2DIVA

Solution structure of the rrm domain of trna selenocysteine associated protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
99
structure length
99
Chain Sequence
b'GSSGSSGMAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA selenocysteine associated protein
publication title Solution structure of the RRM domain of TRNA selenocysteine associated protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2divA01
3CCES 4IOAQ 1VQKS 4TU8A 5DDRC 5CYJA 1VC0A 3BEGB 4QQBA 2KM8B 2DH8A 5LXRA 2CQ1A 2DH7A 1Q82T 2ADBA 2MKHA 2KI2A 1URNA 2DNPA 3US5A 5MLCV 1Q7YT 3TYTA 1ZH5A 1JJHA 1VC6A 3IRWP 5LSOA 1VBZA 2DGVA 2MKJA 4WF9Q 1RK8A 2CQDA 3G8TA 1U1QA 2MQNA 2JVOA 2YH0A 3CMAS 4C4WA 1YHQS 1VBXA 3BS9A 1KQSR 2XS7A 3S01A 2HGMA 1D9AA 1Q86T 5DM6Q 2L08A 2KH9A 1X4GA 1OPIA 1SJ4P 2DNYA 3UD3P 3LPYA 5DDOC 2FC8A 2Q79A 2DNKA 1H6KX 1K8AT 1AUDA 1H2TZ 3UE2A 2M8HA 3EGNA 3B4MA 3BO3A 1UW4A 3Q2SC 2DGXA 1YI2S 2PEHA 4Y00A 3R27A 4ZKAA 2KXNB 3MD1A 2DNNA 2DO4A 1U1NA 4PKDB 5CA5A 1WI8A 3OW2R 2AYMA 1WEZA 2AYGA 3RW6A 1WHYA 2MJNA 1Q81T 3NS6A 2NLWA 2MKCA 3UCUP 3VAFA 2DNGA 2DGSA 1OO0B 4WCEQ 1JJ4A 2OTLS 2DNLA 2MKIA 5LJ5Y 1K73T 2BZ2A 1VQ9S 2DGTA 3G9CA 1VQMS 1OIAA 2YKAA 2HGNA 2MGZA 1DZ5A 2LECA 1WEXA 2RS2A 1YIJS 4CIOA 1U1MA 1WWHA 3CC4S 3NNCA 5D77A 3L3CA 2DNMA 1YTYA 4ED5A 1VQNS 1HL6A 2MZTA 2MQPA 4BS2A 1N54B 1NU4A 4C0OC 1FXLA 3VAHA 2EVZA 1N52B 1X4DA 4OZ1A 1A7GE 1X0FA 3UCGA 3MOJB 2VOPA 2KG0A 2CQ0A 2E5GA 5H1SV 4C7QA 2KVIA 3NNHA 2FHOB 1X4HA 5IM0B 2BOPA 2KYXA 4FXVA 1WEYA 3UCZP 2ZJQQ 2DB1A 2LEBA 2MZ1A 5JVGQ 2CQHA 4WKRA 3RW7A 4TU9A 3SXLA 2ADCA 1R8HA 3N9UC 1P1TA 2MHNA 4V19X 2RRBA 1X4FA 3P6YC 2DNOA 2DH9A 1X4AA 4TU7A 5LSLA 2ZJRQ 5IM0A 1U1RA 1KC8T 1M5OC 2DGQA 5GMKa 4P6QA 2DHXA 2CPDA 2CPYA 3ZZZA 2CPZA 2RNEA 2X1BA 3VAMA 5HO4A 2KFYA 3VAIA 2M0GB 3CCLS 1X5SA 5DDPC 4WIIA 4YOEA 3P49B 2V94A 2L41A 1N88A 2CQPA 2RU3A 2DO0A 3P3DA 3THTA 2RVJA 2DHGA 3S7RA 4F26A 2XB2D 1FT8A 3CCQS 2OIHA 4W90B 2U1AA 2DNQA 3CCMS 2CPHA 2CJKA 2MSTA 3JB9k 2X1GA 2J8AA 2WBRA 3VF0B 1WELA 3MURP 1FJ7A 2J0QD 1VBYA 2KXFA 1U1LA 1PGZA 3FEYB 2KHCA 2LA6A 3CPWR 3CF5Q 4RU2A 2A3JA 3Q2TC 1WF1A 2LYVA 1KOOA 1NO8A 1SJRA 3G96A 4CH0S 2QEXS 1H2UX 1X5OA 2KXHA 3CTRA 1VQPS 1D8ZA 2J76E 2XNRA 2DGOA 1DBDA 5GAHU 2M4MA 2G0CA 5GAEU 1YJWS 5ITHA 3MD3A 1UP1A 1IQTA 4LMZA 3VAGA 1VQOS 2VOOA 1YITS 2RUGA 5GAGU 2MXYA 1SJ3P 1M5KC 1BY9A 4QPTA 3BO4A 2MGZB 1U2FA 3CULA 2MKKA 1X4BA 2MB0B 1M5PC 2GO9A 2MMYA 4J5OA 3LQVA 2MQMA 2LXUA 1YWXA 3CXCR 2XS5A 2D3OR 1UFWA 4IOCQ 3CC7S 1FHTA 3U1MA 5EN1A 2OJ3A 3H2VE 2CPXA 1B7FA 2DISA 2JWNA 2K8GA 1R8PA 2CQBA 2MYFA 3THPA 5GADU 2M7SA 2N3OA 2DIVA 2E44A 2XS2A 1WG5A 3CCRS 3B4DA 1VQLS 2XNQA 2YH1A 1U1KA 3CCSS 1XN9A 2ERRA 3U1LA 3S8SA 2OSQA 1WF2A 2KRRA 1WHXA 3VAKA 1QM9A 3ZZYA 1ZZNA 3IWNC 1W2BR 1WI6A 3DLLQ 1VQ5S 4W92B 3CCUS 2MY7A 1U6FA 1PO6A 2HVZA 1OWXA 5HL7Q 1O0PA 5LXYA 4ERDA 2AYEA 3SMZA 3TO8A 2CPIA 2N7CA 4F02A 4UQTA 3G6ES 2KN4A 2X1AA 1WHWA 5D78A 2DGUA 2CQ3A 3V4MA 2DHAA 5LJ3Y 2PE8A 1SJFA 4A8XA 2LXIA 4EGLA 2E5JA 2HGLA 3UD4P 1VQ4S 1NJIT 4WFAQ 3VAJA 1U6BA 4U67Q 2F3JA 2M52A 2KT5A 1VQ6S 1H2VZ 3K0JA 2DGWA 2U2FA 4PRFA 2M70A 3EX7B 1N8RT 4LIRA 3HI9A 2OSRA 2DHSA 2DIUA 1WTBA 2JX2A 4QU6A 2LKZA 2SXLA 2QFJA 1SJQA 3ULHA 1YJ9S 3CMES 3NNAA 4IO9Q 1HA1A 2D9PA 2MY8A 3TP2A 3UWTA 1X4CA 2FPHX 3DXBA 4FXWA 2KRBA 2N3LA 1M90T 2MQOA 2J0SD 1JMTA 2M9KA 2RQ4A 1X5PA 3D2WA 2MZSA 2LCWA 2RS8A 1F9FA 2KM8C 5DDQC 5IQQA 2CQ4A 2FC9A 3BO2A 1VQ8S 3MI7X 1UAWA 2I38A 4Y0FA 2M8DB 2I2YA 1ZZFA 2KG1A 1DHMA 1RKJA 1KD1T 2RQCA 4YUDA 1FNXH 1L3KA 3G71S 1CVJA 2DNRA 2X1FA 1QVFR 2ZJPQ 1X5TA 4WFNQ 1U1PA 2F9JA 4YB1P 3NMRA 4OZ0A 2G1DA 2DITA 2K3KA 2E5IA 2MSSA 2YTCA 2AD9A 1S79A 1A9NB 2MQQA 1K9MT 3MXHP 4Z2XA 4CH1A 3CD6S 3G4SS 2D9OA 2CQ2A 2MZRA 3P5TL 2FY1A 2MJUA 5DETA 4IUFA 3PIPQ 2VONA 2CQIA 2B0GA 2F9DA 2MZQA 2UP1A 2DNHA 4PR6A 2O3DA 1S72S 3MUVP 2HZCA 2QA4S 1M1KT 2DK2A 2JVRA 4F25A 2XSFA 1VQ7S 5CXTA 4M5DB 2CPEA 2MKSA 2MPUA 3EGZA 1P27B 4TLQA 3CCJS 3VALA 2LMIA 4WFBQ 1U1OA 5GVQA 3J7ZT 2MZJA 2LA4A 3G8SA 2CQGA 2LEAA 1HD0A 3PIOQ 1KOHA 2KU7A 4QU7A 1SXLA 3CC2S 3CCVS 2DNZA 2NZ4A 1X4EA 5DM7Q 2LQ5A 2CPJA 5FJ4A 3H2UB 2CPFA 3I55S 2OTJS 1WG1A 3R1LA 1G2EA 1FJCA 3SDEB 3J7YU 2YWKA 2GHPA 2G4BA 3FEXB 1YJNS 2M88A 1FO1A 2EK1A 2EK6A 1QVGR 2VODA 2MQLA 2E5HA 2L9WA 3MDFA 4UY8T 3HHNB 3S6EA 2N82B 4LJMA 3I56S 1WF0A 1M5VC 2RRAA 2CQCA 3NS5A 3SDEA 1WHVA 4CQ1A 3CUNA 2JRSA 5JVHQ 3R1HA 1JJ2R 1DRZA 1FJEB 2RT3A 2AYBA 1HD1A 2HYIB 5BJRA 2M2BA 5IFMA 1WG4A 3MUMP 3MUTP 1VC5A
chains in the Genus database with same CATH superfamily
2VH7A 3KHRA 5LXRA 1SH0A 3R2DJ 4PWDB 4WWSA 1S6QB 3D68A 1BQNB 2LDIA 5MLCV 3DXSX 4CH7A 1MN7A 2ZBQA 4CLPA 4KSEB 2MKYA 3G8TA 4Y34A 2XWXA 2ZDPA 4L74A 5HQ8A 3QGPA 3CIZA 2J9DA 1Q5VA 2NZCA 3M32A 4FYWB 5EWEA 2VB6A 4X62F 4NLQA 4RKUC 1TK0A 4KGKA 3PJ9A 1SJ4P 4ZDNA 4ZVUB 3UE2A 1SQGA 1KRPA 4UF4A 1C1BA 2C3YA 4X65J 4I56A 5FDLB 5GAHI 4KQZA 4OI6A 2QYGA 1JLBA 2AYGA 4K4YA 4NLUA 4HHUA 1GXTA 4WCEQ 1JJ4A 2RHQB 2ZE2B 1HNWF 1VQ9S 1DTQA 3FQKA 3PM9A 2IPOB 2OPRA 5LM7E 2E1MC 3VGUA 1IR1A 4BS2A 3UN3A 2VASA 3W66A 4NLRA 4B9LA 3MEGB 4DV7F 2OEMA 3M8RA 1RBAA 3S1TA 1X4HA 3JAMU 1U25A 2OHDA 2WVBA 2XI2A 3N4WA 1HQUB 2ILYA 3OSNA 2DNOA 3M6UA 1GMWA 1IQZA 3SFGA 1RT5B 2V2ZA 3WX8A 4WIIA 4P71A 4B17A 4JYAJ 4A8OA 5D0RA 5L9XA 4B9TA 4Q7AA 4CLLA 2OPSA 1NHVA 4F26A 1QSLA 3SZ2A 2P9CA 2ZNYA 1MWZA 4N77A 2H65B 4WZMA 4OJHA 3EVOA 1OQ6A 2HRYA 4DV6F 3ENAA 3T6BA 1RTIB 2W25A 5I3PA 3NKYA 2O01C 4OYMA 5AE1A 2KL8A 2ZM6F 4KBIA 3PHEA 1X4BA 1H98A 3UQSA 1F3VA 4F2SA 3I4HX 3OFHA 4DV5J 2ZKUA 1WSRA 2CVIA 4E2FB 1QD1A 1WC3A 3ZNJ1 2VC0A 4RUHA 4OJ1A 4UOHA 4QOTA 1OJ4A 4QIGA 3ZXWA 4DL6A 2UV8G 2RUSA 4O4GA 2XLKA 2OSQA 2KRRA 1FNOA 3PYGA 5KFMA 4V1Ak 1HR0J 3OBIA 3NLCA 1UJ5A 2PMZD 1V5IB 1T03A 5J1NA 1TUWA 1APSA 1RT2B 4GKJJ 5A8WB 3LAKA 1S7IA 1GAOA 3OL9A 4HHJA 2A10A 2JHEA 1MNEA 4TXSA 1YK9A 3GTYX 1LWEB 1LV5A 4DL0C 2FGCA 5ETMA 3ULHA 4RW7B 3BREA 5F8JA 1X4CA 2VV5A 2YX4A 4DZ6A 5LMNJ 3HKZD 5DS7A 4JI8J 1NH7A 2IAJB 2AJ1A 4OZNA 3VVUA 2VPWB 5KFIA 2AMCB 3MMAA 4TLRA 2W1BA 3FRYA 2H4WB 1FI4A 3JTNA 3RBDA 4P74A 2X1FA 1F2HA 5EDWA 5ETVA 1K44A 4YB1P 3NMRA 5A2QU 4U8YA 2Z2ZA 2J9EA 3QGHA 2W2QP 1Q53A 5DETA 4IUFA 2IYIA 2FD2A 1VHFA 1TAUA 1EETA 2Z58B 1KFSA 4ECWA 2DK2A 2JH3A 3ZZPA 3K5PA 1H0HB 4M5DB 4LREA 4AYBD 2LA4A 2YNGA 2ZOGA 4KV8B 1LXJA 2IY5B 1X31C 2G2ZA 3BZQA 2HK3A 3M6WA 3BGOP 5K14A 4JUZA 4DXLA 1RI7A 2E7XA 4P2SA 1IBLJ 2B5JB 2ATLA 1VR6A 3BBCA 1FDNA 2XHCA 5B7WA 2W2PP 2AT1B 5J2PA 3DC2A 3EXYA 3OVSA 3CUNA 3MHYA 1PJ7A 4A48A 2KM8B 2C2OB 3CO9A 1MU2B 2BXJA 3BYRA 1FJGJ 2CZ9A 3TYTA 2VPZB 1E6VA 2N7YA 1Q79A 1Q8IA 3FBFA 2V5HG 4HTIA 1TAQA 2VPXB 2DR8A 4NLVA 3LGMA 4DL2A 4CYUB 5LOQA 1MMNA 5DDOC 2V8GA 1TKXB 1H2TZ 2M8HA 2DXDA 1NSQA 3D0GE 4B02A 1R0BG 2VHGA 3RGIA 3MD1A 2G2OA 2GGPA 1OSCA 4IG0A 4DL4A 2J7KA 4Y28C 2HWIA 2C1EB 2AYMA 4C6AA 1VMBA 2EFGA 4IYQA 1U47A 2JL9A 2BQRA 3ONQA 3MGJA 3W64A 1ZAXA 5A8RB 3R5DA 4NEYA 1Q95G 3MMJA 4H4OA 1TL4A 1DZ5A 1Q5YA 4QYZK 2OP5A 2KVQE 2VC1A 2V67A 1HL6A 2VQEF 2ASDA 2B3TB 3ZTPA 2ZKTA 3PZPA 1AUSL 1S9GB 2B6AB 2UXDF 4PPDA 2KVIA 2JEGA 1WDDA 1IKWA 3F0NA 1NSKL 3QZ7A 2R2TA 3D6FB 5M2RA 2P9GA 4ZN1A 4LR8A 2PIIA 2MDAA 4FZVA 3LPEA 2AU0A 2JEJA 1VOMA 5HMWA 1LW0B 4OX9J 4F67A 4MJKA 1GTHA 1YX2A 3S7RA 3GU0A 1S1VA 3RAQA 4A4JA 1FESA 3C6TB 3KDNA 2U1AA 4QYZJ 1RWXB 1S1XB 2YNHB 4IR9A 2V69A 5ETRA 5KT4A 1KLMB 2OUGA 1KOOA 1PAUB 4KGVB 2GMHA 5HN0A 4NX9A 3R2CJ 2W7AA 5RUBA 5GAHU 2CDRB 1S1UA 2RUGA 3MR6A 4C8ZA 5IWAJ 2OPPA 3HULA 4KRWA 2PDAA 3KLHB 4CT8A 2V8PA 4UY85 2K7JA 1M5PC 4IQXA 3RYLA 2D1CA 2AW0A 2CJXB 2F8EX 4ZP6A 3QWPA 4DV0J 3CJKB 3MMCA 3DRSB 4NRTA 2E66A 2W4PA 3PRDA 3VZHA 4MMOA 2XYGB 5HJYA 1R8PA 4PWWA 3BGRA 3C15A 2UVWA 3B4DA 1FD8A 3EJMA 2EC2A 3WQPA 1N5YB 1JLEB 4RW4B 1W2BR 5JJBA 2VG6B 1RT3B 4DR3J 2RAQA 3OHBA 3DRPA 2XC9A 3PRVA 2AYEA 3QNWB 3T9NA 1O8BA 3E51A 4I4BA 2Y1JA 3JSRA 2OPQB 1BC6A 1HARA 2QLFB 1VQ4S 1NJIT 4WFAQ 5J2NA 3PEHA 4PG6A 1E6YB 4NE9C 2GAHC 3KTQA 1KS2A 3GIMA 2OSRA 2QMXA 4KKOA 3J80Y 4DUYF 2SXLA 4ECRA 2DPIA 2KRBA 4X4UA 1XNQJ 4ED1A 3DLEB 3FSYA 4A47A 2JFDA 4B3MJ 4GKKF 2FB0A 3VVTA 1RWPB 4OHVA 2QL5B 1FK9A 4USHA 2WTFA 4JI6J 1JLQA 2ZJPQ 1U1PA 2RKIB 2JSXA 2G0JA 1RXOB 2DITA 3C3LA 3GYXB 1K9MT 1PSDA 3OT9A 2HZAA 2X3GA 5J2QA 2F63A 2KZZA 4RNNA 4ZP7A 5E7OB 1M1KT 4CM0A 4XO0A 4M95A 4DR4F 3LALA 1R0CB 1NMEB 3EGZA 3O5TB 1WC5A 2KU7A 1X9MA 5KFCA 4URGA 2HNYA 4JV5J 3V6JA 2RF2A 4IH6A 3KK2B 2ZH1A 2R2SA 1L3VA 3PJXA 2GS8A 3AJ2A 4NPOA 4UY8T 4HI2A 2CDQA 3QPIA 2ILZA 4BDPA 4AQYJ 4CQ1A 4KJIA 2NXJA 3V81B 3ENVA 1SKUB 4YDXA 1NK6A 1HBNA 1VQKS 4WK1A 5DDRC 1ZAVA 1N34F 3CJ5A 3M1VB 4OX7A 2ZBCA 3LWMA 1F6TA 2HFZA 2V34A 3LP2B 2BR0A 2RDDA 5ETOA 1U24A 1S6QA 2QIFA 2IM3A 1BQNA 3CJQA 4QIWD 3IS9B 3A8IA 3NGTA 4KGZB 2KJWA 3K8WA 1UEKA 1Q86T 2ZNZA 3D5MA 4L76A 3W63A 3G6YA 1YSJA 3TI0A 4GVBB 1RZMA 4YMEA 5A6PA 4IFVA 2QG9B 4ETZA 1FCAA 1H74A 2BRKA 1WKLA 1RYRA 4ZKAA 2EC0A 5LT5A 3KLFB 4C3KA 1Z4UA 1WI8A 2I5JB 4R0JA 2NSCA 2IDLA 3TANA 1T9VA 2MKCA 3UCUP 1MW7A 1KLNA 1U48A 4RJVA 1K73T 5FDLA 1IBMF 3I5AA 1CC7A 2DGTA 5CAAA 4PPZA 4IRKA 3M8SA 4U96A 2NUUG 4LF5J 3GJRB 5L46A 3A12A 1BGXT 2ZH6A 5KT3A 4TN2A 3CDEA 1N54B 3R6LB 2EVZA 1EQ0A 1LEOA 4D3GA 4J9SA 3PW4A 5MAOA 4USKA 1J27A 3OTEA 1PYSB 3BPDA 3CDAA 2DR5A 1FTRA 5CHCB 4N76A 2R2UA 4OLOA 1ICEB 3UCZP 2W8KA 2ZJQQ 2LEBA 5F0UA 3MEGA 1CSJA 4LFCF 2MHNA 5ETTA 1Z2ZA 2RE1A 3ILOA 2CPDA 3ZZZA 1C0UB 2HAIA 1EZZB 3MECB 2VIHA 3OFEA 4DX5A 3VTIA 2YQ1A 5L1IA 1RT5A 2UU9F 4LF7F 1HNIB 4TYAA 2R7VA 4ENOA 2IJFA 3K7RA 3NL0A 3GSDA 3OXFA 4NASA 4QWBA 5K8OA 3MR2A 3WHIA 4U7UK 2VU5A 2FQQB 1Y5LB 3BM7A 4P2FA 4ES3A 4I6WA 4GC7A 1UP1A 3CJTA 4NCAA 4CLZA 1SJ3P 2GIRA 4DDFA 4KO0B 4D3HA 2XS5A 5L1KA 1AXQA 2Q1LA 1ZAWA 4M5JA 2ZVIA 2CPXA 1WC4A 2XS2A 1WG5A 3A4TA 2YWGA 4G1PA 4U9RA 3R7NB 4KT0C 5HVGA 1KVIA 2XZDB 3IWNC 1U2CA 2XG8A 4ZVHA 1TK5A 3X1LB 3PTWA 1FE0A 3TZWA 4ZPBA 2I6WA 4OHZA 3V4MA 4DSIA 5AJ3F 2DHAA 1SJFA 4EFAC 4EGLA 3MWBA 3Q23A 4NEZA 2F3JA 4PUOB 3D0IE 1MSWD 3QO9B 1JJCB 3QGIA 1CJKB 4FYYB 5A8WA 1VCTA 2DCLA 1R8AA 4DX7A 3AJDA 3IBFB 5L9NA 2PI4A 2IJNA 4F0KA 2UUCF 3PG9A 3CMES 1CS4B 2ZD1B 3TP2A 5E2QA 2KDOA 2VJVA 3FNNA 3DOLB 2J0SD 3D2WA 2D3UA 1ITPA 2MZSA 2CJ9A 4ED8A 1FD2A 3FC9A 2V4JB 1TU0B 2DHHA 5DG8A 2LVWA 3Q83A 1DHMA 2H9ZA 2IAJA 2GAGC 2X51A 1L5UA 2YTCA 4ANCA 1S79A 2H5IB 5C24B 2PT0A 3GE9A 2F9DA 2MZQA 2FZGB 5HLFB 2QA4S 2Q43A 3DDNA 1XMQJ 2LMIA 5GVQA 4G1QA 3M2RB 1IN0A 5KFKA 3G2XA 3TUJC 4PWUA 3T9ZA 2NZ4A 4TYBA 2I0XA 4M5DA 4DG1B 2CPFA 3N6LA 3I55S 1MG7A 1EIYB 4KV8A 1NCLA 5M2PA 3DGVA 2EK1A 3TVKA 4K0KF 2V50A 2CYYA 1Y00A 1K1QA 1WHVA 4F4XA 1JJ2R 1HD1A 4RO0A 1N33F 2BE2A 2M2BA 4KHPF 5IV4A 4ECSA 2QA4G 3IM8A 5ETQA 2P9EA 2UUTA 2Y0BB 3CVKA 1VQSA 1WC0A 1WC1A 5HVHA 2VBWA 1LW2B 2Z2LA 3AODA 3PNIA 4JV0A 5LSOA 3KLGA 2MKJA 4F0HA 1OMSA 9ATCB 2WOMB 2HK2A 4EBEA 4LVNP 2V2QA 3LP0A 1IWGA 5F8LA 2UZAA 5SZTA 1R3NA 3BBBA 1FNMA 1UA1A 2M3DA 1OPIA 4FF4A 3OHAA 1JLFA 3W5ZA 4KGXB 1EB0A 1JKHA 3EGNA 1GTEA 4CYUA 2DGXA 4WP8A 2AV5A 4I0WA 4BBYA 4CM2A 2ZHOA 2AJ4A 1TKXA 5B0BA 2Q6CA 1CQNA 3DRXA 4DR7F 5GAGI 1FDBA 3DOMA 1BQXA 1KKHA 4NLPA 3HHLA 3DI6A 1T94A 4JI1J 2HHSA 1T95A 3ISND 3CWJA 1DQ8A 3DNCA 1HHSA 2B4PA 5A8RA 3BN7A 1RDRA 2CZVC 4C0OC 4Q2LA 3MOJB 2FLLA 2EFVA 1QUVA 4FXDA 3BJYA 2V8HA 1CJUA 2FHOB 2PN6A 7AT1B 1RAFB 4NOHA 2CJQA 2DB1A 5DQIA 1VDHA 3N9UC 4KFBB 2HURA 1T9YA 4EI2A 1FFGB 1NKEA 2AEJA 2RNEA 1W25A 2KFYA 3M9NB 4B3RJ 4X4PA 3H4DA 2H1YA 3P49B 3PW7A 2BANB 2JLEA 3AQPA 2H51B 1RWKB 1SC3B 2XMTA 4YHHJ 4DV1J 3I82A 5D4NA 3JB9k 3ZTSA 1OY6A 4I2QB 4PCQA 4ECTA 5KG7A 5CZXA 5D6GA 4NMLA 2RDJA 3CGIA 4I7FB 3C6TA 3N28A 4EZ9A 2YNHA 2J76E 1WC6A 4J9VA 1TTHB 4OYZA 4OI2A 3LF0A 3SQOP 1GK8A 3VAGA 3GMGA 1U26A 2MXYA 3BO4A 4J5OA 2BKOA 2JZ5A 3BKTA 1Y10A 1KWMA 4AL5A 2R7QA 2BEFA 5EN1A 3GP9A 3MM8B 3THPA 1BXNA 3CJKA 1U1KA 3DRSA 3S8SA 5D4PA 5CD4H 3VAKA 2P8IA 2QL7B 4NA2A 1RTDA 2HVHA 4ECUA 2HS0A 4ATNA 4WYWA 2XBPA 3QYYA 2AGOA 2UVRA 1N5YA 2A6MA 1YKWA 4RW4A 2DBBA 2PE8A 3CO0P 4DUZJ 1NDKA 1Q0NA 2LFVA 4N47A 3CMQA 3AD9C 4K4TA 3A8EA 4G1IA 4U67Q 2A0FB 3D1OA 2RH3A 5LMUF 1NK4A 2H54B 1HI0P 1T9WA 2L48A 2Z2MA 1TKTB 4ELUA 4DV2F 1YDLA 4OZ3A 2FPHX 4U95A 1S1TB 3C16B 3I9ZA 3ENQA 4RNHA 5IQQA 2I38A 1A0OB 4W4MA 4LF8J 2Q6BA 2ZVSA 3MCSA 3TW0A 1KD1T 1FNXH 5H9EK 1YGYA 1S10A 1QAXA 2XMMA 1RA7A 2K3KA 3DM2B 1TV6B 2JLGA 2CG8A 3W9IA 5KFOA 2FY1A 3GFHA 2X7IA 3W2VB 1N6QB 4ZCKA 4ZIVA 1DJ0A 4F25A 3GJSB 3AOAA 4F0MA 1XNRF 4RW8B 2QLWA 2MZJA 3RBEA 1KOHA 4NA1A 4MK7A 4QCLA 1AZSA 3UN5A 1SKRA 3TA2A 3D3BJ 3OD2A 1WG1A 4R25A 1V3SA 1FKOB 2E5HA 2KTQA 1FRXA 4LJMA 4FNHA 5H9EJ 3KK2A 1SC1B 2JRSA 3WDOA 3DN9A 3HVWA 5C7PA 3KWMA 4FBUA 3FKBA 4ED7A 1CQMA 3PW5A 4QQBA 4PYAA 2NYIA 2JDJA 3IM9A 1URNA 2DNPA 4ETXA 3IRWP 2RU9A 2C3UA 2DGVA 2NXCA 1TL1B 2ZOMA 2LEPA 1TQLA 3MEEB 2DXEA 5KT2A 1D3WA 2HGMA 4NLYA 4IDKB 5DM6Q 1JLGB 1XR6A 1X4GA 1HWUA 4CDIA 3QWUA 2PFFB 2KFNA 2OH2A 3IS9A 2IC3A 2KT2A 1K8AT 3E01A 2XZTB 4GVBA 2DNNA 4PKDB 5KOXA 3H42A 5GAEI 3I4PA 2WZ1A 1RU1A 3GSIA 2NXUA 1Z2LA 4UOFA 3WC2A 4KH0B 2MKIA 2VFUA 2MGZA 4PQUB 4LSNA 3NCQA 2XSJA 3L3CA 3W9JA 4ED5A 2BDPA 2K1RB 2J6UA 1W7WA 1X4DA 1A7GE 3UCGA 5HMXA 2KG0A 3TEGA 4H4KC 1HWJA 5C42A 1WEYA 3AXKA 2F1FA 5DQGA 2ADCA 1BWVA 1VIXA 4PAAA 2XMKA 1RKIA 4RNMA 2VICA 2XTJP 4RNFA 2W7PA 4M5HA 2JEIA 1ZM9A 3W8PA 3RUBL 3PR5B 2CQPA 3ETOA 1CLFA 1QJHA 3P3DA 4M63A 2QMWA 1HBMB 4DU8A 3D6MB 4EBDA 4H54A 2CJKA 2RIJA 2ASJA 5F9LA 3VF0B 3AFGA 3J7Z5 4OV6A 4NLDA 5FD1A 3PYFA 4PXEA 2LA6A 4DR1J 2VDIA 4C3LA 1SVDA 2KXHA 1D8ZA 4MIWA 4NXNJ 3MD3A 4UUWA 5GAGU 5BYQA 3OR1B 2UV8A 1I94J 1U2FA 4I64A 4KPCA 5G0RA 3GFYA 3LP1B 2LXUA 3TOQA 3KNGA 4DQIA 4HH1A 4WIQA 2UUBJ 1IJFB 2IM2A 3ENWA 3EPIA 3POTA 4KO0A 4MAKA 1QAJA 4ELTA 3C8YA 2H48B 3AQOA 4PG8A 4WU2A 3CCRS 2FVCA 3TZZA 3Q8QB 3JSYA 3Q24A 1QM9A 3MCMA 2QZ8A 4X4QA 3I5BA 3Q8PB 1GXUA 3J81Y 2WVEA 2HVZA 4WP9A 3BBFA 4USIA 4O44B 4OFZA 3G6ES 4LF2A 5D78A 4YEAA 1OQ3A 1I3OB 3AB2B 2LXIA 1VJWA 1HWLA 4U7UD 4TY9A 1U6BA 2GVZA 1RBOB 3FCHA 2DGWA 2C2EA 1U4BA 3ISZA 1SUQA 1RLDA 1PAEX 4QU6A 2QFJA 2CJYB 3D6HB 4QPXA 4QIFA 1CJKA 3KHHA 4ECVA 3CJ2A 3PW2A 2ZD1A 1VJQA 3DOLA 3MI7X 4DPXA 4JYAF 1G1XA 2YKOA 1T0TV 1RT1B 2VFRA 1CJVB 3FJ2A 4OYXA 2LQBA 3I0SB 2MSSA 2XCAA 3AD8C 3G4SS 2BJDA 5CYMB 2HS4A 4PR6A 5KFSA 1YZ6A 4B3TJ 3H0PA 3QATA 3CDBA 4ZMMA 2MPUA 3KFWX 2W8LA 4LIWA 4WBFA 3J7ZT 2LEAA 2GJIA 1UZDA 3IMQJ 3OLBA 2E5LF 2DNZA 3R3TA 3I32A 1AYEA 3L7UA 3EGWB 2W9CB 3AA8A 1V6HA 3QSIA 5CQGA 2O1PA 1CULB 3M2RA 4AXJA 5DO2A 1RJJA 2UVUA 4B9MA 4EZ6A 2HBQB 5IT9U 4FF1A 3SQGA 4ZK7M 2GV1A 1HR0F 2BA9A 1HWIA 4WJBA 1X9SA 5CYJA 3CSKA 5KG6A 2DEJA 1GX6A 1PILA 4M5NA 2WSFC 4LF4J 2BBEA 2KI2A 1I1GA 4GKJF 1NSAA 1C1CA 3IBWA 1U1QA 1YRUA 3ILJA 3CMAS 1HW9A 3BYPA 2HQCA 3ET6B 2QMUB 3S01A 1D9AA 1ZM4A 4FN5A 2HBRB 4WTYA 3OUYB 5EWGA 5KFLA 3PFOA 2HHQA 1Q4RA 4DF8A 3LPYA 1DQ9A 4RR5A 3TUIC 1H6KX 1S5ZA 2HLUA 3B4MA 4ES2A 3M8PA 1KN6A 1AA1B 2W4CA 1LWFB 1YJRA 4IQMA 1IKXA 4ZVQB 2F40A 2NR0A 3QLHA 5CYQB 1NDPA 2NLWA 2VG7B 4BLGA 3FBCA 2DNGA 3R97A 4DR5J 1HLWA 1UFKA 2YKAA 8RUCA 3BSNA 4P7TA 3EWGA 1WEXA 4OLPA 4CIOA 1U1MA 5D77A 3IG1B 2MQPA 1TFWA 2Y8WA 1U02A 2DR9A 3OJSA 4DQRA 2Y8YA 2YQ3A 2DR6A 5THWA 4A8MP 3UR0A 2HHHJ 4H4MB 4MYTA 2OI2A 3QRQA 3CDUA 3EVWA 1S1WB 3MMBB 4QIEA 1U2RA 3B78A 1NUEA 1N5VA 2W2MP 1IBLF 1ZTTA 3KMSA 3N5FA 5CCLA 1NJZA 1U6ZA 2W4DA 5KFQA 4CRJA 1V9OA 3HSZA 1S9EB 4DV6J 2HPUA 3FFIB 3W1YC 1WOSA 3HFZB 2IDEA 2ZM6J 3WBZA 1FJGF 3ISNC 1FJ7A 3RBZA 2NYHA 1U1LA 4R5PB 2CRLA 3QSYB 4B3OB 1L3UA 2KZMA 3G87A 2XNRA 2ZUAA 4GC6A 5KT5A 5GAEU 1JQGA 4P52A 1UW9A 1HKAA 4I7FA 2ACYA 3A3PB 3CULA 1FKPB 2B8QA 5HROB 4HHHA 1URRA 3KG4A 2IBOA 5KFXA 2XLJA 1O51A 4PEOA 4M8LA 4C97A 4C8LA 2V9WA 5J1EB 1AFJA 2E44A 1RWUA 4WXWA 1WHXA 4DLEA 8ATCB 2QGFB 2B9XA 2IBKA 2B9YA 7FDRA 4ERDA 2DTJA 3RTVA 1VIOA 3H7HB 5C25A 3PRBA 2CQ3A 1J5OB 1Y5IB 2K3IA 4FNIA 2B56A 1NB7A 3D54A 4F4YA 4IG3B 3FCVA 4LIRA 2FDNA 3V6HA 2JX2A 1Y0HA 3M8QA 3NNAA 3CE8A 1ZETA 5C5JA 4J90A 1FF2A 1HNXJ 3GQCA 2HQGA 4JV2A 4LQ3A 1F9FA 3LUYA 2AZ1A 4ZOSA 1YBAA 3CW2C 4NYZA 1UAWA 2HWTA 3GJQB 1EQMA 3M8YA 4OX9F 5LSRA 4YUDA 3H25A 2ASYA 3BH6B 1T9TA 1SC6A 2NUHA 3AHPA 3HD2A 1RLCL 3NWGA 2Q3PA 6FDRA 1HYSA 4CH1A 3Q8YA 1QDUB 4OI0A 3BDEA 2BMBA 1Q1KA 2O3DA 1VRUA 3DM2A 4Z7YA 4N5SA 2BJ8A 5GMDA 4DU7A 4TLQA 4WFBQ 3OFGA 3W2VA 5IWAF 4A8YA 4QU7A 3N01A 4QW8A 2WONB 1RHKB 2VKRA 4DV0F 2B8PA 1UVJA 1IWAA 5A8KB 3K5LA 4WP3A 1UWBA 4LFAF 5FLXU 2KFZA 1DQAA 1Q16B 2L9WA 3MDFA 3S6EA 4K5RA 1WF0A 3I0RB 2C2NA 4DR3F 4CLSA 3ITHB 1KHWA 2F7VA 1BD6A 3K57A 1JNZB 1KP6A 1ELOA 2WB4A 3IGNA 2VKZG 5ETKA 1JJHA 5JUMA 3R7BB 4EYHB 1RK8A 4CP5A 1RWOB 2JVOA 1GH8A 4MFBB 1JLAB 2W2OP 4C4WA 2CKWA 1KQSR 1P9QC 5F0WA 2J7UA 2XLIA 4ZVTB 4X4NA 4PYDA 4F8RA 3MEEA 4A8FA 2OLWA 1N32J 3EDRB 4FYDA 5E5NA 1EX8A 3EVMA 3C46A 2YPZA 2QA2A 4EU0A 3JQMA 4USTA 3NBPA 3OTCA 2FY8A 4B3MF 3EM1A 2VG5A 1TZ0A 5IOLA 3RW6A 1YRXA 1AB8A 4QW9A 4YB7A 4NZ0A 4J9NA 2DNLA 3TQEA 1HQEB 2OFHX 4OYPA 4Y6IA 1OIAA 4MK8A 1N0VC 4P2XA 5IT4A 4I68A 4Q0BB 2AF6A 1RAJA 1KTQA 1R27B 3RU0A 2YXLA 3VAHA 1VRTB 2C2KB 2RJZA 4PQUA 3GIRA 3M9MB 3PX6A 3NNHA 3MEDB 1TL7B 2EFOA 3U1NA 2DRBA 3AXMA 3FDSA 3RW7A 2DH9A 2AGPA 2C2RA 2P2CB 1U1RA 4WPAA 5HVFA 3PW0A 4K4UA 1RWMB 3CJ4A 3GIIA 1PG5B 5HBMB 1WUUA 2V94A 3DLKB 4PG7A 2PI5A 4HVZA 4AQYF 2HRTA 4LSLB 2C2MB 2DO0A 1KNZA 2E7WA 5T7LA 4OYWA 3TR5A 2XB2D 2BRLA 2G1HA 5K8NA 4R8UA 2CWKA 4W90B 5F9NA 2EG1A 3G82A 4Z7CA 2XY6A 1NB2A 3T41A 4DMZA 5L8RC 1D9FA 4ZVOB 3FEYB 4E8UA 3Q2TC 1NO8A 1TVRB 2YVSA 2YNFB 1SJRA 3F56A 3OJUA 2DGOA 2VBXA 3DRRB 1YG0A 4OZJA 3U02A 1HW8A 1IKYA 2E1CA 3L7PA 2MB0B 2HFNA 2PFDA 4O4RA 3H5SA 1NSPA 4QWDA 1WD6A 3PCOB 1B7YB 1GT8A 1U0HB 4AL6A 5D0HA 2B7BB 3M7VA 5F3ZA 4O3SA 3JAMY 2M7SA 3PO5A 4C8YA 2YWEA 1SQEA 1WF2A 4AXIA 1WI6A 5BYSA 4L72B 3CCUS 3FMBA 3QJLA 1KTVA 1OWXA 5HL7Q 3ILIA 4DUYJ 2HZVA 2VZ9A 4UQTA 4ID5B 4UOCA 3T6JA 2QFIA 1WJ9A 4YR3A 2FJBB 3VR1A 2ACMA 1U09A 1S0OA 2QC3A 1RYSA 3TJ8A 2IRYA 2CNLB 4CLWA 1UPMB 2HNDA 5F8MA 9RUBA 3VAJA 3SV3A 4O44A 1H2VZ 2M70A 3QFHA 1N8RT 4PG5A 4GKKJ 2LQ9A 1MWYA 1PJ5A 2L9DA 1BQMB 5E3QA 4GVLA 1RTZA 1WOOA 4C8KA 1QAYA 2D9PA 1LQ9A 5IV3A 4JBCA 4Y2CA 3D67A 1RAAB 2PSZA 4IH5A 2A1BA 2IVFB 4HDHA 4JV1A 2KG1A 3DLBA 1OY8A 4FP9A 1TKZB 2BKNA 1UVMA 1S97A 2EG2A 2D9OA 2CQ2A 1RT1A 3O3LA 5KFBA 1CJVA 3EZUA 3I0SA 3MM5A 2JC1A 2HVEA 1H3DA 1X0PA 3M30B 2OGUA 2CAJA 3AY0A 4O3QA 2VBZA 4ZJLA 4RUCA 1SXLA 3CC2S 3M4XA 3KNAA 2EXUA 1FXDA 2W24A 1N34J 2MTLA 1RQ0A 2GHPA 1UEUA 4IOBA 1F9HA 2HW3A 3ZTRA 3IRXB 5KFPA 2YKNA 1K0TA 2N4DA 1YZ7A 3W5YA 1M5VC 1CULA 5EHHA 4AD6A 4UOGA 5IFMA 1NKBA 3RAXA 3SV4A 2YBVA 1I5OB 2ROEA 4IO1A 3JYTB 2AX0A 4OMFG 2CQDA 2MQNA 2VQFJ 3DOKA 1FX4A 1FWLA 1VBXA 3DLGB 1RT6B 4LRDA 3PVXA 2OEJA 4ZJOA 4DHVA 5A2QY 2V6AA 1PYTA 1FRHA 1XWLA 3MFIA 2NPFA 2BM0A 1VHIA 3Q8RB 2UUAJ 3CCTA 2HQIA 5F41A 2GX8A 3MAAB 4EUVA 3OUYA 3H2LA 3M2UB 2J6SA 1RABB 2VUGA 4ED0A 3DYAA 4DV4F 1LWFA 3ICLA 3C14B 2QRRA 4Z37A 1GEHA 1NJWA 1PC4A 4HI1A 1S6PB 2QV6A 5H9FK 2VG7A 3JXOA 1NJXA 4NLTA 1QE1A 1OYEA 1RACB 2GA7A 1S99A 2QO3A 3UVJB 3KJVB 4OZ1A 1LFWA 2E5GA 4MKAA 3BQ2A 2V4RA 4A8QA 1O6XA 1XMQF 3SSQA 2GQQA 3W61A 1RTHB 3O6QA 1F2GA 4V19X 4OX6A 2WVFA 4EMDA 2X1BA 3BB5A 3KHGA 3HSJA 1S1WA 3MMBA 2ZUGA 3M9OB 1HNZF 4RU9A 2HVDA 1V3RA 1EP4B 3CCQS 4BC7A 4JI7F 3W9HA 1C1BB 5H9FJ 1S9EA 2RQMA 5D15A 4ZLNA 4ILRA 4E0DA 3DKDA 1T05A 3EGVA 6FD1A 2DR7A 4RU2A 6AT1B 3BR8A 1BWEA 4R5PA 2HFUA 5DGAA 1LWXA 2MMYA 3LQVA 1S49A 1JXEA 3J7AN 2B4OA 1N36J 3SI8A 1IJEB 2LP4A 2AEMA 1AROP 1UWAA 2IIHA 2OMOA 3CC7S 1Q8BA 2ZH9A 2POKA 5AJ3J 2PC6A 3RRKA 2UXBF 4LF6J 1M1HA 4XDCA 3HT0A 3IC1A 2N3OA 3JTOA 4KB7A 2OEKA 5GMEA 3HM9A 1UCNA 3PKYA 2R7RA 5AXKA 4DBQA 4L3KA 4DR2J 1GNKA 3C66A 4OJ3A 4ECZA 3IAM9 1HIYA 5IZHA 1UZHA 1WTFA 4GO5X 1NHUA 3KOAA 3F41A 3K5MA 2XMVA 3EXCX 4RW9A 5IT0A 3ZTQA 4DSLA 1B70B 3OVAA 4L6V3 2DHSA 2DIUA 4HEA9 3G6VA 4QBUA 1YJ9S 2DKOB 4TVAB 1MMLA 2M9KA 5KFZA 3TZYA 1HBUA 1X5PA 2J9CA 3NOCA 5L39A 2WVDA 3EICA 3T3FA 3L09A 5BXIA 4CLUA 2ALZA 3PYEA 4J9OA 2ZH2A 4DFMA 4J9UE 3HFKA 4YB6A 2R7OA 2RQCA 5ETPA 1CVJA 1S9FA 3PXGa 4DV1F 1HPZA 3D1QA 2HHVA 2ZZTA 4DJBA 3P5TL 2KB2A 2HWHA 3MTKA 4YY3J 3BV8A 4QIVA 4TY8B 2BKPA 4PXBA 3GG0A 4K0KJ 2MLZA 2VPYB 2BQ3A 1S12A 4MT1A 1P27B 3VALA 4ICLB 4KIAA 2RHSB 1N33J 2D3ZA 3CCVS 3NCPA 4HR2A 2XEXA 1CPZA 3P45B 1JX4A 1LWCB 1HQ2A 2BJ3A 5DG7A 4U7CA 4X4SA 4L3NA 1TP7A 4O3RA 2ROPA 2RILA 2YNIA 2KO1A 3UDCA 3M05A 4UTGA 4MKYA 4LT6A 3LAMA 2MQLA 4IH7A 1P1LA 2FVSA 1WG4A 4ECYA 2QLJB 1IXKA 3RB4A 2DH8A 4GO7X 3I0RA 2DH7A 1Q82T 3N6MA 2E9RX 1FEEA 1O5JA 3GV8B 5HATA 3ITHA 3D7SB 4DUZF 4URQU 2VF3A 3MMAB 3SCIE 4KAIA 4OI4A 2YH0A 4M5GA 2EFNA 2AJQA 2HIQA 4OHXA 1DTTB 4USMA 1TKDA 1YHQS 4QWEA 3K59A 1RT7A 4DR7J 3QIPB 1NAQA 2FJVA 4MFBA 1UJ4A 1WACA 3GPAA 4WTOB 2KHDA 4WK3A 2DNKA 3MM6B 1AUDA 3KK1A 4F4AA 4ID8A 1EETB 1GX5A 4X4TA 4LSZB 4N8OA 2Z56B 1HI8A 2YNGB 3K89A 1MROB 5KAKA 4USUA 4ZLLA 5K8PA 2VD3A 5K14B 4F3QA 1B4SA 2NXEA 2UUWA 4DZDA 5B09A 4RBTA 3JSMB 1T3NA 1WWHA 4NCGB 1NZ8A 1CG2A 4HH0A 4NLGA 4A46A 1HQEA 5J2PB 5L1JA 1NU4A 3HHEA 2XGQA 3OL8A 2IMWP 3FSXA 2ZH3A 2RQKA 5DRKA 4C0HA 2IMOA 3ZC4A 4CNZA 1FRIA 5IM0B 1VRTA 3GONA 2CQHA 1UFLA 1CJTB 4TU9A 2H3EB 1FWPA 1X4FA 1X4AA 5A0YA 2W9BB 1KC8T 4A8KA 3B54A 4C11B 1X9WA 3R5AA 3VAIA 3QMQA 4Q2MA 2J7WA 3CCLS 3EZ5A 4N41A 4ZVGA 2E9ZA 4DV3F 4DFKA 4LF9F 1QSYA 2DHGA 1D09B 1KQKA 2OIHA 3DDIA 3A13A 1SCJB 4P2MA 5A6WA 2O5DA 3OTDA 3TNVA 2GGPB 2Q66A 4IG0B 1R0AA 2KHCA 3M6XA 2LYVA 2RD5C 3GIKA 1FRMA 5IS2A 3IR6B 3MM7B 2QEXS 1IM4A 3DGPB 4Y3CA 4LMZA 3GFXA 4H4OB 2YNFA 1SL0A 3ILLA 3DRRA 3CXCR 5L1LA 1BE4A 5KG5A 4EEYA 1R89A 5D3GA 1NZAA 3KG0A 4OYIA 4OI3A 3DHWC 1IKWB 4FKYA 3RR8A 3NGSA 5EX3A 3CCSS 2JFKA 4MTPA 4K7QA 2FYXA 1VQ5S 3R5BA 5LMUJ 2G2YA 4NLXA 2H4YB 1PJ6A 5D8HB 4ILMA 2KN4A 2RB7A 4IRCA 4E98A 3UD4P 3W60A 1J2VA 1S1VB 2BM1A 4PRFA 3SYZA 3HHKA 3IWXA 2IM1A 3TVYA 1TUGB 3KYLA 3B82A 4UUXA 5IC6B 3UPFA 3K2YA 3FUYA 3Q8SB 3DCAA 1JMTA 1JLCB 2B51A 4PWDA 3H98A 2LCWA 4URSA 1VFJA 1YQHA 3RG6A 1S1UB 1N48A 3VWSA 2DVIA 2CQ4A 2FC9A 1VQ8S 4Y0FA 2ZWPA 1RAIB 3MZIA 1RKJA 2APOA 3HSDA 3HJFA 2QYCA 3FRZA 4K2JA 1X5TA 2F9JA 4WFZA 1IBKJ 4NA3A 3C15B 4DR1F 3IWLA 4DEZA 4X84A 3ETMA 4FVMA 4C9DA 1MWQA 4NXNF 2R9LA 4CTAB 3DRPB 3EZOA 1XMBA 1M5SA 3G8SA 5HQMA 4OYBA 3EDQB 1V5VA 4C8OA 3PJWA 3M30A 2ZE2A 2O66A 3R1LA 3WC0A 5ETNA 2C28A 3KLIB 2YKPA 2AEFA 1RP5A 5CH7B 5BJRA 3J7A1 1GXLA 3H20A 2MKHA 3AOCA 1QLNA 1HQUA 4EO8A 4UW2A 1RAEB 1VBZA 2I9SA 3OVBA 1HNVB 2GW8A 2HBYB 1FK9B 2Y1RI 2P6SA 3CCZA 1Y5NB 3JYTA 3OSPA 1ZPVA 4IRDA 2RDIA 2ZBRA 4NYOA 3QFWA 2XMWA 4HLBA 5HI7A 4ECXA 2DNYA 2YY3A 5J2QB 2Q79A 4YFUA 5DLGA 2MEWA 2ABYA 5DG9A 4K50A 4Y00A 5KFYA 2V68A 3PO4A 1S57A 4DQPA 4USJC 1T11A 2COLA 3A1YG 4B9SA 3VV2B 2PMHA 2WSCC 4Q5VA 1UVIA 1RTIA 2E7VA 5LJ5Y 4F50A 2RF2B 3G9CA 1IBCB 1SB6A 2D69A 1VQNS 2DRAA 3QT8A 4P9SA 3MEKA 3UR3C 4ZIWA 2E1RA 3VGVA 2CQ0A 4M1KA 5K9FA 4C7QA 4RUAA 2BOPA 2ZBPA 2IA6A 2BYCA 2DYAA 4J9LA 3N79A 3D1HA 1EARA 3EPGA 3I31A 2IRUA 1RTHA 3HMJG 2QA1A 4BWJA 1X5SA 2YKQA 1RT2A 3DFEA 2L41A 2UXCJ 1YLXA 4FF2A 4IFVB 2C2DA 1LWEA 1YRTA 3HFVA 3KLEB 3W2WB 3K17A 4FF3A 3MAHA 4LF4F 1EP4A 3MURP 2J0QD 2KXFA 2YWFA 5I4MA 4RW7A 3CPWR 5K5MA 2F8HA 3IA0A 4JOUA 4QYRA 3W5XA 3CTRA 2R8KA 3R5CA 1YJWS 1G4CA 2VDHA 2KT3A 2CJBA 1FX2A 4B9NA 2LLZA 4QPTA 3U7JA 2LQ8A 1IKVB 4TQSA 3DMJB 4NZ7A 1H73A 3HKWA 3DU6A 3HZGA 4PG4A 2R7SA 4KYZA 4H4KA 1VQLS 1T9UA 2YH1A 3JSBA 3U1LA 5CD4A 1ZZNA 3HT3A 4OIXA 4W92B 1ZM3A 1WORA 4DR5F 3QAEA 5U47A 3SMZA 1L3SA 3PKMA 1UJ6A 2R8HA 2MQ8A 2Z2YB 1HFEL 3KDOA 2B5JA 1C0TB 1EKRA 2B4VA 2C22A 3EX7B 4DSFA 2AZ3A 4LVOP 4XPCA 2HHHF 4XK8C 3RAMA 2VA2A 1VISA 3OR2B 2BJ9A 4ECQA 3CD5A 7FD1A 2FJEB 1VRQC 2J0WA 3KJQB 2HS3A 5T14A 5ADZA 2ZH4A 3QT6A 1MU2A 2RS8A 4OV1A 3JQJA 2D3O1 3A3NB 2HNZB 3BO2A 3T1HF 3MPDA 3GV5B 4XPEA 1FWKA 3GR1A 4ZLPA 2P6TA 1PBAA 4WKYA 4JI5J 4DSKA 1S48A 1HI1A 2E5LJ 4LRAA 2CFXA 2AD9A 4JP8A 1YBUA 1A9NB 4LBPA 2K06A 1JB0C 3D3CJ 2EEYA 4YP3A 2CQIA 4ED6A 1V3ZA 2R7WA 5DLFA 3LW5C 3RR7A 3CJSA 1M5HA 4ZPDA 1TELA 2HZCA 1SH2A 3RRHA 3OL6A 2JOQA 3MCOA 4P10A 3MPWA 5KFVA 4TY8A 3OTOJ 1DLOB 3O8WA 1C2PA 4X64F 4JI4J 2OO4A 2F4VF 1X4EA 3MPYA 3TZXA 2GVDB 2HMIB 4ICLA 4USWA 1G2EA 1UVNA 3FK4A 4Y2IA 1F60B 5F8IA 4B3SJ 2CXEA 3SIPB 3T5KA 5CABA 1LWCA 5D4OA 2N82B 3X3UA 3SCKE 4QZVB 3Q86A 3NS5A 3C6UB 2QT7A 1S9GA 2B6AA 1DAXA 1VC5A 4OYOA 3CCES 1DY3A 1D8YA 4LBHA 2ALYB 3NWRA 1J5EF 1T7PA 1C4AA 5AXMA 4WF9Q 3GIJA 2OMLA 4F3OA 1EAYC 2HQDA 3GR0A 1LW0A 2YX7A 2NCKL 1DTTA 3I87A 1F9EB 1NPPA 3QIPA 1S1XA 4C48A 3EYZA 4ZPCA 5KFNA 1HNXF 5KFEA 4ZVSB 2DO4A 3TX0A 4G1QB 3MM6A 1KLMA 2CNNB 2HHPA 3GG1A 1K0VA 4CCHA 4HTJA 2DGSA 2E29A 2LU2A 2DJWA 4LBIA 4DWIA 3DLHA 2YWWA 1MROA 2PMWA 3KLHA 2RS2A 2FJAB 3CB4A 2FHJD 3JSMA 2BE2B 3NAIA 4NCGA 1Y4ZB 1RE1B 3Q8VA 2PGCA 1TL3B 1SL2A 2GCFA 1JLEA 3P96A 5JVGQ 3SXLA 1XR5A 2RRNA 2VG6A 1RT3A 4ITSA 1KVJA 3KLGB 4TU7A 5IM0A 4C8NA 4X66F 3BPSP 2DHXA 3I96A 3EUNA 3LP0B 1CJTA 4ZVEA 3UDLA 2HLTA 3KK3B 2W9BA 2OPQA 3CDWA 1S4EA 1JLFB 4C11A 2RVJA 1E6YA 2WAQD 1JKHB 2DNQA 4Y2MA 4K4VA 5B0GA 3UI3A 1FE4A 1R8CA 2FHKA 2K7KA 2J8AA 2ZHAA 1NK0A 2QTWA 1VBYA 3G96A 1KFDA 3DOMB 1VBKA 1VQPS 1TK8A 3BKUA 5ITHA 1IQTA 3N5BA 2GZOA 3IBCB 4DR6J 4FKXA 2BABA 2VFTA 3HHLB 3DI6B 3DLEA 3QT5A 4K5SA 4OZ2A 3MM7A 2XY7A 1QTMA 2F5GA 1H38A 1GMUA 3DGPA 5KFDA 1YWXA 4JI3F 1XMOJ 3ZZUA 4IOCQ 2RKIA 2DEIA 1N32F 2WCXA 2OJ3A 1CJUB 1QAIA 3AD7C 3DLJA 2K8GA 5GADU 2MYFA 5E3PA 3D4JA 4XDDA 4BHQA 3VGTA 2WRMA 4DFJA 1RHJB 3NGKA 2MY7A 4I2PB 1U6FA 4J9MA 5LXYA 4NLWA 2R8IA 4F4ZA 2CA9A 2X1AA 1Y11A 2W7OA 3LTOA 3MR3A 1KSPA 5E3AA 1RHQB 4FVCA 2GC8A 3HVAA 5BR8J 4Q8FA 4RZRA 4NRUA 4LRBA 3BSCA 3BSAA 3FBEA 2VBYA 3V81A 1IVZA 4YB5A 3HVTB 2BX6A 3JTPA 4MK9A 3M1VA 4P72A 1LKZA 3UDEA 2QSWA 3LP2A 4I67A 1JLCA 3W65A 4JI0F 4CLTA 4LFBF 3W3SA 2NS1B 3TAQA 3ZO7A 3HHDA 4FS2A 1XTZA 2E5IA 5DJBA 1UTAA 3MXHP 4Z2XA 5E0OA 2HAFA 4B9VA 5KFWA 2ATCB 4EK2A 2EPIA 3UD5A 1TUVA 4LFAJ 1RTDB 4DS4A 3L9ZA 1ZYQA 4FYXB 2CPEA 2MKSA 3QJJA 3KLFA 3D9BA 3KUGA 2I5JA 4OX8A 3D6TB 1S7HA 2X3DA 1PIEA 1FFSB 2E1PA 4CTAA 5KG0A 5KT7A 2ROGA 1F5BA 4DCJB 2ZC3A 4YN3B 4MKBA 3KUEA 2EBEA 1SH3A 4LR7A 2GHVC 1QVGR 4EYIB 3JQKA 1RHRB 4ZJQA 1T8EA 4LUBA 3CNQP 1WDTA 4QR0A 4M5MA 2DT9A 3KLIA 3L7OA 4ZN3A 3LGHA 1VC0A 2KJVA 1G6BA 1UA0A 4ANDA 4K8RA 3THVA 2ZH7A 1ZH5A 1VC6A 1VK8A 3T19A 3GCWP 1ZA2B 2FHJA 1C0UA 3PFEA 3MECA 1NBEB 1N5TA 2BQUA 1HNVA 1ZPWX 4ES1A 4WFXA 5JXSA 3TAMB 4O3NA 1HNIA 1VS3A 3BO3A 3VGSA 2J6TA 3TX8A 4M5KA 3CD0A 1SJ1A 2QJ3A 4I6AA 3NGDA 1WEZA 1AZSB 2B4UA 4N56A 3FMWA 1QY7A 2XYPB 1VQMS 3T1YJ 3VCDA 1QSSA 3NNCA 2F4FA 2JNJA 3PACA 4NYPA 4X65F 2XI3A 5IT9Y 3MPUB 1T02A 4K4ZA 4DOZA 1N52B 5J1PA 4F36A 4IFYB 2XMAA 1OYDA 3J81j 1N0UA 2XY5A 4Y65A 3KHLA 2KYXA 5E41A 1XK8A 1SQFA 4WKRA 2DY1A 1ROFA 3RZAA 4NXMJ 2XQCA 1RHUB 4P6QA 1SV5B 2IA0A 3A8JA 3MFHA 1SPBP 4ED4A 2RU3A 2BV3A 4DS5A 4I1TA 4PUOA 3GB0A 3OV7A 3QO9A 1FT8A 2IC3B 3E01B 3CCMS 4HT7A 3LGNA 1S76D 3J80U 1NXIA 1CS4A 1JIHA 1CBKA 3KLEA 3W2WA 1PBUA 4OL8A 4ZCIA 3TEHB 1BHNA 2VQFF 3PYDA 4KHMA 3HO1A 3NCRA 1YITS 4EBCA 1M5KC 2V4JA 2MGZB 1FDAA 2GJ2A 2MKKA 4LSNB 4G3IA 2G0IA 2XSJB 3BKFA 2MQMA 3GCXP 1UFWA 1UEVA 3CJ3A 1NLKL 3U1MA 2UUAF 3RB0A 1IKVA 2GQ2A 3PHTA 1B0VA 4K4XA 1ZTWA 2MLXA 4RPFA 5C42B 4ZPVR 5C24A 2CUYA 2WSEC 3DMJA 3E3XA 1CC8A 3P4UB 2MLYA 1NPKA 5HLFA 3R7SB 4JI2J 2W01A 1OY9A 1OSDA 4DV5F 1FVSA 3H59A 4V19J 1WHWA 3FZ2A 5LJ3Y 4DG1A 1ZBTA 2AJ0A 1RSCA 2KT5A 4QWAA 4N8NA 4X62J 1B3TA 1PC5A 4XAKA 4ED2A 3A8KA 1WTBA 3RRGA 1H72C 2A6OA 1C0TA 1XEZA 1HA1A 3HHLD 3DU5A 4FXWA 3T1AA 2B7CB 3OR2A 3ZZOA 3TRGA 1LW2A 2R2RA 4HKQA 1VQYA 3MTJA 2AIRB 1W2IA 2M8DB 5G0RB 1ZZFA 2WOMA 2BACA 4YR0A 4QR1A 1GFWB 1HNWJ 3TA0A 2HNZA 3Q89A 2QN6B 2G1DA 4KPYA 3POTB 4RUBA 5LMNF 2ZWOA 1ZS6A 3QBCA 4JI8F 2EWHA 4FS1A 4DFPA 4NI2B 3H4BA 3PIPQ 4WFYA 1Q7LB 1PCAA 4DV7J 3MUVP 3F73A 1XJWB 1JXVA 1LK7A 3D0HE 2AJFE 3IAS9 4R0EA 5I3UB 3TAPA 4CO3A 5DM7Q 3B8HA 5D0GA 1RGVA 1RWVB 3H2UB 1S0VA 1FRLA 3HJVA 1N36F 2GVZB 4ZVFA 1FJCA 3SDEB 1DLOA 1QTNB 4FBTA 1G3OA 3LA0A 2O67A 3BR9A 2EK6A 3GWCA 4LF1A 4BC9A 4LF6F 4BCAA 3BN4A 4LRCA 2GVDA 3I56S 2HMIA 1SUQB 1RAOA 3R1HA 2AYBA 2K2PA 2QL9B 3JS9A 2J8SA 2PA3A 3IR7B 4Y2KA 1SL1A 4PXCA 4DR2F 2ZITA 2J5AA 5AXLA 1ZA1B 5A76A 3KUHA 4ZPWR 2Y9HA 4HDGA 3WIUA 2ADBA 3C6UA 5E3CA 1Q7YT 3EMTA 3IGVA 4KFBA 2R8JA 4DCPB 3SFUA 3TQ1A 3HX9A 1B0TA 2OD4A 3UNYA 4C8MA 1XIQA 1RHMB 1XBWA 3IP0A 4G6VB 1HHQA 1VK3A 3E8OA 4DV4J 2L08A 5J2MB 2BANA 2KH9A 2XMJA 1Y7PA 1SBRA 2RMLA 3N6NA 2AHOB 5EX0A 4AFFA 4M94A 3NXZA 4I2QA 3LANA 2ZBIA 3H5XA 1U1NA 5CA5A 2DXFA 1RBLA 3H5YA 3OW2R 2BJEA 3BGUA 3NGRA 1Q81T 2A18A 5CZVA 1U8WA 5HSPA 1X7VA 3KJNB 2XCPA 3OPKA 2FIUA 1DARA 1XR7A 3KLVA 4RX6A 1FRKA 5FLXY 1Q8LA 4DCOB 2MZTA 3NG8A 2AWZA 4NMXA 4YY3F 5M2UA 3SQGB 4UZCA 1HNZJ 4PABA 2BW7A 1WOPA 4ZHRB 2AJ2A 3MM8A 3OQ2A 1T9XA 2EFQA 4G65A 1R8HA 2GFFA 1P1TA 4JI7J 1C1CB 3UFCX 2ZJRQ 5LSLA 4F2RA 1TL3A 4CO5A 1KHVA 3IR5B 3FEZA 3WX4A 2V8VA 5DDPC 5I42B 4YOEA 3C19A 2DY9A 3ZFVA 5IXUA 2HFSA 4PQAA 3T5JA 1MN9A 4OZLA 1K1SA 3MM9B 3H90A 3KK3A 2IVMA 3M8PB 4EO6A 3O44A 2BJ7A 2GIFA 3CJ0A 3AH6A 1IKXB 2HIYA 1PGZA 1TKTA 1K47A 3CF5Q 3CEDA 4WZQA 1NM2A 3QLHB 1H2UX 4C3MA 1FEHA 4QR2A 5DQHA 2UXBJ 1S1TA 3C16A 1RAHB 2Z57B 4B08A 1VQOS 1ZOTA 1BY9A 2IFXA 2CADA 2GO9A 5EUHA 4BWMA 2D3OR 1N5SA 1RWWB 1FA0A 3GYNA 1TV6A 1LFPA 2JWNA 1NK7A 3C2PA 2DIVA 1YJUA 1D0EA 2GNKA 2JC0A 1UKUA 2ERRA 1N6QA 2GHWA 2ASLA 4RWWA 3SSSA 4NZ6A 3ZZTA 3QQCD 2J9DE 1S4FA 3RB3A 3FGVA 3FQLA 1PO6A 1HMVB 1F1BB 4RW8A 1YBTA 1AFIA 4O23A 2R3VA 2N7CA 4Q44A 4DN9A 3J7YI 2BVZA 4I2PA 1NK9A 3HSGA 1X60A 1KONA 2EKNA 5HQLA 1FKOA 4DF4A 5D4LA 3VQTA 1RU2A 3PEJA 2MY8A 1Z1ZA 3UNGC 5KOWA 2RQ4A 4RW6B 5B0AA 5BYRA 5KG3A 1BUXA 3CD7A 1NEEA 1FDDA 4ILLA 1RADB 4ZLJA 1GMVA 3H8YA 3QAUA 2AX1A 3HVTA 1NJYA 2CNKB 2I2YA 1TL1A 4CZCA 2M5YA 2H5EA 1UMJA 2L3MA 1IR2A 4K2XA 1SKSA 4IDKA 3KG1A 1JLGA 1XNQF 2Z0GA 5KFJA 3AB4B 3VHQA 2VQEJ 2B9EA 1D1UA 1S0MA 2ZH5A 4ZP9A 4J9PA 3PR4A 2UXDJ 2GQCA 5CXTA 5E3RA 4JI6F 4I6YA 3OL7A 1HD0A 1IM6A 5C25B 3MCNA 2I1RA 1RT4B 2FZCB 2CPJA 5KFFA 3OXGA 1HBOB 3IN5A 3TVZA 4MH8A 2G4BA 1YJNS 5HANA 4O0NA 5KFTA 3HHNB 2DD8S 2RRAA 2K1RA 4TKTA 1NK5A 1QVFR 3M8QB 3V2UC 1I51B 2RT3A 1FXRA 4GRSA 4N7TA 3MUTP 2JEFA 5B0FA 1TMMA 4TU8A 3BEGB 4JV5F 2FZKB 2WW4A 1F3FA 1N4LA 3I5CA 2PO4A 2Z30B 2C42A 1L3TA 2GJFA 4DQQA 4J7CA 2PD1A 4KR0B 3NS7B 2XS7A 1HYSB 4OHYA 3RJMB 2XZWA 2L9NA 5FIIA 5B0DA 2YPYA 1HBMA 1VRUB 1UW4A 3Q2SC 5T41A 2KXNB 3TAMA 1G7CB 1IR0A 2IYGA 4F04B 3R5JB 4MIBA 1WHYA 3VAFA 2V63A 1OO0B 2OTLS 1UWBB 3OR1A 2ZZMA 4WE1B 5E33A 1IBKF 1N5QA 1YIJS 3CC4S 2BUNA 2GIQA 5C2GA 3LP1A 2FLNA 1FXLA 4RBVA 3HPOA 2VOPA 2FJWA 4HACB 2D7SA 2HRUA 2WK4A 4DV3J 3UDVA 4LF9J 2MZ1A 1XERA 4LF5F 4AE5A 4IFYA 5KG2A 3AOBA 1M5OC 2DGQA 2CNOB 2CPZA 3IFEA 1UPPA 4M5LA 4L73A 3QJPA 4NWBA 1UVLA 1TR0A 2XO6A 1SV5A 1R31A 3GFZA 3THTA 1YJVA 4GMKA 3VQSA 2A2CA 3V6DB 3RBXA 3L95X 3NP5A 3KKFA 2CWXA 2WBRA 1WELA 3CJRA 3BGFA 1EHWA 3M2VB 5I3QA 1KDNA 2KYZA 2VFVA 5HP1B 3NBPB 1ZM2A 2VG5B 3NAHA 1X5OA 1LOUA 4ZA1A 3HK2A 2JLFA 1VLYA 4DR4J 3K5OA 4CWBA 2DPJA 4OZ5A 3K5NA 5F8HA 4ZCLA 3QZ8A 1PKUA 1NHKL 1F5AA 1WKJA 3WZ0A 2FLOA 1S77D 2W9AA 1DFDA 3H2VE 4KTQA 2F8MA 3AA9A 8AT1B 3W7BA 5CYMA 2XO7A 4PZVA 1JK9B 4AUKA 2YKMB 3V4IB 1RTJB 4CNYA 3ZNUA 2NQPA 4A8XA 4OI1A 4UT4A 3GILA 2HGLA 2W9CA 5K20B 2NSBA 1VQ6S 5T7LB 3K0JA 1FRJA 1AT1B 5KFRA 4KC5A 4ZITA 4R8UB 5SUHA 3G82B 3HZEA 5G4DA 1VYAA 2LKZA 3I9V9 3PDNA 2BE7D 4IO9Q 4DLGA 4YR2A 3UWTA 4ZS6A 1REGX 2N3LA 2Y1IA 1A6LA 1WSVA 2XM3A 2GMJA 1D9DA 1IUJA 2KM8C 1IKYB 4PXDA 1P6TA 2AP6A 2H5JB 4TNOA 1B64A 2Y3YA 2UXCF 3DHXA 3OFFA 3W8GA 5F3TA 1EKSA 1L3KA 3MR7A 1SKWA 4ZP8A 3G71S 4RBUA 2B9WA 1IBMJ 3MAQA 1REVB 3ET6A 1C4CA 4DUTA 3M8ZA 1S6UA 3B6BA 2R7TA 3ZTOA 2V0NA 3NGUA 3LO3A 1R7IA 3MR5A 3SBMA 2IM0A 1U45A 1U0SA 2AKWB 2XSFA 2EKYA 2EW9A 1Y3JA 4NI2A 3PIOQ 5C2CA 5CYQA 4LFCJ 4UQGA 5FJ4A 3HHLC 2HNDB 5KFUA 4Q8EA 5I3UA 3J7YU 2HFVA 1FVQA 2M88A 3FBBA 3IG1A 2UU9J 4LF7J 3SDEA 3CD6S 1FJEB 2HYIB 4P73A 3MUMP 5AT1B 4A8WA 4IOAQ 3WIVA 4H4MA 2ZDOA 3M32B 2HHUA 1P9YA 1FERA 4DL5A 1F0XA 1OPZA 2HG4A 3FCWA 3M6VA 4QWCA 5K8MA 2B43A 1BLUA 3QGGA 1T3OA 3FFIA 1RA6A 1RB0A 2FC8A 3GJTB 4O0IA 3MM5B 1JLBB 4KH1B 3KMQA 5J2MA 4DL7A 3R27A 3SEOA 2YX1A 3PV8A 4W98A 4B3OA 1Y9OA 1DTQB 4ALZA 3K8VA 2MJNA 3NS6A 3BQ1A 4CI0B 3O2IA 2OPRB 4DL3A 5B08A 3TUZC 2AGQA 4JI5F 2E9TA 5KG4A 4HYKA 3UO0A 1N56A 1SIWB 2LECA 4L75A 1HWKA 1FKPA 2ZC4A 2WBMA 5HROA 2DCUB 2LU1A 2OAUA 4CO2A 2YKNB 2CJAA 4OJGA 3A3OB 2ZHBA 1X0FA 2CIMA 2QE5A 4C2MA 5H1SV 3KXDA 1XC9A 3G8QA 5J1EA 1QUPA 3OTOF 3HLUA 2W2NP 4JI1F 2UUCJ 4JI4F 3AAWB 2RRBA 4ZPAA 1WKKA 3P6YC 4ZHRA 2HVIA 4NL5A 3J81U 2BJ1A 5GMKa 5F8NA 1M1GA 2CPYA 3DOKB 4RL1A 2OPSB 3VAMA 3LH2S 3KJFB 5HO4A 4KGMA 2M0GB 4B3SF 1J5OA 5KFGA 2R7XA 2V2VA 3D66A 2IHR1 2I8EA 1OS5A 5EGYA 2IRXA 3ELHA 4ZVRB 4J9QA 1P8GA 4IG3A 5DZ6A 3PY8A 2LDYA 5I42A 2YQ0A 2CPHA 4DQSA 2MSTA 3L4BC 2HQFA 2FLPA 5JMNA 5LL6d 1DURA 2AQ4A 3N0VA 4C98A 2A3JA 4B3RF 3MM9A 2R7UA 3DYAB 4X2BA 4K4SA 3O1LA 3TWZA 2G0CA 3QRRA 4UZBA 3OLAA 2VFSA 1MLAA 2VA3A 2HBZB 4DN0A 4YHHF 4ZVPB 4J9RA 4WXOA 4WYLA 4K4WA 4S0MA 1QE1B 4HL9A 2HSEB 3R5GA 4O4GB 1KQFB 3TJ9A 1FHTA 3CT9A 1RAGB 1B7FA 4X4OA 3GYGA 2PEBA 5KG1A 2XNQA 2BOAA 1XN9A 2XMUA 1FFWB 3ZZYA 4KHPJ 1T03B 3IO1A 1U49A 1XQIA 3DLLQ 3R8YA 1AW0A 4P75A 1S6OA 2P5VA 2ZFHA 4F02A 2UVVA 4MKVA 1TMJA 2WONA 2FJDB 4MYUA 5HK4A 2Z4PA 2E5JA 2JJ4D 4CO0A 1HMVA 2FGOA 3P8BB 5A8KA 2HEKA 2M52A 3FVYA 4I69A 3MPVA 1KVKA 2NPIA 3DDKA 3T1HJ 3AJ1A 3HI9A 3FSIA 4FDFA 3QT7A 2DRDA 1T05B 1SJQA 4NCBA 1LK5A 5KT6A 4DI6A 2QLBB 1SI9A 4RWXA 4FYVB 1M90T 5HAOA 2C3PA 4DX6A 3QRPA 2WW8A 3W62A 3GV7B 3UW1A 2N4CA 1JNRB 4YDDB 1TFYA 4RW6A 3Q8UA 2A2DA 4USVA 1JLAA 3T5LA 5F8GA 3NEKA 3LOUA 2Y1LB 4CT9A 1NNDA 5KTQA 5AXNA 1NRKA 1VLOA 4EWTA 4X64J 2F4VJ 4RNOA 3ZZRA 2V8DA 3TA1A 1RUSA 2WB1D 5ETLA 2KKHA 3F44A 2MZRA 2MJUA 5HMYA 2VONA 2B0GA 3U27A 4DPOA 2DNHA 3H5UA 4LF8F 2CG4A 2EFPA 4CLFA 3T5HA 3HVRA 3Q22A 3TARA 4DR6F 4ANEA 3HCXA 1VGYA 4OQJA 4DPYA 2C3OA 3BSOA 3UN2A 3GZ7A 2EBGA 4AL7A 1XMOF 1VI7A 1J5EJ 1NPRA 3ZZ0A 2YWKA 2D74B 1SIZA 3FEXB 4RW9B 4DPWA 2HHXA 4IKAA 1RT4A 1NKCA 4Q0BA 2WVCA 1NDCA 5KFAA 3TUPA 1HBOA 2CQCA 4K59A 2FVRA 3MF5A 4DPUA 2V2KA 1DRZA 2CVEA 2HHTA 1E6VB 2FVPA 2CZ4A 2FUG9 2C2ZB 2CQ1A 3MEDA 1HBUB 4CO4A 1TL7A 4J91A 4XTTA 3US5A 1B99A 3BF4A 4X4VA 3OTBA 1NK8A 5BR8F 4F3MA 2FJXA 3BS9A 5L38A 4F4KA 1FTCA 4Q43A 1HPZB 1Y3KA 5HBMA 3NMAA 3DLKA 3P5BP 4FPRA 2Z8QA 1B0PA 2G13A 3HXMA 4LSLA 3CJ8A 3TJAA 3UD3P 4IR1A 2J0XA 5IQ6A 1RCXB 4ELVA 3M8WA 3RB6A 4OYAA 1YI2S 2PEHA 2V9KA 1TVRA 2ZEJA 4MIAA 2G9OA 3HDSA 2BZ2A 3G6XA 2VJUA 2GMLA 2HGNA 2YNIB 1I6JA 3AT1B 3CCWA 2LQJA 2DNMA 2QSFA 1YTYA 1X8DA 3BGLA 3SCLE 2Y0SD 4P7VA 3BQ0A 4X66J 1W26A 2NREA 1WNEA 2FTRA 2BE9B 1JXLA 1U0HA 4QJVA 4WE1A 4C0BA 1Q78A 4DPTA 4AT1B 4LRFA 3SCJE 1PYOB 5B0CA 3CIMA 4FXVA 4WU3A 1H7WA 1R43A 5DGBA 4HACA 4DV2J 1U7LA 4LR9A 4J37A 3G86A 3R9LA 2F65A 1UETA 4ID5A 1U8SA 2E1AA 1RT7B 4HT5A 4DSEA 5B0EA 3BDPA 4Q45A 1KEKA 1N88A 5ETSA 4TQRA 2HFOA 1UVKA 3Q0AA 4NLSA 4M5IA 4CLYA 1CEZA 1YJTA 4X4RA 3KK1B 1R8BA 2X1GA 3QIDA 1BQMA 3NOGA 1NH8A 2HQ3A 4JI3J 2XWYA 5AE2A 2D41A 4O3PA 1WF1A 3V6DA 2OPPB 4XIUA 3H40A 1FKAF 1NDLA 2GO8A 4CH0S 1RISA 4NLOA 1DBDA 1S0NA 2M4MA 3M2VA 4YQWA 2VOOA 3MOZA 3MMCB 1XNRJ 5HP1A 2R42A 2XHWA 2V4QA 2ZH8A 2OD6A 5D0EA 1KR4A 1GMWD 3BGRB 1EJ7L 1TKZA 4J9KA 3NRBA 1Q8KA 4DX8H 3E2EA 5DZ7A 4CO1A 1BMQB 1S59A 2XGPA 2DISA 2CQBA 4OHWA 2OELA 3K58A 1F5CA 1I94F 2HKEA 4F7VA 4FPIA 1RCOB 2R8GA 4B9UA 2XULA 2MHEA 2R4FA 5A0YB 4ER8A 4CLKA 1O0PA 5J2NB 2UUBF 5AE3A 3T1YF 3TO8A 2CPIA 1LXNA 3FZBA 2FHMA 2DGUA 3BH7B 2OFGX 1M0SA 2QLXA 4ED3A 4KKOB 2YKMA 3V4IA 1RTJA 3IXQA 1R6YA 4KY3A 1SC4B 4LQ9A 3V5RA 2U2FA 3I6PA 3LWLA 1JWWA 2NXNA 4KE5A 1HHTP 1TL5A 3IRXA 4YS2A 3NY0A 3EE3A 1LNQA 4JI0J 3DRYA 1R0AB 3HF5A 4LFBJ 2PA8D 1ACMB 4O3OA 4NXMF 3DXBA 4A8SA 2YWHA 2MQOA 3OXLA 3R6GB 5IC4B 3PX4A 2FVQA 1JLQB 3SSRA 5DDQC 1RWNB 5KFHA 4ZPTR 1GQEA 5HMZA 3V6KA 1ULRA 3HD1A 4ZCMA 2DNRA 2XYHB 3DLGA 4WFNQ 1RT6A 1YVFA 1YJ7A 3PX0A 4OZ0A 5D3GB 3ADAC 2C3MA 2ZZNA 3HP6A 2LXFA 5CCMA 2MQQA 2WHOA 2RSQA 1KQGB 1REVA 2UP1A 1S72S 3MAAA 2HHWA 3GLJA 2JVRA 4U6PA 1VQ7S 3M2UA 2HNYB 3CCJS 5HJXA 1U1OA 3D28A 3VZIA 2CQGA 4U8VA 5EWFA 2LQ5A 4KHRA 3C14A 2VL1A 2OTJS 2IVYA 4JB8B 2ZOFA 4Y2AA 5GADI 4DSJA 4RLEA 4F4WA 1S6PA 1FO1A 4B3TF 2VODA 1UL3A 2QX0A 1MMDA 1HBNB 2BW2A 5JVHQ 3KJVA 3UVJA 1KBRA 2IJRA 2OKQA 1H7XA 2EI5A 1R6VA 4JI2F
chains in the Genus database with same CATH topology
2ZITA 1CQMA 2J5AA 3PW5A 2VH7A 1IXKA 4QQBA 3KHRA 3RB4A 2DH8A 4GO7X 5LXRA 1SH0A 2NYIA 3I0RA 5AXLA 2DH7A 1Q82T 2JDJA 4PWDB 4ZPWR 4HDGA 3N6MA 2ADBA 3C6UA 1S6QB 5E3CA 1URNA 1BQNB 2DNPA 2LDIA 5MLCV 3DXSX 1Q7YT 2E9RX 4CH7A 1FEEA 1O5JA 3GV8B 4ETXA 3IGVA 3ITHA 3IRWP 2RU9A 4KFBA 4DUZF 4KSEB 2C3UA 4URQU 2R8JA 2DGVA 3SFUA 3TQ1A 3MMAB 3SCIE 3HX9A 1B0TA 3G8TA 4KAIA 4Y34A 4OI4A 2OD4A 2YH0A 1TL1B 2XWXA 2ZDPA 5HQ8A 4C8MA 2EFNA 3QGPA 2ZOMA 3CIZA 2AJQA 2LEPA 2J9DA 2HIQA 3M32A 4OHXA 1DTTB 5EWEA 1XBWA 2VB6A 1TKDA 1YHQS 4G6VB 4X62F 1TQLA 4QWEA 3MEEB 4NLQA 3K59A 1RT7A 1VK3A 3QIPB 1D3WA 5KT2A 2HGMA 4RKUC 1NAQA 4IDKB 3E8OA 4NLYA 1TK0A 4KGKA 2FJVA 5DM6Q 2L08A 4MFBA 1JLGB 1XR6A 2BANA 5J2MB 1X4GA 2KH9A 1UJ4A 2XMJA 1HWUA 1SJ4P 1WACA 1Y7PA 3QWUA 2PFFB 4ZDNA 2KFNA 1SBRA 2OH2A 2KHDA 3IS9A 4WK3A 2DNKA 2IC3A 2KT2A 2RMLA 3MM6B 3N6NA 1K8AT 1AUDA 3E01A 3UE2A 3KK1A 4ID8A 1KRPA 1EETB 1C1BA 1GX5A 4AFFA 5EX0A 2C3YA 4M94A 4X4TA 4I2QA 3LANA 4N8OA 2DNNA 2ZBIA 3H5XA 1U1NA 4PKDB 5CA5A 4I56A 5FDLB 5KOXA 5GAHI 1HI8A 5GAEI 2YNGB 3I4PA 3H5YA 4KQZA 4OI6A 3OW2R 1MROB 1JLBA 5KAKA 2BJEA 3BGUA 2AYGA 4K4YA 1Q81T 4NLUA 2A18A 5CZVA 5K8PA 2VD3A 1X7VA 2NXUA 1Z2LA 5K14B 4F3QA 1GXTA 3OPKA 2XCPA 4WCEQ 1JJ4A 3WC2A 2FIUA 2ZE2B 2MKIA 1HNWF 2VFUA 1VQ9S 2UUWA 1DARA 1XR7A 5B09A 4RBTA 2MGZA 1DTQA 3FQKA 3PM9A 3JSMB 1T3NA 4PQUB 3KLVA 4RX6A 1FRKA 4LSNA 5FLXY 3NCQA 1WWHA 2XSJA 2OPRA 4NCGB 3L3CA 4ED5A 2BDPA 2E1MC 1CG2A 4HH0A 1Q8LA 4NLGA 2MZTA 4A46A 3NG8A 4BS2A 1HQEA 5J2PB 2K1RB 1NU4A 5L1JA 2AWZA 3HHEA 4YY3F 2J6UA 2XGQA 3OL8A 5M2UA 2VASA 2IMWP 3FSXA 4NLRA 4B9LA 1X4DA 3SQGB 1A7GE 3MEGB 3UCGA 5HMXA 2ZH3A 4DV7F 2RQKA 2KG0A 5DRKA 4C0HA 2IMOA 3ZC4A 3M8RA 4H4KC 4CNZA 4ZHRB 1FRIA 3S1TA 3MM8A 1X4HA 5IM0B 1U25A 1HWJA 5C42A 3OQ2A 1WEYA 2XI2A 1VRTA 2EFQA 2F1FA 3N4WA 5DQGA 1HQUB 2CQHA 1UFLA 4TU9A 2ADCA 1R8HA 2GFFA 2ILYA 3OSNA 1VIXA 1P1TA 2XMKA 1X4FA 1RKIA 2DNOA 1C1CB 4RNMA 1X4AA 3UFCX 3M6UA 5A0YA 5LSLA 2ZJRQ 2W9BB 4F2RA 1KC8T 1TL3A 4A8KA 1IQZA 3SFGA 1KHVA 4CO5A 1RT5B 3IR5B 4RNFA 3FEZA 2W7PA 4C11B 1X9WA 2JEIA 3R5AA 3WX4A 1ZM9A 2V8VA 3VAIA 3QMQA 4Q2MA 2J7WA 3CCLS 5DDPC 5I42B 4WIIA 3EZ5A 4N41A 4YOEA 4ZVGA 2E9ZA 3ZFVA 3PR5B 2CQPA 4B17A 4A8OA 4DV3F 3ETOA 1CLFA 5L9XA 4B9TA 1QJHA 4Q7AA 5IXUA 4DFKA 3P3DA 4M63A 4LF9F 4PQAA 1QSYA 2OPSA 2DHGA 2QMWA 1NHVA 4F26A 3T5JA 1KQKA 4OZLA 1K1SA 2OIHA 3MM9B 1HBMB 4EBDA 4H54A 2CJKA 3KK3A 1QSLA 5A6WA 3SZ2A 2P9CA 2RIJA 2IVMA 3M8PB 4EO6A 2ASJA 3O44A 2ZNYA 2O5DA 3CJ0A 3OTDA 3TNVA 5F9LA 1MWZA 4N77A 3VF0B 3AH6A 3J7Z5 2GGPB 2Q66A 4IG0B 4NLDA 1IKXB 1R0AA 5FD1A 1TKTA 2KHCA 2LA6A 4PXEA 4OJHA 3M6XA 3CEDA 3CF5Q 1PGZA 4WZMA 4C3LA 2LYVA 1OQ6A 2RD5C 3GIKA 1FRMA 2HRYA 5IS2A 3IR6B 3MM7B 4WZQA 2QEXS 1IM4A 3QLHB 1H2UX 2KXHA 4C3MA 1D8ZA 1FEHA 4QR2A 5DQHA 4DV6F 1S1TA 4MIWA 3T6BA 1RTIB 3MD3A 2W25A 4Y3CA 5I3PA 4LMZA 3NKYA 4UUWA 4B08A 1VQOS 2O01C 3GFXA 5AE1A 1ZOTA 5GAGU 5BYQA 3OR1B 1BY9A 2UV8A 2IFXA 4H4OB 4KBIA 2ZM6F 2YNFA 3PHEA 1SL0A 1U2FA 1X4BA 1H98A 3UQSA 4I64A 2GO9A 3DRRA 5G0RA 3GFYA 5EUHA 4F2SA 3LP1B 2LXUA 3CXCR 3I4HX 3OFHA 3TOQA 3KNGA 5L1LA 4BWMA 2ZKUA 4HH1A 2D3OR 5H9EJ 1N5SA 5KG5A 4DQIA 2CVIA 1IJFB 2IM2A 1FA0A 3ENWA 3EPIA 4EEYA 1R89A 5D3GA 3POTA 4KO0A 1NZAA 4MAKA 3GYNA 1QAJA 1TV6A 2VC0A 4RUHA 3C8YA 3KG0A 4OJ1A 4ELTA 1LFPA 4QOTA 4OI3A 2JWNA 1NK7A 4QIGA 3C2PA 4DL6A 3AQOA 4PG8A 3DHWC 2UV8G 1IKWB 2DIVA 1YJUA 4WU2A 1D0EA 2GNKA 3CCRS 3RR8A 2FVCA 2JC0A 4O4GA 5EX3A 1UKUA 3CCSS 2ERRA 2XLKA 3Q8QB 2JFKA 1N6QA 2GHWA 2OSQA 4MTPA 2KRRA 1FNOA 3JSYA 4RWWA 3SSSA 5KFMA 3Q24A 1QM9A 2ASLA 2QZ8A 4NZ6A 4X4QA 3ZZTA 3I5BA 2J9DE 3Q8PB 1S4FA 1VQ5S 3R5BA 1GXUA 3RB3A 3J81Y 3FGVA 3OBIA 3FQLA 1PO6A 1HMVB 2HVZA 4NLXA 3NLCA 4RW8A 1UJ5A 1AFIA 4O23A 5D8HB 4USIA 4O44B 4ILMA 2N7CA 4OFZA 2PMZD 4Q44A 4DN9A 2KN4A 3G6ES 5D78A 1T03A 5J1NA 4YEAA 1OQ3A 3J7YI 1APSA 1RT2B 2RB7A 5A8WB 3LAKA 4IRCA 3AB2B 2LXIA 2BVZA 1GAOA 4I2PA 4E98A 3UD4P 3OL9A 1VJWA 4HHJA 1HWLA 4TY9A 1NK9A 1J2VA 1U6BA 2A10A 3FCHA 2JHEA 1MNEA 4TXSA 2DGWA 1S1VB 1KONA 2BM1A 4PRFA 2C2EA 3SYZA 1LWEB 3HHKA 1U4BA 1LV5A 1FKOA 3ISZA 4DF4A 5D4LA 3IWXA 2IM1A 3VQTA 2FGCA 4DL0C 1SUQA 3TVYA 4QU6A 2QFJA 3PEJA 3ULHA 4QPXA 3KYLA 4RW7B 3B82A 4QIFA 4UUXA 3UPFA 2MY8A 3KHHA 3BREA 3K2YA 5F8JA 4ECVA 1X4CA 3Q8SB 1Z1ZA 3CJ2A 2VV5A 3UNGC 3PW2A 3DCAA 2YX4A 5KOWA 1JMTA 2RQ4A 4RW6B 1JLCB 5B0AA 5BYRA 5KG3A 2B51A 4PWDA 3H98A 3HKZD 3CD7A 2LCWA 1NEEA 1FDDA 4URSA 4ILLA 1VFJA 1YQHA 5DS7A 2ZD1A 1NH7A 1S1UB 2IAJB 2AJ1A 1N48A 3VWSA 4OZNA 2DVIA 2CQ4A 2FC9A 2VPWB 3DOLA 1VQ8S 3MI7X 5KFIA 3H8YA 3QAUA 4Y0FA 2AX1A 3MMAA 3HVTA 4TLRA 1NJYA 4JYAF 3MZIA 2I2YA 3FRYA 1G1XA 1TL1A 1RKJA 2APOA 3HJFA 2YKOA 4CZCA 3JTNA 2QYCA 3RBDA 3FRZA 2M5YA 1RT1B 2X1FA 1X5TA 2H5EA 2VFRA 5EDWA 3FJ2A 2F9JA 1UMJA