2DISA

Solution structure of the rrm domain of unnamed protein product
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
109
structure length
109
Chain Sequence
GSSGSSGNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unnamed protein product
publication title Solution structure of the RRM domain of unnamed protein product
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2disA01
2NLWA 1PGZA 2MY8A 2HYIB 5CA5A 2KXNB 3G8TA 1VQ6S 2G1DA 2KYXA 3MXHP 4C4WA 2JVRA 2HGLA 2F9JA 1SXLA 2JX2A 3CCMS 1A9NB 2RNEA 1H2TZ 2XB2D 3VAFA 3SDEA 2J76E 2RU3A 4F26A 2KRBA 1OIAA 3B4MA 2E5HA 1WHYA 5IQQA 1DZ5A 1OWXA 2RQ4A 3NMRA 2U2FA 3TO8A 4YUDA 2KH9A 1D8ZA 5IM0B 2ERRA 5BJRA 3G96A 2RVJA 2G4BA 2DNNA 5GADU 4CH1A 1L3KA 5DDOC 3ZZYA 1JJ4A 1M5KC 3THPA 3US5A 5DDPC 1JMTA 3G71S 1SJ3P 4BS2A 2DHAA 2YH0A 2M70A 2CJKA 3EX7B 3UCGA 2OTJS 3I55S 3JB9k 1Q82T 5IM0A 4PRFA 4TU9A 1Q81T 2A3JA 2CPHA 3RW7A 2J8AA 1CVJA 1DHMA 2DGXA 5LSOA 4CQ1A 1NJIT 2DNOA 2CPFA 5LJ5Y 5LSLA 5JVHQ 2RRBA 3G8SA 3MUVP 1WWHA 3NNCA 4IOAQ 1X4DA 2MQMA 2XS7A 2KU7A 2QEXS 3NNHA 1VQ8S 5ITHA 2DNZA 3EGNA 2VODA 1U1QA 2D9PA 3UCUP 4W90B 2CPZA 1M5OC 3VAKA 5DDRC 2CPEA 1WEZA 3VAGA 2RRAA 3NNAA 2OSQA 2OTLS 3BEGB 1P27B 3D2WA 1G2EA 1IQTA 5FJ4A 2XS5A 1UFWA 2ZJRQ 2J0QD 3CF5Q 1YIJS 4QU7A 1UW4A 1WG5A 1VQNS 2DNLA 3OW2R 1U6FA 2MMYA 4F25A 3RW6A 2KFYA 4OZ0A 1WELA 2SXLA 3UD3P 2D3OR 1U1PA 2LXUA 2CQBA 4WFNQ 3TP2A 2MZ1A 1HD1A 3CC7S 2AYEA 1QVFR 3CPWR 2M4MA 1K9MT 2YKAA 1H2VZ 1SJRA 2MYFA 2MJUA 3CXCR 2DO4A 1WF0A 2K3KA 1W2BR 3S8SA 2DGUA 1U1MA 1N52B 3CCQS 3NS6A 2EK1A 2YTCA 1X4EA 5DDQC 3B4DA 1HA1A 2DGVA 1NO8A 2HZCA 4Z2XA 1ZH5A 2CQHA 1VBXA 2DGOA 3ULHA 2MJNA 1WHWA 1VQKS 1WI6A 2Q79A 2MKHA 4YB1P 3BO4A 1FT8A 4EGLA 4QPTA 2CPIA 2XS2A 4PKDB 5DM7Q 4LIRA 4WCEQ 2MY7A 3CCUS 1U2FA 3DLLQ 4IUFA 2DGSA 2L08A 3LQVA 3U1LA 1XN9A 2EK6A 1X0FA 2O3DA 1QVGR 1VBZA 1X5PA 3VAJA 1WI8A 3CMES 1WG4A 2DHSA 1VQOS 1JJ2R 3CCLS 1KD1T 2MZQA 2MXYA 1VC6A 2M2BA 2MKKA 2PE8A 1FJEB 3P3DA 2KHCA 2DNQA 2F3JA 2LA4A 3CMAS 2DIVA 4Y0FA 2RS2A 3S6EA 3U1MA 2DB1A 3G9CA 3IRWP 2JWNA 5LXRA 2M52A 4FXWA 4QQBA 3CC4S 1KOHA 1P1TA 5GVQA 4ED5A 2CQPA 1FNXH 2DO0A 2MKSA 2ZJPQ 1FO1A 2M7SA 3H2VE 2E5JA 2FHOB 1FHTA 2LKZA 1S72S 5CYJA 5JVGQ 2AYGA 1H2UX 2KT5A 2MSSA 2BZ2A 4C0OC 4CIOA 1VQLS 4TU8A 1K73T 5LXYA 1Q86T 4PR6A 2ADBA 1RK8A 1OPIA 2KM8C 1FXLA 3P5TL 1U1KA 1YJ9S 2HVZA 1M5PC 4TLQA 3CCRS 2LEAA 2LXIA 2LYVA 3CCES 2N3LA 1BY9A 2LA6A 4LMZA 2F9DA 3ZZZA 3MD3A 2CQCA 4OZ1A 4Y00A 2CQIA 5GAEU 3VALA 2DH9A 3BO2A 1M5VC 1VQ4S 4A8XA 2CQ4A 2ADCA 2XNQA 2MKCA 4W92B 1WG1A 2N82B 4IOCQ 2QFJA 2OSRA 4WF9Q 2DNKA 1M90T 1N88A 1X5OA 2M0GB 2MQQA 2YH1A 2KI2A 1K8AT 1X4FA 5H1SV 1AUDA 1VQMS 2CPYA 4J5OA 3UD4P 3P6YC 1R8PA 3Q2SC 1NU4A 3S01A 2N3OA 1FJCA 1SJQA 1YI2S 3CUNA 2KXFA 1X4BA 2DK2A 2RUGA 2MQLA 2WBRA 1UP1A 3L3CA 1N54B 3G6ES 3BS9A 1QM9A 1X4GA 1SJ4P 2DH8A 2KN4A 2AYMA 2MQPA 2E5IA 3PIPQ 3CC2S 2L41A 1RKJA 5EN1A 1WF1A 2K8GA 2D9OA 1VBYA 2CQ3A 2LMIA 1VC5A 3DXBA 1U1NA 2MQOA 4WFBQ 2DITA 1A7GE 3I56S 1U1LA 2B0GA 2CPDA 3PIOQ 2FY1A 5CXTA 2RT3A 2MKJA 1O0PA 3MDFA 2MZRA 4CH0S 2X1BA 4C7QA 3CULA 1DBDA 2XSFA 1F9FA 1ZZFA 5HO4A 1X4HA 4IO9Q 1U1RA 5D78A 2DIUA 2LEBA 2VOPA 2OJ3A 2MZTA 3G4SS 2VONA 4UQTA 3V4MA 2LECA 2L9WA 1U1OA 2LCWA 1B7FA 1KC8T 1R8HA 4WIIA 2UP1A 1Q7YT 3TYTA 1X4CA 2QA4S 3CCVS 2V94A 5DM6Q 3MUMP 3J7ZT 5GMKa 2KM8B 2YWKA 1WHXA 2KG0A 1WHVA 1U6BA 1WF2A 2AD9A 2KXHA 3MOJB 5HL7Q 3MI7X 2VOOA 2M9KA 4P6QA 4RU2A 2M88A 3P49B 3UCZP 2GHPA 5MLCV 2DNRA 2MB0B 5GAHU 4TU7A 2FC8A 1VC0A 5DETA 4WFAQ 1UAWA 1X4AA 2DNGA 2RS8A 1VQ9S 2DNPA 1YITS 2GO9A 3EGZA 1HL6A 1WEXA 3VAMA 2KG1A 2DHGA 3IWNC 3SXLA 3J7YU 1YJNS 3R1LA 1JJHA 3VAHA 1FJ7A 3THTA 3SMZA 2BOPA 3CCJS 2N7CA 1DRZA 2RQCA 2X1FA 2DH7A 2JRSA 1PO6A 1WEYA 2AYBA 4ZKAA 2DGTA 2HGMA 1SJFA 2OIHA 2DGWA 3R1HA 3CCSS 5IFMA 2DNYA 2E5GA 3CD6S 2MZJA 2KVIA 3MUTP 4YOEA 4QU6A 2MSTA 2KRRA 2G0CA 1YTYA 2FC9A 2NZ4A 1S79A 2FPHX 3UWTA 2MGZB 2X1GA 1KOOA 1YWXA 2M8DB 4F02A 4WKRA 2U1AA 2CQDA 3S7RA 2MPUA 4V19X 2CQGA 2E44A 2HGNA 4FXVA 2DNHA 3CTRA 2EVZA 1M1KT 2LQ5A 2PEHA 3FEYB 2MHNA 2MZSA 2MGZA 1ZZNA 4ERDA 1URNA 2I38A 2XNRA 2CPXA 3VF0B 1X5SA 3FEXB 1YHQS 2I2YA 3N9UC 2DHXA 4UY8T 2DISA 2DNMA 2DGQA 4LJMA 2CQ2A 1YJWS 3MURP 2J0SD 1X5TA 3VAIA 1VQPS 2X1AA 2MKIA 2JVOA 1VQ7S 3NS5A 5GAGU 1HD0A 1KQSR 1WTBA 1VQ5S 3HHNB 1OO0B 2ZJQQ 1D9AA 1H6KX 2CQ0A 4M5DB 3H2UB 3MD1A 5LJ3Y 3Q2TC 3R27A 2M8HA 2CQ1A 2CPJA 2MQNA 3LPYA 3SDEB 5D77A 3UE2A 1N8RT 3HI9A 4U67Q 3K0JA 3BO3A
chains in the Genus database with same CATH superfamily
3FC9A 2HKEA 4WK1A 3QT8A 3V6KA 2QYGA 4LF7J 3IRXA 2F4FA 4UF4A 2H5JB 2OD6A 1OIAA 1EIYB 3K8VA 1X0PA 2R2TA 4N41A 7AT1B 1U0HB 4Q5VA 4HHJA 3VCDA 2XI3A 2FVCA 3H5UA 1EARA 1RT1A 4JI3F 5DS7A 2M70A 2CJKA 2BJ8A 4URQU 4CLUA 5KFBA 1N48A 2B4UA 2W9CB 3NOCA 1JB0C 4NLDA 4QYRA 1AYEA 1IBMJ 1NDKA 4OI3A 2XLJA 2D9PA 1JNZB 3I9ZA 3BEGB 1M5HA 4DL2A 4B9TA 3AOBA 4DQQA 2V34A 3N6LA 1CJVA 5KG3A 5BYQA 2FUG9 3DC2A 3H20A 1LWCB 3AY0A 2JEGA 3E01A 1S6PB 1WKJA 2EW9A 3QWPA 3T1HJ 4QW8A 2YKPA 3OQ2A 4YY3F 4DU8A 1U1MA 2ZVIA 2ZD1B 2KZZA 3DLGA 3HZGA 1LWEA 2FVRA 4TLRA 5J2NA 3RR7A 3I5AA 4KJIA 2H1YA 3DRPB 4E2FB 4P7TA 3BN4A 5IC6B 4UY85 1XN9A 3BKFA 4WIQA 2F8EX 1TKTB 1Z2ZA 3KYLA 2W2QP 2D3ZA 1FX2A 1MWZA 2GGPB 4ANEA 1FRKA 3CCTA 2MXYA 4LF5J 3QIPA 1YJTA 3EZOA 4GC6A 1KOHA 2JEFA 2YPYA 1IM6A 5DGAA 1RWUA 4QWEA 1H7WA 2PMHA 1GMWA 2FZKB 5IWAF 4C48A 1PIEA 1K73T 4P74A 4I0WA 1OY9A 1IR0A 4HH1A 3TEGA 1U49A 4OX7A 4P7VA 3W8GA 4DUZJ 2E9ZA 2OPSA 4CZCA 2E9RX 3FCVA 3DDKA 2MTLA 3M9NB 3MD3A 2I8EA 1F5AA 5FIIA 2GW8A 2HWIA 3QT6A 3U7JA 4EBDA 5T41A 5SUHA 4DR7F 1YBAA 1K8AT 1PC5A 3HD2A 4ZVGA 1IXKA 1Q8KA 2G2YA 3MM7B 4EWTA 3KK1B 3PRVA 3ITHB 1SL2A 3RBXA 1RISA 2DITA 2WB1D 3QQCD 4PG7A 2HNYB 1QSYA 2DD8S 2IA0A 4AL6A 4NLQA 3I87A 1C0TB 2AWZA 2HRUA 2LDIA 3A8IA 2WW4A 3QRQA 1L3UA 1S0OA 1XR5A 3LA0A 1R27B 2HBRB 4JBCA 2V94A 3KLHB 3J7ZT 2KM8B 3AODA 1NSKL 1WHVA 3R5BA 3OSNA 2C3YA 3DHWC 2VOOA 5K14B 1CBKA 4CWBA 3UCZP 2DNRA 3JXOA 1VC0A 1FDNA 3PACA 2DNGA 4FYWB 3GFHA 1W2IA 1FA0A 2CADA 1NK9A 4JV5F 4GVBB 3VAHA 2V8PA 2RDJA 2BDPA 2JJ4D 1C4CA 4I7FA 4Y3CA 4Q8EA 2WVCA 5KFSA 3FQLA 2E9TA 1DQAA 1UMJA 4NYPA 3DGPA 4JB8B 3AOAA 1RTJB 4P2SA 4WP8A 3CJ5A 1FE0A 3MTJA 2WB4A 1C0UA 1IBLJ 2CQGA 4WXWA 4KHMA 3CDWA 3EXCX 1ZZNA 4LF2A 3HHLC 3GMGA 4KTQA 4O3PA 3JSMB 4ED8A 2I2YA 4LF8F 3Q23A 2HIQA 2Z30B 3ILIA 4B3MJ 3C16A 2BJ1A 3LP2A 1D9AA 3TI0A 4R8UA 3LP0B 4J90A 1RT3A 2CQ1A 1BQXA 4F8RA 5D77A 1RUSA 1QAYA 2VFSA 4PYDA 1S1XA 5DLGA 1PGZA 3CIMA 1TFWA 1VQ6S 2AGOA 4IQMA 1SXLA 3CO0P 3W2WA 1S59A 4AXJA 1RHMB 2VFUA 4DL4A 1NSPA 4R0EA 4ZPVR 8AT1B 5K5MA 4F4KA 5L39A 1FVQA 4I7FB 1TMJA 4K4ZA 3VGVA 1PBAA 2N4CA 3VQSA 1O6XA 4ZMMA 1QTMA 4OV1A 3CD5A 4QIGA 2AQ4A 2J8AA 2O67A 3K59A 1NJIT 3GR1A 5LSLA 4EBEA 3CJ8A 4E98A 2HNDA 3MEKA 4QW9A 4DFPA 4UT4A 4LRAA 3NNHA 5A0YB 4K4UA 2CPZA 2V8HA 4K0KJ 2D1CA 2HQIA 4EYHB 2QLBB 2Y1JA 5HROA 2IVFB 3D3BJ 2MMYA 3ZC4A 2HVHA 4RWXA 1S0NA 4R0JA 2L48A 4P9SA 4DR1J 3KLEA 1FRMA 4FPRA 2H65B 3CPWR 5J1NA 2MYFA 1HPZB 1NDLA 5KT3A 1XQIA 4I2PB 1N33J 2V67A 3K17A 5DDQC 1FKOA 1GX5A 2YWGA 4UOCA 1X8DA 5KT5A 4A46A 1U7LA 4K4XA 2XS2A 5I3UB 3TAQA 1KS2A 4O0IA 1NMEB 1WACA 4RNMA 5DQIA 4ILMA 2KDOA 4CP5A 4Z37A 2B8QA 1VC6A 3IS9A 1JLFB 3P3DA 2DNQA 5DO2A 3H42A 5KFYA 2JWNA 5LXRA 1YVFA 4CLSA 1JXLA 3W60A 3FGVA 1H2UX 4WZQA 2J6SA 1LXJA 2VDHA 2QMUB 5D0HA 1AUSL 4X64J 1SC4B 4NLXA 4PWUA 3V2UC 3HHLB 3CCES 3UN5A 3NAHA 2CQIA 4OYOA 1S6QA 1RT5B 2Z57B 1NHKL 2ADCA 3MMBA 3S1TA 3V6DB 4PZVA 1FESA 2ZNYA 4LSLB 4D3HA 4FVCA 3W5YA 2PT0A 1VRUB 3D4JA 2ZH4A 2EEYA 2D41A 2ZFHA 4N76A 1N6QA 3KLGB 1UVIA 4YDDB 2IJNA 3D1OA 3B78A 1X31C 2ILYA 2BUNA 2QMWA 3K58A 4IO9Q 3PYGA 3V4MA 3BYRA 3ISNC 3DKDA 3T3FA 1VISA 4GKKJ 2NSBA 4C0HA 3PJ9A 2C28A 2FJXA 4PG8A 1HQEA 2RKIB 2B6AB 2OHDA 2ROPA 1RA6A 1IJEB 3FCHA 3OUYA 2XHWA 4DV2J 3OJSA 1V3SA 2XGPA 3F56A 1JNRB 4MH8A 1SIZA 3LPEA 4ECUA 3I6PA 4DPUA 3D66A 2HNZA 4FBUA 2CJAA 3T1YJ 4HDGA 5T7LB 2BJ7A 2POKA 3V6HA 3IBCB 4LF9J 4KGXB 4CO3A 4YOEA 1KLMA 2G0CA 5J2QB 2CZVC 2NXCA 2OPPA 2QA1A 2OI2A 2CQDA 4X2BA 4HLBA 5ETQA 2UUAF 2FYXA 3KOAA 2X3DA 3BYPA 3R6LB 2DCUB 3H4BA 4HH0A 3BDEA 3RRHA 4RJVA 1Y10A 1QJHA 3OR1A 1QLNA 1F5BA 4ZJOA 2GVDA 3AFGA 4U7CA 3WX8A 2DISA 1QSLA 2HHQA 2GVZA 2VQEF 1HMVA 3KK3A 3CCZA 4OZJA 2G13A 5CYMB 3T5LA 2MKIA 1UEUA 5GAGU 1ZS6A 1FKPA 1H6KX 2X51A 5F0UA 4DV0F 4ZITA 2JC0A 5BXIA 3QT5A 3OXGA 1T9VA 2G0IA 1RWKB 4FP9A 4F26A 5ETNA 3IO1A 4OYZA 5KG0A 1RU2A 1MW7A 2Z4PA 4ZN3A 4KFBB 1BQNA 2XMJA 3M9OB 1YJVA 4DPXA 2YNHA 4USWA 4P72A 1CS4A 3CEDA 1Z2LA 5KFFA 1S4FA 2DNOA 3BR9A 5M2PA 2HFOA 2V9WA 3GV5B 3GJQB 1MG7A 2MEWA 4LF1A 4LUBA 2W4DA 3J81U 2QGFB 4XPCA 1KVKA 2Y1RI 2C3MA 1K0TA 4U7UD 1GAOA 5A8WB 1TKDA 4EMDA 2D3OR 2LXUA 1SV5B 4G1PA 2CUYA 6FD1A 3OL6A 1NK8A 1X9WA 4LF8J 2M4MA 2PFDA 1K9MT 2YQ3A 1SJRA 3CXCR 4G6VB 3CB4A 2V8DA 4UUXA 2ZEJA 3I82A 1X4EA 1DFDA 2VKRA 1LQ9A 4J37A 2CQHA 1VQYA 3N01A 4OI6A 2RMLA 1S10A 3PW7A 1OQ6A 3A4TA 4ZJLA 3GG0A 4CO0A 2O3DA 1E6YA 1Q1KA 4I6WA 4ECXA 1WI8A 1PYOB 3GV7B 4OJ3A 1IUJA 4PABA 5EWGA 1G1XA 1CS4B 1OSCA 3QSIA 2BM0A 2BJDA 4FXWA 4J9MA 2MKSA 2GIFA 4ECQA 3J7Z5 2ZJPQ 2M7SA 3H2VE 4JOUA 1N5YB 3RRGA 3SEOA 5D4LA 3LGMA 2G2ZA 2VC0A 4OX8A 5G0RA 5FD1A 4Y2IA 3PX0A 1XC9A 4UZCA 5E5NA 7FD1A 2LA6A 2V68A 2F9DA 2XMVA 2DH9A 2XWYA 4USTA 4LF6F 5E7OB 3BREA 2G0JA 3MEGA 2KT3A 1XMQJ 1N88A 4MFBA 2UXDF 4DUYF 4PUOB 1JLBB 3NAIA 4NCGB 5LMNJ 3ZNUA 1SJQA 1VIOA 2MQLA 3H5YA 3GCWP 1MU2B 4YR3A 2BE2B 4EYIB 3ILOA 3BGRA 1DTQB 3C6TA 4ICLA 1LW2A 4J9RA 4FF3A 2IM2A 4Y34A 2EFGA 2K2PA 4KB7A 2B9YA 1A7GE 2FY1A 1N5TA 4ETXA 1SH2A 2H5IB 1P6TA 1WC1A 1DBDA 1JXEA 5HO4A 1S9GA 4N8NA 4DR2J 5HSPA 1TAUA 5C2GA 2HBYB 3J81Y 3NCPA 4AE5A 1WNEA 4WIIA 2R9LA 3NL0A 5GMKa 1UZDA 3D7SB 4F4YA 1RWNB 3M1VB 1HHSA 1UL3A 4JI4F 4ZPWR 1G6BA 1LXNA 2LEPA 4ER8A 4KHPJ 3KK2A 2IM0A 4K2JA 5BR8F 5LSRA 4DFKA 1CEZA 2D7SA 1PG5B 5H9FK 2DHGA 1H73A 1NM2A 2AJFE 5DLFA 2RQCA 3FK4A 2FLPA 4F4XA 3KNAA 2ZH9A 2FGOA 3IWXA 1VRTA 5A8KA 4M5NA 5FDLA 1YTYA 5HQLA 4YHHF 3HD1A 2FPHX 1VJWA 3DM2B 2MGZB 4F02A 2QL5B 3FEZA 4C8ZA 4RLEA 1N56A 2AJ1A 2J7UA 3TAMA 2I38A 2FTRA 2R3VA 3W5XA 1Q16B 2R8GA 2NPIA 4NI2B 3E3XA 5D15A 2W4PA 1NSQA 3TA2A 4IG3B 1ZYQA 1HBUB 1WTBA 2H48B 3EZUA 5HANA 1J27A 3C14B 2XMTA 2CQ0A 3H5XA 4BDPA 3H98A 1GK8A 3CJKA 1SL0A 1S7HA 3DDIA 4F4WA 1QD1A 3HK2A 3HI9A 2ZHOA 4G1QB 5E3PA 2FVQA 4M5DA 4FF4A 1LW0A 3LH2S 1XMOF 2JX2A 2BVZA 3QO9B 3R5AA 3M6VA 3NMRA 3ENQA 5HATA 1D8ZA 2ERRA 2OELA 2G4BA 4F2SA 4CLFA 1L3KA 5DDOC 4I2QA 3LTOA 1R8BA 3BSCA 3I55S 4ID5B 2C2ZB 4PRFA 5LMUJ 3UPFA 2C3UA 2HZAA 2CWXA 4TY8B 4IH5A 2VBWA 3HHEA 2PA3A 4JI5J 1D3WA 2GJIA 2C2DA 2I0XA 5DRKA 3R2CJ 4CLTA 1Q95G 4LVOP 5HMZA 1HQUA 5J2MB 3AA9A 2BKPA 4OYPA 1IQTA 5KFQA 2EC2A 3T1AA 4AFFA 1AFJA 2HHHF 1WC4A 2DXEA 4F3QA 2ZHAA 4ED0A 1R8CA 4WFNQ 2CNNB 3HHDA 2V4QA 4A48A 4JI0F 3CC7S 2AYEA 4JYAF 2BRKA 1RAIB 4RR5A 3S8SA 1FVSA 1CULA 3B4DA 1XNRF 1HBMB 1NSAA 1B0TA 1N36F 3LP1B 3HFZB 1RBLA 1KHVA 4F3OA 1NK7A 4RW6A 3JYTB 4BC7A 1B64A 1TU0B 4ES3A 1KBRA 3IGVA 1HBOA 4HEA9 4L72B 1VQOS 3QZ8A 5KT6A 1WOSA 2BJ9A 4ZLPA 2GQ2A 1GNKA 1ZPVA 2VG6B 3QMQA 3EDQB 2DB1A 2Z0GA 1N5QA 4RNOA 1KRPA 2DO0A 5L46A 4GKJF 5F9LA 4ECWA 1AZSB 3ZTOA 5HJXA 2VDIA 4TU8A 5LXYA 2DHHA 2ZBIA 4I6YA 4KBIA 2CNLB 3TWZA 1RAAB 3UO0A 1AT1B 2J6UA 3CCRS 2R8IA 3LALA 5IT9U 3M6UA 2RF2B 4OZ1A 5E0OA 1MROA 4IFVA 4WK3A 2YBVA 3ET6B 1F60B 1R0AB 4MK9A 2ZC4A 3DLKB 1VQMS 4X4UA 4L75A 1UJ5A 3HPOA 3G6VA 2FLLA 3FBEA 3PKMA 1GTHA 2UUBF 4FVMA 2LXFA 2J9DE 2HK2A 2XQCA 2V8VA 4CTAA 1T3OA 1JLGB 4HL9A 3MPVA 3TVYA 2R7WA 1RWWB 3W9IA 1QDUB 2MZRA 1DTTB 1VS3A 2AKWB 5J1EA 3CULA 5IT0A 1RKIA 1X4HA 4B9LA 4DR3J 2MZTA 4UQTA 2LECA 2QG9B 4KO0A 3M8PB 5D6GA 3FBBA 1C2PA 5HLFB 3D0HE 2PIIA 1UZHA 4XPEA 4OMFG 1BQMB 3MOJB 2EFNA 4ED4A 2G1HA 2M9KA 4P6QA 4LBHA 2ZKUA 1LOUA 3FZBA 2FLNA 4NLSA 5D4OA 3FZ2A 5CAAA 2GO9A 3QFWA 4WE1B 1JLQA 2C42A 4OZLA 3VAMA 4OJ1A 4M5MA 3M6XA 4DV5F 3R2DJ 2OIHA 3AAWB 4UUWA 2MDAA 2V4RA 2HBQB 3W2VA 1RTDB 2FC9A 2HQGA 1TUGB 4OJGA 3SQGB 1KOOA 5C24A 4WKRA 4QJVA 1F5CA 1WC6A 4KV8A 1SL1A 2K1RB 2AU0A 4K7QA 4TY9A 4HTIA 4C3MA 3NBPA 2XNRA 1NJZA 2OPRA 1IKWA 3X3UA 2UXCF 2NXUA 5L9NA 1B3TA 3IN5A 1VQPS 1SBRA 3QT7A 3J7AN 1VQ5S 3M8QB 4HI1A 2R7SA 4DPYA 3Q8SB 1NKEA 1HNWJ 3BM7A 3R8YA 4O44B 4L76A 2BQUA 5KFNA 3PJXA 2HHWA 2G1DA 2AEFA 2XB2D 3DNCA 5K8MA 4IFYA 1WC5A 4ZLLA 3I0RA 3M30B 3B4MA 1J5OA 1PCAA 2AX0A 4NXMF 1JJCB 1RU1A 1IR1A 1NHVA 4K59A 3SCJE 1IKVB 3UNYA 3F73A 4H4KC 3ILJA 3ZZPA 5ETRA 1FTRA 4DPTA 2DPJA 1MN7A 3HZEA 1A0OB 4RPFA 2KT2A 3WQPA 2A3JA 2XLIA 1DHMA 2HFNA 3AD8C 3GE9A 3UW1A 1VLYA 2VG5A 3MUVP 2KZMA 3M32B 2VIHA 3ZO7A 4CT8A 2VICA 3MZIA 5MAOA 2E5LJ 2DR7A 3GFYA 2BW7A 3F44A 4M5KA 3AJ2A 3MM5A 5FJ4A 1HYSB 2XS5A 3A3NB 4H4MB 4I56A 1S48A 3M8SA 3MAHA 4NLVA 1U6FA 4H4OA 4IRCA 4KPCA 1S1TA 2HAFA 2IAJB 2SXLA 2ZBQA 2XMWA 3M2UA 1MLAA 3TP2A 1FX4A 4KGKA 2HPUA 3G82A 3CJ0A 4R5PA 4I4BA 2RD5C 2AGQA 4OZ2A 1RWMB 4ZA1A 4AQYF 4CLWA 1RTIA 4B3RJ 1JIHA 3TJAA 2Q6BA 2PSZA 4B3OB 1NO8A 3DXSX 2PMWA 3M9MB 3HHKA 4B9VA 2RDDA 1ACMB 3BO4A 4C8KA 5B08A 4DL5A 4LFCJ 4ILRA 4HI2A 1T05A 4X4TA 2VBZA 2HFUA 3U1LA 2EK6A 1XMOJ 3VGTA 4B9MA 4ZJQA 3MM6B 1B7YB 1FJGF 4KKOB 5HI7A 2DYAA 1T03B 2WK4A 2F3JA 4DX6A 1T7PA 1QAXA 1TL3A 3MCMA 3TUJC 5LOQA 1TK0A 4A8MP 3CVKA 2YKNA 1I6JA 2PC6A 4YB6A 2KT5A 3A8JA 3AQOA 1TV6B 2R2RA 4K4TA 5RUBA 1SPBP 2ADBA 1RT7B 1FXLA 1SQGA 3P5TL 1L3SA 3BSAA 3W1YC 1RT4A 4CM0A 2W2NP 1YJ9S 3PW2A 3P4UB 3PFEA 5AE1A 2BMBA 1YJ7A 1EQ0A 2CQ4A 4QIWD 3BGFA 3OTBA 4WWSA 2HAIA 5IC4B 3R5GA 2M0GB 2I5JB 4IDKA 4MYTA 1SC6A 2AEJA 3UD4P 1R8PA 1NK5A 4OHXA 1FJCA 5DQGA 2XI2A 1Y11A 1X4GA 4X4VA 2ZBRA 4GVLA 5I3QA 5KT4A 2HLUA 2DY9A 3UVJB 3KHLA 2R7RA 1VC5A 5AE2A 3SCKE 4WFBQ 3PYDA 4JI7J 1I94J 3MDFA 4CH0S 4MJKA 4TQRA 3EDRB 2OPQB 2I1RA 2OJ3A 2XMMA 3M6WA 2ATCB 3RBDA 1CC8A 2VG7B 2RSQA 4DX8H 2YWKA 3W9HA 4KPYA 1U6BA 1J2VA 3T5KA 3NKYA 1XBWA 2E1AA 2OUGA 1Y0HA 2H3EB 5KFLA 2RS8A 4NLWA 4QWBA 1S49A 1KKHA 4FYDA 4Y65A 4BC9A 1JLEA 3D54A 3CGIA 1DQ9A 2NPFA 3KUEA 2RRNA 3MMAB 3MEEB 2V2ZA 4IDKB 3MM9A 4RW9A 4PCQA 3H8YA 2FB0A 1ZA2B 3V81B 4DS5A 1KQFB 3HVTA 3FMBA 5J2PA 3KLIA 2M8DB 1RT6B 1KQGB 5D8HB 2RQKA 5HBMA 4DR6F 2UUBJ 1IKYB 4LSNB 4OIXA 3F41A 4TVAB 1HR0F 3N9UC 3AB4B 5KFPA 3KHHA 3FFIA 3H40A 1SQEA 3KLVA 2CDQA 3RB0A 1TL1A 4HACA 3OLBA 3V5RA 3TNVA 3GCXP 4DCPB 1FE4A 4ZVSB 2EBEA 1U02A 1AROP 2E7XA 3AH6A 3EE3A 4I6AA 3TJ8A 2MLXA 1EETA 4IKAA 2HWHA 3KG4A 1UKUA 1NPRA 4LQ9A 4P2FA 2XGQA 2HGLA 4ZCKA 1F9HA 2J76E 1DURA 3EM1A 1NLKL 2YX7A 2VFTA 3J7A1 4DV7F 1JLCB 2YNIA 3DMJB 2HQDA 5L1JA 4RW7A 2OH2A 3TZWA 1U8SA 3G71S 1HNIA 4HDHA 2DHAA 3PJWA 5A8RA 3UCGA 3JB9k 5U47A 1ICEB 1Q81T 5DZ7A 4YB7A 3TZYA 4IH6A 5C2CA 3N0VA 2CPEA 2LP4A 4LFBF 1N4LA 2B5JA 4A8YA 4QYZJ 4FYYB 4KGMA 2HMIA 1WG5A 1OYDA 3PEJA 3W9JA 3DCAA 1HNZJ 4OZ0A 3SCIE 4ZHRA 1RAHB 1U1PA 1FXDA 4JI1J 1HD1A 2UXCJ 1EKRA 2LQ8A 2IM1A 3HSGA 5AJ3F 1B70B 1H2VZ 3PG9A 1S7IA 2WBMA 2GV1A 4KY3A 1TKXB 1HNVA 1UVKA 3UDEA 5IQ6A 1TVRA 2QT7A 2Y8YA 1CPZA 3L9ZA 3L09A 3E2EA 3EGVA 1UTAA 4DCOB 1XNQF 1C1BA 3M4XA 5KFGA 4RZRA 1BE4A 3MPYA 1X5PA 2NXEA 1OJ4A 2G2OA 1NPKA 1V5VA 1WG4A 1RCXB 2E29A 3Q8QB 5KG7A 2W9BA 2MZQA 3P45B 4ANDA 2M2BA 2KHCA 4AUKA 3Q8UA 1S1UB 3PTWA 3CC4S 4LF7F 1Q53A 2YQ0A 4DR5J 4AYBD 3TANA 4C11B 4USIA 5KT7A 1FERA 2ALYB 2OAUA 1NJYA 4DSKA 3KJVA 1TZ0A 4O3RA 4F3MA 1ZTTA 3QJPA 1RHRB 2WAQD 4PXDA 5C25B 3PVXA 2LXIA 5F3ZA 3BKTA 1Z1ZA 4ZHRB 3OBIA 3GG1A 2JOQA 4N77A 1TTHB 1IBMF 4W92B 1WG1A 5EHHA 1U45A 2YNGB 1ELOA 1RHJB 3M2VB 3Q2SC 4F50A 4HHUA 2WCXA 3BDPA 2ZM6J 4LREA 4Y6IA 5AXKA 3HVWA 2L41A 1CJUA 2K8GA 3TQ1A 1N0UA 2VBYA 2OMLA 2Z58B 1R7IA 3EWGA 3G86A 2J8SA 2CZ9A 2HVIA 3ICLA 3T1HF 1RWOB 2RT3A 1S1VA 2AJQA 2XO6A 3IR5B 4TYBA 1U1RA 1UPMB 5D3GB 2HHTA 3PW4A 2UVUA 2C2OB 1U1OA 1CQMA 2R42A 1KC8T 2QV6A 3TYTA 3MTKA 3MFIA 1JKHA 1LWXA 2KG0A 4DV6J 1SUQA 1O5JA 2EPIA 1PJ6A 5HL7Q 5CABA 1FFWB 1UJ6A 1LKZA 2PMZD 3LO3A 1U47A 4FF2A 4BBYA 1TQLA 5B0AA 1XMBA 4MIBA 3EICA 3V4IA 3HULA 2DR8A 2CZ4A 3CSKA 1UFLA 2RE1A 3QGGA 2JLEA 3CCJS 1RWPB 3QGHA 1HLWA 1SJFA 3LWMA 4E8UA 4HKQA 1VLOA 1BGXT 4DUZF 1WDTA 3OR2A 2UUWA 1S9EB 5DQHA 3FJ2A 2H9ZA 2VL1A 4DJBA 2P8IA 4NLYA 3PR4A 5F8LA 1LK5A 2P6SA 1G4CA 4J9SA 4UTGA 3CDUA 3JQJA 3C6UB 1QSSA 1U48A 3I0SA 4DLGA 5ETMA 1AFIA 1O51A 4EZ9A 3J80Y 4K8RA 4DL0C 5B0GA 3MECB 1BMQB 4ZVHA 2CKWA 4NA1A 3PYEA 2ASYA 1NEEA 3N4WA 5E3RA 4PPZA 2DJWA 1ZBTA 2CPJA 5KFMA 3D67A 3MMCA 3N79A 1E6VB 6FDRA 1IN0A 2JVRA 1H2TZ 2GJ2A 4LT6A 1QE1A 3OTCA 4FYVB 5IQQA 4NMXA 4EU0A 2Z56B 3FSXA 4BHQA 3IM8A 4O23A 5ADZA 2DNNA 4YP3A 1V3RA 4X4PA 2YXLA 2IA6A 3QLHA 2YH0A 1VK3A 3D1HA 5LL6d 4DR4J 1HARA 1LWFB 1Y5LB 2XZDB 5IM0A 4EEYA 1TAQA 4U9RA 1UPPA 5D0RA 3VZIA 5LJ5Y 5JVHQ 2A1BA 2RRBA 1WC0A 2VKZG 4J9OA 1YRUA 2QC3A 1UFKA 3IG1A 4PG5A 2P2CB 2L9DA 1EP4A 2Z2YB 2HHVA 2VU5A 1RQ0A 2ZJRQ 2AZ3A 1MSWD 4GC7A 3ENVA 2B9XA 1CJTA 3DGVA 3MWBA 1IBKJ 2GAGC 2CG8A 3UD3P 3FBFA 1IBLF 2UVWA 5KFDA 4U7UK 2DXFA 2HBZB 3P8BB 4M5JA 3MFHA 5A76A 5IV4A 2HFSA 1TL4A 1HA1A 2JH3A 4DZDA 2HZCA 2R7TA 3R7SB 1VBXA 2VH7A 4OYMA 4M63A 1EX8A 1BWEA 4B3MF 1VDHA 3SI8A 2CJBA 1F2GA 2MY7A 1JK9B 1TFYA 2RJZA 3VAJA 4ZP9A 2HSEB 2KL8A 2DHSA 4DG1A 1KD1T 3D68A 4L3KA 4OZNA 3OJUA 3CMAS 2W4CA 1HWKA 1BUXA 4YDXA 3HHLD 1P1TA 1F3VA 2CA9A 2DBBA 2F63A 2AYGA 5M2RA 1LK7A 4NZ0A 2FZCB 3IG1B 3IWLA 4ZP8A 4Y2AA 2AW0A 5JJBA 2FVSA 3C19A 4ZIWA 1HHTP 2XTJP 1YLXA 2J9EA 3BBBA 4WXOA 1H72C 1RHQB 3L4BC 4F67A 3VALA 2HVDA 2YNFB 4V1Ak 3SZ2A 3SSQA 3GV8B 2YH1A 1X4FA 5H1SV 1S0VA 4J5OA 4K0KF 2ZE2B 1UEVA 3B82A 3L3CA 2E1CA 4MAKA 3DRSA 2AT1B 4NCAA 1TL7A 4PQAA 2HVEA 3GQCA 2AJ0A 5EN1A 4D3GA 1UWBB 3TEHB 3TA0A 2O1PA 4DR1F 4O4GA 4YMEA 4ZN1A 4C8LA 4FKXA 2CPDA 3R5JB 5CXTA 4O3QA 2H5EA 4ID8A 4WYLA 2W01A 1N33F 4QR2A 1HW9A 2R8KA 2LEBA 4KQZA 2VASA 2LCWA 1R8HA 2UP1A 5IOLA 3PO4A 4QOTA 5JUMA 1D9DA 1Q8LA 3UQSA 2BX6A 2WSCC 5L9XA 3NWRA 4LR9A 2KXHA 2W1BA 2DR5A 3ZXWA 1CJKB 3KG1A 3G8QA 2DTJA 1VQ9S 1F3FA 2V4JB 1SKSA 4LSZB 4P73A 4Q45A 3LAMA 2BANB 1FJ7A 4ALZA 1H0HB 3UI3A 1RT2B 4DQSA 1T02A 3ZTPA 2YWEA 5DG8A 2VQFJ 1Z4UA 4X64F 3MUTP 1GX6A 2MSTA 1HFEL 3DYAA 4M95A 2HLTA 4XK8C 4V19X 1T94A 4PAAA 4S0MA 4ERDA 3OV7A 2WONB 3HT3A 2WOMA 3MCOA 4ELUA 4X62J 3FQKA 3D6MB 1HI8A 4URSA 3IBFB 3MPUB 1Y5IB 5HMWA 4C3LA 3HXMA 2HHSA 3QYYA 4ZVRB 2EFVA 1AA1B 1NK4A 2AJ4A 1EKSA 4DL3A 4I67A 2M8HA 2XYGB 3HSJA 1WUUA 4OI0A 3IRXB 3NGDA 2D3O1 1ZPWX 1SVDA 4M94A 2AZ1A 1WKKA 4LRCA 4L3NA 4C4WA 3CCMS 2RNEA 4F04B 4DDFA 3C2PA 4GKKF 2RU3A 1B0VA 3Q8VA 5ETOA 1VMBA 1DZ5A 1BLUA 3DOKA 1RT1B 1RAFB 3O5TB 2KH9A 1N0VC 2BR0A 3G96A 4RX6A 4DV3J 1K1SA 3CJTA 5AT1B 3ILLA 4CH1A 3TR5A 4TYAA 5CZVA 2W9AA 3EX7B 3GJSB 4BLGA 4DV2F 2CPHA 1D0EA 1CVJA 5LSOA 4NA2A 3OVSA 3EYZA 4G3IA 2MLZA 1CJVB 2ZDOA 2FGCA 3T1YF 2ZZTA 1P1LA 2XULA 3JSBA 1HBNA 4FZVA 3E01B 4LRBA 4Q2MA 4LF9F 1UFWA 2B51A 2J9DA 2XMUA 4ATNA 1HIYA 2YWWA 1WELA 2MZ1A 1SCJB 3DLGB 1S6OA 3VGUA 3NGKA 1LWEB 4OHZA 5J2NB 3FSYA 2DO4A 4KAIA 5K9FA 2ZC3A 4PXBA 3TARA 1NNDA 2EG2A 2CXEA 3G2XA 2IPOB 4IRDA 2DGOA 5C42A 3BGOP 2MJNA 2CIMA 2HQFA 3WHIA 1FT8A 4LF4J 1X60A 3C46A 2IM3A 4TKTA 3Q24A 4PKDB 2CJ9A 4WPAA 1TMMA 3LQVA 5ETLA 3QIPB 3PW5A 1N5SA 4ZIVA 2XBPA 2IVYA 3K5LA 3VTIA 2FJAB 3TOQA 4KHRA 2RS2A 4UZBA 1SI9A 2V2QA 3DLBA 1RHKB 3QGPA 4CRJA 1FHTA 1S97A 2OPSB 2ASDA 3FMWA 2J0WA 4DBQA 4RUCA 2HVZA 4CDIA 4DSIA 5L8RC 4IH7A 4ZPCA 1IKXA 5GAEU 1RTHA 3WC2A 1FTCA 3BO2A 4A8XA 2ACYA 4ECSA 3K57A 3OLAA 2D69A 1TKZA 2AGPA 5HP1A 2NYHA 1V9OA 3GR0A 5ETSA 3TZXA 5KFHA 1AUDA 2W24A 5KFUA 2B3TB 3S01A 2GMLA 1A6LA 3CUNA 1X4BA 1UP1A 2Y3YA 3M7VA 1P9YA 5B09A 3HP6A 3Q86A 3MM8A 4ECVA 3DXBA 2MQOA 2PI5A 4R25A 1PAUB 3PIOQ 2V2VA 1SC1B 1FWPA 3WC0A 2IRYA 1OY6A 4ZVUB 2DIUA 2NUHA 1BWVA 2DCLA 5KG6A 4EUVA 4CLKA 5A2QU 2QA4S 1X4CA 2GIQA 1FD8A 2QLFB 2P9EA 2F4VJ 4RW8A 1GXTA 2QSFA 4DXLA 3DOMA 2KFZA 3GZ7A 4RU2A 3KWMA 2M88A 2W7PA 3RAQA 1Y00A 3OFHA 2DRBA 3DLJA 4TU7A 2FC8A 2GNKA 3RGIA 5B7WA 1X4AA 4Y2MA 3RU0A 2WVFA 1RCOB 4B3TJ 3PCOB 4RL1A 1Y3JA 2NZCA 1C1CA 4PWDA 2WVBA 5I42A 1ULRA 3IFEA 3DGPB 3WBZA 3TAPA 1X9SA 3MPDA 2DNYA 1GMUA 3I4PA 1C0UB 2IY5B 1B0PA 2EWHA 3KLFA 1QUPA 1UVMA 1XTZA 2UU9J 3VHQA 2RHSB 1GEHA 1M1KT 1XMQF 4NZ7A 4JI6J 1URNA 3RR8A 3C16B 2ZH6A 1DLOA 3BH7B 3HF5A 4OLOA 5LMNF 4UY8T 3LP2B 1UVLA 1RZMA 3BPDA 1FEHA 4KH0B 2V5HG 4R8UB 4OX9J 1KN6A 3MURP 3ZZRA 2BM1A 1RT3B 4WFZA 1FRIA 2F5GA 3MEDA 3VAIA 4OYXA 2XG8A 3R6GB 1S1XB 1NPPA 1KSPA 1KFDA 4CNZA 2PDAA 2YKMA 3ZFVA 4AL7A 5E3QA 3N5FA 2MQNA 3W2WB 2B7CB 3ZZTA 1JLAA 2NLWA 1RADB 4HT5A 4ZPBA 4DR2F 1Y5NB 3OSPA 3RZAA 1PBUA 2FHJD 2HHUA 3BQ0A 3SDEA 3DRRA 2B4OA 3ZZOA 3FRZA 2GQQA 1FK9A 2NR0A 2U2FA 4ANCA 4KGVB 2ATLA 4RWWA 3MAQA 1S99A 5GADU 3ETOA 2YPZA 3RG6A 4X4NA 2HNDB 1IWGA 4I1TA 3GU0A 5CD4H 2OTJS 3D28A 9ATCB 4KHPF 4TU9A 5CCMA 2VPZB 5DGBA 3W61A 3MAAA 7FDRA 2BBEA 4NYZA 4I68A 5A2QY 5HROB 2KU7A 2RIJA 1S9FA 3QAEA 4MMOA 1RP5A 3KLEB 5B0DA 3JTOA 4F25A 1S1WA 1HI1A 2CQBA 3A13A 2GS8A 2FZGB 3M8YA 1FKOB 1ROFA 2YKAA 2RDIA 2K3IA 2NCKL 3PHEA 4Q0BA 2J9CA 1TUWA 4OI4A 2YTCA 2DGVA 4Z2XA 3HKWA 1FI4A 1BC6A 1B99A 4EGLA 2XO7A 4P52A 3D0GE 2A6OA 3IS9B 2ZBPA 2ZWPA 3FRYA 1VBZA 4RW4A 3M2RA 3GIJA 1U4BA 1Y3KA 2KJVA 4ITSA 4Z7CA 5KFKA 1JJ2R 2K06A 1U25A 4ZCLA 1VJQA 3NGTA 2KKHA 5KOXA 2OFHX 4NMLA 4PG6A 3U1MA 3G9CA 4QQBA 3ZTRA 2CQPA 1FNXH 4M5IA 2QA4G 2XY5A 5D0EA 1NAQA 1FO1A 2E5JA 1NHUA 4C0OC 1X9MA 1EQMA 2HFZA 1RK8A 4DCJB 2IHR1 1YRTA 4RBTA 1S6QB 1CG2A 2A2CA 1T95A 3PNIA 3FNNA 3MMBB 2XSJA 1Q5VA 2H51B 2DEIA 1D8YA 4C8MA 5LMUF 1S1WB 4QIEA 3UDLA 4K4YA 1CQNA 4JI5F 3AB2B 4IOBA 2K7KA 1FEEA 4GO5X 2QFJA 4X84A 2DNKA 1M90T 3MR6A 3SFGA 4MIAA 3TW0A 2OO4A 3GSDA 3P5BP 4QZVB 3P6YC 1ZA1B 2JEIA 1N6QB 2NQPA 3Q89A 2KXFA 2RUGA 4N5SA 4E0DA 2UUCJ 1QM9A 3DLEA 2HS3A 2KN4A 2Q66A 2JC1A 3GIRA 2WTFA 3CC2S 1T9TA 3OFEA 1R89A 5LT5A 2IYIA 1NUEA 3HT0A 4C9DA 3FUYA 3K89A 5AXLA 1KP6A 5AE3A 5D78A 2HIYA 3HJVA 3C66A 1HQEB 1T9YA 1FFGB 1N32J 3OUYB 1RB0A 2WSFC 3OFFA 3A8EA 4DV4F 1YJRA 1H7XA 3OTOF 2BACA 4OLPA 4JI2J 1K1QA 5GAHU 1VI7A 2HNZB 1R31A 3UR3C 5EWEA 2UVRA 1TK8A 4N7TA 3W65A 4DPWA 3FDSA 1U8WA 4HT7A 1NB7A 1R6VA 4IG0A 1KLMB 1F1BB 4OYIA 4G1IA 4C0BA 3KJFB 2OPPB 4RUAA 1M5SA 5DG9A 2E5GA 4OFZA 1FDBA 4PG4A 2IC3A 4I64A 4WFXA 2ALZA 4NEYA 2X1GA 2PFFB 3OR1B 3MR7A 2FJVA 4PQUA 2GVDB 1Q79A 2GVZB 4OJHA 1HMVB 4LBPA 3KK3B 5I4MA 2IMOA 1Q8IA 2JEJA 3BPSP 2D74B 5D4NA 1FKPB 4RBVA 3H7HB 5C7PA 1TUVA 1JX4A 2DGQA 3HSDA 2G9OA 1YJWS 3QNWB 1K0VA 3GILA 3D0IE 2IRXA 1WOPA 1FDDA 2ZOGA 3RRKA 2A6MA 2OGUA 2FD2A 4WTYA 1BQNB 4DR3F 2XMKA 4J9KA 2YNHB 3UR0A 2W2OP 2IVMA 2E5HA 2P6TA 4L73A 2OKQA 1RAJA 1YK9A 3JSRA 1OY8A 3NY0A 5KFXA 2ZOMA 2F1FA 5H9FJ 3WIUA 2OEMA 1QTNB 4YR2A 4BS2A 4NXNJ 1U0HA 2QTWA 3I32A 2YKQA 3HM9A 1S4EA 3LW5C 2VJVA 1QAIA 1X4DA 1XIQA 1VQ8S 2W9CA 4NCBA 2DNZA 3EGNA 1R43A 3D2WA 2W8LA 5GAGI 2HRYA 1PILA 4DL7A 3CF5Q 3OW2R 4YR0A 1FRXA 3WZ0A 2A0FB 3CT9A 3NGSA 1QVFR 4UOHA 2UZAA 1LWCA 4J9LA 1S6PA 3AOCA 3CO9A 2WHOA 2AP6A 1E6YB 1WHWA 2MKHA 4YB1P 2ZD1A 4MTPA 3H90A 4NYOA 3MR3A 2OLWA 4P75A 3QFHA 1QVGR 4F7VA 1VQSA 1XJWB 2B7BB 3DRPA 1HNWF 1FNOA 5AXNA 4JP8A 3PR5B 3OVBA 2JFKA 1J5EJ 2GX8A 2CVIA 1KWMA 2UV8A 2XY7A 1Q78A 2A10A 2VA3A 1TKTA 4A8SA 1NKBA 2GGPA 4YN3B 4EI2A 5G0RB 4C98A 2N7YA 1Q86T 2IJRA 2C2EA 2KM8C 2XYHB 3OL8A 4HTJA 1NDPA 4OHVA 2LEAA 2J0XA 3BV8A 3MEGB 1T3NA 3PRDA 2N3LA 4LMZA 2W8KA 3C3LA 4MFBB 1RJJA 2XZTB 1VQ4S 2R2UA 3O3LA 3QATA 4AT1B 5CCLA 1SB6A 2E5LF 5L38A 3BGRB 2J5AA 3C6TB 4ICLB 3FCWA 1GQEA 4K5RA 1LW2B 2N3OA 5KFVA 3TUZC 3K5OA 2DK2A 2WBRA 3LGNA 3CJRA 3BS9A 4ZVEA 2AYMA 3VQTA 2MQPA 2E5IA 1H74A 2FJDB 1RKJA 3TA1A 1S9GB 3MM7A 4O0NA 4JI8J 4X66J 3ZTSA 3GFZA 4QPXA 4X4RA 3KK1A 2XSFA 1ZZFA 3ITHA 1O8BA 4B3RF 1QAJA 2VOPA 1DY3A 2HURA 1YGYA 2HNYA 4F4AA 4KE5A 5DM6Q 2BKOA 2R8JA 1C0TA 2BJEA 1AB8A 4LFCF 3W66A 4XIUA 1RAOA 3LF0A 3NS7B 3KK2B 1PC4A 2VV5A 3H0PA 3QGIA 3ZZ0A 3KLHA 3PV8A 4USVA 2GHPA 4DQPA 2ZHBA 4DV1J 4FN5A 4ZPTR 3TUIC 3WDOA 1XR7A 5K14A 1VRTB 5KFOA 4OYWA 3SXLA 1YJNS 4G65A 1WOOA 2YWHA 5A8KB 5FDLB 4Y28C 4CT9A 1PO6A 1WEYA 2W25A 4H54A 4AD6A 3MGJA 4GVBA 1ZAWA 1OYEA 1NXIA 2GO8A 2AMCB 1YBTA 3PXGa 3KKFA 4HR2A 3TAMB 2BW2A 2B4PA 2DNHA 3CTRA 2VHGA 2LQ5A 2NYIA 3BGLA 1RTJA 2QRRA 1VCTA 3VF0B 1IM4A 1S12A 2EFQA 1RDRA 4M5HA 1BHNA 1YHQS 1APSA 1HQ2A 3HO1A 2QSWA 1YG0A 3M8WA 2XEXA 1R8AA 3CJKB 2ZH2A 2P5VA 4WU3A 3JSMA 3KMQA 2DXDA 3QSYB 3NWGA 1KQSR 5LM7E 5HVHA 4F2RA 4N8OA 3EZ5A 2FHKA 4M5DB 1ZAVA 1LW0B 3MHYA 4NOHA 4JI7F 4KC5A 2XCAA 1I94F 1HW8A 3UE2A 3IR6B 4U67Q 3G87A 2EI5A 3SQOP 3C15A 3BF4A 3KHRA 2CJYB 2GAHC 5CA5A 3LP0A 2R2SA 2B4VA 5KFCA 4DV4J 1H3DA 3OD2A 3OTOJ 3W5ZA 2C2MB 4DZ6A 4I2QB 1WHYA 1RHUB 2KHDA 2CJXB 2W7AA 4DPOA 3HX9A 2HS0A 3TX8A 4FYXB 3SV3A 3THPA 4ZCMA 2J7WA 1EZZB 3SFUA 1OQ3A 1HQUB 2CPFA 4B08A 3NNCA 3ETMA 1LFPA 4DOZA 4W4MA 1TELA 4A8OA 1M1HA 2QEXS 5DDRC 2ZKTA 3VAGA 2OSQA 3QIDA 3KXDA 1G2EA 3HCXA 3BSNA 2DNLA 1SQFA 5A0YA 4YFUA 5F0WA 4FXDA 3L7PA 2Z2LA 3FVYA 1CULB 2VFRA 2Y0BB 4A8KA 2EKYA 1Q5YA 5SZTA 1VOMA 4OZ3A 4CLYA 3GTYX 1RBOB 4B9SA 2COLA 4QWDA 2GJFA 3AJDA 2IJFA 1C4AA 4RW6B 1ZAXA 3C15B 4OL8A 2UXBJ 5EUHA 1HPZA 3TQEA 5HQ8A 4YS2A 1HBOB 2Q79A 4I2PA 2CPIA 3W63A 3RBZA 5DM7Q 4IUFA 2L08A 2FVPA 4X65J 3EPGA 3NEKA 2I6WA 1DJ0A 4EO8A 1NJXA 1CSJA 5I3UA 1ZM4A 2LA4A 3W3SA 2DIVA 2KVQE 2XZWA 3IRWP 1FKAF 2QLXA 4Q7AA 2M52A 5GVQA 3KMSA 2F7VA 2VB6A 3O8WA 1JLFA 1FXRA 4J91A 1IWAA 4DL6A 4PWWA 3BN7A 3MR5A 2D3UA 3AD9C 2XC9A 3I31A 1RYSA 2XLKA 3OL7A 1M5PC 4F0KA 1MROB 4TLQA 1S5ZA 2PD1A 4IFVB 1HWUA 4FDFA 1BY9A 1GFWB 3W64A 1S76D 4DWIA 1SKWA 5DJBA 3HHLA 2CVEA 2XNQA 5K8PA 1VR6A 5L1IA 2Y0SD 4F0HA 3OHBA 2ZH3A 3AXMA 3KNGA 2CPYA 1RT5A 4XDCA 4CTAB 4KSEB 4MKYA 3SSSA 4TNOA 4B3SJ 4LQ3A 2DEJA 3V6DA 1SJ4P 1U24A 2DH8A 2CDRB 4LSLA 3MF5A 4BWJA 1HNZF 5J1EB 2D9OA 1VRUA 4JI1F 2CQ3A 5KFWA 2AF6A 2VJUA 4GO7X 2B0GA 2MKJA 2BOAA 4EFAC 4KO0B 3JTNA 3TX0A 3X1LB 3KLGA 1NH7A 3MCNA 1KLNA 5IT9Y 5KG1A 3AHPA 4J9VA 1F0XA 3G4SS 2VONA 3NP5A 1CC7A 4CCHA 8ATCB 1NB2A 3KJQB 1YX2A 2AD9A 1WSVA 4KGZB 1JLQB 3MI7X 3D6FB 4HHHA 3A12A 4PEOA 1RACB 4JI3J 4DSLA 5HJYA 5M2UA 2RKIA 2BYCA 2B6AA 2L3MA 1YITS 4OYBA 3L7OA 3NCRA 5C5JA 4CNYA 1KR4A 2EC0A 5D4PA 3HKZD 4DR5F 3W2VB 2JRSA 2VBXA 2AYBA 4ZKAA 2DGWA 3UFCX 5C24B 3IM9A 1YQHA 5EGYA 3NG8A 4U8YA 4KV8B 4MIWA 1OSDA 2BRLA 1R0BG 3NBPB 5DG7A 5T7LA 3V6JA 2ROGA 2MPUA 2ZH7A 2HGNA 2DT9A 2OPRB 4Y2CA 1IKWB 5J2QA 4YY3J 4CH7A 2CPXA 2Q3PA 2RH3A 3FEXB 2H4YB 2IBOA 2KTQA 4DFJA 2ZM6F 3KUGA 3I5CA 2NUUG 3O6QA 2JVOA 1UJ4A 1D9FA 4NLRA 3IAM9 3POTA 1VBKA 2IYGA 3MD1A 5ETKA 3WX4A 5CYMA 5K8OA 2LQBA 3LPYA 4IFYB 3I0RB 2PA8D 1OPZA 4X4QA 2CJQA 1J5OB 2ASJA 3LGHA 4J9PA 1UA1A 3OPKA 2AJ2A 1WD6A 2F9JA 3RB6A 5F8HA 1PYSB 3DDNA 3N6MA 1L3TA 5IWAJ 3UDCA 4DV6F 4YUDA 4DX7A 3ELHA 1T9UA 4Z7YA 4WKYA 3U27A 2R7UA 2VG5B 2PEBA 4FPIA 3US5A 4F4ZA 4KFBA 5E3CA 2XWXA 2GA7A 2BE7D 2BV3A 4CQ1A 2ZH1A 2RB7A 4ZOSA 3MM5B 4TQSA 2IDLA 4DR7J 4H4OB 1T11A 1RWXB 2HQCA 2RRAA 1SKRA 4IR1A 1WEZA 3NNAA 2HHPA 3NMAA 3BJYA 1S1TB 3EVMA 1Y7PA 1WC3A 2YX4A 5CH7B 1UVNA 1KQKA 3M2UB 2DRDA 4Q2LA 4QU7A 1YZ6A 3G82B 3AXKA 4R5PB 4ZP7A 1T9WA 5I3PA 3C8YA 4J7CA 2PN6A 1EB0A 2B9WA 1Y9OA 2ZZNA 3DU6A 4DI6A 1RTIB 4M1KA 1FFSB 4ENOA 4ZVTB 1JWWA 3POTB 4CLLA 1UWAA 3TRGA 2MJUA 5A8WA 3D9BA 4MK8A 1X7VA 3GYNA 2W7OA 1W2BR 4J9UE 1SV5A 1HHQA 3NS6A 2EK1A 1ZH5A 5ETPA 1T05B 2GIRA 1GTEA 2B43A 2DVIA 2X7IA 5HVFA 3HLUA 3QJLA 1W26A 2FJEB 4ZK7M 4M5GA 1PAEX 3CCUS 2DGSA 1N5VA 1TL3B 3RAXA 3N28A 3EUNA 3GP9A 1NBEB 2YKNB 3CCLS 2R4FA 2NREA 2ZUAA 4JV5J 1FWLA 2JDJA 1RT4B 1KNZA 2M5YA 5L1LA 4OX6A 2GC8A 3VVTA 5CYJA 3BSOA 3JAMU 3I9V9 3QWUA 3PX6A 2JSXA 1SH0A 1N5YA 2LYVA 4DR4F 3UN3A 1EJ7L 4M8LA 4JV1A 2MKYA 2QA2A 2ZUGA 1T0TV 2JL9A 4OV6A 1TP7A 2JHEA 2LU2A 1URRA 3IA0A 1NU4A 4MKVA 2EBGA 4DX5A 2ZH5A 2QJ3A 1IBKF 4PUOA 1JLBA 4NCGA 1XERA 3PX4A 2YWFA 3T6BA 3GIKA 2LU1A 4CO2A 3U1NA 1MU2A 2BE2A 1IVZA 4AL5A 2JZ5A 1DTQA 1NZ8A 2RUSA 3EGWB 3WIVA 3CW2C 2XYPB 4N56A 4O3SA 2RHQB 1Q7YT 4ELTA 3BQ1A 3ENAA 4C8NA 2C2KB 4NEZA 1JLEB 4LR7A 3M1VA 4RNNA 3B6BA 3MM9B 2BJ3A 3IWNC 4RW9B 1JJHA 2UV8G 1FNMA 2N7CA 1DRZA 4QCLA 3HVTB 4ZVQB 5J2PB 2DGTA 3KLIB 3ONQA 4F36A 2MZJA 3TZZA 1AW0A 1P9QC 2L9NA 2NZ4A 5HBMB 2BKNA 3BH6B 3P96A 2U1AA 1KVJA 3LOUA 2UVVA 4B17A 2E44A 2WVEA 4M5LA 3HFKA 3R9LA 4WFYA 2F8HA 4DMZA 2MZSA 3FFIB 2GHVC 3DM2A 2MGZA 1TL1B 4UOGA 3PZPA 1X5SA 2Y9HA 3QBCA 4HACB 3O2IA 3JAMY 3GIMA 2AX1A 2IDEA 3M8RA 2CQ2A 2AHOB 1I51B 1IQZA 2C1EB 1RAGB 1EETB 3DU5A 2XM3A 3PDNA 2HHXA 4YQWA 4NI2A 1KTVA 5LJ3Y 4USMA 2QL7B 4IG3A 1HBUA 5IS2A 4V19J 2BA9A 3FSIA 3SCLE 3C14A 2XY6A 5GMEA 2HYIB 1VGYA 3H5SA 2YNIB 2FDNA 3CD0A 3TVKA 3KG0A 1A9NB 1MMDA 1TR0A 4RW7B 3K8WA 2NS1B 2OMOA 2JFDA 4G1QA 1HNIB 5A8RB 4WBFA 3TO8A 2VFVA 4O4RA 4DSJA 5BJRA 1XEZA 3QO9A 3RAMA 2O66A 4OZ5A 1YDLA 3CMQA 2VUGA 1Q82T 4FNHA 3RW7A 3K5MA 2FHJA 4NPOA 2B5JB 4IOAQ 1WWHA 1VHFA 3ZZUA 4ID5A 2HMIB 1U0SA 1XR6A 3MCSA 2IMWP 5CD4A 5ITHA 2H54B 4TY8A 2OTLS 1P27B 1OS5A 2VQFF 4ILLA 5JXSA 2J0QD 4HVZA 2J7KA 1VQNS 4XAKA 4FF1A 2F8MA 3K7RA 1NH8A 5J2MA 4RNFA 2EFOA 4NZ6A 2CWKA 4WP3A 5CQGA 1ZETA 4XDDA 1HNVB 3KFWX 1VYAA 1TVRB 2QLJB 3CJ2A 1WF0A 3KHGA 3K5NA 2DGUA 2JNJA 1SH3A 2APOA 1U09A 4NRTA 1REGX 3I96A 1C1BB 4X62F 1RLCL 3EPIA 3ULHA 1Q0NA 1KVIA 4K5SA 4ZPAA 2Y8WA 1W25A 3G6YA 1GMWD 4LIRA 2W9BB 1HBMA 3T6JA 2B9EA 3LP1A 5JMNA 4EK2A 2Z8QA 2GZOA 3IC1A 3JYTA 1YKWA 3RB4A 1LFWA 5D0GA 2Z2ZA 3EVOA 4NLPA 1DARA 2ZDPA 3KJVB 2DR9A 3MPWA 4B02A 2FHOB 5KFJA 4B9NA 5KG2A 2VG6A 4TXSA 4PYAA 4NLUA 2BQ3A 1OPIA 4DV3F 1MWQA 3T41A 1AZSA 3CIZA 1SC3B 1S6UA 5KG4A 1WSRA 5J1PA 3ZZZA 5KT2A 2VD3A 2AEMA 2UUAJ 4A8WA 2N82B 4F0MA 5F9NA 2OSRA 1Y4ZB 4MK7A 1X5OA 2RF2A 2P9CA 2MQQA 1HWLA 1PYTA 5L1KA 3DRYA 1CJUB 5T14A 3ET6A 2IIHA 5E33A 2VQEJ 1NK6A 1R0AA 2KO1A 3MOZA 3DLKA 1ZM2A 1S1VB 1UA0A 3IAS9 5BYRA 1VBYA 5ETTA 2LMIA 4C3KA 4LRDA 1SIWB 4DV0J 3U02A 5KFEA 1O0PA 4FNIA 2LLZA 5A6PA 2X1BA 1JKHB 1JLGA 1FDAA 4QR1A 2C2RA 1SUQB 3GFXA 3AD7C 9RUBA 1DTTA 3D5MA 2MQ8A 2GFFA 4LF4F 2ABYA 2PO4A 1GMVA 4OHYA 3EVWA 3THVA 1WF2A 3NGRA 1YBUA 2WSEC 5EX3A 3V4IB 4J9QA 2WVDA 2M3DA 4ED1A 3M8PA 5F8IA 3P49B 5HLFA 4CO1A 1FD2A 5MLCV 1ZM3A 3SSRA 1BQMA 1FWKA 2DPIA 4WFAQ 2LDYA 3IP0A 3OXLA 4X4SA 3ADAC 2Y1IA 2KJWA 1NZAA 3HDSA 1WEXA 2C22A 3J7YU 2V69A 3CCWA 4YB5A 1ZTWA 1FRHA 3OR2B 4WE1A 2DH7A 2E66A 2MLYA 2HGMA 3SV4A 2KVIA 4JUZA 2XMAA 4CLPA 3HJFA 3QRPA 1QY7A 2ZOFA 4ECZA 4N47A 4A8QA 3T19A 3I0SB 2GCFA 2F40A 1RTDA 3DLHA 1LV5A 3SQGA 3A1YG 3NXZA 3RB3A 2K1RA 1KTQA 2DHXA 2DNMA 3UN2A 3FKBA 1NDCA 2X1AA 1VQ7S 3PKYA 1HD0A 4DEZA 2HFVA 3MMCB 1RBAA 4MKAA 3Q2TC 3FBCA 4C6AA 1H98A 1L5UA 1UW9A 1QE1B 3M8QA 1M0SA 4QWCA 2KXNB 2C3OA 3MXHP 1UETA 4CYUA 3R3TA 3OT9A 8RUCA 5B0FA 3CD7A 3EXYA 3JQKA 4O44A 4ES1A 2KFNA 3QLHB 1RYRA 2BE9B 4ELVA 1MMNA 2QYCA 2F4VF 5IM0B 2QX0A 3RTVA 6AT1B 3M30A 2PGCA 1JJ4A 1M5KC 3OFGA 2ZBCA 4DQRA 4MYUA 3G6XA 3GPAA 1IKVA 1BD6A 2DGXA 4B3TF 1EP4B 4P2XA 4LF6J 3K5PA 4O3OA 1LNQA 2R7XA 3QAUA 2MQMA 2XS7A 5CYQA 1SJ1A 1CJTB 2VODA 2UXDJ 3PHTA 5F8MA 4DUYJ 4NA3A 1ZOTA 1F2HA 4QR0A 1FRLA 3M32A 1YIJS 4QBUA 2V0NA 3RW6A 3OXFA 2UU9F 1D09B 5F41A 3UNGC 1HYSA 4H4MA 3SBMA 4ZLJA 3PEHA 3Q83A 3CDBA 1RI7A 3ISZA 2IAJA 1ITPA 3I4HX 4JI6F 1N52B 3CCQS 3HSZA 4CLZA 3BBFA 4NLGA 2LQ9A 2P9GA 1F6TA 4CYUB 3CJQA 1VK8A 4OX9F 5G4DA 3GYXB 3J7YI 1KONA 2V2KA 4DG1B 1T9XA 4B3OA 4LBIA 1RE1B 1RAEB 4JI4J 3CMES 1HKAA 3PRBA 1U6ZA 3JS9A 3E51A 2QE5A 1HI0P 2MKKA 1WTFA 5E41A 3GWCA 1G7CB 5BR8J 1HNXF 3S6EA 4CI0B 3JQMA 4U8VA 3MM6A 1UCNA 4ED5A 1SKUB 1NCLA 4KKOA 5JVGQ 1T03A 5E3AA 5CYQB 1TL5A 2QFIA 2E1RA 4EBCA 1JXVA 2VPWB 1TV6A 2O5DA 2BABA 3DRXA 4YHHJ 4QWAA 4Y00A 1RT7A 2F65A 4QIFA 2LFVA 4ZVOB 5B0BA 2B56A 2RU9A 4KR0B 2OEKA 2VC1A 4NLTA 3Q8YA 4EO6A 3DRSB 1TL7B 3KJNB 4BWMA 5KFZA 1MNEA 2E1PA 1QUVA 3D3CJ 3W62A 4J9NA 2IFXA 4O4GB 4NWBA 3G6ES 2I5JA 4ED2A 2PI4A 2DRAA 4NL5A 2HWTA 3TJ9A 3PIPQ 3BKUA 3OHAA 3D1QA 1U1NA 1KEKA 4K50A 5HK4A 2FY8A 1DAXA 4USHA 3L7UA 4P10A 2GMHA 2VPYB 3UVJA 3BBCA 2LVWA 3R5DA 2L9WA 4ED6A 1BXNA 1VHIA 4OI2A 3T9NA 3CCVS 3QRRA 4DN9A 4H4KA 4USUA 4ZDNA 2OPQA 1WHXA 4ZP6A 4ED7A 2R8HA 3GJRB 4JV0A 1YRXA 2VG7A 4C97A 5DETA 4OI1A 2R7OA 2JLFA 2VA2A 2HS4A 1NKCA 4L6V3 2OFGX 1KFSA 2EFPA 1RTZA 2BOPA 3SIPB 2WRMA 2HEKA 3DYAB 2DR6A 1ZM9A 1I3OB 3EMTA 2HHHJ 4QU6A 3MMAA 3ISND 3MEEA 2ROEA 4ZPDA 5EWFA 5HN0A 2J6TA 3IGNA 4JI0J 3V81A 2WOMB 2EG1A 1GT8A 4JYAJ 4WJBA 4PPDA 3DN9A 3CJSA 3QPIA 5F8GA 1RT6A 1WDDA 4ETZA 1XNRJ 2OEJA 4CO5A 3AQPA 4NX9A 4DSEA 3T5JA 1N36J 2YY3A 3BR8A 3N6NA 2UUCF 1IKYA 1RABB 4LRFA 2ZVSA 4LSNA 2N4DA 1OO0B 3GB0A 1RGVA 2ZJQQ 4K4VA 4GRSA 4A4JA 3R27A 3SYZA 3K0JA 3GJTB 1K44A 3DOKB 2MY8A 5HMYA 2EXUA 5KFAA 3QZ7A 1N32F 3VAFA 1L3VA 4GKJJ 2KRBA 4DF8A 4NE9C 3CJ4A 1OWXA 2RQ4A 3VZHA 1N34F 3AA8A 2RQMA 3NOGA 2GMJA 2OD4A 5DDPC 4JI2F 1JLCA 3DMJA 5IT4A 2QL9B 1HBNB 3LWLA 3G8SA 2ASLA 3M8ZA 3UCUP 1M5OC 2OP5A 2JLGA 2V9KA 4DF4A 2ZH8A 3NCQA 1UW4A 2Z2MA 1Q8BA 3IMQJ 2I9SA 4C2MA 1VFJA 4OHWA 2RAQA 4GMKA 3RYLA 1V6HA 5C42B 2V8GA 2K3KA 3VGSA 1AXQA 1WKLA 4RBUA 5FLXU 2V50A 3BQ2A 3DHXA 3J81j 5HAOA 2GHWA 1WI6A 2XHCA 1U2RA 2CFXA 3VR1A 1TKXA 4WCEQ 1U2FA 3CJ3A 3M05A 4LFAF 3IXQA 1X0FA 2CNKB 1XWLA 4FS2A 3N5BA 2QIFA 3BB5A 2PE8A 1FJEB 3GIIA 4B9UA 2UUTA 4QIVA 2FJBB 3BZQA 4Y0FA 3Q22A 3W8PA 1JQGA 2LKZA 5DZ6A 4DV5J 3CDAA 3PM9A 4CIOA 4UW2A 1S1UA 1NRKA 1WORA 1S0MA 1IKXB 1RTHB 1UEKA 2E7WA 3EJMA 4C11A 1VRQC 4U6PA 4HYKA 2ZWOA 1TKZB 5HP1B 4NXNF 4DLEA 1HWIA 2CG4A 2FJWA 4O3NA 1M5VC 2C2NA 4EZ6A 2MKCA 5C25A 1UVJA 3CWJA 4LIWA 2HW3A 1FCAA 4LR8A 4IYQA 3LANA 3T5HA 2AIRB 1PJ5A 2KI2A 5A6WA 3MM8B 4CM2A 4K2XA 3PY8A 2Q43A 3K2YA 5IZHA 4X4OA 1N54B 2MHEA 2YNGA 4UOFA 4WTOB 3CDEA 1WF1A 3M2VA 3GSIA 1Q4RA 1RSCA 5CHCB 4ECTA 4KIAA 4YEAA 5AXMA 2CAJA 3RUBL 4ES2A 4RW8B 4ZVPB 1FF2A 2AV5A 4Y2KA 1MN9A 4DHVA 3DOMB 3B54A 3MUMP 5ETVA 4OQJA 4C8OA 1V3ZA 5D3GA 1IBCB 4NXMJ 2ZNZA 1REVA 2ACMA 1HNXJ 5F8JA 3LUYA 5GAEI 1RA7A 3B8HA 2H4WB 4L74A 3OVAA 4DUTA 1C1CB 2LQJA 4ECRA 3NGUA 3DOLA 1J5EF 4PWDB 4BCAA 1UAWA 4URGA 3A3OB 5I42B 3EGZA 2W2PP 5FLXY 5IV3A 1HL6A 1RLDA 2KG1A 3UD5A 3J80U 2BXJA 2VZ9A 3RJMB 5B0CA 3KLFB 2X3GA 1M1GA 4RO0A 2X1FA 4WP9A 3O1LA 2VPXB 1R0CB 5K8NA 3R1HA 5GMDA 3CD6S 4PXEA 1G3OA 3AJ1A 1S79A 3GYGA 3S7RA 4UQGA 4QYZK 1DLOB 3UDVA 4DU7A 4FXVA 1MWYA 1S9EA 4DS4A 4ZVFA 2PEHA 5KFTA 3FEYB 2MHNA 3CE8A 4AQYJ 1YJUA 2IRUA 3D6TB 4DQIA 4OYAA 3MEDB 1LEOA 1V5IB 4RU9A 1XK8A 4A47A 5KTQA 2GQCA 4LJMA 4KH1B 3C6UA 3QJJA 2YKMB 4FBTA 2J0SD 3JTPA 2IBKA 3NS5A 2FLOA 4LVNP 3DFEA 1GXUA 1JLAB 2E7VA 1T8EA 3JSYA 4I69A 2Q1LA 1REVB 1GH8A 2QO3A 3KDOA 3LAKA 4JI8F 4X66F 4W98A 3H59A 3SDEB 3KTQA 1FJGJ 3DRRB 3MECA 2KB2A 5B0EA 3BO3A 2FQQB 2BQRA 1FK9B 3DOLB 2NSCA 3G8TA 3R5CA 2CRLA 2KYXA 3Q8PB 2ZZMA 2VF3A 4LF5F 3D6HB 1E6VA 5KAKA 2R7QA 2RVJA 4RUHA 4DSFA 3MAAB 3R7NB 3R7BB 2R7VA 3ZZYA 1RXOB 5EDWA 1JMTA 1SJ3P 5EX0A 4DN0A 4DV1F 2HQ3A 1IR2A 5KFRA 3L95X 2QZ8A 2C3PA 3O44A 1KDNA 3E8OA 1VIXA 1LWFA 1D1UA 4K4WA 1U1QA 4W90B 3VAKA 2Q6CA 5IXUA 5HVGA 5H9EJ 4FKYA 1MMLA 4U95A 4RNHA 1S57A 1Q7LB 4KT0C 2KFYA 2ILZA 2DY1A 4IO1A 4C8YA 4Q0BB 1EHWA 2NXJA 2FIUA 4ZS6A 4IR9A 5F3TA 2YQ1A 4RKUC 1B4SA 1U26A 5BYSA 2O01C 3IR7B 4K4SA 2HZVA 4PXCA 1U2CA 3HFVA 4RW4B 1VQKS 2ZITA 3M2RB 1I1GA 3NLCA 3I5BA 5GADI 4WU2A 4KRWA 4QPTA 3A8KA 3DLLQ 2KYZA 1PKUA 3A3PB 2E1MC 4ZCIA 1NK0A 2WZ1A 1N34J 2YKOA 4NLOA 3W7BA 3F0NA 5HMXA 1W7WA 4XTTA 1P8GA 1S72S 1DQ8A 2MSSA 2XSJB 2BZ2A 1VQLS 1PJ7A 5KG5A 4PR6A 2CYYA 2FHMA 1TK5A 1U1KA 3H25A 4U96A 3VWSA 4P71A 2EKNA 5KOWA 2B8PA 2CQCA 1K47A 1S77D 4TN2A 4KYZA 4IOCQ 2YVSA 4DR6J 4WF9Q 3RBEA 3DLEB 3R97A 4ECYA 1HR0J 1KHWA 5H9EK 2A2DA 2YNFA 4RUBA 2QN6B 1YI2S 3PO5A 3DI6A 4USJC 2K7JA 3MR2A 2YX1A 2ZE2A 4IQXA 3VV2B 3I56S 1U1LA 1R3NA 3ENWA 1NJWA 2V6AA 2A18A 3ZNJ1 3OL9A 4C7QA 3ZTQA 1F9FA 1UWBA 3IBWA 4LFAJ 4FS1A 2UXBF 3PFOA 1B7FA 3KUHA 3AT1B 4DV7J 2NXNA 3PW0A 4USKA 4NRUA 1I5OB 3NRBA 4X65F 1GXLA 4XO0A 1EAYC 1IJFB 5THWA 1YSJA 3GONA 2MB0B 2BEFA 2HRTA 4Q43A 3BGUA 4MKBA 1OMSA 3VVUA 4IG0B 2V63A 2DNPA 3OTDA 1CLFA 3HVAA 3PYFA 3R1LA 3T9ZA 1CJKA 4IRKA 3THTA 2RILA 3SMZA 2HK3A 2IC3B 4DFMA 3KDNA 2V4JA 1FRJA 5HQMA 4LFBJ 4CO4A 3CCSS 5IFMA 2BANA 5K20B 3HVRA 2KRRA 2Y1LB 3DI6B 4PQUB 5F8NA 3HMJG 2DKOB 1H38A 3UWTA 1F9EB 1RT2A 2CNOB 1YWXA 4Q8FA 1WJ9A 4ED3A 3MMJA 4ZLNA 3Q0AA 5AJ3J 3TUPA 2EVZA 3TVZA 1R6YA 5E2QA 3OTEA 4Q44A 4B3SF 2W2MP 4AXIA 4MT1A 1YZ7A 3Q8RB 4NASA 1PSDA 1X5TA 2XCPA 4P2MA 2QMXA 2WONA 4JV2A 5GAHI 1XNQJ 2QLWA 3HHNB 3H2LA 3CNQP 4A8FA 3H2UB 3GLJA 2WW8A 1HWJA 4WYWA 5KFIA 1RWVB 2HG4A 1N8RT 5CZXA 4WZMA 3H4DA
chains in the Genus database with same CATH topology
3FSIA 3SCLE 3ZZTA 2XY6A 1JLAA 2BQUA 2NLWA 4HT5A 4DR2F 4ZPBA 4WK1A 2HYIB 1VGYA 1Y5NB 5KFNA 3H5SA 2YNIB 2FDNA 3PJXA 3RZAA 3OSPA 2HHWA 2G1DA 3CD0A 3TVKA 2FHJD 2HHUA 3V6KA 3KG0A 1A9NB 1MMDA 3IRXA 3BQ0A 2XB2D 3DNCA 1TR0A 3SDEA 5K8MA 3DRRA 2B4OA 4IFYA 3K8WA 4RW7B 3ZZOA 2OD6A 3I0RA 1OIAA 2NS1B 2OMOA 3B4MA 3FRZA 3M30B 2JFDA 4G1QA 1J5OA 1HNIB 2GQQA 3K8VA 1FK9A 1X0PA 2R2TA 2NR0A 2U2FA 5A8RB 3TO8A 2AX0A 2VFVA 4NXMF 4O4RA 4N41A 2ATLA 1NHVA 5BJRA 4DSJA 4Q5VA 4K59A 4HHJA 1IKVB 4RWWA 1XEZA 3SCJE 1S99A 2XI3A 3VCDA 3MAQA 3QO9A 3F73A 5GADU 3ETOA 2FVCA 4H4KC 3H5UA 3RAMA 3ZZPA 2O66A 4OZ5A 4X4NA 1FTRA 2DPJA 2HNDB 1RT1A 4I1TA 4JI3F 5DS7A 2M70A 3HZEA 2CJKA 5CD4H 2OTJS 2VUGA 3D28A 4URQU 5KFBA 1N48A 1Q82T 2KT2A 4FNHA 2B4UA 4KHPF 2W9CB 4TU9A 2A3JA 5CCMA 1JB0C 3RW7A 2VPZB 2XLIA 5DGBA 1DHMA 2HFNA 3K5MA 4NLDA 4QYRA 2FHJA 7FDRA 3GE9A 4NPOA 3UW1A 1VLYA 2VG5A 2B5JB 4IOAQ 3MUVP 1WWHA 4OI3A 2BBEA 2KZMA 4NYZA 2XLJA 1VHFA 3M32B 4I68A 3ZZUA 5A2QY 4ID5A 2HMIB 3MCSA 1XR6A 4CT8A 5HROB 2IMWP 2KU7A 3MZIA 2RIJA 5ITHA 5MAOA 2D9PA 1JNZB 4TY8A 1S9FA 3QAEA 2DR7A 3GFYA 3I9ZA 4MMOA 2OTLS 3BEGB 3F44A 1M5HA 4DL2A 1P27B 4B9TA 1OS5A 1RP5A 3AJ2A 3MM5A 5FJ4A 2VQFF 1HYSB 4DQQA 2XS5A 5JXSA 4ILLA 4H4MB 4I56A 1S48A 3KLEB 3MAHA 3M8SA 2J0QD 5B0DA 4HVZA 2J7KA 1VQNS 3N6LA 4XAKA 4NLVA 1U6FA 5KG3A 3JTOA 4H4OA 5BYQA 2FUG9 4IRCA 4FF1A 2F8MA 3DC2A 3K7RA 4F25A 3H20A 1LWCB 1NH8A 1S1WA 5J2MA 1S1TA 3AY0A 2IAJB 2SXLA 1HI1A 2JEGA 2XMWA 2CQBA 3M2UA 4RNFA 2EFOA 4NZ6A 3E01A 3TP2A 1S6PB 5CQGA 1ZETA 2EW9A 4KGKA 1FKOB 1ROFA 1HNVB 2HPUA 3QWPA 4XDDA 2YKAA 2RDIA 3KFWX 3CJ0A 4R5PA 4QW8A 4I4BA 2RD5C 1TVRB 2YKPA 2AGQA 3OQ2A 4ZA1A 4AQYF 2K3IA 3CJ2A 1WF0A 4YY3F 3KHGA 3K5NA 2DGUA 3PHEA 1U1MA 1SH3A 2ZD1B 2J9CA 2APOA 4Q0BA 1RTIA 2KZZA 3DLGA 3HZGA 4OI4A 1JIHA 2YTCA 2Q6BA 1U09A 2DGVA 4NRTA 2PSZA 4B3OB 1LWEA 1NO8A 4Z2XA 3DXSX 3I96A 1C1BB 2FVRA 3HKWA 4X62F 3M9MB 3EPIA 4TLRA 5J2NA 3ULHA 3RR7A 1KVIA 1BC6A 3HHKA 4B9VA 3I5AA 4K5SA 4ZPAA 3BO4A 4KJIA 4C8KA 4EGLA 1W25A 3G6YA 5B08A 2XO7A 3DRPB 4DL5A 4LIRA 2W9BB 1HBMA 4P7TA 3D0GE 4ILRA 3IS9B 4HI2A 3BN4A 3T6JA 2VBZA 4X4TA 1T05A 4UY85 3U1LA 1XN9A 2EK6A 3FRYA 3LP1A 1VBZA 2F8EX 4RW4A 4B9MA 1TKTB 3M2RA 1Z2ZA 3GIJA 1U4BA 1Y3KA 2KJVA 4ITSA 3KYLA 2D3ZA 2Z8QA 3MM6B 1MWZA 2GGPB 5KFKA 1JJ2R 1FJGF 3IC1A 4KKOB 3JYTA 1FRKA 3CCTA 5HI7A 1U25A 2MXYA 4ZCLA 2KKHA 5KOXA 1T03B 3QIPA 2OFHX 2WK4A 3RB4A 2F3JA 1LFWA 1YJTA 1QAXA 1T7PA 1TL3A 4GC6A 4NLPA 4NMLA 3TUJC 1TK0A 1DARA 4PG6A 3U1MA 3G9CA 2ZDPA 4A8MP 4QQBA 3KJVB 1KOHA 2DR9A 2CQPA 2JEFA 1FNXH 3MPWA 3CVKA 2YKNA 1I6JA 2QA4G 2XY5A 4B02A 5DGAA 1NAQA 1FO1A 1RWUA 2E5JA 2FHOB 1H7WA 4QWEA 2PMHA 2PC6A 4YB6A 1NHUA 2KT5A 5KFJA 3AQOA 1TV6B 5IWAF 4C0OC 4B9NA 5KG2A 1X9MA 1K73T 2VG6A 2R2RA 2HFZA 4I0WA 4K4TA 4TXSA 1IR0A 4HH1A 4NLUA 2ADBA 2BQ3A 1RK8A 1OPIA 1RT7B 1FXLA 4DV3F 2IHR1 3P5TL 1L3SA 3BSAA 1YRTA 1RT4A 4RBTA 1U49A 4OX7A 4P7VA 1YJ9S 1S6QB 1CG2A 3PW2A 2A2CA 1T95A 3PNIA 2OPSA 2E9ZA 4CZCA 3FNNA 3MMBB 2XSJA 3CIZA 2E9RX 3DDKA 3PFEA 1S6UA 3M9NB 5KG4A 5AE1A 5J1PA 1D8YA 3ZZZA 3MD3A 4C8MA 5LMUF 1S1WB 5KT2A 2VD3A 4QIEA 3UDLA 4K4YA 2I8EA 1F5AA 5FIIA 1CQNA 2GW8A 2HWIA 2CQ4A 3AB2B 4JI5F 4IOBA 2K7KA 4A8WA 4QIWD 3U7JA 3BGFA 2N82B 1FEEA 5F9NA 3OTBA 4GO5X 2QFJA 2OSRA 4EBDA 4X84A 2HAIA 1Y4ZB 2DNKA 5T41A 1M90T 4MK7A 3MR6A 1X5OA 2RF2A 2M0GB 2P9CA 4MIAA 2I5JB 4IDKA 5SUHA 3SFGA 3TW0A 4MYTA 2MQQA 1YBAA 4DR7F 2OO4A 1PC5A 1SC6A 1K8AT 3GSDA 1HWLA 4ZVGA 4QZVB 1IXKA 3UD4P 3P6YC 1R8PA 1NK5A 5L1KA 3DRYA 2JEIA 5T14A 1N6QB 4OHXA 2NQPA 1FJCA 3MM7B 2KXFA 2RUGA 5DQGA 2XI2A 5E33A 1NK6A 4N5SA 4E0DA 1R0AA 2KO1A 4EWTA 1QM9A 1X4GA 3DLEA 2HS3A 3MOZA 3DLKA 4X4VA 1ZM2A 2KN4A 1S1VB 1UA0A 2Q66A 5I3QA 2JC1A 5KT4A 2WTFA 3CC2S 2HLUA 3KK1B 3IAS9 3OFEA 3KHLA 5BYRA 3ITHB 1SL2A 1VBYA 1R89A 5LT5A 2R7RA 1VC5A 2LMIA 2IYIA 4C3KA 5AE2A 3SCKE 4WFBQ 1RISA 2DITA 2WB1D 1SIWB 4PG7A 3U02A 5KFEA 1O0PA 3MDFA 2HNYB 1QSYA 2DD8S 4C9DA 4CH0S 4FNIA 2LLZA 4MJKA 5A6PA 2IA0A 4TQRA 2X1BA 4AL6A 4NLQA 1JKHB 1JLGA 3I87A 1C0TB 5AXLA 1FDAA 5D78A 2OPQB 4QR1A 5AE3A 2C2RA 2I1RA 1SUQB 2AWZA 3GFXA 2OJ3A 2XMMA 2HRUA 2LDIA 3C66A 1HQEB 1DTTA 3D5MA 1L3UA 3M6WA 1S0OA 1XR5A 1R27B 3RBDA 4JBCA 2GFFA 1CC8A 2V94A 2VG7B 2RSQA 3KLHB 2ABYA 2PO4A 3J7ZT 4LF4F 2KM8B 3OUYB 4OHYA 4DX8H 2YWKA 1WHVA 4KPYA 3R5BA 1U6BA 3THVA 1WF2A 3OSNA 1J2VA 2WSEC 2WSFC 2C3YA 3DHWC 3OFFA 5EX3A 3V4IB 4J9QA 3T5KA 3NKYA 2M3DA 3A8EA 4ED1A 3M8PA 4DV4F 1YJRA 2VOOA 1H7XA 5K14B 3OTOF 2BACA 5F8IA 3P49B 4OLPA 5HLFA 4CO1A 1XBWA 3UCZP 1FD2A 2E1AA 1K1QA 5MLCV 1ZM3A 2DNRA 5GAHU 1VC0A 3SSRA 1FDNA 1BQMA 3PACA 1Y0HA 2DPIA 4WFAQ 2LDYA 5KFLA 2DNGA 2RS8A 4NLWA 1VI7A 3OXLA 4X4SA 2HNZB 1R31A 1S49A 3GFHA 4QWBA 3UR3C 5EWEA 4FYDA 1W2IA 4Y65A 2Y1IA 1TK8A 2UVRA 2KJWA