2DIXA

Solution structure of the dsrm domain of protein activator of the interferon-induced protein kinase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
GSSGSSGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINILKANASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-inducible double stranded RNA-dependent protein k
publication title Solution structure of the DSRM domain of Protein activator of the interferon-induced protein kinase
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2dixA01
2KHXA 2LUPB 1YYWA 4JI6E 2L3CA 3T1YE 2NUEA 4LF7E 4JYAE 2LTSA 3T1HE 4B3ME 2E5LE 3P1XA 4DUYE 4DKKA 4DV4E 2LUQA 4LF5E 4JI1E 1WHQA 4NXNE 4B3RE 4DR6E 2UXCE 2RSMA 1N34E 4X62E 4JV5E 1QU6A 4DR7E 4YHHE 4B3TE 4NXME 3ADLA 2L33A 2EZ6A 5LMUE 2VQFE 1RC7A 2B7TA 4X66E 1XMQE 2JY9A 1FKAE 2VQEE 1T4OA 1X48A 2IHR1 2DB2A 3VYYA 4WFTA 2RS7A 2UU9E 4JI3E 2UUCE 1HNXE 4JI2E 1YYOA 2L2KB 2RS6A 2UXDE 4GKJE 4B3SE 2YT4A 1T4NA 2NUGA 2ZM6E 1XMOE 1IBKE 4JI4E 4M30A 2B7VA 2UUBE 1HNWE 5IWAE 4JI0E 2L3JA 1UILA 1DI2A 1UHZA 4X8WA 2LBSB 1GQEA 4JI5E 1EKZA 4LF8E 2LJHA 4DV7E 4DV0E 1XNRE 4LF4E 1STUA 4X65E 3ADGA 4DR5E 1HR0E 2B3TB 3J7Yp 1N32E 4GKKE 4KHPE 2CPNA 1N36E 2L2MA 3LLHA 1FJGE 2LRSA 4M2ZA 1I94E 2DMYA 1T4LB 2UXBE 4DR1E 2N3GA 1O0WA 4LFAE 2N3HA 4DUZE 4DV3E 4OX9E 4JI7E 4DV6E 2HHHE 4K0KE 3C4BA 4DR4E 1RQ0A 4LF9E 1YZ9A 2DIXA 1J5EE 3ADIA 2UUAE 1X47A 4LF6E 5CFFE 1ZBTA 3VYXA 2JVAA 4X64E 4AQYE 2L2NA 4JI8E 1IBLE 1XNQE 2NUFA 3OTOE 5BR8E 3C4TA 2RTXA 4OOGC 4DV1E 4DV2E 1IBME 5LMNE 1YYKA 2LTRA 4WYQB 1X49A 2MDRA 4YY3E 1WHNA 1J26A 1PKPA 3ADJA 4DR3E 1HNZE 3HTXA 4DV5E 2F4VE 2NA2A 4LFBE 4LFCE 4DR2E 1N33E
chains in the Genus database with same CATH superfamily
2EPOA 1YUIA 2R1FA 2ELYA 1DQ3A 2YU8A 2LTSA 2R76A 4B3ME 4DUYE 4DKKA 1B69A 5KL5A 4NXNE 4ZYEA 2V87A 2YTFA 2RSMA 4WSGA 1A1IA 1PJQA 4B3TE 2EMKA 2EOFA 2A25A 4NZVA 4BS9A 1FKAE 2VQEE 1X48A 2DB2A 3H09A 2FGGA 5KL3A 2RS7A 1KJKA 3BGHA 2EN8A 1ZAAC 4MLQA 3DJWA 3J80C 2VRDA 3HPZA 4GKJE 5A2QC 4P78A 4B3SE 1A1GA 2BBGA 2CT1A 5AE2A 4LTYA 4N4RB 1XMOE 5A6AA 1PJTA 2EMAA 4MLVA 2UUBE 1HNWE 5IWAE 4JI0E 3KZZA 4F9CB 2EOQA 1UILA 2ADRA 3M99B 1NCSA 1ZR9A 4LF8E 4O24A 3BF2A 1STUA 4WXDA 2DMIA 1AAYA 4LF4E 3EPHA 4WPYA 2EORA 3ADGA 4HTGA 5AC4A 2RQLA 5A6BD 1N32E 4KWYA 1N36E 4KZSA 2VF1A 4R2AA 1I94E 2EPRA 2EN7A 4NHRA 4DUZE 4DR2E 2EL4A 2LMZA 2YTJA 2M1SA 1YZ9A 2EPUA 3EQ1A 1J5EE 2EN1A 2EPPA 1X3CA 2JR1A 1X47A 4R2RA 5IV8B 1JK2A 4X64E 4AQYE 2L2NA 3VHTB 2EM4A 5BR8E 3C4TA 5KL6A 4DV1E 1SFEA 4GZNC 2EE8A 4WYQB 1X49A 1A1JA 1BBGA 2LT7A 1IMUA 4DR3E 1HNZE 3UK3C 3HTXA 3C6MA 2FTXB 4LFBE 2E1MA 4LFCE 4BMJA 4O4KA 3JAMC 3BIDA 2L6MA 2EOZA 2NUEA 2YSOA 2L3CA 4JYAE 2EWLA 3J7AG 2YPNA 2EJ4A 2E5LE 4LF5E 2ODRC 4JI1E 1WHQA 4DR6E 1SR9A 5FLXC 1N34E 2DSYA 4X62E 4WX9A 2ELZA 2YRKA 1QU6A 4YHHE 4NXME 3ADLA 2L33A 2EZ6A 1IQOA 2VQFE 3EPKA 4R2QA 1X5WA 2YTDA 3IWDA 2EQ3A 3MHSC 4R2EA 2YTEA 4X66E 1XMQE 1MEYC 2JOXA 3VYYA 1GZ6A 2UU9E 4JI3E 2V86A 2K4VA 1JK1A 2WBUA 1HNXE 2V89A 1YYOA 2JP9A 2JXPA 1N3GA 4R03A 4BC7A 4DMIA 2YT4A 2DLQA 1T4NA 2NUGA 4JI4E 2BB8A 4M30A 5IT9C 1X6EA 4F2JC 1PJSA 1UHZA 4JI5E 2WCC3 1EKZA 4DV7E 3QG5C 4O43A 4BHBA 4DR5E 2GPIA 2YTNA 2M4IA 1HR0E 4GKKE 1KYQA 3HQ1A 4KHPE 2L2MA 4LU9A 1AH5A 2EN2A 2EPLX 2LRSA 4F6MA 1A1FA 4F54A 2DMYA 4IS1C 2UXBE 2LJUA 4DR1E 1G2FC 1O0WA 2MC5A 2N3HA 1Z1BA 4OX9E 4JI7E 4DV6E 2V8QB 4HEIA 1T39A 4K0KE 2MKDA 2GLIA 2EOSA 2EP3A 3ADIA 2J7JA 4L8NA 2G7HA 1L4SA 2JYAA 2YRMA 5LLQA 2EQ1A 2YTPA 3VYXA 4I8OA 2M7QA 2I9IA 2JWOA 3OTOE 5TSEA 2EMIA 2EM9A 4OOGC 2LTRA 3FIGA 4O5GA 2JPAA 5F3WA 2EM0A 1P47A 4YY3E 1PKPA 2EMYA 2KOUA 4M0VA 2EPXA 2VE7C 3MSWA 2LVHA 1N33E 2LUPB 1YYWA 4JI6E 4F9AB 2V83A 3T1YE 2EMWA 1BBOA 4LF7E 3T1HE 4R8OA 5AE3A 2PRTA 2EOYA 2EM7A 2YRHA 2EPKX 4B3RE 3ZOQB 1GTKA 2UXCE 4TUGA 2YWQA 4M9VC 2EN4A 4DR7E 1MGTA 5AC5A 2WZOA 2YTIA 4RHBB 1RMDA 2N8XA 5A6BA 2EOOA 1EH8A 2LV2A 2EPCA 1ZU1A 2MDGA 1A1KA 2JY9A 1T4OA 4WFTA 1X6HA 1X6FA 2LCEA 4GEQB 1LLMC 4JI2E 1UN6B 2EMLA 3HXLA 5KL7A 2UXDE 2H36X 4P7DA 1IBKE 2L8TA 4ZYDA 1WJPA 2YZTA 2B7VA 1YFHA 2DGCA 5T6JA 2L3JA 3TQMA 2EM8A 1DI2A 2YTGA 4X8WA 2LBSB 1GQEA 4BHCA 2LJHA 1XNRE 4ZYHA 2GHFA 1WRJA 2EOXA 3F6GA 2HJJA 2Q8UA 2DLKA 3MHHC 2HC5A 2JOBA 3LLHA 5A69A 2HGHA 5AASA 4M2ZA 3RMPA 5A6JA 3AV0A 2EL6A 2EM6A 2N3GA 4IJDA 1UBDC 4DV3E 1YUJA 4LFAE 2HHHE 3LMLA 2KONA 2YTQA 2M9AA 4DR4E 1QNTA 2EN6A 4LF9E 4RH8A 1F2IG 2EPZA 3OMLA 2EOHA 4FK5C 3EPJA 2UUAE 2WBTA 1ZBTA 3THNA 2JVAA 4JI8E 3KZYA 1IBLE 3L00A 1XNQE 1YYKA 5DNYA 1ZBQA 1T38A 2MDRA 4R2DA 2MC6A 1WHNA 2EMCA 3JTZA 4BC9A 4X9JA 2ENHA 2WBSA 4ZYGA 4DV5E 2EN3A 5ADZA 2F4VE 2EPAA 3IWCA 1A1LA 4L5NC 1A1HA 2KHXA 2EM2A 1TF6A 2ENAA 1YPNA 2YU5A 2V85A 2CSHA 5A6KA 3P1XA 2EOEA 4DV4E 2EQ0A 2LUQA 2EPNA 2EMGA 3VK6A 1WXRA 5IXMB 5KL4A 2EM5A 1NEIA 2ENCA 2I13A 2EL5A 2EOIA 4JV5E 2F8BA 2EM3A 2V88A 1TF3A 3J81C 2CTDA 2EMXA 5LMUE 2FV4B 4R2SA 5AE1A 2YTOA 4WXCA 1RC7A 2B7TA 2IHR1 5LL6R 2EMBA 2UUCE 1PDAA 1EH6A 2EMZA 4BCAA 2L2KB 2RS6A 3K6QA 1YSAC 4TUIA 2LE2A 3HPSA 2ZM6E 4Q35B 2EOMA 2LO3A 4J8ZA 2L92A 1DGCA 4F6NA 4DV0E 4F9BB 2B9DA 3F6HA 3IWBA 4X65E 2B3TB 3J7Yp 2RPCA 2CPNA 1BB8A 1FJGE 2DRPA 2EMFA 3THOB 2K7IA 2NABA 1T4LB 1TN9A 4BBYA 3BBGA 3C4BA 1G2DC 3EPLA 1RQ0A 3DF6A 2DIXA 2YSPA 2EOJA 2MKNA 3ECRA 4LF6E 5CFFE 2ODRD 1EH7A 4Q28A 4R2PA 1IQSA 2EMHA 2NUFA 2EPMX 2RTXA 3JU0A 3KWRA 4DV2E 1IBME 5LMNE 3C6KA 2D9HA 2RSIA 1J26A 3ADJA 5KL2A 2NA2A 2E72A 4WSPA 4R2CA 3AUZA
chains in the Genus database with same CATH topology
4L5NC 2L6MA 2KHXA 2LUPB 1YYWA 4JI6E 4F9AB 2V83A 2L3CA 3T1YE 2NUEA 1DQ3A 2V85A 4LF7E 4JYAE 2EWLA 2LTSA 3J7AG 3T1HE 4R8OA 5AE3A 4B3ME 2E5LE 3P1XA 4DUYE 4DKKA 4DV4E 2LUQA 2ODRC 1WXRA 4JI1E 3VK6A 1WHQA 4LF5E 4NXNE 4B3RE 3ZOQB 2V87A 4DR6E 1SR9A 2UXCE 4TUGA 5FLXC 2RSMA 1N34E 2DSYA 4X62E 4JV5E 1QU6A 2F8BA 4DR7E 2V88A 2WZOA 4YHHE 3J81C 4B3TE 4NXME 3ADLA 2L33A 2EZ6A 5LMUE 2FV4B 2VQFE 5AE1A 3IWDA 1RC7A 2B7TA 4BS9A 4X66E 1XMQE 2JY9A 1FKAE 2VQEE 1T4OA 1X48A 2IHR1 2DB2A 2JOXA 1GZ6A 2FGGA 2RS7A 3H09A 4WFTA 5LL6R 3VYYA 2V86A 2UU9E 4GEQB 2UUCE 4JI3E 2K4VA 3DJWA 1HNXE 3J80C 4JI2E 2V89A 1YYOA 4BCAA 3HPZA 2RS6A 3HXLA 3K6QA 2L2KB 4R03A 2UXDE 4GKJE 4BC7A 4P78A 5A2QC 2LE2A 2YT4A 2H36X 3HPSA 4P7DA 4DMIA 1T4NA 5AE2A 4B3SE 4LTYA 2NUGA 2ZM6E 1XMOE 1IBKE 4JI4E 2L8TA 4M30A 5IT9C 2YZTA 2B7VA 2UUBE 1HNWE 4J8ZA 5IWAE 4JI0E 5T6JA 4F9CB 2L3JA 1UILA 1DI2A 1UHZA 4X8WA 2LBSB 2L92A 1GQEA 4JI5E 1EKZA 4LF8E 2LJHA 4DV7E 4DV0E 4F9BB 2B9DA 3F6HA 1STUA 3IWBA 4X65E 4LF4E 1XNRE 4WPYA 3ADGA 3F6GA 4DR5E 2B3TB 2M4IA 3J7Yp 1HR0E 3HQ1A 2CPNA 1N32E 1N36E 2L2MA 4KHPE 4GKKE 4LU9A 2JOBA 3LLHA 4KZSA 2LRSA 1FJGE 2VF1A 5AASA 4M2ZA 1I94E 4F54A 3RMPA 2DMYA 3AV0A 1T4LB 2UXBE 4DR1E 2N3GA 1O0WA 2MC5A 2N3HA 4DUZE 4DV3E 4TUIA 4LFAE 4JI7E 4DV6E 2V8QB 4BBYA 3LMLA 2HHHE 4OX9E 2KONA 4K0KE 3C4BA 4DR2E 4DR4E 2LMZA 2M1SA 1RQ0A 4LF9E 1YZ9A 3DF6A 2DIXA 3OMLA 1J5EE 3ADIA 4L8NA 2G7HA 2JR1A 2UUAE 1X47A 4LF6E 5CFFE 2ODRD 1ZBTA 3VYXA 2JVAA 4X64E 4AQYE 2L2NA 4I8OA 4Q28A 4JI8E 2M7QA 1IBLE 1XNQE 2JWOA 2NUFA 3OTOE 5BR8E 3C4TA 2RTXA 3JU0A 3KWRA 4OOGC 4DV1E 4DV2E 5LMNE 1IBME 2LTRA 3FIGA 1YYKA 4WYQB 5DNYA 1ZBQA 5F3WA 1X49A 2MDRA 4YY3E 2MC6A 1WHNA 4BC9A 3JTZA 1J26A 1PKPA 2KOUA 4M0VA 3ADJA 4DR3E 1HNZE 3HTXA 2VE7C 3MSWA 5ADZA 4DV5E 2NA2A 2FTXB 2F4VE 2E1MA 4LFCE 4LFBE 4BMJA 3JAMC 3IWCA 4WSPA 3AUZA 1N33E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHX A;  2LUP B;  1YYW A;  4JI6 E;  2L3C A;  3T1Y E;  2NUE A;  4LF7 E;  4JYA E;  2LTS A;  3T1H E;  4B3M E;  2E5L E;  3P1X A;  4DUY E;  4DKK A;  4DV4 E;  2LUQ A;  4LF5 E;  4JI1 E;  1WHQ A;  4NXN E;  4B3R E;  4DR6 E;  2UXC E;  2RSM A;  1N34 E;  4X62 E;  4JV5 E;  1QU6 A;  4DR7 E;  4YHH E;  4B3T E;  4NXM E;  3ADL A;  2L33 A;  2EZ6 A;  5LMU E;  2VQF E;  1RC7 A;  2B7T A;  4X66 E;  1XMQ E;  2JY9 A;  1FKA E;  2VQE E;  1T4O A;  1X48 A;  2IHR 1;  2DB2 A;  3VYY A;  4WFT A;  2RS7 A;  2UU9 E;  4JI3 E;  2UUC E;  1HNX E;  4JI2 E;  1YYO A;  2L2K B;  2RS6 A;  2UXD E;  4GKJ E;  4B3S E;  2YT4 A;  1T4N A;  2NUG A;  2ZM6 E;  1XMO E;  1IBK E;  4JI4 E;  4M30 A;  2B7V A;  2UUB E;  1HNW E;  5IWA E;  4JI0 E;  2L3J A;  1UIL A;  1DI2 A;  1UHZ A;  4X8W A;  2LBS B;  1GQE A;  4JI5 E;  1EKZ A;  4LF8 E;  2LJH A;  4DV7 E;  4DV0 E;  1XNR E;  4LF4 E;  1STU A;  4X65 E;  3ADG A;  4DR5 E;  1HR0 E;  2B3T B;  3J7Y p;  1N32 E;  4GKK E;  4KHP E;  2CPN A;  1N36 E;  2L2M A;  3LLH A;  1FJG E;  2LRS A;  4M2Z A;  1I94 E;  2DMY A;  1T4L B;  2UXB E;  4DR1 E;  2N3G A;  1O0W A;  4LFA E;  2N3H A;  4DUZ E;  4DV3 E;  4OX9 E;  4JI7 E;  4DV6 E;  2HHH E;  4K0K E;  3C4B A;  4DR4 E;  1RQ0 A;  4LF9 E;  1YZ9 A;  2DIX A;  1J5E E;  3ADI A;  2UUA E;  1X47 A;  4LF6 E;  5CFF E;  1ZBT A;  3VYX A;  2JVA A;  4X64 E;  4AQY E;  2L2N A;  4JI8 E;  1IBL E;  1XNQ E;  2NUF A;  3OTO E;  5BR8 E;  3C4T A;  2RTX A;  4OOG C;  4DV1 E;  4DV2 E;  1IBM E;  5LMN E;  1YYK A;  2LTR A;  4WYQ B;  1X49 A;  2MDR A;  4YY3 E;  1WHN A;  1J26 A;  1PKP A;  3ADJ A;  4DR3 E;  1HNZ E;  3HTX A;  4DV5 E;  2F4V E;  2NA2 A;  4LFB E;  4LFC E;  4DR2 E;  1N33 E; 
#chains in the Genus database with same CATH topology
 2EPO A;  1YUI A;  2R1F A;  2ELY A;  1DQ3 A;  2YU8 A;  2LTS A;  2R76 A;  4B3M E;  4DUY E;  4DKK A;  1B69 A;  5KL5 A;  4NXN E;  4ZYE A;  2V87 A;  2YTF A;  2RSM A;  4WSG A;  1A1I A;  1PJQ A;  4B3T E;  2EMK A;  2EOF A;  2A25 A;  4NZV A;  4BS9 A;  1FKA E;  2VQE E;  1X48 A;  2DB2 A;  3H09 A;  2FGG A;  5KL3 A;  2RS7 A;  1KJK A;  3BGH A;  2EN8 A;  1ZAA C;  4MLQ A;  3DJW A;  3J80 C;  2VRD A;  3HPZ A;  4GKJ E;  5A2Q C;  4P78 A;  4B3S E;  1A1G A;  2BBG A;  2CT1 A;  5AE2 A;  4LTY A;  4N4R B;  1XMO E;  5A6A A;  1PJT A;  2EMA A;  4MLV A;  2UUB E;  1HNW E;  5IWA E;  4JI0 E;  3KZZ A;  4F9C B;  2EOQ A;  1UIL A;  2ADR A;  3M99 B;  1NCS A;  1ZR9 A;  4LF8 E;  4O24 A;  3BF2 A;  1STU A;  4WXD A;  2DMI A;  1AAY A;  4LF4 E;  3EPH A;  4WPY A;  2EOR A;  3ADG A;  4HTG A;  5AC4 A;  2RQL A;  5A6B D;  1N32 E;  4KWY A;  1N36 E;  4KZS A;  2VF1 A;  4R2A A;  1I94 E;  2EPR A;  2EN7 A;  4NHR A;  4DUZ E;  4DR2 E;  2EL4 A;  2LMZ A;  2YTJ A;  2M1S A;  1YZ9 A;  2EPU A;  3EQ1 A;  1J5E E;  2EN1 A;  2EPP A;  1X3C A;  2JR1 A;  1X47 A;  4R2R A;  5IV8 B;  1JK2 A;  4X64 E;  4AQY E;  2L2N A;  3VHT B;  2EM4 A;  5BR8 E;  3C4T A;  5KL6 A;  4DV1 E;  1SFE A;  4GZN C;  2EE8 A;  4WYQ B;  1X49 A;  1A1J A;  1BBG A;  2LT7 A;  1IMU A;  4DR3 E;  1HNZ E;  3UK3 C;  3HTX A;  3C6M A;  2FTX B;  4LFB E;  2E1M A;  4LFC E;  4BMJ A;  4O4K A;  3JAM C;  3BID A;  2L6M A;  2EOZ A;  2NUE A;  2YSO A;  2L3C A;  4JYA E;  2EWL A;  3J7A G;  2YPN A;  2EJ4 A;  2E5L E;  4LF5 E;  2ODR C;  4JI1 E;  1WHQ A;  4DR6 E;  1SR9 A;  5FLX C;  1N34 E;  2DSY A;  4X62 E;  4WX9 A;  2ELZ A;  2YRK A;  1QU6 A;  4YHH E;  4NXM E;  3ADL A;  2L33 A;  2EZ6 A;  1IQO A;  2VQF E;  3EPK A;  4R2Q A;  1X5W A;  2YTD A;  3IWD A;  2EQ3 A;  3MHS C;  4R2E A;  2YTE A;  4X66 E;  1XMQ E;  1MEY C;  2JOX A;  3VYY A;  1GZ6 A;  2UU9 E;  4JI3 E;  2V86 A;  2K4V A;  1JK1 A;  2WBU A;  1HNX E;  2V89 A;  1YYO A;  2JP9 A;  2JXP A;  1N3G A;  4R03 A;  4BC7 A;  4DMI A;  2YT4 A;  2DLQ A;  1T4N A;  2NUG A;  4JI4 E;  2BB8 A;  4M30 A;  5IT9 C;  1X6E A;  4F2J C;  1PJS A;  1UHZ A;  4JI5 E;  2WCC 3;  1EKZ A;  4DV7 E;  3QG5 C;  4O43 A;  4BHB A;  4DR5 E;  2GPI A;  2YTN A;  2M4I A;  1HR0 E;  4GKK E;  1KYQ A;  3HQ1 A;  4KHP E;  2L2M A;  4LU9 A;  1AH5 A;  2EN2 A;  2EPL X;  2LRS A;  4F6M A;  1A1F A;  4F54 A;  2DMY A;  4IS1 C;  2UXB E;  2LJU A;  4DR1 E;  1G2F C;  1O0W A;  2MC5 A;  2N3H A;  1Z1B A;  4OX9 E;  4JI7 E;  4DV6 E;  2V8Q B;  4HEI A;  1T39 A;  4K0K E;  2MKD A;  2GLI A;  2EOS A;  2EP3 A;  3ADI A;  2J7J A;  4L8N A;  2G7H A;  1L4S A;  2JYA A;  2YRM A;  5LLQ A;  2EQ1 A;  2YTP A;  3VYX A;  4I8O A;  2M7Q A;  2I9I A;  2JWO A;  3OTO E;  5TSE A;  2EMI A;  2EM9 A;  4OOG C;  2LTR A;  3FIG A;  4O5G A;  2JPA A;  5F3W A;  2EM0 A;  1P47 A;  4YY3 E;  1PKP A;  2EMY A;  2KOU A;  4M0V A;  2EPX A;  2VE7 C;  3MSW A;  2LVH A;  1N33 E;  2LUP B;  1YYW A;  4JI6 E;  4F9A B;  2V83 A;  3T1Y E;  2EMW A;  1BBO A;  4LF7 E;  3T1H E;  4R8O A;  5AE3 A;  2PRT A;  2EOY A;  2EM7 A;  2YRH A;  2EPK X;  4B3R E;  3ZOQ B;  1GTK A;  2UXC E;  4TUG A;  2YWQ A;  4M9V C;  2EN4 A;  4DR7 E;  1MGT A;  5AC5 A;  2WZO A;  2YTI A;  4RHB B;  1RMD A;  2N8X A;  5A6B A;  2EOO A;  1EH8 A;  2LV2 A;  2EPC A;  1ZU1 A;  2MDG A;  1A1K A;  2JY9 A;  1T4O A;  4WFT A;  1X6H A;  1X6F A;  2LCE A;  4GEQ B;  1LLM C;  4JI2 E;  1UN6 B;  2EML A;  3HXL A;  5KL7 A;  2UXD E;  2H36 X;  4P7D A;  1IBK E;  2L8T A;  4ZYD A;  1WJP A;  2YZT A;  2B7V A;  1YFH A;  2DGC A;  5T6J A;  2L3J A;  3TQM A;  2EM8 A;  1DI2 A;  2YTG A;  4X8W A;  2LBS B;  1GQE A;  4BHC A;  2LJH A;  1XNR E;  4ZYH A;  2GHF A;  1WRJ A;  2EOX A;  3F6G A;  2HJJ A;  2Q8U A;  2DLK A;  3MHH C;  2HC5 A;  2JOB A;  3LLH A;  5A69 A;  2HGH A;  5AAS A;  4M2Z A;  3RMP A;  5A6J A;  3AV0 A;  2EL6 A;  2EM6 A;  2N3G A;  4IJD A;  1UBD C;  4DV3 E;  1YUJ A;  4LFA E;  2HHH E;  3LML A;  2KON A;  2YTQ A;  2M9A A;  4DR4 E;  1QNT A;  2EN6 A;  4LF9 E;  4RH8 A;  1F2I G;  2EPZ A;  3OML A;  2EOH A;  4FK5 C;  3EPJ A;  2UUA E;  2WBT A;  1ZBT A;  3THN A;  2JVA A;  4JI8 E;  3KZY A;  1IBL E;  3L00 A;  1XNQ E;  1YYK A;  5DNY A;  1ZBQ A;  1T38 A;  2MDR A;  4R2D A;  2MC6 A;  1WHN A;  2EMC A;  3JTZ A;  4BC9 A;  4X9J A;  2ENH A;  2WBS A;  4ZYG A;  4DV5 E;  2EN3 A;  5ADZ A;  2F4V E;  2EPA A;  3IWC A;  1A1L A;  4L5N C;  1A1H A;  2KHX A;  2EM2 A;  1TF6 A;  2ENA A;  1YPN A;  2YU5 A;  2V85 A;  2CSH A;  5A6K A;  3P1X A;  2EOE A;  4DV4 E;  2EQ0 A;  2LUQ A;  2EPN A;  2EMG A;  3VK6 A;  1WXR A;  5IXM B;  5KL4 A;  2EM5 A;  1NEI A;  2ENC A;  2I13 A;  2EL5 A;  2EOI A;  4JV5 E;  2F8B A;  2EM3 A;  2V88 A;  1TF3 A;  3J81 C;  2CTD A;  2EMX A;  5LMU E;  2FV4 B;  4R2S A;  5AE1 A;  2YTO A;  4WXC A;  1RC7 A;  2B7T A;  2IHR 1;  5LL6 R;  2EMB A;  2UUC E;  1PDA A;  1EH6 A;  2EMZ A;  4BCA A;  2L2K B;  2RS6 A;  3K6Q A;  1YSA C;  4TUI A;  2LE2 A;  3HPS A;  2ZM6 E;  4Q35 B;  2EOM A;  2LO3 A;  4J8Z A;  2L92 A;  1DGC A;  4F6N A;  4DV0 E;  4F9B B;  2B9D A;  3F6H A;  3IWB A;  4X65 E;  2B3T B;  3J7Y p;  2RPC A;  2CPN A;  1BB8 A;  1FJG E;  2DRP A;  2EMF A;  3THO B;  2K7I A;  2NAB A;  1T4L B;  1TN9 A;  4BBY A;  3BBG A;  3C4B A;  1G2D C;  3EPL A;  1RQ0 A;  3DF6 A;  2DIX A;  2YSP A;  2EOJ A;  2MKN A;  3ECR A;  4LF6 E;  5CFF E;  2ODR D;  1EH7 A;  4Q28 A;  4R2P A;  1IQS A;  2EMH A;  2NUF A;  2EPM X;  2RTX A;  3JU0 A;  3KWR A;  4DV2 E;  1IBM E;  5LMN E;  3C6K A;  2D9H A;  2RSI A;  1J26 A;  3ADJ A;  5KL2 A;  2NA2 A;  2E72 A;  4WSP A;  4R2C A;  3AUZ A; 
#chains in the Genus database with same CATH homology
 4L5N C;  2L6M A;  2KHX A;  2LUP B;  1YYW A;  4JI6 E;  4F9A B;  2V83 A;  2L3C A;  3T1Y E;  2NUE A;  1DQ3 A;  2V85 A;  4LF7 E;  4JYA E;  2EWL A;  2LTS A;  3J7A G;  3T1H E;  4R8O A;  5AE3 A;  4B3M E;  2E5L E;  3P1X A;  4DUY E;  4DKK A;  4DV4 E;  2LUQ A;  2ODR C;  1WXR A;  4JI1 E;  3VK6 A;  1WHQ A;  4LF5 E;  4NXN E;  4B3R E;  3ZOQ B;  2V87 A;  4DR6 E;  1SR9 A;  2UXC E;  4TUG A;  5FLX C;  2RSM A;  1N34 E;  2DSY A;  4X62 E;  4JV5 E;  1QU6 A;  2F8B A;  4DR7 E;  2V88 A;  2WZO A;  4YHH E;  3J81 C;  4B3T E;  4NXM E;  3ADL A;  2L33 A;  2EZ6 A;  5LMU E;  2FV4 B;  2VQF E;  5AE1 A;  3IWD A;  1RC7 A;  2B7T A;  4BS9 A;  4X66 E;  1XMQ E;  2JY9 A;  1FKA E;  2VQE E;  1T4O A;  1X48 A;  2IHR 1;  2DB2 A;  2JOX A;  1GZ6 A;  2FGG A;  2RS7 A;  3H09 A;  4WFT A;  5LL6 R;  3VYY A;  2V86 A;  2UU9 E;  4GEQ B;  2UUC E;  4JI3 E;  2K4V A;  3DJW A;  1HNX E;  3J80 C;  4JI2 E;  2V89 A;  1YYO A;  4BCA A;  3HPZ A;  2RS6 A;  3HXL A;  3K6Q A;  2L2K B;  4R03 A;  2UXD E;  4GKJ E;  4BC7 A;  4P78 A;  5A2Q C;  2LE2 A;  2YT4 A;  2H36 X;  3HPS A;  4P7D A;  4DMI A;  1T4N A;  5AE2 A;  4B3S E;  4LTY A;  2NUG A;  2ZM6 E;  1XMO E;  1IBK E;  4JI4 E;  2L8T A;  4M30 A;  5IT9 C;  2YZT A;  2B7V A;  2UUB E;  1HNW E;  4J8Z A;  5IWA E;  4JI0 E;  5T6J A;  4F9C B;  2L3J A;  1UIL A;  1DI2 A;  1UHZ A;  4X8W A;  2LBS B;  2L92 A;  1GQE A;  4JI5 E;  1EKZ A;  4LF8 E;  2LJH A;  4DV7 E;  4DV0 E;  4F9B B;  2B9D A;  3F6H A;  1STU A;  3IWB A;  4X65 E;  4LF4 E;  1XNR E;  4WPY A;  3ADG A;  3F6G A;  4DR5 E;  2B3T B;  2M4I A;  3J7Y p;  1HR0 E;  3HQ1 A;  2CPN A;  1N32 E;  1N36 E;  2L2M A;  4KHP E;  4GKK E;  4LU9 A;  2JOB A;  3LLH A;  4KZS A;  2LRS A;  1FJG E;  2VF1 A;  5AAS A;  4M2Z A;  1I94 E;  4F54 A;  3RMP A;  2DMY A;  3AV0 A;  1T4L B;  2UXB E;  4DR1 E;  2N3G A;  1O0W A;  2MC5 A;  2N3H A;  4DUZ E;  4DV3 E;  4TUI A;  4LFA E;  4JI7 E;  4DV6 E;  2V8Q B;  4BBY A;  3LML A;  2HHH E;  4OX9 E;  2KON A;  4K0K E;  3C4B A;  4DR2 E;  4DR4 E;  2LMZ A;  2M1S A;  1RQ0 A;  4LF9 E;  1YZ9 A;  3DF6 A;  2DIX A;  3OML A;  1J5E E;  3ADI A;  4L8N A;  2G7H A;  2JR1 A;  2UUA E;  1X47 A;  4LF6 E;  5CFF E;  2ODR D;  1ZBT A;  3VYX A;  2JVA A;  4X64 E;  4AQY E;  2L2N A;  4I8O A;  4Q28 A;  4JI8 E;  2M7Q A;  1IBL E;  1XNQ E;  2JWO A;  2NUF A;  3OTO E;  5BR8 E;  3C4T A;  2RTX A;  3JU0 A;  3KWR A;  4OOG C;  4DV1 E;  4DV2 E;  5LMN E;  1IBM E;  2LTR A;  3FIG A;  1YYK A;  4WYQ B;  5DNY A;  1ZBQ A;  5F3W A;  1X49 A;  2MDR A;  4YY3 E;  2MC6 A;  1WHN A;  4BC9 A;  3JTZ A;  1J26 A;  1PKP A;  2KOU A;  4M0V A;  3ADJ A;  4DR3 E;  1HNZ E;  3HTX A;  2VE7 C;  3MSW A;  5ADZ A;  4DV5 E;  2NA2 A;  2FTX B;  2F4V E;  2E1M A;  4LFC E;  4LFB E;  4BMJ A;  3JAM C;  3IWC A;  4WSP A;  3AUZ A;  1N33 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...