2DIVA

Solution structure of the rrm domain of trna selenocysteine associated protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA selenocysteine associated protein
publication title Solution structure of the RRM domain of TRNA selenocysteine associated protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2divA01
3NMRA 1M90T 1WF0A 2KFYA 5DM7Q 4V19X 3CPWR 1YIJS 3CD6S 1UFWA 2M9KA 3IWNC 3P5TL 5CA5A 2N3OA 1X0FA 4IUFA 2RVJA 1OIAA 1VQLS 2MKKA 2MQQA 1G2EA 3G9CA 4OZ1A 2O3DA 3TP2A 2FHOB 1HL6A 3MI7X 3J7ZT 1WHWA 2CQ1A 1QVFR 1ZZNA 4BS2A 3CUNA 2E44A 4CIOA 2KM8B 2DO4A 2MQLA 1VQOS 2MJNA 3MURP 3EGNA 1JJHA 2GHPA 1U6BA 1WELA 1P27B 2RS2A 3G8SA 1ZH5A 2VOOA 2KT5A 1KD1T 1N88A 1X4HA 1VQKS 1WF2A 2DNZA 3CCRS 3B4MA 1WEXA 2CQCA 2DNLA 1WI8A 2MPUA 3ZZYA 1DHMA 1FO1A 2KRRA 3MUMP 2MKHA 2KI2A 5MLCV 2N82B 1K8AT 1FHTA 2DH7A 3CCVS 2LCWA 1P1TA 2YKAA 2M2BA 3CMAS 2DHSA 2LMIA 2E5HA 1H2UX 2RRBA 2U2FA 3V4MA 1HA1A 4F25A 2AD9A 4PRFA 3CCJS 2OSQA 1UP1A 4A8XA 1VC0A 3SXLA 1M1KT 3B4DA 1WHXA 2UP1A 1U1LA 2AYEA 3DLLQ 2DNGA 4QQBA 2M88A 2CPYA 1UW4A 4WF9Q 3CC7S 3PIOQ 3P3DA 2DNYA 3H2UB 1O0PA 3VALA 2HGLA 1X4GA 1PO6A 1VQNS 2JVOA 2N3LA 2CQDA 2E5IA 2DNQA 2AYBA 1YI2S 4WFNQ 5DDRC 5GMKa 3U1MA 1QVGR 1OWXA 4TU8A 4W92B 1U1MA 1X4CA 3S7RA 5EN1A 3UCUP 1X4AA 1VBXA 1FXLA 4TLQA 2CPFA 2CQ2A 3VAKA 3Q2SC 4WFAQ 2DNRA 2KG0A 3CTRA 2MHNA 1Q81T 2DGOA 1WEYA 2CPZA 2MZQA 4FXWA 3THTA 2G4BA 2SXLA 5GAHU 2OTJS 1FJEB 3EGZA 2J0QD 2KN4A 3U1LA 2MMYA 3BO4A 2XS5A 2CQIA 2DGQA 3IRWP 5GAGU 2QEXS 1URNA 3CCQS 1KOHA 3I55S 2CPEA 3R1HA 3CMES 2DIVA 1WEZA 2YWKA 1WF1A 4PKDB 1M5KC 2VOPA 2PEHA 2L08A 1VQ6S 1H6KX 2HYIB 2RS8A 2DIUA 4TU7A 2E5GA 4Y00A 3FEXB 2M7SA 5GVQA 1SXLA 1HD1A 2DNPA 2EK1A 3LPYA 2MXYA 3MUTP 2CPIA 3R1LA 2ZJQQ 1VQMS 1WTBA 2LA4A 1X5TA 1UAWA 2K3KA 2J0SD 2LKZA 3CCES 2CPHA 1Q7YT 5DDOC 2RT3A 2OTLS 3UCZP 3VAGA 2PE8A 2EVZA 4WCEQ 2ADCA 2MY8A 4LIRA 2F9JA 3UD3P 1K73T 2DGXA 2MB0B 2MQPA 2M8HA 1M5VC 4YB1P 2DK2A 2HGNA 3G71S 1WHVA 4Y0FA 2LQ5A 2FC9A 2X1FA 2DH9A 1FNXH 1SJ3P 1H2TZ 2DGUA 2MYFA 1YITS 3MD3A 1A9NB 2CQ3A 2DO0A 2ZJPQ 2DNOA 5IQQA 3TYTA 5DDQC 2QA4S 1KC8T 2XNRA 3HHNB 3NNCA 3Q2TC 1JJ2R 3ZZZA 3CCLS 4OZ0A 1NO8A 4IOCQ 2LXUA 1FJ7A 2M52A 2RUGA 2XS7A 1L3KA 2DH8A 5GAEU 3G96A 3N9UC 2HVZA 4WIIA 2LEAA 4CQ1A 2DNKA 2JVRA 1U6FA 3NNAA 1WI6A 5BJRA 3UE2A 2MGZA 2D9OA 3BO2A 2WBRA 1VQ4S 2MZJA 2E5JA 1KQSR 2DGVA 5LJ3Y 1NU4A 2KXNB 1X4DA 1N52B 5IM0A 2F9DA 3S8SA 2AYGA 1U1PA 4IOAQ 2KH9A 2MKJA 4LJMA 1YTYA 3HI9A 2DHXA 2FPHX 2MKIA 2MGZB 1WG1A 5CXTA 3CULA 1H2VZ 4YOEA 3VAJA 2CQPA 1VC6A 2JX2A 2D3OR 2CQ4A 3G8TA 2M70A 1W2BR 5LJ5Y 3K0JA 3TO8A 4J5OA 5HO4A 1DZ5A 4CH1A 2MKCA 1M5PC 2Q79A 1SJRA 1PGZA 3P6YC 1OO0B 2HZCA 3MD1A 1WG5A 3ULHA 2LECA 2CPXA 2M0GB 3BS9A 1S79A 2CJKA 2VODA 2LA6A 5LXRA 2RQCA 3LQVA 2DGSA 5LSLA 3CXCR 2MQOA 1S72S 4QPTA 2KYXA 1YHQS 2MKSA 2NZ4A 2DISA 3US5A 2LEBA 2DHGA 1AUDA 1VQ8S 3MXHP 1VC5A 2RRAA 2X1BA 4W90B 3UCGA 1A7GE 1U1KA 2MJUA 2F3JA 1HD0A 1SJFA 3CF5Q 4WFBQ 2HGMA 1ZZFA 5JVHQ 2RU3A 2CQ0A 3VF0B 2ERRA 3P49B 2YH0A 2NLWA 1SJQA 5ITHA 2KM8C 2D9PA 2X1GA 3FEYB 2GO9A 3CC2S 4ERDA 1VBZA 4C0OC 3DXBA 1NJIT 3RW6A 3EX7B 3THPA 2JRSA 1VQPS 3BEGB 2LYVA 2A3JA 4M5DB 2J8AA 2DB1A 3MDFA 2CQHA 1XN9A 2MZSA 3NS6A 2B0GA 3CCUS 2DHAA 1YWXA 5HL7Q 2JWNA 2I2YA 2MY7A 3NS5A 1X5PA 2CQBA 2QFJA 3BO3A 1YJ9S 3PIPQ 4F26A 2V94A 2X1AA 1BY9A 4YUDA 3J7YU 1B7FA 1F9FA 1OPIA 4U67Q 2FY1A 1FJCA 1N54B 4WKRA 1RK8A 5GADU 5D77A 2K8GA 2KXFA 4QU7A 3SDEA 3H2VE 3CCSS 1JJ4A 2KHCA 4PR6A 3MOJB 2RNEA 5IFMA 3VAHA 2G0CA 1D9AA 2KVIA 3MUVP 3JB9k 1DRZA 1KOOA 1N8RT 4QU6A 4CH0S 2MSSA 1R8HA 2U1AA 3L3CA 2LXIA 1U2FA 2DGWA 4C4WA 3VAIA 2EK6A 4ED5A 3D2WA 3SDEB 5JVGQ 1D8ZA 1YJNS 1U1NA 1K9MT 2DNMA 4UQTA 1CVJA 1VQ7S 1RKJA 3VAMA 1X4EA 2MZTA 3UD4P 2KXHA 2L9WA 3CC4S 2XNQA 2CPDA 5CYJA 3S01A 2G1DA 3NNHA 5LXYA 3G4SS 3R27A 2KRBA 2VONA 1M5OC 2OJ3A 2ADBA 1X4FA 1WHYA 4ZKAA 1WWHA 2I38A 1VQ9S 1QM9A 1VBYA 3UWTA 4Z2XA 3VAFA 1SJ4P 2MQMA 3RW7A 4IO9Q 4EGLA 2MQNA 4UY8T 2J76E 1IQTA 4P6QA 2DNHA 5IM0B 1Q86T 2XS2A 1JMTA 5DETA 2N7CA 2AYMA 1WG4A 1FT8A 3SMZA 5LSOA 1U1QA 1X4BA 4LMZA 2MZ1A 3S6EA 2L41A 5D78A 1U1OA 1X5SA 4TU9A 2DNNA 2BOPA 1R8PA 1DBDA 2KG1A 2ZJRQ 2DITA 1X5OA 2DGTA 2OSRA 2RQ4A 4C7QA 2KU7A 5FJ4A 1VQ5S 2MZRA 1Q82T 2FC8A 3G6ES 3OW2R 2YTCA 2XB2D 2BZ2A 2YH1A 4F02A 1U1RA 3CCMS 2CPJA 4FXVA 5DM6Q 3I56S 1YJWS 2OIHA 2M8DB 2CQGA 5DDPC 4RU2A 2XSFA 2MSTA 2M4MA 5H1SV
chains in the Genus database with same CATH superfamily
4F3QA 5K5MA 4C8OA 2YKOA 4MIAA 5B7WA 4ED0A 1SQFA 1DTTA 2P2CB 2HS4A 3SQOP 3H5YA 5HMXA 3RR7A 3OFHA 3D28A 2VD3A 3PDNA 3L7OA 4HHUA 1IXKA 2GHPA 2JFDA 1P27B 5KFHA 4ZHRA 3VQTA 4AQYF 4DR4J 1HQ2A 2QGFB 2QL7B 1S0NA 3EZUA 1MU2B 4MMOA 1NKBA 1DFDA 1GTHA 3LO3A 1VHFA 2MKHA 1SV5B 4CO3A 2W4DA 4TY8B 4RO0A 3CCVS 4N56A 1MG7A 3OXLA 3L9ZA 5J1EA 1D09B 1ZA1B 1KSPA 4IFVA 2FVPA 3ZTQA 3O5TB 4ZPTR 2XM3A 2HWTA 4OI4A 5KFNA 4J9SA 1EARA 3RGIA 4QIWD 4YB6A 2BKOA 4KE5A 1QAXA 4JI7J 2KDOA 7FDRA 2HBZB 1PYTA 3NCRA 4I4BA 4X64F 3HHLC 3M8WA 3THTA 2NQPA 1LXNA 1EKRA 3OUYA 1LW0B 1LQ9A 2YQ3A 1D8YA 3CO9A 2BJ7A 1M5KC 2VOPA 4RUHA 2L08A 3K7RA 1VQ6S 1V3RA 1U8WA 2F5GA 2C3UA 1TVRA 3A4TA 2GQ2A 2ROPA 1CULB 1IR0A 2R7UA 1F5BA 2FHMA 1Q7YT 1R6VA 3DI6A 4RKUC 2QLFB 1PIEA 4B9MA 1T9YA 4FYVB 4PEOA 4DU7A 2BJ3A 1QTMA 1FK9A 4ATNA 3T41A 2QA4S 1X60A 2EWHA 2HRUA 2NYIA 2V8PA 2FLLA 2FZCB 3RBXA 1L3KA 4X4QA 1SBRA 2E7WA 3G96A 3UDCA 3H25A 3AODA 3I6PA 3MAHA 2Q6CA 3A8KA 5FDLA 5I3PA 2AU0A 1RT2B 5CXTA 3VAJA 1CJTA 3IM9A 1EP4B 2UUCJ 2QN6B 4EMDA 4HT7A 5JMNA 2QT7A 4DCPB 1OJ4A 4B08A 1RKIA 2R2TA 3MMCB 2X51A 2KYXA 1GX6A 3EYZA 2L9DA 3BBFA 3SQGA 1UWBB 2C22A 2OKQA 4U7UK 4OFZA 3J81Y 1RT3A 4OZNA 4LFCJ 1UZHA 4J9NA 4M5DA 1REVB 5C2CA 3VF0B 1YJTA 2F1FA 3HSZA 3M9NB 4M5LA 4ENOA 2ZH3A 5A6WA 3BGUA 2WW8A 2JRSA 1H0HB 2A3JA 1LNQA 3PV8A 2QX0A 3S1TA 1JLEA 5KG3A 2R42A 4F26A 4F4ZA 1KNZA 4FS2A 1B7FA 2HQGA 2E1CA 2FY1A 4ZVGA 2DBBA 4JI3J 4PXBA 4DSEA 1JLQA 3ENWA 2VDIA 4A47A 4J9QA 3ENVA 4OZJA 4KGVB 5IXUA 2F8EX 1KOOA 3IGNA 4QU6A 1HNVB 3Q83A 4NRUA 2O66A 2HZAA 3QYYA 1T11A 1U6ZA 1U1NA 1K9MT 1U0HA 4LF7J 5CYJA 5E7OB 2G1DA 1HFEL 4ZPVR 3G4SS 3W9HA 1VCTA 3V81A 5L9NA 3MEEA 1WHYA 3D66A 3WHIA 4ID5B 4EUVA 2AX0A 4KTQA 2G0JA 2J9CA 3N4WA 1WG4A 3SMZA 5IC4B 3JQJA 3MPDA 4JI1J 3BDPA 1FJGJ 1X5SA 4Q8EA 2DNNA 1WDDA 4PWWA 3T5JA 4UOGA 5E41A 3O8WA 2MZRA 1Q82T 2E9ZA 4ZVUB 4USTA 4OZ2A 3O6QA 5CHCB 2HQ3A 3GIRA 4C2MA 5CH7B 3KJVB 3PXGa 1LK5A 5BR8J 4JI2J 1AW0A 4ZJLA 3LP1A 3HD2A 2OH2A 4OI1A 2N3OA 2YKMA 1U02A 3J7A1 1RSCA 3JSBA 4OZ1A 1HL6A 5B0EA 2WVEA 1ZZNA 2WAQD 5EGYA 3MR2A 4H4KA 3F73A 1RAAB 3PHTA 1UVKA 3EGNA 4XK8C 4GKKF 1JLAA 2BJ1A 3J7Z5 1KD1T 2PSZA 1RJJA 1VIOA 1SJ1A 1WF2A 4IH6A 3RAQA 2FUG9 4U6PA 4BC7A 3QO9A 3QJJA 4ZPWR 1DHMA 3O1LA 4Q45A 1WKKA 2H1YA 4DX8H 2UUAJ 2N7YA 1QUVA 1U48A 2W2NP 3G6YA 3EPIA 3HCXA 2U2FA 3SYZA 2YPZA 1VRUA 3DCAA 1WOSA 4RW7A 4P75A 4WF9Q 2M88A 1S0VA 1N5SA 3LALA 1HWLA 5L1IA 1ZPWX 1L5UA 5A0YA 3DLGA 4ZVSB 1YI2S 2V4JA 4RPFA 4DV6J 5LMNJ 1X4CA 1VS3A 3HHKA 5AE2A 1FI4A 4G6VB 5HJYA 4W4MA 5KG6A 1I5OB 3IRXB 1Q81T 3MOZA 3PW2A 3QT5A 2ZH1A 2MMYA 3BO4A 2D1CA 4ECWA 1NDPA 2QA1A 3A3OB 4PG4A 4AYBD 2OEJA 5K20B 3CMES 2DIVA 2PFDA 3KUEA 1W26A 4WP9A 5IV3A 3D1HA 2B7CB 3FCWA 3KLVA 4LR7A 1VQMS 1X5TA 5LM7E 2J0SD 3CCES 3A3NB 1N34J 5H9FK 3TWZA 4X4RA 4WCEQ 2VF3A 2PI4A 1RDRA 4S0MA 1U24A 4ECXA 5B0GA 4HR2A 1FNXH 5RUBA 4N8NA 3W62A 3NGKA 4ZK7M 2WHOA 3H7HB 2OAUA 4C97A 2CVEA 4LF9F 1J2VA 1TUWA 3FDSA 3MMBA 1HYSB 3T1HJ 3AH6A 3WX4A 4IOBA 3DRXA 2OEMA 2PN6A 3W64A 2ASDA 3R6LB 3UE2A 4M95A 1WACA 2E5JA 1NU4A 3A8JA 4URQU 1FDDA 3MM7B 3H8YA 2WONB 4DZDA 1S6PA 3BGRA 1FFSB 1HBUB 1XMQJ 3K5LA 4QIEA 1KLNA 3P6YC 4MFBA 4NLPA 5HVFA 1EQ0A 2W2QP 1JKHA 4RZRA 4AE5A 3T5LA 3HVTA 4DR5F 1NH8A 2HG4A 4DUYJ 4O0NA 4HT5A 4C6AA 1RTHA 4L76A 3IAM9 1ICEB 3A8EA 1B3TA 2ERRA 1FKAF 2BANB 5KG2A 2FLOA 3GR1A 4ERDA 1N6QA 2R2RA 1MROB 4YR2A 2WB4A 2VH7A 3RU0A 2PI5A 6FDRA 2OD4A 1G6BA 3NS5A 3PJWA 3G6XA 3V6JA 1YZ6A 3UQSA 3Q8RB 1GFWB 2GVDA 2Q66A 1G7CB 4NA2A 1H74A 1CJUB 3HM9A 1HBNB 1HIYA 4HI1A 3DU5A 3KLEA 3MTKA 4ZVFA 5KFBA 4OQJA 4Y2CA 4DL0C 2G2OA 2YX7A 2GC8A 4NZ6A 4EYIB 4M8LA 5LXYA 1WNEA 3R27A 1F60B 2GMJA 4ALZA 4O4GB 1X4FA 2XG8A 4FYDA 4CO4A 3M8PB 2XI3A 2BE7D 4DV0F 1AZSA 2G9OA 4WBFA 4DN9A 1IBKF 2DNHA 4JI8F 1WOPA 2NXJA 3FFIA 4Q44A 2MZ1A 2DCUB 5J2PA 1UVIA 2HNYA 1U1OA 1RBLA 2V0NA 3HT0A 2BOPA 4LVNP 5DQHA 3ITHA 2CDQA 3VZHA 2COLA 2XEXA 4DR7J 1Q5VA 4RWXA 5L8RC 2BZ2A 1I3OB 4LIWA 2KYZA 4WTYA 4O44A 4NLYA 3K2YA 1ACMB 2ZD1B 3NMRA 1H98A 3TI0A 3IFEA 5C24A 1S6QA 2ACMA 1U49A 2KJVA 3OL7A 3KLGB 3MAAB 3QJPA 5CA5A 2IRXA 2UVWA 2OD6A 1WTFA 1WC3A 2CKWA 2MQLA 2HQFA 3VGVA 3ILJA 1QE1A 3MURP 1JJHA 4JV2A 1EX8A 2HHUA 4LF4J 4OYZA 1NSAA 1IKYB 3QRPA 4X2BA 1REGX 3M2UA 1CG2A 1RBOB 2P5VA 1VLOA 4F3MA 3QWUA 3FEZA 3FBCA 2E7XA 5HI7A 2DY9A 2KVQE 1RA6A 1EAYC 3H40A 1FDNA 1XMOJ 3EICA 3LTOA 2VBZA 5F9NA 4LSLB 5D4LA 5J2QA 4NLOA 4X4VA 2NSBA 1VMBA 1SKSA 1EJ7L 4EYHB 2XLJA 2OSQA 5IOLA 4IG3A 2QO3A 1WJ9A 3SXLA 3U1NA 2AYEA 3OQ2A 3BF4A 3PRBA 4DWIA 2EBGA 3P3DA 2DNYA 1HBMA 2WZ1A 3P45B 3MR3A 3QBCA 2JVOA 3TVYA 1U45A 3R5AA 2ZE2B 4EBCA 3H90A 4F67A 5KT5A 2CQ2A 2EW9A 3GR0A 1TKXA 2IJRA 3OSPA 2LEPA 2DNRA 4CO0A 5BYSA 3EVWA 2JLFA 3JTPA 2YQ0A 3OTBA 1N56A 5DS7A 4YB5A 1N5TA 3H4DA 3LUYA 2XO7A 1S49A 3IG1A 1C1CA 3W5XA 4FP9A 4L6V3 4U9RA 1ZOTA 2V50A 5FIIA 3RB4A 1B0VA 2EK1A 3LPYA 3M2RB 5EWEA 1O6XA 3IBFB 2K3KA 3PO5A 2YNHA 2ZDOA 2HHPA 3NOGA 5DG8A 3N6MA 3SIPB 2M8HA 1M5VC 2H5EA 5F3ZA 3DRSA 3G71S 1UWAA 3VWSA 1BLUA 4CLUA 5K14B 2ZJPQ 2V9WA 3H98A 1KC8T 4OJ1A 4ZCKA 3KHRA 1TL7B 4USIA 3GIMA 2RU9A 3P5BP 1F3FA 1JLFA 1RP5A 5CQGA 5F8GA 1H38A 2W7AA 4TY9A 4W98A 4USMA 5DRKA 1U1PA 4IQXA 4X65J 2D3OR 2GNKA 1B70B 2V9KA 4NEZA 4ZJOA 3K0JA 2MKCA 1RTIB 3MD1A 4I6AA 3ULHA 3MEDB 2YBVA 3TARA 2M0GB 2FJDB 5LXRA 2GJIA 3D67A 3FSIA 5E33A 2P6TA 5L46A 2GCFA 4NPOA 3HVWA 5GMDA 2MJUA 3NP5A 3OJSA 1XNRF 5HSPA 1PYSB 2B4PA 2F4VJ 5ITHA 2NR0A 4ZVOB 4YY3J 2GO9A 3I0SA 3AXMA 3C46A 4GVBA 1NJIT 2DCLA 4K4UA 4DR6J 3BEGB 2AWZA 3QT7A 3GLJA 3KKFA 3NS6A 3PW5A 2I2YA 3IGVA 2XHWA 2X1AA 2A1BA 3QIPA 4CZCA 3M1VA 5GADI 2E7VA 3J81U 2RE1A 1SKUB 4UT4A 3G2XA 3SDEA 1X8DA 3MOJB 2RNEA 3VAHA 3MUVP 5HBMB 3F0NA 3CJQA 4R25A 1YZ7A 4Q2MA 1D8ZA 2WTFA 1VQ7S 1A6LA 4ZA1A 1OMSA 3GSDA 1K1SA 2VONA 1M5OC 3PEJA 1CQMA 2HMIB 4PXDA 4LFAJ 4LUBA 1DQ9A 3UN5A 1SJ4P 5AXMA 3KNGA 3HSDA 4P6QA 2HHSA 4ELUA 4BC9A 4K4SA 2UXBF 2N7CA 1S5ZA 2CIMA 5IQ6A 2YNFB 4O3NA 4DQQA 4N5SA 4DX6A 5KOWA 4UY85 4PG8A 3GYNA 1X5OA 4C7QA 3WC0A 3H20A 3Q8QB 4LF8J 3QPIA 4MT1A 1X9SA 3D9BA 4DQRA 4DG1B 4CLSA 1NSQA 4QWEA 5C2GA 2ZDPA 1SKWA 4L75A 4FNIA 2NREA 1RA7A 4ZVRB 1ZAXA 2CWKA 1B7YB 3MMJA 2J6SA 1PCAA 3T5KA 4E8UA 2FGOA 3D0GE 2MKKA 3TP2A 3MI7X 3AFGA 1M5SA 4X62F 3NGRA 3PW4A 2FZGB 2QL5B 2A10A 1MU2A 5HMYA 2MJNA 3OV7A 2IHR1 1QAYA 2Q1LA 3AOBA 4O3RA 5KG5A 4TY8A 4WKYA 3RRHA 4A46A 4MIBA 3J80Y 2VPWB 3TZWA 1JNZB 1YVFA 5JUMA 1G4CA 3OL8A 1IN0A 3PY8A 1T0TV 5F8LA 4DR7F 4ZDNA 2VQFJ 1H2UX 3AD8C 3MM6B 4KT0C 1FRMA 2BW2A 4DV1F 3PIOQ 5D4OA 2EKYA 1L3VA 3HF5A 3TAMB 2W7OA 4D3HA 1RYRA 1X31C 3NWRA 4NLTA 1NK4A 3FK4A 1FXLA 4XTTA 2ZZMA 4PXEA 1LW0A 2RILA 4NZ7A 3PR5B 4ZLLA 1BQNA 1S97A 3WBZA 2V8HA 1JXEA 4FXWA 2SXLA 2YKQA 5GAHU 3FRZA 2XS5A 3PZPA 3ISND 2X3DA 1CULA 1UFLA 1VK3A 3LAKA 1FEEA 2AGPA 1D0EA 3L7PA 2Y3YA 1XJWB 2ALYB 4A8OA 4X4UA 4QR1A 1UJ5A 2Y1JA 4OX9F 1KQGB 3HXMA 4EBEA 2RMLA 4B9VA 4HLBA 2HS0A 2RDIA 1LFPA 1YITS 2DO0A 3W2WB 2HLUA 4NLWA 3FUYA 3ZZZA 4I67A 1QSYA 3V6DB 2XS7A 2ILYA 3JSYA 1GEHA 5THWA 1VRTB 1I1GA 1RT2A 4X4OA 2IY5B 4IYQA 4LF6J 1EP4A 2O1PA 2QLBB 3KMQA 2KL8A 7AT1B 4CLLA 1QAIA 2BKNA 3RBZA 1FWLA 1WG1A 4BDPA 2W4PA 3FCHA 3MMCA 3CCTA 4JI5F 1E6YB 1ZBTA 2B4OA 1ULRA 1UWBA 2LECA 3JQMA 3DNCA 2CPXA 4J9OA 2VIHA 2LA6A 4DFJA 3BH7B 2DGSA 4CLZA 4CLTA 3R5DA 3QMQA 2DISA 1REVA 1B4SA 5ETVA 1IKWA 1XIQA 4CDIA 3ZXWA 1NK6A 1FE0A 2GMLA 2E9TA 1XNQJ 2D9PA 3EE3A 1YRTA 5AXKA 4E98A 3FEYB 3E8OA 5CCLA 3CC2S 3DXBA 3K89A 2AHOB 4IDKB 4Y2AA 3VVTA 2ATLA 3OLBA 2FGCA 1R3NA 3T5HA 3FBBA 1Q79A 4DCJB 2G2ZA 3NGUA 4IRCA 1HNVA 1MMDA 1S0MA 1CJKB 2C3YA 2POKA 2WVDA 4X65F 2CJXB 1N8RT 3BQ0A 1N4LA 1U2FA 3GG0A 2AX1A 2F65A 1WKJA 2ZFHA 4ED5A 3W2VB 5H9FJ 4EZ6A 3OPKA 4ID5A 3THVA 4I2QB 3I9V9 4F0HA 3I9ZA 4ELVA 1RQ0A 2I5JA 2ADBA 5F8HA 4FXDA 4USWA 3BQ2A 4NXNJ 1MNEA 3RB3A 1Y3JA 2PC6A 4QIVA 3PX0A 2F4VF 1LOUA 1NPKA 2GHWA 1BMQB 2J9DA 4PG6A 3KJVA 1GXTA 3EXCX 4OJGA 4NYZA 1T7PA 3EDRB 5I4MA 1AUSL 3BB5A 3C16B 3TW0A 2G1HA 2H9ZA 5KFQA 2JDJA 4JI0F 2DR5A 2B9YA 4KH0B 3E51A 1RTZA 3GCXP 2XYGB 1X0FA 1F5AA 1VQLS 2NXUA 1Q4RA 4ZVHA 2O3DA 1TTHB 2ZKUA 2CQ1A 1S9FA 4FVMA 4CCHA 2DO4A 3ZTRA 8RUCA 3KHHA 3CJKB 1YBTA 4I7FB 1WELA 1UVNA 5KFCA 2FJXA 1X4HA 3D0HE 1JXLA 2HFUA 1SQGA 1I6JA 2XWYA 5M2RA 3MM9B 1LXJA 2BW7A 2ZHAA 2IYGA 2ZITA 5A2QY 4TNOA 1KKHA 3GYGA 2LCWA 5GMEA 2VFVA 3CEDA 3NWGA 3BKTA 3GFHA 4Y34A 1W7WA 2E5HA 1S1WA 3J81j 1IBLF 1YRXA 5D0RA 2R7SA 1UW4A 4ELTA 4IRKA 4DPTA 3OVAA 3VALA 4WIQA 3IRXA 3U1MA 3ZC4A 1OSCA 4PPDA 2E1PA 2YKPA 3HMJG 5BXIA 2D3UA 1RAEB 2Y1LB 3BGOP 3CTRA 4K5SA 2G4BA 3ONQA 1KHVA 1UEVA 4BCAA 2KN4A 1I94J 1IVZA 3EZ5A 2DGQA 1RT4B 2Z8QA 2QEXS 1HNIB 2CPEA 4PKDB 3POTB 4MH8A 2FJBB 3N6NA 3TUZC 3MPVA 4NYPA 4OYWA 3UN2A 2GGPB 1U25A 3CCZA 4P73A 3I87A 2LA4A 3BQ1A 2CPHA 5DDOC 2BQUA 3SSSA 2MY8A 4LRAA 5A6PA 2JNJA 5ETKA 4Y0FA 4Q7AA 4EU0A 1HYSA 3MD3A 1A9NB 5CABA 2OP5A 4H4OB 2LQBA 1R8AA 2JEGA 4LR9A 1KS2A 2WW4A 4ZPBA 3W9JA 2APOA 3R7BB 2BQRA 1JIHA 3CDAA 1IQZA 1GNKA 3BO2A 3MM7A 4M5JA 2WONA 3EMTA 3EVMA 1NJWA 4A8QA 2D3O1 4OV6A 1HBUA 3QWPA 1U09A 2CZ4A 4CLWA 1YTYA 1HR0F 1TKZA 3R2DJ 3MEGB 3ENQA 5ETNA 1MMNA 3PG9A 5LJ5Y 3AOCA 5HO4A 3ETOA 1NHUA 3KXDA 4GC6A 2CNLB 1TUGB 2CJKA 1NXIA 4OHXA 1T9WA 2VODA 1ZA2B 4OHYA 3MPWA 3ZNUA 3H4BA 2BANA 3MPUB 1MWZA 3UCGA 1ZAWA 2K7JA 3C6UB 1C1BB 1MROA 2BJ8A 3BGLA 1ZZFA 1GQEA 3BH6B 2NLWA 4RBUA 5ETRA 2BE2B 3HVAA 4FPIA 4WU2A 4NE9C 1KDNA 5K8OA 4F4WA 4C0OC 2W9AA 4DV2J 1R0BG 4M5HA 3EX7B 3SV4A 2CQHA 1YJRA 4ZVQB 1NDKA 3KOAA 1YWXA 1CJUA 4O4RA 1WOOA 3UNYA 3U7JA 4KHPF 1HBNA 3PRDA 4LF2A 1YGYA 2PMHA 1N54B 1WC4A 3BR9A 2KXFA 1Y5IB 4DFMA 3VGUA 1DURA 4LBPA 1HI1A 4NMXA 1U2RA 1NHVA 4KFBA 4UOHA 4P2XA 2KTQA 1SH3A 1RU1A 2OELA 1R8HA 5F3TA 4J90A 2QTWA 4O4GA 4DV5F 4DCOB 4K59A 4ZPCA 5HJXA 4LRCA 3CD7A 2QSWA 3ENAA 3FQKA 2AT1B 3GG1A 2UXDF 4TN2A 1EIYB 5BYRA 1B0PA 2DJWA 2DY1A 4MK8A 4F7VA 1AB8A 2HEKA 2XMMA 4NWBA 5DO2A 4EO8A 1LWEB 5IM0B 4DZ6A 4JBCA 1R43A 3MM5B 5B0AA 4DX7A 5IWAF 2ZEJA 3S6EA 1F2GA 2L41A 5IV4A 2ZJRQ 1D9DA 3CGIA 5IZHA 2ZD1A 2ZOFA 4DLGA 1N48A 1TU0B 1UTAA 4CI0B 2ZHBA 3G87A 3I56S 3KLGA 3MAAA 2OIHA 2AV5A 3OR1B 2IFXA 1MMLA 2NUUG 3PW7A 3ET6A 1ELOA 1G2EA 2UXCJ 4TVAB 1IKYA 4K4VA 5T7LB 2VICA 4F2SA 1JB0C 4HHJA 3WC2A 3QFWA 4K50A 1ZH5A 2VOOA 4YB7A 1XR6A 3GJQB 2J7KA 4F4KA 2KB2A 2JOQA 4PYAA 4J9KA 3AAWB 2ZVIA 3MR5A 4LSLA 3QSYB 1O5JA 3DRRA 5KOXA 1WI8A 5ETOA 2F7VA 3ZZYA 1D1UA 4PQAA 2DXEA 1NHKL 3Q8YA 1Y5NB 2I1RA 1HWJA 1LW2B 4NOHA 4QIFA 3WDOA 3CMAS 1WORA 2CG8A 2VASA 3TA0A 1U8SA 3DOLB 1T05A 1VC0A 2QA2A 3TR5A 4C11B 2ZE2A 5J2MB 1QLNA 1JXVA 3MGJA 3DLHA 5LMUF 4U8YA 1G3OA 3KG0A 3J80U 1O0PA 2P9GA 2E5IA 3CCWA 5DDRC 5HATA 4QW8A 1FWKA 1IM4A 2CPFA 2WBMA 3Q2SC 4GMKA 4ZP7A 2AJ2A 3T9NA 3CDBA 1HHSA 3K5OA 4ZCMA 3CJ2A 1WKLA 5C7PA 2HW3A 3U1LA 3KJFB 1URNA 3M2RA 3W9IA 2YWKA 1WF1A 2ABYA 1H6KX 2W01A 4ED1A 1VJWA 2L3MA 1J27A 1HD1A 2VKZG 1VRQC 1NAQA 2ZJQQ 1WTBA 1RAJA 1T94A 2EFOA 1S1VA 4UZBA 4PG7A 5K14A 1PJ6A 1TQLA 5HANA 2MB0B 1TL7A 2BXJA 1H2TZ 1XTZA 3TA1A 4FF4A 2DGUA 4PXCA 3RRGA 3PACA 4R5PB 4QZVB 4F0KA 4FVCA 4QCLA 2PIIA 3W61A 4WIIA 3ILOA 5D0GA 2LEAA 2HKEA 1CJVB 4XPCA 4KV8B 1VQ4S 1Y3KA 4L73A 2MZJA 4WXWA 1VDHA 1W25A 1RTIA 5AJ3J 4P9SA 1LFWA 2DVIA 2E5LJ 3MEDA 3MM8B 3CULA 3RB6A 4AQYJ 4P10A 3R3TA 4DBQA 4DL2A 4I1TA 1K1QA 2Q79A 1PGZA 3GIKA 4CT8A 1S72S 4QPTA 4NCAA 2DHGA 4Z7YA 3JTOA 2HHQA 2X1BA 4W90B 1T03B 4DQPA 1B99A 2R8IA 2CQ0A 1KN6A 2O67A 5HMZA 1RAFB 4ED6A 1VBZA 1RTDB 5KFOA 3NCQA 2W2OP 3THPA 2R8KA 2DHAA 3CJ3A 4AXJA 2OFGX 2CQBA 4JP8A 4ZP8A 1KVKA 1VYAA 5HBMA 4LQ3A 4NLVA 4X64J 2XTJP 5D77A 2K8GA 2KO1A 4DV7F 2Z2LA 2YKNB 2IIHA 4RNMA 2IM3A 5AXLA 3KK1B 1L3TA 4DV4F 2HMIA 3PTWA 2DNMA 3VAMA 1Q7LB 4OYAA 2MZTA 1HQEB 3DMJA 2V5HG 4L3NA 3M6UA 8AT1B 5HN0A 3K8VA 4DSJA 2AEJA 2XMKA 3KLIB 2YNFA 3M6WA 3UVJB 2JJ4D 5CAAA 1UZDA 4HDHA 3N0VA 5IT0A 4X4PA 2GW8A 1TL1B 4LF5F 5E3PA 3W63A 4DG1A 1Q53A 2PO4A 3PFOA 4Z7CA 1N36J 1UFKA 5K8MA 3G6ES 4FF2A 4F02A 1U1RA 4DPYA 3KJQB 3CCMS 5DM6Q 5EWFA 2DKOB 3DGPB 3QGIA 2AMCB 4ES3A 5GAHI 4UUXA 4RJVA 1TELA 1WF0A 4QR2A 4UW2A 2JLEA 5LL6d 2CJQA 3C14B 5KTQA 5F0UA 2OLWA 1S9GA 2ZBIA 1EHWA 3OFFA 4IUFA 2VG7B 2RVJA 4MTPA 3RJMB 4IR9A 2QA4G 3AT1B 4CRJA 7FD1A 4NLGA 3IA0A 4KH1B 2GO8A 3OTOF 3L4BC 2HNZB 3B6BA 1S1TA 4EEYA 4JV1A 2AGOA 3FGVA 3G8SA 2J8SA 2IVMA 1VQKS 1GXUA 3TJ8A 3CCRS 4QW9A 3M8ZA 1WEXA 4LRFA 2AZ1A 2MPUA 1OQ3A 1VJQA 2QV6A 2HSEB 3MM6A 5DQGA 3PRVA 4ZLPA 3ELHA 1SC6A 2I0XA 2V4RA 4NX9A 1RXOB 2NPIA 3JTNA 4P52A 5U47A 3TAMA 5DZ6A 2CPYA 1SIWB 4KSEB 3TQ1A 1JK9B 4ID8A 1GK8A 1NJYA 2AYBA 1EETB 1S4EA 4WFNQ 4U7UD 1N0VC 3UCUP 5J2NB 3OTEA 1CPZA 1OPZA 2O5DA 3UPFA 3D6TB 2V8GA 6AT1B 3KTQA 2XHCA 2EFNA 3Q8SB 1RHUB 3M7VA 3VTIA 4RUAA 4Q0BB 2PEHA 1OYEA 1HI0P 4ECQA 3I0RB 1NLKL 3DRYA 1QD1A 3KJNB 3UCZP 3N79A 1ZTTA 3W2WA 4KO0B 2W2PP 1XMBA 1VHIA 2IM1A 3UD5A 5D6GA 1PBAA 1XQIA 3ZZUA 4QWCA 3HK2A 3V6DA 2WVBA 1DQAA 2DRBA 2B3TB 3CDWA 4RNFA 2A0FB 2IDLA 3QAEA 1H73A 2B8QA 2HVZA 1Q8IA 1JLCB 2HVEA 4CH7A 2YPYA 2DR8A 3OJUA 5LJ3Y 1E6YA 1Y4ZB 1EZZB 1HLWA 4FKXA 1H2VZ 4G1QB 2CQPA 5I3QA 3M8RA 4HI2A 2QSFA 1RU2A 4IFVB 2C2ZB 3BN4A 4ECYA 1TK8A 4JUZA 2LU1A 2HQIA 1TL3A 4H4MB 2ZH2A 2AIRB 5IT9U 2D7SA 4A8YA 1KR4A 2RRAA 2L48A 1RACB 1P1LA 3CF5Q 2V2ZA 1L3UA 4IDKA 4WYLA 2B43A 3NAIA 5F0WA 2HHWA 2E1MC 3NBPB 1Q8KA 2JHEA 2AJ0A 1FTRA 3HD1A 4U96A 3NGDA 5HL7Q 1C0UB 4H4KC 1SC1B 1CJKA 1UJ4A 1YJ9S 4NCGB 2DTJA 4DR2F 2W7PA 3G8QA 3I82A 1S6OA 5GADU 3PX4A 3MFHA 5AJ3F 3GMGA 2E5LF 3W2VA 4RW6B 4Q5VA 1BC6A 4KGZB 4I2QA 1UA0A 3R97A 2H48B 2BV3A 1RKJA 3KG1A 4E2FB 4Y65A 2Q43A 3D54A 3OSNA 2YY3A 3BZQA 3R5GA 5B0CA 2AJ1A 2W2MP 3C6TB 4Z2XA 3EDQB 2ZBCA 4P2FA 3I31A 4CWBA 1IQTA 4ECZA 5KFAA 1FRXA 4PQUB 4LF9J 5KFIA 2WK4A 2RQMA 4WK1A 2Y1RI 1FNOA 2ACYA 1Z2LA 4BLGA 2B4UA 2MLYA 1XWLA 2AF6A 4PCQA 3SQGB 4X66F 1N32F 3ZO7A 3TA2A 3G82A 1S0OA 1YIJS 3CDUA 2R7RA 1MSWD 2P9EA 5KFFA 2W9CA 1VI7A 2VFTA 5L9XA 1N5YB 3CJKA 4I7FA 2FHOB 1WHWA 3MMAB 4J9PA 4DR5J 3CUNA 2RDJA 4CTAB 1KFDA 1GAOA 4X4TA 3IAS9 4B3MF 3CWJA 4YR0A 1FXRA 3MM9A 4C3LA 2VL1A 2MLZA 2RKIB 4MYTA 2VQEJ 1MLAA 2B9EA 4FF3A 1HARA 2AKWB 3JQKA 3N28A 1FO1A 2KRRA 2KI2A 2XMJA 3HVRA 3UN3A 2G2YA 1N36F 2ATCB 4JI4J 1U0HB 2NXCA 4IFYB 1HA1A 3CCJS 5J1NA 4G65A 4ZIWA 3X3UA 4RW9B 2KFZA 4HH1A 3SV3A 4MKBA 4KB7A 2DNQA 5GMKa 1OWXA 2R2SA 3OR2B 3W7BA 3SI8A 1XR5A 1X4AA 3H59A 3M05A 4WFAQ 2CNNB 2I9SA 4B3RF 1T3NA 3POTA 4N76A 2W9BA 2WVFA 2DGOA 4OX7A 1NMEB 3B8HA 4WYWA 1S76D 1KVIA 5C25B 1WSVA 1IJFB 2J9EA 1NDLA 1VQYA 4D3GA 2E9RX 1U2CA 4DV0J 2GGPA 2B9XA 4RNNA 5FLXU 3MCOA 1IBKJ 2YVSA 4JI8J 3FSXA 3C3LA 1H72C 3OHAA 1YBAA 3OBIA 1RB0A 2KKHA 4RUCA 3MECB 2ROGA 2CNOB 4K2JA 4LF1A 3R5JB 5G0RB 4DSIA 1UEUA 3QT8A 4OI2A 2B5JB 4UF4A 3X1LB 4H4OA 3N5BA 5MAOA 3QATA 4ED8A 5SUHA 2HHVA 1NDCA 3HKWA 2X1FA 4KHRA 2CA9A 3D6FB 4USJC 2V4QA 3K58A 2RAQA 5DDQC 3V2UC 1JNRB 1OQ6A 3Q2TC 2GVZB 1AFIA 5KFUA 4NI2B 2DH8A 1FX4A 1YG0A 4RBVA 2DPIA 2YXLA 3VZIA 3MEGA 3LP0B 4P7VA 1RWKB 1V6HA 1YSJA 3JXOA 4B3SF 3BN7A 3D4JA 3T6BA 1N52B 2F9DA 3S8SA 2IYIA 2HFVA 1U7LA 5KFZA 3CJSA 2XULA 3ADAC 3K5MA 2VG6B 1DZ5A 1X0PA 2LXFA 3LGNA 4HL9A 5G4DA 4OJHA 3QZ8A 3C6UA 4X84A 1C1BA 1YRUA 2ZUGA 2MKSA 3GJTB 2C2DA 3UDVA 2V4JB 3ETMA 3MXHP 3GSIA 2BE2A 2J0XA 1YDLA 4YDDB 3MZIA 2B4VA 1GTEA 2LVWA 4HTJA 2RU3A 2XMWA 5E5NA 3P49B 2KM8C 3M30B 2HWIA 1Q1KA 4FNHA 2Q6BA 3RW6A 3F56A 3J7AN 2VPYB 2HNDA 2MZSA 2CAJA 3GTYX 4ANCA 1IR1A 3HHLB 2V63A 2HK2A 3EVOA 1CS4B 3IO1A 3J7YU 5L39A 1NM2A 1NK9A 1F9FA 2VFSA 3Q8VA 2UU9F 3D7SB 3FBFA 1FDAA 1KBRA 2AZ3A 1MWQA 2E29A 1RHMB 5HQLA 5L1JA 3T3FA 2XYPB 1RISA 2U1AA 3GZ7A 3HO1A 2DGWA 4KGXB 3PYFA 3VAIA 3LGMA 2BEFA 3KLFB 1YJNS 1V5VA 4UQTA 3KUHA 5L38A 4JV5F 1X4EA 5KG4A 2XNQA 5L1KA 5KFJA 4OYIA 3NAHA 3MM5A 1S77D 1RCXB 4LBIA 2K06A 4ILLA 2J6UA 4M5NA 2B56A 4KQZA 1S9EB 2XMAA 1UVMA 1FVSA 4I68A 2J76E 3CVKA 2FHJD 2YNGA 2ZH4A 2VFRA 4U7CA 1GX5A 1X4BA 2IAJB 1SKRA 3LWLA 3E2EA 2XO6A 1UA1A 4MFBB 4BHQA 3SCJE 4MK7A 4OLOA 2EC2A 2YTCA 2XB2D 3DLKB 1NBEB 3OR1A 4R8UB 4KGKA 3HVTB 4UZCA 1PBUA 1UJ6A 1FE4A 2MSTA 4DUZF 2FLPA 4UOCA 4V19X 3I4PA 3CD6S 2M9KA 2BRLA 3BBCA 1HNXJ 4IG0B 3GQCA 1OIAA 5F8NA 5EWGA 4MKVA 2B6AA 3PX6A 2E44A 3U02A 2FHJA 1ZPVA 1FDBA 1TR0A 4WE1B 1XNRJ 1FXDA 3I96A 2FQQB 1M5HA 2GVDB 2ZC4A 4DDFA 1UMJA 3PJXA 3DRPB 4LRBA 2FVRA 2DNZA 1LW2A 2CYYA 2F63A 3GFZA 3I4HX 5CYQB 2PD1A 3DM2B 2V2KA 1ZAVA 4LBHA 3DOLA 1DTQB 4ICLA 1XEZA 3D1OA 2EI5A 4C11A 2DYAA 5J2MA 2BACA 3TUIC 1Z4UA 2LDIA 4DFPA 4DS5A 1HI8A 1WHXA 2OPRB 1VQNS 1TL5A 2BJEA 5E3RA 2J0WA 4G1PA 1RI7A 5FD1A 3N6LA 4TU8A 2H54B 4EFAC 4QIGA 2RF2B 3W5YA 4OHZA 4A8MP 1BQMA 2Y0SD 2P9CA 4DQSA 3B78A 4DL3A 3HSJA 5D0HA 1FKPB 1KOHA 3R1HA 1WEZA 2VQEF 2UXBJ 4ES2A 4I56A 3CJ8A 4CO5A 2M7SA 2WOMB 4C98A 4CM2A 1UAWA 2PFFB 2LKZA 4EWTA 2VU5A 3NKYA 4BWJA 1T8EA 4R5PA 4F3OA 5CYMB 2ZWOA 4JI4F 3I5AA 2DK2A 1RWOB 1BQXA 4EBDA 5KG0A 1QE1B 1CJVA 2PA3A 2DNOA 5IQQA 4E0DA 4KV8A 1QDUB 2Z2ZA 4OZ0A 1FRLA 2M52A 4F04B 2B51A 2C2RA 4HVZA 2JVRA 1PC5A 3MM8A 2Q3PA 5KG7A 5CZXA 1UEKA 1E6VB 4X62J 4ED3A 1KWMA 2O01C 3O2IA 2QC3A 2KH9A 2A6MA 3T19A 1F5CA 5ETQA 4J5OA 4RW4B 9ATCB 3W3SA 3W60A 3ICLA 1PC4A 2AEMA 3BS9A 2K3IA 1HBMB 1T03A 5LSLA 5H9EJ 2LP4A 2B7BB 5K8NA 5F8JA 3US5A 4DL5A 2BJDA 4P7TA 2C2EA 4G3IA 2ZM6J 2VJVA 1RTDA 4Z37A 1SJFA 4AT1B 4WFBQ 5JVHQ 3LPEA 1VISA 4RLEA 1VIXA 4DV1J 3PHEA 2UVVA 3FQLA 3VHQA 5I3UB 1NNDA 2JZ5A 3AD9C 3MTJA 2HIQA 3QQCD 4Y2IA 1WC6A 1F3VA 3BO3A 2RB7A 1FD8A 2UUWA 3UFCX 2CUYA 4K4XA 2YKNA 1NK7A 3QSIA 4GKJJ 2MKYA 4AFFA 4QU7A 4U8VA 3KK1A 3CCSS 2BJ9A 5E3QA 2BM0A 2JFKA 3IR5B 2CWXA 4P71A 1UW9A 3C15B 1BHNA 3TNVA 3DLJA 3QIDA 4CLFA 4FBUA 3KLIA 4LR8A 4KC5A 3KDOA 2HHTA 4ZPDA 1Q8BA 5I42B 4OX9J 2GAHC 3G86A 1S7HA 3HJVA 2ZH9A 3EJMA 3AOAA 4IO9Q 5HP1B 4AUKA 1FTCA 3SSRA 5DETA 5KFWA 4LREA 3TRGA 5C5JA 4KHMA 2N4DA 5KFEA 1R8PA 3HX9A 2JL9A 3DGPA 1UETA 3IBWA 4NLSA 2OPQA 1AYEA 2BR0A 1RUSA 3GJSB 1P6TA 3MAQA 3OW2R 2C2MB 4LQ9A 3I5BA 1KTVA 5T14A 4DN0A 2DD8S 1YJWS 3C14A 4PUOB 3CSKA 2VG7A 3N01A 3RBDA 4USKA 2JSXA 1APSA 2NZCA 3KYLA 4YR3A 2FJEB 5KFKA 4JI5J 3R9LA 1X7VA 3H42A 1U4BA 4PPZA 3RBEA 1Y5LB 4DUTA 4URGA 2HNZA 2NS1B 1HBOB 4ETZA 4C9DA 1CSJA 4X4SA 3W5ZA 2CZVC 4MYUA 2ZBPA 3M32B 4AL7A 1FRIA 4P2SA 1V3SA 2EFPA 2RUSA 1TKDA 3TVZA 1YQHA 5F8IA 1F0XA 2C3MA 4XO0A 3CD5A 4OL8A 2AJFE 4J7CA 3T1AA 2YWEA 3WIVA 5E2QA 4J9UE 2XMVA 1LWFB 2UV8A 4IH5A 4DXLA 1T3OA 4LVOP 3ISNC 2CJYB 1BWEA 5KT3A 3AY0A 3I32A 3IR7B 4OYPA 4DV3F 2AD9A 2GHVC 2GX8A 1EETA 1U1LA 2GQCA 3NS7B 3SCIE 4A8KA 1BXNA 5D0EA 5J2NA 3RR8A 2HGLA 1SL0A 3IXQA 1QVGR 1HNXF 3OTCA 3M8SA 5EN1A 2J7WA 3WIUA 3VAKA 1SH2A 1S1UB 3PM9A 3LOUA 4WU3A 4V1Ak 2OTJS 3I0RA 4CYUB 4IKAA 3QNWB 1ZETA 3I55S 3CIMA 1NPPA 1SCJB 2W1BA 2DIUA 2CJBA 3BPDA 4Y00A 3DDIA 4KO0A 3OL6A 2XQCA 4WP8A 1SXLA 2MXYA 3P96A 2BUNA 4QYZJ 2HFZA 4A8SA 1EB0A 2RT3A 4KAIA 2ADCA 1C0TB 4XDDA 4UOFA 3M8QB 3LANA 5ETTA 5L1LA 1H7WA 1YJ7A 4B9NA 2GS8A 6FD1A 1JLCA 3LH2S 4JI0J 2CADA 1IWAA 4PG5A 1FESA 3DKDA 2E1RA 4Y28C 3QJLA 1J5EF 2K7KA 3AQPA 4M63A 4HH0A 5GAEU 3N9UC 4L3KA 4EI2A 2EKNA 1WI6A 3H2LA 1N5QA 4G1QA 2EPIA 2HAIA 4YHHF 1KQSR 5A8KB 2XYHB 3AXKA 4NMLA 4IOAQ 3HI9A 3UO0A 4DR1F 3QGHA 2KT3A 2ASLA 4H4MA 3T1YF 4HDGA 3CD0A 2AGQA 2FJAB 1SJRA 1RAOA 4R0EA 3CNQP 1HHTP 1S79A 5KFGA 2OUGA 3CXCR 4RW8B 4KPYA 4DJBA 3FCVA 2LEBA 2UV8G 4QJVA 4ZS6A 5M2UA 3NBPA 2EFVA 1SIZA 1HNZF 2HGMA 3KNAA 1BQNB 1IBLJ 3FVYA 3GV7B 2YH0A 1C0UA 2VZ9A 1LWXA 3V6HA 5CD4A 5JXSA 4NCGA 4B17A 2LQ8A 4JYAF 1VQPS 5HQ8A 3AQOA 2H4YB 2CJAA 4B3TF 5KFPA 2Y8WA 3EWGA 2DHHA 4KKOB 2JEFA 3PIPQ 4IRDA 4RW6A 4C8MA 4QWAA 1MWYA 1IR2A 4F0MA 4F4XA 3KG4A 2G0CA 2HHHF 4J9RA 4CH0S 1RHRB 1SV5A 2PEBA 3W65A 3C6TA 4CLKA 2MLXA 2GFFA 2EG1A 1Z2ZA 3MCNA 2OPSB 1S12A 2RD5C 2ZM6F 1WWHA 4KPCA 3TEGA 2HVHA 1KLMB 3LA0A 1FNMA 4PQUA 3R7SB 3A8IA 4WPAA 2WCXA 3FRYA 4HHHA 4K4WA 1Q8LA 1HWKA 1FRHA 5ADZA 3BR8A 5D78A 2LU2A 4NLRA 3G6VA 1S6UA 2XMTA 1DBDA 4ECRA 5FJ4A 2IA0A 4JV0A 3M8YA 4IO1A 4FBTA 2VBYA 3EXYA 1C4AA 4Y3CA 1IKWB 3QT6A 5DDPC 1TMMA 4HTIA 1AA1B 2OO4A 1HR0J 2Z4PA 4GKJF 1N5YA 4PWUA 4DSKA 1FFWB 3LWMA 1HQUB 3MMAA 2E1AA 1FRJA 1RHKB 4CTAA 3PW0A 3P5TL 3B82A 3T9ZA 2NCKL 3MWBA 4OHWA 2FZKB 2XI2A 2C3PA 2RKIA 3AJ1A 4J9VA 2DRAA 1Q95G 3BGFA 2OEKA 2YQ1A 3PYEA 1TV6B 2P8IA 1U6BA 3DFEA 1QJHA 1HNWF 1YBUA 4MK9A 2AW0A 3Q8PB 3MPYA 3GV8B 2DR7A 2N4CA 2QMXA 4DS4A 5LOQA 2JEIA 4IFYA 1T95A 1NSPA 3DN9A 2VPZB 3M6VA 4KHPJ 4RW9A 2M2BA 2M5YA 1RTJB 5HK4A 3V5RA 4URSA 5CD4H 2I5JB 1KP6A 3DLLQ 3OR2A 1VQSA 3OD2A 3JSMB 3MR6A 1NB7A 3KDNA 2R7XA 3H2UB 3ZTSA 4QBUA 2IRYA 1N5VA 1P8GA 2HRTA 3D68A 4DV5J 1URRA 5C25A 3DHWC 1Q0NA 2ZBQA 3V4IB 2P6SA 4WZMA 3H5SA 2QE5A 4KBIA 2UXDJ 2MZQA 3VGTA 1WUUA 1FJEB 1PSDA 3BSNA 3A12A 2V68A 3IRWP 3NGSA 2VG5B 4TXSA 3MECA 3L09A 5G0RA 4ED7A 2J9DE 2HYIB 2HBYB 3BJYA 3F41A 4OYXA 1KEKA 4YEAA 4TU7A 2B5JA 5IWAJ 3SZ2A 1S99A 2ZH8A 2W24A 2V34A 2OFHX 2NYHA 4F36A 1IBMF 1FERA 2BMBA 2EEYA 3J7YI 2HK3A 3IMQJ 2PE8A 1T9UA 5CZVA 2FIUA 1IBCB 2GVZA 1UL3A 3LP2B 5LSRA 4NI2A 4WWSA 2MYFA 3B54A 4AD6A 2HRYA 1GH8A 3BYRA 3LP0A 1NO8A 2EG2A 3HHLD 2F40A 4DHVA 2BYCA 2HBRB 2DNKA 2QZ8A 1FCAA 2BABA 2V8DA 5KT2A 4WFXA 2VG6A 3BBBA 5A8WB 5DG7A 3K5PA 1HMVB 3EM1A 2CQ4A 3G8TA 1S1WB 3TO8A 2A2CA 1XBWA 2LQ9A 1RCOB 1M5PC 4PWDB 1OO0B 2HZCA 2DT9A 3DU6A 3R8YA 3ZZOA 2RQCA 4G1IA 3TZYA 2HFNA 3ZZTA 1YHQS 4FZVA 1H7XA 1JJCB 1VBKA 4YN3B 2VC1A 3M30A 3DLEB 3W66A 4CO2A 1S57A 2E66A 4DR4F 2FD2A 4NA3A 3DOKB 4OI0A 3HHLA 2KZZA 4ZPAA 1CS4A 5LMUJ 5F41A 3KHLA 3DOMB 4PAAA 2JWNA 4J9LA 5DGBA 1SC4B 4J91A 1T9TA 2ZWPA 4NRTA 4ZMMA 4CLPA 4RUBA 1OPIA 3TANA 1FJCA 2RHQB 3HFVA 3CJ4A 3KLFA 2OPPB 1D9AA 1KQKA 4B9LA 1RT1B 3BPSP 5HROB 4QR0A 1SUQB 5HVHA 2LXIA 4C4WA 3GFYA 5A76A 2EK6A 2ZHOA 3D2WA 1Y7PA 5M2PA 3QRRA 1K0VA 5HMWA 1FKOB 3CC4S 4JI7F 1S9EA 2KRBA 4JI6J 3KK3B 4YDXA 3R7NB 3OL9A 5D3GB 2IAJA 1Y9OA 4DLEA 1JMTA 1TKZB 4OHVA 3D1QA 2CG4A 3DLKA 3JYTB 1GMWD 4R8UA 4DFKA 5B0DA 5HVGA 2OSRA 2RQ4A 3ZTPA 4Q2LA 2W4CA 1OY8A 3E01B 4ZVPB 3ZTOA 2J6TA 3PKMA 3P8BB 2L9NA 3VR1A 4ZN3A 1NKEA 1K0TA 4IG0A 1M90T 2AP6A 5DM7Q 4JOUA 2PA8D 1IKXB 2KJWA 5AT1B 5KFVA 3SCLE 3K5NA 3L7UA 3IWNC 2JH3A 4Q43A 1QY7A 4WE1A 3D6MB 1P9QC 4NLUA 1RE1B 3OVBA 3J7ZT 1WDTA 5KFMA 1QVFR 1IKVB 4KY3A 3DRPA 2ZC3A 3H5UA 1FEHA 5CYQA 2UUCF 1GXLA 3DM2A 3D3BJ 4HEA9 1GMWA 4RL1A 4B9TA 1DTQA 2XSJB 4ED4A 1RYSA 4LRDA 3B4MA 1Q78A 2XC9A 1YX2A 4KFBB 2HQCA 4EO6A 5MLCV 3EZOA 2IJFA 2OPRA 2LMIA 4WTOB 4LFCF 4F25A 2H5JB 3VVUA 5HLFB 3B4DA 4O0IA 4C48A 2ILZA 1S1XB 5F8MA 2ROEA 4DV7J 2Z58B 3TX0A 3D0IE 2RF2A 4MKAA 1DY3A 2BQ3A 2BA9A 4WXOA 3DYAB 2MEWA 4W92B 5HAOA 4DV4J 1RT6B 4TLQA 2K1RB 3K17A 2Z2MA 2YNIB 4PYDA 1F1BB 1FKPA 3IWLA 3R5BA 1LK7A 2ZOGA 4JI3F 2QLXA 2XGQA 3ZNJ1 2WOMA 3Q22A 2MTLA 1P9YA 4J37A 2Y0BB 1Z1ZA 2C1EB 4AL5A 4LF5J 5EX0A 5DLFA 2FY8A 5CYMA 4I6YA 4LF7F 4RR5A 3ET6B 4I2PB 4HKQA 4ECTA 3OXGA 3GB0A 4YB1P 3LF0A 1NKCA 5KG1A 3RRKA 4C3KA 4FN5A 3IS9B 3O3LA 2KZMA 3TYTA 3PEHA 3GV5B 3HHNB 4JI1F 1V3ZA 4IOCQ 2LXUA 1FJGF 1FJ7A 1E6VA 1DLOB 4IQMA 5DJBA 1QSSA 2XLKA 3NNAA 3BKUA 5BJRA 1ZM3A 3DRRB 3PYGA 2D9OA 3M8PA 4DX5A 2IVFB 2DGVA 3OTOJ 1X4DA 2ASJA 4RW4A 2MDAA 2AYGA 5BR8F 2DHXA 3IM8A 2MKIA 2MGZB 4JI2F 3H0PA 2Y8YA 4YOEA 2GIRA 1VC6A 4N41A 1W2BR 1RT7B 3RB0A 1T05B 2NXEA 1MW7A 3OHBA 3RTVA 1OY9A 3GWCA 4OIXA 2VA2A 4CO1A 2NZ4A 3EGVA 2GIFA 1VC5A 4USUA 1JLGB 1CLFA 2PT0A 1SPBP 4DMZA 5I3UA 3BREA 2UVUA 4UQGA 3AJDA 4USVA 1BD6A 4K2XA 3BKFA 4XDCA 3DGVA 2J8AA 4L74A 2R9LA 2UUAF 1H3DA 4OZ5A 1BY9A 3CO0P 4OLPA 1S1VB 2WSEC 1RK8A 3C15A 2IVYA 3HP6A 4DPWA 3O44A 4H54A 2G0IA 3H2VE 3RG6A 3C66A 4CP5A 3BM7A 2ZBRA 4AL6A 2EFQA 2MSSA 4K5RA 2IPOB 3Q23A 5I42A 4DV6F 5LMNF 3FNNA 2L9WA 5HP1A 1S7IA 2DPJA 4CLYA 4ZVTB 4ZKAA 4FKYA 2I38A 1QM9A 4OJ3A 2BM1A 2UUTA 4ZN1A 4ILMA 1FT8A 4LMZA 2H5IB 1N33J 5KT6A 4RU9A 2XY6A 2KG1A 3MR7A 4ZIVA 3ZFVA 2DGTA 4PUOA 3QLHB 3GIIA 1N34F 4OV1A 4OI3A 2QYCA 3KLHB 2WB1D 2BDPA 2ZOMA 2JC1A 1CC8A 2B9WA 3VV2B 4FXVA 2HWHA 1V5IB 4KGMA 5DG9A 3H5XA 4RU2A 1R0AB 2M4MA 1VR6A 3CW2C 2KFYA 1HBOA 3NGTA 4B9UA 3T1HF 3AA9A 2ALZA 3M32A 5KT4A 2MQQA 1VGYA 1O51A 1S48A 3NY0A 2CNKB 1HPZB 4BS2A 4GC7A 4JI6F 2G13A 2X3GA 5LT5A 3A1YG 2Y9HA 2I8EA 3UW1A 2VV5A 1RAHB 1LWFA 4IR1A 1XMQF 3EUNA 4ITSA 5IC6B 2CRLA 5HQMA 3DHXA 5GAEI 3KFWX 1KRPA 4B9SA 3MUMP 4K0KJ 1K8AT 1FF2A 3W8PA 4OX6A 2DH7A 4C8KA 1PJ7A 4DUYF 3LW5C 2DHSA 3QGGA 4DR2J 3DMJB 1KVJA 4ZJQA 1RWPB 3CC7S 4FDFA 4A8WA 1GMUA 4C0HA 1PO6A 1W2IA 1S1UA 2QLJB 3DC2A 5A8RB 1U1MA 2ZZTA 3MEKA 5E0OA 4CYUA 3UDLA 4B3OB 1RWXB 5ETMA 3TAQA 9RUBA 4QWBA 4ZITA 2CQIA 5GAGU 4YS2A 4DU8A 1B0TA 4HACB 3PJ9A 1SQEA 5B08A 2IMWP 1I51B 4U95A 1V9OA 4P72A 1C0TA 2R7QA 1ZM2A 5GVQA 2CFXA 3M8QA 2CPIA 3R1LA 4N47A 1S9GB 3PNIA 1RZMA 3LGHA 3BV8A 2EVZA 4C8YA 3SFGA 3AD7C 2AEFA 3IP0A 1CBKA 2HGNA 2W25A 4X66J 2FVQA 1N32J 1S1TB 2XNRA 3HULA 4F4AA 3E3XA 3ZZRA 3CCLS 4OMFG 4CM0A 5A8KA 3WQPA 4ER8A 3NL0A 2ZH6A 1NZ8A 1BE4A 3SEOA 4CQ1A 4ZVEA 4M1KA 1ITPA 4I64A 4M5GA 4BBYA 2ASYA 2HVIA 3M9MB 5KFRA 3K59A 1HWIA 5D15A 2MKJA 1HWUA 4B3MJ 4ZCLA 2BKPA 3HLUA 3GPAA 2IC3B 2M70A 4RW8A 5AE1A 1LV5A 1KONA 4ANDA 3M2VB 5JJBA 3MCSA 4GRSA 4DOZA 4NCBA 2MQOA 2HAFA 4DQIA 1TL4A 2FB0A 1JLBB 1PKUA 5IS2A 2C28A 4KYZA 4NL5A 2F3JA 4I6WA 4LF4F 4DF4A 4ETXA 1DQ8A 2C2OB 4KKOA 4M5KA 2WVCA 3TVKA 2M3DA 1C4CA 1LWCB 5IT4A 2IMOA 1RT5B 5T41A 4K4TA 5C42B 1XMOF 2QYGA 1X5PA 2V94A 3NG8A 2XGPA 3TZXA 2GA7A 2FVSA 4B3RJ 2UVRA 4WKRA 3Q24A 4EZ9A 1CQNA 3FKBA 2VUGA 1TK0A 1NSKL 5E3AA 1JJ4A 3JAMY 2OMOA 1DARA 2GJFA 3ISZA 1YKWA 2OPSA 1R8CA 2Z0GA 1UPPA 2RDDA 3HFZB 1KLMA 2QJ3A 2RHSB 3C19A 4CNZA 4ZLNA 1YK9A 4DR3J 1Y00A 2FJVA 1TP7A 4NXMJ 5H9EK 3R5CA 4DSFA 1FD2A 1VBYA 2A2DA 3HDSA 4NZ0A 4FYWB 4LSZB 3DXSX 4UY8T 4CT9A 1OS5A 1J5OB 2XS2A 4Y6IA 4L72B 1PG5B 1S59A 2QRRA 2MHEA 3A3PB 1NCLA 5KFSA 1LKZA 2R7VA 3CDEA 3ILLA 2D3ZA 3TUPA 4DPUA 4NLDA 3M6XA 5A2QU 1GT8A 4NYOA 2H3EB 2YH1A 1TL3B 3KK2B 4B3SJ 1HQUA 4LSNB 2M8DB 1SL2A 5KFTA 2V2VA 3NXZA 4FPRA 4FS1A 3GCWP 1TKTB 1EKSA 2VPXB 4Y2MA 2X7IA 1TV6A 4WJBA 4TQSA 2BVZA 2VA3A 1UCNA 1X9MA 1TK5A 1YLXA 4OZLA 1HKAA 3FMBA 1DTTB 1ZM4A 4ZOSA 4LT6A 3OTDA 1N88A 4X4NA 4O23A 4UUWA 1MN9A 3TJAA 3FSYA 1VRTA 2CQCA 2NXNA 4ZHRB 1RTJA 1N33F 4PABA 3OXFA 2CXEA 5EX3A 2OGUA 2FJWA 4YMEA 1NEEA 2VJUA 3JSMA 4TLRA 1D3WA 1XR7A 4XPEA 3V4MA 4PRFA 4C3MA 2UU9J 1UP1A 4YY3F 2DEIA 3F44A 1QSLA 1M1GA 3MFIA 5J1EB 4DR6F 1S10A 1X4GA 3V4IA 2N3LA 3QGPA 1DJ0A 1TAQA 2C2NA 3VQSA 2LLZA 1RWVB 3AB2B 3S7RA 1C2PA 4MKYA 4JV5J 2W8LA 2CJ9A 3T6JA 2XY7A 2VG5A 2YWHA 3KUGA 3OVSA 2CPZA 3LAMA 2XZTB 3FJ2A 4XAKA 5ETLA 1R0CB 3HSGA 4F2RA 2HPUA 2QMUB 2F4FA 4WP3A 3OUYB 3G82B 1UVJA 3LP2A 4K0KF 4O3PA 2W9CB 3VAGA 1TVRB 3PO4A 4LIRA 2F9JA 2MQPA 3TOQA 2V69A 4LFAF 3CJ5A 2FC9A 2DH9A 2PGCA 3P4UB 4MJKA 4DUZJ 3DI6B 3M9OB 4ECSA 3GIJA 3NNCA 2R3VA 5K8PA 2BOAA 3CB4A 5A8WA 2XY5A 1FK9B 4LF8F 1VLYA 1HMVA 4ECVA 2HHXA 2VHGA 1AXQA 2YWFA 2WSFC 4PWDA 1K47A 3DDNA 4HYKA 2W8KA 1ZTWA 3UI3A 1Y10A 5FDLB 1XERA 2PDAA 1TMJA 3DLEA 3BSAA 1CJTB 3FC9A 3C16A 4KJIA 2D41A 1T9VA 3DOKA 1VQ8S 3C8YA 3GFXA 1A7GE 1U1KA 1TFWA 1M0SA 1HD0A 1R31A 2QLWA 4QYZK 3UR0A 4DPOA 3DOMA 2W9BB 1SJQA 3GONA 1TZ0A 2X1GA 4N8OA 1RT3B 4GVLA 2HBQB 5B0FA 4M5DB 2DB1A 3MDFA 4DEZA 3KMSA 3W8GA 2MY7A 2VQFF 2OPPA 3Q86A 4M5MA 4U67Q 1FFGB 2FDNA 1RT1A 4ANEA 5HROA 1JWWA 3BSOA 1SUQA 1JLEB 2IBOA 5EDWA 2I6WA 2QG9B 4MIWA 4PR6A 3JB9k 3JS9A 1FKOA 2D69A 2ZVSA 3NMAA 1B64A 4M5IA 3KK3A 1JLQB 3KWMA 2RRNA 5CCMA 5IT9Y 5D3GA 3UD4P 4K7QA 2CPDA 2V8VA 2HURA 2JLGA 1FX2A 3JSRA 4O3QA 3JYTA 3VAFA 4DPXA 2QMWA 2XCPA 3HKZD 4WFYA 1Q86T 3V81B 4O3OA 3UR3C 2AYMA 3E01A 3MEEB 2WSCC 3EGWB 4A48A 4C0BA 4A8FA 4QYRA 2DITA 1HW8A 3RUBL 3IN5A 2IBKA 2LDYA 2V6AA 1NH7A 3OFEA 2KT2A 1IKXA 1RT4A 2YX1A 1HNIA 4K4YA 4R0JA 2XMUA 1UPMB 3CPWR 1UVLA 5EUHA 1UFWA 2R7WA 1IKVA 3U27A 3D3CJ 1NUEA 1NJZA 4ILRA 3IC1A 1PILA 3LP1B 1SC3B 4LF6F 1RGVA 2Z30B 1RWUA 2FHKA 4FYYB 2HNDB 5B09A 2YKMB 2Z2YB 3HZEA 5B0BA 5KFDA 2ZH7A 4DR3F 2XSJA 3RYLA 1VQOS 4NXMF 2RS2A 2KT5A 2RQKA 4QWDA 5KFLA 2HVDA 1TUVA 2VKRA 3M4XA 2DNLA 1RHJB 3EPGA 1JLAB 2YWGA 4EK2A 4K4ZA 4KIAA 4ED2A 2N82B 5KFYA 1WSRA 1X9WA 3NLCA 5D4PA 5HLFA 1FHTA 2LQJA 2DR6A 1RHQB 1P1TA 1S1XA 3QO9B 2NPFA 1Y0HA 2KFNA 3Q0AA 4QPXA 4A8XA 1XNQF 3DYAA 2ZNYA 3IBCB 3WZ0A 5D8HB 2R4FA 2UP1A 4QQBA 2Z57B 3PCOB 1RT6A 2K1RA 2FYXA 2YNIA 2YNGB 4DL6A 1BGXT 1VRUB 4RW7B 3SBMA 1Q16B 1NJXA 3FMWA 5A0YB 3GU0A 4J9MA 3DLGB 3GE9A 4BWMA 1OY6A 2MHNA 1NB2A 4Y2KA 4M94A 2HLTA 2J7UA 2J0QD 3VGSA 2A18A 1R27B 1NK5A 1Q5YA 1PAEX 4I2PA 2J5AA 1OYDA 3FEXB 2GAGC 2D74B 3IWXA 1RAGB 2RJZA 3IS9A 3HT3A 2EC0A 3UD3P 4NXNF 2C3OA 2B6AB 2LQ5A 1DLOA 4GO5X 4DF8A 2ZNZA 5AXNA 3KHGA 2CQ3A 1RABB 1WC1A 1GMVA 2UZAA 3NOCA 3UNGC 1T9XA 4WFZA 3HJFA 3BYPA 2VBXA 2GJ2A 2RUGA 3D5MA 3PYDA 1VK8A 2KHDA 4YFUA 1U6FA 1FWPA 2MGZA 4LFBJ 1VFJA 2OI2A 2OMLA 1KQFB 4ZLJA 1RT7A 1QAJA 2KXNB 2EBEA 3MMBB 3VCDA 4RNOA 4ICLB 2XCAA 1LWEA 5IM0A 4P74A 3CJTA 2FPHX 2PMWA 4C8NA 4DL4A 4RNHA 5FLXY 1RBAA 4ECUA 4CH1A 4CNYA 1WG5A 1JLGA 5BYQA 3LQVA 1S6PB 1RLCL 3BGRB 1ROFA 5KFXA 5D4NA 1DAXA 1RWWB 4P2MA 4NEYA 3PVXA 2GIQA 4DV3J 1XC9A 1JKHB 3CJRA 3ZZPA 4PZVA 1HW9A 3SFUA 1KTQA 1SB6A 1BQMB 4B02A 1SH0A 5DZ7A 2CVIA 1FRKA 2IRUA 1RTHB 3NRBA 3GJRB 4TYBA 1F9EB 1F6TA 2V67A 2LYVA 2VBWA 5T7LA 1XN9A 1R8BA 2UUBJ 2B0GA 2HZVA 4OZ3A 2QFIA 2QFJA 1N6QB 3BDEA 1N0UA 1U26A 2IDEA 4WK3A 2DXDA 2B8PA 1O8BA 2R2UA 3TZZA 1WD6A 1SI9A 3W1YC 1YJUA 2HIYA 4F4YA 1AFJA 1DRZA 2LFVA 2BX6A 3CIZA 4OX8A 3L3CA 1IUJA 1HHQA 2IA6A 5JVGQ 3BSCA 3FZBA 3HHDA 1CVJA 3ZZ0A 2KXHA 1Y11A 3OT9A 3KLEB 3S01A 1PJ5A 1AT1B 4ES1A 1TAUA 2OJ3A 2QL9B 4ZCIA 2R7OA 1T02A 1YJVA 1I94F 2DEJA 3R6GB 1QTNB 3JAMU 2MQMA 3RW7A 1RAIB 4EGLA 2MQNA 4ZP9A 2CZ9A 3QFHA 2K2PA 3QLHA 3Q89A 5LSOA 1KHWA 3KLHA 5K9FA 1J5EJ 4K8RA 1AZSB 4TU9A 1RADB 3AA8A 3RZAA 2F8HA 3HPOA 2MQ8A 2KU7A 1BWVA 4C8ZA 1R6YA 3FFIB 1R0AA 2R8HA 4FF1A 5J2PB 4YHHJ 2HNYB 1LEOA 1CEZA 2CPJA 3ITHB 2BE9B 3GYXB 4YQWA 1WC0A 2Z56B 4NLQA 1R89A 3TJ9A 2XSFA 5GAGI 3PKYA 4F50A 4DR1J 3QAUA 3HHEA 4O44B 2IM0A 1HPZA 3T1YJ 4V19J 4F8RA 3V6KA 3SSQA 5C24B 3G9CA 5J1PA 2Y1IA 1S6QB 1A0OB 3OFGA 1WC5A 2H65B 5SZTA 5AE3A 4CIOA 2KM8B 1AROP 1D9FA 2XZWA 2ZZNA 2R8JA 1TFYA 1HNZJ 2V2QA 2C2KB 1U0SA 2AJQA 1XK8A 3AJ2A 2HFOA 4TQRA 1QUPA 3MCMA 3HZGA 2R8GA 4JYAJ 2AJ4A 4AXIA 3M2UB 4B3TJ 3DLBA 3UDEA 3GP9A 2WRMA 2F8MA 5F9LA 2YKAA 3I5CA 1EQMA 2RRBA 2YWWA 2RSQA 3PR4A 4OYOA 3CJ0A 1M1KT 2GZOA 4XIUA 2HS3A 5A8RA 4NA1A 4YP3A 2DNGA 4OYMA 5J2QB 2GMHA 2XLIA 4DV2F 1RWNB 2BBEA 4B3OA 2HHHJ 5KT7A 2BRKA 2CQDA 3HFKA 2ZUAA 4IG3B 2VB6A 1ZM9A 1K44A 3K57A 3TAPA 1VBXA 1F9HA 4NLXA 4RBTA 3QRQA 1UKUA 1SL1A 4HACA 2KG0A 2OPQB 1WEYA 3EGZA 5ETPA 1S4FA 4RX6A 4DL7A 4NASA 4UTGA 1TKXB 3CCQS 1G1XA 2FLNA 1RLDA 2C42A 3DDKA 2RH3A 3CMQA 2ZH5A 3A13A 4A4JA 1FVQA 2RS8A 4DSLA 2E5GA 2A6OA 5DGAA 2DR9A 3IG1B 3TEHB 2DNPA 1C1CB 1M1HA 3NCPA 3MUTP 4Q8FA 2HFSA 4I69A 3K8WA 3SCKE 2OTLS 1VOMA 2DXFA 3N5FA 1K73T 2DGXA 2VC0A 3ILIA 1FA0A 4TKTA 1WHVA 2JC0A 1NRKA 1SJ3P 2YNHB 3FZ2A 1JJ2R 3DRSB 1OSDA 3AB4B 1HQEA 1KFSA 4RWWA 1IWGA 5KAKA 3QZ7A 4C8LA 2IM2A 2XWXA 4OYBA 3RAMA 2AQ4A 2VFUA 3CT9A 2WBRA 3MF5A 1BUXA 2H51B 4I0WA 2IC3A 1JLFB 3Q8UA 3UVJA 2GV1A 3M2VA 4LJMA 1ZS6A 1NZAA 1TL1A 2H4WB 2JX2A 3IR6B 1HNWJ 3L95X 1JX4A 2DRDA 3TQEA 5E3CA 1JLBA 4ZP6A 2R7TA 2FTRA 2UXCF 1NPRA 2YX4A 2VDHA 4KR0B 1AUDA 4QOTA 2CDRB 3WX8A 2EXUA 1IJEB 2GQQA 1LWCA 2HQDA 1F2HA 2IJNA 3FBEA 1RT5A 5C42A 4O3SA 2ZKTA 4KRWA 4N7TA 3D6HB 1SVDA 4MAKA 4WZQA 4GO7X 5ETSA 4TYAA 3CCUS 3MHYA 5EHHA 4JB8B 3I0SB 4OI6A 4GVBB 2NUHA 4YUDA 4LFBF 1NK0A 1R7IA 1CC7A 5DLGA 2JEJA 2KHCA 3QIPB 1NK8A 5IFMA 3M1VB 2KVIA 2XZDB 3GILA 2OHDA 3C2PA 1JQGA 3RAXA 3SDEB 1RWMB 4FYXB 3R2CJ 2EFGA 3NEKA 3NNHA 2NSCA 1IBMJ 1IM6A 1J5OA 3OLAA 4DI6A 1ZYQA 1L3SA 1MN7A 4GKKJ 4N77A 1VQ9S 3UWTA 2PMZD 3TUJC 8ATCB 1U1QA 3AHPA 2XBPA 3KK2A 4IH7A 4LSNA 2UUBF 3PFEA 1VQ5S 2FC8A 2QIFA 4USHA 1PAUB 2RIJA 1U47A 3CE8A 1PYOB 1TKTA 4Q0BA 2CQGA 5DQIA 3TX8A 2FVCA 5H1SV
chains in the Genus database with same CATH topology
4F3QA 4JI0F 2FLPA 5K5MA 2KFYA 2DR5A 4C8OA 4UOCA 2B9YA 2YKOA 1HBOA 4V19X 3I4PA 4MIAA 3CD6S 3E51A 5B7WA 2M9KA 4ED0A 4B9UA 2BRLA 3T1HF 3AA9A 1X0FA 1DTTA 1F5AA 4IG0B 3GQCA 1OIAA 2NXUA 3M32A 2ALZA 1Q4RA 5KT4A 1VQLS 2MQQA 5F8NA 1VGYA 2HS4A 2O3DA 1O51A 4ZVHA 2ZKUA 5EWGA 1S48A 3H5YA 2CQ1A 1HPZB 1S9FA 2B6AA 4BS2A 3PX6A 5HMXA 3RR7A 4FVMA 4CCHA 2E44A 3U02A 3OFHA 3D28A 2VD3A 3PDNA 3L7OA 2DO4A 4GC7A 2FHJA 1ZPVA 1FDBA 1TR0A 2G13A 4WE1B 4JI6F 3KHHA 3CJKB 1IXKA 2X3GA 5LT5A 3A1YG 1FXDA 2GHPA 3I96A 2JFDA 4I7FB 1WELA 1P27B 5KFHA 1UVNA 4ZHRA 2I8EA 3VQTA 4AQYF 1M5HA 2ZC4A 2VV5A 3UW1A 5KFCA 4DDFA 1X4HA 1LWFA 3D0HE 2FJXA 1JXLA 1UMJA 3PJXA 3DRPB 1I6JA 4IR1A 1XMQF 3EUNA 2FVRA 1S0NA 4ITSA 3EZUA 2DNZA 1MU2B 4MMOA 1LW2A 2CYYA 2XWYA 5M2RA 3MM9B 1NKBA 1GTHA 3LO3A 1LXJA 2CRLA 3GFZA 3I4HX 5CYQB 1DFDA 3DHXA 5GAEI 2ZHAA 2PD1A 3KFWX 1KRPA 3DM2B 1VHFA 4B9SA 3MUMP 2MKHA 2V2KA 2IYGA 1SV5B 2ZITA 1K8AT 4CO3A 2W4DA 1ZAVA 4TY8B 3DOLA 1DTQB 5A2QY 4ICLA 1XEZA 3D1OA 1FF2A 2EI5A 4OX6A 2DH7A 4C11A 4TNOA 4C8KA 3CCVS 5J2MA 2BACA 4N56A 2LCWA 3TUIC 4DUYF 1Z4UA 2VFVA 2LDIA 3CEDA 3LW5C 2DHSA 3NWGA 3GFHA 4Y34A 3QGGA 2E5HA 3DMJB 3OXLA 5J1EA 4DFPA 4DS5A 1HI8A 1S1WA 1KVJA 1IBLF 1KSPA 4IFVA 2FVPA 1YRXA 1WHXA 3O5TB 4ZPTR 2R7SA 2HWTA 4OI4A 1UW4A 4ELTA 5KFNA 3CC7S 2OPRB 4J9SA 4A8WA 4IRKA 4C0HA 3OVAA 3VALA 1PO6A 1VQNS 1TL5A 2BJEA 5E3RA 1W2IA 1S1UA 2J0WA 4G1PA 3DC2A 1RI7A 4QIWD 5FD1A 3IRXA 3U1MA 4YB6A 5A8RB 3N6LA 4TU8A 3ZC4A 1U1MA 4KE5A 4EFAC 1OSCA 4PPDA 1QAXA 3MEKA 2YKPA 4QIGA 3HMJG 2RF2B 5E0OA 3UDLA 4OHZA 4B3OB 2D3UA 2KDOA 4A8MP 7FDRA 3TAQA 3NCRA 4I4BA 3CTRA 4X64F 1BQMA 4QWBA 2Y0SD 3HHLC 2P9CA 4K5SA 3THTA 2G4BA 4DQSA 1LXNA 2NQPA 3ONQA 3B78A 1KHVA 1UEVA 4BCAA 2KN4A 4DL3A 3EZ5A 2CQIA 2DGQA 1RT4B 3OUYA 1LW0B 2Z8QA 5GAGU 2QEXS 1LQ9A 1FKPB 1HNIB 2YQ3A 1KOHA 3R1HA 2CPEA 1D8YA 1WEZA 2VQEF 3CO9A 1B0TA 3POTB 4PKDB 4MH8A 2FJBB 1M5KC 1SQEA 2VOPA 3N6NA 4RUHA 5B08A 2L08A 3K7RA 2IMWP 4ES2A 1VQ6S 3TUZC 1V3RA 1V9OA 3MPVA 4I56A 4NYPA 2C3UA 1TVRA 4CO5A 2M7SA 1C0TA 2R7QA 2GGPB 1ZM2A 2GQ2A 2WOMB 5GVQA 3ZZTA 4C98A 2CFXA 1U25A 3CCZA 2ROPA 3M8QA 2CPIA 3R1LA 3I87A 2LA4A 1IR0A 1UAWA 4N47A 1S9GB 2LKZA 3BQ1A 2R7UA 2PFFB 2CPHA 1F5BA 2FHMA 3PNIA 4EWTA 1Q7YT 5DDOC 2BQUA 3NKYA 3DI6A 3SSSA 2EVZA 4BWJA 2MY8A 4RKUC 4C8YA 1T8EA 3SFGA 5A6PA 4R5PA 4F3OA 5CYMB 4JI4F 3I5AA 2DK2A 2HGNA 4Y0FA 4B9MA 1BQXA 4Q7AA 4EU0A 1HYSA 4EBDA 2W25A 3MD3A 5KG0A 1A9NB 1QE1B 1QTMA 2FVQA 1FK9A 2DNOA 2PA3A 5IQQA 1S1TB 4ATNA 4E0DA 2QA4S 2EWHA 2HRUA 2XNRA 3E3XA 4KV8A 2OP5A 2NYIA 4H4OB 2LQBA 1R8AA 3ZZRA 4OZ0A 3CCLS 2FLLA 2JEGA 1FRLA 4OMFG 1KS2A 5A8KA 4ZPBA 2M52A 2B51A 2APOA 1L3KA 3NL0A 4X4QA 2ZH6A 1SBRA 2E7WA 2C2RA 3G96A 2BQRA 3SEOA 4HVZA 1JIHA 3UDCA 4CQ1A 2JVRA 4ZVEA 3H25A 4M1KA 3CDAA 1IQZA 4I64A 1PC5A 4BBYA 1GNKA 3MM8A 3BO2A 2Q3PA 3MM7A 5KG7A 2ASYA 5CZXA 2WONA 2HVIA 3I6PA 1NJWA 1E6VB 4A8QA 3M9MB 3MAHA 4ED3A 1HBUA 5KFRA 3QWPA 2Q6CA 1U09A 2CZ4A 3K59A 1HWIA 5FDLA 2O01C 3O2IA 5I3PA 2KH9A 2MKJA 1YTYA 1HWUA 1RT2B 2AU0A 1HR0F 3T19A 1TKZA 4ZCLA 3MEGB 1F5CA 5CXTA 3HLUA 3VAJA 3ENQA 1EP4B 2IC3B 2M70A 4RW8A 1MMNA 5LJ5Y 4J5OA 5HO4A 5AE1A 1LV5A 4RW4B 1KONA 4HT7A 3W3SA 3ETOA 1NHUA 3M2VB 2QT7A 4GC6A 5JJBA 3ICLA 4B08A 1PC4A 3BS9A 2CJKA 4OHXA 2K3IA 3MCSA 4DOZA 1RKIA 2R2TA 4NCBA 2VODA 1HBMB 1T03A 5LSLA 3MMCB 2MQOA 2X51A 5H9EJ 2KYXA 2B7BB 5K8NA 4DQIA 1TL4A 1GX6A 3EYZA 2L9DA 4OHYA 2FB0A 3MPWA 3US5A 1JLBB 4DL5A 3SQGA 3H4BA 5IS2A 2BANA 3FSIA 2C28A 2BJDA 1UWBB 4P7TA 2C2EA 1MWZA 2C22A 3UCGA 4G3IA 1ZAWA 2K7JA 2OKQA 4NL5A 1RTDA 3C6UB 4U7UK 2F3JA 4OFZA 1C1BB 1MROA 4Z37A 4I6WA 1RT3A 3J81Y 1SJFA 4WFBQ 4LF4F 3BGLA 4OZNA 1ZZFA 4DF4A 4ETXA 5JVHQ 4J9NA 1DQ8A 4M5DA 1REVB 3VF0B 1YJTA 2F1FA 1GQEA 4RLEA 2NLWA 4RBUA 1VIXA 2BE2B 3HVAA 4WU2A 3M9NB 5K8OA 4KKOA 4F4WA 3PHEA 2UVVA 4C0OC 3TVKA 2W9AA 2M3DA 2ZH3A 5A6WA 1C4CA 3FQLA 3BGUA 2WW8A 5I3UB 1NNDA 2JZ5A 1LWCB 2JRSA 3EX7B 5IT4A 1H0HB 2A3JA 2IMOA 3SV4A 2CQHA 1RT5B 1YJRA 5T41A 4K4TA 3KOAA 3MTJA 2HIQA 1YWXA 5C42B 3PV8A 4O4RA 1XMOF 3S1TA 1X5PA 4Y2IA 1JLEA 5KG3A 3U7JA 4KHPF 1HBNA 3BO3A 2RB7A 2BOPA 3PRDA 4F26A 2V94A 4F4ZA 1FD8A 1KNZA 4FS2A 2UUWA 1B7FA 3NG8A 2XGPA 1YGYA 3UFCX 4K4XA 2E1CA 2YKNA 2PMHA 2FY1A 2GA7A 1NK7A 2FVSA 1N54B 2UVRA 4WKRA 3Q24A 4ZVGA 4EZ9A 1CQNA 3BR9A 2VUGA 1TK0A 2KXFA 1Y5IB 2DBBA 4DFMA 4PXBA 4AFFA 1DURA 4QU7A 4DSEA 1JLQA 3ENWA 3KK1A 5E3AA 4A47A 3CCSS 1HI1A 5E3QA 4J9QA 1JJ4A 2BM0A 2JFKA 3IR5B 3ENVA 3JAMY 1U2RA 2OMOA 1NHVA 4OZJA 4KFBA 1DARA 5IXUA 2F8EX 2KTQA 1KOOA 1SH3A 3IGNA 4QU6A 3ISZA 1HNVB 1R8HA 4NRUA 2O66A 3QYYA 3TNVA 5F3TA 3DLJA 3QIDA 4FBUA 2OPSA 4O4GA 1R8CA 1U6ZA 2Z0GA 4DV5F 1U1NA 1K9MT 3KLIA 1KLMA 4KC5A 4K59A 5CYJA 2HHTA 5E7OB 4CNZA 4ZPCA 2G1DA 1HFEL 4ZPVR 4ZPDA 3G4SS 1Q8BA 3CD7A