2DIUA

Solution structure of the rrm domain of kiaa0430 protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
b'GSSGSSGCHTLLYVYNLPANKDGKSVSNRLRRLSDNCGGKVLSITGCSAILRFINQDSAERAQKRMENEDVFGNRIIVSFTPKNRELCETSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0430 protein
publication title Solution structure of the RRM domain of KIAA0430 protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2006-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2diuA01
4YB1P 2CPHA 1H2UX 4TLQA 2JVOA 4EGLA 5GMKa 3R1LA 2KFYA 3G71S 3P49B 1VC5A 4A8XA 1X4FA 4UQTA 2M88A 2K8GA 2GHPA 3CTRA 2WBRA 3MDFA 4V19X 3UCUP 1SJQA 5CYJA 2RS2A 1JJ2R 2EVZA 3JB9k 5CXTA 1U1RA 2LEBA 2DGOA 4FXVA 1OO0B 1HA1A 2MKCA 2ADBA 2L41A 4J5OA 2DIVA 4F26A 2X1GA 1XN9A 1U1KA 3OW2R 2MZJA 2O3DA 2DGWA 2FC9A 3NS6A 2MKJA 3VAIA 2N7CA 2LXIA 3MI7X 2DHSA 2JWNA 1WHWA 2N3LA 3G4SS 4W92B 1WI6A 2ERRA 1U1QA 5LXYA 1X5OA 2CPJA 4ERDA 3CC2S 2DH9A 3J7YU 1YITS 3CCLS 2XB2D 3EX7B 2DNOA 1VQ8S 1WHXA 2RT3A 5JVHQ 3NMRA 1VBZA 5DDPC 2D9OA 2KT5A 2PE8A 5DETA 2J76E 1X5TA 2U1AA 5LJ3Y 2DGQA 4CH0S 1P27B 2DNMA 2M52A 5HO4A 2CQDA 3J7ZT 1Q81T 2F9DA 5LJ5Y 2MY8A 4WFNQ 1N54B 3CCVS 3UD4P 4C7QA 3VALA 1L3KA 2MZRA 1VQNS 1OIAA 2YH0A 2MKKA 4UY8T 3HHNB 1A9NB 3DLLQ 3MD1A 3CC7S 1VQ9S 2AYEA 2YTCA 4YUDA 2HGLA 2DHXA 3MOJB 5IM0A 2RVJA 3TP2A 2LECA 4CH1A 1X4DA 2KN4A 2DNHA 4PKDB 2CQGA 2E5IA 3N9UC 4TU8A 2N82B 5LSLA 1WG4A 2NLWA 2KU7A 5GAHU 2BOPA 1H2VZ 3VF0B 2KHCA 3PIOQ 2MQMA 1SJ3P 2VOOA 2J0SD 2DNKA 3CD6S 2M70A 2MZQA 5D78A 2Q79A 2NZ4A 3CCMS 2OSRA 2G4BA 1ZZNA 5DDQC 3MUTP 3VAJA 4U67Q 2X1FA 2L9WA 2M4MA 2CPIA 2DNZA 2AD9A 2DH8A 1U2FA 5DDRC 3I56S 1X4BA 2UP1A 5DDOC 1U6BA 1NO8A 2DGXA 5MLCV 1WI8A 1KQSR 2DITA 2QEXS 1X5PA 1SJFA 1H6KX 2RQ4A 2FPHX 3CXCR 2FC8A 2M8HA 1DHMA 2KRBA 3SDEA 1Q7YT 2OTJS 1WF2A 3MURP 2DGTA 3MD3A 2MJUA 1VBYA 2RRBA 5DM6Q 4WCEQ 3Q2TC 1JJHA 2M9KA 2L08A 2CJKA 4CIOA 2LMIA 1DBDA 5LXRA 1U1MA 3UD3P 1N88A 1A7GE 2LEAA 3V4MA 2KXFA 1Q82T 3MUMP 3G96A 2MHNA 1WHYA 1KOHA 2V94A 2RU3A 5BJRA 4IO9Q 3P5TL 1HD1A 1KD1T 1X4CA 3H2UB 2FHOB 3MUVP 2RUGA 1VBXA 1PO6A 2FY1A 1WEYA 3BS9A 1S72S 1SJRA 1VQPS 1K73T 1BY9A 4QPTA 1X4EA 2CPFA 2SXLA 4OZ0A 3VAKA 2DIUA 2RNEA 2VOPA 3TYTA 2MQNA 5IFMA 5H1SV 2F9JA 1CVJA 2DNPA 1NJIT 2EK1A 1VC0A 3BO3A 1YTYA 1M90T 2CQ2A 2MY7A 3VAFA 2KXHA 1U1OA 2AYMA 3H2VE 2MQLA 2DNYA 3U1MA 2DO4A 2KRRA 2MB0B 2MQPA 1ZH5A 5IQQA 2XS5A 5CA5A 1VQMS 3ZZZA 3LPYA 2X1AA 2LXUA 2XNRA 1R8HA 2MMYA 2OJ3A 1U1NA 3NS5A 3CC4S 2KYXA 2J0QD 1M1KT 2CQBA 2LCWA 2LQ5A 4P6QA 3UCGA 2M2BA 1PGZA 4PRFA 3US5A 2CQ4A 2OSQA 3NNHA 1X5SA 1S79A 1IQTA 2DB1A 1Q86T 4W90B 3I55S 1YJWS 4QQBA 3S6EA 1KC8T 4IOAQ 1OPIA 2M8DB 1RK8A 5GAGU 1U1LA 1WF0A 2F3JA 1YI2S 1DZ5A 2RRAA 2QA4S 5DM7Q 3EGZA 2XS2A 2ZJRQ 4ED5A 2DHAA 2U2FA 1FJCA 2B0GA 2MSTA 2ZJPQ 3MXHP 2MKIA 3NNAA 2KI2A 2D9PA 4Y0FA 4LJMA 3IRWP 3G6ES 2OIHA 2J8AA 2CQ0A 2PEHA 3CULA 3S01A 1WEZA 3RW7A 3VAGA 1FO1A 5GAEU 2KM8C 3NNCA 1SJ4P 2I38A 4TU9A 2I2YA 1SXLA 2ZJQQ 1FT8A 4BS2A 3CCSS 3G9CA 5IM0B 1M5PC 3ZZYA 2CQPA 2E44A 3G8TA 1D9AA 3S8SA 1U1PA 1N52B 2DGVA 2E5HA 3K0JA 2EK6A 1UW4A 2CQCA 1X4AA 5GVQA 3DXBA 3SXLA 2CQHA 2MQQA 3HI9A 2DNGA 4IOCQ 2A3JA 4WIIA 1FNXH 3B4DA 1VQLS 2MZSA 3VAHA 2M0GB 1OWXA 3SMZA 2AYGA 3S7RA 2MQOA 1K8AT 3ULHA 4RU2A 2X1BA 2XNQA 3R27A 4C0OC 1DRZA 2MZ1A 1M5VC 2GO9A 3G8SA 2MXYA 5JVGQ 2HGNA 1NU4A 3B4MA 3BO4A 3VAMA 1YIJS 3FEXB 1KOOA 2DO0A 2MPUA 1B7FA 2G1DA 2MYFA 3THPA 4Z2XA 1N8RT 2JX2A 2OTLS 2LKZA 2XS7A 1WG1A 3Q2SC 3RW6A 1JMTA 4WF9Q 3CPWR 4Y00A 3BEGB 3LQVA 1WTBA 1YWXA 5GADU 3R1HA 1K9MT 2RQCA 3IWNC 3EGNA 3THTA 2DISA 2DK2A 1YHQS 4TU7A 3SDEB 2DNRA 3CCJS 1F9FA 2KVIA 2CPYA 2MJNA 2MGZA 2LYVA 1VQ5S 4QU6A 3CMAS 3BO2A 1X0FA 4IUFA 2MKHA 2HYIB 2DNLA 1HD0A 2MZTA 1VQKS 1FHTA 1G2EA 5D77A 3L3CA 1H2TZ 2VODA 1WG5A 1VQ7S 1WF1A 4FXWA 1X4GA 1RKJA 4QU7A 2ADCA 3PIPQ 2N3OA 2RS8A 1M5KC 1FXLA 1HL6A 1QM9A 1AUDA 2LA4A 3CCRS 4YOEA 3CCES 2DGSA 1YJ9S 2CQIA 2CPZA 2BZ2A 2CPXA 2CPEA 4WFBQ 4ZKAA 5FJ4A 2MSSA 3UWTA 2G0CA 1W2BR 2HZCA 2XSFA 1WHVA 5LSOA 4OZ1A 2MGZB 3CUNA 1URNA 2E5JA 2CPDA 1WEXA 4LMZA 2AYBA 2KH9A 4WFAQ 2HVZA 4CQ1A 2DHGA 3CF5Q 4LIRA 2JVRA 2QFJA 2K3KA 2MKSA 2CQ3A 5ITHA 2KG1A 4F02A 4PR6A 3CMES 3UE2A 1UAWA 5HL7Q 2CQ1A 3P3DA 2YH1A 1QVFR 3CCUS 1VQ6S 1UP1A 2KM8B 1QVGR 1R8PA 2DNNA 3FEYB 2DNQA 2HGMA 1YJNS 4F25A 3D2WA 2YKAA 1VQ4S 4C4WA 2LA6A 2E5GA 1D8ZA 1JJ4A 4M5DB 1M5OC 1U6FA 2JRSA 2YWKA 1UFWA 1FJEB 3UCZP 2D3OR 1P1TA 1VC6A 3TO8A 1WELA 4WKRA 2KG0A 2DH7A 2VONA 1FJ7A 1O0PA 1ZZFA 1VQOS 1X4HA 1WWHA 3U1LA 2M7SA 5EN1A 3P6YC 3CCQS 2DGUA 2KXNB
chains in the Genus database with same CATH superfamily
4YB1P 2HZAA 4K2JA 3P49B 4ILMA 4DPOA 4PEOA 1UJ5A 3ZZPA 3MDFA 3OBIA 5CYJA 3JB9k 2D3ZA 1S99A 4N41A 3BSCA 3IAS9 3M8QB 2QA2A 1WUUA 3OTCA 1OYEA 2KKHA 4QIWD 3T9NA 3QJJA 1FFWB 4A46A 2DGQA 2W9BA 5HO4A 5A6WA 3HULA 1N54B 4B3MF 1ZM3A 4NI2A 1R8AA 1F60B 2IMWP 1ZYQA 2XWXA 4KGXB 2ACYA 3J7YI 2Y0SD 2YTCA 2L9NA 4KGZB 5C25B 5E2QA 1MMDA 4DL6A 3MM6B 3M2VA 4C2MA 3PIOQ 4FVCA 2KDOA 2ALYB 1ZS6A 1S4EA 3OV7A 2GJIA 3PVXA 3CCMS 5HQ8A 4WE1A 4IDKA 5C2CA 2F40A 4DS5A 2UXDJ 3A8EA 3PR5B 2HIYA 2MLXA 1NO8A 1X5PA 2R7SA 1R0BG 4GC7A 3W64A 1HNIB 4JI8F 3RYLA 4I0WA 5DG9A 2DGTA 2MJUA 4DUTA 3EVMA 2HBYB 1S0VA 5KG4A 3HHLA 1ZAXA 4LRDA 2XSJB 4WWSA 4LFCJ 4DSFA 3W1YC 3D9BA 1KD1T 1CJKA 3EICA 2FY1A 3TWZA 1VQPS 1K73T 5KG7A 4PQUA 2BE9B 2HBQB 2DNPA 2VD3A 4KQZA 4ZHRB 3GYNA 3BO3A 1RT5B 4ZCIA 1AW0A 3H2LA 2IA6A 2X1AA 1RT6B 2OJ3A 1RWNB 2QN6B 1IQZA 2GA7A 4FYXB 2BM0A 2QSWA 3IWXA 4XK8C 1X5SA 3ZZOA 1F5AA 4M8LA 1LOUA 1ITPA 3H20A 2W4PA 2DY1A 4CLPA 2VBXA 1RHUB 2U2FA 3GZ7A 3RUBL 2HMIA 3DRRB 3G82A 2XGPA 1CJUA 4NCBA 5HQMA 1U09A 2L9DA 3DU6A 4KC5A 1WEZA 2AX0A 2I2YA 4ZVTB 5J2MB 4GKJF 3S8SA 1R43A 1UVNA 1LWEA 2B4PA 4M5JA 2OPQA 3B4DA 6FDRA 1NJYA 3BQ2A 2J0XA 3KMSA 2IFXA 1XWLA 3ULHA 4F3MA 2V2VA 1PAUB 3CJ5A 3GSIA 3KMQA 1JLCA 2AGPA 2BE7D 1QJHA 3NY0A 2IM1A 3BEGB 3X1LB 2C2KB 1XIQA 2E7VA 1R0CB 2B43A 3MCSA 1U0HA 3W2VA 1TL7A 1T95A 4EI2A 1TL1B 3E01B 3ZTRA 5AXNA 1H2TZ 4A8KA 2J8SA 1MROB 4P75A 1SQEA 2W24A 3C15A 3AQOA 4LFCF 2CQIA 3NGRA 1NK8A 1I94J 2GMHA 3FJ2A 1I3OB 5KFCA 2E7XA 2JEIA 4HACA 4J90A 4RBTA 5CD4H 4ZCKA 1XC9A 4BHQA 4LFBF 4M1KA 1BLUA 1NXIA 4F02A 4JV2A 3WHIA 4IH5A 3UE2A 1WKKA 2WONB 3LP2B 3D1OA 1I1GA 2X7IA 4BBYA 3UN2A 2YXLA 4DQQA 1M5OC 5IT9Y 4B9LA 3NMAA 5LT5A 2A0FB 3QT5A 4C0HA 2KO1A 3T5KA 2CADA 3MFHA 2F4VF 2VONA 3MGJA 4J9VA 2JLEA 2HS4A 4ZIVA 2NUUG 2K3IA 1JX4A 4R0JA 2KXNB 2DEIA 2JVOA 5GMKa 5KT6A 4OYIA 2GV1A 4IKAA 3SZ2A 2VDHA 3CGIA 1REVB 1AFIA 3PYEA 4M63A 4DV4F 1C1BB 4WXOA 1PBUA 2HFNA 3M6WA 4G1QB 4X4NA 1JKHB 1S10A 4XPCA 3FBCA 2CDRB 4IH7A 2ZWOA 3M05A 3UW1A 3W5ZA 1FRJA 4WJBA 3O3LA 2V4RA 3J7ZT 1Q8IA 3GLJA 4C7QA 2B4OA 3K5LA 1MWYA 2HHVA 3MECB 3HHNB 4X4TA 2I5JB 1FFGB 3PJXA 2V2QA 3OTBA 3KLFA 4J9QA 2FQQB 1RADB 4CTAB 3MM7B 3CD6S 4PG4A 2UUBJ 1G6BA 1J5OA 5EUHA 1ZZNA 4LRAA 5DDQC 2NYIA 5LM7E 5A2QU 1XNRF 4JYAJ 5HMYA 2VFRA 4DCOB 4NYOA 4QYRA 1RCXB 2HHHJ 5KFGA 2P9GA 1Q8LA 3NCRA 3OR2A 4OZ3A 3R5BA 4CIOA 2OLWA 3UD3P 1XERA 4DSLA 2KXFA 3O44A 2PMWA 3X3UA 3LW5C 3MAHA 1WHYA 5J1EA 4ELUA 1VLOA 4DR5J 3I4HX 4IFVA 2DY9A 2JOQA 2UVRA 4NLTA 1O6XA 1UW9A 3KDOA 2CPFA 2SXLA 4OX7A 3PACA 2GX8A 2QV6A 1NKBA 4KFBA 3AA9A 5D15A 3HHLC 3SCKE 5KFQA 2FJAB 2QLXA 3RRGA 3H2VE 1OQ3A 2HRYA 1V5IB 1K0VA 3GFHA 2C3YA 1U2CA 2KYXA 4YB5A 3B6BA 2CG8A 5LL6d 1UVMA 3IA0A 5G4DA 4OZLA 4YHHF 4JI5F 2P9EA 1Y11A 2CWKA 4IOAQ 3N4WA 3KYLA 4L6V3 5ETLA 2AJ0A 3HJFA 2ZHBA 1YZ7A 4AL7A 2MSTA 1FRXA 3TZWA 4B9MA 3BSNA 4LJMA 1U45A 1JLFB 2EBGA 3G6ES 3PKMA 2BR0A 4HDGA 1SJ4P 2HVDA 3SQGB 3MEEA 4X66J 5KT4A 3I0SB 4NASA 3PO4A 1WD6A 1D9AA 4DQSA 2LP4A 2KFZA 2CZ9A 4PPZA 5L1KA 2A3JA 3HFZB 1YRXA 2MZSA 1FKPA 5F0UA 4Q43A 5K8NA 5J2NA 3R27A 1J27A 1RTIB 1FI4A 2HGNA 3D6HB 2B5JA 4GC6A 4QR2A 2MPUA 3H4BA 2NSBA 1TKXA 1N8RT 3Q2SC 2GC8A 3J7A1 3R1HA 3IWNC 4TU7A 3CCJS 3SIPB 4E8UA 1GNKA 4DR1F 3TX8A 3R9LA 2PGCA 4K4SA 1IWAA 4EBEA 2MKHA 1NH8A 1FHTA 2ZH1A 3DLGB 4DX6A 3MTJA 5KG0A 2M3DA 4C97A 3ILLA 3O8WA 3JTNA 2B8QA 1IN0A 2RS8A 1L3TA 1WC6A 2GVDB 5LMNJ 3QSYB 3CCES 2BE2A 1HARA 2CJYB 3BB5A 1SBRA 2VG5B 5ETSA 1W26A 5FLXY 4LMZA 5K14B 3W7BA 2QFJA 3K5NA 5F8GA 1Q8BA 3DLEA 3CO9A 2AF6A 3QRPA 2LEPA 2VICA 1ACMB 1T3NA 3U27A 4KBIA 4FS1A 1M5SA 2YKAA 4RW6A 2G2ZA 4M5DB 1U6FA 4DPYA 2ZBPA 1KKHA 1UFWA 2H48B 2MLZA 1KHWA 3I5BA 3KKFA 5T7LB 3C19A 3H5XA 1NAQA 2NXUA 4JI4J 2KJWA 3AAWB 2AWZA 2DTJA 4B3TJ 1HYSB 4H4OB 3ZXWA 2HBZB 2DGUA 3C6UB 3M1VA 3DGPB 3BBFA 3EGVA 2WBRA 4Q0BB 4G1PA 4KKOA 1XR6A 2D3UA 4OJHA 2F8EX 4UZBA 4EZ6A 4OX6A 4ID8A 2JNJA 4ZVGA 4M94A 4PZVA 4DWIA 2YVSA 3T5LA 5DDPC 2UUAF 2PE8A 3LP0B 4AL5A 1QAJA 1JLAB 2ZITA 2AGQA 4U8VA 5F3TA 4DR7F 3Q8QB 1VQ9S 4KPCA 1BD6A 3D67A 1HQUB 2COLA 2BMBA 5DG7A 2V0NA 4WIQA 3JTOA 2GFFA 3QZ7A 1TK0A 3JSBA 2BM1A 2MZQA 3AHPA 1RT7A 2OH2A 2JFDA 4DL7A 3NGTA 3M7VA 2JEGA 4ES1A 1SC3B 1HBMA 1JXVA 1QTNB 1YVFA 2Y8WA 4O4GB 3CXCR 1XNQJ 3DRPB 1NPPA 4U8YA 1Q7YT 3M8YA 5G0RB 2EBEA 5KFWA 4CO1A 3AXMA 3G96A 3CEDA 3RAXA 1B99A 2OEKA 3H2UB 1SI9A 2RUGA 1FKOA 1PO6A 3OR1A 4H4MA 1NUEA 2ZH9A 1S72S 4WP3A 4QPTA 2UU9J 4NLSA 3Q8YA 4F4KA 4RPFA 2KXHA 3HT0A 2DO4A 2OPPA 3SBMA 4ZLLA 2EKYA 2XS5A 4DR3F 2FHJA 1MWQA 4NL5A 3FRYA 2KTQA 4PXCA 1WTFA 3NNHA 1R8CA 2M8DB 3ET6A 5HVGA 2UUWA 3W5XA 1FNMA 2E5LJ 1R8BA 3PEHA 5KTQA 2Y1RI 2ZJPQ 4K7QA 4FPRA 4I2QA 2ZHOA 3LAKA 1FDDA 1IM4A 2A18A 3BZQA 5CYQB 2E44A 4A4JA 1S1VA 4NXMJ 1AA1B 2UV8A 3TVYA 1LQ9A 2MQQA 4QIEA 1M1GA 3ZO7A 4WBFA 3IS9A 3F44A 1CULB 5DZ6A 3SMZA 5EX0A 2XEXA 4WE1B 3IWLA 4CP5A 2FVCA 3G8SA 1VK3A 3FEXB 3ETMA 4ER8A 2C2RA 4E98A 1DTTB 2J6UA 3I87A 4ECQA 3JSYA 3UDLA 1YWXA 2V67A 4KRWA 3HFVA 4QCLA 4KIAA 2QT7A 1VQYA 2CPYA 3Q8UA 4AE5A 3HHLB 1GMVA 3ZZRA 5K8MA 4OL8A 3KFWX 3Q8RB 4UUWA 3JS9A 1RQ0A 2R8IA 1VQ7S 2IIHA 4ZP8A 5I3QA 3CSKA 4X64F 2IM0A 1DQAA 4ZLNA 1AUDA 2EPIA 4N8NA 3EJMA 4ZKAA 1K1QA 2EKNA 5KFNA 3UQSA 1S48A 3A8KA 3KG1A 3KJVB 1WEXA 4ECVA 4CQ1A 4HL9A 2BKPA 1HLWA 4U7UK 2JHEA 4OI6A 3PM9A 2HLTA 4PR6A 1KLMB 3PXGa 4USUA 3FEYB 3UNYA 3CJSA 3D2WA 1Q78A 2LA6A 1D8ZA 3K5PA 1S57A 1YQHA 2HMIB 2GAHC 1NNDA 4WKRA 4PWWA 3KK1A 2C3PA 1FJ7A 2QLBB 2M7SA 2KZZA 3FVYA 3AJ2A 2DBBA 3P6YC 3V6HA 1FESA 2MTLA 2DR9A 5HK4A 1FDAA 3DLKA 2PI4A 1RWPB 1T3OA 4Y2AA 2M88A 1N36J 3LANA 2Q66A 2AJ1A 1T9WA 1I6JA 4FXVA 2ADBA 1OJ4A 1U1KA 2O3DA 4M5NA 3MI7X 3BPDA 1CJTB 1T02A 2IA0A 2FTRA 3FMWA 4DBQA 1NSAA 1JLCB 2QIFA 3OVSA 1S1UA 3CJKA 5CD4A 4DPXA 5I42A 5LJ5Y 3QFWA 3W2VB 2PIIA 2YH0A 4M5KA 4R0EA 2AHOB 2C28A 4CT8A 1BUXA 4YUDA 2AP6A 5IM0A 5K8OA 1Q0NA 3AFGA 4NLWA 3KOAA 1H2VZ 3QGPA 2KHCA 5J2QB 3ENQA 1RA6A 3EMTA 4GRSA 4LSLB 5F8HA 2L9WA 1H0HB 4HACB 2CPIA 2WK4A 2DH8A 2DGXA 3V4IB 2M8HA 3SDEA 1WF2A 3ZTOA 2FYXA 2LMIA 3BSAA 3PX0A 2CIMA 1E6VA 3SCIE 1S6OA 2RU3A 5HLFB 4IO9Q 3QMQA 3TVZA 2FHOB 3M8PB 1WJ9A 3IG1B 1JNRB 4DLEA 1BY9A 4OZ0A 2QYCA 3GIIA 3NGDA 2GGPB 4XDCA 1RAHB 3BJYA 3HDSA 1LK5A 1FX2A 3N28A 4ZPBA 3U1MA 4RUBA 1CJVA 1VQMS 3ZZZA 2V9KA 1HNXF 4NLXA 4Z7CA 1V5VA 1N36F 1YJTA 4WFXA 1RACB 4QQBA 2ZH3A 3IGNA 2XO7A 2R7OA 5GAGU 1HNZF 2IC3B 3HHLD 1FDBA 2ZM6F 2DRDA 4P71A 2QA4S 1Q5VA 3QIDA 4DV7J 1BWVA 2KFNA 4URQU 1N34F 3W62A 3PRVA 1YBTA 2KI2A 2GQQA 3IRWP 1H7WA 2OIHA 3RJMB 3KK2B 2CQ0A 1OY9A 4UOCA 2KM8C 1KS2A 1JB0C 1DQ9A 1WC1A 2XYHB 1WDTA 3IBCB 1OSDA 4NYPA 3SXLA 4IOCQ 2BKOA 3RBXA 4WPAA 3VQSA 4TY9A 1N33F 1MMNA 3OTOJ 4RWXA 4F4ZA 1S6PB 3AD8C 5HROB 3VAMA 3OSNA 1UZDA 3Q8VA 2V4QA 4USIA 2NREA 2MYFA 4CLFA 1JXLA 1UEKA 2LKZA 4W98A 3DRSB 3KLIA 1TVRA 2E1RA 3I9ZA 4IFYA 2D3O1 4JV5J 1S59A 5L8RC 1RLCL 1HNWJ 5LOQA 5H9EJ 2J6TA 2K1RB 3O5TB 2DPJA 3KK3A 4I4BA 4QR0A 2HYIB 3FBEA 1VQKS 1PIEA 1BXNA 1G2EA 4P9SA 1JQGA 1EETB 1Y3KA 1Z2ZA 5J1EB 1WG5A 1LW0B 4U95A 1VHIA 2D69A 2QMXA 4XAKA 4QIVA 1HBOA 3PW4A 1SKUB 1RTHB 2XYPB 3DOKB 2MSSA 1RAEB 2GHWA 2EFPA 2GAGC 1Y00A 3LPEA 1ZBTA 2CPDA 1A6LA 4DL4A 4MIBA 4WFZA 3HX9A 5ITHA 3ZNUA 2Z2LA 1UAWA 1DURA 2HWTA 3BN7A 1MW7A 1JLQB 3BKTA 4F25A 1U48A 2HFVA 3OTDA 3R8YA 4DV0J 4C4WA 2OD4A 1S97A 2EXUA 3DDNA 3EE3A 4HHHA 1ZM4A 1XR7A 1DARA 3KNAA 2R2RA 2YKNA 1IJEB 4PYAA 4DV7F 4MFBA 4N7TA 2WOMA 3M6XA 5EN1A 4MMOA 2R3VA 1KQGB 3BPSP 4RL1A 2V2KA 4FN5A 2KFYA 1SPBP 5DLGA 3P96A 3OVAA 2EVZA 1GXUA 3OLAA 3PJ9A 1HA1A 4KGVB 4V19J 2BRKA 2B51A 2DGWA 5J2NB 1ZA2B 1HWKA 4HI2A 4H4KA 1TL3A 3D1QA 3F41A 2RD5C 2EC0A 4DSJA 4DQPA 3NAHA 4YDXA 3T1HJ 2R2SA 2DNOA 1TKXB 2YWFA 1YLXA 2HNZB 2RT3A 4IYQA 2J76E 2JJ4D 2PA8D 4K0KJ 1YBUA 4FNIA 2Z0GA 2AJ2A 1GTEA 1YKWA 3BQ1A 2BJ7A 3N79A 2BUNA 4YB6A 3LP1A 1YRTA 2DHXA 3K5MA 2AZ3A 3M9NB 3N9UC 2AW0A 4QWCA 2Q6CA 1S76D 1NK4A 5E41A 1GMWA 4DQIA 2POKA 1UA1A 1UWAA 4EYIB 5KFZA 3KTQA 1RWUA 1N48A 3DLEB 2AEMA 2YKPA 2YNHB 1GX5A 3BQ0A 4PXBA 2W8KA 2FPHX 3A3PB 4DF4A 4ES2A 4JI1F 3PR4A 1S4FA 4RW6B 2A1BA 4CM0A 3ZC4A 3GB0A 3J80Y 4NLPA 1SB6A 1Y0HA 3IGVA 1WEYA 1X8DA 2DIUA 1RWMB 3NG8A 4B3OA 3TYTA 2H9ZA 1T03B 2VH7A 3M1VB 5DZ7A 3GFYA 2H51B 1S9FA 2B7BB 3BREA 2B56A 3MR2A 1K1SA 2BJEA 1RUSA 2MB0B 1S6QA 4OYOA 4DZDA 5JJBA 2KT3A 4KKOB 2QLWA 3R7SB 3TUZC 1T9TA 4KV8A 4X65J 2J7KA 1VOMA 3Q83A 3JAMY 1YI2S 3EGZA 2A2CA 4URSA 4DL5A 2P2CB 4ZP9A 3OXGA 4M5IA 1VYAA 4C8OA 2ZOFA 3HD1A 4TYAA 5IT9U 1IBMF 2W7OA 4ZP7A 4LF2A 4BS2A 3GV8B 2FLNA 3R6LB 2VFTA 2XM3A 4ED7A 4DV5J 4Q44A 1D9FA 1W2IA 1YGYA 3U02A 2N4CA 3NWGA 3W66A 3R5AA 3S7RA 2HBRB 2ZBCA 4GVBA 2X1BA 2RKIB 1FRLA 4C0OC 1CQMA 1T9UA 4C8NA 3Q22A 4NXNF 4JI3J 4J9NA 1DQ8A 3WIUA 1NDLA 2WCXA 4BC7A 1HBMB 3M2UB 2G9OA 1NHVA 2XZTB 4DUYF 3EGNA 3THTA 2GO8A 4EFAC 2HLUA 3OJSA 4TY8A 1YG0A 3NBPA 1SIWB 1HD0A 5L1IA 2HNDA 2ZFHA 1WOOA 2JSXA 3MZIA 4KB7A 1JXEA 2XMKA 1BQNA 3VHQA 4RW8B 1RAJA 2ASDA 4I1TA 3VWSA 2J0WA 2XZWA 2CPZA 5F8MA 3V81B 2OEMA 4RW4A 3PFOA 2ASLA 5A6PA 2XSFA 4M5HA 1WHVA 3GIJA 4ZCLA 4IG0B 2PSZA 1FE4A 1MG7A 2OPRB 2UUTA 2JVRA 4LIWA 2MKSA 2CQ3A 3D6MB 4LF7F 2GJFA 3EWGA 2CQ1A 3DOMA 2KM8B 3QQCD 2EFNA 3M8ZA 2VPXB 3QT7A 5KFUA 2E5GA 4HLBA 4YQWA 4NOHA 4L72B 3EVWA 2R7RA 1C0TA 1VC6A 4HKQA 2H4WB 2DR6A 1FTRA 2KG0A 2DH7A 4DPWA 4WXWA 4LF5F 1IBKJ 4ZMMA 4F2RA 4NLYA 4IO1A 4OQJA 1H38A 1HPZB 3M6VA 1L3VA 3CT9A 2LQBA 3G71S 1VC5A 5HJXA 4OYAA 1VRUB 5BR8J 3CTRA 4LQ9A 3FCHA 3GQCA 3ZTPA 4E0DA 3BGOP 4YP3A 3L95X 4I7FA 4CLYA 3WDOA 2FVQA 1EAYC 1VLYA 3JYTA 3D54A 1IM6A 1HI0P 4D3GA 3J7YU 4CO3A 4OV1A 1WHXA 2MKYA 3SI8A 4C8ZA 4CH0S 3E3XA 2BQUA 4NLRA 2Y1IA 3PTWA 3OUYB 2HAFA 3UD5A 2AJ4A 1B0PA 1Y5NB 3BR8A 3PCOB 1UWBA 2AYEA 4X84A 1QUVA 1FWLA 4YY3F 1X9SA 4ZVOB 4TU8A 4ATNA 3T6JA 1GEHA 1HQEB 1PG5B 3ICLA 2J0SD 1BE4A 5KOXA 3HSDA 4FF2A 1EHWA 3EZ5A 5CZVA 5GAGI 5DGBA 3NRBA 3I56S 1FK9B 4BWMA 1NB7A 4JI7F 1H6KX 3CMQA 5KFAA 2D1CA 5IWAJ 2CKWA 1LXJA 4QYZJ 3KG4A 4IG3A 2LEAA 1Q82T 4ED6A 3NXZA 1RLDA 1S1WB 3MPWA 2X3DA 2E1AA 3R5GA 3PW5A 1X4CA 2AEJA 4OLOA 3GFZA 2IAJB 2MLYA 4FYWB 4ZVSB 1C1CA 3QO9A 5A0YA 4RU9A 3BS9A 3W5YA 3VAKA 2R8GA 4USVA 4DDFA 3AA8A 3VGSA 3DLKB 3KDNA 1R89A 1N5TA 4O3OA 4Z37A 1S5ZA 1U1NA 2WW8A 3HVRA 3MPUB 2LQ5A 1PGZA 4B9NA 4UUXA 1YJVA 3M2RB 3NOGA 3ILOA 1NB2A 4FYVB 4FYYB 1IR1A 4WZQA 5RUBA 1S1UB 3POTB 4HT7A 2M5YA 1FJCA 2IRYA 4B9VA 3TZZA 3TI0A 3DM2B 4ILLA 5HMXA 1RHQB 1X60A 3BKUA 1F3VA 2LQJA 4ED4A 3J81j 2CXEA 1ZAVA 4HH1A 1TKTA 3CCSS 5IM0B 3ZZYA 3OL7A 5KFXA 2VDIA 1NEEA 2CNKB 1REGX 3ZTQA 2WW4A 4WIIA 1NZ8A 2FHJD 2GW8A 4DV2J 1IKWA 5AJ3F 2Y3YA 4X4UA 3D3BJ 1PYSB 4PUOB 2VZ9A 3U7JA 2GO9A 1NU4A 2IVFB 3FCVA 2HNYB 1N32F 4FVMA 2G1DA 4WP9A 4CO0A 3LQVA 1SC1B 4KGKA 2PO4A 3BDPA 1VI7A 5CCMA 3SDEB 2HG4A 3NS7B 4Y3CA 4QW9A 2RJZA 4YB7A 5IOLA 1NHUA 2MEWA 5B0GA 5D77A 3SV3A 5J2PA 3UR3C 5EWEA 3Q24A 2BOAA 4USWA 5E5NA 2A2DA 2PDAA 1HL6A 5KFSA 5K5MA 3E2EA 2BZ2A 2GMLA 3OFGA 1SL2A 4UTGA 3CIZA 3JQMA 1U25A 3AOAA 5AXMA 1CJVB 2DPIA 3H5UA 1UZHA 1SV5B 4KE5A 2Y0BB 2E1MC 5E0OA 2I9SA 1UP1A 4X4RA 3I31A 1RWXB 3ENVA 2KZMA 4TVAB 2C22A 4NZ6A 4ANEA 4G6VB 3KLGB 3TUJC 4P10A 4AT1B 1T9VA 5KT5A 1P1TA 1S9GA 3TO8A 3N6MA 4DV6J 1KVKA 5D3GB 3CJ8A 4XPEA 3EXCX 4P2XA 3DYAB 2G13A 2A6OA 4WYLA 2EFVA 3GV7B 3GCWP 1H2UX 1P9QC 3QSIA 1X4FA 1O5JA 2K8GA 4QR1A 2E7WA 1EQ0A 5L9NA 5I3UA 2B9YA 4LF6F 2L41A 5L39A 2DIVA 3KG0A 1LV5A 3VAIA 3AOBA 2CVIA 2IJRA 1OQ6A 2IJFA 3HSJA 4GKKF 4ERDA 2YPYA 2PT0A 4L74A 1X5TA 2VPWB 4NWBA 1HBNB 4WP8A 4IFYB 2CQDA 2F9DA 3MM8B 1LW2B 1KQFB 4OI2A 2MZRA 1QE1B 3DXSX 2WSCC 2VQEJ 1AUSL 2N4DA 2CDQA 4QPXA 1CBKA 2OO4A 3G86A 2YNIB 4DLGA 2RVJA 2XG8A 2YQ0A 3GR1A 4NA3A 5FDLB 5E3RA 1WNEA 4HTIA 1HBOB 4JI6J 3SQOP 1AZSB 4KHRA 2VOOA 3LUYA 2NZ4A 4CDIA 4F4YA 1PJ6A 2OSRA 1A0OB 2BYCA 3VV2B 4OZJA 3OHBA 4U67Q 4P2SA 2W7PA 3QRQA 5FIIA 4OI0A 1RT2B 4PG7A 1X4BA 3I5CA 5DDOC 1U6BA 2XYGB 1RT1B 2DITA 2EEYA 3W60A 2E1PA 1CPZA 2W9CB 2KRBA 2W2QP 1FXDA 2VPYB 4BC9A 1RYRA 2L08A 2AQ4A 4LSZB 4K8RA 3TX0A 2XHWA 1FTCA 1CG2A 1CSJA 4F3QA 3KLHB 1XMBA 1IKXA 2D41A 4DEZA 2MHNA 4WU2A 4RW7B 3FFIA 2O67A 4FBTA 3CNQP 3IFEA 2YKNB 3W2WA 4ZVPB 4DG1B 4MFBB 4ICLA 2GVZA 2W4CA 2ZC3A 1AROP 1X4EA 2RNEA 3JSMA 1K0TA 3MMAB 2DHHA 1NJIT 2ZH5A 3KJQB 3BYPA 2CQ2A 8ATCB 3BSOA 2NCKL 4IOBA 4X62J 3HO1A 4RNHA 1IKVB 3DKDA 2B9EA 3W9HA 3DNCA 1OPZA 1OPIA 1HR0J 4I2PA 4OJGA 5C42B 4ECRA 1YSJA 3KHHA 3VCDA 4F7VA 2JC1A 3D68A 2GIFA 2RU9A 3MM9B 4ZLPA 3D7SB 3ILIA 1T05A 1G4CA 5D0GA 1DLOA 2CA9A 2PEHA 4F8RA 2W7AA 2E29A 4PWDB 3RW7A 1FO1A 4ECWA 2XCPA 3TANA 1S9EB 4DV3J 2I38A 2WBMA 3G9CA 1SUQA 5HJYA 3H98A 5IV3A 2ZUGA 4EYHB 4ZOSA 2VQEF 4TXSA 1GAOA 1NLKL 4NLUA 5DQHA 4DUZJ 1HBUB 2RUSA 3TAQA 2R7WA 3MEDB 1PBAA 2V8GA 2XMWA 1HW9A 1EP4B 3RB3A 1PJ7A 2ZVIA 1YIJS 2GHVC 3V6DA 2EFQA 1RP5A 1GT8A 2YQ1A 4LT6A 2OTLS 4X4QA 2JX2A 4JV0A 1WG1A 2QX0A 3T5HA 2OEJA 3WBZA 5D4OA 1BQMB 4MIAA 4BWJA 3CPWR 1WTBA 1Y5LB 5ETQA 4F3OA 5GADU 3M8RA 3QATA 1HKAA 1YHQS 2Z30B 1RTDB 2Z4PA 4OYBA 2JZ5A 3DN9A 2MGZA 4QU6A 3KUGA 1KNZA 2GIQA 1ULRA 2VG7A 2ZD1B 4CT9A 1WF1A 2HVHA 4FXWA 2H5EA 3BV8A 2IPOB 1S1XB 4X4OA 4KO0B 1Q5YA 4G1IA 4ANDA 1WORA 2CPEA 2OELA 4OI3A 5ETKA 1MU2A 1ZAWA 3G87A 2HZCA 3VVTA 4OZ1A 2ZE2B 1TP7A 3GR0A 1URNA 3UDVA 3MAAA 4ZJQA 2HFSA 2HVZA 4WFAQ 3MCOA 2KG1A 3NLCA 2AGOA 2C3MA 1QAYA 1RI7A 4C8LA 3TR5A 3CCUS 1FEEA 1U8SA 5KT7A 4KV8B 3HZGA 2DNQA 1WOSA 4U7UD 2NZCA 1Y4ZB 1VQ4S 1JJ4A 4O23A 2R42A 1RYSA 4KSEB 4HR2A 2NSCA 1V9OA 4A8WA 2XY5A 5EHHA 4JI0J 1GQEA 2F63A 3M8QA 2RAQA 1XR5A 4TLQA 2YNGB 2FJXA 3FRZA 3PJWA 4DV3F 3DLBA 1FDNA 4AQYF 1JJ2R 4JI2F 3L4BC 1OO0B 4NA2A 2HHWA 2HQGA 3W61A 3OW2R 4L73A 3H40A 4KH1B 3KNGA 4ELVA 3GG0A 3UVJB 2ASYA 2CPJA 3CCLS 3KLEB 3EX7B 1WKLA 5C25A 3CW2C 1T94A 4A8YA 3MM6A 2D9OA 2KT5A 2MHEA 2U1AA 4JOUA 5LJ3Y 4NLQA 2UXBJ 2Z56B 1OIAA 1A9NB 2ILYA 3NBPB 1RT3B 1H98A 3LF0A 3OVBA 3I5AA 4DOZA 5KFDA 2HHTA 4C11B 4CO4A 4CH1A 4DFJA 1LNQA 4LF1A 1X4DA 2QFIA 3RRHA 2YX4A 1QUPA 2E5IA 4NLDA 1BQNB 3BBCA 1TV6B 4DR6J 3FDSA 3AXKA 5K9FA 4KY3A 4RW4B 1T0TV 2V5HG 3M32B 2F65A 1JK9B 1B70B 3C14B 2X1FA 3D0GE 2M4MA 2XSJA 3C66A 1HHQA 4G3IA 1S7HA 4DPUA 3OL8A 3BGFA 2DJWA 4NLOA 3ITHB 3MURP 4LF9J 2YX1A 5DM6Q 4WCEQ 2HKEA 4ZHRA 4MK7A 5LXRA 1RT5A 3BR9A 3FMBA 2GQCA 3RR8A 1RT6A 3BN4A 1AFJA 4BCAA 2BJ3A 3MR5A 5DLFA 1CLFA 2UXDF 4NMLA 3UR0A 1F5CA 1GMWD 3PFEA 4HHUA 4URGA 3K5OA 4QIFA 4N47A 2EK1A 3LGHA 4JI0F 3N6LA 3HHEA 2MQLA 2DNYA 1TK5A 5E33A 3DRRA 5CA5A 5J1NA 1X9WA 2HZVA 2VQFJ 2NR0A 3GJQB 4O44A 4I7FB 1RA7A 3WX4A 4LREA 1S0OA 2O1PA 1SH0A 1B3TA 1M5HA 2YPZA 2QYGA 1HMVA 5HQLA 1B7YB 2Q1LA 4KR0B 1FKAF 1G3OA 2UXCJ 3QT8A 4OHWA 1TU0B 3RTVA 4OYWA 3IAM9 3QAEA 4C3LA 2DXFA 5CCLA 1UEVA 2CJAA 2HVIA 2CJ9A 1RHJB 4O0IA 4I56A 3NNCA 3QFHA 1SXLA 2ZJQQ 2UXBF 3C2PA 3G8TA 5KT2A 2VG6B 5BYQA 5H9EK 3WC2A 2EK6A 3BGUA 3CDBA 4Y28C 3RAMA 4OI1A 1TKZB 2OMLA 3CVKA 2ZBRA 3OLBA 2FLOA 3IR6B 5HBMB 3J81Y 5HMZA 3W63A 2C2NA 2XC9A 1CS4B 2BVZA 2QLFB 1TL1A 3E01A 2MXYA 2V9WA 4I6AA 3K8WA 3TRGA 1MROA 4Z2XA 3TA0A 4NCGB 3TJ9A 2NPIA 2FVRA 4N8OA 4NLVA 2ZC4A 4CI0B 3CO0P 3ZNJ1 4X4VA 4IG3B 4QBUA 2HQDA 5A8WB 3L3CA 3CE8A 3K8VA 4YDDB 3F73A 3PO5A 2IBOA 4LQ3A 4QU7A 1G7CB 2N3OA 3I0RB 2BKNA 1CC7A 1C1CB 4AXJA 1U49A 1OY6A 4F4XA 5FJ4A 3UWTA 1UEUA 3ZZ0A 3QLHB 4NMXA 2Z58B 2E5JA 1O51A 2O66A 4NZ0A 4K4XA 3CF5Q 3R6GB 4EO6A 1LWFB 2BW2A 4FDFA 3I6PA 2IM2A 4OX9J 4KTQA 1BQXA 2YX7A 4R8UB 3TNVA 2GZOA 1KWMA 3PV8A 1REVA 1I94F 4AYBD 1DFDA 1UMJA 3A8IA 3BDEA 3H5SA 1C1BA 1JLEB 3GFXA 1O0PA 4J9RA 3D6FB 1VQOS 1RHKB 1JKHA 2ZH2A 3PY8A 3J80U 4EGLA 2W25A 2VPZB 3RG6A 2AEFA 5D6GA 2KHDA 4RX6A 4YN3B 1P8GA 1U1RA 2DGOA 5D0RA 5KFRA 2MKCA 3VQTA 3MECA 1I51B 2FC9A 5J1PA 5I3PA 3UDEA 2HQFA 4LRCA 4Q7AA 4CLTA 3Q23A 2I5JA 3W65A 1FNOA 2RMLA 3ETOA 5JVHQ 3K2YA 3NMRA 3MM7A 2G2YA 1YBAA 2J7WA 1Q81T 2YKMB 2EWHA 3UD4P 5M2RA 1SKSA 3DOLB 2GCFA 4NE9C 4X2BA 3GIKA 2V34A 1IVZA 3DLHA 3MPDA 3CC7S 3D66A 3D1HA 4ID5B 2XWYA 2N82B 2RQKA 1M1HA 4HDHA 3L09A 3MMCB 3RR7A 1JLBB 1HW8A 1TMMA 3OHAA 2UV8G 3CJ2A 1LEOA 2VIHA 1GXLA 3F56A 4ZVRB 3Q8PB 3MHYA 3CWJA 2F8MA 1WI8A 3GCXP 4R25A 3EDQB 3B78A 1LFPA 2J6SA 3PHEA 5DRKA 5GMDA 1Q1KA 2XLJA 2RQ4A 3TZXA 5KFTA 2X51A 1B4SA 3A1YG 2K2PA 3NOCA 4PG8A 2XZDB 1C2PA 2M9KA 4C3MA 1UPPA 4HEA9 1TAQA 2Q6BA 3C16A 4CNZA 2UUBF 3THVA 3L7PA 2AMCB 4LSNB 3PYGA 2CZVC 2XMJA 2ZBQA 3W8PA 3G6VA 3FZBA 2HHPA 5KFFA 3DRYA 5I4MA 4JYAF 1Z1ZA 5H1SV 5E3CA 3RBDA 1S1TB 2B4UA 2HHHF 3NCQA 3GG1A 4KT0C 2MQPA 4C8KA 4RWWA 3LPYA 1JLFA 4DR4J 5GADI 3DMJB 2V8HA 4P6QA 1N5YB 2BANB 5FD1A 5D4LA 1ZM2A 3I0SA 1T9XA 4DR5F 5CZXA 5F0WA 7AT1B 3F0NA 4B3RJ 2FUG9 2YWWA 2FJEB 2RRAA 2DRBA 4ED5A 2VFSA 2B0GA 5ETNA 2J8AA 4IH6A 2RQMA 3LTOA 3SEOA 1RTIA 5D4PA 3CULA 3LGMA 5F8LA 3RBEA 1YK9A 1K44A 4DR2J 4L3NA 5DS7A 3QIPA 1FJGJ 1N0UA 1PJ5A 2LU1A 1H73A 2APOA 1UW4A 3J7AN 5GVQA 5D4NA 2CQHA 2AT1B 3DDIA 3GJSB 4OHXA 4ETXA 1Q16B 3RB6A 2AV5A 3HVWA 2AX1A 2XNQA 2P9CA 2ZH7A 2VJVA 5AT1B 3HM9A 4ED8A 3DLGA 1B7FA 4ZK7M 4IRKA 2DR7A 2ROGA 2V4JB 2KT2A 4LRFA 5HVHA 1N5QA 1C0UB 2GVDA 1JMTA 2GJ2A 1K9MT 4X66F 5IT4A 4J7CA 3W9IA 1F9FA 2LDYA 4XTTA 4WU3A 1RU1A 3BGRB 3LH2S 2VG5A 1GXTA 4QWAA 3CMAS 3V5RA 4ILRA 1LWCB 4TN2A 5K14A 2MZTA 5KOWA 2BV3A 4IRDA 4PAAA 1TELA 1UFLA 3BH7B 4UY85 3FFIB 2XHCA 2Y8YA 1TL5A 3ISZA 2LA4A 1RTZA 3JSMB 4YS2A 4DV1J 4N5SA 1W2BR 3LOUA 4M5DA 1D1UA 1X0PA 4EZ9A 1FWKA 2DXDA 3KJFB 5T7LA 3HSZA 1ELOA 4Y2IA 1N6QB 1VQSA 3BKFA 5A8KB 2Q3PA 1OYDA 2CJXB 4Y2KA 3N5BA 1HYSA 5HN0A 1HI1A 3JTPA 3TEHB 1Y10A 4H4OA 1RTJB 1R0AB 2JFKA 3CJTA 2HGMA 1YJNS 2F5GA 3DGPA 2PMHA 3UDCA 5HP1B 5M2UA 2QL7B 5EWGA 5LMNF 1E6YB 2PD1A 4R5PB 1VS3A 4Q0BA 5C24B 4DFMA 3QBCA 4C98A 3MEGB 1DLOB 3GSDA 2BJ8A 1SUQB 4NX9A 1WDDA 2CPHA 4B3MJ 3HVAA 4PYDA 2RF2B 3IRXB 2IJNA 4F2SA 4EEYA 1VR6A 3LP0A 4V19X 5ETTA 1SJQA 1JLAA 4DFKA 3IC1A 3VGTA 4FPIA 4DZ6A 2OPSB 2AZ1A 1WHWA 2EG1A 1XMQJ 3C46A 4AFFA 5DQGA 1SIZA 1HQUA 2X3GA 2Z57B 4JI4F 4FNHA 4OYXA 2VHGA 3AY0A 1VQ8S 4B3TF 1T7PA 1TTHB 5DETA 4J9SA 3GP9A 5KT3A 2MY8A 5GMEA 4WFNQ 1PCAA 2P6SA 1L3KA 1NPKA 4S0MA 3LALA 2MKKA 4JUZA 4ZJLA 3MOJB 1SC4B 5KG5A 4AUKA 4IR9A 4QZVB 1FVSA 4QYZK 5D0EA 3CDWA 3HVTA 4O4GA 4GO5X 3GPAA 4OJ1A 3DRPA 3IBWA 1P9YA 2W9BB 1RBAA 2DNKA 4ZS6A 3QGIA 3GIMA 1FFSB 4NI2B 1MU2B 3P8BB 3VAJA 4JP8A 1RB0A 4UW2A 4M5GA 2RIJA 4DV1F 2V63A 3PYFA 1IKYA 3NEKA 4C9DA 1KQSR 1QLNA 4A8MP 1SJFA 3WIVA 5KFEA 1YRUA 4Q8EA 3M2VB 1NHKL 1R7IA 4EWTA 1SH3A 3AD9C 5AE3A 2KL8A 4PG6A 4LRBA 1F5BA 1U1MA 4IDKB 1A7GE 1CEZA 1U4BA 2OKQA 2GS8A 4A8OA 4Q2MA 5IZHA 2DT9A 4N77A 2CNOB 4PWUA 2MQNA 3D6TB 2CNNB 4RJVA 2NXJA 3H5YA 1JNZB 1UETA 2MY7A 2B9XA 1U1OA 4DMZA 5B0DA 2BQ3A 1XNQF 2ZDOA 1DTQA 4E2FB 1ZH5A 2ZOGA 3ENAA 2C1EB 4MAKA 4P2FA 1R8HA 4ZCMA 4GKJJ 2ZBIA 4B02A 1CJKB 4OZ2A 3US5A 2QL5B 2VASA 1S79A 1S12A 5CYQA 5EWFA 3PW2A 3D4JA 4MYTA 2ZH6A 4PQUB 5K8PA 4RUAA 2AU0A 4ENOA 1XMQF 2XS2A 2UU9F 1HNVA 2H5JB 2MKIA 1CULA 4I6WA 2J9DE 3H8YA 3S01A 1KFDA 4CZCA 4RBVA 3LAMA 4OLPA 1TFYA 1M5PC 3AJ1A 3HLUA 3I4PA 2HEKA 1DTTA 1U1PA 1NZAA 4Q2LA 3HD2A 2E9TA 2D74B 3RBZA 1Y5IB 3MPVA 3TUPA 1OWXA 3G82B 3PW7A 1CJUB 2E5LF 3OL9A 1VGYA 4DQRA 3FSYA 5THWA 2XQCA 1VCTA 2CVEA 4LF4J 2HRUA 2WVCA 2ZOMA 3TQEA 2OFHX 2R9LA 3RW6A 1LWEB 2K7JA 2I1RA 3OD2A 2OPQB 2DNRA 1HWIA 4I6YA 3HHDA 1KR4A 2XO6A 4LFBJ 4NXMF 4AL6A 3KJVA 4LFAJ 5C7PA 3BYRA 2XI3A 2RHQB 2CZ4A 4F4WA 4ZN1A 2JL9A 3GYXB 1RKJA 3B8HA 1KLMA 1FXLA 2WB1D 2FY8A 1U0HB 2BJ9A 3MR7A 2H54B 1TL7B 5F41A 4EBDA 5T14A 2F4VJ 2XI2A 3WQPA 3PZPA 1T9YA 5IC4B 1OY8A 4F50A 1U26A 3OQ2A 3DFEA 4Z7YA 1Y9OA 2AJFE 2BA9A 3CMES 5KG2A 3TA2A 3AT1B 4O44B 3Q89A 1UFKA 3C15B 1LKZA 4YEAA 1TUWA 3PHTA 3TAPA 1HMVB 1FRIA 4DV4J 1F3FA 2JRSA 1L5UA 4N76A 1NJZA 2VC1A 3QAUA 4HH0A 1XBWA 3T41A 2YBVA 2LVWA 2XBPA 4PABA 1CJTA 3VZIA 5BYSA 2J7UA 2BXJA 1MMLA 2G0JA 1S7IA 4Q45A 4MKVA 2H65B 1WOPA 1KN6A 4MH8A 1RKIA 2C2MB 4FYDA 2HHQA 5A8RA 1DY3A 3NCPA 4ED1A 2FVSA 5BXIA 1YZ6A 5B0CA 1KTQA 2ZKUA 1NK7A 3GTYX 1C4CA 1VRTA 4F26A 3NS6A 1KEKA 4Y65A 3UN3A 2N3LA 7FDRA 4W92B 2ERRA 3FK4A 4B08A 1U1QA 1SL1A 2V8PA 5LXYA 2F1FA 3HXMA 2VBZA 1WC4A 3R2DJ 2CJBA 4ZVUB 4YFUA 2OFGX 1PC4A 5H9FJ 3GU0A 3B82A 4RLEA 3OT9A 5J2QA 2R4FA 1SKRA 1FEHA 4O3QA 1XNRJ 1ICEB 5KFPA 3VALA 4LF4F 4LSLA 4C3KA 3CJ0A 2ZDPA 5AE2A 2J9DA 2ZVSA 3ONQA 3V4IA 4LFAF 3DHXA 1V6HA 1VK8A 4RUHA 2KU7A 2XLIA 2JEJA 2ZEJA 1XJWB 2PFDA 2B6AA 2DNZA 4PXDA 2AD9A 5HLFA 1U2FA 3IXQA 1TR0A 3D28A 5GAHI 3M8PA 3IG1A 1RWWB 3KLFB 4HTJA 1V3RA 1NBEB 2GGPA 4EUVA 1SJ1A 3TA1A 1J5OB 1UTAA 1N88A 3V6KA 5F8IA 1TFWA 4CLWA 5BJRA 4YHHJ 4JI5J 2NPFA 5B09A 1N5SA 2ILZA 4GVLA 4Y6IA 4ZVHA 1H7XA 2P5VA 1ZM9A 3MM5A 3OR2B 2IC3A 4RW9A 3AH6A 4AXIA 3GJRB 4K5RA 2AYMA 5IQQA 3EM1A 3KK2A 4IFVB 1TUVA 3RB0A 1UCNA 3ZFVA 5KFYA 1NJWA 1YJWS 1RK8A 3KWMA 1FRHA 2F4FA 1U1LA 4KFBB 1IR0A 4OZ5A 4DX5A 2DHAA 3TUIC 3MXHP 2B9WA 4MKBA 3GE9A 2GMJA 1N4LA 4MK9A 1JWWA 3QJLA 4K4ZA 1S6PA 4AD6A 3EZOA 5HROA 5GAEU 2UZAA 4M5LA 4K59A 2CQPA 4DR1J 1EARA 3DRSA 3R7BB 4P52A 4ZJOA 3K59A 1C4AA 3CJ3A 2K1RA 1U02A 1Q4RA 6FD1A 4NPOA 2MQOA 1WC5A 1R31A 4I68A 4PQAA 4J9KA 1VBKA 1EETA 1KOOA 2WVEA 1LW0A 3MEEB 1TZ0A 1RGVA 3GMGA 2IMOA 4NA1A 5L9XA 1KONA 1AT1B 4Y00A 1RTHA 1VMBA 5KFBA 2J9EA 3TJ8A 2UVUA 4C8MA 3DOKA 1MNEA 2HK3A 1FKPB 3LWMA 2MJNA 2LYVA 8RUCA 1AXQA 2OAUA 2P6TA 1HFEL 1X0FA 3TARA 4IUFA 4FKXA 3ZTSA 3CDEA 2C2EA 3E8OA 3C16B 2B5JB 3AB2B 4FF4A 2ZNYA 3OTOF 1CQNA 2QGFB 4MJKA 2ADCA 3EUNA 1JLQA 4ZN3A 4K50A 2PI5A 2ZHAA 3MCMA 3IN5A 4JV5F 1N5VA 2EFOA 1QDUB 1HNWF 2DHGA 3T5JA 2Z2YB 2HRTA 3P3DA 5EDWA 2ASJA 3ADAC 2ZZTA 1J5EJ 2BE2B 4FZVA 2B7CB 4ZA1A 2VA2A 3FC9A 3EXYA 1FJEB 2WVDA 2FD2A 1HIYA 5SZTA 1NK6A 3PYDA 1RSCA 2BABA 3EPGA 4DU7A 1URRA 1ZZFA 1X4HA 1LFWA 2UUAJ 3T9ZA 1NK9A 4ALZA 5CQGA 4K4TA 2NYHA 3CCQS 3QIPB 4K2XA 3RRKA 2HNZA 4MT1A 4DR7J 5E7OB 4RUCA 2FVPA 1EKSA 4KAIA 1VIXA 1P1LA 4U6PA 4DV0F 1MSWD 2W01A 2IRUA 2HWHA 3IR5B 2LXIA 2V50A 1ZPVA 1WI6A 4J9PA 2H4YB 2RDIA 4DI6A 2R2UA 5L1JA 3LGNA 1U47A 4USMA 4CCHA 2YWHA 1TQLA 3RAQA 2GQ2A 2F8HA 3TVKA 1VJWA 2DNMA 2LDIA 2M52A 3BGLA 2HQ3A 4QWBA 3OFEA 4LR8A 2CFXA 3S1TA 4KJIA 4K5SA 5B08A 4P2MA 2CJQA 4DCJB 3DC2A 4RR5A 4FF1A 1UJ4A 3KUEA 1FWPA 3T19A 2YNHA 1B0VA 1SC6A 5F9NA 3MMJA 3Q86A 4DL3A 4NCAA 2HS3A 3D0HE 9RUBA 1SJ3P 3NL0A 3T1HF 4A8SA 4F0HA 5ETMA 4ECTA 4HYKA 3PG9A 2CG4A 1JLGA 4DS4A 3A3NB 3EVOA 1KQKA 2G4BA 3PX4A 4PXEA 3HJVA 4K0KF 1W7WA 4ITSA 3H25A 2QO3A 3RZAA 4I69A 2QLJB 3HZEA 1RWOB 4U9RA 3J81U 2UP1A 1NSQA 5D0HA 1Q8KA 4LR9A 4RNOA 1FRKA 4O3SA 2BJDA 2QMUB 1T03A 3H4DA 1GFWB 4DR3J 2YNFA 1EIYB 1MLAA 1DBDA 4B3SJ 1YDLA 2EFGA 2G0IA 4TQRA 3H59A 1RT7B 1OS5A 1J5EF 4P7VA 1KOHA 2UVWA 3PNIA 2NQPA 3EGWB 2FZCB 3MUVP 3DI6A 2ROEA 1BGXT 5E3PA 1IBCB 3VVUA 4ED2A 2VOPA 2YWEA 1Q79A 1U2RA 5IFMA 2CRLA 3CJRA 1M90T 4DPTA 2JLFA 3HCXA 2V68A 3AJDA 3MMBA 2LXUA 4ED0A 1NJXA 3KHLA 2CQBA 4P72A 3T1AA 1FKOB 3OR1B 2OSQA 3QZ8A 4H4MB 1FVQA 1IQTA 4MYUA 2ZZNA 4W90B 1BWEA 1KC8T 4ZIWA 1WF0A 1DZ5A 5CYMA 3FSXA 2ATLA 2RB7A 4NEYA 3CD0A 2OPPB 4WFYA 3NNAA 4DX7A 1UJ6A 3EYZA 4Y0FA 1YJ7A 2JH3A 1RDRA 2RKIA 1RWKB 3D5MA 1JJCB 2IYGA 1QSSA 1EQMA 4DSEA 4RO0A 3SV4A 4FF3A 3KHRA 2W2PP 3ET6B 2DGVA 3M2UA 1SKWA 1RE1B 3HVTB 4X65F 1X4AA 3A3OB 4ECXA 4WZMA 1RCOB 3QWUA 2R2TA 6AT1B 4KHPJ 4I2QB 4I67A 4RU2A 1V3SA 1BHNA 2G2OA 4Q5VA 3OXLA 4HHJA 7FD1A 5CH7B 1SCJB 4X64J 3B4MA 3PX6A 3LWLA 1IKYB 1S1VB 4RW8A 3W3SA 3PDNA 2AJQA 2ABYA 3V81A 4ECYA 3H0PA 3IS9B 4OI4A 1VQ5S 4DV5F 4IG0A 4IQMA 3ELHA 1EJ7L 1NM2A 2OPRA 4OYMA 2I8EA 4B3SF 1MN7A 4C8YA 2HWIA 2HHUA 1AYEA 3IBFB 3R3TA 1QM9A 2HFUA 1HHTP 4C0BA 4JI3F 4YOEA 2XULA 4OHYA 5CABA 5LSOA 1VDHA 4PCQA 2QMWA 4JB8B 4H4KC 1VJQA 2VKZG 1DTQB 2KH9A 3CIMA 4WTOB 2V6AA 2HFZA 2XCAA 4F67A 3W9JA 1F2HA 5IC6B 2ZUAA 2PN6A 1R8PA 1X9MA 1HPZA 1VRUA 4LR7A 3LA0A 2YWKA 2I0XA 2D3OR 1HNVB 2PEBA 1HWJA 1WELA 4FBUA 1GH8A 4W4MA 2R7TA 4KYZA 3I9V9 2ROPA 1GK8A 3MFIA 2UVVA 3M30A 4V1Ak 1Q95G 2IBKA 1DJ0A 4CO5A 3QNWB 5HSPA 3FBFA 3TEGA 1FCAA 3MCNA 3O6QA 2P8IA 3TZYA 1GTHA 5KFLA 2X1GA 3OUYA 3KK1B 2MZJA 4EO8A 2N7CA 1ZA1B 3G4SS 5B0EA 3MOZA 1YX2A 2JDJA 4KHPF 4N56A 3TAMA 4J9LA 1RAFB 2IYIA 5KFMA 1ZPWX 4X4SA 1IBKF 1HQEA 1SVDA 2GIRA 2BACA 3CCVS 1RHRB 3EPIA 2XLKA 5BR8F 4UY8T 1W25A 3DLLQ 3MD1A 3MEKA 2IY5B 5FLXU 5EGYA 1FK9A 2BRLA 2F7VA 2KN4A 1PKUA 2DNHA 4TLRA 4PKDB 4QW8A 5LSLA 4CLLA 4MK8A 2ZNZA 2BOPA 3VF0B 3CJKB 2UUCJ 4QIGA 2E9ZA 4J9UE 2M70A 5I42B 3SSRA 1GMUA 4CWBA 4D3HA 3PEJA 1F9HA 1HQ2A 5KFKA 3MUTP 2R8JA 5CHCB 1S1WA 1ZETA 5MLCV 2IAJA 2C42A 4U96A 2QEXS 3RB4A 1KLNA 2FIUA 5B0AA 3GYGA 4ED3A 1VBYA 5GAEI 1HNXJ 3A4TA 2CJKA 4I64A 1F1BB 4ETZA 3KJNB 3WX8A 3K17A 2DD8S 3FQKA 4X4PA 2WSFC 3ENWA 3NP5A 4ZPCA 3OXFA 1R6YA 3IM8A 1HNZJ 4RKUC 3UNGC 2ZM6J 3M2RA 5U47A 5EX3A 1D0EA 1N34J 3CJ4A 2W1BA 2I6WA 4CLZA 5A76A 3NGUA 4BDPA 1YTYA 5A8RB 3POTA 3VAFA 1ZTWA 2CWXA 5IWAF 1E6VB 2NXEA 2ZZMA 3DGVA 3QGGA 3DM2A 4USTA 4F0MA 1VRTB 4M95A 3FCWA 1H72C 1M1KT 2LCWA 3UCGA 2GNKA 2M2BA 4PRFA 4LBIA 3FUYA 5B0FA 2R8KA 3HP6A 2EI5A 2MDAA 1N33J 2Z2MA 4K4UA 1KRPA 3D3CJ 2ZJRQ 4HVZA 1NKEA 2D9PA 4PUOA 4ZVQB 1NK0A 3VAGA 4L76A 1ZOTA 4J9OA 2BW7A 4C6AA 4BLGA 4TU9A 3HT3A 4OHZA 2HNYA 1V3ZA 3U1NA 4KGMA 4OIXA 4O4RA 3K0JA 4A8FA 3TJAA 5KFOA 3HI9A 3T3FA 3SFUA 2M0GB 1RXOB 4YMEA 1K8AT 9ATCB 2HW3A 3SSQA 3HKWA 1DRZA 5KAKA 2UUCF 1TKDA 4NYZA 5JVGQ 2XY6A 2WRMA 4XIUA 2B6AB 3K7RA 2DO0A 2VF3A 2XS7A 3ILJA 2WTFA 1RT4A 2LQ8A 4MKYA 1R6VA 2DISA 2FLPA 3A12A 1U24A 3I82A 2DNLA 3ZZTA 2FGOA 4DXLA 1PAEX 4UZCA 4DV2F 3H42A 3H90A 1NSPA 1IBLJ 2B8PA 1SV5A 3G2XA 3C3LA 1RAAB 2Y9HA 1UA0A 2IRXA 1M5KC 1HWLA 3KLIB 3HPOA 3DRXA 1TVRB 3ISNC 1WKJA 3MM5B 4USHA 2CPXA 4LVNP 3KLGA 2NXNA 2G0CA 4RW9B 2KB2A 3GJTB 3KK3B 1H74A 4ZLJA 4CRJA 3HK2A 2BEFA 2Z8QA 5D3GA 1LK7A 2C3UA 2HHXA 3DYAA 3JXOA 4OZNA 3N5FA 2YH1A 1QVFR 5HMWA 1VQ6S 1IR2A 5LSRA 1QVGR 1XEZA 1PC5A 3AODA 2WB4A 4F36A 2VBYA 3NKYA 3V6JA 2C2OB 4K4YA 3M8WA 2W8LA 1WSRA 3CD7A 1WACA 2V69A 1S0MA 2K06A 4L75A 2A6MA 3RGIA 4ES3A 2V8DA 2QSFA 3C8YA 2QRRA 3MR3A 1UVLA 2FJWA 1EZZB 2IVMA 3MPYA 1HWUA 3R1LA 2O01C 4UQTA 1NRKA 1HBNA 4YR0A 3EDRB 2OI2A 5KFHA 2RS2A 3MM8A 2YY3A 1LW2A 3L7UA 4UOHA 3K89A 1QE1A 1EB0A 3Q0AA 2MKJA 5L38A 2DHSA 2YNIA 2WOMB 3OTEA 2EC2A 4DV6F 2DH9A 1YITS 5FDLA 2R7XA 1KTVA 1EX8A 3HFKA 1AZSA 4QWEA 2DR5A 4IR1A 1Z2LA 3GILA 5L1LA 5D8HB 1VIOA 4ZPDA 2D7SA 1TL3B 3O1LA 3P5BP 1RT2A 4FXDA 5DGAA 5SUHA 2LECA 1KVIA 4JI1J 3GIRA 1RT1A 4ZPAA 3FKBA 3VGVA 1NCLA 2NLWA 1RJJA 2W9CA 3C6TA 2Z2ZA 5DG8A 1IBLF 1MWZA 3BBBA 3CCZA 2Q79A 2ACMA 1NDCA 3R97A 2FGCA 3KLHA 4RW7A 3LP1B 3MTKA 5AE1A 3NGSA 4ZPWR 3UFCX 4DG1A 4QJVA 3M6UA 2QJ3A 1Y7PA 1DHMA 2Q43A 3MMAA 4DSKA 3G6YA 3Q2TC 3HHKA 5DJBA 1WC3A 3OJUA 2VKRA 1APSA 4JI6F 1QD1A 2RSQA 2HSEB 5DO2A 5CAAA 2RHSB 3FQLA 4F04B 1IKVA 1RAIB 4WK1A 2OMOA 3N0VA 1SL0A 4A47A 2QL9B 1F0XA 4Q8FA 1VRQC 4LF8J 3KUHA 1UVKA 2FB0A 5C42A 2JEFA 1XK8A 1IBMJ 2IHR1 2QTWA 4CYUA 3MM9A 1VISA 5F8JA 2FJBB 2VFVA 1S49A 4PWDA 2L3MA 3AOCA 4CO2A 1S9EA 2HHSA 4LVOP 4JBCA 1Q86T 4B3OB 3B54A 2F3JA 3HKZD 5DM7Q 1BC6A 1KFSA 1HBUA 1RBLA 3AQPA 3MEDA 4NXNJ 3MWBA 2HFOA 1OMSA 1EP4A 1NMEB 1S6QB 2MQ8A 1FXRA 1LXNA 1KHVA 2LXFA 4X62F 4DUYJ 2N7YA 4TNOA 4PG5A 2AIRB 4ANCA 1NK5A 2FJDB 1BQMA 2RDJA 5A2QY 2DNGA 1RTDA 3VAHA 1HR0F 2H3EB 1JLGB 3QT6A 3TW0A 1I5OB 2ZD1A 2E1CA 2XMTA 1D8YA 4B9UA 3OFFA 2XGQA 4ZVFA 1S1XA 1NDPA 4HI1A 4KO0A 4DX8H 2ZH4A 2LQ9A 4K4VA 2KVIA 2YNFB 2ZE2A 5IS2A 1R27B 4DUZF 4LF7J 1QAXA 4GVBB 4C48A 3SCJE 4GMKA 3J7Z5 2KYZA 3IO1A 2DYAA 5JUMA 2VODA 3DI6B 2WZ1A 3CDUA 4FP9A 3PIPQ 3PRBA 1NDKA 2QA1A 3CCRS 1FA0A 2DGSA 4KH0B 2VBWA 2ZKTA 4J9MA 2VUGA 2ZH8A 3V2UC 4TY8B 3JQKA 3FGVA 4LF5J 2R8HA 2NS1B 4LF8F 2HNDB 5AXKA 4MKAA 2K3KA 3MMBB 4O3NA 1HNIA 1FE0A 4DU8A 2DNNA 2H5IB 2YNGA 2C3OA 4KPYA 3QRRA 4OHVA 5ETRA 4RNFA 5CYMB 1KP6A 4OX8A 4Y34A 4LBPA 1TK8A 5ADZA 1SQFA 1K47A 2HURA 5F9LA 3O2IA 4B9TA 2ZWPA 5HI7A 3DOMB 3UVJA 2BDPA 5HATA 5B0BA 1QY7A 3NAIA 5H9FK 4EU0A 1Z4UA 3KLEA 1FF2A 2K7KA 1UKUA 3M9OB 1C0TB 5CXTA 2LEBA 3K57A 5K20B 4J5OA 4YY3J 1U0SA 3CD5A 1TUGB 2HQIA 3GWCA 4USJC 4CM2A 1RT3A 1CC8A 2JWNA 5IXUA 5BYRA 4C11A 4DN0A 4ECZA 3AD7C 2HIQA 1XQIA 4U7CA 3QWPA 5KFJA 4CH7A 3JSRA 1TV6A 5F8NA 3FSIA 2DVIA 3UN5A 1P27B 2HPUA 2B3TB 3UPFA 3IM9A 5DQIA 1RU2A 3M32A 3C14A 4JI7J 4GO7X 2C2DA 4IQXA 4K4WA 4FS2A 2VFUA 3VZHA 4L3KA 3JYTB 1T8EA 3BF4A 5J2MA 1P6TA 2DRAA 1WG4A 3DDKA 3I96A 5LMUJ 5KG6A 3E51A 4UOFA 2WVFA 1AB8A 3ITHA 5KG3A 5D78A 4M5MA 4CLUA 4MTPA 3R5JB 1PYTA 2XMMA 2LFVA 3DU5A 4OV6A 2DEJA 1UWBB 2J5AA 2RE1A 4WK3A 2IDLA 1B64A 5E3QA 3W8GA 2KJVA 1UL3A 1R3NA 1QSYA 2FC8A 4QOTA 3R5CA 3MR6A 2QE5A 2OTJS 2JC0A 2H1YA 3EZUA 4P73A 2RRBA 1SQGA 3P4UB 4NRUA 1FX4A 1VFJA 1IUJA 4DR6F 5IV4A 1HD1A 2VC0A 1RISA 1WC0A 3QYYA 2VU5A 4A8QA 4H54A 2C2ZB 2V2ZA 3DCAA 1SJRA 4WYWA 2CUYA 3M30B 1CVJA 1VC0A 2FHMA 5F3ZA 2Y1JA 5M2PA 4USKA 1FERA 3NGKA 4JV1A 1Q7LB 3CCTA 4OYZA 4CNYA 2KRRA 4LF9F 1PSDA 2XNRA 3CC4S 1NPRA 1DAXA 2WONA 3LP2A 2CQ4A 3QO9B 5A0YB 2BQRA 1ZTTA 3TAMB 3I55S 2VV5A 3S6EA 5AJ3J 1YJUA 2VG6A 4UQGA 1PYOB 3G8QA 3RU0A 1TKZA 2BBEA 3IR7B 5HBMA 3IP0A 4NRTA 2G1HA 4Y2MA 1N32J 2JLGA 1CS4A 4QWDA 3OSPA 4RNNA 2BX6A 5JXSA 3GONA 4O0NA 4OMFG 4MIWA 1D9DA 3PW0A 2QA4G 3IMQJ 2VQFF 1N52B 4DCPB 4NCGA 2E5HA 3G6XA 2CQCA 1D09B 3DXBA 3ZZUA 5B7WA 3WZ0A 2CAJA 2W2MP 3N01A 2HK2A 1RBOB 3AB4B 3KXDA 2UXCF 1VHFA 2LLZA 2AYGA 5LMUF 4B17A 4G1QA 2HVEA 5A8WA 2MZ1A 1M5VC 3P45B 3QGHA 1TKTB 5L46A 1LWXA 4PPDA 3THPA 4RNMA 1YJRA 2QC3A 3I0RA 1TAUA 4WF9Q 1FD8A 2HQCA 5IQ6A 2O5DA 2ALZA 2RQCA 4ZP6A 2DK2A 1D3WA 4NEZA 2FZGB 1IKWB 3QLHA 3LO3A 4ECSA 1U7LA 3VGUA 4NZ7A 4OJ3A 3TQ1A 2WAQD 1J2VA 2XMVA 4OFZA 3D0IE 2FJVA 1N56A 1LWFA 1X4GA 3HSGA 3SSSA 4CTAA 1RAOA 3KLVA 1TMJA 4TKTA 3OFHA 5KG1A 3JAMU 1NKCA 4R8UA 4O3RA 3JQJA 1ROFA 2WVBA 5J2PB 2R7UA 1JLEA 4TQSA 5HL7Q 4KHMA 3ISND 1NH7A 4RZRA 4DFPA 1U8WA 1OSCA 1IWGA 1M0SA 4CLSA 3Q8SB 1T11A 4LF6J 1Y3JA 4O3PA 3HF5A 2RDDA 4WTYA 5ETVA 2VL1A 3UCZP 3R5DA 3T1YJ 2RILA 4GKKJ 2OHDA 4ECUA 1L3SA 5AXLA 5C2GA 1UPMB 1RHMB 1O8BA 1WWHA 2NUHA 4XDDA 4EK2A 2XY7A 4A8XA 4CLKA 2GHPA 3UCUP 2PA3A 4YR3A 1S77D 2YKMA 4OX9F 1S9GB 1H3DA 3DOLA 1S6UA 3VTIA 1XN9A 5HAOA 2J9CA 1B0TA 4DL2A 4ZPVR 2PC6A 1X5OA 3CC2S 2XB2D 1UVIA 4ID5A 4LUBA 2IVYA 1VBZA 3HMJG 3MMCA 4YR2A 2OP5A 4DN9A 2W4DA 1RT4B 4F0KA 3M9MB 1JLBA 2DKOB 2VA3A 3R2CJ 2R7VA 2L48A 5I3UB 1F6TA 1VQNS 3GV5B 2DCLA 5HVFA 4P7TA 2KVQE 2OGUA 1TL4A 1QTMA 3CDAA 3SQGA 3BH6B 2HGLA 3TP2A 3M4XA 2PMZD 3N6NA 3CCWA 2CQGA 4UT4A 3FEZA 3BM7A 5GAHU 2MQMA 3TOQA 1RAGB 5ETOA 3I32A 3T6BA 2DR8A 1XMOJ 1KDNA 2VB6A 3A13A 5DDRC 2XMUA 1RABB 3SFGA 1N0VC 1Q53A 3VR1A 4LSNA 4OYPA 2AKWB 2ATCB 2R7QA 2EG2A 2FHKA 4P74A 5ETPA 4G65A 2Y1LB 3MF5A 2WSEC 4ZITA 2CYYA 3MD3A 3DLJA 4J91A 1S1TA 1JJHA 4EBCA 2RRNA 1S0NA 1SH2A 8AT1B 1IXKA 3V4MA 3MUMP 3A8JA 2DXEA 2V94A 4IRCA 2FZKB 3P5TL 1FRMA 4DL0C 3DMJA 3L7OA 1VBXA 1N5YA 2BANA 1EKRA 2W2OP 3SYZA 3T1YF 1FD2A 2F9JA 3OL6A 1UVJA 2HAIA 3FNNA 3K58A 3MAQA 2V8VA 1PILA 2XTJP 2QG9B 1IKXB 1U6ZA 2E9RX 2MMYA 3FBBA 3NS5A 3NWRA 2J0QD 3W2WB 5IT0A 2IM3A 2OD6A 2QZ8A 5KFIA 4ICLB 2B4VA 4LBHA 2GVZB 2DB1A 2YKOA 3L9ZA 2CNLB 3H7HB 1IJFB 1KVJA 3FZ2A 4TYBA 4WKYA 1KBRA 3CB4A 1G1XA 2W9AA 1KSPA 2NXCA 2YKQA 3SCLE 1FT8A 2V4JA 3C6UA 1RWVB 5HANA 4DR4F 1C0UA 1X7VA 4I2PB 4F4AA 4UF4A 3C6TB 1FNXH 1VQLS 1JIHA 5JMNA 4B3RF 3BGRA 1T05B 1F2GA 1LWCA 3R7NB 1X31C 4DHVA 3PKYA 3CJQA 3BO4A 2BJ1A 3WC0A 4XO0A 1XMOF 3PRDA 4DR2F 3DHWC 5MAOA 1FJGF 4RBUA 2XMAA 1QSLA 5KFVA 2OUGA 3BO2A 1F9EB 2HS0A 2YQ3A 2DCUB 1N6QA 3V6DB 4J37A 5C5JA 5A8KA 2PFFB 3M8SA 3OPKA 1RTJA 1RZMA 1R0AA 2VJUA 4ZDNA 4DF8A 3QPIA 1YJ9S 4WFBQ 1NSKL 5HP1A 4HT5A 2A10A 1L3UA 2MGZB 3CUNA 1E6YA 4R5PA 1XTZA 2EW9A 5C24A 2FDNA 2AYBA 4JI8J 4CYUB 2VG7B 4ELTA 4LIRA 3QJPA 2WHOA 3MEGA 1QAIA 4FKYA 4DSIA 4AQYJ 2E66A 4ZVEA 4ZPTR 4JI2J 5G0RA 2RF2A 3IRXA 1BMQB 2LU2A 4Y2CA 2RH3A 2YWGA 1WSVA 1HHSA 4UOGA 5E3AA 3MAAB 1GX6A 2W2NP 4NLGA 3UO0A 2FLLA 2OPSA 3UI3A 4B9SA 1MN9A 5T41A 2IDEA 3U1LA 3KHGA 4DJBA 1HI8A 4EMDA 4A48A
chains in the Genus database with same CATH topology
4YB1P 2V2KA 3PY8A 4FN5A 4EGLA 2KFYA 3P49B 4ILMA 4DPOA 2W25A 1UJ5A 2VPZB 5DLGA 2IBKA 1DJ0A 4CO5A 3P96A 3ZZPA 5D6GA 3OVAA 2KHDA 3MDFA 3OBIA 4RX6A 5CYJA 1FCAA 1P8GA 3O6QA 2EVZA 3JB9k 1GXUA 3OLAA 2D3ZA 1U1RA 2DGOA 1GTHA 1HA1A 5KFRA 2MKCA 3VQTA 3MECA 1S99A 4V19J 5KFLA 2BRKA 2X1GA 3OUYA 3KK1B 2MZJA 2B51A 2DGWA 2FC9A 5J1PA 4EO8A 4N41A 5J2NB 2N7CA 5I3PA 1HWKA 4HI2A 4H4KA 1TL3A 3D1QA 3F41A 3G4SS 2RD5C 3BSCA 5B0EA 3MOZA 2EC0A 2JDJA 3IAS9 4KHPF 4N56A 3TAMA 4J9LA 3M8QB 4DSJA 4Q7AA 3Q23A 2QA2A 4DQPA 2I5JA 2IYIA 3NAHA 4YDXA 5KFMA 1ZPWX 3OTCA 2R2SA 1FNOA 2DNOA 1TKXB 2YWFA 2HNZB 4X4SA 2RMLA 3ETOA 1IBKF 2RT3A 5JVHQ 3K2YA 3NMRA 2KKHA 4IYQA 4QIWD 3T9NA 1HQEA 2J76E 3QJJA 4A46A 2JJ4D 2DGQA 2PA8D 3MM7A 2W9BA 5HO4A 5A6WA 1YBAA 2J7WA 1Q81T 4FNIA 2GIRA 1N54B 4B3MF 1ZM3A 2BACA 2EWHA 2YKMB 2Z0GA 3CCVS 5M2RA 3UD4P 1SKSA 3DOLB 2GCFA 3EPIA 1GTEA 1R8AA 2XLKA 5BR8F 4X2BA 3GIKA 4UY8T 1W25A 1F60B 2IMWP 1ZYQA 2XWXA 3DLLQ 3MD1A 3BQ1A 3DLHA 2ACYA 3J7YI 3CC7S 3MEKA 3N79A 3D1HA 2BUNA 4YB6A 5EGYA 2Y0SD 2YTCA 3LP1A 1YRTA 2DHXA 1FK9A 3K5MA 2BRLA 2F7VA 2L9NA 3M9NB 2KN4A 2DNHA 4TLRA 4PKDB 4ID5B 2XWYA 3N9UC 5C25B 4QW8A 2N82B 5LSLA 2RQKA 4HDHA 3L09A 5E2QA 2AW0A 1MMDA 4MK8A 2ZNZA 4DL6A 3MM6B 4QWCA 2BOPA 3MMCB 3VF0B 3M2VA 3CJKB 2Q6CA 4C2MA 3PIOQ 3RR7A 4FVCA 4QIGA 2KDOA 1JLBB 2E9ZA 1HW8A 1S76D 2M70A 5I42B 1NK4A 3OHAA 3SSRA 5E41A 2UV8G 3OV7A 4DQIA 2GJIA 3PVXA 2POKA 4D3HA 3CCMS 5HQ8A 3PEJA 1UA1A 4WE1A 3CJ2A 4IDKA 5KFKA 3MUTP 2R8JA 1GXLA 2F40A 4DS5A 4EYIB 5KFZA 3F56A 3Q8PB 5CHCB 3KTQA 1S1WA 3MHYA 3A8EA 3PR5B 1RWUA 1N48A 1ZETA 3CWJA 2F8MA 1NO8A 5MLCV 3DLEB 1WI8A 2IAJA 4R25A 2YKPA 2C42A 3B78A 1LFPA 1X5PA 1GX5A 2YNHB 2J6SA 2QEXS 3PHEA 5DRKA 2R7SA 1Q1KA 2XLJA 3BQ0A 4GC7A 3RB4A 1HNIB 2RQ4A 1KLNA 4JI8F 4PXBA 2FIUA 2FPHX 3RYLA 2W8KA 4I0WA 5KFTA 4DF4A 5B0AA 2X51A 4ES2A 4JI1F 3PR4A 5DG9A 4ED3A 2DGTA 3A1YG 2MJUA 1VBYA 2K2PA 4PG8A 1S4FA 1S0VA 1C2PA 2M9KA 5KG4A 5GAEI 4RW6B 4C3MA 2A1BA 2CJKA 4I64A 4HEA9 3HHLA 4ETZA 1TAQA 1ZAXA 2Q6BA 2DD8S 4CNZA 3FQKA 2XSJB 4X4PA 2UUBF 3ZC4A 3GB0A 2WSFC 3THVA 3J80Y 4NLPA 4DSFA 3ENWA 3L7PA 3NP5A 4ZPCA 3OXFA 1KD1T 1R6YA 1SB6A 4LSNB 2CZVC 1Y0HA 2XMJA 4RKUC 3UNGC 2FY1A 3IGVA 1WEYA 3G6VA 3M2RA 5U47A 3FZBA 1VQPS 5EX3A 1K73T 1X8DA 2HHPA 5KFFA 1D0EA 3DRYA 5I4MA 3CJ4A 2DIUA 5KG7A 4JYAF 3NG8A 1Z1ZA 3TYTA 4B3OA 2H9ZA 1T03B 4PQUA 2VH7A 3M1VB 5H1SV 5E3CA 3RBDA 3GFYA 1S9FA 2DNPA 2VD3A 1S1TB 4KQZA 2B7BB 2B4UA 4ZHRB 4BDPA 3GYNA 5A8RB 3BO3A 3BREA 1YTYA 2B56A 3POTA 3MR2A 3VAFA 1K1SA 1ZTWA 1RT5B 5IWAF 2HHHF 2BJEA 1E6VB 3NCQA 2ZZMA 3GG1A 3QGGA 1U1OA 2MB0B 3DM2A 4KT0C 4ZCIA 2MQPA 4C8KA 1AW0A 4RWWA 3H2LA 2IA6A 3LPYA 2X1AA 1JLFA 1RT6B 1VRTB 1S6QA 2OJ3A 4M95A 5JJBA 2KT3A 4KKOB 2QLWA 5GADI 1M1KT 1IQZA 2GA7A 3DMJB 2LCWA 3UCGA 2GNKA 2V8HA 2M2BA 4P6QA 2BM0A 3TUZC 4PRFA 1N5YB 2BANB 2QSWA 5FD1A 3IWXA 4XK8C 4KV8A 5D4LA 1X5SA 1ZM2A 2J7KA 3ZZOA 3I0SA 1VOMA 4DR5F 5B0FA 2R8KA 5CZXA 1F5AA 5F0WA 4M8LA 3HP6A 2EI5A 2MDAA 2FUG9 2Z2MA 3JAMY 4K4UA 1LOUA 2FJEB 1KRPA 3H20A 1YI2S 2RRAA 2W4PA 2VBXA 3EGZA 2ZJRQ 2DRBA 2A2CA 4HVZA 4ED5A 2U2FA 2VFSA 2B0GA 3GZ7A 4URSA 4DL5A 2HMIA 1NKEA 3DRRB 4ZP9A 2D9PA 2XGPA 4NCBA 3OXGA 1U09A 2J8AA 4IH6A 2RQMA 2L9DA 4C8OA 3SEOA 1RTIA 2ZOFA 3DU6A 4KC5A 4TYAA 3LGMA 5D4PA 1NK0A 5F8LA 4PUOA 3CULA 1WEZA 3VAGA 2AX0A 1IBMF 3RBEA 1ZOTA 2W7OA 4J9OA 4ZP7A 4TU9A 2I2YA 3HT3A 4L3NA 4BS2A 4OHZA 5DS7A 2HNYA 3QIPA 3GV8B 2FLNA 1N0UA 2LU1A 2VFTA 5J2MB 4GKJF 3S8SA 1R43A 1V3ZA 3U1NA 4KGMA 4OIXA 4ED7A 1UVNA 2APOA 4O4RA 4Q44A 1LWEA 1D9FA 3K0JA 1W2IA 1UW4A 2B4PA 1YGYA 3U02A 4A8FA 2OPQA 2N4CA 5GVQA 5D4NA 5KFOA 2CQHA 3HI9A 3B4DA 6FDRA 3T3FA 1NJYA 3NWGA 3SFUA 4OHXA 2J0XA 4ETXA 3BQ2A 1Q16B 3R5AA 2M0GB 3KMSA 3RB6A 2IFXA 2AV5A 1XWLA 3S7RA 2ZBCA 3HVWA 2AX1A 4YMEA 1K8AT 3ULHA 4F3MA 2X1BA 2XNQA 2P9CA 2ZH7A 3SSQA 2HW3A 2RKIB 1FRLA 3HKWA 4C0OC 1DRZA 5KAKA 2UUCF 1CQMA 1TKDA 3HM9A 4NYZA 4C8NA 3Q22A 5JVGQ 4ED8A 3CJ5A 2XY6A 2WRMA 4XIUA 2B6AB 3DLGA 3K7RA 4NXNF 2DO0A 1B7FA 4ZK7M 4IRKA 2DR7A 2ROGA 2V4JB 3KMQA 2KT2A 1JLCA 4J9NA 2AGPA 1DQ8A 2XS7A 1N5QA 1C0UB 2WCXA 4BC7A 1HBMB 1QJHA 1JMTA 2G9OA 3M2UB 2IM1A 3BEGB 1NHVA 2WTFA 1RT4A 2GJ2A 3X1LB 4DUYF 4MKYA 1K9MT 4X66F 5IT4A 3EGNA 3THTA 2DISA 2B43A 3MCSA 2GO8A 1F9FA 2LDYA 3W2VA 4EFAC 2FLPA 4WU3A 2HLUA 1T95A 3BGRB 3LH2S 4TY8A 3OJSA 2VG5A 1GXTA 4QWAA 3CMAS 3V5RA 1U24A 1YG0A 3I82A 3NBPA 1SIWB 4ILRA 1LWCB 4TN2A 1TL1B 2DNLA 1HD0A 2MZTA 5K14A 3ZZTA 2FGOA 2HNDA 5L1IA 2ZFHA 3E01B 5AXNA 5KOWA 4DV2F 1H2TZ 2BV3A 4IRDA 4A8KA 1UFLA 2JSXA 4UY85 3MZIA 3FFIB 4KB7A 1SV5A 3C3LA 1JXEA 2XMKA 1MROB 1BQNA 1SQEA 4RW8B 1UA0A 2W24A 2IRXA 1RAJA 1M5KC 1HWLA 2ASDA 3KLIB 3HPOA 4I1TA 3DRXA 1TL5A 3ISZA 3VWSA 1TVRB 2LA4A 2J0WA 2XZWA 3ISNC 3AQOA 4LFCF 3MM5B 2CQIA 2CPZA 4USHA 5F8MA 2CPXA 3JSMB