2DISA

Solution structure of the rrm domain of unnamed protein product
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
109
structure length
109
Chain Sequence
GSSGSSGNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RRM domain of unnamed protein product
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords unnamed protein product
total genus 10
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2disA01
2N82B 1VQ6S 3JB9k 2ZJPQ 2RT3A 1U1MA 5DDRC 2CQDA 2E44A 2RS8A 3CMES 2ADBA 3CULA 1B7FA 2DGQA 3S6EA 1U2FA 1HA1A 2JVOA 2CQ0A 1M90T 3NNHA 2CPEA 3MUVP 3PIPQ 4ED5A 1L3KA 1HD0A 5DDOC 1X4GA 2LXUA 2KM8B 2RQCA 2E5JA 3R27A 1X5OA 1WHXA 1FHTA 2CPIA 4FXVA 2ZJQQ 1VBZA 2CQ3A 1QVFR 5H1SV 1KD1T 2KYXA 2VOOA 5MLCV 5ITHA 1X4AA 3NNCA 1NO8A 3VAHA 4RU2A 4P6QA 2DISA 2K8GA 1YJ9S 1KOOA 2MJUA 3NS6A 4F02A 2ADCA 4W90B 1D8ZA 2CQ1A 2KT5A 2DHAA 4IUFA 2M9KA 4QU6A 1U1RA 3CC2S 4LIRA 3R1LA 2MZ1A 5DDPC 2DGVA 5DETA 2KG0A 1HL6A 3P3DA 3BEGB 1R8HA 2MMYA 3NNAA 3B4MA 2CQ4A 2MY8A 2FPHX 2ZJRQ 1N8RT 4J5OA 2PE8A 1HD1A 1SJRA 2MQNA 2DGXA 5JVGQ 2DHXA 1S72S 2L41A 4WFAQ 3I56S 2X1GA 3CMAS 4OZ0A 3TP2A 2MQPA 5GVQA 2L08A 3BO2A 3DXBA 2Q79A 1N54B 2XS7A 4Y00A 1WHWA 2RNEA 2DGWA 3N9UC 1UFWA 1VQ9S 1WHYA 3DLLQ 1A9NB 2KH9A 5GAEU 2M8DB 1U1LA 2CQHA 2D3OR 3MXHP 3G8TA 4WCEQ 2NZ4A 5D78A 1K8AT 1WI6A 2DITA 2CQCA 2MQQA 1K73T 1VQNS 5FJ4A 1P1TA 5JVHQ 3CCJS 3UD4P 2DNZA 3UE2A 5HL7Q 3G71S 4WF9Q 1FO1A 2LXIA 5LSLA 4WFBQ 1FJCA 2DB1A 2OTJS 2MKIA 1YI2S 2DNLA 3BO3A 2G1DA 2LKZA 2N7CA 3S01A 1ZZFA 4BS2A 2UP1A 1ZH5A 1WI8A 3CCUS 2M4MA 2AYEA 1VQ7S 3PIOQ 1DBDA 1VQOS 3SXLA 1U6BA 2X1AA 2LEBA 2DO4A 2M52A 3CCSS 5IM0A 1F9FA 4CH0S 3TO8A 5CXTA 2HYIB 1WG5A 1WHVA 2LCWA 2X1BA 2DNMA 2M88A 3VAJA 1UP1A 3G6ES 3MD3A 5LXYA 2CPZA 4TU9A 1JJ2R 5DM7Q 1FXLA 2F3JA 2KG1A 1YITS 1W2BR 1JJ4A 4Y0FA 3V4MA 2XS5A 2CPFA 2MZSA 2MKJA 4IOCQ 1OWXA 3FEXB 4UY8T 4ERDA 2JX2A 1S79A 2RQ4A 1DHMA 1YHQS 3J7YU 1OIAA 1QM9A 2DGOA 1FJ7A 1VQ5S 1P27B 3LQVA 2MQMA 1WF1A 2E5HA 4V19X 2MYFA 1QVGR 2N3OA 1RKJA 3CCES 1Q86T 4YOEA 5IFMA 1WF2A 4LJMA 3CC7S 1FJEB 3CCMS 3S7RA 3SDEA 2KI2A 5CYJA 3RW7A 1UW4A 2VODA 1BY9A 3P6YC 2MGZB 2E5IA 5DM6Q 4M5DB 3HHNB 3S8SA 3CCVS 1U1PA 2QA4S 3ZZYA 3CD6S 2CQPA 2LMIA 1ZZNA 4U67Q 2RRAA 3Q2TC 1Q7YT 1U1QA 1OO0B 2MXYA 4TU7A 3UCZP 2MZQA 2KVIA 2O3DA 2WBRA 1Q81T 2MKCA 2ERRA 2JWNA 4PR6A 2EK1A 3VAIA 4WFNQ 3OW2R 2CPYA 1WEYA 2NLWA 2V94A 1RK8A 2DNGA 2J76E 4W92B 2KU7A 2KFYA 1Q82T 1DRZA 2A3JA 2LECA 3MUTP 2MKKA 2KN4A 4C0OC 3K0JA 1X5PA 2LEAA 2DNHA 2KXFA 2KXNB 3VAKA 4QPTA 2M70A 1YTYA 2RUGA 5GMKa 3IWNC 2CPHA 3CC4S 2DNPA 1H6KX 5LJ5Y 2G4BA 1VQ4S 1CVJA 2GO9A 2RS2A 2L9WA 2MGZA 2QFJA 2J8AA 2FC9A 3Q2SC 3ULHA 1YIJS 2AYBA 4QU7A 2B0GA 4IOAQ 3SDEB 1WEZA 2MHNA 3H2VE 4Z2XA 1VBXA 3BO4A 1SJ4P 1IQTA 1UAWA 3G96A 2MSTA 2XNQA 5CA5A 2OTLS 3EGNA 2M0GB 1VQ8S 1X4CA 2KRRA 2RVJA 3VF0B 5DDQC 5EN1A 1VQMS 3HI9A 3G4SS 2XNRA 2VOPA 1D9AA 2RU3A 1FNXH 4TU8A 1PGZA 3THPA 3EX7B 2SXLA 1VQLS 2OSQA 4WIIA 1R8PA 2DIUA 5BJRA 3VAMA 1G2EA 2DH9A 1X4DA 2CPDA 4C7QA 1H2TZ 1X4HA 2KHCA 2BOPA 2PEHA 4YB1P 2FC8A 2JVRA 2M7SA 3CCRS 3P5TL 2XSFA 1VBYA 3BS9A 3FEYB 4UQTA 2MJNA 3U1LA 2DNNA 2DO0A 2MB0B 3NMRA 1X4BA 1SJFA 2F9JA 2CJKA 3G9CA 1WG4A 2CQ2A 3VALA 1JMTA 3MUMP 2MY7A 1SJ3P 1NU4A 5GADU 2F9DA 2DHGA 4CQ1A 2HGLA 1M5KC 3UWTA 2DH7A 2CQGA 4IO9Q 1X0FA 2KXHA 2DH8A 1YJWS 1SXLA 1X5TA 2OIHA 2AD9A 3CUNA 1H2VZ 1KOHA 2LA4A 2U1AA 2D9PA 3L3CA 1AUDA 2MQOA 2GHPA 3IRWP 3MOJB 3CF5Q 2OJ3A 1WTBA 2EVZA 4TLQA 4CH1A 1M1KT 3RW6A 2D9OA 5IM0B 3J7ZT 1SJQA 2BZ2A 1KC8T 2LQ5A 4CIOA 4OZ1A 3TYTA 1U1KA 4ZKAA 2N3LA 1VC6A 1URNA 2YH1A 2DNRA 5D77A 1X4FA 3UD3P 1A7GE 2DK2A 4LMZA 2MQLA 2J0SD 2XS2A 1XN9A 2FHOB 2XB2D 2EK6A 2MZRA 1NJIT 2YTCA 2X1FA 4A8XA 1N88A 3P49B 2DHSA 1M5PC 2RRBA 1O0PA 2FY1A 3US5A 2HGNA 2DNQA 4F25A 2K3KA 1WWHA 1YWXA 5HO4A 2YWKA 1X4EA 2CQBA 2M2BA 2J0QD 4FXWA 2HGMA 3R1HA 1FT8A 5GAHU 2OSRA 2DNKA 2MZJA 4WKRA 1U6FA 2KM8C 3VAGA 2HZCA 4QQBA 3MD1A 1YJNS 1KQSR 2I38A 3CTRA 3B4DA 3H2UB 1WG1A 3I55S 3CCLS 1OPIA 3CXCR 1VC5A 2AYMA 3G8SA 1WEXA 1X5SA 2M8HA 2KRBA 2DGTA 2LA6A 5LJ3Y 2U2FA 5LSOA 2LYVA 1DZ5A 4F26A 1JJHA 1H2UX 2QEXS 2DNOA 3MURP 4EGLA 1N52B 2CPXA 2YH0A 3UCUP 1VQKS 3LPYA 3D2WA 2DGUA 2G0CA 3UCGA 3MDFA 1M5OC 2DIVA 2E5GA 5GAGU 1VC0A 4PKDB 2HVZA 3CCQS 1WELA 3U1MA 1PO6A 1U1OA 1WF0A 5IQQA 1U1NA 2DNYA 3EGZA 2YKAA 3MI7X 2VONA 1K9MT 3VAFA 3SMZA 3CPWR 5LXRA 1VQPS 2MPUA 3THTA 2CPJA 2MSSA 4YUDA 2MZTA 2JRSA 3ZZZA 4PRFA 2I2YA 2MKHA 1M5VC 2MKSA 2AYGA 3NS5A 4C4WA 2DGSA 2CQIA
chains in the Genus database with same CATH superfamily
4DR2J 4DPXA 3QIPB 4Y65A 1FWPA 2GIQA 4ZVFA 1IWGA 1MN9A 1NB2A 5D4OA 2ZJPQ 3DOKA 4PXCA 1YKWA 3BREA 3MECB 3PX4A 4X4UA 4L72B 3QSIA 1EZZB 2HBYB 4OJGA 1PKUA 2Y0SD 4QR0A 4L3KA 1Q95G 4ALZA 2C2KB 1HA1A 5HMWA 3FK4A 4GMKA 4ZVHA 3NNHA 4KSEB 3MUVP 3DOKB 1I6JA 2Q66A 1S9EA 4AL5A 3DOLA 1UW9A 3PW4A 4L6V3 5E0OA 4DPYA 4MKBA 2AJ2A 4J9VA 2UUWA 2PGCA 2AX0A 2V4JB 3O6QA 2E29A 4OJ1A 2LXUA 5ETVA 5J2MB 4DR3F 3V6KA 1HNVB 3T1YF 1Q1KA 2IIHA 1NBEB 3OVSA 1X5OA 4KBIA 2BJEA 5FDLA 3A3OB 2HRTA 3PYFA 2GMJA 4FXVA 2ZH9A 2UXBF 4IH7A 5DLGA 2XTJP 1N33F 2VG6B 4I4BA 2GVZA 1KD1T 4JV5J 3DRPB 1IJEB 3UVJB 3DRSA 4DX8H 5B09A 5ITHA 1HWKA 2AMCB 3JTPA 4NEZA 1U0HA 3C15B 5DGBA 4MMOA 2ZH4A 1EKSA 4UZCA 3QT6A 1KTQA 4P6QA 2MLYA 4FBUA 3HSDA 4FDFA 2B56A 3D4JA 1KOOA 2MJUA 3JSMA 2HNDA 4USTA 1YJ9S 1APSA 1SC6A 3EXCX 1UVKA 4ZPAA 2K2PA 1NLKL 2GGPB 3LTOA 4I2QB 4F2SA 4IR9A 2BKNA 1TUGB 1KQFB 4IUFA 2M9KA 4QU6A 3KLEA 4YY3F 3CC2S 1FEEA 1U1RA 4WU2A 2UXCF 1NDCA 1TU0B 1HBUA 1T9UA 3LP1A 4B3OB 2V4QA 3B78A 1WC3A 4I64A 3WDOA 2XEXA 4WU3A 4DPUA 2XLJA 2W2OP 3BEGB 4V1Ak 2YNGB 3UO0A 1C0UB 2MMYA 1N56A 4OL8A 2CZ4A 3GYGA 1SKWA 2CNKB 3GP9A 5B0FA 4J5OA 2PE8A 4YR0A 3EZ5A 2PC6A 2G0JA 3JQMA 2ZITA 3KDOA 3PFEA 4IG0A 3ZTOA 1NSQA 1RU2A 2L41A 1IVZA 1XR5A 2C2MB 1EAYC 2F8MA 2FY8A 3DLGB 3HHEA 3R5BA 2H51B 4N77A 1HPZA 4Y28C 5F41A 2KYZA 2YPZA 3M2UB 2XC9A 3A8EA 3KMSA 1N0UA 2YQ3A 4URSA 5CHCB 3A8KA 1SVDA 3O8WA 3T6JA 3PX6A 1IUJA 1N54B 2B9XA 2V69A 2VFVA 1WHWA 2XWXA 3SQOP 3W9IA 2VH7A 4RNOA 3IGNA 2VHGA 1FFSB 2FTRA 1XC9A 2EFOA 5EX0A 3W1YC 4O44A 1A9NB 2VKRA 4DSFA 3SEOA 5GAEU 1IKWB 1SH0A 1LWXA 4RLEA 1U1LA 3VGSA 2D3OR 5D0RA 4X4TA 4PUOB 1HBOA 3CJ8A 4NPOA 5D78A 2FVQA 4F4XA 5D3GA 1RGVA 3VGTA 3K5NA 3TA1A 1SUQA 1YK9A 1VQNS 1JLGA 4GKKJ 2F5GA 4C8KA 4ICLB 4USVA 4RU9A 2YVSA 1ZBTA 2YNHB 1I51B 4DN0A 3G2XA 4A8QA 1UVMA 2Y1JA 2DNZA 2V9WA 1YZ6A 1ZYQA 5HL7Q 2IM0A 3DMJA 2DXFA 5HP1A 2ASJA 1T11A 1FE0A 2FZGB 4D3HA 2W1BA 5DLFA 1IBCB 3DGVA 4DV3J 1PSDA 1S1TA 3CMQA 4CT8A 2RIJA 2RDIA 2QX0A 4C8YA 2G1HA 3KLIA 1ZM9A 1OQ3A 1UPMB 2LKZA 3AJDA 4M5KA 3S01A 3HFKA 4L76A 3HHDA 1LK5A 2KT3A 4O4GA 2Y9HA 4YDXA 2VD3A 1M1GA 2BJ3A 2AYEA 1ZPWX 5FLXU 1J27A 1FEHA 1T9WA 4FKYA 4LSZB 4GO5X 4DF8A 1LOUA 2YX1A 1CJVB 5HJXA 3SXLA 1N5YB 1HR0F 2B9WA 1U6BA 4B02A 4CO4A 2R2RA 3TARA 5HP1B 3TO8A 1S49A 5CXTA 1UETA 1RAFB 2AP6A 2ZVSA 4KGMA 2BRLA 3K2YA 4Y2IA 3C19A 3ZNUA 4E98A 3W2VB 4KH0B 1WTFA 2DKOB 4NCAA 2FB0A 4YQWA 1CC7A 1WG5A 1RTIA 3NKYA 2WW8A 3IRXB 2OFGX 4AD6A 3OUYA 3GIIA 2BE2B 4MKYA 1F3FA 3X3UA 3OV7A 1RBOB 1PCAA 4DCJB 4C3MA 5C24B 4NXMJ 2N4DA 3G6ES 3ENQA 3J7A1 1VHFA 4TYBA 2CDQA 5LXYA 1HBOB 2CPZA 4DSLA 4N7TA 2MEWA 2W9CA 3OR1B 4DPTA 2HHXA 3T3FA 5DM7Q 4MT1A 2GMHA 3IAM9 4RW7B 4I6WA 1YITS 1FTRA 2CAJA 1DURA 3CJRA 4J9KA 2DRDA 3N6NA 3AH6A 3CJ5A 1FK9B 2FGOA 1LFWA 3BBBA 1QAJA 3SCKE 3AJ2A 3LPEA 2XS5A 2PEBA 4ES1A 2QSWA 2F40A 2H65B 2MZSA 1U47A 3VGVA 3RG6A 4IOCQ 3KMQA 1AB8A 3QLHB 3NGUA 1GMWD 4UY8T 1PC5A 1AROP 2FZCB 3QZ8A 4ELVA 4CNYA 1OIAA 1RABB 4GVBA 5K9FA 3VQTA 1FJ7A 3CJKB 2DPIA 3F44A 3BGOP 3PRVA 2E5HA 3M9OB 2P6SA 1CBKA 3SFGA 2N3OA 3J81U 3OL8A 3WC2A 2R7OA 3T1AA 3TOQA 2WBMA 4ZP7A 4F3QA 2LU2A 3SI8A 1NSPA 1KSPA 2HFSA 1DFDA 1NUEA 4LJMA 5HLFA 2V4RA 3LP0B 1B0TA 1TUWA 4CLKA 2ACYA 4ID5B 2HVDA 4AYBD 3C14A 1RLDA 5THWA 5B0GA 3LWMA 1HWLA 4C11A 4M5JA 1HBUB 1UJ6A 4A47A 3MR5A 2WSEC 1LFPA 1UW4A 2HPUA 4A8SA 2C2DA 2VODA 3P6YC 2KTQA 5KT2A 2E5IA 2DRAA 4DL5A 5DM6Q 5HQMA 3KHRA 3QLHA 1FRIA 2NYIA 4PWWA 1VHIA 3N28A 3OVAA 3QJLA 4P2XA 1JNZB 3T9ZA 1I1GA 3S8SA 5DQHA 2XO7A 1U1PA 2HS0A 4USKA 3NOCA 4LF8J 3Q83A 2X3DA 2IDLA 2BQ3A 3QJJA 1MMDA 1UJ4A 2LMIA 3CO0P 2QYCA 1ZZNA 1R8AA 1TK0A 3BR9A 3Q2TC 1NSKL 3PCOB 4DV1F 1OO0B 2MXYA 3H0PA 4TU7A 4AL7A 1XNQJ 1GXTA 4WXWA 1GMUA 5ETTA 1MWYA 5KFCA 1S10A 4KHPF 2W9CB 2KVIA 5LT5A 5F8GA 5F3ZA 3W8GA 3R5DA 2W25A 4LFCJ 1PC4A 2RB7A 3PEHA 1RT1A 4ZPDA 3LAMA 5FDLB 4Z37A 5LMNF 5ETSA 5K14A 4NYPA 5CAAA 4DR6J 1C2PA 1W26A 2OAUA 1HHQA 2YXLA 4IO1A 3OLAA 4DV2J 1OY6A 1D3WA 4W98A 5IC6B 1TKXB 5T7LA 4EYIB 2W2NP 4O3QA 4DUTA 3DLKB 3HD1A 2KFYA 3DOLB 3RAXA 2DY1A 4BWJA 2LLZA 4K50A 3N6LA 4JI5J 4WP9A 1HARA 3MUTP 3M8SA 4RX6A 3DDKA 3IBFB 2XYHB 2ZFHA 2GV1A 3PNIA 5I3PA 5AE1A 1VJQA 4J9SA 1B70B 4F04B 1FRXA 2NPFA 5K20B 5MAOA 4A8WA 3HHKA 2E9ZA 2KXNB 2E7XA 1F5BA 1LXNA 4QPTA 2M70A 2ZH1A 2RUGA 1YTYA 3TZXA 3RB6A 2IY5B 3CC4S 3NGTA 1TUVA 2QA2A 5M2RA 4DV4F 2IYIA 5AXMA 3OFFA 2OPQB 8RUCA 4WE1A 1W25A 1KLNA 1OYDA 1Q5YA 3IBCB 4B17A 2V63A 2F8EX 5GMDA 1QUPA 2YNHA 3SQGA 1EX8A 3K57A 4LVNP 1HLWA 4A8KA 4LRAA 3CIZA 3E8OA 4UOCA 2B51A 2O67A 1RAIB 1SUQB 2CJQA 2JSXA 2IFXA 2MLZA 3GTYX 3QNWB 4H4KC 3KHHA 5D3GB 3H2VE 2MLXA 1IBLJ 1KHVA 5GAHI 4LR9A 1VBXA 1DLOA 2XCPA 4J91A 1IQTA 5FIIA 2ZHOA 1B7YB 2DYAA 3Q8SB 2KFNA 2OTLS 4MK7A 2XULA 3FBBA 4OYMA 4O44B 3RBDA 1YJUA 1HFEL 2ZH7A 5A8WB 5DDQC 1TL5A 1N36F 2H4WB 1UEKA 2P8IA 2OELA 3DU5A 5F9NA 1S76D 2RU3A 3UDCA 5ETMA 4R8UB 1FNXH 2P9EA 2Y1LB 3Q8VA 2VU5A 5D4PA 2UXBJ 3MR2A 5F8JA 3EX7B 3K8VA 2N7YA 1RACB 2SXLA 2HWHA 5BJRA 1P8GA 2DIUA 4LF8F 4B3RF 2P9CA 3BM7A 4NLWA 4UUXA 1G2EA 2HQDA 1N32F 3E51A 3EZOA 1PYTA 3K7RA 4AT1B 3KNAA 1NKCA 2RJZA 2HBZB 1F5CA 3NY0A 2PA8D 2PEHA 3GFZA 4RBUA 2FC8A 2JVRA 2ZDPA 3KXDA 3M32B 4ZJLA 1RYRA 3M30A 4IRDA 1VBYA 3BS9A 3RRKA 1QSLA 4GKJF 2RHQB 1SH3A 1QUVA 2MJNA 2YKPA 4O0NA 4OX9J 2KZZA 4FBTA 1WC0A 3U1LA 2J9EA 1WC6A 3FRYA 3KJVA 5HSPA 3GIJA 2MB0B 1GXUA 1X4BA 4X66J 2OD4A 5DZ6A 2CFXA 1N5SA 1FXRA 4J9LA 1HNIA 3TZWA 4FS1A 2ZKTA 3V6DA 1EB0A 3KWMA 2CQ2A 4I2QA 1YIJS 1ELOA 1JMTA 2RKIA 1SJ3P 3MM7A 1NU4A 3FQLA 2W2PP 4KQZA 4CQ1A 3SCLE 1QAXA 3A12A 3LGHA 2JLGA 2R7QA 2F4VJ 4F4WA 1CLFA 2DH7A 3A3NB 2CQGA 2VG7A 5L1JA 2NSBA 2BVZA 4F8RA 4JI3F 1TL1B 1IKVA 3DRSB 2HLUA 3M8YA 2DH8A 2H9ZA 4P7VA 3E3XA 1SXLA 1BQMA 2IC3B 2AGQA 1SCJB 2AHOB 5I3QA 3I9ZA 4RW9B 4MYUA 2ZBIA 3SQGB 3TUJC 3ENVA 2U1AA 3L3CA 4DV6F 1Q8KA 2ZBPA 3DNCA 4KV8B 4OYZA 4PPZA 2GHPA 2RD5C 3G8QA 3IP0A 3MMJA 5SUHA 4A4JA 2MQOA 3IRWP 3CF5Q 3HO1A 2GVDB 2ZHBA 4DUYF 5BR8J 2K1RB 2Z30B 3PW5A 2GFFA 1TVRB 5IM0B 4ECYA 1SJQA 2CVEA 1FJGF 2LQ5A 1U1KA 2BXJA 4XAKA 1V9OA 2D74B 3PY8A 4ZVOB 2HQ3A 4X4QA 4ZVRB 3AB2B 4FN5A 3QPIA 4EBCA 3VV2B 4DR4F 1RXOB 1URNA 2DNRA 2OPPB 2XSJA 1E6YB 2VJVA 4F4AA 1X4FA 3JQKA 4IKAA 1A7GE 4ZPBA 1UCNA 1OMSA 2YKNB 3PDNA 4DL0C 2ZC3A 2VPZB 2V68A 3MECA 3CC7S 3BSOA 1RTHB 4RNHA 2GZOA 2XMWA 2MQ8A 3DLKA 4KPCA 2L9NA 4TNOA 5ETPA 2VA3A 4A8MP 4NZ7A 2FHOB 1QSSA 2C3OA 2LQ8A 4IQMA 1NK6A 2XB2D 4DR7J 2WZ1A 2MZRA 4U96A 2YTCA 4K4TA 4DQIA 2OEJA 2W2QP 1SQFA 3NCRA 4A8XA 4URGA 3R5AA 4PXDA 2ZBRA 1LWFB 4F0MA 1YSJA 3L7UA 2WOMA 4HYKA 3US5A 1ZTWA 2DNQA 5KG4A 1HQEA 5HATA 5HVFA 2O1PA 4BWMA 5C25B 4DV3F 2UUBJ 2IM2A 1MWZA 2DEIA 4HHHA 1V6HA 3CDAA 3QAEA 5HO4A 3D68A 3NRBA 3HVRA 4NCGA 1C0TB 1TKZB 2VV5A 5D0HA 4ZJQA 3JXOA 4OZJA 1S6PA 2C3PA 3VVUA 1C4AA 2HLTA 3ICLA 2M2BA 4ZP8A 3FBFA 3ZTSA 1FT8A 3R1HA 5GAHU 4OYPA 3H42A 1KDNA 2V2VA 2KM8C 3VAGA 3LALA 3PYGA 1XWLA 1RB0A 4WK3A 4ZVTB 1TELA 5CD4H 1G4CA 3HHLA 3ZZ0A 2ZH8A 4QQBA 4X66F 3CTRA 3LAKA 3H2UB 5IV4A 2HAFA 1NH7A 3AXKA 1X9SA 5KFRA 4JI1F 2BDPA 3WBZA 4X64F 1OPIA 2GIFA 3CCTA 3CXCR 4DFJA 1N6QB 4CO3A 3BQ1A 2VFUA 1SL0A 2QLWA 1LWCA 5CH7B 1X5SA 3F41A 4ZVPB 2KRBA 1T8EA 2CG8A 4DV7J 3C16B 3CT9A 4EEYA 2CZ9A 3CE8A 1SC1B 5IZHA 1H2UX 3QGHA 4KAIA 2J5AA 3OXLA 2V6AA 3D54A 5DS7A 1HR0J 1NAQA 2H5JB 4KKOB 4AXJA 1TFWA 1NHKL 1HBMA 2QZ8A 3RR7A 4G1QB 3W61A 1JQGA 1UL3A 2HHPA 2YH0A 3W5ZA 5J1EA 3Q8RB 1KHWA 2FVCA 3ETMA 1JXEA 1V5IB 2I5JB 4GVBB 4DF4A 4K4UA 2HHVA 1GAOA 2G0CA 2GO8A 3GJRB 4HTJA 4ZVEA 4DMZA 1IR1A 4ZHRB 3TZZA 5H9EK 2O66A 2EBEA 2ZE2A 2AJQA 1AYEA 1Q8IA 2XZDB 2AGOA 3F0NA 1SKSA 3HDSA 1HYSA 1FJGJ 3KLFA 1WD6A 1F0XA 1GQEA 3M8RA 3GCXP 2YWGA 3D5MA 3ZO7A 1WF0A 5CYQA 1IBMF 1HQUA 3OD2A 2YKAA 5AJ3J 5A6PA 2VQEF 3KTQA 5KG5A 4LF7J 2B7BB 1QLNA 1KS2A 2V8DA 4XK8C 3DYAA 4ZVQB 3OR1A 2IBKA 3SMZA 3HLUA 2BV3A 3THTA 1D9DA 3GZ7A 1MROB 4P7TA 1LKZA 4LF6F 2EKNA 4BCAA 4NYOA 1UVNA 1FKPA 2DR8A 2BE2A 1WKJA 3IRXA 3UR3C 2DR9A 2CZVC 1T3OA 2MZTA 1TKTB 3AXMA 3BSAA 3DGPA 4I2PB 5KG1A 1VFJA 1OYEA 3ZZZA 2E1CA 2R8HA 1JLBB 2I2YA 4JYAF 2ZDOA 5I3UB 3NS5A 1CC8A 4E8UA 2AYGA 3RRGA 2JOQA 1T3NA 3HHLD 1U8WA 4OI3A 1VQ6S 1IM4A 1CS4B 3I0SA 2W7OA 3POTA 2KT2A 3CD0A 3TUIC 4ECXA 3PV8A 4JV5F 3NP5A 3KNGA 2RT3A 2BX6A 4LSNB 1JLQA 1U1MA 4OZ5A 2VPXB 4XDCA 1S1UA 3FZBA 2CQDA 1TR0A 5C42A 5J2NA 2ZZNA 2IAJA 4KO0A 2GJ2A 3D3CJ 4OYAA 4CT9A 1HWUA 3UW1A 1H72C 4C8LA 1U2FA 2RSQA 1KEKA 1TL7B 4B9VA 3N4WA 4WZQA 2HBQB 2ILYA 1VC0A 4I67A 2ZZTA 2FQQB 4OX6A 3V81A 2BR0A 1UA1A 1TAQA 3BDEA 3PIPQ 1KLMB 4ED5A 1D9FA 2ZOFA 3MEDB 5KT7A 1FERA 5K8NA 3DC2A 3NEKA 1U8SA 2E5JA 3C6TA 5CZXA 2V0NA 3I6PA 3U02A 2CJXB 1T95A 4ICLA 3OXFA 4DSIA 2QL7B 4N56A 4LT6A 2CPIA 3DU6A 5B0AA 3OXGA 4TN2A 4N47A 3DOMA 2CQ3A 3AAWB 3M8WA 1Y0HA 4L75A 1IKXB 2KHDA 4PXEA 4PUOA 3EVOA 2H5EA 2P5VA 1RWVB 3D0HE 2KKHA 4OV1A 4AXIA 3BYPA 2BM1A 3EGWB 3IR5B 3OQ2A 3LP2B 1KVIA 1KKHA 3EXYA 2YWHA 3MWBA 4IOBA 3MFHA 3KK3A 2JFDA 1TFYA 4FXDA 2BQUA 3T9NA 2R3VA 1D8ZA 3FCVA 9ATCB 1CJKB 2KT5A 4WK1A 1XMQF 1GMWA 1NB7A 2CA9A 1FRHA 1N5VA 2R7UA 2BJDA 2MZ1A 3R1LA 5DDPC 1CJKA 2ACMA 5BXIA 3HX9A 3T5LA 4WYLA 1RAAB 1HL6A 4DFKA 2PSZA 4PWDB 3P3DA 2AIRB 2O01C 2RUSA 3QGIA 2W9AA 5KT5A 4CO2A 2IMOA 4I6YA 3MM6A 3CJ4A 4DV0F 3CJ0A 3PZPA 3FMBA 3KG4A 4MAKA 1RCOB 2ZJRQ 5E33A 1RWPB 1YGYA 4AFFA 3RAQA 1IBKJ 1HD1A 3NL0A 3ISNC 3NWRA 4LF6J 1EQMA 4OI1A 4ZK7M 3CO9A 2PD1A 2DHXA 5D0GA 3IO1A 4NLOA 3LP1B 3SCIE 3FRZA 1S72S 4WFAQ 2X1GA 2E1PA 3IR6B 5D8HB 2PO4A 3FNNA 3KLEB 2KVQE 3UNYA 1LXJA 3EM1A 4HH1A 1N36J 5KFUA 3BN7A 1MW7A 3KK1B 2RNEA 2KFZA 3CDUA 2ROGA 3OR2B 4KYZA 5EDWA 3N9UC 4ZIWA 1UFWA 4QW8A 3V81B 4B3RJ 1RHMB 1RJJA 5KT3A 4XPEA 5KAKA 4ECUA 4Y2CA 9RUBA 2VQFF 2NUUG 4ECVA 4QW9A 2AJFE 5EUHA 1VK8A 3NGKA 2GMLA 1U0HB 3C15A 3MM6B 3D3BJ 4P2FA 1HNZF 2OFHX 3M8QA 3PKYA 1IKYB 3B6BA 2ZWPA 4KJIA 1NPKA 1G7CB 1K8AT 1JLQB 4GKJJ 2CQCA 3VCDA 1K73T 2ROPA 3I5BA 2CKWA 2GQ2A 1NHVA 1K47A 1P1TA 1T9VA 4IFVB 4ZLJA 4PYAA 3CCJS 2A18A 4IR1A 2B9YA 3WIUA 4CM0A 3EE3A 4NLVA 1JWWA 3G71S 3MCOA 4YHHF 4I2PA 4YR2A 2LXIA 3BPSP 4X4PA 4WFBQ 1FJCA 2WB4A 4FF2A 1VOMA 1XNRF 1H38A 2VFSA 2DB1A 4ELUA 5A2QU 1BC6A 1MU2A 3BO3A 2G1DA 4Z7YA 4DG1A 1ZZFA 4BS2A 4QWCA 1WI8A 2D3UA 2V2KA 4F50A 1X60A 2R42A 1DQAA 3CCUS 1UZHA 3W65A 2IDEA 5EHHA 3DOMB 2RAQA 3J81Y 3PIOQ 1DBDA 5CYQB 2QLJB 5M2UA 2HW3A 2LEBA 3M6UA 1S0OA 1F9FA 4CH0S 4ZLLA 3BYRA 3W60A 2XBPA 2E7WA 2W4PA 3C6TB 3TWZA 2HYIB 1PJ7A 1EARA 1S59A 3M4XA 4TY9A 3AA9A 3D28A 2HNZA 4DUYJ 4K5RA 2M88A 4NI2A 3BQ2A 1XQIA 4OZ2A 4DPOA 7FD1A 1UP1A 3A3PB 2VFTA 4FYDA 3CCWA 2F4VF 1S12A 2CRLA 3MD3A 4FNHA 4DPWA 4WFXA 2HURA 2PDAA 4QWAA 3W2WB 1JJ2R 1KWMA 4V19J 3SCJE 1LQ9A 4USJC 5L8RC 1UWAA 4ZP6A 5E3RA 1W2BR 3MF5A 4Y3CA 2C2EA 1LWEA 2YNFB 3RZAA 3SBMA 5HJYA 3UPFA 1I94F 3OT9A 4F7VA 1HNXF 1TKDA 1RAOA 1WOSA 2CPFA 3HVWA 3K5MA 5I3UA 1NMEB 1UA0A 4MIWA 2XMAA 2EG1A 4JI1J 2JX2A 1S79A 4NYZA 1DHMA 4X65F 1DQ8A 1YHQS 2DGOA 3F56A 3ILJA 2CIMA 4RUHA 1VQ5S 2ZNZA 2WK4A 3FQKA 3LQVA 4FVMA 5KG0A 3H7HB 2ASYA 3VGUA 4C0BA 1N5QA 3T5KA 2XY5A 3PR5B 3BH7B 4JBCA 4V19X 1KQGB 3Q86A 2QSFA 3DLBA 5I42B 2E66A 1CULA 2PFDA 2F4FA 3L95X 4CO0A 4IG3B 5IFMA 5K8PA 3AD8C 3BGRB 3I9V9 2BABA 1C0TA 3R97A 2RF2B 4QIEA 3CCMS 2BANA 1Y9OA 3C2PA 4IRKA 3BBFA 3S7RA 4Q8FA 3QT5A 4CTAA 1JKHA 5DRKA 3WHIA 2JJ4D 3FUYA 3D9BA 5KFNA 4DX5A 1LWFA 1HYSB 1J5EJ 4P2SA 3RW7A 1RE1B 3ZTQA 3KLHB 4K4VA 3QQCD 2Z0GA 3UD5A 3TANA 2DD8S 1MSWD 3B54A 4OLPA 4PWUA 3TQEA 4QIVA 4NLSA 4LIWA 3BPDA 4EO6A 1FWLA 2HFVA 2I5JA 3R7NB 2QL5B 1RWKB 3P5BP 3TAQA 2XHWA 3CCVS 4Q7AA 2A6MA 5CABA 3LW5C 2YKQA 3ZZYA 1SV5B 3CD6S 2HHTA 2AZ1A 3FFIA 3GR0A 4U67Q 2RRAA 2R7VA 2XMTA 2K06A 2YKNA 3QBCA 2AU0A 3QJPA 1AZSA 1RTJB 1Q7YT 3TX0A 3UCZP 4LF4F 2MZQA 2OEMA 2VPYB 3EVWA 1R6YA 2QA1A 4C97A 5J2QA 4N5SA 1Q81T 3MTKA 1N34F 2JWNA 1CJTB 3BKTA 4JI8F 1EQ0A 1RA7A 2PMZD 2E1RA 4ILMA 4DV2F 4W4MA 1MLAA 2UZAA 3MPYA 3H25A 2QGFB 3AD7C 4X4NA 4DV4J 1B64A 2FVSA 3MEGB 2EFPA 2OI2A 4ETZA 4K4XA 1RT4B 4PCQA 3ILLA 1JJCB 2C3UA 2DNGA 3QGPA 2J76E 3MEGA 4ZP9A 4KV8A 2G2YA 4K2JA 1RT2B 5KFOA 1C1CB 1SBRA 4H4OB 3H2LA 1L3SA 1B0PA 1X8DA 1S1WA 1YRXA 4LSLA 1NHUA 2Q43A 4DQPA 2PFFB 2RILA 3D67A 2MKKA 2Z2YB 2X7IA 2J6SA 5J2QB 4GC7A 3H8YA 4C0OC 3Q22A 2J8SA 3PHTA 4DCPB 4ECRA 4RW6B 1VYAA 3QT7A 5KFVA 2QYGA 3GSIA 3I87A 1R27B 1TMMA 2VF3A 4M5IA 4NE9C 4ZLPA 3VAKA 3D7SB 4RW4A 3SYZA 2IHR1 2OKQA 3IWNC 2CPHA 3LA0A 2B8PA 2LDIA 4J9RA 2DNPA 4URQU 4FF3A 3N0VA 4MKAA 3ISZA 1UTAA 5G0RA 5LJ5Y 5FD1A 4FYXB 5HQ8A 2G4BA 2HFUA 1HNIB 2W2MP 1IR2A 3ZXWA 4QOTA 3HKZD 4OYWA 4RWXA 4UOFA 3OL7A 2AEMA 4C48A 5A2QY 3D0GE 2R7TA 1U25A 3CWJA 3O2IA 4OHYA 4PQUA 2W8KA 2J8AA 3Q2SC 3ULHA 4Y2KA 4ZLNA 4QU7A 4WP3A 3MAAA 2B0GA 2HAIA 2QA4G 5LOQA 1TL3A 5ETOA 4QPXA 1JKHB 2V50A 3H20A 2MHNA 4KFBA 1JLFA 1GX6A 2BANB 2GA7A 4RW6A 3BO4A 1DZ5A 4ILLA 1SJ4P 3MMAB 2DR5A 1XMBA 4NRTA 3N5BA 3R5CA 3F73A 1FE4A 1W7WA 4MJKA 4AQYF 2AX1A 2FDNA 2B4OA 4KGZB 1S1WB 1S4FA 2M0GB 1TVRA 2XMMA 4OV6A 4WP8A 1VQ8S 1X4CA 2KRRA 2RVJA 3OFEA 4NLGA 4EI2A 3G4SS 4FYVB 4F0KA 2XNRA 1Q8BA 2VOPA 1D9AA 4X4VA 2EC0A 4M94A 1R0AA 4BDPA 1Y5NB 4RW9A 2IBOA 3RR8A 4EZ9A 1PGZA 4DBQA 1BQMB 2IC3A 5ETQA 2HQGA 4HT7A 4QZVB 4WIIA 5CYMB 4ZVSB 2QG9B 1PAUB 4X64J 4DV5F 4USMA 4DR5J 2E5LJ 3R2DJ 3NCPA 3BGFA 4JI5F 3R7BB 3RTVA 3R9LA 3OPKA 4TLRA 4USHA 1SB6A 5DQIA 2D1CA 4CWBA 3W2WA 4J9PA 3SIPB 4KPYA 4C9DA 2UUTA 1NPPA 2AWZA 2RKIB 3EWGA 3L7PA 2M7SA 2C1EB 1RHQB 4TXSA 3CCRS 1NXIA 2BMBA 2KL8A 2QL9B 2GCFA 2XSFA 3FEYB 1REVB 4D3GA 1ZAXA 1D8YA 4NMLA 4DR4J 4EMDA 1GEHA 4F36A 2HNZB 4A48A 3KUHA 4A46A 1RP5A 4OMFG 1WC1A 2DO0A 5ETLA 4KGVB 1U4BA 2HRUA 3B8HA 3LOUA 5A8RB 4DS5A 3NMRA 2NZCA 3GLJA 1UVIA 3N01A 2I1RA 4EYHB 2IJRA 1DQ9A 1UFLA 3FKBA 1FNMA 4G1PA 2QO3A 1VMBA 1WG4A 4CLUA 3VALA 2VG5B 3Q89A 3ZZRA 4DR2F 1S9FA 2Y8YA 2W9BB 3AA8A 3GV5B 2QRRA 2C42A 2F9DA 3V6JA 2ZZMA 2HGLA 2WCXA 3VHQA 5EWGA 1M5KC 3TVZA 3NG8A 4NWBA 1FX2A 3QAUA 2ZH6A 1U2CA 1X0FA 5KFQA 2KXHA 4LQ9A 4RZRA 1IBKF 1AFIA 4DQSA 3MEKA 2FHJA 4OZNA 2Z56B 1TZ0A 1RWNB 1M5SA 1X5TA 3D1HA 3HMJG 2ZHAA 1B0VA 1UFKA 1KOHA 2H1YA 3I32A 2JLEA 4PG6A 2JC0A 2RRNA 3DKDA 3HD2A 4BLGA 2LQJA 4GKKF 2OJ3A 4CLSA 4FVCA 1WTBA 2EVZA 3GILA 3T1YJ 2KO1A 5IT9Y 1M1KT 4DUZJ 2UVVA 4N41A 1N0VC 4JYAJ 1KONA 4AUKA 2W8LA 2BZ2A 2FHJD 3PEJA 4HI1A 4OZ1A 3OSPA 4OLOA 4B9TA 3U7JA 5J1NA 4ECSA 4NA2A 3LF0A 3EICA 1NNDA 4I7FB 2ZOGA 2OEKA 3IMQJ 4ZIVA 3M8QB 3PO5A 1S6QB 2KDOA 4ZKAA 2XO6A 2N3LA 1HNZJ 2HMIB 3J80Y 4LF5J 1M0SA 3L9ZA 2YH1A 2HBRB 2F65A 5IT4A 3GU0A 1HI8A 1FVQA 3N6MA 4DLGA 1BHNA 2MQLA 3FGVA 2I8EA 4LF1A 3NWGA 4ED6A 3OR2A 2V8VA 2RU9A 5LMNJ 1WJ9A 1S48A 3PR4A 3CDWA 2NQPA 1NCLA 1D0EA 3FSYA 2HQIA 4PAAA 3E01A 2XZWA 3OVBA 2FJXA 2FY1A 4Q0BA 2QIFA 1VRQC 3K5LA 1NDPA 1REGX 1XBWA 4CP5A 3M9NB 2HQFA 2DPJA 3OTOF 1FFWB 3PACA 2IPOB 2CWKA 4M5GA 3C8YA 4DG1B 2YX4A 3FCHA 2CQBA 3ONQA 3TI0A 3EGVA 5DO2A 3MOZA 4OJ3A 3OL9A 4FXWA 4HKQA 1CQMA 3DRYA 2R2SA 2W7PA 2MZJA 2AW0A 4DN9A 1HNWF 4ES3A 3K17A 2EPIA 1PG5B 4OQJA 3HXMA 1T9TA 3NBPB 3OBIA 4USUA 4HLBA 5T7LB 4JV1A 1RHKB 2I38A 2FJEB 3Q8QB 1CSJA 4KR0B 4RL1A 3I55S 4NOHA 5KFZA 1PJ6A 2H5IB 4IFVA 1XMQJ 4QYZJ 1AXQA 1RT1B 5IC4B 4YB6A 1WEXA 4LF7F 4H4MB 3R8YA 2EFGA 2HIYA 4PZVA 4LR8A 4UTGA 4EU0A 5LM7E 1O6XA 5LSOA 5A6WA 4F26A 4RW7A 1JJHA 3GCWP 1K44A 2DY9A 2EI5A 4OI4A 1T05B 1RBLA 1GNKA 4JOUA 1RHJB 5HBMB 3MURP 2FVRA 1BMQB 1IKXA 1ROFA 2MTLA 2CNNB 1ACMB 2BRKA 1R8CA 3ILOA 2NUHA 3MAQA 1VQKS 1NRKA 3DDIA 3LO3A 3TNVA 3UCGA 1EP4A 3OUYB 7FDRA 2OPRB 4KGKA 2AGPA 3MEDA 1NEEA 3PW7A 1LK7A 2D69A 2HVZA 3M1VA 1KLMA 5KFTA 1KQKA 2VQEJ 3CCQS 1KVKA 1C4CA 2Y1IA 1U1OA 1PO6A 2DEJA 2R7SA 2GAHC 2DNYA 1F5AA 2OPSB 2DJWA 3LP0A 2YKMA 4UOHA 4J9UE 3J81j 5HLFB 1QSYA 4ED8A 1K9MT 1DARA 2VPWB 3VAFA 3GE9A 3FVYA 5M2PA 3CPWR 3GIRA 2MPUA 3PRBA 6FD1A 2IAJB 3VTIA 3G82B 1Q0NA 1QJHA 1S1UB 4L73A 1HI0P 5HVGA 4G1IA 2OO4A 5F3TA 3T5JA 2ZM6J 3HJFA 2LP4A 1U24A 2X51A 4YUDA 2XI2A 3ZZTA 2XZTB 2MKHA 1M5VC 2Z8QA 4C98A 1U02A 1ZPVA 1GX5A 2VC1A 4C4WA 2F1FA 2GIRA 2XWYA 1V3RA 2N82B 2JNJA 3D6FB 1FK9A 4YY3J 3ELHA 2A10A 1JLGB 4LREA 1RT5A 3KHGA 1KFDA 1K1SA 1N4LA 3QFHA 3TA0A 1LNQA 5RUBA 2E44A 2FHKA 5KFAA 1NKBA 2JEFA 2OLWA 2R7WA 3NAIA 2ADBA 1BQNB 1BQNA 2C3YA 5KFEA 1B7FA 1TV6B 3GFHA 3BN4A 3IC1A 2BEFA 2JVOA 2CQ0A 4KE5A 4JI8J 5KFHA 1M90T 1LW2A 2L48A 4LRBA 4B3MJ 1MN7A 2ZBQA 4CCHA 1S99A 3R6GB 1HNWJ 4WBFA 1BXNA 1FRJA 2HFOA 4DQRA 4HT5A 3D1OA 2RQCA 3R27A 1X7VA 2JDJA 3UR0A 2BA9A 3QRRA 3D6HB 1HPZB 1WHXA 1BWEA 4CLPA 1FHTA 5KFSA 1EHWA 2F8HA 1JLCB 1HMVB 2MHEA 4TYAA 2HVEA 4DL6A 1B3TA 4K7QA 4HVZA 5KG2A 3A1YG 4IH5A 2KYXA 5H1SV 4JI0J 1LEOA 1RDRA 1SQGA 4OJHA 1NDLA 2XMVA 1X4AA 5MLCV 2VOOA 3G82A 3MR7A 1MMLA 4FPIA 4HACA 3W5YA 3ILIA 4UOGA 4RW8A 5HI7A 4RU2A 1VS3A 3QWPA 1GT8A 4I68A 4OX8A 3KLIB 2UUCF 5D4LA 1Q8LA 5HROA 4CH7A 1NK8A 1S1TB 1KP6A 4F02A 2W7AA 4S0MA 4O3OA 3TVYA 4CLFA 1LWCB 1HQ2A 4DL3A 2ADCA 4NX9A 4Y6IA 2GNKA 4W90B 4DX7A 3J7YI 3MCNA 1N6QA 3M1VB 2CQ1A 2JHEA 4FZVA 2DHAA 5JMNA 4FYYB 3GQCA 1IN0A 4J9OA 1IXKA 4DLEA 2NPIA 3KJFB 2ALZA 1HNXJ 4LIRA 1TKTA 2FLOA 2IA6A 2B3TB 2IVFB 3TUZC 1JXLA 4OYOA 3JYTA 4LRFA 1WNEA 1AUSL 2DBBA 2DGVA 3TJ8A 5F8MA 5DETA 4R0JA 2KG0A 3T5HA 4DR6F 4X65J 4ITSA 1VLOA 3U1NA 2HNDB 3UI3A 4P72A 3RYLA 1R8HA 3ETOA 3HT3A 2GS8A 1CEZA 3K59A 4RO0A 2HG4A 3NNAA 3CJQA 1P9QC 2GQQA 3DLEB 3ITHA 2MY8A 2ALYB 2NCKL 3Q8PB 1N8RT 2OHDA 1QD1A 2WVCA 1N32J 1SJRA 2FJBB 2MQNA 3LWLA 4PG8A 3MTJA 3PM9A 1T9YA 5JVGQ 2HFZA 1U48A 2FVPA 4DR3J 4ECWA 3W3SA 3KLFB 3HVTA 2WOMB 3ZZPA 1CJUA 1RHRB 3N5FA 2D7SA 5T14A 3I56S 2C2NA 3EJMA 1FNOA 3GV8B 2R2TA 3CMAS 3DLHA 3IFEA 4MKVA 2ZE2B 3FCWA 1U6ZA 3D6MB 2MQPA 1Y00A 4ECQA 1UVLA 4ZHRA 3BO2A 1J5EF 2LEPA 3UN2A 2CJYB 3DXBA 3AB4B 3CGIA 2UXDJ 2XS7A 4K59A 1N33J 1RWOB 1OSDA 2JC1A 1YVFA 4OFZA 3NBPA 1RWWB 4IG0B 4IFYB 4Y2AA 5C2GA 5KOWA 1R7IA 3JTOA 1L3VA 4G1QA 1RTHA 4HDGA 3V5RA 1X9WA 1VQ9S 1HBMB 3I0RA 2B43A 5EGYA 4UF4A 4X62F 4DL7A 2J6TA 1NM2A 5L1LA 2G2ZA 1VBKA 4WCEQ 5LMUF 4ZOSA 3IWXA 3ENAA 3KLGB 4KRWA 1WI6A 1FVSA 1RTZA 2DITA 1O5JA 2LDYA 4Q2MA 5J2PA 4XIUA 5D0EA 1U49A 4J90A 4EUVA 3EZUA 2XQCA 1H74A 2PI5A 5IWAJ 3GONA 3UD4P 2BKOA 4OHZA 6AT1B 2H48B 1FO1A 3I5CA 4DU7A 2GGPA 1HWIA 3QT8A 5LSLA 1BQXA 1S1VB 3IA0A 1XR6A 1ZAWA 4O4RA 1JIHA 5H9FK 1WC4A 3HVAA 3O1LA 2P2CB 4PQAA 1IBMJ 2UVRA 1IKVB 3H5UA 3CJ2A 1TKZA 3EGZA 5IQ6A 3O3LA 2C2RA 3MPDA 1OJ4A 1ZH5A 3KFWX 1ZETA 1JB0C 3HSJA 4IDKB 2VG6A 3W8PA 1VQ7S 5AE3A 3MM7B 1WDDA 4AL6A 2EWHA 1XEZA 2AJ1A 2VZ9A 4TKTA 4TVAB 2X1AA 1LV5A 1JX4A 3UDEA 4U6PA 3HHLC 5IOLA 2ZUAA 1AT1B 1VK3A 4JI4F 3G6VA 2RQMA 3KJVB 1U09A 1Q53A 1WHVA 2GX8A 2LCWA 1H3DA 2X1BA 3OTDA 2O5DA 5L46A 2XY7A 2OD6A 1B99A 3NCQA 5J2PB 3VAJA 3H40A 2Y8WA 3KLGA 5KFIA 1R6VA 4QCLA 4C8NA 2K7JA 1E6YA 3UN3A 4IRCA 3HJVA 5KFYA 3IN5A 1M1HA 2QC3A 3KG0A 2UVWA 1FXLA 1OPZA 2F3JA 2K7KA 1J5OA 1V5VA 1RU1A 4NA3A 3MZIA 4Y0FA 1WKKA 1HI1A 4WFYA 1NJWA 2W9BA 2RDDA 3QIPA 4IFYA 5KT4A 3FJ2A 5KFWA 1FWKA 3HK2A 1QY7A 3DM2A 4CLZA 4M1KA 2OH2A 2GVDA 2UUAJ 1WC5A 4R8UA 5JUMA 2V8GA 1H7XA 3FEXB 2WVBA 2XCAA 4RWWA 4DXLA 4R5PB 3A13A 1DTTA 3OLBA 3E2EA 4ERDA 3AD9C 3LANA 3D66A 3J7YU 1CJUB 4OI2A 5IXUA 2ZEJA 2KZMA 2JL9A 1P27B 4ANEA 1WF1A 3QO9A 3GJTB 2VJUA 2MYFA 3EPGA 2PT0A 2QLBB 2AJ4A 3OJSA 3ISND 1FD8A 2VG7B 3NXZA 1A0OB 3ITHB 4CRJA 1WACA 4LFAJ 1RAEB 2WVEA 1HW9A 4DS4A 3RB4A 4ZA1A 1DY3A 4C0HA 1NH8A 1FJEB 3MM8B 5L1KA 2HSEB 1S77D 1WUUA 3R5JB 1GMVA 1V3ZA 2CADA 2JEJA 1FCAA 5IS2A 2KI2A 2HHSA 3FEZA 4B3TF 5CYJA 1UWBB 1Y3JA 3HFVA 1BY9A 3HKWA 1DTTB 1RWXB 1RZMA 3PVXA 1I94J 2YX7A 2OPQA 4M5DB 3IM9A 4JI7F 3DM2B 4ATNA 3M30B 4ZPWR 5HMYA 3V4IB 2CQPA 2VFRA 1L5UA 2HIQA 3QRPA 4MFBA 3WX8A 2W24A 3PYDA 4MH8A 2UV8A 3CSKA 3MAHA 2VBYA 2IYGA 3NAHA 3W9JA 5AJ3F 4J9MA 1UVJA 8AT1B 1VGYA 2BOAA 2O3DA 1JLFB 3HZEA 5AXKA 1GTHA 1L3UA 2QLXA 2MKCA 5ETRA 3QIDA 1TL3B 1JLCA 4PR6A 2XY6A 5F8HA 1ICEB 2G13A 4O3RA 4XPCA 4OYXA 2XG8A 1FKOB 5K5MA 3WC0A 3DHXA 1QDUB 5IV3A 2R8IA 3IS9A 4IQXA 2V94A 4J37A 1RK8A 3PJ9A 4JI6F 3JAMY 4W92B 5K8OA 2ZD1B 3OTBA 4QIWD 5K14B 2XLKA 2A3JA 2LECA 1WDTA 4DUZF 2GW8A 3GB0A 4DQQA 4USIA 2XGQA 1RHUB 4H4KA 3GR1A 1F60B 3ZFVA 3TUPA 4IDKA 2LEAA 1ZA2B 2YKOA 4NASA 5K8MA 1P9YA 3MR3A 5E41A 2KXFA 3OFGA 4QWBA 3MMBB 2HVIA 3HULA 2EEYA 4DR1F 3FZ2A 1Y10A 4ZPVR 5SZTA 1H6KX 2F7VA 2DXEA 1XMOJ 4QIGA 1RT2A 3P45B 4RKUC 4WTYA 2GO9A 4H54A 3QYYA 3NGSA 2J0XA 1FX4A 5F9LA 2J6UA 1FRMA 1QAYA 2DCLA 2QFJA 2RS2A 2V8HA 3DI6A 4NL5A 2FZKB 3I31A 3QATA 2D3ZA 2J0WA 2L9DA 4FNIA 4U8YA 4C11B 5LSRA 2V2QA 3MPWA 5CCLA 4ELTA 4PG7A 1XNQF 3SZ2A 4QBUA 2FLLA 1Z2LA 1WEZA 4ID5A 5AXNA 4CO5A 2Y3YA 4Z2XA 1YZ7A 4DV5J 2E5LF 1KTVA 4TY8A 3IGVA 2CVIA 1S0MA 2OPSA 4R0EA 2QV6A 4F4ZA 2XNQA 4FF4A 4OZLA 3HP6A 3KG1A 1P1LA 3CCZA 3CD7A 3EVMA 1K1QA 1RA6A 2NXUA 2YQ0A 1C1BB 3TEGA 3SV4A 4LQ3A 1UKUA 2IRXA 3VF0B 4U8VA 3HSZA 4BHQA 1VQMS 4B9NA 1ZM2A 1S5ZA 1T94A 2YNIA 4M5HA 4PXBA 2NXNA 4P74A 2Y1RI 5D15A 4O0IA 4U7CA 5HMZA 1E6VA 3NLCA 2COLA 3K5OA 1VCTA 1VQLS 1T02A 2HQCA 1R8PA 2OSQA 4CLYA 2NSCA 3VAMA 1QAIA 1VQSA 1H7WA 3BKUA 2XYPB 3H5SA 2DH9A 5KOXA 1R8BA 1X4DA 1Q4RA 2CPDA 2M3DA 2BE9B 3M6VA 4NLTA 3W62A 3WX4A 1K0VA 5KTQA 4IG3A 2LVWA 3TR5A 1X4HA 2BOPA 1A6LA 2HFNA 4DV0J 3I4PA 2W4CA 2MKYA 1FDAA 4NLYA 3OFHA 3Q8YA 4YR3A 3VZHA 2IRYA 2Z2MA 4EK2A 3Q0AA 1X9MA 2HS4A 4UQTA 4WTOB 5ETKA 4DCOB 3ZZUA 2V34A 2RDJA 3C6UA 5D6GA 4RUBA 1VJWA 4DI6A 2CJKA 2YWFA 4F3MA 3G9CA 2ZWOA 1VRUA 1C1BA 1GXLA 2V2ZA 2DT9A 4K4WA 4ER8A 3AODA 2AJ0A 1U2RA 3NGRA 2HHWA 4OI0A 1N5YA 3NS7B 1BWVA 5GADU 3T6BA 2RE1A 4P52A 3SSRA 3UWTA 4UUWA 4BBYA 2B6AA 5HROB 2B4PA 3UFCX 4TY8B 5I4MA 1TK8A 4RW8B 3D6TB 2VBZA 3KJNB 1XTZA 3FSXA 2H54B 4ZPCA 4RNNA 1YJWS 3IXQA 3SSQA 2WB1D 2BACA 3CJKA 1HMVA 4JUZA 4J7CA 2OIHA 1WKLA 2AD9A 3CUNA 1H0HB 2LA4A 3B82A 4EBDA 2D9PA 1AUDA 2D41A 3DMJB 3PYEA 3MOJB 2UXDF 5E3PA 3AQOA 4TLQA 1G3OA 4QYRA 4CH1A 2VDHA 1NKEA 4ZDNA 2D9OA 3HF5A 3J7ZT 3T19A 2MDAA 4CIOA 1OS5A 2FYXA 3MMBA 1LW2B 5ETNA 1TK5A 2IJFA 4DV1J 1XNRJ 4WZMA 1S6UA 5KFBA 1RYSA 5LL6d 1S6QA 2HMIA 1TV6A 4DZ6A 4DSEA 4I7FA 2ZKUA 2ZVIA 2C3MA 4KGXB 1IQZA 3BGUA 2DK2A 3CNQP 3M2RA 4P9SA 4ZN3A 5C24A 5E3CA 1AA1B 4RBTA 2J0SD 3O44A 2ZD1A 5DG8A 1EJ7L 1RTIB 4AE5A 5HK4A 5B7WA 4B3MF 5L1IA 2JEIA 4DWIA 3W2VA 2X1FA 2YWWA 1FKOA 3K8WA 4LR7A 4NXMF 3M2UA 1BUXA 1N88A 5GADI 2DHSA 4CLWA 3P49B 2E1MC 2P9GA 1M5PC 1CJVA 2C28A 1PYSB 2HGNA 2E1AA 3KLVA 5BYRA 1WWHA 2B4UA 4L3NA 1IKYA 3GIMA 2YWKA 2V9KA 4O4GB 1Y7PA 1X4EA 1GFWB 5E7OB 2A6OA 4G3IA 2AQ4A 1N34J 4L74A 1LW0A 2J7UA 4B9UA 3DFEA 2OMOA 2ZOMA 3DCAA 1FF2A 2J0QD 2YKMB 1R31A 4MIAA 2VG5A 5U47A 4DX6A 2OSRA 3K5PA 3K58A 3S1TA 4WKRA 1U0SA 2IM1A 4NEYA 3PX0A 3HCXA 4ED4A 3MPVA 3KK1A 3AQPA 3B4DA 3KDNA 3MGJA 1WG1A 2CYYA 2DXDA 2OPRA 2EBGA 3DHWC 2B4VA 3A8JA 2IRUA 4Y34A 4JI2F 3TJ9A 1FD2A 4O3SA 3HSGA 1R43A 2AYMA 3DRRA 1VC5A 3TW0A 2M8HA 3CB4A 2DGTA 2V8PA 1IBLF 2U2FA 3JSMB 2R8GA 4DEZA 2LYVA 5HBMA 2J7WA 4NLRA 2BE7D 2QEXS 1TP7A 1YX2A 2DNOA 4K5SA 4P73A 4LBIA 3FMWA 5BYQA 1NZAA 1VQYA 2G2OA 4DZDA 1IR0A 3WQPA 1S9GA 4Q45A 2CXEA 4HL9A 3EDQB 3LUYA 1N52B 5CYMA 4X4OA 3UVJA 2CPXA 3QO9B 5CZVA 5F0UA 3UDLA 1JK9B 4CO1A 4H4MA 4AQYJ 3GFXA 3GJSB 3R6LB 3UCUP 1R0BG 4JI4J 2UUAF 1UEVA 4QIFA 1G6BA 3LPYA 3D2WA 2DGUA 2E7VA 1YJVA 2QMWA 2XMKA 3GJQB 2M5YA 1SL2A 3MDFA 2HZAA 1M5OC 5GAGU 2QTWA 4JV2A 1YBAA 4PKDB 4ZMMA 4X4SA 4O23A 3T1HJ 3CJSA 1S9EB 1YRTA 1U1NA 3MI7X 3JSYA 5KFLA 1HHSA 1KNZA 2J9DA 1IM6A 3MCSA 3TAPA 3V2UC 2KJWA 2AT1B 3TAMA 2VONA 4F67A 4XO0A 5LXRA 1C0UA 4NXNF 5T41A 2A0FB 3MAAB 2Q6CA 3UN5A 2HHHF 1OY9A 2PMWA 2VBXA 2R2UA 4JI3J 4B3OA 2WHOA 3W7BA 4Q0BB 3MMCB 2MSSA 4PEOA 1WOPA 3IM8A 4Q43A 4EZ6A 1N48A 3BBCA 4U9RA 4N8NA 3TX8A 4HHJA 2WVDA 4MK8A 4KTQA 1XK8A 2DGSA 4WJBA 4ECZA 2CQIA 3MEEB 2POKA 3GV7B 3QFWA 2IM3A 1FXDA 1S7IA 3JB9k 4JI0F 4DOZA 4JI7J 1F3VA 4PABA 1NJZA 4Z7CA 2BUNA 2BQRA 2CNOB 5DDRC 1EETB 4CYUB 4HI2A 4ZN1A 5L39A 2RS8A 3CMES 5KFXA 4XDDA 1RTDB 4J9NA 2CJAA 3P96A 3CULA 2DGQA 3G87A 4OYBA 3S6EA 4EFAC 3DRPA 5L38A 4KHRA 3RBZA 2CJBA 2VA2A 2CPEA 2KB2A 1HWJA 1S1VA 3FBEA 3HFZB 1C1CA 2J9DE 4H4OA 5GMEA 2IJNA 1FKAF 2VKZG 2HEKA 3POTB 4A8OA 1FDDA 1L3KA 1HD0A 2APOA 2UV8G 5DDOC 1X4GA 1IJFB 1RUSA 1NJYA 1RT4A 1SIWB 3I96A 2KM8B 1HKAA 3EMTA 3LGNA 1TQLA 2RQKA 3PHEA 4GC6A 2V4JA 5J2MA 1ITPA 2Z57B 2EFNA 2UXCJ 4B3SJ 2FLPA 5D4NA 4F0HA 2DR6A 1CJTA 3IG1A 2ZJQQ 1VBZA 1FKPB 2AEJA 2QLFB 1QVFR 4CZCA 2DR7A 1FRLA 2VC0A 3HZGA 4MTPA 3NNCA 4EO8A 2IVMA 2DVIA 5EWFA 3BKFA 3NGDA 3KHLA 1NO8A 1EKRA 1AZSB 1RTJA 4CDIA 3VAHA 1ZTTA 2R8KA 3DYAB 4YMEA 2W01A 3I0RB 2AZ3A 2DISA 2K8GA 4UW2A 1D09B 5CQGA 3NS6A 3I5AA 1AW0A 1RADB 2EKYA 3TVKA 3IBWA 4KIAA 4EBEA 5KG3A 4P75A 1EIYB 3MM9A 4ID8A 5CCMA 3THVA 1S1XB 4DFMA 1SKUB 2FGCA 1Y11A 4F3OA 2E9RX 4K4SA 1VIOA 1L3TA 3HVTB 2BJ9A 3R7SB 1PAEX 1U26A 1ZOTA 4CTAB 3MM5A 4EWTA 4B9LA 4C8MA 1DAXA 4ZVGA 2RF2A 2IMWP 5KFMA 2AF6A 3VWSA 3QRQA 2VASA 3B4MA 3DLEA 4F4YA 2Z2LA 2CQ4A 2FPHX 2QE5A 2I0XA 3GYXB 4DU8A 5HQLA 1TMJA 2R7RA 5I42A 1DJ0A 4NXNJ 4LFCF 4RR5A 3KUGA 5LMUJ 2DGXA 4TQSA 2WONB 2YQ1A 1IWAA 3PJXA 3AOCA 1TAUA 4BC7A 3OW2R 5KFJA 3W63A 3JYTB 5IT0A 3H4DA 3J80U 1RAJA 4MYTA 4OZ0A 3KKFA 3TP2A 3BSCA 5GVQA 2L08A 1QTMA 4B3TJ 3IR7B 2Q79A 1PBUA 1ZM3A 2LQ9A 3AT1B 5GAEI 4Y00A 4DFPA 2B9EA 4I0WA 3HHLB 5ADZA 2DGWA 1LWEB 2YNFA 1CQNA 1Y5LB 3OTOJ 3G6XA 5GAGI 3L7OA 1WHYA 4WFZA 4PPDA 1R0CB 1S4EA 3DLLQ 4E0DA 2KH9A 3I82A 1F2GA 2M8DB 4WXOA 4KH1B 2CQHA 4X2BA 1RBAA 4HACB 4RBVA 3G86A 3P4UB 3MXHP 2LU1A 4NCGB 4K8RA 4M5LA 3G8TA 4QYZK 4PQUB 4J9QA 2NZ4A 5EX3A 4KHMA 2RMLA 2NS1B 2UUCJ 2MQQA 2EFVA 1Q5VA 2HK2A 5FLXY 5FJ4A 5JVHQ 1Q16B 1UPPA 4QJVA 3MEEA 5DGAA 1ZA1B 3DDNA 1S1XA 3A8IA 3RAMA 2VIHA 3RB0A 4Q44A 4FPRA 3DRXA 3GG1A 3UE2A 1S0NA 3MM9B 3GFYA 4BC9A 3FSIA 4WF9Q 1JLEA 2B7CB 2CUYA 3I4HX 5G4DA 4DDFA 4WKYA 3V6HA 2E9TA 1ZS6A 2ATLA 3LH2S 4G6VB 3MMCA 4WIQA 3BQ0A 5G0RB 1DTQB 3L09A 1BE4A 2JLFA 4RUAA 2V5HG 2OTJS 3CJ3A 2MKIA 3HPOA 2DNLA 2HK3A 1YI2S 2XM3A 3G6YA 1KRPA 1X31C 2R4FA 2XMJA 3PTWA 1SI9A 4GO7X 2N7CA 3BR8A 3W64A 2UP1A 5DG7A 1J2VA 1OQ6A 2ZUGA 2M4MA 1SH2A 1YJRA 1RT5B 3FBCA 2JH3A 4LF5F 1VQOS 1WSRA 2LXFA 1T9XA 2DO4A 2M52A 3ADAC 3AFGA 5IM0A 3CCSS 1FDNA 1N5TA 2K1RA 4ENOA 4ANCA 3BJYA 3TEHB 3MCMA 4U7UK 4DSKA 1V3SA 1RI7A 1NK7A 1BD6A 3WZ0A 3M2VA 4OHWA 3EDRB 2DNMA 3L4BC 4GVLA 3H59A 1AFJA 2VB6A 4OHXA 2PN6A 3KJQB 4YB7A 3C66A 4WWSA 4XTTA 3T41A 2BYCA 2YBVA 3SSSA 3UQSA 2ZH2A 4N8OA 1U45A 1TL1A 2JZ5A 4NZ0A 3VR1A 4TU9A 2HKEA 2W4DA 3H5YA 5KFPA 3JSBA 3D0IE 1EETA 2HS3A 3FDSA 4OZ3A 1VR6A 1F9HA 2OP5A 5E3AA 4CYUA 3LGMA 4X62J 2KG1A 2WTFA 1JJ4A 5B0CA 2QMXA 3RB3A 5AE2A 4LF9J 4K0KJ 1BLUA 2RH3A 3TZYA 1VIXA 2HWIA 2VDIA 2XHCA 4HHUA 1SV5A 1QE1B 1GTEA 1T0TV 1UZDA 2OMLA 3V4MA 3KK2A 1WORA 1WSVA 1ZM4A 4KT0C 4NLQA 4ZS6A 3V6DB 3PO4A 4ZCKA 2MKJA 4CLTA 1RT6B 1S97A 2HHUA 1OWXA 1EP4B 5F8IA 2WRMA 3JSRA 2GAGC 2RQ4A 1RT3A 2EW9A 3OHAA 2NREA 3X1LB 1QM9A 2B5JB 2UU9F 2MQMA 3JTNA 7AT1B 1H98A 1NK4A 1T03B 1QVGR 1RT7B 2FJAB 1RKJA 1UMJA 3IWLA 3CCES 3EPIA 1Q86T 1T05A 2R7XA 3GWCA 4OI6A 4B9SA 4YOEA 3W66A 3TAMB 3BV8A 3BGRA 1WF2A 1Z4UA 2BJ8A 4CI0B 4PYDA 3VZIA 3BF4A 1CULB 1RSCA 1O51A 4PWDA 1P6TA 3SDEA 4X84A 3ET6A 3TA2A 2CNLB 2ROEA 3P8BB 1VRTB 4C6AA 1I3OB 1RQ0A 4DV6J 1YJ7A 4LRCA 1YG0A 3M9MB 1KR4A 5E3QA 2CJ9A 1F6TA 2HNYA 2MGZB 2FJWA 3RU0A 5DG9A 1D1UA 1Z1ZA 1SC3B 4JI2J 1RLCL 1BGXT 1W2IA 4JV0A 4ED1A 2Q6BA 5F0WA 5DZ7A 1JLAB 4MIBA 3KK3B 2NXJA 3HHNB 5H9FJ 2BJ1A 2QA4S 2RHSB 4I69A 2BW2A 2KJVA 1CPZA 1KBRA 1SJ1A 1B4SA 1S9GB 1F1BB 4DJBA 5L9XA 2BW7A 1U1QA 1Z2ZA 2UUBF 3AHPA 3M8PA 2AEFA 3HT0A 3AOAA 8ATCB 3M05A 2DRBA 2AV5A 3ZC4A 3C3LA 2WBRA 2FJDB 4RUCA 3Q8UA 2ERRA 2CWXA 3DRRB 1ZAVA 1MG7A 2EFQA 3R2CJ 2EK1A 2VUGA 1K0TA 1YDLA 3E01B 1XMOF 2P6TA 2HZVA 4LRDA 4NI2B 4RNFA 2N4CA 3VAIA 4WFNQ 4G65A 2CG4A 3RBXA 1WEYA 1YBUA 2JFKA 2NLWA 4HTIA 2ZM6F 4OYIA 1HBNB 1HBNA 3GSDA 3KOAA 5IT9U 3DXSX 5A8KB 4F4KA 5HVHA 3AOBA 2KU7A 1NK0A 1XJWB 1RWMB 1S0VA 3H90A 1Q82T 2XGPA 1DRZA 4K4YA 3HM9A 5A0YB 3VQSA 5HAOA 1U7LA 4U7UD 1LW0B 3Q23A 2KN4A 3K0JA 2H4YB 1X5PA 3CD5A 3GG0A 4KO0B 4YEAA 4ZVUB 4KHPJ 4DV7F 5J2NB 3M8PB 4PG4A 2UVUA 2DNHA 2IVYA 4N76A 4FS2A 1XIQA 4LFAF 1MU2B 2HHHJ 1MWQA 1PBAA 5DJBA 5GMKa 2Y0BB 1RWUA 4LBHA 4YDDB 2X3GA 3M7VA 4LBPA 4OHVA 2ZH5A 3SV3A 1FRKA 2LFVA 1JLAA 3OSNA 1VRUB 4QR2A 1VQ4S 2HVHA 2B8QA 4JB8B 1S7HA 1JLBA 3DN9A 1CVJA 3H5XA 4YFUA 4ETXA 1TKXA 5H9EJ 1YJTA 1OSCA 2WAQD 4NLXA 2L9WA 2MGZA 3C6UB 4Q8EA 3NMAA 1XR7A 3H98A 2NR0A 2BKPA 2FC9A 3M2RB 2NXCA 1VRTA 2GC8A 4NA1A 4Y2MA 3SFUA 4ILRA 5B0BA 2AYBA 2WVFA 4A8YA 1MROA 3TRGA 2F63A 4Q5VA 4IOAQ 4NMXA 3SDEB 3ZTPA 1HW8A 1MMNA 4LF4J 2FHMA 2QN6B 3MFIA 1YQHA 1F2HA 2I6WA 2XMUA 4P71A 4C3LA 1UAWA 2WSCC 3ZZOA 4CLLA 5C2CA 2Q3PA 1VDHA 3GPAA 3KYLA 2MSTA 5CA5A 3G96A 5A0YA 1R3NA 3EGNA 3CEDA 4B3SF 3N79A 1T03A 1UEUA 1E6VB 1JXVA 3AJ1A 2B5JA 5A8KA 2HWTA 1PYOB 3HI9A 1RT3B 1SL1A 5A8RA 5EN1A 2ZNYA 3TJAA 5KG6A 2A2DA 2YNIB 4O3NA 3PKMA 2FLNA 4TU8A 1REVA 2VBWA 1JNRB 4IYQA 4FF1A 4PG5A 3THPA 3KK2B 5KT6A 5J1EB 3GYNA 4LFBF 1QE1A 3GMGA 4O3PA 4ZCMA 5HMXA 5HANA 4KY3A 1NK5A 1SIZA 3C14B 4KKOA 4LF2A 3ZTRA 1VI7A 4WYWA 4I56A 4C7QA 2B6AB 3W9HA 4ZITA 1H2TZ 1SC4B 2KHCA 4YN3B 4RNMA 3JQJA 3PW0A 1WOOA 4YB1P 2QJ3A 3P5TL 4M5NA 1YBTA 4WPAA 4LVOP 4YP3A 4DR7F 1S6OA 3IAS9 4GRSA 4IH6A 1R0AB 4M5MA 3DI6B 5KFKA 4DR1J 2DNNA 3CVKA 1R89A 1H73A 2V67A 3M2VB 4R25A 1PIEA 2HNYB 2F9JA 4USWA 1SJFA 4OX9F 1UJ5A 2YWEA 3BB5A 3M6WA 3M6XA 3RRHA 4ZJOA 3K89A 2VQFJ 3ET6B 2H3EB 4ED3A 3QZ7A 4ANDA 5KFDA 3MUMP 1NPRA 2LQBA 1HIYA 2MY7A 1KFSA 1Y4ZB 2DHGA 3AY0A 1URRA 3T1HF 4C8OA 1OY8A 3LP2A 3QWUA 3MMAA 4P10A 4OX7A 3RBEA 2ZC4A 5JJBA 4M8LA 4KFBB 4IO9Q 1RT7A 4HH0A 5C25A 4NZ6A 4QWDA 4A8FA 2VL1A 5E5NA 4QR1A 2XYGB 3QMQA 3J7AN 1DTQA 3A4TA 2R8JA 4UY85 1RAGB 4RPFA 5AT1B 1FA0A 2PIIA 1H2VZ 1ULRA 2Z58B 4M95A 1YLXA 4ZCLA 1RT6A 4NCBA 4MK9A 4YB5A 2ZBCA 4ED0A 2XI3A 4X4RA 3RW6A 3OL6A 5L9NA 3FC9A 1NJXA 3MR6A 4HDHA 2EXUA 1I5OB 2ILZA 3VVTA 4RW4B 3TYTA 5BR8F 1KC8T 3C46A 2YY3A 4OIXA 2HRYA 2OPPA 2XSJB 4FYWB 2XLIA 1TL7A 3TQ1A 3J7Z5 4DSJA 2FIUA 3BSNA 1VC6A 2GJIA 5D77A 5C42B 2DTJA 3UD3P 4K2XA 4K4ZA 4MFBB 5C7PA 4HEA9 6FDRA 1F9EB 4LSLB 3BH6B 4LMZA 2C2ZB 4LSNA 3JAMU 1Y5IB 3V4IA 2ATCB 2JEGA 5KFFA 1CS4A 1XN9A 2J7KA 3I0SB 2XS2A 3OTCA 5KFGA 2BJ7A 4CNZA 5F8NA 2EK6A 1NJIT 4JP8A 5C5JA 2A2CA 5HN0A 5B0EA 2EC2A 2FJVA 4M63A 4TQRA 2Z2ZA 1O8BA 1T7PA 2G9OA 3DGPB 2K3IA 4JI6J 4LFBJ 4I6AA 2RRBA 1O0PA 3R5GA 1Y3KA 4F25A 4UT4A 1CG2A 2L3MA 2PI4A 2K3KA 3PRDA 4FKXA 5AXLA 4C8ZA 3O5TB 4NLDA 1YWXA 4B08A 2A1BA 3Q24A 2CDRB 4B9MA 4Q2LA 3U27A 3FFIB 2J9CA 1IKWA 3KUEA 2HGMA 2FD2A 2OGUA 1HQUB 2DNKA 3MM5B 1U6FA 4KB7A 2HZCA 4ZCIA 4P2MA 5B0DA 1G1XA 1JLEB 1Q7LB 3MD1A 1YJNS 1KQSR 1KVJA 1RAHB 3IS9B 1XERA 5EWEA 2EG2A 4QWEA 1NK9A 5KG7A 4R5PA 3H4BA 3KLHA 4ECTA 1HHTP 1RCXB 2C2OB 1RISA 1S57A 3OTEA 3EUNA 4KC5A 1FDBA 3CCLS 1SQEA 1GH8A 3DLGA 4I1TA 4NLPA 2HHQA 3G8SA 4YHHJ 2AKWB 2NXEA 2ASLA 1NZ8A 3M32A 3M8ZA 3EYZA 3RUBL 2LA6A 5LJ3Y 2GHWA 4FP9A 4C3KA 3GIKA 2D3O1 1FFGB 4ED2A 1NSAA 1X0PA 4CM2A 4HR2A 3QGGA 4ED7A 5F8LA 2ASDA 1J5OB 3R3TA 1KN6A 3W5XA 2G0IA 4DR5F 1PJ5A 1GK8A 4LUBA 2YPYA 2YNGA 4EGLA 1MNEA 3C16A 3PG9A 2QMUB 3PXGa 4ZPTR 3BZQA 1SPBP 5CD4A 2C22A 3NOGA 4K0KF 1YRUA 4DL2A 2BM0A 4DL4A 3IG1B 4YS2A 5BYSA 4M5DA 3D1QA 3PW2A 5E2QA 1QTNB 2IA0A 1FTCA 3CJTA 2QFIA 2DHHA 3BGLA 2DCUB 3PJWA 3DLJA 2PA3A 5JXSA 3RJMB 4C2MA 3RGIA 2DIVA 2E5GA 4RJVA 2BBEA 3JS9A 3PFOA 2FUG9 1UWBA 4UQGA 3OHBA 5A8WA 1TTHB 1VLYA 3CDBA 2WW4A 3MPUB 3QSYB 2QT7A 4NLUA 5A76A 1WELA 2UU9J 3U1MA 2WSFC 2GJFA 2WONA 1NDKA 3UNGC 4UZBA 2Q1LA 3ENWA 3OJUA 1PILA 4DHVA 5IQQA 3ZNJ1 4E2FB 2VICA 1RKIA 3CDEA 3MM8A 1SKRA 3MHYA 1DLOB 2I9SA 1S6PB 3BDPA 4LF9F 1VQPS 1VISA 1RTDA 1Q78A 3CIMA 2CPJA 2ZH3A 2GHVC 1TL4A 3UDVA 1M5HA 2OUGA 3CW2C 5DQGA 2GVZB 3WIVA 1HQEB 5IWAF 2NYHA 2ABYA 4ES2A 4NRUA 2R9LA 1FESA 1FI4A 2GQCA 2JRSA 2Z4PA 1Q79A 4F2RA 4PRFA 4U95A 5J1PA 2MKSA 2PMHA 4WE1B 1HNVA 2CPYA 5B08A
chains in the Genus database with same CATH topology
3QIPB 4Y65A 2GIQA 4ZVFA 2ZJPQ 5D4OA 3DOKA 4PXCA 4X4UA 3BREA 3MECB 3PX4A 4L72B 4OJGA 2Y0SD 4QR0A 4ALZA 1HA1A 5HMWA 4GMKA 4ZVHA 3NNHA 4KSEB 3MUVP 3DOKB 1I6JA 2Q66A 1S9EA 4AL5A 3DOLA 3PW4A 4L6V3 5E0OA 4MKBA 2UUWA 2PGCA 2AX0A 2V4JB 3O6QA 2E29A 4OJ1A 2LXUA 5J2MB 4DR3F 3V6KA 1HNVB 3T1YF 1Q1KA 3OVSA 1X5OA 4KBIA 2BJEA 5FDLA 2ZH9A 2GMJA 4FXVA 2UXBF 4IH7A 5DLGA 1N33F 2VG6B 4I4BA 1KD1T 3DRPB 1IJEB 3DRSA 4DX8H 5B09A 5ITHA 1HWKA 3JTPA 5DGBA 4MMOA 2ZH4A 1KTQA 4P6QA 4FBUA 1YJ9S 2B56A 1KOOA 2MJUA 3JSMA 2HNDA 1APSA 1SC6A 3EXCX 1UVKA 4ZPAA 2K2PA 2GGPB 4I2QB 4F2SA 4IR9A 1KQFB 4IUFA 2M9KA 4QU6A 3KLEA 4YY3F 3CC2S 1FEEA 1U1RA 4WU2A 1HBUA 3LP1A 4B3OB 2V4QA 3B78A 4I64A 3WDOA 2XEXA 4WU3A 2XLJA 3BEGB 4OL8A 2YNGB 1C0UB 2MMYA 1N56A 2CZ4A 1SKWA 5B0FA 4J5OA 2PE8A 4YR0A 3EZ5A 2PC6A 3PFEA 2ZITA 4IG0A 2L41A 1XR5A 3DLGB 2F8MA 3HHEA 3R5BA 4N77A 4Y28C 2ZHAA 1I94F 5F41A 1HPZA 4M95A 2XC9A 2KYZA 3M2UB 3KMSA 3A8EA 1N0UA 2YQ3A 4URSA 5CHCB 3O8WA 3T6JA 3PX6A 1IUJA 1N54B 2B9XA 2VFVA 1WHWA 2XWXA 2VH7A 4RNOA 3IGNA 2FTRA 1XC9A 2EFOA 5EX0A 4O44A 1A9NB 2VKRA 4DSFA 3SEOA 5GAEU 1IKWB 1SH0A 4RLEA 1U1LA 2D3OR 4X4TA 4PUOB 1HBOA 4NPOA 5D78A 2FVQA 4F4XA 5D3GA 1RGVA 3TA1A 1SUQA 1VQNS 1JLGA 4C8KA 4ICLB 4RU9A 2YVSA 1ZBTA 2YNHB 1UVMA 4DN0A 4A8QA 2Y1JA 2DNZA 2V9WA 1ZYQA 5HL7Q 2IM0A 3DMJA 5HP1A 2ASJA 1FE0A 4D3HA 5DLFA 1PSDA 1S1TA 4CT8A 2RIJA 2RDIA 4C8YA 3KLIA 1ZM9A 1OQ3A 2LKZA 3S01A 3HFKA 4O4GA 3HHDA 1LK5A 2KT3A 4YDXA 2VD3A 2AYEA 1ZPWX 1FEHA 4DF8A 1N5YB 1HR0F 4GO5X 1LOUA 2YX1A 3SXLA 1U6BA 2B9WA 4B02A 4CO4A 2R2RA 5HP1B 3TO8A 1S49A 5CXTA 1UETA 2ZVSA 2AP6A 4KGMA 4Y2IA 2BRLA 3K2YA 4E98A 3W2VB 4NCAA 1WTFA 2FB0A 4YQWA 1CC7A 1WG5A 1RTIA 3NKYA 2WW8A 3IRXB 2OFGX 3OUYA 3GIIA 4MKYA 2BE2B 3X3UA 3OV7A 5C24B 4C3MA 2N4DA 3G6ES 3ENQA 3J7A1 1VHFA 4TYBA 2CDQA 5LXYA 1HBOB 2CPZA 4DSLA 2W9CA 3OR1B 2HHXA 3T3FA 5DM7Q 2GMHA 3IAM9 4RW7B 4I6WA 1YITS 1FTRA 1DURA 4J9KA 3N6NA 3AH6A 3CJ5A 1FK9B 2FGOA 1LFWA 1QAJA 3SCKE 3AJ2A 2XS5A 4ES1A 2QSWA 2F40A 1U47A 2MZSA 3KMQA 4IOCQ 3QLHB 4UY8T 1PC5A 1AROP 3QZ8A 4ELVA 4CNYA 1OIAA 5K9FA 1FJ7A 3VQTA 3CJKB 2DPIA 3F44A 2E5HA 3M9OB 2P6SA 3SFGA 2N3OA 3OL8A 3WC2A 2R7OA 3T1AA 3TOQA 2WBMA 4ZP7A 4F3QA 2LU2A 3SI8A 1KSPA 1DFDA 4LJMA 5HLFA 2V4RA 3LP0B 1B0TA 2ACYA 4ID5B 4AYBD 5THWA 5B0GA 3LWMA 1HWLA 4C11A 1HBUB 1UJ6A 4A47A 3MR5A 2WSEC 1LFPA 1UW4A 2HPUA 4A8SA 2C2DA 2VODA 3P6YC 2KTQA 5KT2A 2E5IA 2DRAA 4DL5A 5DM6Q 3KHRA 3QLHA 1FRIA 2NYIA 3N28A 3OVAA 3QJLA 1JNZB 3T9ZA 1I1GA 3S8SA 5DQHA 2XO7A 1U1PA 2HS0A 2BQ3A 3QJJA 1MMDA 1UJ4A 2LMIA 1ZZNA 2QYCA 3Q2TC 1R8AA 1TK0A 3BR9A 4DV1F 1OO0B 2MXYA 4TU7A 4AL7A 1GXTA 4WXWA 1MWYA 5KFCA 1S10A 4KHPF 2W9CB 2KVIA 5LT5A 5F8GA 5F3ZA 3R5DA 2W25A 1PC4A 2RB7A 3PEHA 1RT1A 4ZPDA 3LAMA 5FDLB 4Z37A 5LMNF 5K14A 4NYPA 1C2PA 2OAUA 3OLAA 4IO1A 1D3WA 5T7LA 1TKXB 4EYIB 4O3QA 3RAXA 3DLKB 2KFYA 3DOLB 4BWJA 2LLZA 4K50A 3N6LA 1HARA 3MUTP 3M8SA 4RX6A 3DDKA 2ZFHA 2GV1A 3PNIA 5I3PA 5AE1A 4J9SA 1FRXA 2NPFA 5MAOA 4A8WA 3HHKA 2E9ZA 2KXNB 2E7XA 1F5BA 1LXNA 4QPTA 2M70A 1YTYA 2RUGA 3RB6A 3CC4S 1TUVA 2QA2A 5M2RA 4DV4F 2IYIA 5AXMA 3OFFA 2OPQB 4WE1A 1W25A 1KLNA 4B17A 2F8EX 1QUPA 2YNHA 3SQGA 3K57A 4LVNP 4A8KA 3CIZA 3E8OA 4UOCA 2B51A 2O67A 2CJQA 1SUQB 2JSXA 2IFXA 3KHHA 4H4KC 5D3GB 3H2VE 1KHVA 5GAHI 1VBXA 1DLOA 2XCPA 1IQTA 5FIIA 2ZHOA 3Q8SB 2KFNA 2OTLS 4MK7A 2XULA 4O44B 3RBDA 1YJUA 1HFEL 2ZH7A 5A8WB 5DDQC 1TL5A 1N36F 5F9NA 3DU5A 1S76D 2RU3A 3UDCA 4R8UB 1FNXH 2P9EA 5D4PA 5F8JA 3MR2A 3EX7B 3K8VA 2N7YA 2SXLA 2HWHA 5BJRA 1P8GA 2DIUA 4LF8F 4B3RF 2P9CA 3BM7A 4NLWA 4UUXA 1G2EA 1N32F 3E51A 3K7RA 3KNAA 1NKCA 2RJZA 1F5CA 2PA8D 2PEHA 3GFZA 4RBUA 2FC8A 2JVRA 2ZDPA 3M32B 1RYRA 3M30A 4IRDA 1VBYA 3BS9A 3RRKA 1QSLA 4GKJF 1SH3A 1QUVA 2MJNA 2YKPA 2KZZA 4FBTA 3U1LA 2J9EA 3FRYA 3KJVA 2MB0B 3GIJA 1GXUA 1X4BA 2OD4A 2CFXA 1N5SA 1FXRA 4J9LA 1HNIA 4FS1A 2ZKTA 3V6DA 3KWMA 4I2QA 2CQ2A 1ELOA 1JMTA 2RKIA 1SJ3P 3MM7A 1NU4A 3FQLA 4KQZA 4CQ1A 3SCLE 1QAXA 2JLGA 2R7QA 4F4WA 1CLFA 2DH7A 5L1JA 2CQGA 2VG7A 2NSBA 2BVZA 4F8RA 4JI3F 1TL1B 1IKVA 3DRSB 2HLUA 4P7VA 2DH8A 2H9ZA 3E3XA 1SXLA 1BQMA 2IC3B 2AGQA 5I3QA 3I9ZA 4RW9B 4MYUA 2ZBIA 3SQGB 3TUJC 3ENVA 2U1AA 3L3CA 4DV6F 3DNCA 4KV8B 4PPZA 2MQOA 2GHPA 2RD5C 3G8QA 3MMJA 5SUHA 4A4JA 3IRWP 3CF5Q 3HO1A 2ZHBA 4DUYF 2K1RB 3PW5A 2GFFA 1TVRB 5IM0B 4ECYA 1SJQA 2CVEA 1FJGF 2LQ5A 1U1KA 2BXJA 4XAKA 1V9OA 2D74B 3PY8A 2HQ3A 3AB2B 4FN5A 3QPIA 4EBCA 1URNA 2DNRA 2OPPB 2XSJA 1E6YB 1X4FA 4IKAA 1A7GE 4ZPBA 3PDNA 2YKNB 4DL0C 2ZC3A 2VPZB 3MECA 3BSOA 1RTHB 4RNHA 2XMWA 4F4ZA 2VA3A 3DLKA 4TNOA 2L9NA 4A8MP 4NZ7A 2FHOB 1QSSA 2C3OA 4IQMA 1NK6A 2XB2D 4K4TA 2MZRA 2YTCA 4DQIA 3NCRA 4A8XA 4URGA 3R5AA 4PXDA 4HYKA 1LWFB 1YSJA 2WOMA 3US5A 1ZTWA 2DNQA 5KG4A 1HQEA 5C25B 2O1PA 4BWMA 4DV3F