2DIXA

Solution structure of the dsrm domain of protein activator of the interferon-induced protein kinase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
GSSGSSGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINILKANASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DSRM domain of Protein activator of the interferon-induced protein kinase
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Interferon-inducible double stranded RNA-dependent protein k
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2dixA01
4X66E 1HNWE 3VYXA 3C4BA 3LLHA 2KHXA 1YYOA 4LF8E 4DV7E 4B3ME 4JI5E 4JV5E 2RS6A 1GQEA 4JI0E 1T4OA 1RC7A 4M2ZA 4AQYE 1N34E 4GKJE 4DV6E 4JYAE 2LTRA 4JI8E 2B3TB 2DIXA 1XNRE 1X47A 1STUA 4X64E 4JI6E 2DMYA 4DR5E 4DUYE 2NA2A 3OTOE 4WYQB 1XNQE 1YYWA 4LFCE 1J5EE 2UXDE 3ADLA 2CPNA 2RTXA 2N3HA 4LF7E 2LUQA 3C4TA 4B3TE 5LMUE 5LMNE 3VYYA 1PKPA 4X65E 2YT4A 4DR3E 4LF9E 4B3SE 1UILA 4DR7E 2L2NA 1XMQE 1RQ0A 2UXCE 2HHHE 4X8WA 4M30A 2VQFE 4K0KE 1IBKE 2UUAE 2LUPB 2NUGA 4DV4E 1HNZE 2MDRA 1T4LB 2F4VE 4JI2E 4DR6E 4OX9E 4DR4E 4YHHE 1FJGE 1YYKA 5CFFE 1N32E 4YY3E 3ADJA 2EZ6A 4JI4E 4DR2E 4JI3E 4WFTA 4LFAE 1T4NA 4DV0E 1FKAE 4JI1E 2L2MA 2RS7A 4LF4E 1X49A 1N33E 1EKZA 3P1XA 1IBME 2NUFA 4NXNE 3ADIA 3T1HE 1HNXE 2LTSA 2ZM6E 2L3JA 1YZ9A 4DUZE 1N36E 4NXME 4KHPE 3T1YE 2L33A 2DB2A 4DKKA 2NUEA 2UXBE 1DI2A 2B7TA 2LRSA 4OOGC 1I94E 2UU9E 1XMOE 4LF5E 4LF6E 2L2KB 2LBSB 2UUBE 1IBLE 2IHR1 2E5LE 2UUCE 2B7VA 1ZBTA 1WHQA 4DV2E 3ADGA 4DR1E 2VQEE 1HR0E 1UHZA 2JY9A 4DV1E 4DV5E 4JI7E 3HTXA 2LJHA 1QU6A 2RSMA 4B3RE 5BR8E 4GKKE 1X48A 1WHNA 2JVAA 1O0WA 5IWAE 2N3GA 1J26A 4LFBE 2L3CA 3J7Yp 4X62E 4DV3E
chains in the Genus database with same CATH superfamily
2E1MA 2M9AA 2V85A 2YRHA 2EPUA 4LF8E 4B3ME 4JV5E 2YTDA 2EPKX 1RC7A 5LLQA 5DNYA 1A1GA 1N34E 2EL4A 2L6MA 4P7DA 2B3TB 2EMFA 2EL5A 3BIDA 4ZYDA 4WSPA 4F2JC 3ADLA 3F6HA 1TN9A 4Q28A 2EPPA 3C4TA 2YTOA 5LMUE 2ENHA 1PKPA 2EOFA 4DMIA 1P47A 2YTGA 4GZNC 5KL2A 1YUIA 3THOB 4WXCA 3JAMC 4R2PA 4KZSA 3OMLA 4RH8A 2EMAA 5IXMB 1XMQE 3AV0A 2YTQA 2MDGA 4X8WA 2LV2A 3LMLA 4HEIA 2EOHA 1HNZE 4DR6E 1AAYA 4OX9E 3MHSC 1X5WA 4YHHE 1A1HA 1FJGE 1YYKA 2EM4A 2EQ3A 3ADJA 2HGHA 4WFTA 4DV0E 4NHRA 2EM5A 2EM0A 2RQLA 1G2DC 2NUFA 2EQ0A 3T1HE 1ZU1A 1YZ9A 4BMJA 1N36E 4NXME 4KHPE 2DLKA 2YWQA 3T1YE 2J7JA 2YSOA 3K6QA 1RMDA 2L33A 2YU5A 1GZ6A 2VF1A 2NUEA 2UXBE 2LRSA 2UU9E 2JOBA 1XMOE 4R8OA 2L2KB 2UUBE 2IHR1 2V86A 2EWLA 2M4IA 4BHBA 2E5LE 2UUCE 4R2QA 1ZBTA 3ADGA 4IS1C 2WZOA 4RHBB 1A1LA 4DV5E 2JY9A 4JI7E 5F3WA 2WCC3 2RSMA 5BR8E 1JK2A 5A6BD 5FLXC 4N4RB 3KZZA 3KZYA 3BBGA 2N3GA 4LFBE 4X62E 2NABA 4DV3E 3L00A 2EQ1A 3VYXA 1PJQA 3LLHA 2G7HA 1UN6B 4R2EA 2EM3A 4O43A 4JI5E 2EPLX 1WRJA 1NEIA 2EN1A 2RS6A 1GQEA 5ADZA 4M2ZA 4HTGA 2WBSA 4DV6E 2ELZA 1XNRE 2WBUA 1X47A 4X9JA 1STUA 2EOZA 1IQSA 2Q8UA 2EMHA 2FV4B 3M99B 2L92A 4WXDA 2NA2A 2K4VA 2VE7C 4R2RA 4F9AB 3EPLA 2YTJA 3VHTB 2EPNA 2EN3A 2EM9A 4LTYA 4O24A 3F6GA 5LMNE 2LJUA 2EMXA 1SR9A 2ENAA 4IJDA 4WX9A 2EM8A 1UILA 1T38A 2EMWA 5A6AA 2UXCE 1KYQA 2DLQA 4O4KA 3ZOQB 4K0KE 2CTDA 2NUGA 4DV4E 4FK5C 1T4LB 2F4VE 4R2DA 5LL6R 2V88A 2RSIA 3KWRA 2GLIA 2EMGA 5IT9C 5CFFE 4WSGA 1PJTA 2V87A 4JI4E 4LFAE 1T4NA 2YRMA 1FKAE 2CT1A 4JI1E 3J7AG 3MSWA 3EPHA 1BBOA 5KL3A 2EPXA 2JWOA 3JTZA 4NZVA 1TF3A 2M1SA 2F8BA 4NXNE 4R03A 3ADIA 1HNXE 1LLMC 2EOQA 1A1JA 2MC5A 2EPOA 3QG5C 2JR1A 3THNA 2ODRC 1DGCA 2EP3A 2A25A 1DI2A 2B7TA 4L8NA 2MKNA 4Q35B 3TQMA 1ZR9A 1MEYC 2EMYA 2B7VA 1SFEA 2I13A 4DV2E 2VQEE 1HR0E 1A1KA 2YTFA 5KL5A 2LJHA 1Z1BA 4L5NC 5IV8B 4F6MA 2K7IA 2DSYA 3J7Yp 2PRTA 2BBGA 1UBDC 2JPAA 5KL6A 2WBTA 2KOUA 4DV7E 1X6HA 4JI0E 1A1IA 1T4OA 4AQYE 3H09A 1EH8A 2LTRA 4JI8E 2DIXA 3UK3C 1IQOA 2B9DA 4X64E 2DMYA 3AUZA 4DR5E 2EM7A 3OTOE 4ZYHA 1J5EE 2UXDE 4GEQB 2CPNA 2RTXA 2EL6A 2ODRD 4MLQA 2N3HA 4P78A 3C6MA 2LUQA 1BBGA 2EPMX 3VYYA 2EMIA 4X65E 4BBYA 2E72A 2LMZA 5AASA 1PJSA 2BB8A 2EE8A 4B3SE 2EOJA 1ZBQA 4DR7E 2L2NA 1RQ0A 1QNTA 3HPSA 2LCEA 4M30A 2VQFE 2L8TA 1IBKE 4JI2E 2I9IA 2YPNA 4KWYA 2EORA 5AE2A 4M0VA 2LVHA 4YY3E 1IMUA 3BGHA 2EZ6A 1KJKA 4DR2E 4JI3E 1G2FC 2L2MA 2RS7A 2DRPA 1X49A 4LF4E 1N33E 1YFHA 1IBME 1EH7A 2ZM6E 1YSAC 2YZTA 3HQ1A 2JOXA 2M7QA 2EOOA 2LT7A 1YUJA 3IWDA 2EPZA 2V8QB 2DB2A 3IWCA 4F54A 4OOGC 4M9VC 2FTXB 2LBSB 1A1FA 1IBLE 2YTIA 3DF6A 2JXPA 2EMBA 1BB8A 4DR1E 3RMPA 2JP9A 2DMIA 2EN2A 5TSEA 3EPKA 1AH5A 3HTXA 1QU6A 2JYAA 4B3RE 3BF2A 2EMLA 4GKKE 1X48A 5AC4A 2ELYA 3EPJA 1O0WA 2EOEA 4MLVA 3DJWA 4X66E 1HNWE 3C4BA 2EJ4A 1N3GA 2EMCA 2KHXA 2R76A 2YTPA 1B69A 1YYOA 3J81C 3HPZA 1JK1A 2HJJA 2EM2A 2EN8A 1DQ3A 2ENCA 2LO3A 2D9HA 4BCAA 4JYAE 4GKJE 3ECRA 1ZAAC 2GHFA 4JI6E 3JU0A 1WXRA 4DUYE 4WYQB 1XNQE 1YYWA 5A6JA 4LFCE 2EOSA 5T6JA 2EM6A 5A6KA 2EMZA 2N8XA 4LF7E 2EOMA 1EH6A 4B3TE 4I8OA 2ADRA 1WJPA 2LE2A 2V89A 2YT4A 4R2SA 1F2IG 4LU9A 4DR3E 4LF9E 1MGTA 1GTKA 1T39A 4F6NA 2YSPA 5KL7A 2RPCA 2EOIA 4BC9A 3C6KA 2EN4A 1PDAA 2HHHE 2UUAE 2LUPB 2HC5A 2DGCA 2EPCA 2EOXA 2MDRA 4DR4E 5AE3A 4BS9A 3IWBA 1N32E 5A2QC 2CSHA 2EOYA 5KL4A 2MKDA 2H36X 4TUGA 2R1FA 3HXLA 4BC7A 5AC5A 5AE1A 2VRDA 1EKZA 3P1XA 4BHCA 2LTSA 2EPRA 5A6BA 2YTEA 2L3JA 4DUZE 2KONA 3EQ1A 3FIGA 2EN7A 1X6FA 2YTNA 4DKKA 2YRKA 5A69A 1I94E 4ZYGA 1TF6A 1YPNA 3MHHC 4LF5E 4LF6E 4J8ZA 4WPYA 1NCSA 1X6EA 2GPIA 2EPAA 1WHQA 2MC6A 2YU8A 4R2CA 1UHZA 4DV1E 4R2AA 4O5GA 3VK6A 4ZYEA 2EN6A 1X3CA 2FGGA 3J80C 4TUIA 2V83A 1WHNA 2JVAA 5IWAE 1J26A 1L4SA 2L3CA 2EMKA 4F9CB 4F9BB
chains in the Genus database with same CATH topology
4X66E 1HNWE 3VYXA 3C4BA 2E1MA 3LLHA 2G7HA 2KHXA 2V85A 2KOUA 1YYOA 3J81C 3HPZA 4LF8E 4DV7E 4B3ME 4JI5E 4JV5E 2RS6A 1GQEA 5ADZA 1T4OA 1RC7A 4JI0E 4AQYE 4M2ZA 5DNYA 1DQ3A 1N34E 4GKJE 4BCAA 4DV6E 3H09A 4JYAE 2LTRA 2L6MA 4P7DA 2B3TB 2DIXA 4JI8E 1XNRE 1X47A 1STUA 2B9DA 4X64E 4JI6E 2DMYA 2FV4B 3JU0A 3AUZA 4DR5E 1WXRA 2L92A 4DUYE 2NA2A 3OTOE 4WYQB 1XNQE 2K4VA 2VE7C 4WSPA 4LFCE 1J5EE 1YYWA 4GEQB 3ADLA 2UXDE 4F9AB 5T6JA 2CPNA 2RTXA 3F6HA 2ODRD 2N3HA 4P78A 4LF7E 4Q28A 2LUQA 3C4TA 4B3TE 4I8OA 4LTYA 5LMUE 3F6GA 5LMNE 3VYYA 1PKPA 2LE2A 2V89A 4DMIA 4X65E 2YT4A 4BBYA 1SR9A 4LU9A 4DR3E 2LMZA 5AASA 4LF9E 3JAMC 4KZSA 3OMLA 4B3SE 1UILA 1ZBQA 4BC9A 4DR7E 2L2NA 1XMQE 3AV0A 1RQ0A 2UXCE 2HHHE 3HPSA 3LMLA 4X8WA 4M30A 3ZOQB 2VQFE 2L8TA 1IBKE 2UUAE 2LUPB 4K0KE 2NUGA 4DV4E 1HNZE 2MDRA 1T4LB 2F4VE 4JI2E 5LL6R 4DR6E 2V88A 4OX9E 4DR4E 4YHHE 1FJGE 1YYKA 3KWRA 5AE3A 5IT9C 5AE2A 4M0VA 4BS9A 3IWBA 5CFFE 1N32E 5A2QC 4YY3E 3ADJA 2EZ6A 2H36X 2V87A 4JI4E 4DR2E 4TUGA 4WFTA 4JI3E 1T4NA 3HXLA 4DV0E 1FKAE 4JI1E 4LFAE 4BC7A 3J7AG 3MSWA 2L2MA 2RS7A 5AE1A 1X49A 4LF4E 1N33E 1EKZA 3P1XA 3JTZA 2JWOA 1IBME 2M1SA 2F8BA 2NUFA 4R03A 3T1HE 4NXNE 3ADIA 1HNXE 2LTSA 2ZM6E 2L3JA 1YZ9A 2YZTA 3HQ1A 4DUZE 2JOXA 4BMJA 2MC5A 2KONA 2M7QA 1N36E 4NXME 4KHPE 3T1YE 3FIGA 2JR1A 3IWDA 2ODRC 3K6QA 2L33A 2V8QB 2DB2A 3IWCA 4DKKA 1GZ6A 2VF1A 2NUEA 2UXBE 1DI2A 4F54A 2B7TA 2LRSA 4L8NA 4OOGC 1I94E 2UU9E 2FTXB 2JOBA 1XMOE 4LF5E 4R8OA 4LF6E 2L2KB 2LBSB 4J8ZA 1IBLE 2UUBE 2IHR1 2V86A 2EWLA 2M4IA 3DF6A 2B7VA 4WPYA 2E5LE 3J7Yp 2UUCE 1ZBTA 1WHQA 2MC6A 3ADGA 4DV2E 4DR1E 2VQEE 3RMPA 2WZOA 1HR0E 1UHZA 2JY9A 4DV1E 4DV5E 4JI7E 5F3WA 3HTXA 2LJHA 1QU6A 2RSMA 3VK6A 4B3RE 5BR8E 2FGGA 3J80C 1X48A 4L5NC 5FLXC 4TUIA 2V83A 4GKKE 1WHNA 2JVAA 1O0WA 5IWAE 2N3GA 1J26A 4LFBE 2L3CA 2DSYA 3DJWA 4X62E 4DV3E 4F9CB 4F9BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 E;  1HNW E;  3VYX A;  3C4B A;  3LLH A;  2KHX A;  1YYO A;  4LF8 E;  4DV7 E;  4B3M E;  4JI5 E;  4JV5 E;  2RS6 A;  1GQE A;  4JI0 E;  1T4O A;  1RC7 A;  4M2Z A;  4AQY E;  1N34 E;  4GKJ E;  4DV6 E;  4JYA E;  2LTR A;  4JI8 E;  2B3T B;  2DIX A;  1XNR E;  1X47 A;  1STU A;  4X64 E;  4JI6 E;  2DMY A;  4DR5 E;  4DUY E;  2NA2 A;  3OTO E;  4WYQ B;  1XNQ E;  1YYW A;  4LFC E;  1J5E E;  2UXD E;  3ADL A;  2CPN A;  2RTX A;  2N3H A;  4LF7 E;  2LUQ A;  3C4T A;  4B3T E;  5LMU E;  5LMN E;  3VYY A;  1PKP A;  4X65 E;  2YT4 A;  4DR3 E;  4LF9 E;  4B3S E;  1UIL A;  4DR7 E;  2L2N A;  1XMQ E;  1RQ0 A;  2UXC E;  2HHH E;  4X8W A;  4M30 A;  2VQF E;  4K0K E;  1IBK E;  2UUA E;  2LUP B;  2NUG A;  4DV4 E;  1HNZ E;  2MDR A;  1T4L B;  2F4V E;  4JI2 E;  4DR6 E;  4OX9 E;  4DR4 E;  4YHH E;  1FJG E;  1YYK A;  5CFF E;  1N32 E;  4YY3 E;  3ADJ A;  2EZ6 A;  4JI4 E;  4DR2 E;  4JI3 E;  4WFT A;  4LFA E;  1T4N A;  4DV0 E;  1FKA E;  4JI1 E;  2L2M A;  2RS7 A;  4LF4 E;  1X49 A;  1N33 E;  1EKZ A;  3P1X A;  1IBM E;  2NUF A;  4NXN E;  3ADI A;  3T1H E;  1HNX E;  2LTS A;  2ZM6 E;  2L3J A;  1YZ9 A;  4DUZ E;  1N36 E;  4NXM E;  4KHP E;  3T1Y E;  2L33 A;  2DB2 A;  4DKK A;  2NUE A;  2UXB E;  1DI2 A;  2B7T A;  2LRS A;  4OOG C;  1I94 E;  2UU9 E;  1XMO E;  4LF5 E;  4LF6 E;  2L2K B;  2LBS B;  2UUB E;  1IBL E;  2IHR 1;  2E5L E;  2UUC E;  2B7V A;  1ZBT A;  1WHQ A;  4DV2 E;  3ADG A;  4DR1 E;  2VQE E;  1HR0 E;  1UHZ A;  2JY9 A;  4DV1 E;  4DV5 E;  4JI7 E;  3HTX A;  2LJH A;  1QU6 A;  2RSM A;  4B3R E;  5BR8 E;  4GKK E;  1X48 A;  1WHN A;  2JVA A;  1O0W A;  5IWA E;  2N3G A;  1J26 A;  4LFB E;  2L3C A;  3J7Y p;  4X62 E;  4DV3 E; 
#chains in the Genus database with same CATH topology
 2E1M A;  2M9A A;  2V85 A;  2YRH A;  2EPU A;  4LF8 E;  4B3M E;  4JV5 E;  2YTD A;  2EPK X;  1RC7 A;  5LLQ A;  5DNY A;  1A1G A;  1N34 E;  2EL4 A;  2L6M A;  4P7D A;  2B3T B;  2EMF A;  2EL5 A;  3BID A;  4ZYD A;  4WSP A;  4F2J C;  3ADL A;  3F6H A;  1TN9 A;  4Q28 A;  2EPP A;  3C4T A;  2YTO A;  5LMU E;  2ENH A;  1PKP A;  2EOF A;  4DMI A;  1P47 A;  2YTG A;  4GZN C;  5KL2 A;  1YUI A;  3THO B;  4WXC A;  3JAM C;  4R2P A;  4KZS A;  3OML A;  4RH8 A;  2EMA A;  5IXM B;  1XMQ E;  3AV0 A;  2YTQ A;  2MDG A;  4X8W A;  2LV2 A;  3LML A;  4HEI A;  2EOH A;  1HNZ E;  4DR6 E;  1AAY A;  4OX9 E;  3MHS C;  1X5W A;  4YHH E;  1A1H A;  1FJG E;  1YYK A;  2EM4 A;  2EQ3 A;  3ADJ A;  2HGH A;  4WFT A;  4DV0 E;  4NHR A;  2EM5 A;  2EM0 A;  2RQL A;  1G2D C;  2NUF A;  2EQ0 A;  3T1H E;  1ZU1 A;  1YZ9 A;  4BMJ A;  1N36 E;  4NXM E;  4KHP E;  2DLK A;  2YWQ A;  3T1Y E;  2J7J A;  2YSO A;  3K6Q A;  1RMD A;  2L33 A;  2YU5 A;  1GZ6 A;  2VF1 A;  2NUE A;  2UXB E;  2LRS A;  2UU9 E;  2JOB A;  1XMO E;  4R8O A;  2L2K B;  2UUB E;  2IHR 1;  2V86 A;  2EWL A;  2M4I A;  4BHB A;  2E5L E;  2UUC E;  4R2Q A;  1ZBT A;  3ADG A;  4IS1 C;  2WZO A;  4RHB B;  1A1L A;  4DV5 E;  2JY9 A;  4JI7 E;  5F3W A;  2WCC 3;  2RSM A;  5BR8 E;  1JK2 A;  5A6B D;  5FLX C;  4N4R B;  3KZZ A;  3KZY A;  3BBG A;  2N3G A;  4LFB E;  4X62 E;  2NAB A;  4DV3 E;  3L00 A;  2EQ1 A;  3VYX A;  1PJQ A;  3LLH A;  2G7H A;  1UN6 B;  4R2E A;  2EM3 A;  4O43 A;  4JI5 E;  2EPL X;  1WRJ A;  1NEI A;  2EN1 A;  2RS6 A;  1GQE A;  5ADZ A;  4M2Z A;  4HTG A;  2WBS A;  4DV6 E;  2ELZ A;  1XNR E;  2WBU A;  1X47 A;  4X9J A;  1STU A;  2EOZ A;  1IQS A;  2Q8U A;  2EMH A;  2FV4 B;  3M99 B;  2L92 A;  4WXD A;  2NA2 A;  2K4V A;  2VE7 C;  4R2R A;  4F9A B;  3EPL A;  2YTJ A;  3VHT B;  2EPN A;  2EN3 A;  2EM9 A;  4LTY A;  4O24 A;  3F6G A;  5LMN E;  2LJU A;  2EMX A;  1SR9 A;  2ENA A;  4IJD A;  4WX9 A;  2EM8 A;  1UIL A;  1T38 A;  2EMW A;  5A6A A;  2UXC E;  1KYQ A;  2DLQ A;  4O4K A;  3ZOQ B;  4K0K E;  2CTD A;  2NUG A;  4DV4 E;  4FK5 C;  1T4L B;  2F4V E;  4R2D A;  5LL6 R;  2V88 A;  2RSI A;  3KWR A;  2GLI A;  2EMG A;  5IT9 C;  5CFF E;  4WSG A;  1PJT A;  2V87 A;  4JI4 E;  4LFA E;  1T4N A;  2YRM A;  1FKA E;  2CT1 A;  4JI1 E;  3J7A G;  3MSW A;  3EPH A;  1BBO A;  5KL3 A;  2EPX A;  2JWO A;  3JTZ A;  4NZV A;  1TF3 A;  2M1S A;  2F8B A;  4NXN E;  4R03 A;  3ADI A;  1HNX E;  1LLM C;  2EOQ A;  1A1J A;  2MC5 A;  2EPO A;  3QG5 C;  2JR1 A;  3THN A;  2ODR C;  1DGC A;  2EP3 A;  2A25 A;  1DI2 A;  2B7T A;  4L8N A;  2MKN A;  4Q35 B;  3TQM A;  1ZR9 A;  1MEY C;  2EMY A;  2B7V A;  1SFE A;  2I13 A;  4DV2 E;  2VQE E;  1HR0 E;  1A1K A;  2YTF A;  5KL5 A;  2LJH A;  1Z1B A;  4L5N C;  5IV8 B;  4F6M A;  2K7I A;  2DSY A;  3J7Y p;  2PRT A;  2BBG A;  1UBD C;  2JPA A;  5KL6 A;  2WBT A;  2KOU A;  4DV7 E;  1X6H A;  4JI0 E;  1A1I A;  1T4O A;  4AQY E;  3H09 A;  1EH8 A;  2LTR A;  4JI8 E;  2DIX A;  3UK3 C;  1IQO A;  2B9D A;  4X64 E;  2DMY A;  3AUZ A;  4DR5 E;  2EM7 A;  3OTO E;  4ZYH A;  1J5E E;  2UXD E;  4GEQ B;  2CPN A;  2RTX A;  2EL6 A;  2ODR D;  4MLQ A;  2N3H A;  4P78 A;  3C6M A;  2LUQ A;  1BBG A;  2EPM X;  3VYY A;  2EMI A;  4X65 E;  4BBY A;  2E72 A;  2LMZ A;  5AAS A;  1PJS A;  2BB8 A;  2EE8 A;  4B3S E;  2EOJ A;  1ZBQ A;  4DR7 E;  2L2N A;  1RQ0 A;  1QNT A;  3HPS A;  2LCE A;  4M30 A;  2VQF E;  2L8T A;  1IBK E;  4JI2 E;  2I9I A;  2YPN A;  4KWY A;  2EOR A;  5AE2 A;  4M0V A;  2LVH A;  4YY3 E;  1IMU A;  3BGH A;  2EZ6 A;  1KJK A;  4DR2 E;  4JI3 E;  1G2F C;  2L2M A;  2RS7 A;  2DRP A;  1X49 A;  4LF4 E;  1N33 E;  1YFH A;  1IBM E;  1EH7 A;  2ZM6 E;  1YSA C;  2YZT A;  3HQ1 A;  2JOX A;  2M7Q A;  2EOO A;  2LT7 A;  1YUJ A;  3IWD A;  2EPZ A;  2V8Q B;  2DB2 A;  3IWC A;  4F54 A;  4OOG C;  4M9V C;  2FTX B;  2LBS B;  1A1F A;  1IBL E;  2YTI A;  3DF6 A;  2JXP A;  2EMB A;  1BB8 A;  4DR1 E;  3RMP A;  2JP9 A;  2DMI A;  2EN2 A;  5TSE A;  3EPK A;  1AH5 A;  3HTX A;  1QU6 A;  2JYA A;  4B3R E;  3BF2 A;  2EML A;  4GKK E;  1X48 A;  5AC4 A;  2ELY A;  3EPJ A;  1O0W A;  2EOE A;  4MLV A;  3DJW A;  4X66 E;  1HNW E;  3C4B A;  2EJ4 A;  1N3G A;  2EMC A;  2KHX A;  2R76 A;  2YTP A;  1B69 A;  1YYO A;  3J81 C;  3HPZ A;  1JK1 A;  2HJJ A;  2EM2 A;  2EN8 A;  1DQ3 A;  2ENC A;  2LO3 A;  2D9H A;  4BCA A;  4JYA E;  4GKJ E;  3ECR A;  1ZAA C;  2GHF A;  4JI6 E;  3JU0 A;  1WXR A;  4DUY E;  4WYQ B;  1XNQ E;  1YYW A;  5A6J A;  4LFC E;  2EOS A;  5T6J A;  2EM6 A;  5A6K A;  2EMZ A;  2N8X A;  4LF7 E;  2EOM A;  1EH6 A;  4B3T E;  4I8O A;  2ADR A;  1WJP A;  2LE2 A;  2V89 A;  2YT4 A;  4R2S A;  1F2I G;  4LU9 A;  4DR3 E;  4LF9 E;  1MGT A;  1GTK A;  1T39 A;  4F6N A;  2YSP A;  5KL7 A;  2RPC A;  2EOI A;  4BC9 A;  3C6K A;  2EN4 A;  1PDA A;  2HHH E;  2UUA E;  2LUP B;  2HC5 A;  2DGC A;  2EPC A;  2EOX A;  2MDR A;  4DR4 E;  5AE3 A;  4BS9 A;  3IWB A;  1N32 E;  5A2Q C;  2CSH A;  2EOY A;  5KL4 A;  2MKD A;  2H36 X;  4TUG A;  2R1F A;  3HXL A;  4BC7 A;  5AC5 A;  5AE1 A;  2VRD A;  1EKZ A;  3P1X A;  4BHC A;  2LTS A;  2EPR A;  5A6B A;  2YTE A;  2L3J A;  4DUZ E;  2KON A;  3EQ1 A;  3FIG A;  2EN7 A;  1X6F A;  2YTN A;  4DKK A;  2YRK A;  5A69 A;  1I94 E;  4ZYG A;  1TF6 A;  1YPN A;  3MHH C;  4LF5 E;  4LF6 E;  4J8Z A;  4WPY A;  1NCS A;  1X6E A;  2GPI A;  2EPA A;  1WHQ A;  2MC6 A;  2YU8 A;  4R2C A;  1UHZ A;  4DV1 E;  4R2A A;  4O5G A;  3VK6 A;  4ZYE A;  2EN6 A;  1X3C A;  2FGG A;  3J80 C;  4TUI A;  2V83 A;  1WHN A;  2JVA A;  5IWA E;  1J26 A;  1L4S A;  2L3C A;  2EMK A;  4F9C B;  4F9B B; 
#chains in the Genus database with same CATH homology
 4X66 E;  1HNW E;  3VYX A;  3C4B A;  2E1M A;  3LLH A;  2G7H A;  2KHX A;  2V85 A;  2KOU A;  1YYO A;  3J81 C;  3HPZ A;  4LF8 E;  4DV7 E;  4B3M E;  4JI5 E;  4JV5 E;  2RS6 A;  1GQE A;  5ADZ A;  1T4O A;  1RC7 A;  4JI0 E;  4AQY E;  4M2Z A;  5DNY A;  1DQ3 A;  1N34 E;  4GKJ E;  4BCA A;  4DV6 E;  3H09 A;  4JYA E;  2LTR A;  2L6M A;  4P7D A;  2B3T B;  2DIX A;  4JI8 E;  1XNR E;  1X47 A;  1STU A;  2B9D A;  4X64 E;  4JI6 E;  2DMY A;  2FV4 B;  3JU0 A;  3AUZ A;  4DR5 E;  1WXR A;  2L92 A;  4DUY E;  2NA2 A;  3OTO E;  4WYQ B;  1XNQ E;  2K4V A;  2VE7 C;  4WSP A;  4LFC E;  1J5E E;  1YYW A;  4GEQ B;  3ADL A;  2UXD E;  4F9A B;  5T6J A;  2CPN A;  2RTX A;  3F6H A;  2ODR D;  2N3H A;  4P78 A;  4LF7 E;  4Q28 A;  2LUQ A;  3C4T A;  4B3T E;  4I8O A;  4LTY A;  5LMU E;  3F6G A;  5LMN E;  3VYY A;  1PKP A;  2LE2 A;  2V89 A;  4DMI A;  4X65 E;  2YT4 A;  4BBY A;  1SR9 A;  4LU9 A;  4DR3 E;  2LMZ A;  5AAS A;  4LF9 E;  3JAM C;  4KZS A;  3OML A;  4B3S E;  1UIL A;  1ZBQ A;  4BC9 A;  4DR7 E;  2L2N A;  1XMQ E;  3AV0 A;  1RQ0 A;  2UXC E;  2HHH E;  3HPS A;  3LML A;  4X8W A;  4M30 A;  3ZOQ B;  2VQF E;  2L8T A;  1IBK E;  2UUA E;  2LUP B;  4K0K E;  2NUG A;  4DV4 E;  1HNZ E;  2MDR A;  1T4L B;  2F4V E;  4JI2 E;  5LL6 R;  4DR6 E;  2V88 A;  4OX9 E;  4DR4 E;  4YHH E;  1FJG E;  1YYK A;  3KWR A;  5AE3 A;  5IT9 C;  5AE2 A;  4M0V A;  4BS9 A;  3IWB A;  5CFF E;  1N32 E;  5A2Q C;  4YY3 E;  3ADJ A;  2EZ6 A;  2H36 X;  2V87 A;  4JI4 E;  4DR2 E;  4TUG A;  4WFT A;  4JI3 E;  1T4N A;  3HXL A;  4DV0 E;  1FKA E;  4JI1 E;  4LFA E;  4BC7 A;  3J7A G;  3MSW A;  2L2M A;  2RS7 A;  5AE1 A;  1X49 A;  4LF4 E;  1N33 E;  1EKZ A;  3P1X A;  3JTZ A;  2JWO A;  1IBM E;  2M1S A;  2F8B A;  2NUF A;  4R03 A;  3T1H E;  4NXN E;  3ADI A;  1HNX E;  2LTS A;  2ZM6 E;  2L3J A;  1YZ9 A;  2YZT A;  3HQ1 A;  4DUZ E;  2JOX A;  4BMJ A;  2MC5 A;  2KON A;  2M7Q A;  1N36 E;  4NXM E;  4KHP E;  3T1Y E;  3FIG A;  2JR1 A;  3IWD A;  2ODR C;  3K6Q A;  2L33 A;  2V8Q B;  2DB2 A;  3IWC A;  4DKK A;  1GZ6 A;  2VF1 A;  2NUE A;  2UXB E;  1DI2 A;  4F54 A;  2B7T A;  2LRS A;  4L8N A;  4OOG C;  1I94 E;  2UU9 E;  2FTX B;  2JOB A;  1XMO E;  4LF5 E;  4R8O A;  4LF6 E;  2L2K B;  2LBS B;  4J8Z A;  1IBL E;  2UUB E;  2IHR 1;  2V86 A;  2EWL A;  2M4I A;  3DF6 A;  2B7V A;  4WPY A;  2E5L E;  3J7Y p;  2UUC E;  1ZBT A;  1WHQ A;  2MC6 A;  3ADG A;  4DV2 E;  4DR1 E;  2VQE E;  3RMP A;  2WZO A;  1HR0 E;  1UHZ A;  2JY9 A;  4DV1 E;  4DV5 E;  4JI7 E;  5F3W A;  3HTX A;  2LJH A;  1QU6 A;  2RSM A;  3VK6 A;  4B3R E;  5BR8 E;  2FGG A;  3J80 C;  1X48 A;  4L5N C;  5FLX C;  4TUI A;  2V83 A;  4GKK E;  1WHN A;  2JVA A;  1O0W A;  5IWA E;  2N3G A;  1J26 A;  4LFB E;  2L3C A;  2DSY A;  3DJW A;  4X62 E;  4DV3 E;  4F9C B;  4F9B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...