2DIVA

Solution structure of the rrm domain of trna selenocysteine associated protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RRM domain of TRNA selenocysteine associated protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords TRNA selenocysteine associated protein
total genus 10
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2divA01
3HI9A 3BO4A 2CPIA 2J76E 2LMIA 5GVQA 3G6ES 5LJ5Y 2DNPA 2VOOA 1VBZA 1URNA 5HO4A 3PIOQ 1U1PA 1Q81T 1KQSR 2YTCA 4ZKAA 2GHPA 5BJRA 1F9FA 2BZ2A 1WHWA 2N7CA 2LEAA 1ZH5A 1VQ9S 2CQGA 3UCUP 1YJ9S 3NNCA 5JVGQ 4P6QA 2RS2A 2MQLA 1R8HA 1SJQA 1WHYA 2MZSA 2QFJA 2HZCA 4ED5A 1JJ2R 1X5TA 5HL7Q 3SXLA 2I38A 1SJRA 1CVJA 2DH7A 1A7GE 2ERRA 1KOOA 2LQ5A 2KFYA 3NMRA 2YH1A 3CMAS 3VAHA 3G96A 2DGQA 2E5JA 1X4AA 3FEYB 3BEGB 3L3CA 1X5OA 3US5A 1VQ7S 3P49B 2OSRA 3UCZP 4UY8T 1IQTA 4YB1P 1S79A 3PIPQ 5H1SV 2FY1A 1FJ7A 4WFNQ 2M2BA 1AUDA 1FT8A 2RRBA 2X1GA 4LJMA 2MJNA 2KM8C 1N54B 1OPIA 2DGTA 3CUNA 1HL6A 2KT5A 2YH0A 2RS8A 2MGZB 2CQHA 2D9OA 2N3OA 2KG1A 2O3DA 3J7ZT 2DHAA 1PO6A 4QU6A 1ZZFA 3NS6A 1UAWA 1HA1A 1SJFA 2SXLA 2XNQA 4WIIA 3G8TA 2E44A 3NS5A 5LSOA 3B4MA 4QQBA 2ZJQQ 3VAIA 4M5DB 2F9JA 5CYJA 4ERDA 2DGWA 4YUDA 2HVZA 2KN4A 2MSSA 4RU2A 1M5VC 3NNAA 2FC8A 1VBYA 1X5SA 2DGUA 2MMYA 1WF0A 1KC8T 2MQPA 2CPDA 2MYFA 5GAEU 1YTYA 3CCSS 2MKJA 2DGOA 1U1NA 3CCLS 2V94A 1H2VZ 2K3KA 4PKDB 3RW6A 2M8DB 1YHQS 1D9AA 2X1BA 2G4BA 4OZ0A 3MI7X 2LEBA 1FJEB 2KXNB 1N52B 2FPHX 2CPYA 2J0QD 1M5OC 3CTRA 4TU7A 2OJ3A 1U1MA 2X1AA 1WWHA 2KM8B 1VC6A 1Q82T 2XNRA 5DDQC 3VF0B 2JVRA 1SXLA 1YIJS 1X4DA 3CCUS 2KI2A 3S01A 1WF2A 1NO8A 1YI2S 2QEXS 4LMZA 2CPJA 4CQ1A 3VALA 5CXTA 2OTJS 3MD1A 2DIVA 3G71S 3UCGA 1JJ4A 2HGNA 3CMES 2DH9A 2OSQA 4V19X 2VONA 4PRFA 3NNHA 3CCES 2CQPA 3N9UC 3P5TL 4CH1A 3CXCR 2WBRA 2DNYA 2DNGA 2KHCA 2HGMA 2LXIA 1WI8A 2YKAA 2ADCA 1D8ZA 1K8AT 3FEXB 1P27B 5IM0B 2EK6A 4WF9Q 2JWNA 3MXHP 2GO9A 3IWNC 3H2VE 3UWTA 2L9WA 5MLCV 2MKCA 1K9MT 1DHMA 4FXVA 3U1MA 4A8XA 4OZ1A 1Q7YT 4BS2A 2M7SA 2RUGA 1YJWS 4QU7A 2XS2A 2CQBA 3VAKA 1K73T 2OIHA 1H2TZ 4TLQA 5ITHA 4TU9A 5D78A 2MB0B 5GAGU 3BS9A 2MZRA 4C4WA 2XS7A 1VQ6S 1PGZA 2E5IA 1QVGR 2JVOA 1X5PA 2XB2D 2MKKA 2DGSA 3R1HA 2HYIB 3BO3A 3SMZA 1YJNS 1SJ3P 2DB1A 5DDPC 1XN9A 3VAJA 2CQ3A 1M90T 2YWKA 4F26A 4WKRA 2U1AA 1N88A 2E5HA 5IQQA 2MZJA 4CIOA 1WHVA 1OWXA 1FJCA 2DK2A 2N3LA 3ULHA 2CPFA 2K8GA 3I55S 3EX7B 5JVHQ 3MURP 3CCMS 2HGLA 3S8SA 1NJIT 2DISA 4PR6A 3VAMA 2NZ4A 3UD3P 1JMTA 1JJHA 3LPYA 2AYGA 2L08A 3MD3A 3R1LA 2VODA 1WI6A 2UP1A 2CPXA 1QM9A 2CPEA 2JRSA 4WFAQ 2BOPA 2MY8A 2RQ4A 2Q79A 1DRZA 2CJKA 1ZZNA 3MOJB 2MY7A 3Q2TC 3HHNB 3DLLQ 1L3KA 4FXWA 2DNRA 3H2UB 1X4FA 3P6YC 3P3DA 2CQIA 1RKJA 2AYEA 2I2YA 2LXUA 3CCQS 1FO1A 2X1FA 2LECA 3J7YU 2ADBA 1VQNS 1G2EA 2DHSA 5LJ3Y 4Y00A 5DDOC 1U6FA 2M9KA 3D2WA 2RT3A 2NLWA 2MKIA 1Q86T 2RQCA 1WEZA 2MHNA 4Y0FA 2DNQA 2MJUA 2CQ0A 1WEXA 2DIUA 2F9DA 2M70A 3IRWP 3EGZA 3OW2R 5DM7Q 2KXFA 4W92B 1WG5A 2PE8A 2CQDA 3CULA 2D3OR 2VOPA 2XSFA 2EK1A 3CF5Q 1M5KC 3U1LA 1U1RA 4W90B 2DHGA 2JX2A 2DHXA 1X4CA 2MXYA 2G0CA 2MQNA 4IOAQ 2M88A 2KRRA 1O0PA 2DNLA 2ZJRQ 3RW7A 2KRBA 2MQQA 3BO2A 1VQMS 2MPUA 1A9NB 4J5OA 4WCEQ 5DM6Q 3CC7S 3LQVA 3S7RA 3G8SA 3THTA 2MZQA 2M52A 2KG0A 2DNKA 4EGLA 2DNMA 3EGNA 2A3JA 2MQMA 3MUVP 2LA6A 3TP2A 3K0JA 3MDFA 1VQ5S 2MZTA 5DETA 1HD1A 1DBDA 1FHTA 3G4SS 4IO9Q 1X4HA 1B7FA 5FJ4A 2CQCA 2DNOA 2RVJA 3TYTA 5CA5A 2G1DA 3TO8A 1VBXA 5EN1A 2B0GA 5LXRA 1WHXA 1X4BA 1YITS 1KOHA 1WG1A 5LXYA 1R8PA 3V4MA 2CQ2A 2L41A 1M5PC 3CCJS 2M0GB 3CD6S 1U1KA 5IFMA 3UE2A 1M1KT 1H2UX 4F02A 2OTLS 2QA4S 2KXHA 1X4EA 4YOEA 2FHOB 1VQ8S 1U6BA 2CPZA 2MSTA 1U1LA 4Z2XA 3THPA 4U67Q 4F25A 2AD9A 3SDEB 4UQTA 2RU3A 2DITA 2F3JA 3ZZZA 1VQOS 2DO4A 2KU7A 2U2FA 3I56S 1HD0A 1WTBA 3DXBA 3UD4P 2EVZA 2DNNA 1BY9A 2ZJPQ 1VQKS 1QVFR 1FXLA 1P1TA 4IOCQ 1VC5A 1X4GA 2DH8A 1X0FA 3JB9k 2PEHA 1N8RT 2M8HA 1RK8A 5D77A 1U1OA 1YWXA 2J8AA 3B4DA 3CC4S 4TU8A 2AYMA 1S72S 1VQ4S 5LSLA 2LKZA 2AYBA 1VC0A 5GAHU 3CCRS 2LYVA 4WFBQ 2CQ1A 2LCWA 3ZZYA 2E5GA 1WEYA 1UP1A 2KVIA 2MZ1A 3MUTP 3S6EA 3CCVS 3SDEA 2D9PA 1W2BR 5IM0A 3MUMP 3G9CA 1NU4A 2CQ4A 2CPHA 2DGVA 1VQLS 4LIRA 2M4MA 1OO0B 3R27A 1WF1A 2DO0A 1U1QA 3CC2S 1H6KX 1SJ4P 5DDRC 2N82B 2DGXA 2MKHA 4C0OC 5GMKa 2DNHA 2MGZA 1DZ5A 4QPTA 4C7QA 2KYXA 4IUFA 2RNEA 2MQOA 2XS5A 5GADU 1U2FA 2FC9A 2KH9A 2MKSA 4CH0S 1VQPS 1UW4A 3Q2SC 3CPWR 2J0SD 1OIAA 3VAGA 1WG4A 1WELA 1UFWA 1FNXH 3VAFA 2RRAA 2LA4A 1KD1T 2DNZA
chains in the Genus database with same CATH superfamily
3HI9A 2CPIA 1YK9A 2HAIA 2RD5C 3R9LA 4LF7J 1JLFA 4P72A 4OYWA 2YKQA 4ZVEA 2F8HA 3RBEA 4LRDA 3O2IA 1HQEA 5GMDA 1OQ3A 1XMQJ 4RL1A 4ETZA 2W2MP 1RT4A 2Z58B 3TEHB 2ZH5A 2C2MB 3H59A 3OFGA 4DPWA 1QTMA 1F5BA 3IN5A 2YTCA 5ETTA 1HNIA 2DTJA 3GSIA 4A8OA 1U6ZA 2Q3PA 2WSEC 5KFGA 2NXUA 1KWMA 2XO6A 2BZ2A 4RNNA 4RUCA 1FFGB 3AB2B 4KHMA 3K57A 2AF6A 1IBLF 4QW8A 4K0KF 2UU9F 4C3KA 2Y8YA 2LEAA 2YNHB 3MM8B 1C0TA 3DLJA 3KHRA 1VQ6S 1TL3A 4JI8F 1ZH5A 1YJ9S 3NNCA 4LFBJ 2E9TA 4P2FA 3IBWA 2XWYA 3RR8A 5JVGQ 2GMJA 1C0UA 2HFVA 5I4MA 2E66A 4IG0A 1R8HA 1SJQA 1UMJA 2YVSA 4NLTA 1T3NA 4ED5A 5AE1A 2E9RX 2HPUA 1VIXA 5KFSA 2ZKTA 2R7WA 4O0IA 4RW8B 2NUUG 1K0VA 3FJ2A 4FPIA 2I38A 3QLHB 2HQIA 3R5JB 1SJRA 1UWAA 1ZAXA 5L1IA 2Y1IA 1EAYC 5DQHA 4JI2J 3QNWB 1WACA 3EWGA 1SKRA 3F73A 4WWSA 2DGQA 4ELTA 2CVEA 3A8JA 2XSJA 3CJ2A 1FEHA 1FA0A 1SUQB 3JB9k 1IJEB 4JV2A 4WIQA 1ULRA 2AJFE 3CCWA 3CJ0A 3M8RA 2CADA 2C3OA 2HWTA 4ZPTR 4N5SA 3ETMA 4IR9A 4AUKA 3OL9A 1FDNA 2QRRA 2VASA 1IKYB 3ICLA 4M63A 3W60A 1Q7LB 5F8MA 4JBCA 1L3TA 3PO4A 2LP4A 2R7TA 1X60A 3F56A 4KAIA 3U27A 4EI2A 3QGGA 2J9EA 3R5DA 2VUGA 3M2VA 1PBUA 4NLOA 3PZPA 1WC5A 3D1HA 1HR0F 2HHHJ 4I56A 1IR1A 2FY1A 2D74B 2ILYA 4IO1A 3M8YA 1BWVA 1RISA 1VQSA 4NRTA 3PEHA 3WX4A 3ISNC 3DRRB 2ZDOA 2ZD1A 2XLJA 1AFIA 2EG1A 4MFBA 3TOQA 4EO8A 3MFIA 2P9GA 4RZRA 3ENQA 4DSKA 4IFVB 1O8BA 2ZUAA 2APOA 5AXNA 2AJ1A 2AV5A 2H5IB 5B0CA 1T03A 2FVQA 4CI0B 2DRAA 4C48A 2PA3A 4JOUA 5A0YB 3V6DB 3HMJG 2OPSA 1LOUA 1FRHA 2FLNA 2E7VA 2KG1A 3IGNA 3BREA 4B9LA 1BMQB 3MECB 1FKOB 1GX5A 2I6WA 2JEJA 4HYKA 3OBIA 4NLQA 1FRLA 4ZPBA 2DD8S 5IT9U 4ZJOA 1FNOA 1HNWJ 4NCAA 1ZZFA 1PAEX 4DEZA 2HK2A 1HA1A 5ETMA 2SXLA 1FVQA 3N5FA 3TQEA 3QJLA 1AT1B 1RWWB 2Y1LB 4F67A 2F40A 2E44A 3NS5A 1KS2A 3B4MA 4QQBA 5LSOA 5G4DA 2BQUA 1RHKB 1WOPA 3Q0AA 2V69A 3CE8A 4YUDA 2H3EB 2HVZA 3UFCX 4DQSA 3LOUA 2ATCB 3MHYA 4F4WA 1M5VC 2FC8A 4URQU 1VBYA 2Z2YB 5KFMA 4OHZA 2Q6BA 3MPWA 1WF0A 2OFHX 2GJFA 2IIHA 1XR6A 1SJ1A 3PHEA 1BGXT 2CPDA 2C3UA 3O6QA 2XYPB 5J1EA 4ES1A 2EC2A 2FVPA 5GAEU 4DR6J 2PMZD 1DTTB 3JQKA 3H5SA 5C42B 2YWGA 3NCPA 1SC3B 4ECSA 4PKDB 4A8WA 4JV5F 5D3GB 1TV6A 3T5KA 3MPYA 1RWUA 3EM1A 3EDQB 2HS3A 4JI1F 4XPEA 4YB7A 2D3UA 1D9AA 4I7FB 2B56A 5J2PA 2G4BA 4MKAA 4X65J 3E8OA 3Q23A 1PJ5A 2XSJB 4HHUA 1N52B 2W24A 4V19J 2FPHX 2JLFA 4RUHA 3HK2A 2KFZA 2GJ2A 2NYIA 3J81j 2J0QD 2VDHA 3OVAA 4ECZA 2RJZA 1U8WA 4C3MA 2OJ3A 3BGUA 3ZNJ1 4LSLB 2X1AA 2FYXA 3TVZA 3OFFA 5ETSA 4AD6A 5I3QA 3QWPA 3J7Z5 1Q82T 4LF5F 1RSCA 3VF0B 1M5SA 2JVRA 1SXLA 2W4CA 3KK1B 3CCUS 3TVKA 5KG5A 1TUGB 1WF2A 4LMZA 4WPAA 4IOBA 2XHCA 2Z30B 2CPJA 3ELHA 5ETOA 1FFWB 3R97A 3UR3C 4CQ1A 5L9XA 4CP5A 5KFDA 2EFPA 3EYZA 2BX6A 5DLGA 3KLFB 4UZBA 3G71S 2H65B 4ID8A 4FKYA 5KFHA 2WB1D 3MCOA 2BV3A 2BJ9A 2OSQA 1ZTWA 4EBEA 1TP7A 3QT5A 5HANA 2VONA 1B3TA 4Z7CA 2BVZA 3E51A 2B4PA 1T9XA 5DRKA 5T7LB 3W65A 4X4TA 1VMBA 2VBXA 4K5RA 4DSJA 2GNKA 1CJUB 2WBRA 2W25A 1RBAA 2DNYA 2KHCA 4Y28C 5EWGA 2VQFF 2XI3A 1HNIB 1NXIA 2LXIA 3BSCA 4UTGA 2J6SA 1JLAB 1K1QA 2YKAA 3R5CA 1T02A 3FEXB 4M1KA 1O6XA 3W63A 5FIIA 1T05A 1YKWA 3BPDA 4LBHA 2Z56B 3BBFA 3MEGA 3QZ8A 4IRKA 2GO9A 4DWIA 4K4ZA 2IFXA 4QCLA 3GIJA 3H2VE 3NRBA 2MKCA 3U1NA 1K9MT 1DHMA 3T41A 1MSWD 4BS2A 4Z37A 2DPIA 4OX7A 4UOHA 1NK7A 2FVSA 2XS2A 4J9MA 4ES3A 3PJ9A 2V2ZA 2CQBA 3QGHA 5IT0A 5EDWA 3VAKA 5HQ8A 3KXDA 4UT4A 2I1RA 3FVYA 5AT1B 1H2TZ 2HIYA 3EGVA 4QYRA 4TVAB 4C97A 2QLJB 4Q8FA 1N32F 3GE9A 3VHQA 3FGVA 5GAGU 2AJ4A 5DGBA 5DG7A 4DL2A 1RLCL 4LF8J 2UU9J 1QUVA 2XZWA 7AT1B 3AD7C 1ZM2A 1T94A 2F1FA 4Y34A 2ILZA 2ZH2A 4C3LA 2HNZB 1YRXA 2YQ0A 3C6UB 3OXFA 4QIWD 2XB2D 2V8VA 4R0EA 3F0NA 2A0FB 4OYMA 5E5NA 4X4QA 1NMEB 4H54A 4OYBA 4MAKA 3LP0B 4P73A 2F4VJ 2DVIA 4DV6J 2GJIA 3KOAA 1PILA 3VAJA 3TI0A 4X64F 1M90T 4WTYA 4B02A 4ANCA 5HSPA 1XEZA 2U1AA 2WONB 1RYRA 2Y8WA 3A3PB 3T1HJ 3Q83A 5E3QA 4E8UA 2QFIA 5D0RA 4NXNF 1FX2A 4HACA 4FS1A 1FJCA 2DK2A 3T1YF 1W26A 2AP6A 2N3LA 3RTVA 4DL0C 4RU9A 2IYIA 5C2GA 3MEDB 1HNXJ 1RA6A 4LF6F 3EX7B 1QUPA 3QIPB 3O44A 3MURP 2HGLA 3W2WB 3GIKA 2GVZB 4FN5A 2E9ZA 2VBZA 3TJ9A 1HI1A 3DI6A 3GONA 2D69A 2PN6A 3VAMA 2NZ4A 5CD4A 2FZGB 1JWWA 1LFWA 2OMOA 2ROGA 4KFBB 2C3YA 1RAIB 2QZ8A 2XMWA 2Z57B 5E3RA 2OKQA 4DR7J 4LSNB 1S1VB 3KHGA 2G13A 3IBCB 5F8HA 2ZH1A 1CJTB 3JQJA 4ECTA 3R1LA 1NJWA 1VR6A 4BCAA 4TXSA 1IWGA 1NZ8A 3IAM9 3M05A 2CPEA 2PFDA 2QL5B 3TWZA 1WUUA 3Q8YA 1MU2B 2LU2A 3QLHA 2RQ4A 4F7VA 4CZCA 4DF8A 1EETB 4AL6A 1ZZNA 1I6JA 1S1XB 1CJKA 1F3VA 3DU5A 3GG1A 4RWXA 4TKTA 4ZK7M 4J9OA 3DOKA 4A8QA 2C2DA 3Q2TC 2YNGB 2C2OB 1FRXA 1RGVA 2DNRA 4FXWA 1RKJA 1S1WB 5K14B 3P6YC 4NZ0A 3M2RB 4DV3F 3GJTB 4FNHA 1DY3A 2N7YA 1I94F 4DCOB 4OYPA 3MEKA 2X1FA 4JUZA 4P2SA 2ZOFA 3J7YU 2LECA 4DV5F 5IQ6A 1REGX 1M5HA 4DI6A 1XQIA 1LW2A 2GO8A 1U6FA 2X51A 3FQKA 3KUHA 1HNWF 2M9KA 4DR1J 3FNNA 1CG2A 2HK3A 4DL4A 4ED2A 4C8NA 2HZAA 3VCDA 1HR0J 1D8YA 3DOMB 3J7A1 1S1TB 4O0NA 3TJAA 1Q86T 4DV1J 3NS7B 1N36J 5DG9A 2VG7A 4WK3A 2HQ3A 2V63A 3V81A 3IS9B 4DX7A 2MJUA 3CVKA 3DLKA 4X62F 4IDKB 2F65A 2XM3A 2FUG9 4CLKA 3EZ5A 3EVWA 2AX0A 2HHQA 1K1SA 3EVOA 3RAXA 4A8KA 2VHGA 2M70A 3BSAA 1QSSA 3CJKB 1QAXA 4HTIA 3MM5A 3J80U 1TAUA 3IRWP 4OLPA 1DARA 3BR8A 5DJBA 2JDJA 3KLGB 4DR2J 1UJ4A 2YNIB 1S9FA 1RBOB 2KXFA 3CJ3A 4OZNA 1NK8A 1YVFA 3IM8A 3DDNA 1ICEB 3Q8UA 3UNYA 5A8KA 3KLFA 1WG5A 2WVEA 2DCUB 2WRMA 6FD1A 1S0VA 3MCNA 1RT2B 2ZM6F 3UR0A 4NXMJ 1T9TA 2EFNA 2UVRA 1C1CB 2ZWOA 3R7SB 2JNJA 2QO3A 2YKNA 1F9EB 2IRXA 2ZVIA 1ZBTA 2E1AA 4E98A 4JP8A 3KLHB 1RT6A 1U1RA 2YWEA 4JI7J 2DHGA 4EYIB 5L1KA 2DHXA 3HVAA 3PY8A 3ISND 1X4CA 1X0PA 1R27B 2DT9A 4UF4A 5EWEA 2M88A 1AYEA 2WW4A 3WIVA 4IOAQ 1Q79A 5GADI 3BO2A 4ILRA 4GRSA 3ILLA 4JI0J 1RTJA 1RACB 4RW9A 3W62A 3S7RA 3V5RA 3W7BA 3CC7S 1FJGF 1SV5B 2YKNB 3Q8RB 1B0TA 5EUHA 1CJTA 5LMNF 2M52A 4ZN3A 2VG6A 4N8OA 3PX0A 4K0KJ 3EGNA 4JV5J 5T41A 1L5UA 1TAQA 4LBPA 5KFZA 5KG4A 5HMZA 4OYXA 4LF4F 4HL9A 1YDLA 4DCPB 1X9SA 5B0EA 4PG4A 3R6LB 2VG5B 4I6YA 3CJQA 4DOZA 3KMSA 1CC7A 1EETA 1MROB 1EHWA 3KNGA 1S77D 3MAAB 4JI5J 2GMLA 4CTAB 5AJ3J 1VQ5S 1IKWA 3C6TB 3G6XA 1CPZA 2MZTA 1N5VA 4PQUB 4CO4A 2W7PA 1DTQA 3ET6B 4IO9Q 5FJ4A 4RPFA 1CJVB 2JH3A 1DQ8A 1ZYQA 2B6AB 2HNYB 3OLAA 2ZBIA 2ZBRA 4B9VA 2EBEA 3TUPA 3AH6A 2OEKA 3CJ5A 1S1UB 1VBXA 2C1EB 1MN9A 5HP1A 4USIA 3IAS9 4K7QA 3M7VA 4Y2CA 4RW7A 3N01A 2HRTA 2IC3B 1KOHA 2ALYB 4O23A 4C8ZA 1R8PA 2AHOB 1XMBA 2L41A 2JEGA 2R2SA 5D15A 2OO4A 3HSDA 2EFVA 3RU0A 3ZZ0A 3QRQA 1S4FA 4NYOA 5KFAA 2IRUA 4FF3A 4NYZA 1ZAWA 2POKA 3N0VA 2BKNA 2VQEF 1RUSA 1JLAA 1X4EA 4YOEA 4X84A 1VQ8S 1NEEA 3CO0P 2MSTA 2R7QA 3MMAA 5E0OA 3BQ1A 2BBEA 4Z2XA 4DV2F 3MR5A 1U1LA 2RDDA 5IS2A 1KP6A 2OPRB 3EZUA 5ETKA 4U67Q 3H20A 1LK5A 2VG7B 1IVZA 4OZ2A 1IJFB 3CSKA 2BMBA 4UQTA 2OEMA 3ZZZA 2RU3A 1EIYB 3ZZOA 4JI6F 4JI4F 4LF5J 2KU7A 1TTHB 1VQPS 3M8ZA 5LMUF 3UD4P 3VGTA 1BY9A 1UWBB 4ED3A 1Z1ZA 4B3SJ 5H9EK 1VQKS 2F8EX 1QVFR 4IOCQ 2CXEA 4U9RA 1VC5A 2HNDA 4IH6A 3H0PA 3OTCA 3NOGA 3FSIA 4FBUA 2YKMA 2QT7A 2GMHA 3GJQB 2VH7A 3OPKA 5HVHA 2ZH6A 4Q8EA 2LXFA 1FXDA 3FEZA 2XZDB 1U1OA 4MMOA 2IA0A 3KDNA 4ZPVR 4H4KA 2NREA 4PYDA 2YY3A 3PJXA 2QA2A 4TU8A 2NCKL 5LSLA 4KHPJ 2PGCA 1S1VA 4TY8A 4CLFA 4QJVA 1UVNA 4QWAA 1SKWA 4IFVA 3U7JA 2CJYB 1N6QB 4GKKJ 3HP6A 3ZZYA 4NXNJ 1P9YA 4DR2F 3FDSA 2AU0A 4NI2B 1S1XA 2DR5A 3JXOA 4HEA9 3TX0A 4OJGA 2CG8A 1U0SA 3IO1A 4KGKA 1RTIB 1KVJA 3M2UA 1FDDA 3I82A 3MEDA 1FEEA 1DAXA 1FKOA 2FGCA 1JLGB 4KV8A 2MZ1A 1X8DA 4I69A 2OUGA 1V3SA 4XIUA 3HVTB 3HSZA 1W2BR 3A8EA 5IM0A 4X4SA 3DMJB 3G9CA 2JL9A 2G9OA 1ZPVA 2OPPB 1PJ7A 1VRUB 4NLXA 1T03B 1BHNA 1VQLS 2M4MA 2IPOB 1WF1A 3BGOP 2YWHA 3KYLA 4L76A 5HLFB 3RYLA 1P8GA 3EPIA 1JLEA 2PMWA 1YZ7A 1H6KX 5DDRC 4DLGA 2EPIA 3T5JA 2V50A 1LWCB 2FVCA 2MKHA 5GMKa 5F8NA 1T95A 2DNHA 5C25A 1DZ5A 4QPTA 4B17A 4C7QA 5KG0A 2KO1A 5KT7A 2UXBJ 2V8PA 3PRVA 2ZZNA 1UVIA 5CCMA 5K14A 2XQCA 3L7UA 3W2VA 2KH9A 3BM7A 1NRKA 4ED6A 4CNZA 3CNQP 2RDJA 1RWOB 4YMEA 4J9PA 3Q2SC 3KLGA 4Q45A 1OIAA 3MM6A 1WELA 3MM9B 4K4YA 1WC0A 2LA4A 1NJYA 1U09A 2COLA 4L72B 4ZITA 3G6ES 3FBFA 1BQNA 4OHVA 5KT3A 2R7OA 3E3XA 4O3NA 4I6WA 3RAMA 3MTJA 4YY3F 2FGOA 3HT3A 1NKCA 4IKAA 1J5OB 2YWWA 1LEOA 1TMMA 2VOOA 1LFPA 1URNA 1MMNA 1MROA 4ID5B 1SIWB 1WD6A 1F0XA 1RB0A 2VPYB 3PFEA 2V9WA 4KGVB 1U1PA 4B9NA 1FRKA 4KPCA 4ED7A 1KQSR 2XMKA 4X4RA 2EXUA 4IYQA 5BJRA 1SKUB 3BH6B 1GMWD 3LWLA 1BQNB 2KT2A 4HVZA 4AQYF 2HW3A 2FJVA 1BQXA 1QTNB 3CCTA 4Y2IA 1OYDA 1Q8KA 1MG7A 3I0SB 3MMCB 2HBQB 2G2YA 5HI7A 3HJVA 4KBIA 1RDRA 2N7CA 2A1BA 4A47A 1S48A 4KH1B 4RW8A 3PW2A 4ECQA 3HVRA 5KFXA 1MMDA 4K4SA 2AEJA 2BANB 3AD9C 3PEJA 3TZZA 3GSDA 2C2EA 2I5JA 2Z2LA 2MQLA 3KK2A 2E1PA 3D0IE 4G6VB 2MZSA 1SVDA 2P5VA 3JQMA 2HZCA 1NPRA 3GV8B 4WJBA 3GPAA 2A2DA 4DR1F 1X5TA 4WZMA 2LLZA 3BGLA 5F8IA 3ILOA 2J8SA 1NSKL 2HVIA 1PJ6A 2RUSA 2DH7A 3NGTA 1A7GE 3CMQA 1RT5B 1WSVA 2PDAA 2KFYA 1RAAB 3CMAS 2YH1A 1D9DA 3K5MA 3NMRA 4O44B 4LRBA 3THVA 1KVIA 4B9MA 1D1UA 2FHJA 2FLLA 4WFXA 1TUWA 1FCAA 3BDEA 2C42A 1LK7A 4FP9A 4NZ6A 3T9ZA 2AT1B 1VRUA 1X5OA 5DZ6A 2OPRA 4J9QA 3K17A 4MK9A 4NI2A 3US5A 4Y6IA 1VK3A 2N4DA 4F4AA 1Q78A 3OVSA 4I2PA 1U7LA 2E29A 5K8MA 1HQEB 1HW9A 3TZWA 1BQMB 1MLAA 3P49B 1RABB 1SC4B 3EXCX 2G2OA 3HHLD 4BWMA 5CAAA 5D0GA 1T9YA 2O5DA 2V34A 1S79A 3LPEA 5AJ3F 2B4VA 3ZTRA 2EWHA 1PC4A 2NSCA 3R2CJ 1RAEB 4N77A 3UDCA 2EW9A 3MTKA 5HMXA 3G82B 2WTFA 3AOAA 1KLNA 2RE1A 5A0YA 4NLSA 3R7NB 4TYBA 2CIMA 4Q7AA 2K2PA 4JI0F 2VPXB 1BUXA 3TR5A 1UVKA 1VBKA 4WFNQ 2ZM6J 1AUDA 1FT8A 2RRBA 4V1Ak 1LXNA 4EK2A 5DQIA 4LJMA 5LMNJ 4LRAA 4QR2A 3K7RA 5KG1A 3DOLA 2KM8C 2D3O1 2DRDA 5BYSA 2ZHOA 1OPIA 4IFYB 5F9LA 1HL6A 1Q5VA 4RR5A 4C8MA 5J1EB 2YH0A 4DPUA 2CQHA 3DRSA 5L1JA 4DV3J 4PQAA 3ITHA 4FS2A 1T0TV 1YI2S 2WW8A 1I94J 2VA3A 3C6UA 4NA2A 2HQGA 3J7ZT 3LAKA 3SV4A 1TKZB 2HWIA 4XTTA 3PFOA 4RW4B 4USHA 4ANDA 2BJEA 2DHAA 1PO6A 1EARA 4KGMA 4FF2A 3LGMA 3C15A 3IWXA 3JTOA 4LR8A 4DG1A 2XO7A 1RT3B 3N6NA 1SJFA 4WIIA 3RG6A 1VK8A 4PG6A 3RRKA 3VTIA 4F36A 3TAMA 1HKAA 2PFFB 1FI4A 1SBRA 2F9JA 3DYAB 3M8SA 1F2HA 4ERDA 2DGWA 2ZITA 4A8FA 2KN4A 4YN3B 4RU2A 4USWA 1ZM9A 4IRCA 1S49A 1YBTA 1NB7A 4F0MA 4B3RF 2DGUA 1H74A 3CO9A 4GKJJ 2YNHA 1FRMA 2F63A 3MM8A 3FRYA 2Z2ZA 1GK8A 4EZ6A 4C8YA 1MW7A 1E6VA 4C2MA 2MQPA 2V8DA 4CLLA 5J2PB 2VC1A 4AT1B 4URGA 5KT5A 1V3RA 4DR4F 2MKJA 1U1NA 5HAOA 1AFJA 1MWQA 4B3MJ 2K3KA 3VVUA 3NEKA 2OAUA 4KH0B 2VG6B 4OJ3A 2FD2A 2HLTA 4WU2A 1ZM3A 4OI2A 1YQHA 3SFGA 4OZ0A 1UZHA 3TW0A 2LEBA 4QIVA 1TFWA 4ZDNA 2LFVA 3KFWX 3CCZA 4RNHA 4DN9A 3T3FA 2CPYA 2MQ8A 1NPKA 3D6TB 1JLGA 1RA7A 1V6HA 4TLRA 3KTQA 1S4EA 4ER8A 4DS4A 4M95A 2CJBA 2KM8B 8RUCA 5LT5A 1W2IA 2K1RB 2R8IA 4B3TF 5DDQC 3C3LA 3C8YA 3CD5A 3SQOP 2YQ1A 3LGHA 1U26A 3GMGA 4UOGA 3D4JA 2KI2A 5AXMA 2H54B 4IH5A 4Q0BB 2QEXS 4F0KA 3DDIA 2G0IA 3J7YI 3QO9B 5EX0A 5J2MB 3DHXA 5CXTA 2OTJS 5JMNA 4IRDA 3N79A 1EP4A 5CQGA 3MD1A 1AW0A 4FDFA 2J7UA 3H7HB 4OX8A 5HVFA 1N32J 3E2EA 1JLBA 3CMES 3HDSA 4L6V3 4V19X 4DQIA 4CM0A 3GILA 5SZTA 3CCES 4ECVA 1LWFB 3CXCR 4CH1A 2Y3YA 2J6TA 1N5YA 3D6HB 3W5XA 4DL7A 1YBUA 5K9FA 3IP0A 5DS7A 4XDDA 1PBAA 3JSMB 1B4SA 1NHVA 3TA2A 4IQXA 4W4MA 4X64J 1P27B 3AQOA 4I6AA 4JI2F 5IM0B 2VV5A 1ZAVA 2XMMA 1DFDA 1R6VA 1PYTA 3PKYA 3D6FB 3PX6A 4Q44A 3PVXA 2L9WA 5D6GA 5MLCV 4YY3J 3GIRA 1AZSA 1SB6A 1UJ6A 2GIRA 3NLCA 2M7SA 2RUGA 3RZAA 1LWEA 1F5CA 1H72C 1NH8A 2HQCA 2YNIA 2FHJD 5KFPA 3V4IA 2OIHA 1K73T 2V4JA 3MM5B 2EC0A 2LDYA 4TLQA 2ZOGA 4OYZA 4TU9A 2BUNA 2P8IA 2UVVA 2MB0B 1XR5A 3BS9A 4XO0A 2ASJA 3OJUA 2MZRA 4NASA 1JK9B 1VJWA 2GGPA 4PCQA 4OX9F 2JVOA 2VB6A 4MTPA 1X5PA 3R1HA 2OLWA 1NJXA 2W9CA 1FNMA 1E6YA 1LQ9A 1LW0B 3SMZA 4DV2J 1YJNS 3FK4A 2DB1A 2JJ4D 3ZTOA 1SJ3P 1S0NA 1YJRA 4ZJQA 1SH2A 2ZE2B 4RW6B 1RQ0A 5L38A 5ADZA 1N5YB 2YWKA 3UVJB 3HHKA 2W9BB 4U7UD 1S0MA 4FBTA 1QD1A 2HFNA 1U25A 2D7SA 3D28A 5B0DA 4X65F 4LRCA 1N88A 2AIRB 1V5IB 3QZ7A 2IBKA 4DFMA 3LGNA 4I7FA 5IQQA 4XPCA 1B64A 4H4MA 1FKPB 1SV5A 2VFRA 1WHVA 4ZVTB 1OWXA 1J5EF 3TUIC 2DEIA 4UY85 4S0MA 2G2ZA 1S1WA 3ILJA 4DPTA 4F3MA 4DV4J 1V3ZA 3ULHA 4EBCA 5KAKA 2CPFA 4RW7B 4ZVQB 1G6BA 3HVWA 2WSCC 2K8GA 4PXCA 3QGPA 1VRTB 1TL4A 2WAQD 3FKBA 3ENVA 4X66J 2ASLA 3DCAA 1IKXB 2KFNA 2I0XA 1RTHB 2F4FA 3S8SA 1OQ6A 2KHDA 1FKPA 3W9IA 3NXZA 3QJJA 1CJVA 1JMTA 4L74A 4B3RJ 4NLUA 2PO4A 1RAJA 3BPSP 3NWRA 1UTAA 4IG3B 1S6UA 2AYGA 1PYSB 5KOWA 2L08A 2VODA 1HNVB 3CWJA 1WI6A 1D3WA 3FUYA 1QM9A 1RWNB 1F60B 2AX1A 2C2RA 1RT3A 4WFAQ 3GYXB 2MY8A 2YKPA 2WCXA 3QT8A 4K2XA 2O01C 2Q79A 2Y0SD 3HHLB 3TA0A 3ZZPA 1P6TA 4QR1A 1DRZA 4NCBA 4X4VA 2H5EA 1LXJA 1MN7A 2HNZA 2MY7A 4WE1B 4IR1A 1L3KA 3BB5A 5B7WA 1X4FA 4IG3A 1IR0A 3EVMA 3CJSA 2AYEA 3ITHB 3RB6A 1FK9B 1NJZA 3W8PA 3MEGB 1PIEA 1TL1B 4OJHA 1JKHB 3DLEA 3Q89A 5KT6A 2DHSA 1REVA 1SIZA 3NGDA 4Y00A 1Q4RA 5A2QY 4CYUA 2OELA 2R7XA 5DG8A 2XEXA 2RT3A 3V2UC 5KFWA 4JI7F 2NLWA 4P74A 3H98A 3HHLC 2MKIA 5E3CA 3AODA 3GFHA 2ACMA 3D1OA 3DRXA 2CVIA 2AJ2A 2FDNA 2RB7A 2V68A 4Q2MA 1ZPWX 2PIIA 4HACB 1TL1A 3D1QA 2Z2MA 4G3IA 2Y1JA 4ZLLA 1EB0A 1QE1A 4U7UK 2DEJA 3M9OB 3GR0A 2RIJA 2RSQA 2CQ0A 3KHLA 2HAFA 2P2CB 2RDIA 1HWIA 1Y0HA 1HWUA 2DIUA 1TL7A 2HVEA 2ZE2A 3OXGA 2CNLB 2F9DA 3SCLE 3WHIA 5F3ZA 1VDHA 2GVZA 3QSIA 1XNRF 4UOCA 2UXDJ 4C8OA 2C3PA 2BABA 4CLUA 2L48A 5D4OA 1CULB 3RBXA 3G87A 4R8UB 4PWDA 2UXCJ 2IDEA 3EGWB 1JLQA 3PR4A 2V4QA 2H5JB 1Y7PA 1HBNB 2ZWPA 1RCXB 1MNEA 2KJVA 2J0XA 2PE8A 3ETOA 1NZAA 3HKWA 3KLHA 2WSFC 2VOPA 3BR9A 3TJ8A 4K4VA 3ENWA 2VF3A 2CNKB 2EK1A 2AMCB 3FFIA 5CYQA 3CF5Q 2D3ZA 1KFDA 3M2RA 4P52A 2BJDA 3D3CJ 2G0CA 2UZAA 5KT2A 3ZTQA 2XYHB 3MWBA 1NBEB 2DNLA 3GJRB 4J9NA 2I8EA 3HSJA 4N7TA 3RW7A 2ZJRQ 4DXLA 2MPUA 1VQMS 1LW2B 2FIUA 2NS1B 2WK4A 5B0BA 2AZ3A 1S6PB 4M5NA 1WORA 3G8SA 3D9BA 3THTA 2FJXA 1OPZA 3CIMA 3DLGA 4TY9A 4DL5A 1CSJA 1VJQA 4YB6A 2DNKA 3A13A 3DRYA 4EGLA 4P10A 5RUBA 2KG0A 3G86A 2R7SA 1L3SA 4JI1J 2BE9B 5FLXY 2MQMA 1G7CB 3BQ0A 1SL1A 1WTFA 3JSRA 2JEFA 3VR1A 2FJDB 2RAQA 3O1LA 2BE7D 4FPRA 4QYZJ 3M8WA 3IS9A 2ZOMA 2LA6A 2VU5A 2V4JB 3TP2A 3K0JA 3MDFA 1WJ9A 2W7OA 4EU0A 3C19A 2J0WA 2JOQA 2M3DA 1UVLA 5LOQA 1WKKA 3X1LB 1NAQA 3WIUA 2CJ9A 3N28A 3A3OB 1X4HA 2HS0A 1B7FA 3KLEA 3HLUA 2HBYB 2BRLA 2K3IA 3PV8A 5I3PA 2HIQA 2RVJA 3EZOA 5A6WA 4CM2A 4ZPAA 3TYTA 2R7RA 5KFBA 2XCPA 1R3NA 4HI2A 4M5JA 1F3FA 2G1DA 3TO8A 5H9EJ 4KY3A 4U96A 4B3SF 1Y5NB 4WP9A 1U8SA 1UEVA 4GMKA 2BM1A 3DOMA 4HHJA 4LSLA 2FB0A 3MCMA 4CLTA 1VOMA 3EDRB 5LSRA 4YHHF 2R2TA 5IC6B 4ECWA 1WG1A 3HM9A 3KDOA 2CQ2A 1B7YB 1UFLA 3AOBA 2NXCA 3M9NB 2M0GB 1P1LA 3KK3B 4ED0A 1U1KA 1M5PC 4LFCJ 3JSBA 3NG8A 3W64A 1FX4A 1TL7B 5F8LA 3MF5A 4KQZA 3D3BJ 2OTLS 2HKEA 4OX6A 3RBZA 3OL6A 3KLIB 5CZXA 1UA0A 2KXHA 2R7UA 3DYAA 4A8YA 1U6BA 1TKTB 4ECUA 1HHQA 2HFZA 2R4FA 4USTA 2KB2A 4BC7A 4FYVB 3PW7A 1IKXA 3UQSA 2BOAA 8ATCB 3GB0A 4WK1A 4ZP7A 5KOXA 2WVFA 2F3JA 3JAMU 4TQSA 2XWXA 1JLCA 1VCTA 3W5YA 3QT7A 4F4KA 1I3OB 3AJ1A 4CO0A 4CWBA 5AE3A 3POTA 3D5MA 1HBUA 4LT6A 2DNNA 4OYAA 4JI3J 1JXEA 2NXEA 2YX7A 4DPOA 2DXDA 3UDVA 2DH8A 3BYPA 2PEHA 1JJCB 1RHRB 3IMQJ 4OZ3A 1RK8A 4UQGA 3MR3A 4R25A 5B0FA 1EKRA 4GO7X 4NE9C 1SUQA 4JV0A 4X66F 3LUYA 2I5JB 3B78A 4DFKA 1CJKB 2BDPA 4M5IA 4BDPA 1FFSB 3UDLA 1NDLA 1ELOA 1NDCA 1GMUA 3K8VA 2W9CB 4DV6F 2DR8A 2Y9HA 2ZZMA 3PW0A 5SUHA 4CLZA 3HCXA 1FD2A 2AYMA 1HI8A 3A8IA 3GFXA 1VQ4S 2XMTA 3CIZA 3OHAA 4BWJA 1RCOB 4HH1A 1FTRA 5ETQA 2J7WA 2RILA 1T9UA 2FTRA 1TKXB 2LYVA 2W2QP 4AE5A 4WFBQ 2LCWA 1TR0A 2V67A 3GU0A 3GV7B 3PYGA 2FLOA 1RU2A 2E5GA 2ZD1B 2KL8A 3IM9A 1WEYA 1D09B 3P96A 1AXQA 3C14B 3HT0A 4LSZB 4R0JA 3SV3A 2HFUA 1S57A 4DUZF 4ZLNA 2CA9A 1TKZA 1Y5IB 2KVIA 2VFSA 2QYGA 3LA0A 3MUTP 4DUTA 4AXIA 3OHBA 3MMBB 3QYYA 5F9NA 3BKUA 2D9PA 3UI3A 1RWXB 3UPFA 5J1NA 2W9AA 1T3OA 1QDUB 2LQBA 2VPWB 1NU4A 4RUAA 1R0AB 2CQ4A 2NYHA 3RB3A 2CPHA 2HHSA 3GIMA 2DGVA 1U49A 1UW9A 2HRYA 2XMJA 4IG0B 3QSYB 2DO0A 2PEBA 1XK8A 4X4PA 2AJ0A 1FJGJ 3MFHA 1U1QA 1TVRB 1GFWB 1AZSB 5B09A 1SJ4P 4CCHA 2VBWA 3DDKA 1G4CA 2NXJA 2E7XA 4ZP6A 2N82B 3ZO7A 2R8HA 2R7VA 5DZ7A 2VJVA 1QY7A 2A10A 4RUBA 3I5AA 3K59A 1YLXA 3N6LA 2KYXA 4MIAA 4IUFA 3BSNA 1CQMA 1RT2A 3NGSA 2MQOA 2XS5A 2WONA 4RBTA 1U2FA 3Q8PB 3K2YA 4ETXA 3M6UA 4A8MP 4RLEA 4IH7A 4ATNA 4OV1A 1G1XA 2EFOA 1KFSA 2Y1RI 1UW4A 4PWDB 4G65A 5M2UA 2IJRA 4PAAA 2CG4A 1FNXH 1OYEA 3UD5A 4KSEB 1UPPA 1KD1T 1DQ9A 1J5OA 3LP2A 2J76E 5GVQA 2OD4A 4R5PB 5FDLB 5HJYA 1URRA 2YQ3A 3LAMA 4RNMA 2DNPA 4DR5F 4ZS6A 2W2NP 1HBMA 1S9GA 2C2NA 3R5BA 3DM2B 1VBZA 3WC2A 4B9UA 5BYRA 5KFIA 4QOTA 3QMQA 2W2PP 1LKZA 2GIQA 4O4RA 3SSQA 2R9LA 4Q0BA 3PRBA 2D41A 1XNQJ 4WFZA 2G0JA 4DV7F 1S6QB 3NAIA 3PRDA 3L09A 5ETLA 4ZVFA 4LRFA 2XC9A 4PUOA 3EICA 4OLOA 4B08A 1H38A 1XNRJ 2PMHA 3AAWB 3MUVP 4RNFA 1NLKL 3M30B 1F9FA 1F9HA 1M1HA 3T1AA 1EX8A 4ZLJA 3DLGB 3K8WA 1SQFA 1SQEA 3N4WA 1WHWA 3WC0A 4ZP9A 3TAPA 4JYAJ 3MPVA 5HJXA 2MKYA 2JZ5A 3GG0A 4HR2A 3UCUP 2HS4A 1N0VC 4USJC 5KFTA 1JLEB 3W9JA 1RTDB 4C8LA 4ZOSA 2B8QA 2BRKA 2FHMA 2XGPA 2HBRB 2UV8G 3PYFA 4L3NA 3ZZUA 5KFOA 1IM6A 2BA9A 4USMA 2ALZA 4NA1A 3VGUA 1WHYA 3IWLA 2B3TB 2QFJA 1N6QA 3T6JA 3NMAA 1U45A 3LP1A 1GXTA 4BLGA 2W2OP 3MR7A 2GW8A 5HL7Q 3HPOA 3MMBA 1NK5A 2ERRA 1V9OA 3SEOA 1HMVB 2LQ5A 2N4CA 4KV8B 3SSSA 3FMBA 1S59A 3ZC4A 3I5CA 3KJVB 1J5EJ 1U0HA 3F41A 2IMWP 2V4RA 3DRSB 4Y2KA 1FTCA 3QFHA 3FEYB 3BEGB 4L75A 4KC5A 2IAJB 5E2QA 1VQ7S 2ZZTA 3I87A 5I3UA 4OHXA 1NNDA 2UUWA 5KG6A 3D6MB 5GAHI 3T1HF 3G6VA 4N41A 4X4NA 2HBZB 4WP8A 5C42A 3L95X 2B7BB 2CRLA 1IBLJ 1T7PA 3ZFVA 3UCZP 4UY8T 1IQTA 4FVMA 1JLFB 5GMEA 3T1YJ 2C3MA 3CJTA 3KUEA 4DSFA 2IM1A 3SIPB 4NRUA 2UXBF 3FZBA 1OS5A 2WVBA 3QQCD 5CHCB 5H1SV 4G1QB 5GAGI 4DFPA 1ZTTA 4ELVA 3VGVA 5D4NA 2FZCB 3MEEB 2VC0A 3EE3A 2AGPA 1HLWA 2R8GA 3QJPA 5JXSA 2WBMA 2X1GA 3ISZA 4P2MA 4NZ7A 3SCKE 4CO2A 3DFEA 3DN9A 3NCQA 1R0CB 1DTTA 2DGTA 3P45B 4NL5A 4DZDA 3CUNA 2ATLA 1VRQC 1IBCB 3OSPA 3TEGA 2YPYA 4G1QA 3MR6A 1C0TB 2N3OA 3C46A 4LF1A 1HBUB 2ZEJA 3GV5B 4R5PA 3SZ2A 1GTEA 4ECRA 3DC2A 1Q8IA 2IVFB 4I4BA 5AXKA 3EXYA 5CABA 4QU6A 2IM0A 5JJBA 4NA3A 4KTQA 1UAWA 2BW2A 4Y2AA 4KHPF 1YGYA 3QAUA 1XBWA 3G8TA 4MIBA 3IC1A 3BDPA 2ZJQQ 1NM2A 1Q5YA 2VFVA 1B0VA 4F04B 3H4DA 3OR2A 2WVDA 3GIIA 3M6VA 3MPUB 2R42A 1DLOA 3H8YA 1PG5B 5L1LA 2EFGA 4DR3F 1RWVB 4M5HA 4DSEA 4M94A 1X5SA 2MMYA 3Q8VA 3M2UB 4ZJLA 3ZNUA 4KRWA 3I31A 4C11A 1GNKA 4IQMA 4NOHA 1KLMA 5GAEI 4N56A 4WKYA 1APSA 3I4HX 5H9FJ 3LP1B 1NKBA 2EKYA 1H0HB 4CLYA 5DQGA 2IA6A 2CAJA 4LVNP 3AFGA 3OR1B 3T6BA 4DUZJ 1CBKA 2DBBA 2XY7A 3DU6A 1YTYA 1HBOB 2CFXA 2V94A 4TN2A 2UXCF 3RAQA 3NKYA 3RW6A 2OPPA 1M1GA 2ZH4A 2HLUA 2DRBA 2F5GA 5CZVA 1YHQS 3H5UA 1KLMB 2F8MA 3MI7X 4LBIA 1DQAA 4Y2MA 4Z7YA 5E33A 6AT1B 2KXNB 5JUMA 2HHXA 1N4LA 1AB8A 3FBEA 3IG1A 3RBDA 2QMWA 1DJ0A 1XTZA 2IRYA 4WBFA 3CTRA 1QAJA 1RP5A 1U1MA 3AA8A 1EP4B 4PPDA 4DBQA 2XNRA 3P5BP 4K4UA 2Q43A 4ANEA 1QAYA 3QO9A 5HMWA 5J2MA 4ZVPB 1HHSA 2WB4A 1X4DA 4FXDA 1NSPA 1UEKA 3B8HA 4NLGA 5THWA 4CDIA 4NXMF 4DU7A 4YP3A 3VV2B 4C8KA 2PI5A 1UJ5A 2NSBA 3AJ2A 3CD0A 3GR1A 4PXDA 2IMOA 4WZQA 1PSDA 3CDWA 2QLXA 1JJ4A 3Q8QB 1Y9OA 5T14A 4ENOA 2B9EA 4PRFA 4F3QA 1YZ6A 4ED4A 3R5GA 1XJWB 5M2RA 5CYMA 2CQPA 1RT1B 2H4YB 2IJNA 2VDIA 3QWUA 4MKVA 2V5HG 1MWZA 3NBPA 1S99A 3K5OA 2QG9B 3H25A 1VHFA 1TKDA 2HGMA 5IV3A 2O67A 1WI8A 1K8AT 2ADCA 1D8ZA 3O8WA 1FD8A 2UVUA 1CEZA 3PACA 4WYWA 4D3GA 5L9NA 3KJNB 2AKWB 3MOZA 4WF9Q 5F0WA 1E6VB 2FJAB 1XERA 2JWNA 4M8LA 3JAMY 3IWNC 3MXHP 2RRNA 3UWTA 4BBYA 3WBZA 2BYCA 7FD1A 4FXVA 4PZVA 3G6YA 4EFAC 1Q7YT 3K5PA 4I67A 3ZZTA 1YJWS 1JLCB 1UCNA 1RT7B 4R8UA 3KNAA 1FRIA 4EBDA 4PUOB 4UOFA 3DMJA 3NOCA 4KT0C 5ITHA 4DUYF 2W4PA 5D78A 5IWAF 3O5TB 5BR8F 4KJIA 2IDLA 1NB2A 1NK0A 2XS7A 1VFJA 5J2QA 2E5LF 1ZOTA 2RQKA 1PGZA 3R2DJ 2E5IA 1FDAA 1TZ0A 3CDEA 4LR7A 1QJHA 2DGSA 1PKUA 4CT9A 1RU1A 5L39A 3KUGA 4DX6A 4GC7A 2HYIB 4LQ3A 4DR6F 2P6SA 1NSAA 2O1PA 4RNOA 1F6TA 1UPMB 1S1TA 2HG4A 2W01A 4NEYA 3UN2A 4YB5A 5HMYA 1XN9A 3TQ1A 3KMQA 2HHWA 1Q8LA 1UETA 4RKUC 2OH2A 1NK6A 4LSNA 1RI7A 3B6BA 1KBRA 2BJ3A 5CH7B 2GV1A 4WKRA 2BQ3A 2HHTA 1DURA 1RAGB 3IR5B 2OGUA 1CS4A 4K2JA 3DLKB 4CIOA 1ZA2B 4QPXA 2J7KA 5C5JA 1RTHA 2BE2B 1RHUB 2CNOB 4AQYJ 1NK4A 1IKVB 3GFZA 5IT4A 1S9EB 4OIXA 3Q24A 1ZETA 2YNGA 1Y3KA 2VKZG 1UVJA 2OI2A 3HX9A 3M30A 1IBMF 2HHHF 4ZCLA 4NLVA 1GT8A 4K5SA 1CJUA 1OJ4A 2BW7A 2D1CA 3C14A 3D0HE 4P75A 5KG3A 3CCMS 2VJUA 1R8AA 3Q86A 4XAKA 4PEOA 2QLFB 3R6GB 3MZIA 1SH3A 4PR6A 1XC9A 2IY5B 2JFKA 4ZCKA 2PI4A 2KZMA 1JIHA 2BKOA 4CO5A 4EO6A 3UD3P 4FYXB 4ECXA 3KLIA 3OT9A 5E3AA 1GH8A 5A8KB 4OI3A 3I0RA 3CB4A 3NCRA 4NYPA 4OHWA 2XI2A 2UP1A 2CPXA 3V81B 2X3DA 2JRSA 3OUYB 2VL1A 4DG1B 3OTEA 1SCJB 2GVDB 5C24A 3PO5A 2RMLA 1S7IA 1HWKA 4M5KA 3CJKA 2LQJA 5HQLA 1NK9A 3QAEA 4YR3A 3HHNB 3FCVA 2LVWA 4H4KC 3DLLQ 3I0RB 3P3DA 3IR7B 4AL7A 1REVB 3F44A 5F41A 4ZVGA 1XNQF 2LXUA 3I5BA 3CCQS 4KIAA 2ADBA 2VZ9A 4PXBA 1VQNS 4DQPA 3HD2A 1HNXF 4LF6J 2C28A 4KO0A 5DDOC 3MMCA 5HK4A 4KKOB 3QIPA 3ZZRA 2W9BA 2MEWA 4ECYA 4CT8A 3OR1A 5KFKA 1EJ7L 2KJWA 3D2WA 1VHIA 3CJ4A 3DGPB 3Q8SB 1IKWB 2V0NA 3C6TA 4JB8B 5G0RB 3SQGB 2H9ZA 3MPDA 3MAAA 3WZ0A 4Y0FA 2V8HA 3MM7B 4UW2A 1RXOB 5B0GA 2AEFA 3IR6B 4OX9J 4A46A 1ACMB 5MAOA 2FQQB 3ZXWA 1N34J 3GP9A 4ELUA 1CQNA 5DO2A 1FF2A 1JLQB 2RF2A 3MAHA 4PG8A 4HKQA 3B54A 1WDDA 3K89A 3CEDA 4MIWA 4DQQA 4DPYA 3AHPA 5DLFA 1HNVA 1B99A 1QAIA 1NKEA 3PDNA 2QA4G 1KN6A 2BACA 4JI4J 4JI6J 3HF5A 5A8RA 4DR4J 5IV4A 1RHJB 1UFKA 1HWLA 2H4WB 3UDEA 2EKNA 3M8QA 3A12A 3DGVA 5J2NB 3WQPA 3FCWA 5A76A 3QFWA 3RRHA 4KGXB 3U1LA 1X9WA 1UKUA 5KG7A 2ACYA 2JX2A 3MCSA 4ZN1A 2FJWA 2MXYA 1RLDA 2XMUA 2MQNA 1HI0P 3J81U 4A48A 1KQGB 4LVOP 1D9FA 1Q53A 3AY0A 5KFQA 4F4XA 1SC1B 3IG1B 3M32B 2RHSB 2MQQA 3G82A 4CYUB 3HFKA 3P8BB 5DM6Q 2LQ9A 3DLEB 1V5VA 1H3DA 2MZQA 2CZ9A 2QSWA 2DNMA 3FQLA 3HFVA 4WU3A 1U2RA 3FZ2A 1CLFA 1TK0A 1SH0A 2ROPA 6FDRA 5I3UB 4MYTA 2H48B 3NBPB 4X2BA 4F2RA 1RTZA 5ETRA 4HH0A 3CDBA 4ZIVA 5C7PA 1KVKA 2R8KA 2L9DA 4B3OA 1LWEB 5DETA 2HURA 1WNEA 4QR0A 1GXLA 4KPYA 1NDPA 3J81Y 4HT7A 4ZP8A 4NLPA 1FHTA 2K7JA 3G4SS 2JC0A 1IN0A 1OSCA 2CQCA 2DNOA 5F3TA 2P6TA 3HHEA 4IDKA 4J9UE 3GQCA 4F4ZA 2W7AA 1B0PA 5EGYA 1KRPA 1BWEA 3UN5A 1BD6A 2WZ1A 4UZCA 4OI1A 3CDUA 1R0BG 1HW8A 5EN1A 4A4JA 4J7CA 4EYHB 4QIEA 5FLXU 1FWPA 4PG5A 2ZH3A 1N5SA 5LXRA 1HHTP 2DR6A 1WHXA 2XY6A 1X4BA 1IXKA 3BGRB 4ALZA 4O3SA 4OI0A 4AL5A 2XMVA 5L8RC 3CCJS 1WOOA 5HROB 5CYQB 8AT1B 1UZDA 3OLBA 1LV5A 4BC9A 5D4PA 3ADAC 4DSLA 2RH3A 3EUNA 2XULA 4ZVSB 1ITPA 1N0UA 2Q6CA 5HVGA 3PHTA 4ICLA 2QA4S 4DUYJ 2XBPA 3AT1B 1GXUA 3OTOJ 2FHOB 2KZZA 1IUJA 4D3HA 1NH7A 2CPZA 2JLEA 3KJQB 3O3LA 1HQUB 2GQCA 5D0HA 3THPA 2JLGA 4DV1F 2HMIA 2YXLA 3DM2A 3FBCA 1O51A 4YDDB 3NAHA 4F25A 1LWFA 3K5LA 1YG0A 1E6YB 2CDQA 3SDEB 4YR0A 2K1RA 2DITA 4QYZK 2DO4A 3M2VB 4ZCMA 1RKIA 4FYWB 2V6AA 3L9ZA 2JHEA 2GC8A 1WTBA 1HYSB 3DXBA 2ABYA 1KKHA 4ITSA 2EVZA 3HKZD 5HN0A 2XGQA 4OQJA 2ZJPQ 2R3VA 3HZGA 3M1VB 4PG7A 4LF7F 4G1PA 3C16B 2IVMA 4X4UA 2H51B 1K0TA 3M4XA 4RBVA 1N8RT 2M8HA 4Q5VA 4QWCA 4DR7F 1J27A 3HHDA 4DMZA 2AGQA 4ZIWA 2ZH7A 5EX3A 2CDRB 2ASYA 2HFSA 1IBKF 2HSEB 3VQTA 1WC6A 2GX8A 2XHWA 3H4BA 3HHLA 1F5AA 2J8AA 2ZNZA 1KHWA 3B4DA 4LUBA 2QJ3A 1EZZB 1Z2LA 2XMAA 5D0EA 3CC4S 4OJ1A 1X9MA 1S72S 4RX6A 2AYBA 5KFYA 3OTBA 1Q8BA 1XWLA 5GAHU 3M9MB 3CCRS 3T5LA 5DGAA 2UXDF 2KYZA 3N5BA 4K4WA 2W8LA 4F4YA 2QA1A 4F8RA 5HATA 3KKFA 2DCLA 1IBMJ 5LMUJ 2QX0A 3KJFB 2BQRA 3DLHA 2XLKA 2ZBQA 4W98A 3C66A 4DU8A 3SCJE 2B9WA 3H40A 3BQ2A 3ILIA 1U4BA 1GX6A 4TNOA 4AXJA 3W9HA 3CCVS 1FERA 1G3OA 2KT3A 2QMXA 3W66A 3A3NB 5ETNA 3PX4A 3QPIA 4ZA1A 5D3GA 2FY8A 2E5LJ 1SI9A 1WSRA 3C15B 4Q43A 1OO0B 3R27A 3SQGA 5K8PA 3KK2B 4F0HA 4J91A 5B08A 1N5TA 4KR0B 2K7KA 4I68A 4O3QA 3CC2S 2WHOA 3A4TA 2ZHBA 3AOCA 1LW0A 3GYGA 3W61A 5T7LA 4C11B 1NCLA 2CJXB 3ZTSA 5I42A 3NGKA 4MT1A 2DGXA 1S76D 2XCAA 1VGYA 4GKKF 5HBMB 4B3TJ 2QV6A 4ES2A 5KFEA 1OY9A 5GADU 2BKPA 1HBOA 2BM0A 1PCAA 3PTWA 1RBLA 2MKSA 4O4GA 1YJ7A 2CZ4A 2CUYA 4CH0S 1KNZA 3D54A 3TX8A 2J0SD 3V6KA 1R7IA 1SPBP 1WG4A 3FRZA 3VAGA 2ZC4A 4HDHA 1TK5A 2RRAA 1WKJA 2RF2B 2MLYA 3BO4A 1SKSA 1DTQB 3ET6A 1S0OA 3RRGA 1F1BB 1JXVA 1U2CA 2LMIA 2QE5A 3MECA 4PWUA 1DLOB 5HLFA 5LJ5Y 5IOLA 3HJFA 2QLWA 5A8WB 4YDXA 1HFEL 4DZ6A 2B9YA 2CJQA 3ONQA 4HLBA 4N8NA 5HO4A 2HMIB 4ZVOB 4YS2A 3PIOQ 4ZVHA 1Q81T 1Q95G 4OZJA 4PYAA 3I32A 4Y65A 2J9DE 2HQFA 2L3MA 3SSRA 2W1BA 3BZQA 2GHPA 3R3TA 2CNNB 4MFBB 4ZKAA 3SYZA 3GJSB 4RWWA 4M5GA 2UUBJ 3BF4A 5BR8J 4MKYA 3JSYA 3VWSA 5C25B 3W5ZA 1IKVA 1HWJA 4DL3A 1VQ9S 2CQGA 4ZVUB 1U47A 5FD1A 3EPGA 2IM2A 1BLUA 2QC3A 1B70B 2RQMA 3OTOF 3Q22A 3AXKA 3V6DA 1HNZF 1VYAA 3IFEA 4M5MA 4P6QA 2DYAA 1BQMA 3TA1A 2RS2A 1BXNA 2R8JA 1ZM4A 2IYGA 1BE4A 2GQQA 1CC8A 5K5MA 3AXMA 4C98A 3M8QB 5ETPA 5J2NA 2A18A 2BR0A 1O5JA 2QGFB 1JJ2R 1D0EA 3SXLA 3GCWP 1SL0A 1LWCA 2DPJA 1OMSA 1U0HB 2ZNYA 1N48A 3SBMA 2BJ8A 1I1GA 1CVJA 1KOOA 2ZUGA 2LEPA 1K47A 3MAQA 1XMQF 3VAHA 1N33J 3G96A 4ED1A 4LFAF 2E5JA 2PC6A 3CD7A 4LFCF 3PW4A 4L73A 4NCGB 3V6JA 1PC5A 2FVRA 1X4AA 1S6OA 3L3CA 2YKMB 1GMVA 3DI6B 2OMLA 3TANA 1HPZA 2KTQA 2A2CA 2ZH8A 3DLBA 4NLYA 2B4UA 4LIWA 3IXQA 4YR2A 4DLEA 2OSRA 5FDLA 2LQ8A 3MEEA 4DV5J 4DJBA 1HIYA 2RHQB 2J5AA 4NX9A 4YB1P 2CZVC 2AQ4A 3PIPQ 2XTJP 5HROA 1S6PA 1JQGA 3U02A 4DR3J 4EEYA 5G0RA 1FJ7A 2HQDA 1N36F 4ZVRB 4GKJF 2XLIA 2EG2A 1TUVA 1HQUA 2O66A 2M2BA 3AA9A 3LWMA 2IM3A 2YWFA 7FDRA 1ROFA 1IR2A 2LDIA 2MJNA 2VKRA 2X3GA 3OD2A 3TZXA 5F8GA 1N54B 4KE5A 4DN0A 2QLBB 3PKMA 1RTDA 2ZFHA 5E3PA 2KT5A 9ATCB 2UUCJ 4GO5X 2RS8A 3FSXA 4KGZB 4CNYA 2MGZB 2D9OA 5A8WA 3OV7A 5I42B 4J9KA 1KSPA 1S5ZA 4LF2A 3I0SA 1PAUB 1Y5LB 2FJEB 2FJBB 1FDBA 1T11A 1H73A 1U02A 2O3DA 4MKBA 4OHYA 3BGRA 5D4LA 3DKDA 5J2QB 4PQUA 5IZHA 2NPFA 1JNZB 1IKYA 2Q66A 2OHDA 3NGRA 3NS6A 2OPSB 3CJ8A 4I2PB 5A6PA 2XNQA 2HWHA 2UUTA 3S1TA 2VIHA 1HYSA 1Z2ZA 4FKXA 3W3SA 1NPPA 3VAIA 4DV0J 4M5DB 2IJFA 3E01B 5CYJA 3BSOA 3T19A 4FYYB 1XR7A 2MSSA 3DRRA 5LM7E 4O44A 2B8PA 2GIFA 1HQ2A 3NNAA 5IT9Y 1RT5A 3PG9A 4ZPCA 1JX4A 1Y11A 3OQ2A 3ZTPA 3H42A 2ZKUA 3KK3A 3RB4A 1KC8T 3UN3A 2ZH9A 3M32A 3KG4A 1TELA 4USKA 2IC3A 2MYFA 3DNCA 3QRRA 4JI3F 2XYGB 4IFYA 3CCSS 3W2VB 2DGOA 2MHEA 4G1IA 3CCLS 3GLJA 3H90A 1TKXA 1H2VZ 2DXFA 2CWKA 4U8YA 4QBUA 4N47A 1I51B 1PYOB 2ZVSA 1R0AA 2M8DB 1C1CA 2HNYA 5F8JA 2X1BA 3HULA 3MMJA 1FK9A 1TL3B 1X7VA 1Y3JA 4J9SA 3I9ZA 4NCGA 1FJEB 4OV6A 1R6YA 1M5OC 3B82A 1S7HA 4PPZA 2ZC3A 4HT5A 4QWDA 4TU7A 2KKHA 1WWHA 5K20B 1VC6A 2B9XA 4LQ9A 2E1MC 1RZMA 3BGFA 4RO0A 1R89A 2B7CB 1H7WA 2YBVA 1YIJS 3H5XA 5CD4H 1MWYA 3EMTA 4B9SA 3S01A 2VD3A 4K4TA 1FXRA 1NO8A 1TKTA 5U47A 2VFUA 2X7IA 3A8KA 5J1PA 3VZHA 1LNQA 5EWFA 3VALA 1VLYA 4NMLA 3MR2A 4KFBA 2Q1LA 3DRPB 2DIVA 2YPZA 3HXMA 3UCGA 4NLRA 2HGNA 5IWAJ 5M2PA 4QW9A 1YRTA 2H1YA 2DH9A 3LP2B 4CLSA 5H9FK 1HNZJ 1IBKJ 2EBGA 3DXSX 3R8YA 2YKOA 2ZBPA 3KG0A 2Y0BB 4PABA 4ZCIA 4ZHRA 4BHQA 2V2VA 4E0DA 3NNHA 3N9UC 3P5TL 1AUSL 4B3MF 3M8PA 3TZYA 2DNGA 4A8SA 3CT9A 4I64A 3UO0A 1UVMA 1S6QA 4K59A 3NL0A 4ICLB 2KDOA 2V8GA 3JS9A 2EK6A 3N6MA 1RAOA 1K44A 2C2KB 4ZPDA 4CO1A 2VQEJ 4U6PA 1R43A 4FYDA 1N33F 3GZ7A 5AXLA 4DDFA 2NR0A 2XG8A 2R2RA 1Q1KA 1R31A 3U1MA 3UVJA 4A8XA 4OZ1A 3AJDA 5C2CA 5AE2A 1T9WA 1Y4ZB 4URSA 3OVBA 3I9V9 4DCJB 4QU7A 1NHUA 1RTIA 4CTAA 3LO3A 2I9SA 3GWCA 2WOMB 4I2QB 1WKLA 2KVQE 4LF9F 5ETVA 3FCHA 3C16A 5HQMA 2HHUA 2W4DA 3IRXA 3FSYA 1HARA 3VQSA 3M1VA 4X4OA 4C4WA 3GFYA 3OTDA 2EFQA 2JFDA 3HFZB 2VPZB 3TUZC 2GQ2A 2NUHA 4LREA 2OPQB 4OI4A 4EWTA 1WC1A 2QL9B 2RKIA 4Q2LA 1QVGR 2UVWA 2AJQA 1RE1B 2MKKA 3KWMA 2UUBF 4H4OA 3X3UA 1TFYA 3BO3A 4YHHJ 3GYNA 2PA8D 4NLDA 4P9SA 5IC4B 4DX5A 5DDPC 1EQ0A 4O3RA 4DR5J 4HHHA 2CQ3A 2C22A 1FVSA 1S9EA 1VQYA 4U95A 3RGIA 4F26A 2UUCF 3NP5A 4ZMMA 2BE2A 4P7TA 3HO1A 3BN4A 2G1HA 2E5HA 1GMWA 1QE1B 2CWXA 2HNDB 2UV8A 2AGOA 3RR7A 2MZJA 3LALA 1TU0B 1G2EA 3H2LA 2CKWA 4O3OA 2K06A 3G8QA 1FKAF 4F3OA 3LF0A 3LH2S 2ZDPA 4WXWA 1TVRA 1RAHB 2VFTA 1FE4A 4FVCA 3SI8A 1C4CA 2F7VA 2V9KA 3I55S 4J9LA 4B3OB 1CULA 5KFUA 2QYCA 4E2FB 5JVHQ 1YJTA 2EEYA 2IHR1 3OXLA 4PWWA 3TUJC 4OYIA 4C0BA 2DY9A 1U24A 1JKHA 2BJ7A 2XZTB 1NJIT 2DISA 4ID5A 4YFUA 1YSJA 2GGPB 1H98A 1JJHA 1FWLA 1NHKL 2CJAA 1UWBA 3LPYA 2AWZA 4WFYA 2OEJA 4FNIA 4I1TA 5E7OB 1XMOJ 2OP5A 1S10A 3BBBA 4DQRA 3MD3A 2J6UA 5EHHA 2HFOA 2IVYA 2QSFA 2GFFA 1N34F 3UW1A 2BOPA 1N5QA 3P4UB 1GTHA 3MM6B 4LF4J 1I5OB 1WOSA 4XDCA 2CJKA 3MOJB 4NEZA 3QIDA 5KFLA 2FZKB 3PYDA 4P2XA 3PW5A 4OZ5A 1GAOA 1SQGA 3LANA 4USUA 1R8CA 1W7WA 3H2UB 2AZ1A 2DY1A 2MLXA 4KKOA 2CQIA 1EQMA 1H7XA 2DKOB 1RT6B 5B0AA 2I2YA 2DHHA 1FE0A 1LWXA 3TARA 2BANA 4DV7J 4DS5A 1U48A 1FO1A 4NPOA 4TY8B 2B6AA 1C1BA 2YNFA 3CJRA 2VICA 2P9EA 3PNIA 4KYZA 2QN6B 3VZIA 5LJ3Y 3W2WA 2DR7A 1QLNA 4I2QA 2JEIA 3TNVA 2B5JA 1VRTA 4YEAA 1HBNA 4ZLPA 2HZVA 1M0SA 4KHRA 4RW6A 1L3VA 2YX4A 2Z8QA 1ZS6A 2UUAJ 3JTPA 3R7BB 5E41A 2RQCA 4B9TA 5BXIA 1QSLA 1WEZA 2MHNA 4OZLA 1RJJA 4RJVA 2R2UA 2DNQA 3PR5B 3FFIB 1TMJA 1JLBB 1WC4A 3HVTA 1KQKA 2OPQA 1S12A 2PD1A 4J9VA 1KEKA 1OY8A 3H5YA 3OFEA 4J9RA 3KG1A 4CH7A 3OR2B 3KLEB 1WEXA 4DHVA 4GC6A 3TAQA 4M5DA 2BXJA 4UUWA 3FC9A 3DOKB 3R5AA 3JYTB 2RU9A 5KFFA 4UUXA 1KHVA 3GTYX 4QIGA 2Z0GA 1SC6A 3MM9A 1JB0C 3EGZA 3OW2R 1J2VA 1NUEA 2HEKA 3QGIA 3FBBA 5DM7Q 1MMLA 4Y3CA 3KJVA 2E1CA 4JV1A 1RWKB 4W92B 4LFBF 4U7CA 1X31C 1YJUA 4DF4A 3DRPA 4USVA 3HZEA 5HP1B 3T9NA 2CQDA 3CULA 2D3OR 3HD1A 1OY6A 3SCIE 1RHMB 4MJKA 2XSFA 4DV4F 2CYYA 1SL2A 2BEFA 3D68A 3BH7B 3EJMA 1M5KC 4W90B 3DOLB 4N76A 4DPXA 1UL3A 4RBUA 3V4IB 3L7PA 2QMUB 2B4OA 2KRRA 1O0PA 3DHWC 3L4BC 4CRJA 3BKTA 1W25A 3LP0A 4JI8J 1RT1A 2KRBA 2NQPA 1TL5A 4X62J 2L9NA 4KO0B 1A9NB 4J5OA 2QTWA 4PXEA 4EMDA 4WCEQ 2V2QA 3LQVA 3QT6A 1RWMB 2VBYA 1NDKA 1XIQA 4MYUA 2PSZA 4F2SA 3NY0A 4NLWA 2A3JA 1FESA 3POTB 3AB4B 2NZCA 4F50A 2GS8A 1AROP 2DXEA 2LU1A 1S97A 1IWAA 3MM7A 1QSYA 3M8PB 1C2PA 1RT4B 2B43A 1KONA 3UNGC 4P7VA 2WOMA 3FMWA 3OL8A 1Z4UA 3GCXP 2FLPA 4OL8A 3HSGA 1EKSA 2AEMA 4OMFG 4OFZA 1RT7A 2JC1A 2M5YA 2VG5A 2WVCA 3A1YG 1VLOA 4M5LA 4EZ9A 1DBDA 1HD1A 4I0WA 4L3KA 1RAFB 2VA2A 1BC6A 1YJVA 4TYAA 1VIOA 4FZVA 2DJWA 2ASDA 4DV0F 4H4MB 1GEHA 5CA5A 1RYSA 4LFAJ 4ILLA 3W8GA 4MK7A 2A6MA 1FRJA 4O4GB 1RTJB 1UEUA 2V2KA 3BYRA 4RW9B 5KFCA 2B0GA 4AFFA 5A2QU 5KG2A 4K50A 4ED8A 3D67A 4C0HA 2GA7A 3DGPA 4NWBA 2GAHC 1WC3A 1YITS 3PXGa 5LXYA 1OSDA 1Q0NA 2HHPA 3M6XA 4O3PA 3V4MA 3MGJA 4QWBA 1S1UA 3KLVA 3CD6S 2ZBCA 5IFMA 4JYAF 3JYTA 3UE2A 2RKIB 1M1KT 1H2UX 3I4PA 1Y00A 1A0OB 3RUBL 1N56A 2HRUA 4F02A 4HI1A 3E01A 4JI5F 5KTQA 4KB7A 4WE1A 4CO3A 5IXUA 3PCOB 5KFNA 4DSIA 3C2PA 1YX2A 4MK8A 4MH8A 5CYMB 1MU2A 3J80Y 2HHVA 1RHQB 4NMXA 1VQOS 2AD9A 4C9DA 4HTJA 4RW4A 2U2FA 4OI6A 3I56S 1HD0A 3MMAB 2J9CA 1HMVA 4AYBD 3IBFB 4XK8C 2ROEA 1JXLA 1L3UA 3M6WA 4CLPA 3CDAA 4K8RA 2PT0A 3LW5C 1P1TA 1FXLA 1X4GA 1X0FA 3TAMB 3QATA 1HPZB 1YRUA 1C4AA 3I6PA 2E1RA 2IAJA 3ENAA 2JSXA 2YX1A 3I96A 1KR4A 1KTVA 5LL6d 3K58A 3BJYA 1ZA1B 3D0GE 5D77A 2GZOA 3TRGA 3V6HA 4DFJA 2EI5A 1WDTA 4LR9A 5KT4A 4HDGA 4QWEA 5F0UA 3VVTA 1YWXA 2GVDA 5C24B 4GVLA 3QRPA 1FWKA 2MLZA 4TQRA 3BN7A 4EUVA 3VGSA 1C1BB 2FHKA 1KTQA 1VISA 2OFGX 2YNFB 3JTNA 2LKZA 1XMOF 1TQLA 3KHHA 4U8VA 5KFRA 4WXOA 3RJMB 1TV6B 2Z4PA 1NSQA 3BKFA 1VC0A 4LF9J 1GQEA 1A6LA 3IA0A 3OL7A 2ZHAA 2GAGC 2CQ1A 4QIFA 3NGUA 1VI7A 2E7WA 4FF1A 1C0UB 3SFUA 5KFJA 2MTLA 3CGIA 4CLWA 1UP1A 2GHVC 3D7SB 1KQFB 4YQWA 3L7OA 4FF4A 1JNRB 3OUYA 4OYOA 3CW2C 2GCFA 4J90A 4C6AA 4ZHRB 3WDOA 2B51A 2BJ1A 3T5HA 2NPIA 3WX8A 1R8BA 1IM4A 2QL7B 3J7AN 3S6EA 3G2XA 2AW0A 3LTOA 3SDEA 2XY5A 1CS4B 3PM9A 3MUMP 4LF8F 2A6OA 1YBAA 2QIFA 3IGVA 2GHWA 5KFVA 1HBMB 1S9GB 4K4XA 4LIRA 1F2GA 1RWPB 4GVBA 3BBCA 2W8KA 1Q16B 1T05B 3QBCA 4WP3A 1TK8A 3PYEA 5HBMA 1RADB 3D66A 5K8NA 2B5JB 2C2ZB 2F4VF 4WTOB 4DL6A 4ZPWR 2VQFJ 3AQPA 4DX8H 4P71A 1T9VA 1Y10A 4C0OC 2IBOA 2OD6A 2MGZA 3OSNA 5CCLA 2UUAF 3OFHA 1KDNA 2MDAA 4WYLA 5A8RB 3RB0A 2RNEA 5D8HB 1IQZA 4GVBB 3BV8A 5BYQA 3JSMA 9RUBA 2DR9A 3NWGA 3IRXB 4QZVB 2FC9A 3AD8C 3W1YC 2HVHA 3TVYA 5K8OA 4ILMA 3KK1A 1VS3A 4J37A 2NXNA 5L46A 3PJWA 2HVDA 1AA1B 2J9DA 3K5NA 3CPWR 1P9QC 1T8EA 1UFWA 3OJSA 1UA1A 3VAFA 4H4OB 2P9CA 2DNZA
chains in the Genus database with same CATH topology
3HI9A 2CPIA 2HAIA 2RD5C 1JLFA 2YKQA 4ZVEA 2F8HA 3RBEA 3O2IA 1HQEA 1OQ3A 4ETZA 1RT4A 2ZH5A 3H59A 3OFGA 1QTMA 1F5BA 3IN5A 2YTCA 1HNIA 2DTJA 4A8OA 1U6ZA 2Q3PA 2WSEC 5KFGA 2NXUA 2BZ2A 4RNNA 4RUCA 3K57A 3AB2B 4KHMA 2AF6A 1IBLF 4QW8A 4K0KF 2UU9F 4C3KA 2LEAA 2YNHB 3MM8B 1C0TA 3DLJA 3KHRA 1ZH5A 1TL3A 4JI8F 1YJ9S 3NNCA 2E9TA 3IBWA 2XWYA 3RR8A 5JVGQ 2GMJA 1C0UA 5I4MA 2E66A 4IG0A 1R8HA 1SJQA 1UMJA 2YVSA 4NLTA 1T3NA 4ED5A 5AE1A 2E9RX 2HPUA 1VIXA 5KFSA 2ZKTA 2R7WA 4O0IA 4RW8B 2NUUG 1K0VA 3FJ2A 2I38A 3QLHB 2HQIA 1SJRA 1ZAXA 5L1IA 2Y1IA 5DQHA 1WACA 3F73A 2DGQA 4ELTA 2CVEA 2XSJA 3CJ2A 1FEHA 1FA0A 1SUQB 1IJEB 4JV2A 1ULRA 2AJFE 3CCWA 3CJ0A 3M8RA 2C3OA 2HWTA 4ZPTR 4N5SA 4IR9A 4AUKA 3OL9A 1FDNA 2QRRA 2VASA 1IKYB 3ICLA 4M63A 5F8MA 1Q7LB 1L3TA 4JBCA 3PO4A 2R7TA 3F56A 4KAIA 3U27A 3QGGA 2J9EA 3R5DA 2VUGA 3M2VA 4NLOA 3PZPA 3D1HA 1HR0F 4I56A 2FY1A 2D74B 2ILYA 4IO1A 4NRTA 1RISA 1VQSA 4K4VA 3WX4A 3PEHA 3ISNC 3DRRB 2ZDOA 2ZD1A 2XLJA 1AFIA 2EG1A 4MFBA 3TOQA 4EO8A 3MFIA 2P9GA 4RZRA 3ENQA 4DSKA 4IFVB 1O8BA 2APOA 5AXNA 2AJ1A 2AV5A 5B0CA 1T03A 2FVQA 2DRAA 4CI0B 2PA3A 4JOUA 5A0YB 3V6DB 3HMJG 2OPSA 1LOUA 1FRHA 2FLNA 2KG1A 3IGNA 3BREA 4B9LA 3MECB 1FKOB 1GX5A 2JEJA 4HYKA 3OBIA 4NLQA 1FRLA 4ZPBA 2DD8S 1FNOA 4NCAA 1ZZFA 4DEZA 1HA1A 2SXLA 1FVQA 3N5FA 4F67A 2F40A 2E44A 3NS5A 1KS2A 3B4MA 4QQBA 5LSOA 5G4DA 2BQUA 3Q0AA 3CE8A 4YUDA 2HVZA 3UFCX 4DQSA 3LOUA 3MHYA 4F4WA 1M5VC 2FC8A 4URQU 1VBYA 5KFMA 4OHZA 2Q6BA 3MPWA 1WF0A 2OFHX 1XR6A 1SJ1A 3PHEA 1BGXT 2CPDA 2C3UA 3O6QA 5J1EA 4ES1A 2FVPA 5GAEU 2PMZD 1DTTB 3H5SA 5C42B 2YWGA 3NCPA 4ECSA 4PKDB 4A8WA 4JV5F 5D3GB 1TV6A 3T5KA 3MPYA 1RWUA 2HS3A 4JI1F 4XPEA 4YB7A 2D3UA 1D9AA 4I7FB 2B56A 5J2PA 2G4BA 4MKAA 3E8OA 3Q23A 2XSJB 1N52B 2W24A 4V19J 2FPHX 2JLFA 4RUHA 3HK2A 2KFZA 2GJ2A 2NYIA 2J0QD 4ECZA 3OVAA 2RJZA 4C3MA 2OJ3A 3BGUA 4LSLB 2X1AA 3TVZA 3OFFA 5I3QA 3J7Z5 1Q82T 3QWPA 4LF5F 3VF0B 1M5SA 2JVRA 1SXLA 2W4CA 3KK1B 3CCUS 3TVKA 5KG5A 1WF2A 4LMZA 1YI2S 4IOBA 2CPJA 3UR3C 4CQ1A 5KFDA 5L9XA 3EYZA 2EFPA 5DLGA 3KLFB 3G71S 4ID8A 5KFHA 2WB1D 2BV3A 2OSQA 1ZTWA 4EBEA 1TP7A 2VONA 2BVZA 3E51A 2B4PA 5DRKA 5T7LB 4X4TA 1VMBA 2VBXA 4K5RA 4DSJA 2GNKA 2WBRA 2W25A 2DNYA 5EWGA 2KHCA 4Y28C 2VQFF 2XI3A 1HNIB 2LXIA 3BSCA 2J6SA 1JLAB 1K1QA 2YKAA 3R5CA 1T02A 3FEXB 4M1KA 5FIIA 3MEGA 3QZ8A 4IRKA 2GO9A 4DWIA 4K4ZA 2IFXA 4QCLA 3GIJA 3H2VE 3NRBA 2MKCA 3U1NA 1K9MT 1DHMA 1MSWD 4BS2A 4Z37A 2DPIA 4OX7A 1NK7A 2FVSA 2XS2A 4J9MA 4ES3A 2CQBA 3QGHA 5IT0A 5EDWA 3VAKA 5HQ8A 2I1RA 3FVYA 1H2TZ 4QYRA 4C97A 4Q8FA 1N32F 3GE9A 3FGVA 5GAGU 2AJ4A 5DGBA 5DG7A 4DL2A 2XZWA 1QUVA 1ZM2A 1T94A 2F1FA 4Y34A 2ILZA 2ZH2A 4C3LA 2HNZB 1YRXA 3OXFA 3C6UB 4QIWD 2XB2D 2V8VA 4R0EA 5E5NA 4X4QA 4H54A 4MAKA 3LP0B 2DVIA 2GJIA 3KOAA 1PILA 3VAJA 3TI0A 4X64F 1M90T 4WTYA 4B02A 1XEZA 2U1AA 2WONB 1RYRA 5E3QA 4E8UA 4NXNF 4FS1A 1FJCA 2DK2A 3T1YF 2AP6A 2N3LA 3RTVA 4DL0C 4RU9A 2IYIA 3MEDB 4LF6F 1RA6A 3EX7B 1QUPA 3QIPB 3O44A 3MURP 2HGLA 3W2WB 3GIKA 4FN5A 2E9ZA 2VBZA 1HI1A 3DI6A 2NZ4A 2PN6A 3VAMA 1JWWA 1LFWA 2OMOA 2ROGA 4KFBB 2C3YA 2XMWA 2QZ8A 5E3RA 2OKQA 4LSNB 1S1VB 3KHGA 2G13A 4ECTA 5F8HA 2ZH1A 3R1LA 1NJWA 4BCAA 4TXSA 3IAM9 3M05A 2CPEA 3QLHA 4CZCA 1MU2B 2LU2A 2RQ4A 1EETB 4AL6A 1ZZNA 1I6JA 1S1XB 4RWXA 3DU5A 3GG1A 4TKTA 4J9OA 4ZK7M 4A8QA 3DOKA 2C2DA 3Q2TC 2YNGB 2DNRA 1FRXA 1RGVA 4FXWA 3P6YC 1RKJA 1S1WB 5K14B 4NZ0A 3M2RB 4DV3F 4FNHA 2N7YA 1I94F 3MEKA 2X1FA 4JUZA 4P2SA 2ZOFA 3J7YU 2LECA 4DV5F 5IQ6A 1M5HA 3FQKA 1LW2A 2GO8A 1U6FA 2X51A 1HNWF 2M9KA 3FNNA 1CG2A 4DL4A 4ED2A 4C8NA 3VCDA 1D8YA 3J7A1 1S1TB 1Q86T 5DG9A 2VG7A 4WK3A 2HQ3A 3V81A 3IS9B 2MJUA 3CVKA 3DLKA 4X62F 4IDKB 3EZ5A 2FUG9 2AX0A 2HHQA 1K1SA 3RAXA 4A8KA 2M70A 3BSAA 1QSSA 3CJKB 1QAXA 4HTIA 3MM5A 1TAUA 3IRWP 4OLPA 1DARA 3BR8A 5DJBA 2JDJA 3KLGB 1UJ4A 2YNIB 2KXFA 3CJ3A 4OZNA 1NK8A 1YVFA 3DDNA 3KLFA 5A8KA 1S0VA 1WG5A 6FD1A 2DCUB 2WRMA 1RT2B 2ZM6F 3UR0A 2EFNA 2UVRA 1C1CB 2QO3A 2YKNA 2IRXA 1ZBTA 2E1AA 4E98A 3KLHB 1U1RA 1RT6A 2YWEA 2DHGA 4EYIB 5L1KA 2DHXA 3HVAA 3PY8A 3ISND 1X4CA 1X0PA 1R27B 2DT9A 5EWEA 4IOAQ 2M88A 1Q79A 5GADI 3BO2A 4ILRA 1RTJA 4RW9A 3W7BA 3CC7S 3S7RA 3V5RA 1FJGF 1SV5B 2YKNB 3Q8RB 1B0TA 5EUHA 5LMNF 2M52A 3PX0A 2VG6A 4N8OA 3EGNA 5T41A 1L5UA 1TAQA 5KFZA 5KG4A 5HMZA 4LF4F 4HL9A 1X9SA 5B0EA 4PG4A 3MUVP 2VG5B 4I6YA 4DOZA 3KMSA 1CC7A 1EETA 1MROB 3KNGA 1S77D 2GMLA 4CTAB 1VQ5S 1IKWA 3C6TB 3G6XA 1CPZA 2MZTA 1N5VA 4PQUB 4CO4A 2W7PA 1DTQA 4IO9Q 5FJ4A 2JH3A 1DQ8A 1ZYQA 2B6AB 2HNYB 3OLAA 2ZBIA 4B9VA 2EBEA 3AH6A 3CJ5A 1S1UB 1VBXA 5HP1A 4USIA 3IAS9 4Y2CA 4RW7A 3N01A 2IC3B 1KOHA 4O23A 4C8ZA 1R8PA 1XMBA 2L41A 2JEGA 2R2SA 2OO4A 2EFVA 3RU0A 3ZZ0A 1S4FA 4NYOA 5KFAA 2IRUA 4FF3A 4NYZA 1ZAWA 2POKA 3N0VA 2VQEF 1X4EA 1JLAA 4YOEA 4X84A 1VQ8S