2DIVA

Solution structure of the rrm domain of trna selenocysteine associated protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RRM domain of TRNA selenocysteine associated protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords TRNA selenocysteine associated protein
total genus 10
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2divA01
3BEGB 2L41A 1YWXA 2FY1A 2MQMA 4P6QA 4WCEQ 2DNRA 2DNOA 1N54B 2DGQA 2PEHA 2AD9A 2CPDA 1S79A 2MKCA 2L08A 2DNQA 4QU7A 2RQ4A 2MKIA 2KU7A 2UP1A 1Q82T 2DGOA 2MSTA 1VQ9S 2VODA 1U1PA 2KFYA 3VF0B 3U1LA 1FJ7A 2DHSA 2QFJA 4A8XA 4WFNQ 2DITA 2CQIA 1K9MT 2OSRA 3SDEB 1K8AT 2I2YA 2HGLA 5DETA 2XS7A 2MY7A 1VC5A 5IM0B 2D9OA 3NS6A 2CPIA 2LEBA 4FXVA 1U1QA 3CCJS 2LQ5A 3G8SA 3G9CA 1Q81T 2MGZA 1FXLA 1U6FA 3CMAS 3BO4A 1OPIA 3DLLQ 2LXUA 4OZ0A 2KG0A 1U6BA 2N3OA 5CYJA 4IO9Q 1SJ4P 4IUFA 2DNYA 5DDPC 3N9UC 2ZJPQ 1KOHA 4WIIA 3VAMA 1HD1A 2B0GA 1B7FA 2CPXA 1WHXA 4WF9Q 2MKJA 3S7RA 1FJEB 1RKJA 4ERDA 3BS9A 1UAWA 3MUMP 1NO8A 2VOPA 2XNQA 2DH9A 2CQBA 3ZZZA 3FEXB 2GHPA 1D9AA 2CQ3A 2YH0A 3S8SA 1VQ6S 3G6ES 1YJWS 4ED5A 2MSSA 2KM8B 2KXHA 2RQCA 1CVJA 5CXTA 3THTA 2DB1A 3CCLS 3MUTP 1P27B 2XS5A 3UCGA 1KOOA 4WFBQ 2AYMA 3V4MA 2AYGA 2CQDA 1KQSR 1D8ZA 2O3DA 2YTCA 2CQHA 2DIUA 2MQQA 1ZH5A 1H2UX 1WI8A 2CPYA 4CIOA 1X4AA 1P1TA 2DNZA 1VBYA 3PIOQ 2FC8A 4TLQA 2M8DB 1DBDA 1UFWA 2HVZA 2DNNA 2KM8C 3VAHA 3P49B 2KH9A 2DIVA 2DO0A 2LECA 2KYXA 4F25A 2N82B 1WEYA 1XN9A 3HI9A 1H6KX 5H1SV 2N7CA 2DNGA 1S72S 1FJCA 2KRRA 2DGTA 3CUNA 2XSFA 5GAHU 2LA4A 2U1AA 1X5OA 1WG4A 4WFAQ 4M5DB 2MZSA 1OO0B 2CPJA 1QVGR 4IOCQ 3P3DA 2AYEA 3CC7S 2MY8A 2ZJRQ 3VALA 5HO4A 1AUDA 2E5HA 1HA1A 5GAEU 2DNKA 2RRBA 2HYIB 2ADBA 1R8HA 2DNLA 2G0CA 5LJ3Y 1M5KC 2KHCA 3SXLA 2M4MA 3IRWP 1U2FA 1SJRA 2MPUA 2KN4A 2MKSA 4RU2A 2E5GA 3MOJB 1URNA 2F3JA 2SXLA 1N8RT 3P6YC 2L9WA 2X1GA 3UD3P 2HGMA 3US5A 2G4BA 2DH8A 3VAKA 3SDEA 1WG5A 3MI7X 4U67Q 3CCQS 2LKZA 1U1MA 1X5SA 1O0PA 3S01A 3H2VE 2DO4A 1U1NA 1U1RA 2N3LA 5CA5A 2J0QD 4W92B 2DGSA 3CCES 2MYFA 1FHTA 1N88A 2XS2A 2V94A 3MD3A 2YWKA 4PKDB 5D78A 3J7YU 3CC4S 3D2WA 3Q2TC 3MDFA 2BOPA 1PGZA 2J76E 2KXNB 1QVFR 2QEXS 1SXLA 3NS5A 2D3OR 3L3CA 4BS2A 2A3JA 1JMTA 2MQOA 4TU8A 1DHMA 2YH1A 1PO6A 1X4HA 3VAJA 4CH0S 1BY9A 4Z2XA 2X1BA 2K8GA 1ZZFA 1WF1A 2CQ4A 2RUGA 2Q79A 2LEAA 2JVOA 2XB2D 3VAGA 1X4FA 2CQPA 2RT3A 2MHNA 3IWNC 3MURP 2LMIA 5GAGU 5GVQA 2MZ1A 2VOOA 2D9PA 2KXFA 4CH1A 3S6EA 2RVJA 2KT5A 2G1DA 1VQNS 3TP2A 1FO1A 1YHQS 2QA4S 1KC8T 2MZQA 3CCVS 1WTBA 3NNCA 4UQTA 2CQ2A 3HHNB 1OIAA 2M70A 1F9FA 3RW7A 3BO3A 5MLCV 1X4DA 1UP1A 2MJNA 2WBRA 3MXHP 5LXRA 5EN1A 5LSOA 1WHYA 3PIPQ 2HGNA 3MD1A 1WF2A 2LCWA 3UD4P 3OW2R 4YUDA 3I56S 4F02A 2J0SD 5DM6Q 4J5OA 4OZ1A 1WWHA 1VQ8S 2DISA 1X5TA 2ERRA 3G96A 2M0GB 4V19X 2CQ1A 4QQBA 1YI2S 1VC0A 2CJKA 2EVZA 2F9JA 2OSQA 4QPTA 5JVGQ 2RRAA 2OJ3A 1X4EA 1NU4A 1WEXA 3EX7B 1VQMS 1VQ7S 3CCSS 1U1LA 2KVIA 3P5TL 1VQKS 2MZTA 2JVRA 1WELA 1U1KA 3ZZYA 1U1OA 1A9NB 2MQNA 1VQ4S 2NLWA 2MKKA 2RU3A 3JB9k 3J7ZT 1KD1T 3RW6A 5IQQA 2K3KA 1K73T 4WKRA 3MUVP 3CC2S 1SJQA 1YIJS 5BJRA 5JVHQ 3Q2SC 2OIHA 1M5PC 1WG1A 1M90T 1X0FA 1A7GE 2MB0B 1RK8A 2AYBA 1FT8A 1X4GA 2DH7A 2CQ0A 1YITS 2M88A 2LA6A 2M2BA 3BO2A 3H2UB 1X5PA 4Y0FA 1VBXA 1VQOS 3UCUP 2CPHA 3I55S 2F9DA 3ULHA 4TU7A 4C4WA 1VQLS 3THPA 2ZJQQ 3VAFA 3EGNA 1M5OC 3DXBA 2I38A 1DZ5A 1IQTA 2CPEA 1WHWA 3R27A 2OTJS 5D77A 1WHVA 4PR6A 5FJ4A 2RS8A 5GADU 2CQGA 3U1MA 2KRBA 5ITHA 3G4SS 2MQLA 5LJ5Y 2X1FA 3TO8A 1JJ4A 1FNXH 2DGUA 5IM0A 3UCZP 2E5IA 4FXWA 5LXYA 2M9KA 3CPWR 2JX2A 3CULA 2X1AA 4IOAQ 1VBZA 4C0OC 3VAIA 2YKAA 4YOEA 2MGZB 3R1LA 3NNAA 2E44A 2XNRA 1WF0A 2CQCA 2EK6A 2GO9A 2MXYA 2DHXA 3CCRS 2DGWA 3LQVA 2DNHA 1ZZNA 1VC6A 4ZKAA 1G2EA 3UE2A 1SJ3P 1W2BR 2ADCA 1SJFA 4UY8T 1L3KA 2FC9A 4W90B 2J8AA 3K0JA 3G8TA 2M7SA 2CPFA 2OTLS 3B4DA 3CTRA 1YJ9S 4TU9A 1X4CA 2CPZA 2DK2A 1YJNS 4PRFA 5GMKa 1JJ2R 1OWXA 5IFMA 2MMYA 2MJUA 2FPHX 3R1HA 1NJIT 2LYVA 1JJHA 2MKHA 1YTYA 4CQ1A 4EGLA 4LJMA 1M5VC 1VQ5S 5LSLA 2EK1A 2RNEA 2MZRA 3CF5Q 3NMRA 3CMES 2U2FA 2NZ4A 3TYTA 1VQPS 1M1KT 1UW4A 1R8PA 2E5JA 3CCMS 2DGVA 1WEZA 5DDRC 1WI6A 4Y00A 4F26A 4LIRA 1HD0A 5DDQC 3CD6S 2DHGA 3B4MA 2VONA 5DDOC 1DRZA 2BZ2A 1QM9A 2DGXA 1H2VZ 3CCUS 4YB1P 3NNHA 2KG1A 5HL7Q 2MZJA 1N52B 3FEYB 2M52A 1Q7YT 5DM7Q 4LMZA 1Q86T 2LXIA 2DHAA 3LPYA 2DNMA 3G71S 2HZCA 2JRSA 3CXCR 1H2TZ 2JWNA 2RS2A 2KI2A 1HL6A 2FHOB 3UWTA 3SMZA 4C7QA 2MQPA 2M8HA 4QU6A 2PE8A 3EGZA 1X4BA 2DNPA
chains in the Genus database with same CATH superfamily
3OR1B 1O51A 4YDDB 3PO5A 1DAXA 1AB8A 1GTEA 3FC9A 1FDAA 1N5QA 4P75A 2NSBA 4Y2MA 3OR2B 4I56A 4X4TA 2FY1A 2DNOA 1LW2B 5A6PA 3PW4A 5HBMB 3EPIA 4UY85 1T9VA 3DYAB 5EWFA 4NWBA 1ELOA 2DCLA 3T1HJ 1S79A 1C1CB 4PQUB 2L08A 5KFIA 3H2LA 2DNQA 1G6BA 4FYXB 2BM0A 3RRKA 5KOXA 2MKIA 4MFBA 8RUCA 1Q82T 2DGOA 2MSTA 2LFVA 4OQJA 4U8YA 3GG1A 3A8IA 5AE3A 5D3GA 4IRCA 4LFAF 2H4YB 2XSJB 2WW4A 1FJ7A 1FDNA 1TL1A 1GMVA 1RT2B 4BDPA 4Z7CA 2R8KA 2ZZMA 4A8XA 4ANCA 4KR0B 4WFNQ 4JI6F 2PEBA 2R7RA 5HANA 2F1FA 2OSRA 5BXIA 1K8AT 4DI6A 3OL6A 5I3UA 2WK4A 1GX6A 4Z7YA 4ZK7M 2BVZA 1T3NA 2I2YA 2RU9A 2A2CA 3HFVA 4DCPB 1WC6A 1VS3A 2HLUA 2J9EA 4DR1J 4EBCA 2CPIA 2D3UA 2LEBA 3C19A 1FERA 4J9SA 1N56A 2FDNA 1NSAA 2WSEC 1LWXA 3M2RA 3UI3A 4LT6A 1LK5A 2LQ5A 5KFUA 3RTVA 3BQ2A 4ED6A 2QL9B 3HVTB 1FXLA 5ETVA 4CO5A 4X62F 5CD4H 2P9EA 4LR8A 2BJ7A 3IFEA 3W65A 2BR0A 1YKWA 2RIJA 1U6BA 2KG0A 1EETB 3QLHA 2UUAF 1CC7A 3O8WA 1SJ4P 2DNYA 3KLEA 2GFFA 1IWAA 2RF2A 4OHYA 1MNEA 4WIIA 3VAMA 3Q8YA 4RUBA 4CI0B 2LDYA 2R7XA 3HULA 5HROB 1HD1A 2NZCA 2V9KA 2B3TB 3F56A 2OPQA 3LTOA 3NKYA 1RKJA 2GIQA 1RLCL 2FLPA 4OYAA 4I2QA 1SKRA 4LFBJ 3HZEA 2HFUA 3CD0A 3DI6B 4HL9A 1C1BA 4CLKA 2ZVSA 3GPAA 2XNQA 2B43A 4AL7A 2DH9A 2RHSB 3LWMA 4YN3B 3ZZZA 4YY3J 4H4KC 3CDEA 2LQJA 3QNWB 2AJ1A 1SV5B 3CO9A 4K8RA 1KQGB 1PCAA 4WU2A 2CQ3A 2HQGA 5KFFA 1Q7YT 2D7SA 3W9JA 2NREA 4N76A 5D0RA 4NCBA 3UFCX 1HW8A 2IMOA 3QBCA 2OAUA 4PXBA 4CM2A 3BF4A 1TKZB 3EPGA 4ED5A 2V8PA 1RWUA 1B70B 3I9ZA 1D0EA 4MK7A 3DU5A 3FSXA 1PC5A 4LF4J 1GQEA 1Q78A 1FI4A 1MLAA 2NUHA 1XMQJ 2JL9A 7FD1A 3DCAA 3MECB 3TUIC 3V4MA 1E6VB 4KE5A 2E5LF 3CIZA 1SCJB 3D28A 1D8ZA 1HHTP 4F7VA 2CQHA 3FMWA 7FDRA 3I32A 2R2UA 1TKXB 2VC1A 1VFJA 1ZH5A 1VRUA 1KFSA 2CPYA 1P1TA 4ECVA 2DNZA 2FLOA 4JI5J 4LF9F 4TLQA 3P49B 1GXTA 1DBDA 2HVZA 2KM8C 4QIFA 3IGNA 4DSEA 4A8OA 2P8IA 3KLHA 2EW9A 3W2WA 2GQCA 5HP1B 3D68A 3LP2A 1V6HA 1WEYA 1XN9A 3UN2A 2EKYA 1H6KX 4DZ6A 1RTHA 1S7HA 5C25A 3EGVA 1IBMF 3OJSA 4LRFA 4ZCLA 2FQQB 1FJCA 3FMBA 2ROEA 2Q6CA 1RWNB 1RT5A 1IR0A 1RTJA 1U8SA 1Q0NA 2DGTA 4NCAA 4C8LA 1TL3A 4MYUA 3FFIA 5GAHU 3AOCA 2LA4A 3TVYA 5A8WB 2OUGA 1RWOB 4ECSA 2A6MA 2PDAA 1WG4A 2XZWA 2B6AB 5KFZA 3SYZA 2MZSA 2VFRA 2AJ4A 3EM1A 4M63A 3DOLA 3ET6B 4RW7A 5K5MA 2ZHOA 1RAIB 3GJTB 5IC6B 4M5GA 5GAEU 3OR2A 3DRRB 3QYYA 1FNMA 1ZM3A 1T05B 2ADBA 1R8HA 2CVEA 2DNLA 3OTCA 4BWMA 2G0CA 3UDEA 5LJ3Y 1B7YB 1K1SA 1TVRA 2KHCA 2LQBA 2FJXA 3K8VA 1T0TV 1M5KC 2ZE2A 4OX6A 1JNRB 1GXLA 2ZKUA 4H4KA 4RW4B 5KFXA 1QD1A 3T3FA 1WDTA 3W3SA 3MOJB 1NUEA 1NK7A 2F3JA 2HNZB 2OEMA 3M32B 4LBIA 3OUYB 3V4IA 2UUCF 2RB7A 1N8RT 3QIPB 3HT3A 2X1GA 3KG4A 4JI8J 3P4UB 4ICLA 5KFTA 3KDNA 3KDOA 1JLEB 1BQNA 1S1WB 1LXNA 4HDHA 2G4BA 2UXBJ 1FRXA 1HBMA 1WG5A 1KWMA 3LAMA 4RW9B 1NHKL 2ZFHA 4AE5A 2BANB 4ETXA 1JXEA 1NHUA 2KL8A 1X5SA 3GCWP 1O0PA 4JI3F 1WKKA 2HNYA 1U1NA 3EZUA 4HT5A 4KHPJ 3JQKA 2J7UA 3VGSA 1FTCA 3Q83A 4KT0C 1JX4A 2DGSA 2EKNA 1R43A 3OQ2A 2WZ1A 3CJQA 3RB6A 3RRHA 1M0SA 4B9TA 1W26A 3E8OA 1S77D 1W25A 3MD3A 2F40A 4ZHRB 3M6VA 2DKOB 2HFNA 4MIBA 3MAQA 3RBEA 4WP8A 1D1UA 1EETA 4GMKA 5A0YB 3G2XA 1LK7A 2HHUA 4PZVA 1RWPB 1X9WA 2J76E 2RF2B 3D1OA 5BYQA 2P2CB 1H3DA 3QIDA 4FS2A 1IBKF 2QEXS 4DFPA 3IBFB 3K7RA 3NS5A 3MMCB 3RYLA 2D3OR 4D3HA 2PIIA 3L3CA 1YRXA 3LP0B 4ECWA 2GQQA 4K4YA 1JMTA 1KBRA 4NCGB 3QPIA 3W7BA 1C0UB 1OY6A 2OEKA 4PABA 1ICEB 4YDXA 5B0GA 2E1RA 3IA0A 3MFIA 1PO6A 1FRJA 2HSEB 4KGVB 1AROP 5L1IA 2XCAA 3BBBA 3W2VA 2Q79A 2F63A 2GHWA 2QIFA 3F44A 3MEEB 2GMHA 4KGXB 4ED4A 3TZYA 3M9OB 2DEIA 2QA4G 4ECXA 4QIWD 2BQ3A 2K06A 4DR4J 2XZTB 4I2PA 3HM9A 4IFYB 4OX9J 1YZ6A 3C16B 4ZPCA 3H25A 2B9EA 5GVQA 1F0XA 4FYYB 2D9PA 3PFEA 3A3NB 2R7UA 2KT5A 4OZ2A 2G1DA 4Q2LA 4N5SA 1PBAA 2IDLA 2HMIB 1PAEX 1VBKA 4C48A 1IBLJ 3M9MB 5F8JA 1M1HA 3L7OA 2QA4S 3CVKA 2DPIA 1RHRB 1KHVA 1WSVA 4LBHA 2AT1B 1KC8T 1D09B 5B0BA 4QWEA 2R7WA 4G3IA 1SQEA 1UVIA 2CQ2A 4TYAA 1IBLF 2MTLA 3AB4B 2YWEA 4DU8A 3OV7A 3EVOA 5J2NA 2M70A 3EVWA 3DFEA 5L1LA 3V6DB 1FVQA 1UPPA 2G0IA 4ENOA 3BO3A 5G0RB 2K7KA 1UFLA 4N8NA 1WC0A 2CNKB 2WBRA 4PXDA 4Y2CA 4OX9F 5LXRA 4E0DA 3MXHP 2PT0A 2ZVIA 2HHVA 2B56A 2FLLA 3N6LA 1FFGB 4BBYA 2OKQA 2HGNA 3CJ3A 2LCWA 1N33J 2CAJA 4LQ9A 3UD4P 1N6QA 3BH7B 2GJIA 5HMXA 1RAGB 3KHRA 2MEWA 3M8QB 4RWWA 1ZBTA 3SCLE 3BJYA 4NZ7A 1HBOB 4CWBA 4F02A 3HHDA 1CJUB 2MLYA 4ZVPB 4OZ1A 1WWHA 4PYDA 4B3TJ 2ERRA 1J2VA 4C8YA 2N7YA 5CYQA 4B3RJ 2GVZA 1IBCB 1Q8BA 3N28A 3D6HB 1UPMB 3PYDA 2CQ1A 4HHHA 4WE1B 4OZJA 3J7YI 4PWDB 4KO0A 3M2VB 2VL1A 1TP7A 2P6TA 5M2UA 2F9JA 1RT6B 2OSQA 4QPTA 4PWWA 1YDLA 3DHXA 2XZDB 1X4EA 1NU4A 3W1YC 1PJ7A 1LWEA 5GADI 6AT1B 4ZLJA 2XLJA 2A18A 3GILA 3CCSS 1U1LA 4M5HA 1VQKS 1QTNB 2YQ3A 3KUGA 1NH7A 4Q45A 4AQYF 1U1KA 1EQMA 3BGUA 1B99A 1Q1KA 1NCLA 4WPAA 3EYZA 2WAQD 3AOBA 3BYRA 3DOLB 3ET6A 4I0WA 1U02A 4K2JA 2JFKA 5J1EB 3PACA 3PRBA 2I8EA 4PPDA 3DLJA 3W5YA 2HWIA 1CULB 3JAMY 2R42A 3DRRA 3D9BA 3KG1A 3A3PB 3WQPA 3J7ZT 1T05A 3PJXA 1XERA 2QFIA 3ZXWA 5IQQA 1LW0B 3TJ8A 5HBMA 2K3KA 2GIFA 2BJ1A 4NASA 3R97A 3Q8PB 1AW0A 2RD5C 1C1CA 4WKRA 3MUVP 2FTRA 1JLAA 1FNOA 1X0PA 2W4DA 3ENVA 1T9XA 4PG4A 5CD4A 2UV8G 1A6LA 3G8QA 5JVHQ 5J1NA 1PIEA 3UDLA 2OIHA 4N47A 3SV4A 4WYWA 5A8RB 3T1YJ 4Y28C 5CABA 3T41A 3ILOA 4ID5B 2FZCB 2HS4A 2ALYB 1N5SA 3JXOA 3T1AA 1RYSA 3CCZA 3PKYA 1U24A 3GE9A 3IM9A 4FKYA 4LREA 3NXZA 4OHZA 3C46A 2DH7A 1BQMA 2OFHX 3TX0A 1CEZA 4X4NA 4PG5A 1T9YA 2YNFA 4O0NA 2Q66A 1YQHA 4WZMA 3FBEA 2H48B 2BX6A 3WX8A 5L46A 3I55S 2DY9A 3JSMB 3GMGA 2W4PA 3PR5B 1XJWB 4X64F 1UJ5A 3R5GA 3O1LA 4ZHRA 4DS4A 4MK8A 2CJQA 5DGBA 3KUEA 5A0YA 2AZ3A 1FEEA 1LWFB 2DXFA 1P6TA 3T6BA 4J9VA 1JLFB 2ZJQQ 4DF4A 3TAPA 2ASJA 2FZKB 3BGOP 3EGNA 2B7CB 2FVCA 3PG9A 2DPJA 2WVCA 2IYGA 4ZN1A 3IN5A 4DUZF 3A8JA 1PILA 4USMA 5FLXU 2ZH8A 4DR5F 2JLGA 3VR1A 3R27A 2H4WB 3MMCA 4DV3F 3M4XA 2OTJS 1PYTA 2CZ4A 4DZDA 4NMLA 4QCLA 1RT4B 2H51B 4ZCKA 2ZM6F 2DRDA 3KHHA 1VHIA 2R7OA 4LF9J 5B0EA 3G86A 1WOSA 3QGGA 3G4SS 5LJ5Y 2Y8YA 3CJKA 1OY9A 1C1BB 4IKAA 9ATCB 3LO3A 3TO8A 4P52A 1SL0A 4P2XA 1R0BG 4WXOA 3KLFA 3I5AA 5IM0A 1RADB 1N5TA 4CO0A 3C6UA 1PC4A 2RH3A 1AA1B 2PGCA 3AXMA 5M2PA 1I1GA 2BEFA 2YXLA 1QE1A 4ES1A 1S1TB 2X1AA 2ZZNA 1YBAA 1DQ8A 5U47A 1KVKA 2VC0A 2ZH9A 3WBZA 3VAIA 1VBZA 1HNXF 3N6NA 3GIIA 3NNAA 3FZBA 3WZ0A 3OLAA 2XNRA 3EXYA 2R9LA 4LF5F 2Y9HA 1QAXA 5HJYA 4F4AA 4OI0A 1SKUB 3QMQA 4P7TA 2XYPB 1TUWA 2PSZA 2B9WA 5J2NB 2FVPA 3PRDA 5F8HA 2HQIA 2IIHA 5EGYA 2L48A 3R5JB 4YHHJ 3G6VA 1FXRA 1Q95G 2MXYA 5EX3A 3CCRS 2O66A 3K8WA 1PKUA 3ZTOA 2JNJA 3QT8A 4DX7A 3EXCX 2IBKA 1RBLA 3DMJB 4YFUA 1W2BR 3I6PA 3H7HB 1NH8A 1L3KA 2J8AA 3UDVA 3IG1B 3DLGB 3CDUA 3KMSA 3B4DA 3W8PA 3CTRA 4X4UA 4DX8H 1CJUA 2CPZA 2DK2A 4C3MA 1KNZA 2WRMA 5J2PB 4OZ3A 5CYQB 4HLBA 3TJ9A 2MMYA 4ZJQA 3AH6A 3KLHB 2FPHX 4JV2A 3R5CA 4PWDA 3OTOJ 1JJHA 3SQGB 1YTYA 3LP2B 2HURA 4OYBA 4EGLA 1BWEA 1VQ5S 3GFXA 1TELA 1RSCA 3LGHA 4WK3A 5ETRA 1R8CA 3H20A 4IG0B 4A8FA 1Q8LA 1RTHB 1XK8A 1QAIA 4F4KA 1C0TA 4EYHB 2HIYA 2NPFA 3OSPA 1HI8A 4C2MA 4KYZA 4F2SA 3NMRA 2XGQA 4CM0A 2W7OA 3CMES 4USJC 4EYIB 2YPZA 1BXNA 2U2FA 3TYTA 3PZPA 2XMJA 1ZM4A 1DLOB 5T14A 5KG4A 4X62J 3T5JA 5KT2A 5A8WA 2OEJA 2BJEA 4EU0A 1UW4A 3W66A 2E1PA 2VPYB 3PDNA 3T5LA 2C3PA 2IRYA 2O5DA 2ZBRA 3B82A 4JP8A 2PFDA 2QT7A 3CCMS 3TW0A 2C22A 4NLUA 1NRKA 3H59A 3B6BA 1CULA 2VQEF 2V9WA 5ETSA 4ZPWR 5SUHA 2ASDA 1WI6A 2NUUG 3R9LA 4Y00A 1HR0J 3P45B 5D4LA 3A12A 1U0HB 5E3PA 4DN9A 4JI3J 4GVBB 5DDQC 1S9GA 3FRZA 4MH8A 4AXJA 2VG6B 4ZOSA 2IA0A 2W25A 5KFHA 2QA1A 3AODA 4RW4A 4OFZA 4QW9A 1F9HA 1QM9A 1H2VZ 2HNZA 3BZQA 3M32A 1EARA 4UOGA 2MZJA 1N52B 2XMTA 2YX4A 1R27B 3HHLD 5A8RA 2M52A 5HL7Q 4ID5A 2F65A 1Q5YA 2Z57B 1G7CB 2J9DA 4WP9A 3SEOA 4CLPA 2R3VA 1UETA 5DM7Q 4J7CA 2DRBA 2CVIA 3OL8A 2YKMA 1BQMB 1IM6A 2IHR1 3PYGA 4HDGA 1GAOA 1MWQA 1EQ0A 3AY0A 4DPOA 3N4WA 4USUA 3NOGA 3WIUA 1UZDA 1HL6A 2D41A 3IWXA 4BWJA 3SMZA 3UWTA 4C7QA 5B0CA 2EFVA 4QW8A 4YR2A 2ZBQA 3K89A 5K20B 4V1Ak 2ZBPA 1BUXA 2HVEA 3VQSA 1AUSL 2CIMA 1N0UA 1X4BA 2Z56B 3MM6A 3V2UC 5KAKA 1JK9B 3BEGB 3UR0A 2IM2A 4DCJB 4FF3A 2L41A 1NEEA 4RNNA 2VQFF 4LSNB 4EBDA 2WB4A 3GSIA 1IQZA 2QA2A 1GMWA 1N54B 2DGQA 3MM7A 4MIAA 1S1VA 1SC6A 4E2FB 3K59A 1K0VA 2QSWA 2BKNA 3W8GA 4GKKF 4LSLB 2VHGA 4J9PA 2NYIA 1RTZA 4JI0J 2B4VA 4RX6A 3EJMA 2VODA 3BGRB 1FD8A 2RE1A 4E98A 2GGPA 1RCXB 2VDIA 1PJ5A 3VF0B 2FHJD 3U1LA 2KFYA 2DHSA 3ONQA 2EG2A 2W9BA 2DITA 3ZTSA 1G1XA 2QRRA 1FX4A 1FRKA 1MG7A 3G82A 1FDBA 3SDEB 3LH2S 2HGLA 4FPRA 5DETA 5L9NA 4RW6A 3GIJA 4OI6A 2K1RA 3TANA 2XS7A 4NI2A 2MY7A 2XMMA 1HARA 4RBVA 5IM0B 2D9OA 3NS6A 4FVMA 4HH1A 4R0EA 3PW5A 4IFYA 1OQ3A 4EUVA 4JV1A 1QE1B 3NGRA 1QDUB 2IJNA 4IDKA 2OPPA 5E3RA 2RQMA 3BSOA 1I6JA 2YWFA 2UXBF 2J9DE 1TMMA 3G8SA 2HMIA 2KZZA 1Q81T 3H5XA 4WKYA 1CC8A 4R8UA 1OPIA 1ZA2B 3PYEA 3BO4A 4JI4J 3DKDA 3IXQA 3M8YA 2W24A 4ZVUB 2W7PA 2AJQA 4UQGA 3V81A 3OT9A 4V19J 1IJFB 5D0GA 3UO0A 3QFWA 2BOAA 2FHKA 5DS7A 3F73A 3D5MA 2MKYA 4L75A 4DV2J 3DLBA 3N6MA 1KOHA 5G0RA 4URGA 1KSPA 5F0UA 3GFYA 4YMEA 3R6LB 2V67A 2MKJA 4IG3A 4NLGA 3CDAA 4X66F 2RDIA 4RUAA 2V2VA 1Y9OA 4OYOA 2AQ4A 2B4PA 2ZNYA 4Q5VA 3TAQA 1FJEB 1LOUA 3PTWA 4B9MA 4W98A 3UVJA 2VQEJ 4A8QA 1U6ZA 2CWXA 4P72A 1KLNA 2Z8QA 4ZP8A 1S59A 2XHWA 2IVMA 1HBOA 4NLPA 5J2PA 2D74B 4NLXA 4RKUC 2CQBA 3PO4A 4YR0A 4IFVA 4KGKA 3MM9A 3PHEA 4NLSA 2ZDOA 2HNDB 4ZVTB 4H4MB 2LVWA 4ECTA 3HP6A 4OJ3A 5KFNA 2AX1A 3PY8A 2Z30B 1BGXT 3LP1A 1FX2A 1S1XA 1HHSA 2HFZA 3G6ES 7AT1B 3GWCA 1JIHA 1YJWS 3H5UA 2OPSA 5F8LA 2KFNA 1UL3A 2KKHA 2MSSA 1LWEB 1RBAA 4DX6A 2KM8B 4F67A 2XMUA 4B3RF 2IM1A 2GQ2A 4F0HA 2MHEA 2QGFB 3W9IA 5I42A 1HWKA 5B09A 4ELVA 1SH3A 2BE2B 2CUYA 1OMSA 2DB1A 1P27B 2IM0A 3GR0A 1KOOA 1YLXA 4WFBQ 2ZWPA 1UWAA 2O3DA 1FK9A 1VQSA 3CE8A 1K47A 4TVAB 2Q1LA 3M8SA 4KPCA 4M95A 2NQPA 4A8KA 1SB6A 4CLTA 1H2UX 3MGJA 1S57A 4CIOA 3Q86A 1VRQC 2G0JA 3I4HX 1ZM2A 2E7XA 3JAMU 4YHHF 1UFWA 3JQJA 1VOMA 3W9HA 4YR3A 1QSSA 4LF4F 4D3GA 2DIVA 3O6QA 4Y2KA 5KFYA 2AJ2A 2EBEA 4AL6A 4LRDA 5A2QY 2XHCA 3WX4A 2DO0A 4U95A 3MZIA 4G1QA 5E2QA 2BJ8A 5ETOA 2XMAA 4DSKA 3BREA 2HWHA 4JI4F 2N7CA 2ZH6A 4A8YA 2WW8A 4O0IA 2DNGA 3PEJA 1D9DA 2KRRA 4O3PA 1F5AA 2V6AA 1CPZA 2HFVA 4R5PB 3FGVA 4C98A 3CUNA 2WSFC 3EZ5A 2HVIA 5AJ3F 3IMQJ 1GMUA 3NY0A 1X5OA 1JXVA 2OFGX 1RP5A 5A8KB 2QL7B 2CPJA 1J5OA 1ACMB 1HMVB 3HK2A 1H0HB 4IOCQ 3P3DA 2AYEA 2ZJRQ 2DRAA 5F9NA 2FB0A 3CJ0A 5HO4A 1AUDA 2E5HA 1HA1A 1UJ4A 3KK1A 1N32J 2RRBA 3NGTA 1NNDA 4NXNJ 2V68A 3IS9A 3RGIA 1XWLA 2CZVC 4DXLA 1U7LA 3I82A 1VJWA 3OTDA 2V4QA 5KFKA 3ETMA 3IRWP 1UVMA 3PKMA 2BQRA 1SJRA 2NXUA 2IYIA 2KN4A 2R8HA 2IAJB 4N77A 1G3OA 3PNIA 2ATLA 1URNA 2YKQA 4M5NA 1S4EA 4XIUA 3FVYA 2SXLA 1SUQB 2GHVC 3FZ2A 1HNWJ 1KQFB 3FBCA 2XO6A 2VG5B 1TFWA 4EK2A 2L9DA 5E33A 3US5A 2LLZA 3ZTPA 3GG0A 3E01B 1NDPA 2B51A 3CJKB 1R3NA 3VAKA 2Y1IA 2YNHB 2V2ZA 2WHOA 2VKRA 3W5XA 4F0MA 3H2VE 4U7UK 2VICA 5FLXY 1NXIA 4A8MP 4J90A 3FCHA 4G6VB 2J0QD 1WC1A 3WC0A 2QO3A 2A1BA 2HQ3A 2PO4A 4OYMA 1UZHA 1FD2A 4H4OB 4ZPTR 4ZVQB 3EDRB 3BDPA 4YP3A 5ETLA 4HTIA 2V94A 3KLGB 3M8PA 2VJVA 1HBNB 4PKDB 4DR3F 3J7YU 4JV5F 3ZZUA 5FIIA 3D2WA 2DYAA 2KDOA 4G1IA 3Q2TC 5HLFA 4ECZA 3PJ9A 3NRBA 1NJYA 1HNVB 3CJRA 1JXLA 1RISA 4DJBA 4KAIA 4QJVA 2QLJB 3P8BB 1U25A 3KK2A 4B02A 2KVQE 3MMJA 1L3TA 3KYLA 2CJAA 4USTA 4Q8EA 3PEHA 2A3JA 5B0AA 4F36A 3GSDA 4PXEA 3PW0A 1RT2A 2JEFA 1DHMA 3U02A 2VIHA 1QY7A 3CO0P 4QIGA 1RHKB 2C2MB 3DLGA 4OHVA 4CH0S 2X1BA 2K8GA 3X3UA 4N56A 1Y3KA 3MCMA 4C11B 3DRSA 2RUGA 1AXQA 1JJCB 1F5BA 1RT3A 4NYZA 4P73A 2HZVA 3K17A 3CCES 3MPVA 4C8MA 4AQYJ 2BW2A 3NBPB 1IN0A 1NPRA 2HRUA 3MM9B 1IXKA 3ELHA 1X4FA 2RT3A 3QO9B 4Q43A 1NZ8A 1S1UA 2MHNA 3I0SA 1PYSB 4DV4F 2LMIA 3DRXA 4LF6J 2X3DA 1YBTA 3Q8UA 5CAAA 4DQRA 3M2RB 4IG0A 4J9RA 5H9EK 1XMOJ 1C0TB 3DLEA 2PC6A 4I7FB 3TP2A 2D3ZA 1VHFA 2HZAA 1YHQS 5C2GA 1HWUA 2QMUB 2FYXA 3RUBL 3GV7B 1H98A 2MZQA 2I5JB 1U2CA 3KG0A 3OTOF 5KFGA 2Z2ZA 3QLHB 4UQTA 1KN6A 1D9FA 5A2QU 4YB1P 1UFKA 2NCKL 1MMNA 1NLKL 3VZHA 3RBDA 1OIAA 2R8JA 5LM7E 3KLEB 3RW7A 1S97A 3SSSA 2E1CA 4BC7A 4DR6J 1MMDA 3FCVA 3TQ1A 2EFNA 3KJFB 2V8GA 1NJZA 1CJKB 2UUWA 2MJNA 3D0IE 1V9OA 4KHMA 1RGVA 3QWPA 4CT9A 4DV4J 2RKIB 3DGPB 1OY8A 3O44A 5HROA 2HYIB 5EWGA 4FZVA 2OPQB 1S6PA 1U0HA 3MD1A 4TXSA 6FDRA 3RG6A 1T9WA 3ZFVA 1S9GB 1JLQB 2CDQA 3JSRA 4UTGA 2FJDB 4CRJA 5D0HA 3H40A 4EEYA 1X9SA 1O8BA 2GC8A 5K8NA 1OJ4A 1FDDA 3NCQA 2OLWA 1RAEB 1UVLA 3I56S 3JS9A 1H73A 5LMUJ 1VQ8S 2DTJA 1S6UA 1HQUB 3G96A 2M0GB 2N4CA 4WTYA 4XK8C 4L72B 2RUSA 2B8PA 4JI8F 2UVRA 3NOCA 4QYRA 5HVFA 1S0NA 4WYLA 1KONA 4UUWA 2F4VF 2CJKA 3VVUA 4DUYF 1IVZA 1UWBA 4LF8F 1WNEA 4ECRA 4TY8B 1R7IA 1NPPA 1YRTA 3ILJA 3EX7B 3ZC4A 1TAQA 2Z58B 1GT8A 3ENAA 4USKA 4Y2IA 2AGPA 2AMCB 1HNIB 4YQWA 2KVIA 2B8QA 1CS4B 3TA0A 2HHQA 1RLDA 1J5OB 3ZZYA 4I1TA 4HVZA 2LU1A 3JYTB 2NXJA 4FXDA 4MIWA 3OXLA 2Y0SD 4OJ1A 4B3MF 4NEZA 2EWHA 1HIYA 5E0OA 4C8OA 3KK1B 2UVUA 2YKNA 1S6QA 2HS3A 4NLQA 2RU3A 1M5HA 4IYQA 2IY5B 4OYZA 1Y7PA 1EP4A 1TK5A 2H65B 3BH6B 5KG6A 5IC4B 3EUNA 2J0XA 4WWSA 3TA1A 2VG7B 2M8DB 4LSLA 1VCTA 3VZIA 3DC2A 4F3MA 4IRKA 2IJRA 2OI2A 1SH0A 2QLXA 3WDOA 4RZRA 4ETZA 1HYSA 2GX8A 1CQMA 1UJ6A 2GAHC 2YNGA 3DM2A 1YIJS 2GGPB 2OHDA 4QIVA 1WG1A 2QMWA 1X8DA 4K0KF 1HFEL 1M90T 2BXJA 5D15A 4ZLPA 3BPDA 4H54A 1JKHB 3M1VA 1R6VA 2UZAA 2XYGB 5JUMA 2AYBA 2GO8A 2YNHA 1X4GA 4A48A 5JJBA 1N34J 2UVWA 1RT5B 3NS7B 5HMWA 1WJ9A 2LA6A 4L74A 3BO2A 1AZSA 3H2UB 1ZAWA 2CNOB 1TL3B 1V3RA 2VDHA 3R7BB 3MAAB 1WC5A 1VBXA 3MTJA 3QRQA 3HSJA 1ZA1B 2VFUA 4OLOA 2K2PA 2F9DA 5HVGA 1OPZA 3L9ZA 3N5BA 3IP0A 4JV0A 2EI5A 3D6FB 3LUYA 4ZVHA 1SI9A 3G6XA 2J6TA 5DG9A 4C4WA 1RUSA 1NPKA 3FK4A 1B0PA 3THPA 3VAFA 1Q16B 5AE2A 4UZCA 1M5OC 3C6TA 1UA1A 1I5OB 1V3ZA 3HT0A 4OHXA 3ILIA 2CPEA 4EBEA 2RILA 3CDBA 4MKYA 1ZAVA 4X84A 2QYCA 2LP4A 1FVSA 3HZGA 2OH2A 3OFFA 1HNZJ 1CLFA 1DARA 2B9XA 3H5SA 3KHLA 5H9EJ 5JMNA 1RI7A 4PR6A 2E29A 1H38A 2UU9F 4OMFG 2ZOFA 5IV4A 5KFLA 4K2XA 1TUGB 1C2PA 1NMEB 2QG9B 3BBFA 2HPUA 4C11A 2J6SA 1RT3B 2AGQA 2FJEB 2X3GA 1DTTA 3NBPA 2BANA 4FVCA 3VHQA 4GC7A 3QJPA 1SIZA 1FNXH 4I6YA 2XY6A 1RTDA 4F3QA 3I0SB 3GYXB 2MLZA 4H4MA 3M30B 1OSDA 2E5IA 4MKBA 4FXWA 4FF2A 1REVB 5T41A 3BGLA 4Q0BB 4EFAC 2F8EX 1N4LA 4DL7A 3DLEB 4I7FA 4ZCMA 2ZH7A 1YJRA 2BQUA 4DHVA 3MM8A 1FRHA 3Q8VA 4NPOA 3CULA 2VBWA 1HHQA 2DXDA 2OPSB 4C0OC 3KXDA 2YKAA 3VGUA 3HVTA 1KP6A 2DR5A 4YOEA 3D1QA 4P74A 1XIQA 2E44A 3IBCB 2RRNA 1OYDA 2CYYA 4UT4A 1UEUA 4QPXA 4EZ9A 2VH7A 2V50A 4PXCA 1C4AA 2ASYA 4B9VA 4HI1A 5J2MB 4EO6A 4DL5A 4BLGA 1VRTB 4L73A 3K58A 2NR0A 2AHOB 5KFDA 3OHBA 4NLOA 4RNHA 4CZCA 2DGWA 5FD1A 1FK9B 3DGPA 4R25A 4RNFA 1ZZNA 1VC6A 1PBUA 4HKQA 1XR6A 2V8DA 1S6PB 2VU5A 1IKYA 3D7SB 3JTPA 1JB0C 2G2YA 3UE2A 5HSPA 1JLQA 2CG4A 3MFHA 4DV1J 1C0UA 4DR1F 2ADCA 3OBIA 1Y11A 1KS2A 5D0EA 1T03B 1T11A 3CIMA 2FJVA 3PJWA 1XQIA 3DI6A 2E5LJ 3EGWB 1S76D 3MR5A 1JLBA 2HBZB 3W2VB 1RHQB 2F8HA 3CJ4A 5JXSA 3MEEA 5KG1A 1Q8IA 2GAGC 3FEZA 3MPYA 4JUZA 3RB3A 2BKPA 4G1QB 4J91A 2AKWB 2LYVA 1QSYA 2BYCA 3DDIA 1SKSA 3TUPA 3I31A 2XBPA 5LSLA 4IOBA 4CNYA 3MPWA 4M94A 4CP5A 4DUTA 2W1BA 4RPFA 5A76A 1U2RA 3T5HA 3CGIA 3CF5Q 3ENWA 1OYEA 1KTQA 5CH7B 4OI4A 1VGYA 3DLHA 2W2QP 2PI5A 4JV5J 2NZ4A 1UW9A 4FBTA 1HLWA 4ZP7A 5KG0A 4DR3J 2WOMA 3CMQA 4UF4A 1OS5A 4KSEB 4C3KA 2VV5A 4K4SA 2HBQB 2DJWA 1IJEB 3AJ1A 3MECA 5B08A 2DGVA 3MPDA 4GO5X 3FUYA 3T19A 4ZPDA 4ED0A 4J9NA 5EUHA 1UEKA 4YB7A 3D4JA 4J37A 3UNGC 1NAQA 1SKWA 2PI4A 1RWMB 3ZZTA 1VIXA 4QWDA 2GJFA 4DV5F 1N6QB 4ZIWA 1Q4RA 2BE7D 3CD6S 3B4MA 5C25B 3HCXA 4IH6A 5A6WA 1MROB 3OVSA 3MMBA 3M8QA 2FVRA 2IA6A 3JTNA 4PEOA 1R31A 1EKRA 3M9NB 1SJ1A 4C6AA 3CWJA 3ILLA 2UXCJ 2DXEA 4N7TA 3N5FA 2DEJA 3PHTA 4ID8A 1U48A 3CCUS 1X31C 2YWGA 3MHYA 4ZVOB 3M8ZA 2X51A 5ETKA 2I6WA 5KT5A 1WOPA 1CBKA 4M1KA 5KFPA 1L5UA 2BMBA 1RTIB 3NGKA 4Y65A 3QSIA 5E3CA 2DNMA 3I9V9 1KHWA 3THVA 1NKBA 3CXCR 1H2TZ 4RU9A 4F50A 1RAHB 2JWNA 2RS2A 3F0NA 2NYHA 1LQ9A 3IAM9 2CA9A 4QBUA 4KHPF 4Q7AA 2MQPA 4RWXA 3AA8A 3QFHA 2VA3A 3TZZA 4H4OA 1ITPA 4I6AA 1Y00A 2H9ZA 1MU2A 3UR3C 1HWJA 1JWWA 4KKOB 1CSJA 1MN9A 3HKZD 5GAGI 2G9OA 3KJVB 1YWXA 4NYPA 9RUBA 2MQMA 4F04B 4P6QA 4WCEQ 2DNRA 4O23A 1HI0P 2JEJA 5KG2A 1VYAA 1A0OB 2HHWA 3C6TB 3CJ8A 2GCFA 2CPDA 3CD5A 5CQGA 8AT1B 3QZ7A 2C28A 4QU7A 2RQ4A 3BPSP 2KU7A 4LVOP 5F9LA 2R7TA 4FS1A 1U1PA 4CLFA 3V4IB 3FBFA 2BE9B 2YVSA 3K5OA 3QT6A 4I69A 3QIPA 4F4WA 1P8GA 4ZPVR 3PYFA 4IQMA 1U45A 2JEGA 4JI7F 1JLEA 1BQNB 1FKOA 1Y4ZB 2HHPA 2NXEA 1U4BA 1VLOA 4KH1B 1RTDB 2HKEA 3KK3A 3ITHB 1VC5A 3Q0AA 3QO9A 1REGX 3A1YG 2AEFA 4IH7A 3PX6A 1U1QA 2KFZA 3CCJS 2O1PA 1YBUA 4NA3A 4DFMA 4DL3A 4FNHA 3DRPB 3G9CA 2BA9A 2ASLA 2GV1A 5KG5A 1IUJA 4OZLA 4WTOB 3DLLQ 3AB2B 3NL0A 2DT9A 4OZ0A 1QUVA 3S1TA 2NXCA 3SBMA 3MR6A 2N3OA 1LWCA 3A3OB 5KFOA 2L9NA 1EX8A 4KY3A 1MW7A 4NOHA 5K14A 4LFCF 3SCIE 3C66A 4ANDA 4DBQA 4IO9Q 2BRKA 5DDPC 4FN5A 3GLJA 3N9UC 1SQFA 3AQPA 2ACYA 2V63A 4K4WA 1XMOF 4NXNF 3BSCA 2B0GA 2Z2LA 5MAOA 3VGTA 1B7FA 1P1LA 4WF9Q 2RKIA 1IKYB 3S7RA 3NGUA 1RJJA 4DR7J 1RT4A 4DG1B 4K5SA 3RU0A 5ETPA 4NCGA 4NXMJ 4O4GA 1T94A 2D3O1 4ERDA 1QJHA 3GZ7A 3K5NA 3FJ2A 2PMWA 3H0PA 1NK8A 1UAWA 3Q89A 5DJBA 1NO8A 4K50A 4DV0J 5KFAA 1BQXA 2HQDA 2JFDA 1HQUA 5SZTA 3KLFB 4ILMA 1GH8A 4DN0A 2IJFA 2PFFB 2YBVA 4I2PB 4KIAA 2XC9A 1U47A 2CG8A 4ECUA 1RAAB 4DV7F 4CTAA 3S8SA 4FYDA 1VQ6S 5AXMA 4DUYJ 1S1TA 3M8WA 4AUKA 5EHHA 2ZH4A 4QR2A 4X4OA 2HEKA 2HHHF 1UCNA 1WC3A 2R8IA 2PA3A 3RJMB 4XDCA 3VWSA 2KXHA 2ZEJA 3J7A1 4U8VA 3BGFA 1CS4A 2IFXA 1Z4UA 3VGVA 3OJUA 2DCUB 2ZH5A 1NK6A 1QSLA 2Y8WA 4GKJJ 4OYXA 3CCLS 5F3ZA 3MCSA 1UVKA 2AYGA 2OMLA 2CQDA 2WCXA 2AU0A 3R3TA 2E1AA 5L39A 4ER8A 2AW0A 2VBXA 4ZJOA 4JI2J 2DIUA 5L38A 2XGPA 4N8OA 2MQQA 4LFBF 2ZD1B 4LRCA 4A8WA 1XNQF 3FSYA 1T3OA 3W5ZA 1WI8A 1TK0A 3TWZA 3HDSA 3IG1A 4LF8J 5AXLA 5D6GA 1VBYA 5IQ6A 3B8HA 3PIOQ 3GJRB 1JLGA 1Y3JA 1TKTB 1HW9A 2DNNA 3AHPA 3VAHA 5HQLA 2Y1JA 1IWGA 2AP6A 2KH9A 3WC2A 3OLBA 1X9MA 4YEAA 2O67A 2YNGB 2ZOGA 1KLMA 2Z2MA 3BKFA 2VPXB 5I4MA 2HFOA 1HBUA 4F25A 5IT9Y 1LKZA 1TUVA 5HN0A 1VR6A 1RTIA 2N82B 3ENQA 4WE1A 2I0XA 4DL2A 1S9EB 4KO0B 3UQSA 1TR0A 5EX0A 3GJQB 1IKXB 1ZM9A 3MR7A 3M6WA 1DTQA 2VPZB 5AT1B 2J9CA 2LU2A 1AZSB 1QAJA 4RO0A 2XSFA 1T9UA 1ROFA 1GFWB 3H98A 5L8RC 5H9FK 3V6KA 4M5DB 1Y5LB 1QVGR 5J1EA 3WIVA 2VFSA 2CADA 5AXKA 4DR2F 3CC7S 3VALA 2GVDA 4CLZA 3TUZC 2OO4A 1CJVB 1HPZB 1HYSB 4I68A 1OSCA 3NG8A 3BM7A 2AJ0A 2CJ9A 2NS1B 1RXOB 3I5CA 4GVLA 5DQHA 3V6HA 1R0AB 1NHVA 4DV2F 4RJVA 3GP9A 4TN2A 5THWA 5BR8F 3O5TB 2M4MA 2R2SA 4LRAA 2V0NA 3BSAA 4URSA 2VPWB 1GNKA 5ETQA 2MPUA 4DS5A 3AXKA 5AE1A 4DR4F 2CKWA 2E5GA 5D3GB 2C2OB 1F6TA 3FRYA 2XSJA 3RB0A 2HK2A 4UZBA 4NLRA 1O5JA 3P6YC 2L9WA 4L3KA 4LR7A 4CT8A 3B54A 3Q8QB 3UD3P 3A4TA 4AL5A 2AEJA 3MWBA 4LIWA 4CLWA 1RBOB 2LDIA 3MI7X 3SCKE 4U67Q 3CCQS 2LKZA 3NGSA 3KK3B 1U1MA 2KO1A 3S01A 5HMZA 3PFOA 3NLCA 3KUHA 2F5GA 2VFTA 3MM5B 1U1RA 3M30A 2AZ1A 3EZOA 2Y3YA 4LR9A 3GYNA 3T6JA 4Q0BA 5L1KA 5B0DA 3BQ0A 3HHKA 3UN3A 1N88A 1U0SA 2AF6A 3HO1A 2CZ9A 4C0BA 2HHTA 2E7WA 5D78A 3LOUA 4IR1A 1LWCB 3HLUA 5F0WA 5J1PA 3CC4S 5B7WA 1BE4A 3L7UA 2FGOA 3MDFA 3HMJG 2BOPA 4GKKJ 2W2NP 3K5MA 2ILZA 2FHMA 3H42A 4F0KA 1VRTA 4KFBB 2KXNB 3OVAA 1QVFR 2UXCF 2P5VA 3GR1A 1SXLA 3ICLA 1IR1A 1OQ6A 2RQKA 3KLIA 2R8GA 3KMQA 1DJ0A 3SFUA 3AAWB 3IR7B 1VJQA 1F3FA 3Q24A 2ZUAA 3H4DA 2YQ1A 2Q43A 2MQOA 3N0VA 2DR8A 5F3TA 1X4HA 2CWKA 1P9QC 1BY9A 3IC1A 4Z2XA 3VAJA 1RYRA 3R5DA 4OIXA 1WF1A 2AJFE 2CQ4A 2W7AA 4P2FA 3R8YA 1FXDA 4RW6B 4DQSA 2YX7A 2JVOA 5HMYA 3K2YA 3VAGA 4OX8A 1KEKA 3PR4A 4U96A 3VCDA 4QWCA 2WONA 2Y1RI 4QR1A 3MURP 5GAGU 3L4BC 1UKUA 2CJXB 2BKOA 2VBZA 3HD1A 4DCOB 3GIMA 2DVIA 3S6EA 2RVJA 3KTQA 1VQNS 1IM4A 1FO1A 3BN4A 3QWUA 3R5AA 2XTJP 3RAMA 3DGVA 1XTZA 1R89A 1KR4A 1VQYA 2OELA 4KPYA 3CCVS 2V8HA 3GB0A 4L76A 1WTBA 1RHUB 3PCOB 4KGMA 4MK9A 3NNCA 4NE9C 3PV8A 1S9FA 5LMUF 4NLYA 3PX0A 4QZVB 4HR2A 4ED2A 1U49A 2E9ZA 1QTMA 3D6TB 2RDDA 3E51A 5MLCV 3X1LB 4DFJA 4LF2A 1NJXA 2DBBA 2YWHA 3CCTA 4TKTA 1TU0B 5K8OA 5LSOA 2IVYA 4ZMMA 1WF2A 4CO1A 4J9OA 2EFOA 3RR8A 5HAOA 3OW2R 1GTHA 4PQAA 1T8EA 1G4CA 1FRIA 4A8SA 1M5SA 4DPWA 3MMBB 1DY3A 1JLGB 3BR8A 3PVXA 2A6OA 3ZNUA 4YUDA 4AFFA 4F4ZA 2J0SD 4J5OA 3IRXA 1GEHA 4IFVB 5LL6d 1KLMB 3HKWA 2HNDA 3I4PA 5BYSA 1NZAA 5CZVA 2ZBIA 3PRVA 2QMXA 2WVFA 1W7WA 4NA2A 3H4BA 1S10A 3I87A 1WACA 4QQBA 5DG8A 4CCHA 3Q23A 1VC0A 1RKIA 4JI0F 2JH3A 4YB6A 4G1PA 2LEPA 5JVGQ 2RRAA 1Q5VA 1WEXA 3PW2A 1VQMS 2CJYB 1VQ7S 1LXJA 2ATCB 2H54B 1YVFA 3MEDA 3KJQB 2LXFA 3FFIB 1VDHA 4PG6A 3QJLA 2F4FA 1WELA 2O01C 3W63A 4I67A 2B6AA 2G1HA 3SSRA 4BC9A 3CJ2A 3AQOA 4XTTA 2WSCC 4RW7B 1U1OA 4LF7F 1A9NB 2ZC3A 2R2TA 4ED8A 2MQNA 2ILYA 4ZS6A 4AYBD 3NWRA 2FUG9 2C3OA 4KKOA 1Y5NB 2GVDB 4TNOA 1VQ4S 2NLWA 1BMQB 3QQCD 2FJWA 3HSGA 1EKSA 1CJVA 1GK8A 1HPZA 3LGNA 4K59A 4X66J 3RB4A 3JB9k 4PG7A 5CZXA 5LMNJ 3M2UB 1R0AA 1KD1T 3D3BJ 3D0GE 4GVBA 3PXGa 1HNZF 3TAMB 3DYAA 1K73T 2VF3A 2IDEA 2ZHBA 1NDCA 2A0FB 2ZITA 2QLWA 3IR5B 2V5HG 4HI2A 4XAKA 4F4XA 3F41A 4A46A 4QWBA 3GV8B 3OUYA 4KJIA 2UUCJ 3KKFA 4DLGA 1SL1A 1TL1B 2VBYA 4JB8B 3JQMA 1YZ7A 1A7GE 4I4BA 4NYOA 1XMBA 3FQLA 1RK8A 3LANA 3HPOA 1TL7A 2E1MC 1FKOB 2FJAB 4K5RA 4RW9A 4CO2A 1FT8A 2DHHA 4XPEA 5CYMB 1JQGA 1YITS 2M88A 3R7SB 2HNYB 4R5PA 3QT5A 2M2BA 1UEVA 2GIRA 5GMDA 2B4OA 2BABA 1LFWA 4OI1A 4TLRA 4S0MA 3QGHA 2EPIA 4ES2A 1TZ0A 3U7JA 1Y5IB 3ULHA 4P2SA 1TK8A 4DX5A 4ED3A 2UVVA 2ZM6J 4ZLLA 2E9RX 3M05A 5I3QA 2HQFA 2K3IA 3QAUA 3HF5A 3EWGA 2Z2YB 4B08A 3D66A 4DV3J 3IS9B 4PWUA 4WIQA 2QN6B 5K14B 4DR5J 4JBCA 1IBMJ 1KRPA 2G2OA 2JC0A 5L1JA 1WHWA 2A10A 4WP3A 2R7VA 3T9ZA 2QLBB 4OI2A 5IWAJ 3BB5A 1DURA 1WHVA 2H5EA 3BGRA 2RS8A 2BACA 3M7VA 1RU1A 4OYWA 4DG1A 1UVNA 3AOAA 3U1MA 4OZ5A 2KRBA 4FYWB 3PM9A 4O4GB 5ITHA 3HXMA 1N36J 2HHSA 4Q8FA 3D0HE 2W9BB 2X1FA 3L95X 3G6YA 3TZXA 2R7QA 3N79A 1URRA 4UOCA 5HJXA 1JJ4A 2DGUA 1U09A 4NI2B 5AJ3J 2KJVA 2HWTA 3HD2A 4CO4A 2KT3A 4GO7X 1YG0A 4B17A 5DO2A 1S48A 3J80Y 3DDKA 3CPWR 4F3OA 1XEZA 2KT2A 4WFYA 4OHWA 4C8NA 1L3VA 3P96A 4GKJF 4IOAQ 3FCWA 2W8LA 1RAOA 1NBEB 3HHLB 3POTA 5LSRA 3H8YA 2MGZB 3KLGA 3HVRA 1HBNA 5E7OB 3AJ2A 3MCOA 2DD8S 3FNNA 1LFPA 2FLNA 2ZZTA 3AD9C 2CQCA 3CDWA 3IO1A 3D1HA 4CYUA 4DFKA 3V81B 2C2KB 4MAKA 1HNVA 4DSIA 2WVEA 8ATCB 2EK6A 3D6MB 4R0JA 2P9GA 2UUTA 1E6VA 2NXNA 2E9TA 2DHXA 2PMHA 4OYIA 3LQVA 4DPXA 3J80U 3J81Y 4OZNA 2YWWA 3QSYB 1G2EA 1RT1A 2FY8A 2ZD1A 4IG3B 1TKXA 3UN5A 3A13A 1WSRA 5KT7A 1RAJA 4O3NA 4UY8T 3RBXA 2FC9A 4PYAA 4TQRA 2KJWA 2JSXA 4HACB 4GC6A 2GMJA 1SL2A 2OTLS 2DR6A 2V8VA 4KRWA 1YJ9S 3DRSB 1N5YA 4DR6F 4TU9A 1CQNA 1X4CA 1N5VA 4EWTA 1TAUA 3R6GB 4F4YA 4ZJLA 3C8YA 4PUOA 4ILRA 2QJ3A 5IFMA 2GVZB 3OXGA 3AT1B 4P9SA 1YSJA 5F41A 4C0HA 2MJUA 4ED7A 3R1HA 1WD6A 5KOWA 1HBUB 3M6UA 1HWLA 1RZMA 2QV6A 4LJMA 1RABB 4CQ1A 2H5IB 1FKPB 1F2HA 2EK1A 1MMLA 2H5JB 1TQLA 2CJBA 2QZ8A 1S9EA 1RT6A 2RNEA 3EDQB 3LP1B 4DSLA 4U7UD 3RRGA 1S1XB 1WC4A 2AWZA 2MZRA 4J9KA 2E7VA 2HBYB 3SI8A 1ZPVA 2CDRB 2F8MA 1M1KT 2F4VJ 5DRKA 1VMBA 1MWZA 2EEYA 3PW7A 2VQFJ 2ZDPA 1SIWB 3OL7A 4M5DA 4YB5A 4E8UA 4NA1A 4KTQA 4C8ZA 2V2QA 1YRUA 4DV0F 1CJKA 3EE3A 2HAIA 5IV3A 5DDRC 3JSYA 1MSWD 5D4PA 4ATNA 4LIRA 3ZNJ1 3I0RB 2IRUA 1LW0A 1H72C 4MT1A 4PCQA 1WKJA 3GFHA 3DDNA 3C15B 3HSDA 1V5IB 3TUJC 2B9YA 4X2BA 2ZH3A 1FFWB 1YJVA 3TOQA 1JLAB 5DDOC 4X4PA 3W62A 2XY5A 3QZ8A 5D4OA 1DRZA 4FP9A 3E2EA 2BZ2A 3CB4A 2PMZD 2DGXA 1F60B 3OFGA 3TEGA 1ZTWA 1WDDA 2KG1A 2DR9A 2RMLA 2ZBCA 4UUXA 1Q8KA 1RWKB 3RR7A 2GA7A 2AEMA 2IC3A 2WBMA 5C24A 1HNXJ 1LV5A 3KOAA 5F8GA 2DHAA 1TL7B 1R0CB 5CHCB 4DF8A 1UWBB 2CNNB 4RNMA 1VLYA 5CYMA 3K57A 3G71S 1RA6A 5KFSA 3ZTQA 1FKAF 2HZCA 2JRSA 2YNFB 4MYTA 4WK1A 1RE1B 4TYBA 5IS2A 5I3PA 4K4XA 3R2DJ 2KI2A 3G87A 1XBWA 3D67A 1IKWA 2FHOB 3MM5A 1YK9A 4OI3A 1CG2A 4AD6A 4KB7A 1HR0F 1N0VC 2M8HA 2OPRA 1PAUB 4M5MA 2UXDJ 2PE8A 5E3QA 4CLLA 1HMVA 3EGZA 2DNPA 1P9YA 4ZA1A 1S5ZA 2UV8A 2J0WA 2W01A 3C14A 4KGZB 4Y6IA 4C8KA 4OL8A 2HW3A 1F2GA 4MJKA 5IOLA 3SZ2A 3H5YA 1RAFB 4NLVA 4P7VA 3BDEA 1EP4B 4DV6F 4TY9A 3NMAA 2PEHA 2PD1A 4RBTA 2AD9A 1D3WA 4O3OA 2MKCA 2VG7A 3DOMA 4FPIA 2UP1A 2J7WA 2HS0A 3GONA 1VQ9S 4DV5J 3LP0A 3A8EA 1AFJA 2C2EA 3RAQA 2QFJA 2QLFB 1WUUA 2VG5A 5KFEA 1ZOTA 5KFCA 4IR9A 3MTKA 2CQIA 3K5PA 1K9MT 1Q53A 4J9UE 2AX0A 2C2DA 1NB2A 5K8MA 4ZP9A 1YX2A 4UOFA 4N41A 1Z2ZA 4O3QA 3OPKA 4FXVA 2BJ9A 1SBRA 1TV6B 1E6YB 1MN7A 2WONB 2Y1LB 4KBIA 1VK8A 1H7WA 3OD2A 4P10A 3W60A 4ZDNA 1F9EB 2IM3A 3T9NA 2MLXA 5F8MA 3TR5A 3J81j 2XWXA 3GYGA 4DPUA 3Q8SB 5J2QA 3HHLA 3POTB 3ZZ0A 2MGZA 1U6FA 3CMAS 3TX8A 3T1YF 3M8PB 2BV3A 3OFEA 2LXUA 4ZPAA 5ETMA 2UXDF 4IQXA 1NSPA 4CYUB 1NK0A 2VZ9A 5CYJA 3NGDA 4BCAA 1EHWA 5C5JA 2RDJA 1U26A 3CSKA 3DOKB 3LW5C 3R5BA 4IUFA 2XY7A 1HWIA 2P9CA 5BR8J 4ANEA 1RU2A 2ZJPQ 4M5JA 4CO3A 4DMZA 2GJ2A 4DV7J 4X65F 5T7LB 3CCWA 3MMAA 2AGOA 2CPXA 1WHXA 5HI7A 5LMNF 3DMJA 1WTFA 3HX9A 5KFBA 4U6PA 3UNYA 5GAHI 4J9MA 2MDAA 4DR2J 2KB2A 5LT5A 2EFQA 3BS9A 5G4DA 2ZHAA 1N5YB 4U7CA 1RT7B 3ADAC 1SC4B 3BKUA 3FDSA 5E5NA 5C7PA 3MUMP 5DGAA 2VOPA 1NK5A 2QYGA 1DTTB 2XLKA 3V5RA 2VKZG 3IRXB 4XPCA 4ZVGA 5BYRA 3DNCA 2XCPA 1N36F 4ED1A 3FEXB 1SC3B 1X7VA 2E66A 3FQKA 1S1UB 1FKPA 2J7KA 1S99A 2GHPA 1D9AA 1REVA 4O4RA 3M2VA 2YH0A 5F8IA 3CD7A 2J5AA 5K8PA 4O44B 2R7SA 4OX7A 2PA8D 4WU3A 3B78A 4LRBA 4LUBA 4EZ6A 6FD1A 4I6WA 4LSZB 2NSCA 3MEDB 2W9CB 3RAXA 2JHEA 2UUAJ 1IR2A 3OL9A 4QYZK 2W2MP 2RQCA 5E41A 2BRLA 1CVJA 1FTRA 3HVWA 5CXTA 4K4VA 3TARA 1SPBP 2B5JB 3THTA 5RUBA 4NL5A 1KKHA 2V2KA 5DQGA 4WBFA 3MUTP 2KZMA 2XS5A 3UCGA 2AYMA 4B3SF 3CEDA 3CNQP 5FDLA 3DHWC 5HK4A 1RDRA 2YTCA 4X64J 1KQSR 5CCMA 1AYEA 4ZVRB 1SH2A 3SSQA 3I0RA 4NZ6A 1RWXB 4WJBA 2ZOMA 3FKBA 2WVBA 3M2UA 4JI2F 5KT4A 4DL0C 2W9AA 2GZOA 3C15A 4FBUA 3OVBA 2ZUGA 4WZQA 1AFIA 1X4AA 3A8KA 3TAMA 2HFSA 4DLEA 1T03A 1HI1A 3OTBA 4X65J 4F8RA 2FC8A 3KNGA 3NAIA 2FD2A 3J7AN 2OGUA 4DEZA 2VASA 2ABYA 3AFGA 1NDLA 2BW7A 2P6SA 3TZWA 4ZLNA 2LECA 2KYXA 4DOZA 2IC3B 2YX1A 2W4CA 4L6V3 5C24B 3GQCA 2EG1A 5IT9U 3Q8RB 2KTQA 4WFXA 4J9LA 3HI9A 1I3OB 4ZP6A 2XULA 5H1SV 3GIRA 3C3LA 3KNAA 1VISA 4RL1A 1S72S 2XM3A 2ROPA 1PG5B 4W4MA 4HYKA 5KFRA 5DZ7A 1HQEA 1WORA 2V4JB 1BLUA 4MMOA 4YS2A 2C42A 3CJTA 3WHIA 1HNIA 2XO7A 2HLTA 2U1AA 3HVAA 2ALZA 2OPRB 3R7NB 4WFAQ 1S49A 2XQCA 1OO0B 4TQSA 5HATA 3JSMA 3MM6B 4JYAJ 3JYTA 1BD6A 2HRTA 1J27A 2JDJA 1RHJB 2MY8A 4XDDA 4Q44A 1GX5A 2XMKA 4IRDA 3IM8A 4ECQA 2DNKA 2KHDA 3I96A 4CLSA 1LWFA 4ALZA 3MPUB 4ELTA 2EFPA 3MM7B 1JLFA 2BJDA 4JI1F 5KFVA 1MROA 3SXLA 2Z0GA 2YNIA 3DOMB 3J7Z5 2JJ4D 1K44A 1UMJA 2H3EB 3P5BP 4KV8B 1U2FA 3MR3A 3CJ5A 2WTFA 1I94F 4LFCJ 2MKSA 4ES3A 4RU2A 1RQ0A 2RHQB 3D54A 3JTOA 3MCNA 3UDCA 2VB6A 3PX4A 3NCPA 3DM2B 5F8NA 2I1RA 2IMWP 2Y0BB 4MKAA 5L9XA 2WB1D 1TMJA 1T02A 2GNKA 2XMWA 3BYPA 2HGMA 3QAEA 1JKHA 2VA2A 2ACMA 2DH8A 3G82B 3SDEA 1J5EF 3L09A 3U1NA 1F3VA 3GV5B 3UD5A 3TEHB 3IGVA 4UW2A 1YJTA 1JLCB 1MWYA 2DO4A 3E3XA 2AV5A 3HHLC 5C42B 4FF1A 2R4FA 2KYZA 3C6UB 3LF0A 3ZZOA 3MAAA 3DLKB 2YQ0A 1FEHA 2N3LA 5CA5A 5KFQA 3ZO7A 3ETOA 4W92B 4JI7J 1Q79A 4B3OB 3EVMA 2PN6A 1F5CA 2QX0A 2MYFA 2G13A 2FZGB 4QOTA 1FHTA 3T5KA 2XS2A 4ZPBA 1B0VA 2FIUA 2JZ5A 2YWKA 1K1QA 3OR1A 4LFAJ 4R8UB 3OHAA 1XMQF 3NEKA 1S0VA 4DU7A 2I9SA 4QR0A 2EC0A 4B9SA 3HFZB 3DOKA 1LW2A 4MKVA 2ROGA 1V5VA 4QYZJ 1KVJA 1PGZA 2HHHJ 3TA2A 3T1HF 1IKVB 1Q7LB 2C1EB 2W8KA 2HK3A 4NEYA 1TFYA 1XR5A 2R2RA 1B64A 1EB0A 2YPYA 3MMAB 1PSDA 5T7LA 2OD6A 4MFBB 3GIKA 1FRLA 4JOUA 4A4JA 1VI7A 1RT1B 4BS2A 3QGPA 2B7BB 1H7XA 4OV1A 4ZVSB 5KFWA 3BN7A 3IR6B 1H74A 3UVJB 4TU8A 2YH1A 2COLA 3CT9A 3RBZA 2Q3PA 4HACA 4FDFA 1APSA 3ZZRA 5IXUA 2BDPA 3W64A 4CDIA 3QJJA 4M5IA 1ZZFA 1HKAA 1RWVB 1FF2A 3R2CJ 1FCAA 4LF7J 4DPYA 2BUNA 2XMVA 4B9NA 4PUOB 1ZYQA 2LEAA 3DU6A 4NXMF 1N48A 4NRUA 2XB2D 3H90A 1NSQA 2CQPA 4CLUA 2VFVA 3SQGA 5GAEI 3IWNC 2HIQA 1SC1B 1FWKA 1C4CA 2MZ1A 2M3DA 2KXFA 1B0TA 4XO0A 2EXUA 2VOOA 4CH1A 1WKLA 5ETTA 2RAQA 4O44A 4RNOA 3DRPA 1RWWB 3VVTA 1Z2LA 3MM8B 5K9FA 2ZNZA 2CRLA 3GCXP 3KFWX 5M2RA 2W9CA 3NNHA 1FESA 1S0MA 1I51B 2ZWOA 3O3LA 2OP5A 2YY3A 1JNZB 1DLOA 2ZC4A 3W61A 5KFJA 1QAYA 2BBEA 4B3TF 1PYOB 1U8WA 4O3RA 1T9TA 3HHNB 2MQ8A 3NWGA 2J8SA 3CW2C 5IT0A 2V4RA 4CNZA 4JI5F 1F9FA 1N34F 3QRRA 5J2MA 2F7VA 1SVDA 4Y2AA 5FDLB 5B0FA 2IPOB 4RR5A 3KWMA 3RZAA 1L3UA 4LF6F 1X4DA 1UP1A 1ZTTA 3MEGB 2Z4PA 5IT4A 5EN1A 3VV2B 4DL4A 1PJ6A 1LNQA 1F1BB 1WHYA 3N01A 3O2IA 3PIPQ 2HAFA 2ZH2A 1S7IA 1RA7A 2FVSA 2BM1A 4AXIA 1GMWD 2CFXA 3MOZA 4X4SA 4USVA 4USHA 1X60A 2YKOA 2VG6A 1VK3A 3HJFA 1CJTB 3LA0A 3BKTA 4RLEA 1JLBB 5DM6Q 4DQPA 4RW8A 2IRXA 2DISA 1X5TA 2RSQA 3NAHA 4HHUA 3KHGA 4V19X 4K4UA 4DDFA 2JC1A 2FHJA 4QIEA 4LF5J 1UVJA 2XWYA 4PAAA 4DL6A 5KT6A 1YI2S 1B3TA 2YKMB 2EVZA 3GFZA 1XR7A 2D1CA 4I64A 4Y3CA 2OJ3A 1TKZA 4Y34A 3ISND 1HQEB 4FNIA 3BQ1A 3GU0A 4LF1A 4NLWA 2N4DA 2VUGA 4K4ZA 3QRPA 3P5TL 3TRGA 4B9LA 1IKWB 2JVRA 2MZTA 4U9RA 5A8KA 2V34A 3BSNA 2C3MA 2WOMB 3KLVA 5HQ8A 1NKEA 1B4SA 2K7JA 1NSKL 1T95A 4CLYA 3FSIA 1BC6A 2YKPA 3SCJE 2EBGA 3C14B 3VQTA 4LVNP 2MKKA 2XLIA 3OXFA 4NZ0A 4DSFA 3LAKA 1FWLA 4LSNA 2C3YA 4C3LA 3AA9A 4EO8A 3DXSX 2C2NA 1VRUB 3EMTA 3HHEA 3RW6A 2X7IA 5D8HB 1IQTA 1S1VB 5IWAF 1J5EJ 4GRSA 5ADZA 4ZITA 3K5LA 2V69A 4KV8A 1S4FA 3Q22A 3VTIA 3TVKA 5EWEA 3CC2S 1K0TA 2IAJA 2QE5A 4DUZJ 1ZETA 1BWVA 4OLPA 1HNWF 2HRYA 3FBBA 1SJQA 1S6OA 4FYVB 3Q2SC 5BJRA 4DQQA 1M5PC 1N32F 4PG8A 2OD4A 3DN9A 4HEA9 1L3SA 1I94J 2EC2A 4ZVFA 1X0FA 2XYHB 3E01A 3IBWA 4HTJA 1ULRA 4OV6A 3TVZA 1S12A 1KTVA 1YJ7A 4HH0A 2MB0B 4IO1A 1RCOB 1R8BA 2CQ0A 4ZN3A 3SV3A 2VD3A 2A2DA 2K1RB 1JLCA 1RACB 2POKA 5KTQA 1X5PA 4Y0FA 5C2CA 4K4TA 2IVFB 1EIYB 3BR9A 3DLKA 2C2RA 1VQOS 4B3OA 1TV6A 1E6YA 1XNQJ 3UW1A 4G65A 3UCUP 2CPHA 4B3MJ 1M1GA 4JYAF 4NRTA 2HVDA 2HQCA 4X4RA 4IDKB 2OPPB 4RBUA 3IWLA 4BHQA 3TI0A 5J2QB 3TJAA 4TU7A 1MU2B 1ZAXA 2LQ9A 4EMDA 2UU9J 2GW8A 1NK9A 3KJVA 2JOQA 4Q2MA 4A47A 4HHJA 3ZTRA 1RHMB 2GS8A 5HLFB 1VQLS 4QWAA 1V3SA 2UUBF 3OTEA 1IKVA 1ZS6A 1TVRB 3DXBA 5GMEA 5IZHA 3KJNB 2I38A 1DZ5A 2ZE2B 4PQUA 1Z1ZA 2G2ZA 3BBCA 3ISNC 3KK2B 4ELUA 1NB7A 5D77A 2QTWA 1VIOA 2XI2A 5FJ4A 5HVHA 5GADU 2CQGA 2QSFA 2ZKTA 4ICLB 1UA0A 2WVDA 4M8LA 4OJGA 1S1WA 2MQLA 4B3SJ 3GTYX 4URQU 1RT7A 2Q6BA 4ITSA 1HBMB 2B4UA 4MTPA 1FE0A 4ZCIA 5I3UB 2APOA 3LPEA 3ITHA 4K7QA 1NM2A 2HBRB 4EI2A 1GXUA 3UPFA 5DQIA 3J81U 3UCZP 4LQ3A 1W2IA 3I5BA 1KQKA 4B9UA 2M5YA 5LXYA 4DR7F 3U27A 2D69A 3QT7A 3EICA 2QL5B 2M9KA 3QGIA 2JX2A 2H1YA 2LQ8A 2QC3A 5HQMA 4J9QA 4M5KA 2RJZA 5KT3A 2XEXA 4K0KJ 3V6JA 1NKCA 1KVIA 3R1LA 3LALA 4KH0B 1FJGJ 2C2ZB 2HG4A 1FA0A 4PPZA 2I5JA 4DQIA 1WF0A 2CNLB 5DG7A 3AJDA 1DQAA 3SIPB 5DLGA 1FE4A 2B5JA 2W2PP 3LGMA 4M5LA 5I42B 2BE2A 1FJGF 5LOQA 2BJ3A 4KFBA 4WXWA 4ZVEA 2GO9A 3DRYA 2AIRB 3NP5A 3MEGA 2FGCA 4OJHA 4LBPA 2W2OP 3KLIB 2DNHA 3NCRA 4OYPA 4USIA 4ZIVA 1S0OA 5CCLA 1WOOA 4ZKAA 2IBOA 3HFKA 1SQGA 3ISZA 3QATA 1YGYA 1SJ3P 4F2RA 1N33F 1DFDA 2GMLA 1SJFA 4W90B 4P2MA 1AT1B 5ETNA 1Y10A 3HSZA 3D3CJ 3G8TA 2M7SA 2CPFA 1CJTA 4I2QB 5H9FJ 4C97A 2DR7A 1XNRJ 3TQEA 1YJNS 4C9DA 4RW8B 4PRFA 5GMKa 2XI3A 5E3AA 4KHRA 4ECYA 1JJ2R 1D8YA 1OWXA 1TL5A 4JI6J 4Z37A 4ILLA 4HT7A 1NJIT 1QLNA 2MKHA 3C16A 4NLDA 5AXNA 1Y0HA 1SV5A 1O6XA 1M5VC 4CH7A 1RB0A 2C3UA 4CTAB 4TY8A 4DWIA 4NLTA 2FVQA 1XC9A 2UUBJ 4DSJA 1ZPWX 2L3MA 3C2PA 2V4JA 1UTAA 1TL4A 3M6XA 4USWA 2VJUA 4YY3F 1VQPS 4FF4A 3SQOP 1T7PA 3TNVA 4UOHA 1TTHB 1DQ9A 1XNRF 1KFDA 3V6DA 1R8PA 2JEIA 4X4QA 1FFSB 3MF5A 3OFHA 1HQ2A 2E5JA 4IH5A 3ZZPA 3GJSB 1WEZA 5DZ6A 1YJUA 1FRMA 1S6QB 2YKNB 4DV1F 3IAS9 4KC5A 3BV8A 4F26A 1NK4A 1HD0A 5KFMA 1KDNA 2DHGA 3LWLA 1NDKA 3OSNA 1EZZB 1EAYC 2ZH1A 1BHNA 4RUCA 2VONA 2JLFA 2YNIB 2HVHA 1TKDA 1IBKJ 3L7PA 5DLFA 1TKTA 1R6YA 4P71A 3K0JA 3JSBA 3AD8C 3FEYB 1SUQA 3W2WB 5HP1A 1LEOA 2JLEA 3CJSA 5D4NA 3M1VB 4LMZA 1Q86T 2LXIA 1QUPA 4DPTA 4O3SA 3LPYA 2FJBB 2XG8A 4WFZA 1NJWA 4JI1J 2EFGA 3SFGA 3AD7C 2HHXA 3MR2A 2OMOA 4DV6J 4NMXA 4X4VA 1IKXA 2NPIA 4KQZA 2J6UA 1DTQB 1RTJB 4RUHA 2DY1A 4NX9A 5KG3A 5C42A 5EDWA 3HJVA 4AT1B 2CXEA 3M8RA 1R8AA 4QU6A 3MEKA 5KG7A 4L3NA 1EJ7L 3MAHA 1FWPA 4FKXA
chains in the Genus database with same CATH topology
3OR1B 1O51A 4YDDB 3PO5A 1DAXA 1GTEA 5JUMA 1FDAA 1N5QA 4Y2MA 2NSBA 4X4TA 3OR2B 4I56A 2FY1A 2DNOA 1LW2B 5A6PA 3PW4A 5HBMB 3EPIA 4UY85 3DYAB 5EWFA 4NWBA 1ELOA 2DCLA 4PQUB 1S79A 1C1CB 2L08A 5KFIA 3H2LA 2DNQA 1G6BA 2BM0A 3RRKA 5KOXA 2MKIA 4MFBA 1Q82T 2DGOA 2MSTA 4OQJA 3GG1A 5AE3A 5D3GA 4IRCA 4LFAF 2XSJB 1FJ7A 1FDNA 1TL1A 1RT2B 2ZZMA 4BDPA 2R8KA 4A8XA 4WFNQ 4KR0B 4JI6F 2R7RA 2F1FA 2OSRA 1K8AT 3OL6A 5I3UA 2I2YA 2WK4A 1GX6A 4ZK7M 2BVZA 1T3NA 2RU9A 2A2CA 4DF8A 2J9EA 1VS3A 2HLUA 4EBCA 2CPIA 2D3UA 2LEBA 4J9SA 1FERA 1N56A 2FDNA 2WSEC 3M2RA 3UI3A 4LT6A 1LK5A 2LQ5A 5KFUA 3RTVA 3BQ2A 4ED6A 3HVTB 1FXLA 4CO5A 4X62F 5CD4H 2P9EA 3IFEA 2BR0A 2RIJA 1U6BA 2KG0A 1EETB 3QLHA 2UUAF 1CC7A 3O8WA 1SJ4P 2DNYA 3KLEA 2GFFA 2RF2A 4OHYA 1MNEA 4WIIA 3VAMA 4CI0B 1HD1A 2LDYA 2R7XA 5HROB 2V9KA 2B3TB 3F56A 2OPQA 3NKYA 1RKJA 2GIQA 2FLPA 4I2QA 1SKRA 3HZEA 3DI6B 3CD0A 4HL9A 1C1BA 2ZVSA 2XNQA 2B43A 4AL7A 2DH9A 3LWMA 3ZZZA 4H4KC 3CDEA 2LQJA 2AJ1A 1SV5B 3CO9A 5KFFA 1KQGB 4WU2A 2CQ3A 2NREA 2D7SA 4N76A 4NCBA 3UFCX 1HW8A 2IMOA 4PXBA 2OAUA 3EPGA 4ED5A 3BF4A 1TKZB 1RWUA 3I9ZA 1D0EA 4MK7A 3DU5A 3FSXA 1PC5A 1GQEA 1Q78A 2NUHA 2JL9A 7FD1A 3DCAA 3MECB 3TUIC 3V4MA 1E6VB 4KE5A 2E5LF 3CIZA 3D28A 1D8ZA 1HHTP 2CQHA 3FMWA 7FDRA 3I32A 2R2UA 1TKXB 2VC1A 1VFJA 1ZH5A 1VRUA 1KFSA 2CPYA 1P1TA 4ECVA 2DNZA 2FLOA 4LF9F 4TLQA 3P49B 1GXTA 1DBDA 2HVZA 2KM8C 4QIFA 3IGNA 4DSEA 4A8OA 3KLHA 2EW9A 3W2WA 2GQCA 5HP1B 3LP2A 1V6HA 1WEYA 1XN9A 5C25A 2EKYA 1H6KX 1RTHA 1S7HA 1IBMF 3OJSA 4ZCLA 1FJCA 3FMBA 2ROEA 2Q6CA 1RT5A 1IR0A 1RTJA 1U8SA 2DGTA 4NCAA 4C8LA 1TL3A 4MYUA 3FFIA 5GAHU 3TVYA 2LA4A 5A8WB 4ECSA 2XZWA 2PDAA 1WG4A 5KFZA 2B6AB 3SYZA 2MZSA 2VFRA 2AJ4A 4M63A 3DOLA 4RW7A 5K5MA 2ZHOA 5GAEU 3OR2A 3DRRB 3QYYA 1FNMA 1ZM3A 1T05B 2ADBA 1R8HA 2CVEA 2DNLA 3OTCA 4BWMA 2G0CA 2FJXA 5LJ3Y 1K1SA 1TVRA 1M5KC 2KHCA 2LQBA 3K8VA 2ZE2A 4OX6A 1JNRB 1GXLA 2ZKUA 4H4KA 4RW4B 5KFXA 3T3FA 3W3SA 3MOJB 1NK7A 2F3JA 2HNZB 3M32B 3OUYB 3V4IA 2UUCF 2RB7A 1N8RT 3QIPB 3HT3A 2X1GA 3KG4A 4ICLA 5KFTA 4HDHA 1JLEB 1BQNA 1S1WB 1LXNA 2G4BA 1FRXA 1HBMA 1WG5A 3LAMA 4RW9B 4AE5A 2ZFHA 2BANB 4ETXA 1JXEA 1NHUA 1X5SA 4JI3F 1O0PA 2HNYA 1U1NA 3EZUA 4HT5A 2J7UA 1FTCA 4KT0C 1JX4A 2DGSA 1R43A 3OQ2A 3RB6A 3RRHA 1M0SA 4B9TA 3E8OA 1S77D 1W25A 3MD3A 2F40A 4ZHRB 3M6VA 2HFNA 4MIBA 3MAQA 3RBEA 1D1UA 1EETA 4GMKA 5A0YB 1LK7A 2HHUA 1X9WA 2J76E 2RF2B 3D1OA 5BYQA 1H3DA 3QIDA 4FS2A 1IBKF 2QEXS 4DFPA 3K7RA 3NS5A 3MMCB 3RYLA 2D3OR 4D3HA 2PIIA 3L3CA 1YRXA 3LP0B 4ECWA 2GQQA 4K4YA 1JMTA 4NCGB 3QPIA 3W7BA 1C0UB 4YDXA 3MFIA 5B0GA 2E1RA 3IA0A 1PO6A 1FRJA 1AROP 5L1IA 2XCAA 3W2VA 2Q79A 2GHWA 3F44A 2QIFA 3MEEB 2GMHA 3M9OB 2QA4G 4ECXA 2BQ3A 4QIWD 4I2PA 3HM9A 4IFYB 4ZPCA 3H25A 5GVQA 1F0XA 2D9PA 3PFEA 2R7UA 2KT5A 4Q2LA 2G1DA 4N5SA 2HMIB 3M9MB 5F8JA 3L7OA 2QA4S 3CVKA 2DPIA 1KHVA 1KC8T 5B0BA 4QWEA 2R7WA 4G3IA 1UVIA 1SQEA 2CQ2A 4TYAA 1IBLF 3AB4B 2YWEA 3OV7A 3V6DB 5J2NA 2M70A 5L1LA 3DFEA 1FVQA 3BO3A 5G0RB 2K7KA 1UFLA 4N8NA 4E0DA 2WBRA 4Y2CA 4PXDA 4OX9F 3MXHP 5LXRA 2HHVA 2PT0A 2B56A 2FLLA 3N6LA 4BBYA 2OKQA 2HGNA 3CJ3A 2LCWA 4LQ9A 3UD4P 1N6QA 2GJIA 5HMXA 3KHRA 3M8QB 4RWWA 1ZBTA 3SCLE 3BJYA 4NZ7A 1HBOB 4F02A 3HHDA 4OZ1A 1WWHA 2ERRA 1J2VA 4C8YA 2N7YA 5CYQA 1Q8BA 3N28A 3J7YI 4PWDB 2CQ1A 4WE1B 4OZJA 4KO0A 3M2VB 2VL1A 1TP7A 2P6TA 5M2UA 2F9JA 1RT6B 2OSQA 4QPTA 3DHXA 1X4EA 1NU4A 1LWEA 5GADI 2XLJA 3GILA 2A18A 3CCSS 1U1LA 1VQKS 2YQ3A 4Q45A 1NH7A 4AQYF 1U1KA 3BGUA 1Q1KA 3EYZA 2WAQD 3DOLB 4I0WA 5J1EB 2JFKA 3PACA 3PRBA 2I8EA 4PPDA 3DLJA 2HWIA 3JAMY 3DRRA 3KG1A 1T05A 3J7ZT 3PJXA 1XERA 5IQQA 1LW0B 5HBMA 2K3KA 3Q8PB 1AW0A 2RD5C 1C1CA 4WKRA 3MUVP 2FTRA 1JLAA 1FNOA 1X0PA 2W4DA 3ENVA 4PG4A 2UV8G 1A6LA 3G8QA 5JVHQ 5J1NA 3UDLA 2OIHA 4N47A 3SV4A 4WYWA 5A8RB 4Y28C 4ID5B 2HS4A 1N5SA 3T1AA 1RYSA 3CCZA 3PKYA 1U24A 3GE9A 3C46A 4OHZA 2DH7A 1BQMA 2OFHX 4X4NA 1CEZA 4PG5A 2YNFA 2Q66A 1YQHA 4WZMA 3I55S 3JSMB 3GMGA 2W4PA 3PR5B 4X64F 1UJ5A 3O1LA 4ZHRA 4DS4A 4MK8A 2CJQA 5DGBA 5A0YA 1FEEA 1LWFB 1P6TA 3T6BA 4DF4A 1JLFB 2ZJQQ 2ASJA 3TAPA 3EGNA 2B7CB 2FVCA 2DPJA 2IYGA 4DUZF 3IN5A 1IQTA 1PILA 2ZH8A 4DR5F 2JLGA 3VR1A 3R27A 3MMCA 4DV3F 2OTJS 3M4XA 2CZ4A 4NMLA 4QCLA 1RT4B 4ZCKA 2ZM6F 3KHHA 2R7OA 5B0EA 3G86A 3G4SS 3QGGA 3NNHA 5LJ5Y 3CJKA 1C1BB 4IKAA 3LO3A 3TO8A 1SL0A 4WXOA 3KLFA 3I5AA 5IM0A 1N5TA 4CO0A 3C6UA 2RH3A 1PC4A 5M2PA 2PGCA 1I1GA 1QE1A 4ES1A 1S1TB 2X1AA 2ZZNA 1YBAA 1DQ8A 5U47A 2VC0A 1VBZA 2ZH9A 3WBZA 3VAIA 1HNXF 3N6NA 3GIIA 3NNAA 3FZBA 3WZ0A 3OLAA 2XNRA 3EXYA 2R9LA 4LF5F 1QAXA 4OI0A 3QMQA 4P7TA 2FVPA 2PSZA 2B9WA 5J2NB 3PRDA 5F8HA 2HQIA 5EGYA 2L48A 3G6VA 1FXRA 2MXYA 5EX3A 3CCRS 2O66A 3K8WA 3EXCX 2IBKA 3DMJB 4YFUA 1W2BR 3I6PA 1NH8A 1L3KA 2J8AA 3IG1B 3DLGB 3CDUA 3KMSA 3B4DA 3CTRA 4X4UA