2DIUA

Solution structure of the rrm domain of kiaa0430 protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
b'GSSGSSGCHTLLYVYNLPANKDGKSVSNRLRRLSDNCGGKVLSITGCSAILRFINQDSAERAQKRMENEDVFGNRIIVSFTPKNRELCETSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0430 protein
molecule tags Rna binding protein
source organism Homo sapiens
publication title Solution structure of the RRM domain of KIAA0430 protein
rcsb
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2006-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2diuA01
3UCGA 1VQKS 2CQ0A 1WEXA 5LXRA 1U1KA 3SDEB 2JWNA 2DGTA 2YTCA 1N88A 1WTBA 3JB9k 2FY1A 3MXHP 2NLWA 2KM8C 3CF5Q 2ZJQQ 2CQIA 5IQQA 2B0GA 1SJRA 2DIVA 2ADBA 1X5PA 2EVZA 2YH0A 2RS8A 3MI7X 2LECA 2LA6A 1M5OC 1VQNS 1FJCA 3MD1A 1VQMS 1N8RT 2MQQA 1YITS 3Q2SC 2KXNB 2DNNA 2M8DB 2JRSA 3S7RA 3CCQS 2MZJA 3R1HA 1U6BA 4IUFA 1M90T 2MYFA 3CC7S 4PR6A 1U2FA 2K3KA 1A9NB 3THPA 2RQCA 1SJFA 3DLLQ 2CPHA 2VODA 5DDQC 2M88A 2KG1A 3BO3A 5HL7Q 3CTRA 2BOPA 2M8HA 2M7SA 2M52A 1KQSR 4TU7A 2MY7A 3SDEA 1XN9A 2KYXA 1X0FA 2LEBA 3P3DA 1FNXH 1VQ4S 5LJ3Y 1X4DA 5LSLA 3FEYB 3MDFA 1PGZA 3CUNA 1ZZNA 2G0CA 1P27B 1WEZA 3I55S 3CCVS 3R1LA 1VQ6S 1Q82T 2XNQA 3EX7B 3CXCR 3HHNB 2DB1A 5CA5A 2DO4A 2CQ3A 3CMES 1H2TZ 2CQBA 2ERRA 4CH1A 3LQVA 3MUMP 2LKZA 2MZTA 1B7FA 2DGOA 4TLQA 2E5JA 2RUGA 1X4AA 2M4MA 2MZSA 4QU6A 5DM7Q 1U1RA 2DH8A 1U1LA 2DGVA 1A7GE 2GO9A 3MURP 2J76E 2KH9A 3HI9A 1JJ4A 2DNZA 2LQ5A 2FHOB 2LXIA 2DNQA 2JVOA 2OIHA 1OIAA 2KI2A 2E44A 2N3OA 3CCUS 1S72S 2DGSA 1X5OA 2MMYA 5DDPC 4F25A 2DITA 3IRWP 1RKJA 1Q86T 2DO0A 2PE8A 3BEGB 4U67Q 5GAHU 1X4GA 2SXLA 2EK1A 3MUTP 2MQLA 2DHGA 4C0OC 2MKCA 5D78A 5ITHA 4J5OA 1AUDA 2MQNA 2L08A 2MZRA 3H2VE 4M5DB 5GVQA 1HD1A 2CQDA 3G8SA 2MQPA 3H2UB 1SJQA 2MZ1A 1UW4A 2DGQA 3CCSS 2G4BA 2CQ1A 5IFMA 4WF9Q 2KVIA 4YUDA 3UCZP 1U1PA 2DHSA 4PRFA 2LXUA 2MHNA 1WELA 4WIIA 2RRBA 2RT3A 2A3JA 5GMKa 2D3OR 5DDRC 3P6YC 2D9PA 5IM0A 3SXLA 2X1FA 2GHPA 1HA1A 1OWXA 1FJEB 2FC9A 2CQ4A 3N9UC 2E5IA 3G71S 3UCUP 5GAEU 2ZJRQ 2DNPA 2DK2A 2CJKA 1QVGR 1R8HA 3IWNC 1NU4A 1VBZA 2QEXS 2XSFA 1UFWA 2KU7A 2JX2A 5D77A 1FXLA 1K73T 2CQPA 1CVJA 1M5VC 2O3DA 3G96A 2OTJS 3VAFA 2DNKA 2XS2A 5JVGQ 2KT5A 1YHQS 2XB2D 1YJNS 3VAKA 3NNAA 3J7ZT 2ADCA 4QU7A 3EGNA 3CPWR 2RVJA 1VBXA 3V4MA 3MUVP 1F9FA 3PIOQ 2MSSA 3P49B 2L41A 2MQMA 1VC5A 4FXVA 1U1NA 2MKSA 5LJ5Y 1Q81T 1WHXA 2HVZA 2MKHA 1BY9A 1URNA 2CQGA 2PEHA 2U1AA 2AYBA 3LPYA 2DH9A 5HO4A 2RU3A 4C4WA 1M1KT 4EGLA 1R8PA 3BS9A 1P1TA 1DRZA 2LA4A 2DNMA 3D2WA 3VAIA 3CULA 2CPEA 1W2BR 1G2EA 1X4EA 4F02A 3S01A 2MQOA 4ED5A 1H2UX 4LJMA 1WG1A 5JVHQ 4WFAQ 2J0SD 2RQ4A 3BO2A 4W90B 3I56S 2KN4A 2G1DA 2FC8A 2YKAA 4QPTA 2UP1A 3FEXB 2DNRA 3NS5A 3OW2R 2HZCA 5EN1A 4UQTA 1YJ9S 1WF0A 3TP2A 2MJUA 2CPYA 4OZ1A 2DGWA 2I38A 2E5GA 2KXFA 3MOJB 2MZQA 4LIRA 2CPIA 2DH7A 2F3JA 2RRAA 1PO6A 2VONA 1VQPS 2XS7A 3G9CA 4IO9Q 3US5A 3VAGA 3CC2S 1JJ2R 4LMZA 2X1GA 4ERDA 2CPDA 3ZZYA 2M2BA 2N7CA 3VF0B 2LEAA 1WHYA 3G8TA 2WBRA 3CMAS 1WWHA 2KRBA 1VQ9S 2MKJA 2QFJA 2AYGA 2CPXA 2LMIA 3Q2TC 2MKKA 3CC4S 1QVFR 3MD3A 1HD0A 2DNHA 2DNOA 3CCES 1X4FA 4RU2A 3R27A 1JJHA 2KFYA 2OSQA 2CQ2A 4WFBQ 3S6EA 3NMRA 1K8AT 2M0GB 3CCLS 1D8ZA 1SJ4P 2N3LA 4TU8A 3ULHA 1WHWA 4CQ1A 2LYVA 1X5TA 2I2YA 4WKRA 1K9MT 1WG5A 2L9WA 4Y0FA 2QA4S 2K8GA 4CH0S 3L3CA 3UWTA 4A8XA 3UD3P 4C7QA 4YOEA 2DNLA 2YH1A 2M9KA 3VAHA 1U1QA 1IQTA 1VBYA 1DBDA 1X4BA 1JMTA 1VQ8S 2Q79A 3UE2A 1VQLS 1QM9A 1OO0B 1VC6A 3UD4P 1M5PC 5GAGU 2OSRA 1VQ7S 2NZ4A 2MGZB 4WCEQ 2X1AA 3G4SS 1UP1A 1N54B 2MSTA 2KM8B 2M70A 1SXLA 2FPHX 3BO4A 1KOOA 1UAWA 1H2VZ 2DGXA 4PKDB 1VQ5S 3SMZA 5LSOA 4UY8T 3P5TL 3RW7A 1L3KA 1VQOS 4W92B 3TYTA 4F26A 1FO1A 2DNGA 1NJIT 5DDOC 1ZH5A 2AYMA 3CCRS 5BJRA 1SJ3P 1X5SA 2OJ3A 3B4MA 1KD1T 2KG0A 1WF2A 5LXYA 1WEYA 1WF1A 1WHVA 2X1BA 1FJ7A 4BS2A 3NS6A 3B4DA 1DZ5A 1WI8A 3NNCA 2LCWA 2VOPA 3S8SA 1KC8T 2XS5A 2MKIA 1FHTA 4P6QA 2N82B 2V94A 1NO8A 2E5HA 2RNEA 1KOHA 1FT8A 2RS2A 1YJWS 2U2FA 3ZZZA 2DNYA 3G6ES 2DIUA 3U1MA 2MXYA 3PIPQ 2DGUA 2MJNA 2HYIB 1WG4A 2CPJA 1H6KX 2J8AA 4TU9A 1OPIA 2F9DA 1U1OA 2CPZA 5H1SV 4Z2XA 2CQCA 2YWKA 3DXBA 4YB1P 5CXTA 2KRRA 3CD6S 3TO8A 1YTYA 1U6FA 3EGZA 1O0PA 1S79A 2D9OA 2DISA 3VAMA 2DHAA 3U1LA 1DHMA 3NNHA 2KHCA 1D9AA 4OZ0A 4QQBA 3CCMS 2JVRA 4IOAQ 2MY8A 5DM6Q 4FXWA 2AD9A 1ZZFA 2ZJPQ 3VAJA 2J0QD 2MPUA 1YWXA 5DETA 4IOCQ 1N52B 4WFNQ 5FJ4A 2HGLA 1YIJS 1U1MA 3RW6A 2DHXA 2MGZA 1VC0A 2HGMA 2AYEA 1RK8A 4Y00A 2F9JA 2MB0B 2EK6A 4V19X 2BZ2A 4CIOA 2XNRA 1M5KC 2HGNA 2CQHA 2KXHA 3VALA 1Q7YT 2OTLS 4ZKAA 1WI6A 1YI2S 5CYJA 3CCJS 1HL6A 2VOOA 3THTA 3J7YU 2CPFA 1X4HA 5MLCV 5GADU 3K0JA 5IM0B 1X4CA
chains in the Genus database with same CATH superfamily
1I51B 3UCGA 2FJDB 2CADA 4R5PB 3LWLA 3C15A 3NP5A 4OV1A 3SDEB 1C1BA 5L38A 1VRTA 5EWGA 1E6YB 2XY5A 2YTCA 1U1KA 3DM2A 3M6XA 2GGPB 1N56A 3U02A 5F3ZA 3JB9k 3DI6A 1JXEA 2HVDA 4B9NA 5B0CA 2C2DA 3T19A 2XCPA 1RBAA 1SUQB 2KM8C 3QFHA 4QWCA 3CF5Q 3AA8A 3QT6A 4ZVHA 2CQIA 5IQQA 1NK6A 2DTJA 1HWIA 1ZA1B 3V81B 2YNIB 2YH0A 2V8DA 4NPOA 4IG3A 2JHEA 1RTHB 4FKXA 3M8RA 1RTDA 4G6VB 1VQNS 4U7UK 3MD1A 3GWCA 2CNKB 1N8RT 2FIUA 2E5LF 2YNFA 4Q44A 3HCXA 2Z57B 4R8UA 2QLWA 4HKQA 1SJ1A 4JV0A 2MZJA 1WUUA 2HBRB 2NXNA 5KFVA 4C8YA 3HLUA 5CD4A 3MEGA 3LWMA 5HJXA 2BM1A 3RAXA 2BRLA 2C2MB 4JI3F 1YGYA 1ZTTA 4LF1A 4Y65A 4DV6J 3RBDA 2VPZB 4DR3J 1A9NB 4NXMF 1KLNA 3FUYA 1YJRA 1XBWA 4DLEA 3MPUB 3V6DB 2HMIA 2XI3A 2ZOMA 3D66A 3LF0A 1NSAA 2CPHA 1R8BA 2DXEA 2VG6A 5FD1A 1NK9A 4G1QA 3MEGB 2F40A 4ZOSA 2WW8A 2ZOFA 1DY3A 3CB4A 5CHCB 3M8YA 2M52A 4FDFA 3BQ2A 2P6SA 4TU7A 3HVTA 1JKHA 2FJWA 1OY8A 4WXWA 4CO2A 3IAM9 1S10A 1FFWB 3HKZD 4K2JA 5L9NA 4XTTA 1X0FA 1FNXH 2CZVC 2IRXA 4LF6J 2XMTA 1V3SA 3ZO7A 2V2VA 3MCNA 2Y0BB 2Z2MA 2ZHOA 3J81Y 2Z58B 2H5JB 2G2ZA 3CDBA 4MK9A 3NWGA 4OI6A 5LSLA 3VR1A 1N34J 3GLJA 3CUNA 2HFUA 3D4JA 2G0CA 2W2NP 4BC9A 4YR2A 3I55S 2I1RA 1ZZNA 3DMJA 1SV5B 1Q82T 3QJPA 3IGNA 3CXCR 4DFKA 2BACA 3DDIA 2IHR1 4DL0C 4G1QB 4ZPTR 3OTDA 4ZCMA 2DO4A 1RE1B 2D3ZA 4LR9A 4FS1A 2FZKB 2LQJA 5J2PA 2B6AB 2W9BA 3T9ZA 3FVYA 2B4OA 1GMWD 3MEDB 2AW0A 2LP4A 3RJMB 4A48A 3IWLA 1Q5YA 4OYOA 4X4PA 3L7OA 1CJTA 3PW7A 2XYGB 4M5KA 1RHRB 4ZA1A 1UVIA 5KG2A 1A7GE 1FD2A 1NM2A 2J76E 2VKRA 4LUBA 4BLGA 4DFJA 2H5IB 2XMVA 4TYBA 2VBYA 2OEJA 3QLHA 1CC7A 2FHOB 2LXIA 3KLIB 4XDDA 3NKYA 5KFMA 1EIYB 3RR7A 4FYDA 3R5GA 4QZVB 2V69A 5D0HA 3DMJB 4X4TA 2KJVA 4O3OA 1F9EB 3JQKA 4C3KA 5CH7B 1JLQB 2FZGB 1RLCL 1VGYA 2OO4A 2Y1LB 3ICLA 3N4WA 3KG0A 2MMYA 4E98A 4EBEA 3CGIA 2BRKA 3Q8RB 3PW5A 1R31A 3IM8A 1EETB 3M2RA 3AA9A 4WPAA 4I2QB 3KLHA 1KHWA 1X4GA 3DGPA 5KOWA 1N6QB 4NEYA 4AL7A 3M6UA 4MKYA 2BVZA 4TYAA 4JI4J 1SBRA 2MKCA 4PG8A 4HI1A 4J5OA 3OR1A 1TMMA 1HD1A 3T9NA 4CO3A 2CQDA 4B9LA 1XNQF 2WK4A 4Q2LA 1TL7A 3OTCA 4RW4B 4DI6A 2FVRA 3H2UB 4MT1A 1PBAA 2DBBA 3IS9B 4OLPA 3ZZ0A 2G4BA 3CCSS 1BQXA 2NSBA 2BJ8A 2H4WB 2HWHA 2BE9B 5DQGA 3GG1A 4OZJA 1U1PA 3CJ3A 4O23A 3M9NB 2XC9A 5A8RA 4DN0A 4L3KA 2ZH7A 2DHSA 2FVQA 3T3FA 5KG1A 1AT1B 1CJVB 4PRFA 1JIHA 1LWFB 1EAYC 2J9DE 2MHNA 3UO0A 1DTQA 1SPBP 4DV5F 2J6TA 4M5LA 2K3IA 3FCWA 4JI0F 2RRBA 3IS9A 5F8GA 2A3JA 5ETRA 5HLFB 1D8YA 2D3OR 1Y10A 3WDOA 1H0HB 5DDRC 5IC6B 1YZ7A 3P6YC 4L76A 4HYKA 3KHLA 3O2IA 3MPDA 4QW9A 1OWXA 5MAOA 2FC9A 2CQ4A 3N9UC 2XZTB 3EICA 4IOBA 4WFXA 3K5OA 5T7LB 4A8YA 4DQQA 5A8RB 1FJGJ 2E9ZA 3L09A 3G71S 2CVIA 4YS2A 5AT1B 5GAEU 4TQSA 3GP9A 4D3HA 1N48A 4ED2A 2CKWA 2ZJRQ 1ZTWA 3GFXA 2NUUG 4P2SA 2JC0A 2CJKA 4ZCLA 4FP9A 4O0IA 2CUYA 2GQQA 2UZAA 2V8VA 2XTJP 4NLOA 4WTOB 2IYIA 4N76A 5KFWA 1I3OB 1DLOB 1RHUB 1A0OB 1UFWA 3TQ1A 2JX2A 2UUCF 5D15A 4ECRA 1K73T 4LF5J 5KOXA 2J5AA 1R6YA 1CVJA 3OL8A 3BN4A 2VFUA 2YX4A 2KKHA 4DPWA 4C8KA 1WKJA 1AFJA 4NMLA 4EEYA 3OSPA 1IKWA 4O0NA 2XS2A 2XHWA 4OJ1A 2IRYA 2XWYA 3I4HX 4NZ0A 1YHQS 2UU9J 3VAKA 3TX8A 3ITHA 1CSJA 2R7VA 1VCTA 3A3OB 2V8PA 4MKVA 4DV0J 4K4WA 2RVJA 4YB7A 5BXIA 2D1CA 1X31C 1C2PA 3H5UA 3TUIC 1F9FA 2QA1A 3V4MA 2JEFA 5HANA 1FF2A 2AJ0A 2FHMA 4H54A 4ED1A 3CJ4A 1Q0NA 2A1BA 4B3OB 2GCFA 3FJ2A 2RU9A 5KTQA 1U1NA 4LQ3A 2UXCF 1EQMA 1IBLJ 1DQAA 3ETOA 5M2PA 1HBMB 1NHKL 3GJSB 4G65A 2VJUA 1RWOB 3E01A 1TL3B 2CQGA 4HR2A 1S6PB 1RT1B 1KLMB 3LALA 2AYBA 2WCXA 1YBUA 3TJ8A 2Z0GA 5HO4A 3KLFA 2PA8D 4PUOB 2RU3A 2NPFA 5BYRA 5E7OB 3ISNC 3CDEA 3J81U 3BS9A 8ATCB 3GG0A 3EZ5A 1IBKJ 1NZAA 4A8FA 3A12A 3ZNUA 3IBFB 5A2QU 2HNZB 2DNMA 2E7WA 4LFBF 1APSA 2NZCA 4EFAC 4GVBA 2WVBA 3GFZA 3H20A 2IC3A 5J1EA 3N5FA 3PACA 2IVYA 3AB4B 1C0UA 4F02A 3KUGA 3W66A 1HQEB 3S01A 4JUZA 1H2UX 2J9DA 4AFFA 4IG0B 4A8QA 2DR7A 3IXQA 2OPQA 4JBCA 5L1IA 4C0HA 4F3QA 2VQEF 4C8LA 4RNHA 3GYNA 2BANA 4UY85 4DSJA 4NL5A 5HQMA 4UZCA 5L46A 1TVRB 1HNIB 5LM7E 4AL6A 2FJVA 5E3RA 2W9BB 2VDIA 2HZCA 4KAIA 4FS2A 1RT6B 1SIZA 2K1RB 2VF3A 2YKOA 3L9ZA 1YJ9S 3ET6A 3JTPA 1WJ9A 2A6MA 2L9DA 3GJTB 2GVZB 3R7SB 2OPQB 3FQLA 4TXSA 5D4LA 5ETQA 4GVLA 5CYMB 2I6WA 4CLKA 5KFNA 3GONA 2DGWA 5D3GA 2HLTA 1YJVA 1B0VA 4TNOA 1KR4A 1U47A 4U7UD 2W24A 3BSAA 2KFNA 3OFGA 5HN0A 1QE1A 4Q43A 1TVRA 3J7YI 4F4ZA 4ZVRB 1EP4A 2W7AA 1PO6A 3V4IA 2D7SA 1UVLA 2AV5A 1AYEA 2VONA 4OYIA 4EUVA 1NNDA 3NY0A 1UZDA 1HHQA 1TKTB 1ZOTA 2A18A 2ZD1A 4M5NA 4ZPCA 1XR5A 2ILYA 3MR5A 1U8WA 4NYPA 2YKNA 2DEIA 3M30B 2GAGC 1HNIA 5E0OA 4TVAB 4HTIA 2X1GA 4EBDA 1JJ2R 2KO1A 2Y8YA 4LMZA 4ERDA 3GCWP 4YFUA 2IM0A 3HSJA 3AH6A 2RSQA 3DDNA 4PPZA 2XZWA 4N7TA 1XMOJ 1QAXA 2CWXA 1YJTA 2HVHA 3TAMB 3CMAS 4YP3A 1WWHA 4CLWA 3R97A 1VQ9S 2MKJA 1SH0A 4KGMA 5J2MB 4TLRA 2AYGA 3IA0A 1TKXB 4OI3A 1QSYA 3K5PA 1NJWA 4RX6A 2CPXA 2LMIA 2IBOA 2MLXA 1BQMA 2G13A 1ACMB 1HD0A 4OHXA 3TAQA 1X4FA 1RU2A 2O1PA 2ATCB 3BBFA 4OZ2A 5AJ3F 3L7PA 3M2VB 5KFFA 3KJVA 2ZHAA 1LV5A 4WFBQ 4FYYB 1HBOB 2KYZA 2R7OA 4DHVA 3CCLS 2F8HA 1K8AT 2N3LA 4B9MA 2Q1LA 2BDPA 4TU8A 2XM3A 1N33F 1RT2A 3ULHA 4PG6A 2PFDA 4RLEA 4ZVPB 4Q7AA 2AJFE 2RAQA 3EJMA 2LYVA 3UR0A 2AMCB 4ZLJA 3DRPB 3H90A 2ROPA 2P8IA 4FNIA 2ZBQA 1JLGA 1MMNA 2HRTA 3MPVA 2IVMA 3UI3A 1Q1KA 2W2MP 4Y0FA 4OI2A 2QA4S 5C25A 3L3CA 1ZAWA 2BKOA 2ROEA 1NSQA 1JLCA 3TQEA 4YR0A 3QIPA 3UD3P 3DM2B 5A0YB 2KFZA 1Q16B 1HLWA 2GGPA 2C2ZB 3DU6A 4OZ3A 4PXDA 4C7QA 1VDHA 2LU2A 2YH1A 2M9KA 2BYCA 3KMSA 3VAHA 3LO3A 2ZE2B 1HWKA 3AJDA 3FBEA 1IQTA 2JZ5A 1DBDA 1DLOA 4DOZA 4A4JA 1T9UA 2HQCA 3EVOA 1P9QC 3FNNA 1JMTA 5DG8A 2FYXA 1HNXF 1UPPA 2FD2A 3P5BP 4LT6A 3UD4P 1M5PC 4A8OA 4F0MA 4GKJF 4HT5A 3FCVA 3CD5A 2JH3A 1VLYA 2L9NA 3MWBA 2CZ4A 3A8IA 2R9LA 1UP1A 1N54B 2MSTA 4OJ3A 3ZZUA 1HPZB 2M70A 1M1GA 3HVRA 4J91A 5HK4A 4ZLPA 3TA0A 1KOOA 1R0BG 1JLCB 1H2VZ 3BYPA 3SMZA 4F4AA 4PXBA 5DS7A 3P5TL 1L3KA 2GMJA 1IVZA 2ZE2A 1GNKA 3AD9C 4F26A 1KTVA 5J2PB 1FO1A 2DNGA 1TTHB 1H72C 1S49A 2WONA 1ZH5A 4XO0A 2AYMA 1Y11A 3P8BB 1NK8A 4KJIA 2UXDJ 4P71A 3BGRA 3GSIA 4WK3A 3EPGA 4JI5J 1X5SA 3BKUA 5IOLA 4RW9B 1RA7A 4NLRA 5HMXA 2CJYB 3I9V9 1F9HA 5IV3A 8AT1B 4MFBA 2M3DA 2EBGA 1BQNB 3TVZA 4DUTA 4C8OA 3ZFVA 4CT9A 1NHVA 4DG1B 4DJBA 4CLZA 1HW9A 3OTBA 3KK1A 1RXOB 3J81j 3BDPA 3NS6A 2RDIA 1JLQA 1MMLA 1N5VA 1S6UA 4MTPA 3NNCA 4C48A 3S8SA 3Q22A 2GIRA 2G0JA 1JLEB 3CDUA 2E7VA 4KH1B 2UXBF 5ETKA 3PR4A 1IM4A 2J0WA 1FHTA 4Y34A 2V94A 1NO8A 3GJRB 5AXLA 4LFBJ 4K8RA 1YJWS 1CJKA 4FNHA 4EU0A 5KFGA 3ZZZA 1SH2A 1NH7A 1SVDA 2QMWA 4Z7CA 5C2CA 3RAQA 1X9WA 1I6JA 2D3O1 2ZWOA 1KBRA 3PIPQ 2FHJD 1S9EB 2BBEA 3GR0A 5KFOA 2CA9A 2DPJA 1RADB 5A6PA 4ECZA 1KSPA 4O4RA 2HNYA 2V0NA 3HX9A 4QBUA 5F8HA 4RW4A 4EWTA 2UVRA 3W2WB 5HJYA 1NMEB 3M8QA 1IUJA 1U2CA 4LF9J 1KTQA 1CS4B 5H1SV 4LRFA 2VC1A 3ENAA 3H4DA 3PX0A 2IFXA 4LF7F 1SH3A 2GIQA 2MQ8A 1ITPA 3OR1B 1HI1A 2CQCA 3DXBA 4LBHA 4WU3A 1S9EA 2XWXA 5KG5A 5EDWA 2IAJB 2B43A 3KYLA 2V4RA 1HHTP 3T6JA 2XLKA 3CD6S 1RGVA 4K50A 3DLJA 4NWBA 3TJ9A 4GKJJ 1S79A 4ED4A 4PQUA 2D9OA 2GMLA 1CJUB 3EXCX 5D3GB 4C3LA 4EMDA 3U1LA 1MWYA 2L48A 4ID5A 3NNHA 3C14A 1XIQA 3AHPA 4OZ0A 4DL4A 1NJXA 1RQ0A 1LWEA 2DKOB 4A47A 2QTWA 2JDJA 4ID8A 4RW6B 4IOAQ 1WOOA 3R5JB 2P6TA 3PEHA 4ANDA 2I5JB 4WP3A 4ZJLA 4DCJB 1FE0A 3K8WA 1IKXB 1HW8A 1EETA 3M32A 2CJAA 4NLYA 3IP0A 3SCKE 4AXIA 3GIMA 4RW8A 2ZJPQ 1X9SA 4ZITA 4IOCQ 3DRRB 4QWBA 3PDNA 1CS4A 1CJUA 1FKPB 4WFNQ 3HD1A 1IR1A 3OVBA 2VASA 2V50A 1UA1A 1BQMB 4XIUA 2ZH9A 4KHPF 4J9NA 1G7CB 5GAEI 4LSNB 2WW4A 4OLOA 4ZVUB 3VQSA 3HHKA 2MGZA 2Y0SD 1N0VC 4M5GA 5B0DA 1R7IA 4LR8A 1VR6A 3I82A 5U47A 1I94F 5L1KA 2AYEA 3TVYA 1RAAB 1MG7A 2HKEA 1Z2LA 2EK6A 3M1VB 5ETOA 4ID5B 4J37A 4CIOA 5AXMA 1HI8A 1QTNB 2ALYB 5KFRA 4X4VA 4C98A 2CQHA 3MFHA 2DXFA 1HWJA 3MMJA 1RLDA 3V6DA 4ZKAA 1Q7YT 4LSNA 3DLEA 3KHRA 1WI6A 1SIWB 1QAYA 4RNOA 1HL6A 2CJ9A 4IO1A 2Z2LA 1S1TA 2CPFA 3BV8A 1XNRJ 1DQ8A 2ZWPA 3GIJA 2FJEB 1FCAA 3QPIA 5KFLA 2XULA 2HFOA 4B3OA 3ISZA 1T7PA 2J7WA 4DCPB 2J6UA 2JWNA 3NWRA 4HI2A 4NLUA 1N88A 2P9CA 4DLGA 2OH2A 2CZ9A 2VD3A 1LW0B 4A8WA 1D0EA 3GZ7A 5HQLA 2DY9A 2FVPA 3M6VA 2HQFA 2EKNA 4PUOA 4DF4A 3VTIA 4IYQA 2QA2A 3JTNA 4K59A 1YBTA 2PMHA 1PJ6A 2VZ9A 3MM6A 4OJHA 1DTTA 4PWWA 2GNKA 1SJRA 1RBLA 4H4KA 4ZDNA 2HPUA 2W01A 2EVZA 1WC0A 2Z8QA 3LPEA 4IFVB 2VQEJ 2RS8A 3MI7X 1KLMA 2HAIA 4CH7A 4ZLNA 3H2LA 4JI0J 2ZOGA 3GB0A 3LAKA 4Y2CA 1HMVA 1T9TA 5JUMA 1FJCA 2B6AA 3QSYB 1DARA 1HPZA 2UUAF 3Q2SC 2HMIB 4H4MB 4CLSA 2DNNA 2NYHA 1HNZJ 1S6OA 2M8DB 1F6TA 1S77D 2JRSA 2OFHX 3S7RA 2LQ9A 4PWDA 3PFEA 3R1HA 1U6BA 1JNRB 3QO9B 4RBTA 2GHWA 3PYDA 4U8YA 5A8KA 3LTOA 1RSCA 2BM0A 1FESA 2A2DA 1TK8A 3CC7S 1RKIA 4QWDA 2Z2YB 4PR6A 1U2FA 2KT2A 1MU2B 4RPFA 4F3MA 4JB8B 1HWUA 2HS3A 2V2KA 4RNMA 3GJQB 1O51A 3C66A 1H73A 4ELVA 1SJFA 4IFYA 1OY6A 5KG7A 5DDQC 2M88A 2H4YB 3D1QA 5HP1B 1L3TA 3TZWA 3E8OA 5A8KB 3CTRA 3QT5A 4V1Ak 4ZVOB 4KGKA 1BQNA 3M7VA 2M8HA 2M7SA 3I96A 4H4MA 1MU2A 4I68A 4ED8A 5KFUA 2Q43A 3KG1A 3MR6A 1KQSR 1XN9A 2OPPA 2KYXA 5IWAJ 1Q5VA 4ECYA 2IY5B 3P3DA 4UOCA 4DV0F 1HNWJ 3QO9A 5LJ3Y 3HKWA 2AX1A 3RUBL 2RUSA 4Q5VA 2ZH6A 5LOQA 1BC6A 3RB0A 3NGTA 2AEFA 4NX9A 2V34A 1X4DA 2MTLA 1JLFA 4I67A 5LL6d 2XI2A 4USHA 5E2QA 4C8MA 5J2QA 3CCVS 2JC1A 3GPAA 2V6AA 1TL5A 2VUGA 3CIMA 4DR1J 3AY0A 4HEA9 4MIBA 1VHFA 4MKBA 3BKTA 5KT7A 2R7RA 3PO4A 2CQ3A 4QR1A 1LWFA 1H2TZ 2NXCA 4KYZA 1I5OB 4ALZA 2ERRA 3IO1A 1Y0HA 1Z4UA 4ECUA 1UWAA 1B7FA 5IT0A 3NGSA 3KLHB 1C4AA 3DGPB 2ZZTA 3WHIA 1ZAXA 1FXDA 3ADAC 2JFKA 2GVZA 2M4MA 1YVFA 2DT9A 3O1LA 5K8PA 5DM7Q 4QU6A 4QIFA 1U1LA 4LRAA 1KHVA 2UV8G 5B08A 1GX5A 1OY9A 1Q78A 2GO9A 1GTEA 2IM1A 2KHDA 2QMUB 2BJ3A 2P5VA 3CCWA 4NI2A 5E3PA 5M2RA 4DL5A 4MIWA 2HHHJ 4IDKA 4UQGA 1NKCA 4H4OB 2ZUAA 2DNQA 2OIHA 3PM9A 2YKMA 2KZMA 3C16A 4DXLA 2E44A 1TUVA 4KBIA 2DCLA 2FZCB 4K4VA 3K57A 1TUGB 2DD8S 3BN7A 4FF2A 4KGVB 2AHOB 1SC4B 1M5HA 5A8WB 1RKJA 2VDHA 2OMOA 1VOMA 5G4DA 4JV5J 1S7IA 2WZ1A 1FRMA 1NJZA 4M94A 3MUTP 2GIFA 2R7QA 2MQLA 2XSJA 1SKUB 4RR5A 3EZOA 4LFCJ 4B9SA 5D78A 2KT3A 1MROA 2L08A 1AA1B 3QWUA 1N5QA 5GVQA 3SZ2A 4DZ6A 4MYUA 3G8SA 2MQPA 4DN9A 4GO7X 3KOAA 1FEHA 1UW4A 2HEKA 4FPRA 4EZ6A 3QBCA 3CJSA 5IFMA 2PFFB 3QZ7A 3MCSA 2I9SA 4C2MA 2KVIA 2OFGX 3T1HF 4YUDA 4ELTA 4DR6F 4FN5A 5IT9U 2C1EB 5DGAA 1KVJA 2AJQA 2LXUA 2DR6A 5IWAF 2WVDA 5HVHA 4DV4F 4A46A 1KVKA 3G6XA 3J80U 3HHLA 4S0MA 4RKUC 1W26A 5SUHA 3AJ2A 1ICEB 4HH1A 1VK3A 4ZIVA 5HVFA 3K59A 2D9PA 4LF8J 2RJZA 1ZPVA 1FWKA 1Y7PA 1N5YB 3H5XA 2ROGA 5CYQA 4CP5A 1ZM2A 2E5IA 4IO9Q 3PVXA 3VZHA 1Z1ZA 1T03B 1BD6A 1NPPA 1UCNA 3I5BA 1RWWB 4DL3A 4KR0B 2HS0A 2PEBA 5KFSA 3I87A 1NDCA 4DR5J 2DK2A 1FDDA 3W60A 4OX6A 4J9RA 1QVGR 1CPZA 1R8HA 5E3AA 3IWNC 4L6V3 2YWWA 2W4CA 4WZQA 4HVZA 4L74A 5ETTA 2QEXS 2OP5A 3DRSB 5T41A 1JLBA 5HMYA 2KU7A 3EDRB 4F4WA 3EMTA 5D77A 1IKYA 2Y3YA 3C19A 2W9CB 5I3UA 1S6PA 1UMJA 4P2XA 4YB6A 4LF4J 2NR0A 1IBMF 3FRYA 1M5VC 3WQPA 1JB0C 3G96A 3PYFA 3R7BB 4OX7A 2COLA 4ZJOA 3IR6B 2DNKA 4C11A 3H4BA 2KT5A 3CIZA 1U24A 1B7YB 3N01A 5AE2A 2CWKA 4ED6A 1YJNS 1FKAF 1KQGB 1OYEA 3J7ZT 3MOZA 2ADCA 1RT1A 3EGNA 5KFEA 5LMNF 1D09B 2IMWP 3MUVP 3RB4A 1S1XA 2EG2A 3OUYA 5J1EB 3GV7B 2L41A 3A8KA 3FEZA 4AYBD 2APOA 3MAHA 3B6BA 4FXVA 1VC5A 4QYZK 3M6WA 1FEEA 1JQGA 4K4XA 1GXTA 2MKSA 2RF2A 4KO0A 5LJ5Y 1Q81T 4NLXA 2AF6A 2HBQB 2WOMB 1SKSA 1CJKB 2D74B 4Q8FA 1URNA 1ZAVA 4DSLA 1WKKA 1Y00A 2YBVA 1Y4ZB 4KHRA 4DUYJ 5GADI 4IR9A 2GHVC 1S4EA 2DRAA 1V5VA 1AROP 3DLKB 3GYGA 3WC2A 2XO7A 3VGUA 2LA4A 5G0RA 1RT7B 2E1RA 1SQEA 2HNYB 2WSFC 3O8WA 2E29A 4NRTA 4NA1A 1NH8A 3NG8A 5I42A 2CPEA 3T1HJ 2JLFA 3CULA 4DS5A 3IFEA 4YDXA 3SSSA 1NSPA 1X4EA 4F0KA 1IJFB 3ZZRA 3AJ1A 4DV4J 1HWLA 4Q2MA 4KHMA 1BWVA 4ED5A 4WFAQ 2JEIA 1RWXB 3BBBA 3BO2A 4KGZB 4PQUB 2C22A 2GJIA 2J7UA 2G1DA 2FC8A 2W2QP 2XYPB 3HFKA 4USWA 4ZP6A 3JYTB 4B3SJ 3OW2R 5EN1A 2HFZA 1WKLA 4NYZA 2C3YA 2XY7A 3BREA 1QDUB 4Y6IA 2CPYA 2EI5A 5D0RA 5BYSA 4CTAA 3DI6B 4CLFA 5I4MA 2GA7A 4UTGA 2YKNB 3M30A 2UU9F 2E5GA 2OI2A 1FNOA 3I6PA 2ZM6F 5J2NA 2MZQA 3DHXA 4U95A 4K2XA 2DH7A 3P45B 1WD6A 1RT4B 3CE8A 4LSLA 2Z30B 3VZIA 5C25B 1F0XA 2C2NA 1WOSA 1GXUA 2H65B 3LP2A 2DHHA 3TOQA 5DZ7A 1CLFA 4I6WA 3G9CA 3PW2A 2XYHB 3EVMA 1RTHA 2HG4A 1S1UB 5KFKA 2DYAA 3VAGA 3CC2S 1T3NA 3PKMA 1NAQA 4DR7J 4DMZA 1X0PA 1WOPA 2BABA 4ZJQA 2W8KA 4DV2F 2UV8A 3LP1B 1PG5B 4DDFA 4B3MF 1FI4A 2QLXA 1RT2B 2V9KA 3HVAA 3FC9A 5J1PA 2YNHB 3V2UC 2LEAA 1U49A 1WHYA 2PDAA 3G8TA 4MAKA 1QUVA 4I7FB 1WC6A 2F7VA 2RRNA 3ILLA 3FFIA 2WVEA 5L8RC 5KFCA 3FSIA 4J9LA 3KFWX 1BHNA 1RWVB 3AQOA 2VFVA 1RHQB 2Q6BA 1VQSA 1Y3KA 1YRTA 1UEUA 1OYDA 2PIIA 4U8VA 5K14B 3WIVA 1S1VA 2MKKA 1N34F 3NGRA 3CC4S 1ZS6A 1HBNB 2AJ1A 3DU5A 3CCES 3MTJA 4P7VA 4RU2A 1JJHA 1U48A 1BE4A 1RWKB 5KG0A 4C8ZA 2OSQA 1AB8A 1V5IB 1XMQF 3OFFA 3VHQA 2Q3PA 4J90A 4KQZA 4BHQA 1BWEA 4C6AA 2GS8A 3R5BA 2V2QA 3UNYA 2E7XA 1T05A 3MMBB 4P10A 3TWZA 4JYAF 2E1MC 4LF5F 2YNFB 5H9EJ 1SV5A 1ZA2B 2IA0A 5KFIA 3KWMA 4OI4A 1TL3A 2E66A 1IN0A 3M05A 1R8AA 5K9FA 1SKWA 2PC6A 1VI7A 2VB6A 4PCQA 1WG5A 2L9WA 3GILA 5A2QY 2QL9B 3GV5B 3Q0AA 3FRZA 2K8GA 3RBXA 2QIFA 4O4GA 4CH0S 4ECWA 3GIRA 4DL7A 3UWTA 2VV5A 5CZXA 1F60B 1NLKL 1UVKA 3J7Z5 3PX6A 3D6TB 2CNOB 2EFNA 1I94J 2BJEA 4MIAA 4YOEA 3OLBA 3TX0A 4UZBA 2AQ4A 1I1GA 3P4UB 1NPKA 4F4YA 1FK9B 1S5ZA 2G0IA 1FRKA 2F1FA 3QLHB 2ZH5A 4O3QA 2GX8A 2QGFB 3N0VA 5EWFA 2BKPA 1VQLS 1QM9A 4IG0A 3DN9A 4ICLB 2AEJA 2BMBA 4DV3F 5C24A 3UDLA 4M5HA 2AJ4A 5GAGU 3ZZPA 3ISND 2BANB 1SC6A 1T02A 1T9VA 1N32J 4WCEQ 2X1AA 1TKZA 3HZGA 4RW7B 3SQOP 2R8JA 1E6VB 1MWQA 2RH3A 4DR3F 3V6JA 1NKEA 3BH6B 1VQ5S 4ZP7A 1NDLA 2RKIB 5LSOA 4UY8T 1IJEB 3RW7A 3RBEA 4OL8A 4B3MJ 4OX8A 3W7BA 4AUKA 5JMNA 1QTMA 1RDRA 2A10A 1JNZB 4OYMA 1CQNA 4K5SA 1TKZB 3EM1A 3RTVA 1PAEX 2OPSA 2BR0A 1UFLA 4G1PA 2LDIA 3CCRS 3V4IB 3KK1B 4ZHRB 4X62F 4KH0B 1S9GB 2ADBA 1MSWD 1TV6B 3PCOB 4K4TA 4ECVA 3ELHA 2RE1A 3QQCD 2OJ3A 4RW6A 1GH8A 1C1BB 1QD1A 5IT9Y 3D6HB 4O44B 4JI2J 1T95A 1KD1T 4AQYF 5LXYA 1NDPA 3IG1A 2AX0A 2DR9A 1R43A 1VYAA 1XR7A 4ILLA 5EX0A 1RWPB 4ECTA 2XY6A 3R1LA 1FJ7A 4N8NA 2DR5A 1HNVB 4UW2A 2AT1B 4QPXA 4ANCA 1DZ5A 2HZVA 3CJKB 1WI8A 1QLNA 2LCWA 1XWLA 2WRMA 3AXMA 1DJ0A 1LFWA 3PHEA 4UF4A 3K5NA 4CWBA 2XS5A 2IAJA 3RZAA 2YNIA 4P6QA 5C5JA 2N82B 1JXLA 4H4OA 2PO4A 3V5RA 3Q8VA 4OHYA 5D8HB 1NRKA 1RTDB 1HI0P 4FYXB 3G6ES 2DIUA 2XBPA 1EARA 2R3VA 3M8WA 3AD7C 3EE3A 3N6NA 5CCMA 1S48A 1Q95G 2CDRB 5ETLA 1S6QB 5AXKA 5K5MA 4DX5A 4YY3J 5KFDA 2DGUA 2MXYA 1XMOF 1F5CA 4FZVA 5GMDA 2HYIB 2PMZD 2CPJA 3M2RB 5J1NA 3CD7A 2DRDA 4N56A 1YG0A 2C3PA 5D4PA 1OPIA 3TUZC 1U4BA 2QL7B 2FLOA 4M5JA 1FDNA 1TQLA 2F9DA 3TR5A 2HBYB 5A76A 3D5MA 4B3SF 3LOUA 4HACB 2CPZA 2XCAA 1B64A 4MMOA 2IBKA 1HR0F 4F2SA 5ETVA 4Z2XA 1MROB 2B9YA 2OPRB 1KEKA 1Q8BA 1JK9B 1NUEA 4QJVA 4NCGB 3SSRA 3UFCX 2KRRA 3FCHA 1O6XA 4U96A 5CXTA 3TO8A 1GQEA 1QSSA 1O0PA 3TZYA 2RB7A 3JSBA 3RAMA 3QNWB 2YKMB 5IZHA 5F9LA 2QLBB 3HSZA 2YPZA 3PRDA 3SI8A 3EYZA 4FF3A 1VLOA 4PG5A 3MCMA 3OHBA 1VHIA 2E1PA 2KVQE 2PGCA 1SI9A 1IBKF 1ROFA 2JVRA 1KS2A 2ABYA 2MEWA 4K7QA 5CYQB 2B5JA 2FLNA 3W9IA 3EZUA 3DLGA 3ILJA 2FLLA 4K4ZA 1UTAA 2MY8A 4CRJA 2CJBA 4JI3J 4I7FA 2J0QD 1U0SA 1U0HB 1XMBA 2HK3A 1KKHA 3CW2C 3GYXB 1VQYA 2WHOA 4DV3J 3W61A 2HHQA 1Y9OA 2VQFJ 4LF4F 2K7KA 1FRLA 2HGLA 2KTQA 2XG8A 3CDAA 4RU9A 2XGPA 3HO1A 4X62J 2ZVIA 4BCAA 4UOGA 1K0VA 1UETA 1VC0A 2HHHF 1IWAA 2MLYA 1UVMA 4DV1F 1Q8KA 2HQIA 2HVEA 3K58A 2ZDOA 1RK8A 4JI7J 3F0NA 3UDVA 1S1TB 2F9JA 2VFTA 2XMMA 3DGVA 3DOLB 3HHDA 4B08A 3O44A 2MB0B 2EG1A 3TI0A 2XNRA 4LSZB 1J2VA 4JI6J 3MMBA 1S0MA 1FNMA 2PSZA 3AOAA 4USJC 3MFIA 3MMCA 2ZC3A 4X4SA 2RILA 3W62A 2ASLA 1UVJA 4L72B 3SV3A 1YI2S 1PIEA 3CCJS 1RZMA 1U6ZA 2QE5A 4P52A 3ZTQA 5KFJA 4ED0A 2ASJA 5DRKA 1HMVB 1X4HA 3AAWB 5GADU 1FD8A 2NCKL 3J7A1 5L9XA 1MLAA 3QFWA 5F8MA 1L5UA 5L39A 2IM2A 1IR0A 2RQMA 4WFYA 3TEGA 2X51A 2CQ0A 2RS2A 4F4KA 4JYAJ 1DTTB 3IMQJ 2L3MA 4K0KF 3CJ2A 1WTBA 4AE5A 3DYAA 1UVNA 3HFZB 5FDLB 4J9PA 1TUWA 2N4DA 3W5XA 3ILOA 1F2HA 2QC3A 4GMKA 5HMZA 3VGVA 3MXHP 2CRLA 3PKYA 3PTWA 1FK9A 3T5JA 2NLWA 5B0BA 3OL6A 3OJSA 1YK9A 1EP4B 3OXFA 3SBMA 1C1CA 1XR6A 5LMUJ 1UFKA 4B9TA 4OX9J 4DR6J 1K0TA 3PJXA 3H5SA 3OPKA 3M8SA 1RI7A 2B0GA 2AKWB 2YX1A 4N8OA 2HHUA 1PJ7A 2DIVA 2EWHA 5CYMA 2V4QA 2AZ3A 1DAXA 1GMWA 1LOUA 1YZ6A 3T5KA 5KT4A 1JLBB 2D69A 2LA6A 3AT1B 1M5OC 2GQCA 2JEJA 4LF2A 3T1AA 1VQMS 1YITS 3PEJA 2KXNB 2IRUA 2ZH4A 4BDPA 2YWHA 3H7HB 3D1HA 4GO5X 4DFPA 1U09A 3G8QA 1NHUA 4N77A 3CCQS 5F8JA 3F73A 3HSGA 4UOHA 3I31A 4ENOA 4KSEB 1XQIA 2N7YA 5HBMA 4IUFA 2GAHC 2RIJA 4C0BA 2UXBJ 3R2DJ 1CJVA 1C4CA 1M90T 2MYFA 4N5SA 1N36F 2ACYA 5B0AA 3CO9A 1FDAA 4WKYA 3JAMU 2W2PP 3THPA 2DRBA 3Q8PB 3Q8SB 3TUPA 2RQCA 5KT6A 2OPPB 3MHYA 5CD4H 2R2RA 3DLLQ 2RMLA 2JLEA 4W98A 2K06A 4J9SA 2BUNA 2B4UA 2ZC4A 5A8WA 3JYTA 3BO3A 3M2VA 3KJVB 2VICA 1PAUB 1XC9A 3A3PB 3NMAA 2YNGB 2F8MA 3OBIA 3B78A 4NLPA 5E5NA 2Y9HA 3FBBA 2BE7D 3RB6A 1OPZA 1N6QA 3KK3A 3IR5B 3MECB 4CZCA 1RB0A 4I2PA 3NAHA 2XQCA 1B70B 2PT0A 1RJJA 2JNJA 2LEBA 3UN2A 2ZD1B 2VC0A 4KPYA 5HBMB 3D7SB 1MW7A 5DLFA 3M2UB 3DRRA 1NB2A 2IIHA 4LFAJ 3R5AA 3AOBA 3W2VA 4DPXA 4DX6A 1VFJA 5B0GA 4ZLLA 4AQYJ 4F7VA 3DC2A 2IM3A 5F41A 4DU8A 1BUXA 1PGZA 3FZ2A 4CDIA 1WEZA 1NK5A 1F2GA 3KK3B 5B7WA 5EX3A 1VQ6S 5EWEA 1S6QA 2G2YA 4NA3A 1IKWB 5CA5A 2MDAA 2YQ1A 1XMQJ 4K0KJ 2C3OA 3JS9A 3EPIA 3CMES 1VBKA 1O8BA 3GCXP 3LQVA 3MUMP 1VJWA 2MZTA 3HDSA 4NRUA 4ZK7M 2B8PA 3NXZA 4XDCA 4TLQA 5ETPA 5F0WA 4DU7A 2E5JA 1IKVA 1SL0A 3PRVA 2OAUA 1EKSA 2BJ1A 3QWPA 4I4BA 1U1RA 2DGVA 3KK2A 3MURP 3LUYA 1JJ4A 3H25A 2X7IA 3GR1A 2LQ5A 1LEOA 1RAJA 5K14A 3R8YA 3S1TA 2JVOA 1ZYQA 4N47A 2HQ3A 4YDDB 3RU0A 2KI2A 3P96A 1GTHA 3CCUS 3TRGA 3H5YA 5HQ8A 3CCTA 1S72S 5EUHA 3NOCA 4NEZA 2W9AA 2DGSA 2AGQA 1D9DA 4NLQA 1LXNA 1EX8A 3RBZA 2F5GA 1HBUA 1TL1B 2DITA 3RGIA 4PG4A 4F25A 5DDPC 1HQUB 2I0XA 3IRWP 2FGOA 5H9FJ 3KDOA 2VBZA 1Q86T 2DO0A 3IC1A 2PE8A 1S99A 2GMHA 1YBAA 4HH0A 2BW2A 2SXLA 1TELA 2EK1A 5E3CA 4O3SA 3HVTB 4OYAA 1HQEA 4ZVSB 2DHGA 1RA6A 4C0OC 4ZN3A 5A0YA 2Y8WA 3MF5A 3BGRB 4TY8A 5ITHA 2MQNA 2MZRA 1S1WB 4M5DB 1AUDA 2HAFA 4NXMJ 4PG7A 3H42A 4HHUA 1XEZA 1QUPA 3W65A 4CLTA 3NCRA 4ZVFA 1U02A 1RISA 4DCOB 1NK4A 1S0VA 2LU1A 2QSWA 1LW2B 4RBUA 3W63A 2MZ1A 3DLBA 4PABA 4Y2IA 1ZBTA 2NREA 3V6KA 2CQ1A 3F44A 3HULA 4YHHJ 4O3PA 4F0HA 3UPFA 2BQUA 4USVA 4DQSA 1D1UA 4ILMA 4WF9Q 1IXKA 4OIXA 3MM8A 4YB5A 1N0UA 2F65A 4DEZA 3PO5A 4PYAA 4A8SA 3UCZP 3R9LA 4YEAA 1PBUA 3OTOJ 2YWFA 4DR7F 3BYRA 1HBMA 5I3QA 1SKRA 2C2EA 5D4OA 2R2UA 2BQ3A 3ETMA 4FYWB 4NASA 2HIQA 2RT3A 2AGOA 5ETMA 5GMKa 4F04B 3KLFB 3OR2A 4OYBA 4QYZJ 2W7OA 2BXJA 2X1FA 2GHPA 1HA1A 2FDNA 4Y3CA 1S1WA 5L1LA 1FJEB 4CCHA 1BLUA 2POKA 3EGVA 3DFEA 2O66A 2W25A 3CD0A 2H3EB 3QYYA 3W3SA 4FKYA 1OSDA 3CNQP 4ZP8A 1EQ0A 1T9WA 2XGQA 1PKUA 2OHDA 2B8QA 4DQRA 3ONQA 2DNPA 5DO2A 3LGMA 4MKAA 3UN5A 3DOMB 5KFAA 1RTIA 2H1YA 4J9MA 5DZ6A 1VS3A 3WC0A 1U26A 4DS4A 4WIQA 1NU4A 3CWJA 2RF2B 1RAGB 5D0EA 3ZZOA 5HMWA 5IM0B 4QR2A 3NCPA 1SL1A 3CJTA 3FBCA 4GC7A 4DFMA 2WONB 5J2MA 3M8QB 1S1XB 3R5DA 4NZ6A 5F3TA 5J2QB 3A3NB 4X65F 2O3DA 4QIVA 1S57A 4U6PA 2OTJS 2VFRA 4NLDA 4CI0B 3QIDA 4KO0B 4IRDA 1GT8A 4X66J 5JVGQ 3AB2B 4URSA 4UOFA 2ZKTA 2XB2D 3CJQA 4QCLA 3IG1B 2Z4PA 4PPDA 1IKXA 3M32B 3A13A 4FPIA 1VBXA 1QE1B 5I3PA 1YJUA 1Q8LA 2MSSA 5DLGA 1HNVA 3DLKA 3PIOQ 2MQMA 7AT1B 4E0DA 2FTRA 2UXDF 1B0PA 3CJRA 2HRYA 4RWWA 4WYLA 4ECXA 4LR7A 3T1YJ 2CAJA 1OSCA 2B51A 2UUTA 1XK8A 1IWGA 1RT7A 3HFVA 2E5LJ 4PXCA 4JI4F 2VG7B 2HVZA 2MKHA 1BY9A 2OPSB 3OXLA 3PRBA 3HJFA 3LPYA 1ELOA 2XZDB 1FRIA 4X4NA 2BJ9A 4NCBA 3KG4A 3MGJA 4C4WA 1M1KT 1BGXT 1CC8A 2V4JB 1R8PA 4HL9A 3EXYA 3IRXB 3JQMA 4WXOA 4EGLA 4G3IA 4URGA 1P1TA 4J9UE 3ENWA 3U1NA 3TAMA 3QIPB 4HT7A 1M0SA 5DG7A 3DKDA 3DRYA 3HM9A 2B9EA 2MLZA 1IR2A 3DLEB 5IC4B 3KLVA 3D2WA 3VAIA 1AW0A 2LLZA 1W2BR 2B4VA 3OLAA 1QAJA 2V63A 4QW8A 2HQGA 1G2EA 1REVB 3HZEA 4FF1A 4TY9A 5E41A 2MQOA 3MEEB 2W8LA 4DUZF 3SSQA 4OFZA 2VBWA 1FXRA 1S1VB 3I9ZA 1PCAA 1U2RA 3CJKA 4CO5A 1JXVA 1WG1A 2QLJB 4KV8A 4USUA 5FLXU 5JVHQ 1S7HA 5KFYA 1R0AA 4JI1F 2J0SD 5K20B 3GE9A 3QRRA 3BJYA 1NK0A 2AWZA 3ZZTA 3MPWA 3VAJA 2UP1A 1LFPA 2JEGA 5C42A 1T9YA 3JSYA 2DNRA 4I69A 4FVCA 1FVQA 3NS5A 4IH6A 6FDRA 1LWEB 4ED7A 3EDQB 1SCJB 1RHKB 4I1TA 4M5MA 4UQTA 1T9XA 5CQGA 2OEMA 5JXSA 2VL1A 2KL8A 3PW4A 1WF0A 1VK8A 1WORA 3I5AA 2C28A 1F1BB 8RUCA 3PG9A 4WFZA 3A8JA 4MH8A 3GSDA 3HHLB 2BW7A 2EXUA 4ZP9A 3MOJB 1RABB 5C42B 2JSXA 1B0TA 2ATLA 1SUQA 2CPIA 3MTKA 5JJBA 3TA1A 3QJLA 2IDLA 3Q8YA 4O4GB 3N79A 4ZCIA 1R6VA 4Y28C 1QSLA 1RUSA 1HBNA 3V81A 5KT3A 4WZMA 2OKQA 3SIPB 1RP5A 2YKPA 4ES1A 4RW9A 2HW3A 3US5A 3PFOA 4ZPBA 3TVKA 4URQU 3WZ0A 3K5LA 1S12A 1FKOB 1KDNA 2CPDA 2E9RX 4YY3F 1NDKA 1W2IA 2QJ3A 3MEDA 3ZZYA 4OX9F 4X4RA 4DSIA 2M2BA 2K7JA 3JAMY 4IR1A 2HHVA 3VF0B 3KKFA 2Y1IA 1H74A 4OYPA 3SQGA 2WBRA 2BJ7A 4LF8F 2KRBA 3FSXA 2VG5B 1LW0A 4Y2MA 1TMJA 2BJDA 4RNNA 1H3DA 2UUBJ 1SC1B 3QGPA 2AU0A 3Q2TC 3MR2A 3LGHA 3MD3A 2IDEA 4OZ5A 4ZCKA 1KQKA 1UA0A 2CYYA 4KIAA 4OYXA 4IFYB 4F8RA 5KFQA 1GMUA 2NXJA 4B3TF 2W7PA 4JI8F 2JJ4D 4C9DA 1K1SA 3R27A 2KFYA 1L3UA 1D3WA 2CQ2A 2F4VJ 4Q0BB 3NMRA 2H51B 2PMWA 1D8ZA 3HT0A 4X2BA 1C1CB 5AXNA 2C2OB 1FRHA 3DLHA 4CYUB 3BSCA 1WHWA 4HHHA 3ET6B 5GAHI 3SQGB 4O3RA 2OEKA 2BX6A 3PYGA 2BKNA 2R42A 1X5TA 3OD2A 4DPYA 4E2FB 1DFDA 4OJGA 4GKKJ 4OHZA 1K9MT 4CM0A 3R3TA 2WSCC 3UDCA 2HHPA 4ANEA 5KFHA 2R2TA 1BXNA 5F8IA 4DG1A 2QG9B 4RUCA 1S76D 4ICLA 3NLCA 4A8XA 4F2RA 5C24B 2NXUA 4OV6A 1T8EA 4LF6F 5L1JA 1RWUA 3DYAB 3G6VA 2O01C 2DNLA 4EK2A 1FX4A 1WC3A 4NZ7A 3A4TA 4DR4F 1LWCA 4Q0BA 2HFVA 1GMVA 3QT7A 3PY8A 2CXEA 3KLEA 1K1QA 1X4BA 1ULRA 4JI6F 2V5HG 3AFGA 1Y5LB 2GO8A 4XK8C 4CYUA 2H9ZA 2RD5C 1VQ8S 2GFFA 4LIWA 4OYZA 2ACMA 3O3LA 3GIKA 1VC6A 2R8GA 3TUJC 2HHSA 2OSRA 4P74A 1VQ7S 1HKAA 3KJFB 2IJRA 2VPXB 3G4SS 1LWCB 1RT3A 5H9FK 1S9FA 4EYIB 2AGPA 1DTQB 1X7VA 1OMSA 1IQZA 4ZVGA 4K4SA 1JLFB 1SXLA 2FPHX 3I0RB 3N6LA 3NGKA 4USKA 4RUAA 3BO4A 2DGXA 2FLPA 7FDRA 1YKWA 2GVDA 4X65J 3O6QA 1V6HA 4FYVB 4QIEA 1AUSL 2BA9A 2OLWA 4PYDA 2D41A 3TYTA 5EHHA 3NL0A 3EVWA 4X66F 2GQ2A 2K2PA 2A0FB 2VHGA 3CEDA 3I0SB 1AZSA 2ZITA 2NS1B 1RT3B 1RHMB 4NLVA 4USIA 4I2QA 2V8GA 2YWEA 1SB6A 2R7TA 1IBCB 1PJ5A 4DWIA 2WB1D 4K5RA 2DEJA 2GVDB 4P2FA 5CAAA 5BJRA 3MCOA 4BWJA 1RAHB 2B5JB 1A6LA 3D3CJ 3B4MA 2ZHBA 3DLGB 4AD6A 4USMA 4F67A 2I8EA 3PJWA 3TNVA 4X4QA 1TL7B 1WF2A 2HRUA 1WEYA 1WF1A 2QLFB 1WHVA 4U9RA 3WX8A 3MM9A 4TQRA 3HXMA 4DV7J 1S97A 1TKDA 2QL5B 4B3RF 2ZM6J 4BS2A 2YNHA 4ELUA 1T05B 3Q83A 1Y3JA 3B4DA 2LQBA 1BMQB 1R8CA 4DR1F 3FSYA 3AQPA 1PYOB 4HTJA 2FJAB 5BYQA 3VQTA 2MKIA 3DXSX 2V8HA 2GC8A 3W1YC 4M63A 2RNEA 4LQ9A 4MK7A 2RDJA 1GAOA 5HLFA 1JLAA 2U2FA 1C0TB 3ENVA 1HYSB 4HACA 2CNNB 4LVOP 5GMEA 2DNYA 1NXIA 4YR3A 3ZTRA 1EKRA 3BSOA 3U1MA 2BQRA 2UVVA 4KB7A 4KE5A 4OHVA 2HSEB 2ILZA 1XNQJ 4KFBA 3IAS9 1G1XA 2RQKA 4NLWA 3N28A 2JFDA 1HBOA 2J8AA 4RZRA 1UPMB 3B8HA 5CZVA 4G1IA 4TU9A 4DV5J 3ZTPA 3PZPA 3G6YA 3OL7A 2LXFA 3I4PA 4ITSA 4DR4J 1DQ9A 1H7WA 1U1OA 4ZN1A 5B0EA 1HARA 1T0TV 1WSVA 1U45A 1UEVA 2MKYA 1S0OA 4M5DA 2YWKA 1HNXJ 3U27A 4CLLA 3AOCA 1WSRA 4K4UA 3M8PB 4WP8A 2HNZA 1R89A 1U6FA 3EGZA 2W2OP 3WIUA 1IKYB 4I64A 2W9CA 3FDSA 5D0GA 4DR2F 3G2XA 2DISA 4P75A 3H0PA 3VAMA 4EI2A 2ZH3A 2DHAA 3MAAB 3PXGa 5DJBA 1D9AA 4QQBA 4LFCF 5A6WA 4WP9A 4X64F 1FFSB 2V67A 3CCMS 4PEOA 3KHHA 4ECSA 1JKHB 1FFGB 3SFGA 2V2ZA 9RUBA 1WC4A 1PC4A 3SEOA 1ZZFA 3CJ0A 4RUBA 2V9WA 2UUCJ 3BPSP 4DPOA 1EJ7L 2DPIA 5FJ4A 2K1RA 3OV7A 1U1MA 1VISA 3TW0A 4LBIA 1Y5IB 2B3TB 1YRUA 2DHXA 3K7RA 3MMAA 4LVNP 4Z7YA 2HNDA 3PW0A 2CFXA 1TKTA 4JI5F 4GVBB 3OFHA 4FVMA 3OVAA 4R0JA 5E33A 2FJBB 3DRXA 5DQHA 4TKTA 1LNQA 3C3LA 4ZPWR 3C6UB 4GRSA 2X3DA 1TR0A 3ZC4A 2KXHA 3VALA 3T1YF 2DXDA 1LXJA 2HBZB 1V3ZA 2C3UA 2HLUA 3DOKB 3MMAB 4WU2A 1IBLF 3BB5A 3C2PA 4JI8J 5CYJA 2Q66A 1WDTA 1OQ6A 2R7UA 5HP1A 4IH5A 5KFXA 1ZETA 3W2WA 3HMJG 3THTA 1Y5NB 2Z56B 4NI2B 4CLPA 2F4VF 2Z2ZA 4ZHRA 2HK2A 2NQPA 3N5BA 5MLCV 1S9GA 3BQ1A 3MPYA 2ZBPA 4ES3A 1TK5A 4IRCA 3C16B 1VQKS 3NCQA 1WEXA 5LXRA 3MM7A 3MECA 4QYRA 1SC3B 2DGTA 2DY1A 3IN5A 3RRGA 3UVJA 4ZVQB 1WC1A 2QRRA 2B9XA 4B9UA 2YWGA 2FY1A 4U7CA 3MR7A 3ZNJ1 3I32A 4GKKF 2DR8A 3QGGA 3LANA 3D28A 1IBMJ 1RT6A 4DV2J 1F3VA 2BOAA 3T41A 3LP0B 4C8NA 2ZKUA 2ZJQQ 1H7XA 1MMDA 2J8SA 3DOKA 1NPRA 3C15B 3OTOF 4CM2A 4QOTA 2ASYA 1VRQC 3CO0P 3LP2B 4LF7J 1H98A 1X5PA 4L75A 2LECA 4EZ9A 2HHWA 3GMGA 3HPOA 4DQPA 1CQMA 1T11A 2HHXA 3EWGA 2WTFA 3OQ2A 1RWNB 4R25A 2RHSB 1G6BA 3HJVA 3SCIE 4CO4A 5DGBA 3IRXA 3MEEA 3BQ0A 2E1CA 2B4PA 2D3UA 2HFNA 2MQQA 3LP1A 3ENQA 4DR2J 2CG8A 3TAPA 1VRTB 1SL2A 1GX6A 1RTJA 1FJGF 5HSPA 5ADZA 2NPIA 3C6TB 2C3MA 4Y2KA 4B3RJ 1WNEA 1YRXA 4JV5F 3RG6A 2LQ8A 4TN2A 3M8ZA 1WDDA 4DUYF 3LW5C 2QYGA 2WVFA 3C46A 4CNZA 4FF4A 2RDDA 1ZPWX 3PHTA 4OQJA 2K3KA 5HVGA 2J9CA 2OPRA 2GJ2A 3KNGA 2XLIA 1Q53A 1UZHA 1HIYA 2HZAA 4H4KC 4PXEA 2QA4G 4QIGA 3K8VA 4PAAA 4ZS6A 7FD1A 4F3OA 2VODA 2VG7A 1HBUB 1OS5A 2KG1A 4LRBA 5HL7Q 1QAIA 5BR8J 4DF8A 1LWXA 3POTB 5C2GA 2VPWB 1R3NA 2J9EA 3VWSA 1MNEA 5HROA 3MM9B 2BOPA 3F56A 1RT4A 1KWMA 3UR3C 2H48B 4JOUA 5KFZA 1RTJB 1X60A 2MY7A 3SDEA 1E6YA 3BKFA 1UKUA 2W4PA 3PNIA 3NGUA 1IM6A 3H59A 3T6BA 3DDKA 4CTAB 1FTCA 1VQ4S 4QWAA 1RHJB 2CVEA 2FVCA 4WK1A 4CLYA 2ZNZA 3BGFA 3QGIA 4UUXA 4YMEA 1T3OA 2UUBF 2N4CA 2QX0A 3Q86A 1TAUA 4DV7F 1U25A 2KB2A 3FEYB 1C0TA 1OJ4A 3MDFA 4BWMA 1LQ9A 3W9HA 3MM6B 2ALZA 1P27B 2Y1RI 3QRPA 3RYLA 1ZM4A 3AODA 1NZ8A 4WYWA 3QT8A 4K4YA 3O5TB 2EFQA 2M5YA 2XNQA 1Q79A 4HDGA 2EFVA 2XMAA 2FUG9 3EX7B 3T5HA 1N4LA 2DB1A 4KTQA 1S1UA 3HHNB 2WAQD 3RRHA 4EO6A 4GC6A 3POTA 3BBCA 4DR5F 4M5IA 1HQUA 2YPYA 1XJWB 3A1YG 3CDWA 2CQBA 2KDOA 2QMXA 1FRXA 3DCAA 4CH1A 1VMBA 2LKZA 4ZPVR 4IQMA 4AT1B 4ZVEA 3L95X 3OR2B 1MWZA 2DGOA 3K2YA 2RUGA 2OD4A 1NBEB 1X4AA 2MZSA 2O67A 2JOQA 2DH8A 3QAUA 3UN3A 5K8OA 2G9OA 3GFHA 3QAEA 4TY8B 4XPCA 4M95A 3UNGC 1ZM9A 3HI9A 3OXGA 4LRCA 2DNZA 4FBUA 3D6FB 2W1BA 4WBFA 2CJQA 4RW7A 1YQHA 3JSMB 1OIAA 3KJQB 1TK0A 1KQFB 2N3OA 1YJ7A 4WTYA 4BC7A 4NXNJ 5IV4A 4OYWA 1X5OA 4V19J 1QJHA 4NE9C 1REGX 2BEFA 3H98A 3TJAA 1FKOA 1FA0A 3D9BA 3GIIA 2J6SA 4JV2A 3BEGB 4CLUA 1TZ0A 4U67Q 2C2KB 5GAHU 3MM5A 2HS4A 3D0GE 6FD1A 1GEHA 2FQQB 4Q8EA 3OVSA 2E9TA 1TV6A 4HHJA 3NGDA 3NAIA 1R27B 2VPYB 3H2VE 4EO8A 2VG5A 4C11B 2QN6B 2XEXA 3GTYX 4N41A 2RHQB 1D9FA 5IQ6A 3VVTA 3D0IE 5SZTA 1TFWA 5EGYA 1CBKA 5F8NA 1EHWA 3BH7B 1SJQA 5FLXY 2DGQA 3HSDA 4D3GA 3ZTSA 2VU5A 3OUYB 1LKZA 1NK7A 1FTRA 1TL4A 3GQCA 4IRKA 1F5BA 1SQGA 3C6UA 3C14B 6AT1B 5AE3A 3LGNA 1DURA 2R7WA 2WOMA 2I5JA 1L3VA 1E6VA 1WELA 4M1KA 1LK7A 3MM5B 4WIIA 4EBCA 3KUEA 2QFIA 3BF4A 9ATCB 1F3FA 2C42A 2ZBCA 2IVFB 2HQDA 2X3GA 2RKIA 2P9GA 5IM0A 1VIOA 3CJ5A 1FX2A 3SXLA 4B17A 2UUWA 2EFOA 4LBPA 3X3UA 4Z37A 3X1LB 3FBFA 2JL9A 3Q8UA 2FHKA 5HATA 3QGHA 4KRWA 3W64A 1S4FA 2VJVA 3UCUP 2H54B 3BGLA 1J5OB 2XMUA 3BGUA 3KJNB 5DQIA 1GXLA 1KP6A 4RW8B 1WACA 3Q24A 2ZDPA 3PX4A 1M1HA 1REVA 1JX4A 4ES2A 4A8MP 2Y1JA 2HHTA 1P9YA 2XLJA 1S59A 3DHWC 4DV6F 5AJ3J 4DBQA 1T94A 4XPEA 2R8IA 3K17A 3IR7B 2ZH1A 3BDEA 1V9OA 3M2UA 3R7NB 1VBZA 4KT0C 4NLTA 3W2VB 2CG4A 4CNYA 2FY8A 2XSFA 2HIYA 2OUGA 2GW8A 4IG3B 1N33J 1FDBA 2G2OA 4ETXA 5KT2A 5D6GA 4ZPDA 1FXLA 1W25A 2HWTA 3JTOA 2CQPA 2XSJB 2ZEJA 3GV8B 4QIWD 4W4MA 5T7LA 3VAFA 5THWA 2A2CA 2H5EA 1XERA 1PYSB 1H38A 1KRPA 4NXNF 1QVFR 3E3XA 5T14A 3D6MB 3JXOA 5CCLA 1J5OA 2YQ0A 3NNAA 3JSRA 3QSIA 5F0UA 5KG4A 1RYRA 4QU7A 3VGSA 3CPWR 3R6GB 5J2NB 2CIMA 2DVIA 3EGWB 4LFAF 4MJKA 5AE1A 3E2EA 3QRQA 1IKVB 2YQ3A 1RYSA 4X4UA 2BE2B 4R5PA 2UUAJ 4MK8A 5ETSA 3W5ZA 2OELA 4EYHB 1R0AB 1OQ3A 3KUHA 4JI2F 1MN7A 2JLGA 2UVWA 1PC5A 3OT9A 1WHXA 2V68A 5FIIA 4ECQA 2VG6B 1JLAB 2PEHA 4I0WA 2U1AA 2MHEA 4A8KA 3KMQA 2DH9A 3TANA 3D3BJ 3FKBA 2IJFA 2LVWA 3TZXA 5HROB 1FRJA 2WSEC 3KDNA 1DRZA 4QR0A 2VIHA 2HWIA 3H40A 2IA6A 3LH2S 3SYZA 1KNZA 4W90B 2QZ8A 3RB3A 1RAOA 1Z2ZA 2NYIA 3TA2A 1HQ2A 4LREA 1RCXB 4M8LA 3Q23A 4Y2AA 1YX2A 4LJMA 2CJXB 2XMWA 4RWXA 3KTQA 3IBCB 4NOHA 5GAGI 3NBPB 2AEMA 3AXKA 3CMQA 3M4XA 4L3NA 2EC2A 2QT7A 1YSJA 2RQ4A 4RJVA 1Q4RA 3I56S 1F5AA 1U0HA 2KN4A 2R7XA 2LDYA 2KZZA 3NOGA 2YKAA 2YY3A 4QPTA 4ZVTB 4OMFG 3FEXB 3MAQA 1C0UB 2AJ2A 2YX7A 3OFEA 5D4NA 4WWSA 2ZH8A 1V3RA 2VFSA 1J5EF 3TP2A 1FERA 2HFSA 2MJUA 1CJTB 3HP6A 3D54A 5FDLA 4X84A 1G3OA 3BZQA 2I38A 3CCZA 4IFVA 2DCUB 4OZ1A 3WBZA 1KN6A 1UL3A 1RTZA 2KXFA 3D1OA 3PR5B 1XNRF 2FGCA 3KNAA 4JP8A 1UEKA 4LIRA 5LSRA 3BR8A 1G4CA 1NSKL 2F3JA 2YVSA 4I6YA 2RRAA 4ILRA 2XMJA 5LT5A 3NBPA 1YDLA 1NCLA 3MEKA 1VQPS 3TEHB 2EBEA 2DJWA 3W8PA 2XS7A 2Q6CA 4WE1B 2AZ1A 1CG2A 5HI7A 1RAIB 4QWEA 1KFDA 4J9QA 4PWDB 3U7JA 3KXDA 2VQFF 1VRUB 4J9OA 4P2MA 4R0EA 5DG9A 4HDHA 4WJBA 3PV8A 2N7CA 5KT5A 2QV6A 3NRBA 4RL1A 3FK4A 4ED3A 3HK2A 4DV1J 4OZLA 4NMXA 2UVUA 1Q7LB 2FJXA 3Q89A 3ZXWA 5I3UB 2R8HA 2EKYA 2QFJA 3V6HA 2IYGA 4LF9F 4DSFA 4J9KA 2YNGA 4B02A 4BBYA 4AL5A 3UDEA 3KLIA 5E3QA 4F36A 2GJFA 2EFGA 4RBVA 4O3NA 3J80Y 4C3MA 4PWUA 2DNHA 2DNOA 3FQKA 3W9JA 5H9EK 1UJ5A 2OD6A 3BPDA 3EUNA 5C7PA 1MN9A 2PI5A 3BGOP 2C2RA 5KFBA 3UQSA 1URRA 2VA2A 1TAQA 3TARA 3S6EA 1AZSB 5KG6A 4DQIA 1NEEA 4B9VA 2M0GB 1SJ4P 3NS7B 1HYSA 3LP0A 5B0FA 3N6MA 5CABA 5K8MA 4X64J 1VJQA 3VGTA 4PQAA 1HR0J 3P49B 3R2CJ 1CEZA 1NJYA 4CQ1A 1X9MA 1GFWB 2EC0A 3B54A 3IM9A 2XHCA 2I2YA 2ZZNA 3OL9A 4WKRA 4NCGA 4O44A 1TKXA 4FBTA 2ZVSA 2QYCA 3M9MB 3KLEB 2R8KA 3IGVA 3VCDA 2P2CB 5IS2A 1FE4A 1LK5A 2IJNA 4KHPJ 2GV1A 4DSKA 4HLBA 2R4FA 3H8YA 1KONA 1WTFA 2B56A 2EFPA 4L73A 4NLSA 4NA2A 5M2UA 5G0RB 1B3TA 1HFEL 1M5SA 3UVJB 1RCOB 3CSKA 1P8GA 2P9EA 2UXCJ 1U1QA 4E8UA 1VBYA 4YN3B 3SCJE 4P7TA 2KH9A 4CT8A 4DX7A 2Q79A 2BV3A 3UE2A 1FKPA 1J27A 4KV8B 4XAKA 1OO0B 2NSCA 5HAOA 5KFPA 4I2PB 2CDQA 1S0NA 2ZZMA 2IPOB 1N5YA 4P9SA 2G1HA 2NZ4A 1RU1A 2VH7A 1AFIA 1JLGB 2MGZB 3FFIB 4I56A 2ASDA 4IDKB 2KM8B 2R2SA 1UJ6A 3UD5A 2EEYA 1PILA 1RAFB 3M1VA 1UAWA 2FB0A 4PKDB 2QSFA 1FVSA 4ETZA 4YHHF 2PI4A 3W5YA 2YKQA 2BE2A 4R8UB 3PJ9A 5KG3A 1RACB 1VQOS 1RWMB 1EB0A 3D0HE 1TL1A 2FVSA 4W92B 3M8PA 4KKOA 3BSNA 3RRKA 3QJJA 1TP7A 3JQJA 2FHJA 3D67A 4USTA 4YQWA 2F4FA 3MZIA 3DRSA 3HHEA 2VKZG 3CVKA 3SCLE 4RUHA 5DDOC 2A6OA 1NJIT 2EW9A 4NCAA 3F41A 4Q45A 1W7WA 1NB7A 4F4XA 3OSNA 2WVCA 3K0JA 1R0CB 1P6TA 2EPIA 4UT4A 3OHAA 4J7CA 4DL2A 1K47A 1SJ3P 2F8EX 2VOOA 4JI7F 1FWPA 4FXDA 3C8YA 2AP6A 1AXQA 1B4SA 2B7CB 2KJWA 3QATA 4KFBB 4KKOB 3HHLD 4KY3A 4MYTA 5F9NA 5F8LA 2KG0A 3T5LA 3ITHB 4P72A 3HT3A 2X1BA 2ZBRA 4KC5A 2VA3A 1HNZF 1VIXA 3THVA 4OI1A 2QO3A 1PSDA 2J0XA 4CO0A 2VOPA 4ZPAA 1KC8T 4LRDA 1RAEB 3R5CA 2HNDB 4UUWA 2XO6A 1JJCB 3VV2B 3MR3A 2E5HA 1U8SA 1KOHA 1FT8A 2F63A 3FGVA 2YXLA 2ZUGA 2OGUA 3OTEA 4NYOA 3JSMA 4ER8A 2CNLB 3DOLA 3HHLC 1TFYA 2J7KA 4RO0A 3OJUA 2VBXA 3VVUA 3DOMA 5RUBA 4IQXA 1L3SA 4IKAA 1WC5A 3M9OB 2MJNA 3I5CA 3MMCB 5BR8F 4MFBB 1RBOB 1WG4A 1PYTA 1H6KX 4J9VA 3Q8QB 4I6AA 3ZTOA 3E01B 5I42B 4PZVA 4JV1A 4DZDA 5LMUF 1P1LA 2B7BB 1EZZB 3HVWA 3MAAA 1KFSA 3BM7A 2PD1A 5B09A 1HHSA 3D68A 4DSEA 3L4BC 4P73A 2O5DA 1HNWF 3ILIA 1JLEA 4YB1P 1N5TA 4DL6A 1Q8IA 3G82A 2LFVA 3SFUA 2IMOA 2ZH2A 5KFTA 1J5EJ 2AIRB 2R7SA 1UW9A 1YTYA 4WE1A 1LW2A 5IT4A 2WB4A 3RR8A 2LEPA 2IC3B 4ATNA 1NKBA 3KLGA 2PA3A 3B82A 1CULA 4C97A 1N32F 2ZFHA 3GFYA 3UW1A 1KVIA 1VRUA 2NXEA 2OMLA 1DHMA 1ZM3A 2KHCA 1O5JA 1XTZA 3CJ8A 3MM8B 3TZZA 4KPCA 1UWBB 3IBWA 3W8GA 1K44A 3CT9A 4AXJA 5K8NA 1GK8A 3K5MA 4OZNA 5DM6Q 1RT5A 2W4DA 2PN6A 4FXWA 4DPTA 2AD9A 1N36J 2ZNYA 1SQFA 4ZIWA 2NUHA 4NLGA 3FZBA 3G87A 2GZOA 2MPUA 1YWXA 4CO1A 1UJ4A 3G86A 5DETA 1N52B 4OI0A 1CULB 3QMQA 4DUZJ 3PYEA 4ZMMA 2V4JA 2B9WA 1RTIB 4X4OA 1YIJS 3G82B 1UWBA 1U7LA 3RW6A 4JI1J 3MM7B 3C6TA 2HURA 4F50A 4B3TJ 3GU0A 2HVIA 1B99A 2HGMA 2XMKA 3LA0A 4DX8H 3KHGA 3KLGB 4RNFA 4Y00A 5KAKA 1N5SA 3BR9A 3WX4A 3I0RA 5LMNJ 4OHWA 4V19X 3A8EA 5ETNA 2BZ2A 3IWXA 3NEKA 2HGNA 2WBMA 4LSLB 4DPUA 1YLXA 1X8DA 3FMWA 3QZ8A 1M5KC 3L7UA 3SV4A 2OTLS 3R6LB 1RT5B 4KGXB 3I0SA 3DRPA 3HD2A 5IXUA 1FWLA 2ZBIA 3AD8C 3LAMA 4IH7A 3DNCA 3KK2B 1T03A 3J7AN 1JWWA 3FMBA 3E51A 2E1AA 3HF5A 3J7YU 3K89A 1TU0B 1QY7A 1X4CA
chains in the Genus database with same CATH topology
3LWLA 3UCGA 2FJDB 4R5PB 5EWGA 3NP5A 4OV1A 3SDEB 1C1BA 5L38A 1VRTA 1U1KA 1E6YB 2XY5A 2YTCA 3DM2A 3M6XA 2GGPB 1N56A 3U02A 5F3ZA 3JB9k 3DI6A 1JXEA 4B9NA 5B0CA 2C2DA 3T19A 2XCPA 1SUQB 2KM8C 4QWCA 3CF5Q 3AA8A 4ZVHA 2CQIA 5IQQA 1NK6A 2DTJA 1HWIA 3V81B 2YNIB 2YH0A 2V8DA 4NPOA 4IG3A 2JHEA 1RTHB 3M8RA 1RTDA 4G6VB 1VQNS 4U7UK 3MD1A 3GWCA 1N8RT 2FIUA 2E5LF 2YNFA 4Q44A 4HKQA 4R8UA 2QLWA 1SJ1A 4JV0A 2MZJA 5KFVA 4C8YA 3HLUA 3MEGA 3LWMA 2BM1A 3RAXA 2BRLA 4JI3F 1YGYA 1ZTTA 3RBDA 4Y65A 2VPZB 1A9NB 4NXMF 1KLNA 1YJRA 1XBWA 4DLEA 3V6DB 2HMIA 2XI3A 2ZOMA 3LF0A 2CPHA 1R8BA 2VG6A 5FD1A 1NK9A 4G1QA 3MEGB 2F40A 4ZOSA 2WW8A 2ZOFA 3CB4A 5CHCB 2M52A 3BQ2A 2P6SA 4TU7A 3HVTA 1JKHA 4WXWA 4CO2A 3IAM9 1S10A 3HKZD 5L9NA 1X0FA 1FNXH 2CZVC 2IRXA 2XMTA 1V3SA 2Z2MA 2ZHOA 3J81Y 3CDBA 4MK9A 3NWGA 4OI6A 5LSLA 3VR1A 3CUNA 1ZZNA 2G0CA 4BC9A 4YR2A 3I55S 2I1RA 3DMJA 1SV5B 1Q82T 3QJPA 3IGNA 3CXCR 4DFKA 2BACA 2IHR1 4DL0C 4G1QB 4ZPTR 3OTDA 4ZCMA 2DO4A 4FS1A 2D3ZA 2LQJA 5J2PA 2B6AB 2W9BA 3T9ZA 3FVYA 2B4OA 3MEDB 2AW0A 4A48A 3IWLA 4X4PA 3L7OA 3PW7A 4ZA1A 1UVIA 5KG2A 1A7GE 1FD2A 2J76E 2VKRA 4LUBA 4DFJA 3RZAA 2XMVA 4TYBA 2VBYA 3QLHA 4XDDA 1CC7A 2FHOB 2LXIA 3KLIB 5KFMA 3NKYA 3RR7A 4FYDA 4QZVB 3DMJB 4X4TA 2KJVA 4O3OA 4C3KA 5CH7B 1JLQB 1VGYA 2OO4A 3N4WA 4EBEA 3ICLA 4E98A 3KG0A 2MMYA 3CGIA 2BRKA 3Q8RB 3PW5A 1R31A 3M2RA 1EETB 3AA9A 4I2QB 3KLHA 1KHWA 1X4GA 3DGPA 5KOWA 1N6QB 4AL7A 3M6UA 4MKYA 2BVZA 4TYAA 1SBRA 2MKCA 4PG8A 4HI1A 4J5OA 3OR1A 1HD1A 3T9NA 4CO3A 2CQDA 4B9LA 2WK4A 4Q2LA 3OTCA 4RW4B 2FVRA 3H2UB 3IS9B 2DBBA 4OLPA 3ZZ0A 2G4BA 3CCSS 1BQXA 2NSBA 2HWHA 5DQGA 3GG1A 4OZJA 1U1PA 3CJ3A 4O23A 3M9NB 2XC9A 5A8RA 4DN0A 2ZH7A 2FVQA 2DHSA 4PRFA 3T3FA 5KG1A 1JIHA 1LWFB 2MHNA 2J9DE 2J6TA 4DV5F 1DTQA 2K3IA 4JI0F 5F8GA 2RRBA 3IS9A 5HLFB 2A3JA 1D8YA 2D3OR 3WDOA 5DDRC 1H0HB 3P6YC 4HYKA 3KHLA 3O2IA 4QW9A 1OWXA 5MAOA 2FC9A 2CQ4A 3N9UC 4IOBA 5T7LB 3T5LA 4WFXA 3K5OA 4DQQA 4A8YA 5A8RB 2E9ZA 3L09A 3G71S 2CVIA 5GAEU 4TQSA 4D3HA 1N48A 4ED2A 2CKWA 2ZJRQ 1ZTWA 3GFXA 2NUUG 4P2SA 2JC0A 2CJKA 4ZCLA 4FP9A 4O0IA 2GQQA 2UZAA 2V8VA 4NLOA 2IYIA 4N76A 5KFWA 1DLOB 3TQ1A 1UFWA 2JX2A 2UUCF 4ECRA 1K73T 5KOXA 2J5AA 1R6YA 1CVJA 3OL8A 3BN4A 2VFUA 2YX4A 2KKHA 1AFJA 4C8KA 4NMLA 4EEYA 3OSPA 1IKWA 2XS2A 2XHWA 4OJ1A 2IRYA 2XWYA 3I4HX 4NZ0A 1YHQS 2R7VA 3VAKA 3TX8A 3ITHA 1CSJA 4K4WA 2RVJA 4YB7A 2D1CA 3H5UA 1C2PA 3TUIC 3V4MA 1F9FA 2QA1A 2JEFA 1FF2A 2AJ0A 2FHMA 4H54A 4ED1A 3CJ4A 2A1BA 4B3OB 2GCFA 3FJ2A 2RU9A 5KTQA 1U1NA 4LQ3A 2UXCF 1DQAA 3ETOA 5M2PA 1HBMB 1UVMA 3E01A 1TL3B 2CQGA 1S6PB 1RT1B 1KLMB 3LALA 2AYBA 2WCXA 5HO4A 2Z0GA 3KLFA 4PUOB 2PA8D 2RU3A 2NPFA 5BYRA 5E7OB 3ISNC 3CDEA 3EZ5A 3BS9A 3GG0A 1NZAA 4A8FA 2HNZB 2DNMA 2E7WA 4LFBF 1APSA 4EFAC 3GFZA 3H20A 2IC3A 5J1EA 3N5FA 3PACA 2IVYA 3AB4B 1C0UA 4F02A 1HQEB 3S01A 4JUZA 1H2UX 2J9DA 4AFFA 4IG0B 4A8QA 2DR7A 3IXQA 2OPQA 4JBCA 5L1IA 4C0HA 4F3QA 2VQEF 4C8LA 4RNHA 3GYNA 2BANA 4UY85 4DSJA 4NL5A 1TVRB 1HNIB 4AL6A 2FJVA 5E3RA 2W9BB 2HZCA 4KAIA 4FS2A 1RT6B 1SIZA 2K1RB 2YKOA 1YJ9S 3JTPA 2L9DA 2OPQB 3FQLA 4TXSA 5D4LA 5KFNA 5CYMB 5D3GA 2DGWA 2HLTA 1YJVA 1B0VA 4TNOA 1KR4A 1U47A 2W24A 3BSAA 2KFNA 3OFGA 5HN0A 1QE1A 4Q43A 1TVRA 3J7YI 4F4ZA 1EP4A 2W7AA 1PO6A 3V4IA 2D7SA 1UVLA 2AV5A 2VONA 4EUVA 1NNDA 2ZD1A 1TKTB 1ZOTA 2A18A 4ZPCA 3MR5A 1XR5A 2ILYA 4IO9Q 4NYPA 2YKNA 3M30B 5E0OA 1HNIA 4EBDA 1JJ2R 4HTIA 2X1GA 4LMZA 2KO1A 4ERDA 4YFUA 2IM0A 3AH6A 2RSQA 3DDNA 4PPZA 2XZWA 1QAXA 1YJTA 2HVHA 3TAMB 3CMAS 4YP3A 1WWHA 1VQ9S 2MKJA 1SH0A 4KGMA 5J2MB 4TLRA 2AYGA 3IA0A 1TKXB 4OI3A 1QSYA 3K5PA 1NJWA 4RX6A 2CPXA 2LMIA 2IBOA 1BQMA 2G13A 1HD0A 4OHXA 3TAQA 1X4FA 2O1PA 5AJ3F 3L7PA 3M2VB 3KJVA 2ZHAA 1LV5A 4WFBQ 1HBOB 2KYZA 2R7OA 4DHVA 3CCLS 2F8HA 1K8AT 2N3LA 2Q1LA 2BDPA 4TU8A 1N33F 1RT2A 3ULHA 4PG6A 4RLEA 4Q7AA 2AJFE 2LYVA 3UR0A 3DRPB 2ROPA 4FNIA 1JLGA 1MMNA 3MPVA 3UI3A 2IVMA 1Q1KA 4Y0FA 4OI2A 2QA4S 5C25A 3L3CA 1ZAWA 2ROEA 1JLCA 3UD3P 4YR0A 3QIPA 3DM2B 5A0YB 2KFZA 1Q16B 4C7QA 2GGPA 3DU6A 4PXDA 2LU2A 2YH1A 2M9KA 2BYCA 3KMSA 3VAHA 3LO3A 2ZE2B 1HWKA 1IQTA 1DBDA 2JZ5A 1DLOA 4DOZA 4A4JA 3FNNA 1P9QC 5DG8A 1JMTA 1HNXF 2FD2A 4LT6A 3UD4P 1M5PC 4A8OA 4GKJF 4HT5A 3CD5A 2JH3A 1VLYA 2L9NA 3MWBA 2CZ4A 2R9LA 1UP1A 1N54B 2MSTA 4OJ3A 3ZZUA 1HPZB 2M70A 3HVRA 4ZLPA 3TA0A 1KOOA 1JLCB 1H2VZ 3SMZA 4PXBA 5DS7A 3P5TL 1L3KA 2GMJA 2ZE2A 1GNKA 5J2PB 4F26A 1KTVA 1FO1A 2DNGA 1S49A 2WONA 1ZH5A 4XO0A 2AYMA 1NK8A 4KJIA 3BGRA 4WK3A 3EPGA 1X5SA 2ZH9A 4RW9B 1RA7A 4NLRA 5HMXA 3I9V9 4MFBA 2M3DA 2EBGA 1BQNB 3TVZA 4C8OA 3ZFVA 4CT9A 1NHVA 4DG1B 4DJBA 1HW9A 3OTBA 3KK1A 3BDPA 3NS6A 2RDIA 1JLQA 1MMLA 1N5VA 1S6UA 4MTPA 3NNCA 3Q22A 3S8SA 2GIRA 1JLEB 3CDUA 2UXBF 3PR4A 1FHTA 1IM4A 2J0WA 4Y34A 2V94A 1NO8A 5AXLA 1YJWS 4FNHA 4EU0A 5KFGA 3ZZZA 1SH2A 1NH7A 2QMWA