2DISA

Solution structure of the rrm domain of unnamed protein product
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
109
structure length
109
Chain Sequence
GSSGSSGNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RRM domain of unnamed protein product
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords unnamed protein product
total genus 10
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2disA01
2DHGA 2KG1A 3UWTA 3B4MA 5D78A 1FO1A 3DXBA 1B7FA 3BO3A 3OW2R 5CXTA 4A8XA 3CCVS 3CD6S 2OTJS 2MJNA 2MKKA 2LQ5A 2N7CA 2KN4A 2YH1A 2E5IA 1OO0B 1YJ9S 2M7SA 1G2EA 2E5JA 4WF9Q 4Y00A 2RUGA 2K8GA 4P6QA 3CPWR 4C4WA 1X4BA 3BS9A 3CMAS 1YHQS 2KFYA 3SXLA 3BO2A 2MB0B 2DHAA 4TU7A 5IM0A 2DHSA 1YI2S 3P3DA 2ADCA 2MJUA 3SDEB 1WELA 2MKSA 4WIIA 3UE2A 3Q2SC 1SJQA 1M5VC 4Y0FA 1WWHA 2CQBA 2M9KA 1WF2A 1WI8A 1U1LA 3CCRS 1URNA 3B4DA 3FEXB 2EVZA 3J7ZT 2LA4A 2M4MA 3MUTP 1HA1A 3P49B 2U2FA 2ZJQQ 1AUDA 3CCMS 2MQNA 5IM0B 2AYBA 2LXUA 1WEXA 1VQLS 2FC8A 4LIRA 2LA6A 1N8RT 2MZRA 1K8AT 4WFAQ 1VC0A 4TU8A 1Q82T 3NS6A 2CQ1A 1VQ8S 3J7YU 1M5KC 2OTLS 2CQPA 3US5A 2RRBA 1FNXH 2CQHA 4F26A 2L41A 5LSOA 2RVJA 2MZTA 3S8SA 4BS2A 2MYFA 1Q86T 1CVJA 2FPHX 2K3KA 1WEZA 2M8HA 1KOOA 2DO4A 2DNHA 2EK1A 2DNZA 2CPFA 1IQTA 2KG0A 2XNQA 2M88A 3ZZYA 2KVIA 5FJ4A 1O0PA 1VQ7S 2XS2A 5ITHA 2KT5A 1X4AA 2MY7A 3FEYB 1JJ4A 2B0GA 2DNMA 4F02A 2L08A 2DK2A 2MSTA 2MKCA 2CPEA 2DH9A 2DHXA 2YH0A 1X4GA 3EGZA 2PE8A 2DGTA 1PGZA 4CH0S 1ZZNA 1U6BA 1U1NA 4UQTA 3R1HA 3CF5Q 3CCJS 3CCQS 3D2WA 1ZH5A 2RU3A 2DITA 4PKDB 4QU7A 2RT3A 2DNYA 4ZKAA 2KU7A 3MUVP 2DNPA 1YJNS 2VODA 1OWXA 3PIOQ 3VAKA 2DNQA 2CQDA 2UP1A 3ULHA 1VC5A 4TU9A 1FJEB 1VBYA 1JJ2R 2MKHA 5GAGU 2G1DA 5DETA 1X4EA 4C7QA 3MXHP 3P5TL 1VQ9S 3ZZZA 2J0SD 2MHNA 3CTRA 1VQNS 1YTYA 1L3KA 1VQ6S 3UD4P 3Q2TC 5GMKa 2LEAA 2MZQA 1SJRA 4QPTA 2DNKA 2OJ3A 4RU2A 1BY9A 1F9FA 5LXYA 2RQ4A 3EX7B 2M52A 3N9UC 2FC9A 2CQ4A 1HD1A 1P1TA 3RW7A 1DRZA 1VQ5S 2MQMA 3S7RA 3VAIA 2M8DB 2KHCA 1M5PC 2FHOB 4YUDA 2MGZA 1XN9A 1VQOS 1X5TA 4OZ0A 1NU4A 1N88A 2JWNA 1KD1T 1U1PA 4PR6A 2KM8B 2DNRA 1D8ZA 5IQQA 3TO8A 1VQ4S 2O3DA 1VBXA 2XB2D 2LXIA 5EN1A 3V4MA 2N82B 5JVGQ 1M5OC 3NS5A 3I56S 1OPIA 3IWNC 2L9WA 2CPZA 2F3JA 2MZ1A 1N54B 2JVOA 3VAFA 2GO9A 3VAJA 2QEXS 2KH9A 1DHMA 2CQIA 3G8SA 3CC2S 2LEBA 1JMTA 2CPJA 2HZCA 5LXRA 3R1LA 5DM7Q 2YTCA 2MGZB 2DGQA 3P6YC 3U1MA 2KRBA 3G71S 2DH7A 2N3LA 2X1FA 1WI6A 2RNEA 4WCEQ 2KXFA 1HD0A 2J8AA 2G4BA 1SJFA 2M0GB 1FT8A 2E5GA 2X1GA 1WHXA 2D9PA 1X4DA 5LJ3Y 2CPYA 4EGLA 2EK6A 3H2VE 3CULA 1X0FA 3UCUP 2MZJA 4PRFA 1VQKS 2I38A 5MLCV 3CCUS 3G4SS 2DGVA 1DBDA 5LSLA 2F9JA 2M2BA 2DIUA 4TLQA 4FXWA 2X1BA 2Q79A 3I55S 2QA4S 2DGXA 1WHVA 2CQGA 3NMRA 1RKJA 4IUFA 3THPA 1U1QA 2V94A 2CQ3A 3BO4A 2MQLA 3R27A 4OZ1A 3THTA 4IOCQ 2KYXA 2BOPA 1DZ5A 2KM8C 5HL7Q 1PO6A 1K73T 2QFJA 1H6KX 2CPIA 3TP2A 2ERRA 1YITS 2OSQA 3MURP 3NNCA 4M5DB 4IO9Q 3VF0B 5DDQC 1X5OA 3VALA 1WHYA 3SDEA 2MKJA 1HL6A 4QU6A 2MPUA 1N52B 4WKRA 4C0OC 2MY8A 2RRAA 2JX2A 3CC4S 1OIAA 3RW6A 2XSFA 1JJHA 1WHWA 4V19X 1NJIT 2GHPA 1A7GE 3HI9A 4LJMA 2LECA 4ERDA 2E5HA 2J0QD 2A3JA 2BZ2A 3MOJB 2DNNA 5GVQA 4Z2XA 3IRWP 2RQCA 3CCSS 1U2FA 2HGMA 2OIHA 5CYJA 2AYGA 2MMYA 2MQOA 3LPYA 3TYTA 1P27B 4J5OA 2CQ0A 2RS8A 4YOEA 3NNAA 2DNLA 3VAMA 5DM6Q 1ZZFA 2DH8A 2DISA 1M1KT 3CCES 1UFWA 5DDOC 3VAHA 3JB9k 2DNGA 1QVFR 2LYVA 3DLLQ 5CA5A 3PIPQ 1H2TZ 1YIJS 5GADU 4QQBA 2D9OA 3VAGA 2RS2A 1X4FA 2ZJPQ 2LKZA 1R8HA 2YKAA 4WFNQ 3MI7X 1WG5A 3UD3P 2U1AA 3BEGB 3UCZP 1U1OA 4YB1P 4U67Q 3MUMP 5GAHU 4W92B 1KQSR 1S72S 5D77A 1W2BR 1RK8A 3CMES 2FY1A 1S79A 2DGOA 5H1SV 1X4CA 4W90B 3SMZA 3MD3A 1YJWS 1UAWA 5HO4A 2CPHA 2JRSA 1SJ3P 1U6FA 1K9MT 2I2YA 1SXLA 5GAEU 3EGNA 5LJ5Y 3S6EA 2CQCA 2AYMA 5IFMA 3CXCR 1VBZA 2KI2A 1NO8A 2NLWA 4F25A 3U1LA 2DO0A 2AD9A 1QM9A 5JVHQ 4FXVA 1M90T 1FJ7A 1UW4A 2LMIA 2WBRA 1KC8T 2MKIA 1Q7YT 2M70A 3LQVA 3MD1A 3UCGA 1VQPS 3H2UB 2DIVA 2MZSA 3L3CA 2HGLA 1WG4A 3HHNB 3NNHA 3CUNA 2KRRA 2HGNA 5DDRC 1UP1A 4CH1A 2ZJRQ 1U1MA 2J76E 4CIOA 1WEYA 2D3OR 4UY8T 1FXLA 4IOAQ 2HVZA 2PEHA 2KXHA 5DDPC 1VC6A 3MDFA 1R8PA 2VOPA 1WTBA 4ED5A 3CC7S 2KXNB 4CQ1A 3G8TA 2E44A 2DGUA 2DGWA 1FJCA 1YWXA 2CJKA 2VONA 3G9CA 1FHTA 1X5SA 2SXLA 1X4HA 2YWKA 2HYIB 1U1RA 1WG1A 1WF1A 2OSRA 2DB1A 2MQPA 3S01A 2XS7A 1VQMS 1SJ4P 2CPDA 3G6ES 1H2VZ 2XNRA 2VOOA 1WF0A 2DGSA 1KOHA 1X5PA 2DNOA 1U1KA 2N3OA 1H2UX 2MSSA 2CPXA 2LCWA 4WFBQ 1A9NB 3K0JA 2JVRA 2CQ2A 2X1AA 2XS5A 2MQQA 3CCLS 2G0CA 1QVGR 4LMZA 5BJRA 2F9DA 2ADBA 2AYEA 1Q81T 1D9AA 2MXYA 3G96A 2NZ4A
chains in the Genus database with same CATH superfamily
2E7VA 2KG1A 4QCLA 1WJ9A 4FYYB 4RPFA 3UVJB 3AQPA 1BXNA 1FK9B 1FX2A 4LF9J 2V0NA 4B3OA 1QVFR 3HMJG 3DXBA 4JI0F 3KK3B 2BEFA 1O5JA 1Y5LB 4KFBB 1Y11A 1VBKA 2CNLB 3PKMA 4K4XA 2OTJS 3R5BA 4B3RF 2E5IA 1FNOA 3GYNA 1G2EA 2VDHA 3O3LA 4E8UA 4MFBA 4YR0A 2K8GA 3CPWR 4DWIA 4K0KF 2PMZD 4PXBA 1T94A 3R5GA 4HKQA 4BWMA 1FESA 3CJQA 4GRSA 3HO1A 1MMDA 4MK7A 3SXLA 2DCLA 3EXYA 3EGWB 3RUBL 4C98A 3BO2A 2YX1A 3M8PB 2DHAA 2OPQA 4O4GA 5CAAA 1F2GA 9ATCB 3QIDA 3TX0A 3NS7B 1WNEA 3CO9A 3PHTA 1MWQA 2BANB 3DRPA 4HHJA 3HJFA 5KFLA 2OEMA 2JC1A 3H0PA 4J9OA 2ADCA 3SDEB 3M6WA 1WELA 4OZ3A 3QFHA 1J5OB 4WIIA 1M5VC 4KTQA 3OR2A 3TQEA 4Y0FA 5KFOA 3OFFA 1WWHA 2CQBA 2E1AA 1WF2A 4P2FA 3R9LA 2D7SA 1URNA 5A8KA 1T8EA 2RMLA 2M4MA 3CD0A 4PUOA 4DPWA 2LXFA 1RT6A 1LWFB 3BGOP 2EG2A 3JTOA 4FDFA 4PG6A 4TY8B 2JLEA 3CD7A 2BJ3A 2NXNA 1AA1B 1JWWA 3RBZA 2VG6A 2ZJQQ 1TL5A 4F0HA 2FJWA 1CJVB 4DV4J 2MQNA 2Z0GA 4EBDA 2HHSA 2UXDF 2FLLA 4WZMA 1VQLS 4GKKF 4JI3F 2IYIA 3A1YG 2PFFB 2IJFA 2LA6A 2MZRA 3GFHA 3SCIE 1K8AT 5KG0A 1KVIA 1KQFB 4LF6F 4USWA 1ACMB 4HTIA 4TU8A 3MECB 3M8QB 3W2VA 2NS1B 1CULB 5B0DA 5DG7A 2CWXA 1D9FA 1KQGB 2VFRA 2UVWA 2KDOA 3IWLA 1HBMA 2VJUA 2C2KB 1QAIA 3HT0A 4M5DA 3GIIA 1UVKA 1TFYA 1SC1B 3US5A 3D0GE 3GU0A 2IM1A 1TL3B 2O66A 4XPEA 4E0DA 2MZTA 3M4XA 1NSQA 1RDRA 2DR7A 1UFLA 2MYFA 4LRBA 3IRXB 1UWAA 2BJ7A 2H5EA 2ZHAA 4RO0A 1S4FA 2FPHX 1KONA 4G1PA 1JIHA 1L3SA 3KTQA 3OXGA 4QIEA 2AMCB 3PRBA 1GTEA 2QLJB 4IQMA 2WSEC 2VBXA 5DLFA 1YSJA 2OPSA 2XNQA 3PFEA 1ITPA 3NGTA 2GMLA 4DR5F 1WACA 2QL7B 4MAKA 3AD9C 4X84A 1NK4A 1VQ7S 1GX5A 3Q23A 2XS2A 5F8MA 1VYAA 2PI4A 3ELHA 4WK3A 3PFOA 5E41A 1S6UA 3G86A 3WIUA 1X4AA 2CVIA 2HIQA 3Q8RB 1JLQB 4C3MA 1FXRA 4F02A 2MLXA 3G2XA 3GIMA 3ET6B 4CH7A 2DK2A 1K1QA 1LW0B 3G8QA 4URSA 4ZPAA 4DCJB 1HNWJ 2MKCA 2RB7A 3KLVA 2DH9A 1S0VA 3MM8B 4CO3A 4ECQA 1X4GA 4KHRA 2PE8A 1C4CA 1NCLA 2WB1D 4OJHA 2UUAF 5F8NA 4EO8A 4X4OA 1HLWA 2GQ2A 4KH1B 3IC1A 1Q8LA 1NLKL 2M5YA 1DURA 3ENWA 2B9XA 3KDNA 4I2QA 3GJTB 3CF5Q 1U6BA 3EPIA 2R2UA 4LF8J 3DHXA 2UUTA 4NRUA 2LQJA 4FYVB 1FJGF 2HQFA 1RLCL 3ZZ0A 2V63A 2XQCA 3KHHA 4USIA 1AZSB 2HEKA 2QMXA 4PKDB 2EW9A 2HFUA 3DDIA 5GADI 3HD1A 3CJ5A 2Q6CA 5H9EJ 4ZKAA 4QOTA 2UUCF 5KFVA 2ZWPA 3GJRB 1RWVB 4CWBA 3IG1B 2YKPA 2R3VA 4DLEA 3THVA 2OH2A 2DRBA 4CLPA 3VAKA 3LP0A 2RH3A 3D6TB 2Z2LA 2AJ1A 3MAHA 3TZXA 4RKUC 1HHSA 1RWKB 2CDRB 3DLKB 3EVMA 4IRCA 2HVIA 1VC5A 5I3PA 2HHHF 4NEZA 4Y2IA 3NLCA 5F8IA 3LGNA 3OHAA 1VBYA 5KT5A 1T9VA 3GONA 3HVAA 1WC6A 4JI1F 2MKHA 2R8GA 2XGQA 2E5LJ 4WE1A 2HG4A 3PEHA 4MT1A 3ZO7A 1WC5A 2RIJA 3HM9A 2EBEA 3LA0A 3Q8SB 3OVSA 2B4UA 1S9GA 4KQZA 4ZLNA 4G3IA 2MHNA 3D3CJ 1ROFA 3FZ2A 1S1UB 1S4EA 1L3KA 1I51B 4OYOA 1F3VA 2IJRA 3RBXA 3TVYA 1TU0B 5GMKa 1HNXJ 2AX0A 2IDEA 3QWUA 1RWUA 5GMDA 1FVQA 3MMCA 4ZP8A 2QX0A 2KKHA 3JYTA 3Q0AA 2A6OA 3J80Y 2DNKA 2QL9B 2OJ3A 1RT2A 4RU2A 5G4DA 5KFNA 4MKVA 5CZXA 1NSAA 4X2BA 5LXYA 5KG1A 3QAUA 2FC9A 1RTIA 5LOQA 4ED3A 2P8IA 2ALYB 2VDIA 1FFGB 3PO4A 1XMQF 5KFFA 3S7RA 1RAGB 5KFIA 4ZITA 4ZLJA 1F9EB 3VAIA 2DR8A 4NXNF 3MEEA 1RT7B 6FD1A 3F41A 2P5VA 1OY9A 4JP8A 1SKSA 1M5PC 2MGZA 1N32F 1VQOS 3E01A 3F56A 4NLPA 1NDLA 3NMAA 4OZ0A 1Q78A 1N88A 4ANCA 3K2YA 4CLYA 5A8WB 1WKKA 2FVSA 1FEHA 2YNHA 1XTZA 3MEGA 1KD1T 4B9NA 2NQPA 3ISNC 1YZ6A 3OL6A 3OJUA 4AQYJ 2KM8B 1U1PA 1YDLA 2F8EX 1TKZA 1TK0A 1N5TA 5D4NA 5C25B 3V6KA 4AYBD 2XY7A 5F3TA 1H0HB 1SB6A 1V3SA 4FVMA 4USJC 5KFGA 2V8HA 4AL5A 3I0SB 2LXIA 5EN1A 1SH2A 3V4MA 2N82B 1MSWD 3FSIA 4CM2A 4C8YA 2YWWA 3UDVA 2HHUA 2CPZA 1DQ9A 3PACA 1HBUB 4TXSA 3X3UA 2MZ1A 2GO9A 3VAFA 1S99A 2FUG9 3VAJA 4RW8A 3M32A 3VQTA 2KH9A 3J7A1 2HZCA 2CPJA 3R1LA 4FF3A 1O8BA 4L6V3 2GVDB 2J9EA 2LDIA 3M30A 1TELA 1JLCA 3W1YC 3FQKA 2YTCA 4F04B 5F8GA 3NXZA 2MGZB 5D4PA 3CDBA 3ZTOA 2ASLA 3VGSA 4UF4A 2N3LA 4I0WA 5DQGA 4EBEA 1X8DA 4CT8A 3GIRA 3QATA 1L5UA 1HD0A 3X1LB 1R3NA 1OSCA 2D9PA 4Q0BB 3NG8A 2EC0A 3M8RA 1MW7A 2NCKL 3LGHA 5C2GA 2GNKA 3H20A 4QW9A 2ROEA 1PAEX 2ZWOA 9RUBA 1X0FA 3D68A 3MMAA 3M1VB 5LMNJ 4X66J 1XWLA 3RAXA 2XMMA 2BJ8A 2I38A 2V6AA 3DFEA 5MLCV 5B7WA 2XCAA 2V8VA 1UVLA 2R7XA 3LF0A 3HHLA 2L3MA 4ZDNA 2FY8A 1T3OA 4C3LA 3WHIA 2UU9J 4ERDA 1RT4B 2OAUA 1PCAA 2F9JA 2M2BA 2P9GA 2QC3A 3CJ3A 3IBWA 4FXWA 3VGVA 3I55S 3V4IA 2QA4S 4CZCA 3G87A 1I94J 2B43A 7FD1A 2V8DA 3ZZPA 4ZCKA 4DG1A 3DLKA 3GFYA 4OZ1A 2GGPB 2AEFA 2C2OB 3THTA 4C0HA 4JI6J 2XGPA 3V6DA 3VHQA 1DZ5A 4DDFA 2QFJA 1AT1B 1H6KX 2XLKA 1YITS 3DOLB 4ECWA 3J81j 1RHRB 5LMUF 4IG3A 3AOAA 5DDQC 4U7CA 4XIUA 5C24A 3RJMB 2O67A 4K2JA 4EBCA 1KHVA 1NDKA 1V5IB 2HVDA 3CJRA 3QFWA 2DEJA 4MK8A 1HL6A 2BM1A 2MPUA 2IVYA 1JKHB 1C1BB 1F0XA 3KNAA 4WKRA 3GV8B 1NB7A 4B17A 1OY6A 4DV2F 3KG4A 1HARA 1R7IA 3AJ1A 5K8MA 2MY8A 3GG1A 4JI6F 2RRAA 2UUCJ 4C8OA 4Y3CA 1REGX 4HH0A 1OIAA 4OHXA 1TVRB 4OV1A 4GO7X 5LT5A 3RW6A 2ZM6J 1JLBB 3MCMA 3AD8C 2OMLA 3BR9A 2ZC3A 1PC4A 1BQNA 3MM8A 1N6QA 1EZZB 1N34J 1NJIT 2GHPA 1G7CB 4P10A 4ID5A 3AT1B 3CJ4A 4ZS6A 3TAQA 3MCOA 4UOHA 4ED1A 3DOKB 2JEFA 2A3JA 2ZKUA 1RHKB 2Q43A 4O3PA 4XPCA 4Y28C 1N0VC 8ATCB 2XMAA 1D1UA 3QRRA 2PC6A 2ZVSA 4L75A 4ZVQB 1YRXA 3BSAA 5HI7A 4F2SA 5DZ7A 5KFHA 5CYJA 2B3TB 4QIVA 4ZN3A 4FPRA 3IBFB 3ZXWA 2MMYA 4EK2A 1PYTA 4NZ0A 4GMKA 3CJ0A 1JLFA 2HQ3A 3TANA 4QW8A 5HLFB 1TKTB 4OL8A 3QT7A 2CQ0A 4PG4A 4LQ3A 1IKXA 3NNAA 2BKNA 1RTDB 5KG3A 1ZM4A 4QIFA 5IC6B 1LXJA 2OEJA 2NPFA 5EX0A 3HSDA 5IWAJ 4QWEA 4ZVFA 4KO0A 1QY7A 1SKUB 3I87A 3I9V9 4IQXA 2W25A 5DM6Q 1QJHA 4IFYB 3NAHA 4ZHRA 2ZH5A 3QJPA 1FX4A 4PXDA 4URQU 5D3GA 2DYAA 3HVTB 5BYQA 2FQQB 1BQNB 1UFWA 3DDKA 2OPRA 4F7VA 1HBMB 4W98A 5LMNF 1N6QB 1TKXB 4NXMF 3W2WA 2C28A 2QA1A 4PPZA 1N48A 3KK1B 5H9EK 3MTKA 2UXBF 5M2RA 2UV8G 3CT9A 2UXCF 4RBTA 2W4PA 2AZ3A 1KFDA 1WORA 2LQ9A 3LAKA 2RD5C 2CYYA 4P75A 4QQBA 4N77A 3T5JA 1X4FA 2ZJPQ 1WKLA 2EI5A 3H25A 3PR5B 4YY3F 3PX6A 1JLAB 1LV5A 5HMWA 4MIAA 3O5TB 3MI7X 3UD3P 2Q3PA 1U0SA 1Y0HA 2W01A 3OR1B 2F1FA 3BEGB 4LR8A 3IM9A 2BJEA 2YX7A 3UCZP 1K47A 3DKDA 4QIWD 1T9WA 4FZVA 4KB7A 1UEKA 2PSZA 4U67Q 4OI4A 3MUMP 4LBIA 3V6DB 1Z4UA 1S72S 1OSDA 4F4WA 1W2BR 1CC7A 3CMES 4JI4F 1VRUB 2DGOA 2FB0A 5M2UA 5H1SV 4WZQA 4I2QB 2CJQA 2E9RX 5L9XA 2GAHC 1RAAB 3SMZA 1UCNA 1S48A 1XR5A 1V6HA 3CDWA 4MIBA 4TNOA 2CPHA 4HT5A 5J2QA 1K9MT 1S1TA 3A8IA 1SXLA 3BDEA 4H4OA 4HHHA 5GAEU 3DN9A 3HULA 4RNFA 1LWXA 1CJTB 4LVNP 1H74A 2CQCA 2EFOA 3DRRB 4RLEA 1LW0A 5HVGA 1BGXT 5IFMA 4XDCA 1NO8A 1SJ4P 2J6TA 2BVZA 1V3ZA 2VPXB 1BWVA 2K1RA 1OJ4A 1I5OB 1RHJB 2BDPA 2UUWA 3M8PA 1JB0C 3OTCA 3NCPA 1ULRA 2ZH3A 4HT7A 4H4MA 2J0WA 3UN3A 3MMAB 2HS4A 3BJYA 1QM9A 2VASA 2J9DE 2VU5A 1XERA 3HKWA 4FXVA 5G0RB 5JVHQ 4J91A 5F8JA 1FJ7A 3N01A 2LMIA 4A8KA 1WTFA 4DPOA 1LQ9A 4Q2LA 2ASYA 2M70A 2OI2A 4YHHJ 3PX0A 2AGQA 3EICA 4JI0J 2K2PA 3G82B 2WVBA 1SKRA 2XLIA 2I9SA 3OFHA 3L3CA 2GIQA 2AJQA 4FN5A 1FVSA 1S1XA 2KRRA 3ZZRA 1QE1A 1CJTA 4Q45A 3V6HA 2IBKA 1RLDA 3M8SA 2ZJRQ 4ZCIA 3VTIA 1FRXA 1HBOA 3BH6B 3KK3A 1U47A 3CJKB 2C42A 1XNRF 2J76E 5AXMA 3DLBA 5J1EB 3K57A 1FK9A 3AY0A 2D3OR 1RCXB 2W2QP 2VV5A 2W7AA 5D15A 5DRKA 4YB5A 3T3FA 3TAPA 1SL0A 4N76A 4FF4A 4IOAQ 2RF2A 5KG4A 2BQ3A 2KJWA 4AD6A 1IJFB 4UZCA 2L9DA 4DR2J 1U45A 5A8RA 4ZVEA 4LSLB 2HNDB 1ZAWA 2PN6A 3IGVA 4FYXB 4HHUA 2IYGA 1SQGA 5U47A 5ETTA 2VOPA 3WDOA 4NI2B 4DI6A 4OJ3A 2KXNB 1SJ1A 3MR2A 4C9DA 4PYDA 4WTYA 4DR3F 3K8WA 1YLXA 2RKIB 2DGUA 2ZBCA 3NCRA 3I0RB 7AT1B 4F3OA 5E0OA 3TVKA 2HHTA 1YWXA 2QV6A 1FTCA 3W3SA 1X0PA 3K17A 3GSDA 4Z7CA 2RQMA 2BJ9A 1ZBTA 2R7UA 1KR4A 1GEHA 3TAMB 3ZZUA 1S6QB 2OHDA 5L1KA 2QLWA 2HYIB 4LF7J 1F60B 1U2CA 1F1BB 3DOMA 3OV7A 1HMVB 5HN0A 4HACB 2MQPA 3G6YA 1VQMS 2QLFB 1RADB 3EZUA 4C2MA 3KG0A 3PVXA 4C6AA 1WC4A 5A76A 4PWWA 4J9LA 3I4HX 2WOMA 4G1QA 2ZVIA 2AYBA 2XNRA 2DGSA 3ISND 4BDPA 4N7TA 4NZ6A 1X5PA 3B82A 3OLBA 4PUOB 2B6AB 2C3UA 4NWBA 2GVZA 2Y0BB 4JV0A 1SI9A 3TJ8A 4DU8A 2MSSA 4IFYA 4ZHRB 2EFPA 4IR9A 5BYSA 4WK1A 4U8VA 4P52A 1JX4A 2G13A 1XBWA 3DI6A 4ED6A 4DX8H 5AJ3F 3K0JA 2BKOA 2JVRA 2KT3A 4JI2J 2GA7A 2DXDA 3MMCB 4MYUA 1QVGR 3D67A 1KN6A 1YJVA 3FQLA 4V19J 4NMXA 1LK5A 2P6SA 3PZPA 2XULA 4PQUB 1BUXA 3FEZA 3FKBA 4IFVB 4OMFG 4CLSA 2G0JA 2DHGA 2HW3A 1EX8A 5H9FK 1RJJA 3TW0A 1UMJA 1FDNA 3B4MA 5LM7E 2NXUA 1HNZF 4MJKA 5D78A 4PG5A 1RTZA 2RSQA 3AXMA 1W2IA 4RW9A 4NCAA 4JYAF 1AFJA 1B7FA 3M8YA 4YY3J 4KIAA 3CCVS 4DQQA 2VA3A 1HQEA 4IOBA 4A8MP 2MJNA 2IA0A 2LQ5A 5HAOA 1NAQA 1TZ0A 2VBWA 4Q8EA 1N33F 2E5JA 4WF9Q 1FE4A 4B9UA 1FJGJ 2BXJA 2JOQA 4URGA 4C4WA 3R7NB 1NEEA 4G1IA 3KUEA 2HIYA 3KLHB 2H51B 3IBCB 3V2UC 1YHQS 2Y1RI 4ZA1A 2KFYA 4I2PB 1UL3A 2K7JA 4OJ1A 1U02A 5DQHA 3NL0A 2BUNA 2D3UA 3VVTA 3BPDA 1AZSA 3E3XA 4ES1A 1X7VA 1EETB 2FJAB 2B8PA 2ZBPA 5IM0A 2IIHA 1SV5B 2DHSA 4OV6A 4PZVA 5CQGA 2OGUA 4C11B 1EETA 5EWFA 3D1QA 3BKTA 4J9MA 2RF2B 2AJ4A 2W2NP 3FMWA 3PRVA 2MKSA 1VRTA 2QE5A 1RA6A 4NLUA 3SSQA 1SJQA 4RWXA 3UE2A 3KLGA 2M9KA 3RRKA 1WI8A 3DLGA 1U1LA 1QD1A 1PAUB 3OUYB 1I6JA 2FLNA 3PNIA 3TA0A 3FEXB 3B78A 5E5NA 3AHPA 3KKFA 2LA4A 5AT1B 3WC2A 2A2DA 3MUTP 2B4PA 3D1OA 2G9OA 2U2FA 5DQIA 1RWWB 1DTTB 1S1WA 5J2PA 4P9SA 2RILA 2H1YA 4NASA 3W63A 4DV4F 2CJ9A 4WXWA 2B56A 1HHQA 2RDDA 4KC5A 4M5HA 2LXUA 3A8KA 2PGCA 3D5MA 3O6QA 1VLOA 3OXFA 4DN0A 3MAAB 1NK6A 1RBOB 2W1BA 4BHQA 4F4KA 3QLHB 2XLJA 4LIRA 3IAM9 1HWKA 1J2VA 4CLFA 2GIFA 4QWDA 4F4XA 3ITHA 1S10A 2FJEB 1NB2A 4IFVA 4OYZA 4OHWA 1YVFA 1HI1A 2B9EA 2HK3A 2DXEA 3MR6A 2QMWA 4DSFA 5C7PA 5C5JA 4EFAC 2GS8A 4IDKA 1U6ZA 4NYOA 3TUIC 4DV6J 4DSEA 1XC9A 4FNIA 1VQ8S 3IRXA 3WX4A 3KK2A 1RAEB 2ZH2A 2CQPA 4ZVUB 2XS7A 1S1WB 3HCXA 3LO3A 2MTLA 4PPDA 4EYHB 4F26A 1FWKA 2VBZA 2XZTB 4ZJQA 5EGYA 4MTPA 2RVJA 2HFSA 3KLEB 2HNYB 3HFVA 3S8SA 3EYZA 1N36F 4BS2A 3W7BA 4QR2A 2QA4G 3IFEA 1H38A 4ICLB 1SIZA 1Q86T 4JB8B 4OHYA 3EZOA 1CVJA 2W7OA 2K3KA 1WEZA 2BW7A 2VF3A 2X3DA 1TKDA 2HHWA 1CULA 2DO4A 4OHZA 2WBMA 2EK1A 4Y2AA 1UWBA 2AW0A 2E1PA 1N5SA 2HSEB 3NAIA 3VZIA 4WP8A 3HPOA 1IQTA 4J9KA 1NJYA 2KG0A 1IM4A 3GIJA 1KNZA 2CFXA 1SV5A 5B0CA 2M88A 3ZZYA 2VQEJ 5J2MA 1X31C 1DFDA 4QR0A 1O0PA 5HQMA 5F0UA 1IBKJ 2KT5A 4OJGA 2HVHA 1W25A 4I2PA 1RGVA 4FBUA 3HP6A 2B0GA 5C25A 2ACMA 1TL1B 1VJQA 4L3NA 2NR0A 3A3NB 3QGPA 4IO1A 2IPOB 2LQBA 2DHHA 2MSTA 3I9ZA 3N79A 1NSPA 2VPYB 3OD2A 1SUQA 4GKJJ 1Q8BA 1RT3A 4Q7AA 3BKFA 2ZBRA 3EGZA 3BGLA 1UETA 3KFWX 5KG5A 4I67A 4ZVSB 1R31A 4U95A 4B3TF 3R5AA 4UQTA 1JK9B 2IAJB 3TUPA 1IKXB 4ZN1A 2ZE2B 3D2WA 3E2EA 1S1XB 3MM9A 1PIEA 2RU3A 4LFAF 1YBUA 2XI2A 1FFWB 2ZH4A 1LWEB 2DITA 1HPZB 2KHDA 2LQ8A 1SC6A 2V2KA 3W5ZA 6FDRA 5LSRA 5ETLA 5G0RA 2HPUA 3MM9B 3MUVP 4C8NA 2DNPA 2GMJA 5SZTA 2W9AA 1BWEA 5E2QA 2VODA 2UVUA 5IV3A 1OWXA 1BHNA 2AKWB 3H40A 4KGXB 7FDRA 3N6MA 5FLXU 3D6MB 4DL4A 4DFKA 1B99A 1IBMJ 3RBEA 1MN9A 4TVAB 4UOFA 2ATLA 1SC4B 3UQSA 2XMVA 4Y2KA 3F73A 2R8IA 1X9MA 1JJCB 3HK2A 2VFSA 1PG5B 3SEOA 1FI4A 4USKA 1RTDA 2C3MA 5GAGU 2H3EB 5DETA 1X4EA 4OI6A 5A0YA 4C7QA 3MXHP 1VQ9S 3FBEA 3M2UA 4A47A 3RRGA 1MWYA 1IUJA 4OLOA 1NPRA 4ZVGA 4DV7J 3JSRA 2ZOMA 1VQNS 2GMHA 4E98A 4WIQA 1S6QA 2BE7D 2NSBA 3MM6A 2J5AA 4KHMA 3UD4P 1KBRA 5B0EA 5J2MB 2C2MB 4R0EA 4KGVB 5KFBA 1QTMA 2ZH8A 1RAJA 2G2OA 2MZQA 3R3TA 1SJRA 3I0RA 2A2CA 3FRYA 4EO6A 2DTJA 3K59A 2VB6A 5I42A 1DY3A 3BREA 1B7YB 3EX7B 3SI8A 2FVPA 2DD8S 1N4LA 1NZAA 1NSKL 1HD1A 3OJSA 3ISZA 4OX6A 3DM2A 3FNNA 1P1TA 3RW7A 5HSPA 2MQMA 3PM9A 1IKWA 1PBAA 1EHWA 2P9CA 3BPSP 3GQCA 4O3QA 3P8BB 1HNZJ 2FHOB 4B3MJ 4YUDA 3I82A 3LWLA 1X5TA 1MWZA 2GHVC 3OTDA 3J80U 2DY9A 2KFNA 3GCXP 3PEJA 2HHQA 4LF8F 1RP5A 3TA1A 4NXMJ 1M5KC 4RUBA 5D3GB 2XWYA 3OQ2A 2YQ1A 4PR6A 4B3SF 4JI3J 3U02A 2DT9A 1TUGB 2IHR1 5IQQA 5J2NB 1VQ4S 2EXUA 4OX9F 4AFFA 3RBDA 1CLFA 1V9OA 3I32A 4F0KA 4X4SA 4F0MA 4ECXA 4TLRA 3NS5A 4H4MB 3HT3A 1JLFB 2F3JA 2HMIA 1RWXB 1DQAA 2JC0A 4B3MF 4QZVB 1HFEL 1W26A 4PCQA 2ZM6F 2CQIA 4DPYA 2LEBA 5LXRA 2GX8A 2VKRA 2YWGA 3G6XA 4WYWA 2BKPA 1AUSL 2YKOA 2DGQA 3CMQA 3MM7A 3U1MA 3MEKA 3OLAA 3TX8A 3BR8A 2R7VA 5IV4A 4ELTA 1R0AB 2X1FA 3H5XA 4BWJA 4NRTA 5J2QB 2O5DA 4HDGA 4HI2A 3MFHA 1NK8A 2G4BA 3CCZA 3DGPB 1FT8A 1X4DA 2HRUA 2IM2A 3UR3C 1IR1A 4TN2A 3M32B 4NA1A 2Q1LA 4WXOA 2RJZA 4ELVA 4FYWB 1TP7A 3ZTQA 3WQPA 2ZD1A 3IR6B 3MZIA 3ZC4A 1N33J 3M6UA 2R4FA 3UN5A 3PW5A 4IG0A 4CO2A 4DXLA 2F8HA 3GILA 1EIYB 2VG7A 4DX5A 3A3PB 3CCUS 3QJJA 1S49A 5CH7B 3MAQA 2JLFA 2PD1A 5LSLA 4WP9A 1TK8A 3DLHA 3I5CA 3W5YA 1WDTA 4HEA9 4ZCLA 2X1BA 2XZWA 5C24B 3IXQA 2DBBA 5KFPA 1L3VA 2DGXA 1WHVA 3N4WA 1G1XA 1SQFA 2CQGA 3QQCD 3NMRA 5L8RC 2CJYB 2CJBA 3CIZA 4DOZA 1IBKF 1VQSA 3T6BA 2HBRB 2MQLA 1U2RA 2COLA 3OL8A 4LSNB 3M2RA 5THWA 2VQEF 3GWCA 5KG7A 3JQKA 2GGPA 3DXSX 4CRJA 4ZMMA 1MU2B 1RCOB 4ZVTB 2CPIA 2F4FA 1LW2A 2KM8C 2ZOFA 3BF4A 5DS7A 3TWZA 2RHQB 3ENQA 3KLIA 4IO9Q 4DFJA 1TK5A 4GVBB 3V4IB 4YB6A 1C0UB 2BE2B 3H59A 3K89A 2AEMA 3LH2S 4H54A 4R5PB 3VALA 3SDEA 2B51A 1C0UA 2BE2A 4P2SA 2J0XA 4CNZA 3SZ2A 4Q8FA 4UY85 3DI6B 2AJ0A 3BBCA 1N52B 1FNMA 5DO2A 4AL6A 4Z7YA 2LU2A 1JNZB 2F65A 2OPQB 2V4JA 4O4GB 4DCOB 4F4AA 3JSMB 3W9HA 4F50A 3UD5A 3T1YF 3CC4S 5L38A 3GZ7A 3HJVA 1WD6A 3MAAA 3C3LA 4QJVA 2W8LA 2V8GA 4ED0A 1YBTA 3DU6A 3PRDA 4NX9A 2J9CA 5L1JA 1UFKA 2QIFA 3ENVA 1DTTA 3R97A 1GXLA 3CGIA 3HI9A 5KFRA 3ZTPA 5EDWA 3DOMB 2ZBIA 5H9FJ 5B0FA 4PXEA 1S59A 1BLUA 2VFVA 5KT2A 2LECA 2ZZTA 2RAQA 3MWBA 3DLEB 3VZHA 4ALZA 4ID8A 4X4PA 4KYZA 2J0QD 3MOJB 4PWDB 1YJ7A 3TQ1A 4I4BA 2RQCA 2XO6A 1Q8KA 2V50A 3NOGA 2YNFB 2GVDA 1U2FA 3QPIA 2IBOA 1AW0A 3PKYA 2OIHA 4I56A 4KR0B 2UZAA 1ZM9A 4J7CA 4DHVA 2AYGA 4QWCA 1WDDA 2IDLA 3AB4B 4K4VA 1KLMA 1QUPA 4ES2A 4JI1J 1SH3A 4KBIA 3WBZA 2V9WA 3HFZB 2YPYA 1SIWB 2D3ZA 4YOEA 3A8JA 2VUGA 2IRUA 2XBPA 3AJ2A 4OZJA 1RAHB 3VAMA 2FVQA 1UW9A 3LPEA 1TMJA 4K4WA 5A0YB 1ZZFA 3H4DA 1QLNA 4LBPA 1YK9A 4IRDA 3Q8YA 2DH8A 3GG0A 4K4YA 1KDNA 2NXJA 1VHFA 4KPCA 2DKOB 2BRKA 3IR5B 1M0SA 1PYSB 1GMUA 2KYZA 4ILRA 2F63A 1RABB 4ZPCA 4ZVRB 1N5VA 5A8WA 2QZ8A 5DDOC 3RB3A 4QYZJ 2MLZA 2BE9B 2UXBJ 2LYVA 2KVQE 1Q0NA 4MK9A 2NUHA 4DR1J 1H2TZ 3Q86A 1HR0F 5KOXA 4Y34A 4RW9B 2EEYA 2D9OA 4OFZA 1MMLA 1HWLA 2QG9B 3JSMA 4K50A 3UI3A 2LKZA 3ZTRA 3JAMY 3EDRB 1MROA 5KFXA 2HS0A 4ED4A 3J7YI 2C22A 2UXCJ 2ZUGA 3MMJA 4LF4J 4CM0A 1U09A 2R9LA 1IJEB 5JUMA 2OD6A 2U1AA 3ICLA 2ZE2A 3R7BB 3JSYA 2R8HA 1NPKA 3W9IA 1TUWA 1QAYA 2Z8QA 4CLUA 4YB1P 2CADA 5GAHU 1KQSR 5K14B 4KKOA 5HROA 5I3UB 5EX3A 1MG7A 5AE1A 4LRCA 4KGZB 1Y4ZB 6AT1B 2FY1A 2VL1A 1FE0A 1IR0A 1PBUA 3PJXA 1X4CA 2FD2A 2B6AA 3PW4A 2ROPA 4B9LA 4JI5J 2BRLA 3M2RB 1CQNA 1LFWA 1LOUA 2JRSA 3CJ2A 4WE1B 5ETNA 5J1NA 2WOMB 3QBCA 4C48A 1ELOA 2W2PP 3SIPB 2H4YB 1RI7A 4UUWA 1EARA 3CXCR 1VBZA 2KB2A 5FD1A 3J7AN 1U8SA 1HMVA 1F2HA 1MLAA 2FZGB 3HHLC 3I6PA 4M8LA 5D0HA 5IM0B 2MHEA 2H4WB 1BE4A 4KGKA 1HR0J 5GAEI 2PDAA 3BN4A 5K9FA 4F25A 1Y5NB 4ILLA 4M5NA 2DO0A 3PYEA 2BMBA 4YFUA 3D6FB 2FJXA 1O51A 3Q8QB 4ER8A 1F5AA 3M9MB 4MKBA 3TA2A 5RUBA 2JL9A 4OZ5A 1NDCA 2RKIA 4OYPA 5ETVA 2R7WA 4LFCF 1WSVA 2IY5B 2MKIA 3QO9A 1B0PA 1Q7YT 3LQVA 3MD1A 3UCGA 5IT9Y 1T02A 1W7WA 4USUA 1RHMB 1TR0A 1TKXA 2Y8WA 4LSLA 4DL7A 4BCAA 4KHPJ 2OPPB 1WG4A 4HDHA 3HSZA 1RT6B 2XCPA 4DL5A 1S0NA 1Y3JA 5DDRC 1UP1A 2YNHB 4I1TA 1U1MA 5A8KB 3FSXA 4NCGB 1IVZA 2OO4A 5KFSA 1VRQC 2HQDA 4NL5A 3POTB 4NLDA 3L7OA 1WEYA 3L9ZA 4L73A 3ZZTA 5I4MA 3KK2B 4J9RA 3D4JA 5KT6A 3K5OA 3MEEB 2HVZA 3VGTA 2XYHB 3W65A 4O0IA 2K06A 3Q83A 4IDKB 4IH5A 4JV5F 4EYIB 2QN6B 3T9NA 1U24A 4RBVA 2QRRA 1VC6A 3BB5A 1S57A 4QYRA 2OD4A 5DG9A 3RTVA 1JLQA 1NHKL 2F5GA 3K8VA 3MPDA 2KT2A 3HHDA 1HQUB 5B0GA 3CC7S 2H5IB 3GIKA 4JYAJ 4ZP7A 1PJ6A 4IKAA 4UOGA 2WTFA 2B4OA 4KT0C 3FVYA 3GJSB 5KFMA 4ED7A 2OKQA 1RTHA 1C0TB 2EFGA 4OI3A 4DL0C 1BD6A 5IT4A 2R8KA 1ZETA 4B08A 1RBAA 4F8RA 2VONA 1FRHA 4DPXA 1FHTA 1X5SA 2SXLA 2DRDA 2ZH1A 5J2NA 2VZ9A 3TR5A 4EWTA 3EZ5A 1WF1A 1WG1A 2ZITA 4UW2A 2LDYA 2Z2YB 1CJKB 3S01A 2JNJA 1NJZA 2Z58B 8RUCA 5K8OA 3G6ES 2P9EA 3JTNA 2BQRA 1HIYA 1B0TA 2L48A 1JLBA 2YY3A 4H4OB 4DCPB 1TL1A 1ZM3A 3AA9A 4K4TA 4DFMA 2DPJA 1NNDA 3KJNB 2PA3A 4LREA 1YX2A 1U1KA 1H2UX 4FS1A 3AAWB 2C3YA 4Y65A 1Q1KA 2OELA 2LCWA 4NLGA 1CS4A 3TJ9A 1PYOB 2CG8A 4WFBQ 4F4ZA 4A8FA 1FKPA 2ZC4A 1A9NB 1FWPA 1TAQA 3QGGA 3EVWA 2W9CA 3KWMA 3U7JA 1GMVA 3D7SB 3C8YA 2AGPA 2XS5A 3VCDA 1MMNA 4X4RA 3MECA 2MQQA 2G0CA 3W64A 1RAOA 3F44A 4CO0A 3NEKA 4ECRA 2AYEA 1IQZA 1D09B 4NCBA 1NM2A 3B6BA 2NZ4A 3SCLE 2XMKA 5IZHA 2P2CB 1IWGA 4Q43A 4DX7A 4PWDA 5E3RA 1ZAVA 1TV6B 4OI1A 1S6PA 4C8LA 1VDHA 2FDNA 5IXUA 1FO1A 2RHSB 3KLEA 3M9OB 3CDAA 4O44B 1NK7A 2MKYA 3R5DA 5CXTA 1RWOB 3GP9A 4DV5F 2HFOA 4LQ9A 3TZYA 2RDJA 1S97A 4P7TA 1EKSA 2N7CA 1G3OA 1H3DA 2KN4A 4J9VA 4QBUA 2M7SA 5HBMA 4RU9A 2UUBJ 2Y8YA 3HVTA 4UOCA 4Y00A 3VR1A 2RUGA 2HURA 3P96A 4OX8A 3UN2A 3NBPA 5DZ6A 3UO0A 1AFIA 1AROP 1X4BA 5L9NA 1A6LA 2HNZA 3CMAS 4ILMA 1U8WA 4PQUA 2AWZA 2IC3B 4RUAA 3Q22A 3QSYB 1T03A 1PO6A 2MB0B 4DUYJ 1WKJA 1BQXA 3GMGA 2XY6A 2CAJA 1GQEA 1HWJA 3PXGa 4TU7A 3AD7C 5HLFA 3FBFA 1SKWA 4P74A 3VQSA 4RNHA 4DS4A 2BANA 1XR7A 1ZA2B 2MJUA 2A0FB 2HBZB 3MTJA 4ZJLA 2KO1A 5HP1B 1IBLJ 1RU1A 2W24A 1MNEA 1FRIA 1MU2A 5IQ6A 5CD4H 3Q2SC 4DBQA 4WFZA 2HHHJ 3NP5A 1FRKA 4LSNA 4O3SA 5AXKA 5CYQB 3Q2TC 1Y10A 4I7FB 4G1QB 3CCRS 4G6VB 1RB0A 2F4VJ 3WC0A 2ZFHA 4DQIA 3POTA 2W4DA 3M2VB 1HA1A 3M30B 3NGUA 4NEYA 5D0RA 1LNQA 3UDLA 3KLGB 3P49B 4RX6A 4JI7F 5DGAA 3FK4A 1YJTA 2WAQD 3TAMA 4KFBA 4NYPA 1AUDA 1BMQB 1ZOTA 3LOUA 2R7QA 1KTQA 3AOCA 1EB0A 2PMHA 3IS9A 4WJBA 1J5EJ 2FC8A 3TZZA 1R8BA 1RSCA 2FLOA 2HFZA 2VG7B 1VIXA 3M8QA 4YR2A 2Y1JA 1XMOF 3HHLD 2X51A 3R8YA 4YQWA 1N8RT 3SSRA 4WFAQ 1AYEA 3H7HB 2ROGA 1QDUB 4P2MA 5GAHI 3RB4A 1XQIA 5SUHA 3MPVA 4KSEB 2E1MC 4LR7A 3UW1A 1BQMB 3V81A 1Q82T 4KH0B 3GB0A 5IT0A 4DR7F 1UWBB 2R42A 5K20B 4JV1A 4ED8A 2OTLS 1S6OA 2CNKB 3KMQA 4NLOA 2RRBA 3D6HB 4JI8F 2CQHA 1HYSA 2VG5A 1HBOB 1Q16B 3P45B 3GYGA 3HHEA 4TY8A 5JXSA 5LSOA 2WHOA 1HNXF 2BACA 2ACYA 4DSLA 4LF1A 3IM8A 1N5YB 4LFBJ 5BYRA 3G82A 1KVJA 3RZAA 2M8HA 5K8NA 5D4LA 2LP4A 1KOOA 3CNQP 3BN7A 1UZDA 4DV1F 2DNHA 2DNZA 1GXTA 2CPFA 2CXEA 4D3HA 1S9EB 4X65J 1NKCA 3HVWA 2IVFB 2ZZNA 2UVVA 3D28A 1HI0P 1HW8A 4USHA 3HHLB 4FPIA 2IC3A 5FJ4A 3A3OB 3TJAA 2K1RB 1VQYA 1UJ6A 3EXCX 1JXLA 2QGFB 1RAIB 2MY7A 2ZOGA 3FEYB 3C6TB 4XDDA 2BR0A 2CWKA 2DNMA 1JJ4A 2L08A 2X7IA 2D74B 1S1TB 5D4OA 3N0VA 3T19A 1O6XA 4NYZA 4RW4B 3UNGC 2E29A 5ETSA 4LF4F 2Z57B 4DX6A 4MIWA 2YH0A 4CLZA 2DCUB 3JQMA 3DM2B 1TV6A 4CLWA 3I96A 3NOCA 4JBCA 1ZZNA 1QSLA 1TL7B 4M1KA 3H98A 4CLLA 2NXCA 4MKYA 3JAMU 3DLGB 3CCJS 1ZH5A 1IR2A 2AHOB 3UVJA 4DSKA 4FKXA 3QJLA 4DR6J 1BQMA 2V2ZA 3V81B 3OTOJ 4DR2F 1GX6A 1S5ZA 2FVRA 2RT3A 3KJVB 1FD2A 1KLMB 2DNYA 3UDEA 4LF2A 1FDAA 4NLWA 2YXLA 3DRSB 4AXIA 1GMWA 3MMBB 3ZNJ1 1IXKA 2J9DA 4DUZF 3O8WA 1X9SA 2VJVA 2BX6A 2XY5A 3TI0A 2V68A 2CQDA 4GKJF 5E3PA 3PW7A 1XNRJ 2FIUA 3ULHA 2DY1A 1NH8A 3E51A 3H8YA 1I1GA 4OQJA 4AUKA 5F9NA 4TU9A 1F6TA 2BQUA 1NJXA 4N56A 2GFFA 2HBQB 4LR9A 4DQSA 4ZVOB 2FLPA 1IKYB 3MR3A 4M5KA 3TUZC 1U4BA 2CNOB 5HQLA 4JOUA 4DUZJ 3E01B 1HQEB 4TQRA 4KO0B 2J0SD 3SCKE 3CDUA 1RT7A 3BM7A 4XK8C 1ZTTA 3M7VA 2QMUB 3GV5B 2R7OA 4FS2A 2HBYB 3OL7A 1YTYA 4JI7J 3T1HJ 3KG1A 4Q44A 1SL2A 1HPZA 2HS3A 5HP1A 3MM5B 3P4UB 3HLUA 3QNWB 3H4BA 1QAXA 2CDQA 2D41A 3TZWA 4JI8J 2DRAA 1T95A 3C6UB 3PW0A 1Z2ZA 2ZH9A 1HBNB 1OMSA 2D3O1 1F9FA 3T6JA 2W8KA 1IBMF 4USMA 3J7Z5 2M52A 3GE9A 2YKNB 3N9UC 2R7SA 1VHIA 2CQ4A 2GAGC 2IAJA 2WONA 3PG9A 4Z37A 4GKKJ 2A1BA 3KLIB 3T5HA 3DRYA 4USVA 5FDLB 3M8ZA 1TMMA 1DRZA 1VQ5S 5B0AA 4LF6J 3N5BA 3RYLA 1LKZA 5DGBA 4M5JA 2M8DB 2GVZB 2KHCA 2ZNYA 4CO1A 1XN9A 4DUYF 4YDXA 2PIIA 1NMEB 1OS5A 4X62J 1NU4A 1S0MA 3OL9A 1T9TA 2AZ1A 2VKZG 4WTOB 2AIRB 3W61A 1NKEA 1T0TV 3D0HE 3KJFB 4NZ7A 3W66A 5JMNA 2WZ1A 1TUVA 2J7UA 4J90A 2Y9HA 2VPZB 2VBYA 3TO8A 4OLPA 2BM0A 1U25A 4GVLA 5HMYA 4EUVA 4CCHA 2XB2D 3QGHA 3EVOA 4NOHA 1SBRA 3FMBA 3FZBA 3OFEA 5HK4A 5HJYA 3I56S 1VJWA 2VQFJ 3CCWA 1LWCB 2L9WA 1RQ0A 4LF9F 1N54B 2JVOA 2EFQA 3QGIA 1TQLA 3WIVA 1VGYA 3G8SA 4U8YA 3CC2S 5KFWA 3DLJA 4ELUA 5DM7Q 2Z2MA 3IMQJ 3LP1B 3GR1A 2B9WA 1LWFA 3QSIA 4C97A 3NGDA 5BXIA 2PMWA 3GTYX 2JSXA 2QT7A 3K7RA 5IOLA 2H54B 4IH7A 4ES3A 1WI6A 2RNEA 4I6YA 1KKHA 5K14A 2KXFA 4WCEQ 2J8AA 2XO7A 1R0AA 1K0VA 3AB2B 3QRQA 2E5GA 2X1GA 2H48B 1WC3A 3EUNA 1ZAXA 3MM7B 2CPYA 5FIIA 2VFUA 4EGLA 5LJ3Y 2EK6A 1TKTA 4RR5A 2B7BB 1H72C 3IP0A 3T41A 4J9NA 3CULA 3FUYA 1N32J 1RYRA 2CJAA 3D66A 1NUEA 1OPZA 2YX4A 3MM5A 3UCUP 3QT6A 3QIPA 2QYGA 3AODA 4MH8A 3KLFB 2HQIA 1WOOA 1RT5A 3LANA 4F4YA 1FKOB 4X4VA 1XR6A 3FCHA 2FJBB 5HQ8A 4JI4J 4NLYA 2XSJA 1UJ5A 3QIPB 4C0BA 2ZHBA 4ECYA 5GAGI 2YVSA 4TLQA 4ZPWR 2DIUA 5IWAF 4RUHA 2Q79A 4RW7B 3Q8VA 1FERA 3MR5A 5KAKA 2KFZA 1URRA 2CVEA 3K5NA 1RKJA 3THPA 2CQ3A 1CSJA 3T1HF 1SL1A 4PXCA 3TEHB 4EZ9A 1TVRA 4IOCQ 4BC7A 2HLTA 3IWXA 3JXOA 1D3WA 2EG1A 4D3GA 5C42B 5T41A 5HL7Q 1K73T 1VRTB 3H90A 2ERRA 3DNCA 1R6VA 2OSQA 1JXEA 5ADZA 3NNCA 3DCAA 4M5DB 1JKHA 4OYMA 4F3MA 3FCWA 2OPPA 1S1VB 4C8MA 3VF0B 3D3BJ 3KJVA 3L09A 1X5OA 1RYSA 1PILA 2APOA 2FHMA 1VR6A 3W2VB 4ITSA 2MKJA 3OR1A 3PW2A 2D69A 2ATCB 1B64A 4QU6A 1SVDA 1HW9A 3SBMA 1JLAA 2C1EB 3KLHA 1ZM2A 4EEYA 1NH7A 2NUUG 1HWIA 1KP6A 3T5LA 3BQ1A 5CZVA 2I1RA 4YB7A 1FEEA 2ILYA 5E33A 4R8UB 2WCXA 3MHYA 3QYYA 3BBFA 1Q7LB 2CG4A 4A46A 1WHWA 1Y3KA 3M2UB 4CNYA 4N5SA 3SFGA 4V19X 5CHCB 3W2WB 4KV8A 3K5MA 4K4UA 1VK8A 1R6YA 1RT4A 2B8QA 2RQKA 2YNIA 3ILLA 3LW5C 4RNNA 4DR4J 4LVOP 2V4JB 3PCOB 2QTWA 5GVQA 3HSJA 2EKNA 4OHVA 1ZYQA 4TY9A 4KKOB 4LSZB 4MMOA 4QWBA 4YEAA 5HROB 4A8YA 2HGMA 1RT2B 2EBGA 3GFZA 3H5SA 1M1GA 3JYTB 4X4NA 1RU2A 2K7KA 1HNWF 4RL1A 4NLXA 4HLBA 2BYCA 3KJQB 3LPYA 5ETMA 1EQMA 5LL6d 4EU0A 2MQOA 2P6TA 4LF5J 3C6UA 4O23A 5F3ZA 3DRPB 2EPIA 2ZZMA 1B3TA 1KEKA 1S1UA 4KHPF 2I8EA 3UPFA 4Q0BA 4OZ2A 3M05A 4ZVHA 3V6JA 5B0BA 1B70B 1RUSA 2AJ2A 1REVA 2DNLA 2MDAA 2NYIA 1FFSB 3DC2A 3FBCA 2DR9A 1GTHA 1JLEA 2YNIB 5KFCA 3R6GB 4YS2A 2ZDPA 1P6TA 3R5JB 2ASJA 1N0UA 4FNHA 2BV3A 3AXKA 1S7IA 2VFTA 3SSSA 2BA9A 4ZCMA 2IA6A 4KE5A 1C2PA 3EMTA 1HNVB 3RG6A 2FYXA 2XMJA 4RWWA 5L46A 3FRZA 2B7CB 4RZRA 3C14B 4NA3A 4M5IA 5HATA 1UTAA 1YIJS 1TFWA 4B3OB 1S76D 2YPZA 4O3NA 3VAGA 2RS2A 3CWJA 4DLGA 2J6UA 2HHXA 2V67A 2C2DA 3AJDA 2KZMA 2FGOA 4B3TJ 3CCTA 4RNMA 2AT1B 1R8HA 2QFIA 3BSOA 3AA8A 4NI2A 4X4TA 1OQ6A 4EZ6A 3VVUA 5A8RB 4DV5J 1YKWA 5DG8A 2FHJD 3BYPA 4PQAA 1U1OA 5C2CA 3NGKA 2AF6A 2OFHX 2FGCA 2RE1A 4HL9A 3M6VA 1UA0A 3NWRA 4GO5X 3CJKA 5BR8F 1HKAA 4IR1A 1ZPVA 4I7FA 5J1PA 2FTRA 4ICLA 4HYKA 1J5EF 2HRYA 4DJBA 4W90B 4PG8A 1QE1B 3MD3A 1E6YB 1EP4B 4CLTA 1UAWA 5HO4A 1QAJA 1SJ3P 2I2YA 3CDEA 2FJDB 1RTIB 4W4MA 3NGSA 1R0BG 1Q5VA 3EGNA 4PAAA 2JHEA 1EQ0A 4A4JA 4ETXA 5LJ5Y 1FA0A 2KI2A 2Y1IA 2RRNA 1B0VA 4RJVA 4OZNA 2Y1LB 1T05A 2B5JB 2XG8A 2HAFA 1FKAF 4CP5A 3HD2A 3KHGA 3O44A 2W2OP 5MAOA 3BGRA 3KYLA 2UUBF 2VPWB 2RUSA 2HWTA 1M90T 3MF5A 1S9GB 2RDIA 2WBRA 3H5UA 1T7PA 3PHEA 1EKRA 1KC8T 1XMBA 4J9SA 2E5LF 4DMZA 4YP3A 2AJFE 4UUXA 4R5PA 3H2UB 1S9EA 2FHJA 2DIVA 3KXDA 3RAMA 2WW4A 4BBYA 3NNHA 2HGLA 5F0WA 3HHNB 3K5LA 4DR3J 2OLWA 4CH1A 3B54A 3ILIA 1RT1A 2HHVA 4ZLPA 4WKYA 1L3UA 4B02A 2GCFA 1VRUA 4CIOA 1FXDA 3R5CA 3ADAC 3BQ0A 1LXNA 4K5SA 1NBEB 2G1HA 5KFJA 1C1CA 1UVJA 2V69A 5B08A 2KXHA 2VG5B 3BZQA 3A12A 3TUJC 4MKAA 5KFQA 3PJ9A 4LUBA 3OUYA 4HVZA 1JLCB 3H5YA 1RTJB 5DDPC 5DLGA 4AT1B 2LU1A 2OUGA 3MDFA 4FF2A 4JV5J 3K58A 1CQMA 3MGJA 4X62F 1IKVB 4N41A 3AQOA 1YZ7A 4P73A 3JS9A 4UTGA 4CQ1A 2C2RA 5KFYA 3OVAA 2HVEA 2E44A 3MPUB 4FP9A 1FJCA 1LEOA 3PYFA 3SFUA 4B9VA 1YRTA 2CJKA 4IG0B 3PDNA 1Q79A 2I5JB 4RW6A 1X4HA 4NLRA 4DEZA 2NREA 1F5BA 1U1RA 1XJWB 1JQGA 3IS9B 1P8GA 2BBEA 2V34A 4JUZA 1FDBA 2NSCA 2DB1A 2O01C 3Q8UA 4H4KC 1HNVA 1VISA 3HX9A 3O2IA 3ZZOA 2RU9A 3MEGB 5T7LA 4M5MA 3TEGA 1CJKA 1RXOB 1GT8A 4WU3A 1N5QA 2FVCA 5AXNA 4FVCA 1WF0A 3NKYA 2XM3A 4DSIA 2VOOA 3R2DJ 1R8CA 3GJQB 3UFCX 3F0NA 2YWEA 1F9HA 2DNOA 4AE5A 1NPPA 3HZEA 3QT5A 4DZDA 1J5OA 2JFKA 2DEIA 2OEKA 2CPXA 2ZBQA 2ZDOA 2R2SA 2BABA 4DR4F 4ANDA 2PEBA 1YG0A 1REVB 5AXLA 3G6VA 2AV5A 2WRMA 4K59A 5EWGA 3O1LA 4K5RA 2CQ2A 1RHUB 3TVZA 4U96A 2X1AA 2YWFA 4P71A 4C8ZA 4LMZA 1R0CB 2JZ5A 1VOMA 4NLTA 2ZH6A 1D9AA 3RRHA 3G96A 2Q66A 4TYBA 3FCVA 5ETKA 2JH3A 3UWTA 1YJRA 2ZKTA 1GNKA 1XEZA 4K2XA 1GMWD 5KFKA 4F67A 2ASDA 1TL3A 3NCQA 4LF5F 4ZK7M 3BO3A 3RU0A 2XI3A 3CW2C 1KHWA 3M8WA 2Z30B 3OW2R 3UDCA 4A8XA 3TARA 3CD6S 1SUQB 3C19A 3FBBA 3LTOA 5A2QU 1RWNB 2WW8A 5HBMB 3LWMA 3C2PA 2MKKA 4BLGA 2YH1A 4DR6F 1OO0B 2G0IA 1YJ9S 2JJ4D 3Q8PB 3W60A 4X66F 2QSWA 2XZDB 4OYAA 4P6QA 5E7OB 1RHQB 1YGYA 4M5LA 2L9NA 3BS9A 2XYGB 2GC8A 4J9QA 2IM3A 3MMBA 3BYRA 4G65A 2EFVA 1OYEA 1S9FA 1C1BA 2E1CA 1PKUA 1EJ7L 4N47A 3PYDA 1CEZA 2GJ2A 4ZPDA 4OI0A 1XIQA 2GHWA 2KJVA 2VC0A 1I3OB 3IG1A 3CIMA 3HFKA 3KUGA 3N5FA 2BW2A 3R7SB 5AE3A 2N4DA 1P9YA 2C2NA 3C16B 5JJBA 3C15B 4WP3A 3P3DA 5I42B 1YI2S 4X4UA 2YBVA 4ECSA 1Q95G 2YWHA 2EKYA 4RUCA 3J81Y 2PI5A 3GR0A 1TAUA 1RWPB 1NDPA 5GMEA 1DTQA 4ZPVR 2W9CB 3OPKA 3B8HA 2J7WA 4ZVPB 3ENAA 4C3KA 4F36A 3MM6B 2JEGA 1V5VA 2Y3YA 2HK2A 2UU9F 3OVBA 1VK3A 3J81U 3B4DA 4DPTA 2EVZA 4DG1B 4CTAA 3CJSA 3J7ZT 5I3UA 4RW4A 4GC6A 4I6AA 4ECTA 4FBTA 3OR2B 3VGUA 2V2VA 2CZ4A 2CZ9A 5E3QA 1GXUA 2UXDJ 2AP6A 4FYDA 3A13A 5KT4A 3V5RA 2VD3A 3FFIB 3U27A 5D6GA 3CCMS 1Q5YA 3DRXA 4NLQA 1RA7A 5KFZA 1WEXA 1Y7PA 1MROB 3WZ0A 2AQ4A 3DHWC 4ZLLA 2J8SA 1YRUA 3ITHB 2F40A 3FGVA 1FCAA 4A8SA 3BGRB 2VIHA 5CYMB 2GW8A 3HHKA 1T05B 1C0TA 1M1HA 4DPUA 2ILZA 5EWEA 1SCJB 1VC0A 3HKZD 4ETZA 3KLFA 2Z4PA 1NK0A 1KQKA 2GJFA 2OPSB 3LGMA 1M5SA 4KY3A 4P72A 1YBAA 5J2PB 2FJVA 1Z1ZA 2CQ1A 3NS6A 4N8NA 4L3KA 5KTQA 3L95X 3J7YU 1NK5A 1IBLF 1KFSA 4CO5A 4J9PA 1DQ8A 1UEVA 3DRRA 1WOSA 2GJIA 3IR7B 3BSCA 2J7KA 3CO0P 1KS2A 2ZHOA 1FNXH 1CBKA 2GQCA 2L41A 4IRKA 4ZP6A 4HI1A 2W9BB 5A6PA 1HWUA 4DR1F 4CTAB 1PJ7A 1LFPA 2XMUA 5LMUJ 4QWAA 3MCNA 3PYGA 4NCGA 2GO8A 1F5CA 1FF2A 3R6LB 3NGRA 4DSJA 1FD8A 2LLZA 1OY8A 3RB6A 2DPIA 1H73A 5E3CA 2QSFA 4X64J 1HBUA 1G6BA 4C11A 2FHKA 1VS3A 3D1HA 2XYPB 4QPXA 3EJMA 3EM1A 1ZTWA 1RWMB 4N8OA 4B3RJ 1ZS6A 3OSPA 3C15A 2KL8A 2KVIA 8AT1B 3N6LA 4UT4A 3EPGA 2QA2A 3QMQA 5ITHA 4OZLA 4QIGA 1G4CA 1N36J 1K44A 3D54A 4I64A 2XEXA 2B9YA 5A6WA 3VWSA 4DN9A 2FZCB 4OX7A 4DUTA 4WYLA 2EWHA 1VFJA 2DR6A 1GAOA 2XTJP 4CO4A 1RTJA 2Z2ZA 4P2XA 2EFNA 2VG6B 3NY0A 5CCMA 2N4CA 2CPEA 2DHXA 3AFGA 3KK1A 1HHTP 4O3RA 4IH6A 3BV8A 2WVDA 5CYQA 4CT9A 4YR3A 2DGTA 1JLEB 5KG6A 4CH0S 4ZIVA 1PGZA 2QYCA 1WC0A 4B9SA 1QSYA 4X64F 1U1NA 2DJWA 2E1RA 3JQJA 2WVEA 5IC4B 3R1HA 3CCQS 3FDSA 3ILJA 1NJWA 4XAKA 5FDLA 3MPYA 5KFAA 4U6PA 3SQGB 4CYUA 2HWHA 4X4QA 1N5YA 4RBUA 1RE1B 3KOAA 1UVIA 3DMJA 4C8KA 5KT3A 3RAQA 5FLXY 4I68A 4S0MA 1KSPA 4QU7A 2G2YA 3K5PA 4PEOA 4YHHF 3GSIA 1T03B 2KU7A 2UUAJ 4B9MA 4QYZK 1YJNS 4UZBA 1LW2B 2XMTA 2VH7A 2WB4A 3PIOQ 3NBPB 5D8HB 2DNQA 3QLHA 4K7QA 2ZH7A 2UP1A 3W8GA 5CCLA 2WK4A 3OTBA 5AE2A 2AEJA 3MEDB 3HXMA 1FJEB 3GLJA 3DOKA 3OFGA 3QWPA 2QO3A 1JJ2R 3QZ8A 2I0XA 2G1DA 2W7PA 2R8JA 4O44A 2QLBB 4USTA 5D0EA 5DJBA 2YQ0A 1IKYA 3D0IE 2CA9A 1QUVA 1Y5IB 5T7LB 3P5TL 3W5XA 1Q4RA 1S6PB 4A8WA 5M2PA 1IWAA 2NPIA 3ZZZA 2C2EA 2MEWA 1XNQF 1OYDA 4LRDA 3OHBA 3CTRA 4X65F 1C4AA 4ZJOA 2I6WA 1VQ6S 4F3QA 1NHVA 4JV2A 1VLYA 2J6SA 1UVNA 1VMBA 2LEAA 2R7TA 4Y6IA 4Q5VA 1FRMA 1NZ8A 4QPTA 2HNDA 1S1VA 1BY9A 3TNVA 4KAIA 1IKVA 2CJXB 3CVKA 2RQ4A 1CS4B 3NWGA 4O4RA 3AOBA 3GCWP 4DV3J 3I31A 3DGPA 4IG3B 2YNFA 1P1LA 2W4CA 4LFCJ 4EMDA 2C2ZB 2C3PA 5J1EA 3DOLA 4DR7J 3C14A 1UPPA 1HQ2A 3VV2B 3GFXA 4J9UE 4EI2A 3DLEA 3T9ZA 4WFYA 3KHLA 1DAXA 2CIMA 4WU2A 5ETQA 5KT7A 2JWNA 2UVRA 5EUHA 1JLGA 4WFXA 3MEDA 2DNRA 2ZEJA 5KFEA 1D8ZA 2JLGA 2JEIA 3DYAA 2O1PA 4TKTA 2AU0A 4A48A 3SV3A 1NKBA 1FRJA 1RTHB 4B3SJ 1KTVA 2O3DA 5IS2A 4DV1J 1RT5B 1ZPWX 1VBXA 1UEUA 2R7RA 1HQUA 5JVGQ 1M5OC 1TTHB 1OPIA 1CJUB 5L1IA 3HDSA 2V8PA 1B4SA 2IVMA 1R8AA 3BGUA 1R89A 1Y9OA 4LT6A 1S7HA 4XO0A 1APSA 3M1VA 2QEXS 1DHMA 4PG7A 4LFAJ 1JMTA 3DMJB 3BBBA 4GVBA 1LK7A 2YKMB 4ECZA 1PC5A 3H42A 3SQGA 4CYUB 5T14A 2GIRA 2ZUAA 4I6WA 3MOZA 3IN5A 4ECVA 2AGOA 4KRWA 3HF5A 3M9NB 2KRBA 2LFVA 3G71S 3P6YC 4LF7F 2DH7A 1IKWB 2GZOA 3RGIA 4JI2F 1E6YA 1EP4A 1PJ5A 3A4TA 3KNGA 3LUYA 4LIWA 4UQGA 2F7VA 3LP1A 4WPAA 3UNYA 2M0GB 4KV8B 4ED2A 1SJFA 1N56A 1WHXA 3ONQA 2W2MP 1AB8A 3MPWA 4M63A 1IBCB 3H2VE 1SPBP 1LWCA 4HR2A 5HVFA 1D0EA 3OT9A 3PTWA 3IWNC 3LAMA 4DV7F 5HMZA 4K4SA 2MZJA 4NLVA 1RKIA 4WWSA 5KFUA 2Z56B 2BJDA 4DF4A 4PRFA 3CJTA 1F3FA 2HFNA 2JDJA 4U7UK 1VQKS 4OYBA 1Y00A 2Q6BA 3MR7A 3G4SS 2FZKB 3OXLA 2DGVA 4DV3F 1RACB 1KVKA 5L1LA 1CJVA 1DBDA 2E7WA 2IM0A 2LEPA 3Q24A 2PO4A 3I4PA 5ETRA 1FRLA 2LVWA 2POKA 5D0GA 3BSNA 1UKUA 1KRPA 1H7XA 1XK8A 4DR5J 3WX8A 2WSFC 4FF1A 1CPZA 2HAIA 1U1QA 3QT8A 2V94A 3BO4A 4IUFA 1RAFB 1M5HA 1YJUA 4DQRA 1D8YA 3R27A 1RISA 2ZNZA 5KFDA 3DGVA 1UA1A 2V5HG 2KYXA 3T1YJ 1FTRA 2BOPA 4V1Ak 2WVFA 2YKMA 3TOQA 1NXIA 2NZCA 3TP2A 1WOPA 2YKNA 1IM6A 3MURP 1T9UA 5CABA 2JEJA 4LFBF 5K5MA 1Z2LA 4NA2A 2ALZA 1TL4A 4AQYF 2DR5A 4RW7A 1SC3B 4R0JA 2DXFA 3I5BA 1LWEA 1WHYA 2QJ3A 4Q2MA 3A8EA 1VIOA 2A18A 4ZPBA 3OTEA 4OIXA 2HMIB 2CNNB 2QL5B 3SQOP 5L39A 2CRLA 1UZHA 1PSDA 2H5JB 2H65B 4C0OC 4OX9J 2QLXA 2VICA 2NYHA 3DYAB 4DS5A 1R43A 2HLUA 3L7UA 5CYMA 2XC9A 2E9ZA 5K8PA 1BC6A 2JX2A 2YQ3A 2GV1A 3N28A 4MFBB 3ILOA 2HQCA 1FDDA 1SH0A 2IMOA 2HRTA 1RZMA 2HNZB 2XSFA 4O0NA 3SV4A 1JJHA 3SYZA 2KTQA 1RT3B 3ETMA 3H2LA 4QR1A 1SQEA 1A7GE 4YN3B 2HQGA 2XMWA 3PR4A 3W8PA 4LJMA 3MFIA 2C3OA 4YMEA 2OFGX 2E5HA 2HKEA 2BZ2A 2N7YA 2I5JA 4NMLA 2DNNA 4RW6B 3U1NA 3BQ2A 5A2QY 4ATNA 4Z2XA 4ANEA 4DZ6A 5HMXA 1T9XA 3P5BP 3KMSA 3IRWP 3L7PA 3PO5A 3UR0A 3CCSS 2IFXA 3LP0B 1VCTA 1UVMA 4U7UD 1NK9A 5ETPA 1DLOB 1H7WA 3C66A 3IA0A 2XWXA 1U0HB 4NLSA 5BR8J 3TYTA 2V4RA 1GK8A 1A0OB 1V3RA 1U0HA 2CKWA 1P27B 3C16A 2BOAA 2RS8A 1H98A 3LALA 3CJ8A 1MN7A 4J5OA 5F41A 2VQFF 1L3TA 3OSNA 2E7XA 1XMQJ 1C1CB 2MLYA 4FKYA 1FKPB 3PX4A 1HNIA 3I5AA 4LRAA 2HNYA 1ZA1B 3HSGA 3IO1A 2BJ1A 4DV6F 1U26A 1S12A 2A10A 4M95A 3QAEA 3SCJE 2DISA 1M1KT 3QRPA 3CCES 5HANA 5C42A 4F2RA 1DARA 3FC9A 3CSKA 2CUYA 3OTOF 3VAHA 2HFVA 3JB9k 2NXEA 1FWLA 2OPRB 5KFTA 2DNGA 1S0OA 2DVIA 3AH6A 4HTJA 4O3OA 4YDDB 2CZVC 3PJWA 1NHUA 2VC1A 4OYWA 4TYAA 5CA5A 3PIPQ 3DLLQ 3ET6A 1QTNB 2B4VA 2XHWA 3CD5A 3M6XA 4MYTA 3ZNUA 5GADU 1Q8IA 2YNGA 2W9BA 2XSJB 4GC7A 4L76A 1I94F 1T11A 3BGFA 2B5JA 2YKAA 4OYIA 1FKOA 1GFWB 3IGNA 3EDQB 1HBNA 2X3GA 3FJ2A 4WFNQ 1WG5A 1VI7A 3CB4A 4ENOA 4NPOA 3EWGA 1WSRA 4PABA 1CG2A 2AX1A 1AXQA 1K1SA 1EAYC 1JNRB 4W92B 2UV8A 2WVCA 3ZTSA 5D77A 3KHRA 1RK8A 1U7LA 3EE3A 3L4BC 1E6VA 1S79A 3GYXB 1JXVA 2MQ8A 1HYSB 1X60A 1UPMB 1YJWS 2H9ZA 3KUHA 4KJIA 1U6FA 3LP2B 3BH7B 3S1TA 1T9YA 2XHCA 3ZFVA 3GV7B 4DL2A 4ID5B 4CLKA 2HWIA 1OQ3A 3QZ7A 3IAS9 3FSYA 3NRBA 3S6EA 5HJXA 2AYMA 2A6MA 2OMOA 2G2ZA 2F8MA 1D9DA 4M94A 2ABYA 4DV0J 2NLWA 4OYXA 1NRKA 4PWUA 1DJ0A 4DV0F 4ZOSA 5I3QA 2K3IA 3T1AA 3QO9B 2D1CA 3I0SA 3Q89A 3U1LA 1KWMA 4J37A 2HHPA 5IT9U 4Y2MA 3PY8A 2ZD1B 5E3AA 2AD9A 1HI8A 1N34F 5F8LA 2V4QA 1UW4A 5F8HA 1TKZB 4H4KA 3W9JA 1S77D 1GH8A 4ZIWA 1T3NA 4E2FB 1UJ4A 1VQPS 4NE9C 4I69A 2VA2A 3C46A 3LP2A 2MZSA 1K0TA 1KLNA 5KG2A 3M2VA 3N6NA 3CUNA 3JSBA 3RB0A 2HGNA 4Y2CA 1WC1A 3HVRA 2PT0A 2WSCC 2Y0SD 1TL7A 1E6VB 4AXJA 4RNOA 4DL6A 4DL3A 2OP5A 4LRFA 4DQPA 2PA8D 4BC9A 4UY8T 4XTTA 1XMOJ 1FXLA 2PEHA 4FXDA 1X9WA 1RT1B 2HZAA 1Q53A 5AJ3J 3ETOA 4KGMA 5HVHA 2R2RA 2R2TA 1XNQJ 4WBFA 2WONB 1U48A 3BDPA 1R8PA 4JI5F 5F9LA 1WTBA 3C6TA 4ED5A 2KZZA 1YQHA 5KOWA 3PV8A 3G8TA 2E66A 4DF8A 1R27B 2M3DA 1CJUA 2DGWA 2YNGB 3D9BA 1CC8A 2V9KA 3CEDA 4HH1A 4M5GA 4P7VA 5EHHA 3DU5A 2IJNA 4KPYA 3G9CA 1IN0A 3RR7A 3FFIA 3EGVA 4PYAA 2YWKA 4DV2J 4AL7A 3T5KA 4U9RA 4DFPA 4TQSA 2OSRA 4OI2A 2JFDA 4L72B 2IMWP 3CE8A 2IRYA 1JLGB 2CPDA 4HACA 1H2VZ 5ETOA 4IYQA 4R8UA 4B9TA 2PFDA 4A8OA 1KOHA 1J27A 1ICEB 3DDNA 4NXNJ 1HNIB 3W62A 3RR8A 4K8RA 2N3OA 3OBIA 4R25A 3MCSA 2YKQA 1DTQB 4L74A 1P9QC 5B09A 4LBHA 1WUUA 2HZVA 4K4ZA 2VHGA 4K0KJ 3R2CJ 1U49A 2GQQA 4A8QA 4ZP9A 1QSSA 4ECUA 4CDIA 1DLOA 1RBLA 2V2QA 3DRSA 4RW8B 2IRXA 3E8OA 4ZPTR 3CCLS 4DU7A 5CD4A 3TRGA 5BJRA 2F9DA 2F4VF 3HZGA 4CI0B 2ADBA 3KDOA 3BKUA 1Q81T 3JTPA 2MXYA 2E9TA 3GPAA 2EC2A
chains in the Genus database with same CATH topology
2KG1A 4QCLA 3AQPA 1FK9B 2V0NA 4B3OA 3HMJG 3DXBA 4JI0F 3KK3B 1O5JA 1Y5LB 4KFBB 3PKMA 4K4XA 2OTJS 3R5BA 4B3RF 2E5IA 1FNOA 3GYNA 1G2EA 3O3LA 4E8UA 4MFBA 4YR0A 2K8GA 3CPWR 4DWIA 4K0KF 2PMZD 4PXBA 1T94A 4HKQA 4BWMA 1FESA 3HO1A 1MMDA 4MK7A 3SXLA 2DCLA 3EXYA 3EGWB 4C98A 3BO2A 2YX1A 3M8PB 2DHAA 2OPQA 4O4GA 1F2GA 3QIDA 1WNEA 3CO9A 2BANB 3DRPA 4HHJA 3HJFA 5KFLA 2JC1A 2ADCA 3SDEB 3M6WA 1WELA 1J5OB 4WIIA 1M5VC 4KTQA 3OR2A 4Y0FA 5KFOA 3OFFA 1WWHA 2CQBA 2E1AA 1WF2A 2D7SA 1URNA 5A8KA 1T8EA 2RMLA 2M4MA 3CD0A 4PUOA 2LXFA 1RT6A 1LWFB 2EG2A 3JTOA 4PG6A 4TY8B 2JLEA 3CD7A 1JWWA 2VG6A 2ZJQQ 1TL5A 2FJWA 2MQNA 2Z0GA 4EBDA 2HHSA 2UXDF 2FLLA 4WZMA 1VQLS 4JI3F 2IYIA 3A1YG 2PFFB 2IJFA 2LA6A 2MZRA 3GFHA 3SCIE 1K8AT 5KG0A 1KVIA 1KQFB 4LF6F 4HTIA 4TU8A 3MECB 3M8QB 3W2VA 2NS1B 5B0DA 5DG7A 1D9FA 1KQGB 2VFRA 2KDOA 3IWLA 1HBMA 1QAIA 4M5DA 1UVKA 1TFYA 3US5A 3D0GE 2IM1A 1TL3B 2O66A 4XPEA 4E0DA 2MZTA 3M4XA 1RDRA 2DR7A 1UFLA 2MYFA 3IRXB 2H5EA 2ZHAA 1S4FA 2FPHX 1KONA 4G1PA 1JIHA 1L3SA 3KTQA 3OXGA 4QIEA 3PRBA 1GTEA 4IQMA 2WSEC 2VBXA 5DLFA 1YSJA 2OPSA 2XNQA 3PFEA 2GMLA 4DR5F 1WACA 4MAKA 4X84A 1NK4A 1VQ7S 1GX5A 3Q23A 2XS2A 5F8MA 2PI4A 4WK3A 3PFOA 5E41A 1S6UA 3G86A 1X4AA 2CVIA 2HIQA 3Q8RB 1JLQB 4C3MA 1FXRA 4F02A 3GIMA 4CH7A 2DK2A 1K1QA 1LW0B 3G8QA 4URSA 4ZPAA 2MKCA 2RB7A 3KLVA 2DH9A 1S0VA 3MM8B 4CO3A 4ECQA 1X4GA 4KHRA 2PE8A 1C4CA 2WB1D 4OJHA 2UUAF 5F8NA 4EO8A 4X4OA 2GQ2A 3IC1A 1Q8LA 3ENWA 2M5YA 1DURA 4I2QA 2B9XA 1U6BA 3CF5Q 3EPIA 2R2UA 3DHXA 2UUTA 4NRUA 2LQJA 1FJGF 3ZZ0A 3KHHA 4USIA 2QMXA 4PKDB 2EW9A 5GADI 3CJ5A 2Q6CA 5H9EJ 4ZKAA 4QOTA 2UUCF 5KFVA 3IG1B 2YKPA 3THVA 4DLEA 2OH2A 2DRBA 3VAKA 3LP0A 2RH3A 2Z2LA 2AJ1A 3MAHA 4RKUC 1HHSA 3DLKB 4IRCA 2HVIA 1VC5A 5I3PA 2HHHF 3OHAA 4Y2IA 3NLCA 5F8IA 3LGNA 1VBYA 5KT5A 4JI1F 3HVAA 2MKHA 2R8GA 2XGQA 4WE1A 2HG4A 3PEHA 2RIJA 3HM9A 2EBEA 3Q8SB 3OVSA 2B4UA 1S9GA 4KQZA 4G3IA 2MHNA 1ROFA 3FZ2A 1S1UB 1L3KA 3TVYA 5GMKa 2AX0A 3QWUA 1RWUA 1FVQA 3MMCA 4ZP8A 3Q0AA 2KKHA 3J80Y 2DNKA 2OJ3A 1RT2A 4RU2A 5G4DA 5KFNA 5CZXA 4X2BA 5LXYA 5KG1A 3QAUA 2FC9A 1RTIA 4ED3A 3PO4A 1XMQF 5KFFA 3S7RA 5KFIA 3VAIA 2DR8A 4NXNF 3MEEA 1RT7B 6FD1A 3F41A 2P5VA 1SKSA 1M5PC 2MGZA 1N32F 1VQOS 3E01A 3F56A 4NLPA 3NMAA 4OZ0A 1Q78A 1N88A 5A8WB 3K2YA 2FVSA 1FEHA 2YNHA 1XTZA 3MEGA 1KD1T 4B9NA 2NQPA 3ISNC 3OL6A 3OJUA 1U1PA 2KM8B 1TK0A 2F8EX 1TKZA 1N5TA 5D4NA 5C25B 3V6KA 4AYBD 2XY7A 5F3TA 1H0HB 1SB6A 1V3SA 4FVMA 4USJC 5KFGA 2V8HA 4AL5A 3I0SB 2LXIA 5EN1A 1SH2A 3V4MA 2N82B 1MSWD 3FSIA 4C8YA 2HHUA 2CPZA 1DQ9A 3PACA 1HBUB 4TXSA 3X3UA 2MZ1A 2GO9A 3VAFA 1S99A 2FUG9 3VAJA 4RW8A 3M32A 3VQTA 2KH9A 2HZCA 2CPJA 3R1LA 4FF3A 1O8BA 4L6V3 2LDIA 2J9EA 3M30A 5F8GA 1JLCA 3FQKA 2YTCA 2MGZB 5D4PA 3CDBA 2ASLA 2N3LA 4I0WA 5DQGA 4EBEA 1X8DA 4CT8A 1L5UA 1HD0A 1R3NA 1OSCA 2D9PA 4Q0BB 3NG8A 2EC0A 3M8RA 1MW7A 4QW9A 2GNKA 3H20A 2ROEA 1X0FA 3MMAA 3M1VB 3RAXA 1XWLA 2XMMA 2I38A 3DFEA 5MLCV 2XCAA 5B7WA 2V8VA 1UVLA 2R7XA 3LF0A 3HHLA 2L3MA 4ZDNA 1T3OA 4C3LA 1RT4B 2OAUA 2F9JA 2M2BA 2P9GA 3CJ3A 3IBWA 4FXWA 3I55S 3V4IA 2QA4S 4CZCA 2B43A 7FD1A 2V8DA 3ZZPA 4ZCKA 4DG1A 3DLKA 3GFYA 4OZ1A 2GGPB 4C0HA 3THTA 2XGPA 3V6DA 1DZ5A 4DDFA 2QFJA 1H6KX 2XLKA 1YITS 3DOLB 4ECWA 5LMUF 4IG3A 4U7CA 5DDQC 4XIUA 5C24A 2O67A 4EBCA 1KHVA 4MK8A 1HL6A 2BM1A 2MPUA 2IVYA 1JKHB 1C1BB 1F0XA 3KNAA 4WKRA 3GV8B 1NB7A 4B17A 4DV2F 3KG4A 3AJ1A 1HARA 1R7IA 5K8MA 2MY8A 3GG1A 4JI6F 2RRAA 4C8OA 4Y3CA 4HH0A 1OIAA 4OHXA 1TVRB 4OV1A 4GO7X 5LT5A 3RW6A 1JLBB 3BR9A 2OMLA 2ZC3A 1PC4A 1BQNA 3MM8A 1N6QA 1NJIT 2GHPA 1G7CB 4ID5A 3CJ4A 4ZS6A 3TAQA 4ED1A 3DOKB 2A3JA 2ZKUA 2Q43A 4O3PA 4XPCA 4Y28C 1N0VC 1D1UA 2PC6A 2ZVSA 1YRXA 3BSAA 5HI7A 4F2SA 5KFHA 5CYJA 2B3TB 4QIVA 4FPRA 2MMYA 4NZ0A 4GMKA 3CJ0A 1JLFA 2HQ3A 3TANA 4QW8A 5HLFB 1TKTB 4OL8A 4PG4A 2CQ0A 4LQ3A 1IKXA 3NNAA 1RTDB 5KG3A 1ZM4A 4QIFA 2NPFA 1LXJA 3JYTA 5EX0A 4QWEA 4ZVFA 4KO0A 1QY7A 3I87A 3I9V9 4IQXA 2W25A 5DM6Q 1QJHA 4IFYB 3NAHA 4ZHRA 2ZH5A 3QJPA 4PXDA 4URQU 5D3GA 3HVTB 5BYQA 1BC6A 1BQNB 1UFWA 3DDKA 2OPRA 5LMNF 1HBMB 1N6QB 1TKXB 4NXMF 3W2WA 2C28A 2QA1A 4PPZA 1N48A 3KK1B 3MTKA 2UXBF 5M2RA 2UV8G 3CT9A 2UXCF 4RBTA 2W4PA 2LQ9A 1KFDA 3LAKA 4QQBA 2AJQA 2RD5C 2CYYA 3T5JA 4N77A 1X4FA 2ZJPQ 2EI5A 3H25A 3PR5B 4YY3F 3PX6A 1JLAB 1LV5A 5HMWA 4MIAA 3O5TB 3MI7X 3UD3P 2Q3PA 1Y0HA 3OR1B 2F1FA 3BEGB 3UCZP 2BJEA 2YX7A 4QIWD 4FZVA 4KB7A 2PSZA 4U67Q 3MUMP 4OI4A 3V6DB 1Z4UA 1S72S 1OSDA 4F4WA 1W2BR 1CC7A 3CMES 4JI4F 1VRUB 2DGOA 2FB0A 5M2UA 5H1SV 4WZQA 4I2QB 2CJQA 5L9XA 3SMZA 1V6HA 1S48A 1XR5A 3CDWA 4MIBA 5J2QA 4TNOA 2CPHA 4HT5A 1K9MT 1S1TA 1SXLA 3BDEA 4H4OA 5GAEU 3DN9A 4RNFA 4LVNP 2CQCA 2EFOA 5IFMA 3DRRB 4RLEA 1LW0A 1BGXT 4XDCA 1NO8A 2J6TA 2BVZA 1V3ZA 2VPXB 2K1RA 2BDPA 2UUWA 3M8PA 1JB0C 3OTCA 3NCPA