2DIXA

Solution structure of the dsrm domain of protein activator of the interferon-induced protein kinase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
GSSGSSGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINILKANASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DSRM domain of Protein activator of the interferon-induced protein kinase
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Interferon-inducible double stranded RNA-dependent protein k
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2dixA01
4OX9E 4M30A 1PKPA 4X65E 4DV4E 4AQYE 2RSMA 4OOGC 3OTOE 4LF9E 4LFAE 3ADGA 2LBSB 2L2NA 4LFCE 2VQEE 2F4VE 1O0WA 1QU6A 2MDRA 2RS6A 2VQFE 4NXME 1X48A 2UXCE 2L33A 2YT4A 2ZM6E 1IBME 2NUFA 1HNWE 4B3SE 4JI5E 2NUEA 4DV7E 4X62E 5LMNE 1RQ0A 2UUAE 1J5EE 1T4LB 3T1HE 4YHHE 1WHNA 2LJHA 4DR1E 4X66E 1IBLE 1DI2A 3VYYA 2UUCE 4JV5E 3P1XA 2B7TA 4WYQB 4K0KE 1STUA 2DB2A 3C4BA 5CFFE 3T1YE 4LF8E 4GKJE 3ADIA 4DR4E 4DV0E 2UUBE 3ADLA 4DKKA 2N3HA 4LFBE 4DV3E 5BR8E 4WFTA 2L3JA 4JI6E 1N33E 2L2KB 4JYAE 3J7Yp 4JI7E 1YZ9A 4DV5E 2B7VA 2JY9A 4DUYE 4DV6E 5LMUE 2N3GA 1I94E 1IBKE 2L2MA 1UHZA 2LTRA 4DR5E 2HHHE 2NUGA 4LF6E 4B3RE 1GQEA 3ADJA 4X8WA 1FJGE 1WHQA 2DMYA 2LTSA 3LLHA 2LRSA 1ZBTA 4YY3E 2NA2A 4JI3E 4DR2E 2LUQA 4JI2E 4LF4E 2DIXA 4JI4E 2EZ6A 4B3TE 4JI1E 2L3CA 4LF7E 1J26A 2CPNA 1RC7A 1YYKA 4DUZE 2UU9E 4B3ME 1HNXE 3VYXA 1HR0E 4DR7E 1XNRE 2IHR1 1YYOA 4GKKE 1X49A 4DV2E 4DR6E 1N34E 1HNZE 4X64E 4NXNE 4DR3E 4KHPE 2E5LE 2UXDE 2JVAA 2RS7A 2RTXA 3C4TA 4JI8E 1XMOE 3HTXA 1YYWA 1FKAE 1UILA 1T4OA 4DV1E 4LF5E 4JI0E 1X47A 1N32E 1T4NA 1EKZA 2B3TB 1N36E 1XMQE 1XNQE 2UXBE 5IWAE 2KHXA 4M2ZA 2LUPB
chains in the Genus database with same CATH superfamily
5A6BD 1X6FA 1UN6B 4WPYA 1PKPA 4DV4E 4LU9A 2M1SA 4AQYE 2L92A 4OOGC 3OMLA 5AE2A 4LF9E 2CTDA 2V88A 2VE7C 3IWBA 2VQFE 1X48A 2UXCE 5F3WA 3IWCA 2ENAA 4BC9A 4X62E 1RQ0A 3THNA 2EPXA 2UUAE 2E72A 1NCSA 3J7AG 3T1HE 4YHHE 2EQ3A 1AH5A 2YZTA 4JV5E 2YRKA 1MEYC 5IV8B 2EMWA 5AC5A 4WYQB 1X6HA 5TSEA 3RMPA 4K0KE 5T6JA 1STUA 2PRTA 3EPKA 2G7HA 1SR9A 4DR4E 4LFBE 4WFTA 4JI6E 2EMGA 2HGHA 1BB8A 2YTDA 3BIDA 4DV6E 2GLIA 1WRJA 1A1IA 2N3GA 1I94E 2EMKA 2JR1A 3THOB 2ELYA 2EOQA 1X5WA 2EN3A 3HXLA 2LTSA 1A1GA 2LRSA 1KYQA 2YU8A 2WCC3 3TQMA 4JI4E 2EZ6A 4B3TE 3K6QA 1X6EA 4R8OA 2JYAA 3DF6A 1A1HA 4B3ME 2L6MA 4WXDA 1HR0E 2VRDA 1BBOA 2Q8UA 2WBTA 3ECRA 1TN9A 3EQ1A 2MKDA 4R03A 4JI8E 2RS7A 1N3GA 5AE3A 4R2DA 4FK5C 1L4SA 4WXCA 4NHRA 2EM0A 4IJDA 2EPCA 5LLQA 4DMIA 2LO3A 2V86A 1JK2A 4OX9E 2EE8A 2DRPA 2WZOA 4R2SA 3DJWA 4TUGA 3J80C 2ADRA 4ZYGA 2VF1A 2KONA 2DMIA 2EOOA 2DLKA 1QU6A 2RQLA 4F6NA 2MDRA 2RS6A 5A6KA 2B9DA 1F2IG 2EN2A 2EMZA 2JOXA 2L33A 2HC5A 2LE2A 3HPZA 4P7DA 5AE1A 2EOXA 1IBME 2NUFA 2L8TA 4B3SE 4JI5E 1IQOA 1WXRA 4WSGA 4DV7E 2GPIA 2RSIA 2JP9A 1T4LB 2LJHA 4DR1E 2F8BA 1IBLE 1DI2A 2UUCE 4R2AA 1BBGA 2EPAA 4BHBA 2CT1A 4O24A 1T39A 5KL5A 1MGTA 2EPUA 3L00A 2BB8A 4N4RB 1YUJA 5IT9C 4GKJE 2UUBE 3F6HA 4DKKA 2EL4A 2N3HA 5AC4A 1ZBQA 2EMYA 4DV3E 2EMXA 2J7JA 1LLMC 4JI7E 1ZU1A 2EPRA 2B7VA 1A1LA 1G2DC 2EM8A 2L2MA 1ZR9A 2LTRA 2MC6A 2FGGA 2NUGA 5A69A 4LF6E 2K7IA 2YTPA 1Z1BA 1TF6A 2EM5A 4F54A 2EPMX 5ADZA 5KL3A 4DR2E 2WBSA 1PJSA 2YRHA 4JI2E 5KL6A 4LF4E 2MC5A 3QG5C 2EMFA 3LMLA 4JI1E 2EM3A 2EMAA 2L3CA 4LF7E 5KL4A 1YYKA 4DUZE 1B69A 2DLQA 2EN1A 1HNXE 3VYXA 4DR7E 4HTGA 2I13A 2EPKX 1XNRE 3F6GA 1ZAAC 4ZYDA 2YTFA 2EM6A 4O43A 4F9AB 4DR6E 3JAMC 2EM4A 2ENHA 1P47A 1EH6A 2NABA 2UXDE 2RTXA 4R2EA 3HTXA 1T4OA 2EM2A 1JK1A 5LL6R 4F6MA 1X47A 1N32E 2EWLA 2LJUA 1YFHA 2EOZA 2JPAA 2UXBE 2KHXA 2LT7A 2YTEA 3BBGA 1EH8A 2CSHA 2EOHA 3ADGA 4MLVA 2L2NA 2VQEE 1O0WA 1SFEA 4HEIA 5IXMB 3EPHA 2EM7A 3MSWA 2ZM6E 3C6MA 3EPLA 3JTZA 4X9JA 2EQ1A 1A1FA 3VYYA 2DSYA 3P1XA 2ODRD 2LV2A 2M4IA 2YTJA 4Q28A 4J8ZA 2EL5A 5KL7A 2DB2A 3BGHA 5CFFE 3T1YE 5A6JA 4BBYA 4LF8E 2EMCA 2EN7A 4DV0E 4Q35B 1PJQA 2HJJA 3MHSC 2FTXB 1N33E 2L2KB 3UK3C 4BC7A 3HPSA 3MHHC 2JY9A 4DUYE 3J81C 1IBKE 2YPNA 5AASA 2EOSA 1GQEA 3ADJA 5KL2A 4X8WA 2M7QA 1FJGE 1G2FC 2EMIA 1YUIA 2DMYA 2I9IA 1T38A 4BHCA 5A6BA 2JWOA 2N8XA 2EOYA 4L8NA 2EN6A 2DIXA 1DGCA 2BBGA 2KOUA 2WBUA 2MKNA 1J26A 2V83A 2CPNA 4WSPA 3EPJA 1RC7A 4F9BB 4BS9A 2GHFA 2EPOA 2IHR1 2D9HA 2EPPA 4DV2E 2YTGA 2JXPA 3VHTB 4X64E 4I8OA 4DR3E 4NXNE 4KHPE 2E5LE 2EMBA 1A1JA 2EMLA 1YYWA 1UILA 2ENCA 2EPNA 4F2JC 3HQ1A 1TF3A 2LCEA 4JI0E 4ZYEA 1EKZA 2B3TB 2EORA 4M2ZA 2V8QB 2E1MA 2EN8A 3VK6A 2YWQA 5DNYA 1RMDA 2LUPB 3KZYA 4L5NC 4M30A 4F9CB 5A6AA 4X65E 5FLXC 2RSMA 2EQ0A 2YSPA 1NEIA 3OTOE 3JU0A 4LFAE 2LBSB 2YTNA 4LFCE 2F4VE 2EOEA 4M0VA 4RH8A 4NXME 1KJKA 4R2PA 4KWYA 2YT4A 2EM9A 1YPNA 1HNWE 2YTIA 1UBDC 2RPCA 2NUEA 4O4KA 5LMNE 2ODRC 1J5EE 1WHNA 4X66E 3KWRA 2EN4A 2DGCA 4R2CA 3FIGA 1A1KA 2B7TA 3ZOQB 2V85A 2R76A 3C4BA 1WJPA 2V89A 2FV4B 4WX9A 3ADIA 3ADLA 1PDAA 1EH7A 1IQSA 3M99B 5BR8E 4GZNC 2L3JA 2LMZA 4JYAE 3J7Yp 2EOFA 1YZ9A 4DV5E 1DQ3A 4RHBB 2EP3A 1IMUA 2JOBA 2R1FA 2ELZA 5LMUE 1UHZA 1X3CA 1QNTA 4DR5E 2HHHE 4B3RE 2YSOA 2MDGA 2YU5A 3KZZA 1GTKA 4IS1C 3AV0A 5A2QC 1WHQA 3LLHA 4ZYHA 4TUIA 1ZBTA 2V87A 2NA2A 4MLQA 4YY3E 4JI3E 2LUQA 3AUZA 2EOIA 2EJ4A 2EOMA 4P78A 4BMJA 4M9VC 4GEQB 1GZ6A 2K4VA 4R2RA 2YTQA 4NZVA 2YRMA 2EOJA 4BCAA 2UU9E 2EL6A 3BF2A 3H09A 1PJTA 1AAYA 2LVHA 1YSAC 1YYOA 2A25A 4GKKE 4KZSA 1X49A 4R2QA 4LTYA 1N34E 3C6KA 1HNZE 3IWDA 2JVAA 3C4TA 4O5GA 1XMOE 1FKAE 2EPLX 2H36X 4DV1E 4LF5E 2EPZA 1T4NA 1N36E 1XMQE 1XNQE 2EMHA 5IWAE 2M9AA 2YTOA
chains in the Genus database with same CATH topology
3VK6A 4OX9E 4WPYA 4L5NC 4M30A 4F9CB 1PKPA 4X65E 4LU9A 2M1SA 5FLXC 4DV4E 4AQYE 2RSMA 2L92A 4OOGC 2WZOA 3OMLA 5AE2A 3OTOE 3JU0A 4LF9E 4LFAE 3ADGA 3DJWA 4TUGA 2LBSB 3J80C 2L2NA 2V88A 2VF1A 2KONA 2VQEE 4LFCE 1O0WA 1QU6A 2F4VE 2MDRA 2RS6A 2VE7C 2B9DA 3IWBA 2VQFE 4M0VA 1X48A 4NXME 2UXCE 3MSWA 2JOXA 2L33A 2LE2A 2YT4A 3HPZA 4P7DA 3IWCA 5AE1A 2ZM6E 5F3WA 2L8TA 4BC9A 1IBME 2NUFA 4B3SE 4JI5E 1HNWE 1WXRA 2NUEA 4DV7E 3JTZA 4X62E 5LMNE 1RQ0A 2UUAE 2ODRC 3J7AG 1J5EE 1T4LB 3T1HE 4YHHE 1WHNA 2LJHA 4DR1E 2F8BA 4X66E 1IBLE 3KWRA 1DI2A 3VYYA 2UUCE 2YZTA 4JV5E 2DSYA 3P1XA 2ODRD 3FIGA 2M4IA 4Q28A 2B7TA 4J8ZA 4WYQB 3ZOQB 2V85A 3RMPA 4K0KE 1STUA 2DB2A 3C4BA 5T6JA 2V89A 5CFFE 3T1YE 4BBYA 2G7HA 2FV4B 1SR9A 4LF8E 5IT9C 3ADIA 4DV0E 2UUBE 3F6HA 3ADLA 4DR4E 4DKKA 4GKJE 2N3HA 1ZBQA 2FTXB 4DV3E 5BR8E 4LFBE 4WFTA 2L3JA 4JI6E 1N33E 2LMZA 2L2KB 4JYAE 3J7Yp 4JI7E 4BC7A 1YZ9A 3HPSA 4DV5E 2B7VA 1DQ3A 2JY9A 4DUYE 4DV6E 2JOBA 3J81C 2N3GA 5LMUE 1I94E 1IBKE 2L2MA 1UHZA 2LTRA 2MC6A 2V86A 5AASA 4DR5E 2JR1A 2FGGA 2HHHE 2NUGA 4LF6E 4B3RE 1GQEA 3ADJA 4X8WA 2M7QA 1FJGE 3AV0A 3HXLA 5A2QC 4F54A 1WHQA 2DMYA 2LTSA 3LLHA 5ADZA 4TUIA 2LRSA 1ZBTA 2V87A 2NA2A 4YY3E 4JI3E 2JWOA 4DR2E 4L8NA 2LUQA 4JI2E 4LF4E 2DIXA 2MC5A 3AUZA 4P78A 4BMJA 4JI4E 3LMLA 2EZ6A 4B3TE 4GEQB 1GZ6A 2K4VA 4JI1E 3K6QA 4R8OA 2KOUA 2L3CA 4LF7E 1J26A 2V83A 4BCAA 2CPNA 4WSPA 3DF6A 1RC7A 1YYKA 4DUZE 2UU9E 4F9BB 4B3ME 4BS9A 2L6MA 1HNXE 3VYXA 1HR0E 3H09A 4DR7E 1XNRE 2IHR1 1YYOA 4GKKE 3F6GA 4KZSA 1X49A 4F9AB 4DV2E 4DR6E 4LTYA 1N34E 3JAMC 1HNZE 4X64E 4NXNE 4I8OA 4DR3E 4KHPE 3IWDA 2E5LE 4R03A 2JVAA 2RS7A 2RTXA 3C4TA 4JI8E 2UXDE 5AE3A 1XMOE 3HTXA 1YYWA 1FKAE 1UILA 1T4OA 2H36X 4DV1E 3HQ1A 4LF5E 5LL6R 4JI0E 1X47A 1N32E 1T4NA 2LUPB 2EWLA 1EKZA 2B3TB 1N36E 1XMQE 1XNQE 2UXBE 5IWAE 2KHXA 4DMIA 4M2ZA 2V8QB 2E1MA 5DNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 E;  4M30 A;  1PKP A;  4X65 E;  4DV4 E;  4AQY E;  2RSM A;  4OOG C;  3OTO E;  4LF9 E;  4LFA E;  3ADG A;  2LBS B;  2L2N A;  4LFC E;  2VQE E;  2F4V E;  1O0W A;  1QU6 A;  2MDR A;  2RS6 A;  2VQF E;  4NXM E;  1X48 A;  2UXC E;  2L33 A;  2YT4 A;  2ZM6 E;  1IBM E;  2NUF A;  1HNW E;  4B3S E;  4JI5 E;  2NUE A;  4DV7 E;  4X62 E;  5LMN E;  1RQ0 A;  2UUA E;  1J5E E;  1T4L B;  3T1H E;  4YHH E;  1WHN A;  2LJH A;  4DR1 E;  4X66 E;  1IBL E;  1DI2 A;  3VYY A;  2UUC E;  4JV5 E;  3P1X A;  2B7T A;  4WYQ B;  4K0K E;  1STU A;  2DB2 A;  3C4B A;  5CFF E;  3T1Y E;  4LF8 E;  4GKJ E;  3ADI A;  4DR4 E;  4DV0 E;  2UUB E;  3ADL A;  4DKK A;  2N3H A;  4LFB E;  4DV3 E;  5BR8 E;  4WFT A;  2L3J A;  4JI6 E;  1N33 E;  2L2K B;  4JYA E;  3J7Y p;  4JI7 E;  1YZ9 A;  4DV5 E;  2B7V A;  2JY9 A;  4DUY E;  4DV6 E;  5LMU E;  2N3G A;  1I94 E;  1IBK E;  2L2M A;  1UHZ A;  2LTR A;  4DR5 E;  2HHH E;  2NUG A;  4LF6 E;  4B3R E;  1GQE A;  3ADJ A;  4X8W A;  1FJG E;  1WHQ A;  2DMY A;  2LTS A;  3LLH A;  2LRS A;  1ZBT A;  4YY3 E;  2NA2 A;  4JI3 E;  4DR2 E;  2LUQ A;  4JI2 E;  4LF4 E;  2DIX A;  4JI4 E;  2EZ6 A;  4B3T E;  4JI1 E;  2L3C A;  4LF7 E;  1J26 A;  2CPN A;  1RC7 A;  1YYK A;  4DUZ E;  2UU9 E;  4B3M E;  1HNX E;  3VYX A;  1HR0 E;  4DR7 E;  1XNR E;  2IHR 1;  1YYO A;  4GKK E;  1X49 A;  4DV2 E;  4DR6 E;  1N34 E;  1HNZ E;  4X64 E;  4NXN E;  4DR3 E;  4KHP E;  2E5L E;  2UXD E;  2JVA A;  2RS7 A;  2RTX A;  3C4T A;  4JI8 E;  1XMO E;  3HTX A;  1YYW A;  1FKA E;  1UIL A;  1T4O A;  4DV1 E;  4LF5 E;  4JI0 E;  1X47 A;  1N32 E;  1T4N A;  1EKZ A;  2B3T B;  1N36 E;  1XMQ E;  1XNQ E;  2UXB E;  5IWA E;  2KHX A;  4M2Z A;  2LUP B; 
#chains in the Genus database with same CATH topology
 5A6B D;  1X6F A;  1UN6 B;  4WPY A;  1PKP A;  4DV4 E;  4LU9 A;  2M1S A;  4AQY E;  2L92 A;  4OOG C;  3OML A;  5AE2 A;  4LF9 E;  2CTD A;  2V88 A;  2VE7 C;  3IWB A;  2VQF E;  1X48 A;  2UXC E;  5F3W A;  3IWC A;  2ENA A;  4BC9 A;  4X62 E;  1RQ0 A;  3THN A;  2EPX A;  2UUA E;  2E72 A;  1NCS A;  3J7A G;  3T1H E;  4YHH E;  2EQ3 A;  1AH5 A;  2YZT A;  4JV5 E;  2YRK A;  1MEY C;  5IV8 B;  2EMW A;  5AC5 A;  4WYQ B;  1X6H A;  5TSE A;  3RMP A;  4K0K E;  5T6J A;  1STU A;  2PRT A;  3EPK A;  2G7H A;  1SR9 A;  4DR4 E;  4LFB E;  4WFT A;  4JI6 E;  2EMG A;  2HGH A;  1BB8 A;  2YTD A;  3BID A;  4DV6 E;  2GLI A;  1WRJ A;  1A1I A;  2N3G A;  1I94 E;  2EMK A;  2JR1 A;  3THO B;  2ELY A;  2EOQ A;  1X5W A;  2EN3 A;  3HXL A;  2LTS A;  1A1G A;  2LRS A;  1KYQ A;  2YU8 A;  2WCC 3;  3TQM A;  4JI4 E;  2EZ6 A;  4B3T E;  3K6Q A;  1X6E A;  4R8O A;  2JYA A;  3DF6 A;  1A1H A;  4B3M E;  2L6M A;  4WXD A;  1HR0 E;  2VRD A;  1BBO A;  2Q8U A;  2WBT A;  3ECR A;  1TN9 A;  3EQ1 A;  2MKD A;  4R03 A;  4JI8 E;  2RS7 A;  1N3G A;  5AE3 A;  4R2D A;  4FK5 C;  1L4S A;  4WXC A;  4NHR A;  2EM0 A;  4IJD A;  2EPC A;  5LLQ A;  4DMI A;  2LO3 A;  2V86 A;  1JK2 A;  4OX9 E;  2EE8 A;  2DRP A;  2WZO A;  4R2S A;  3DJW A;  4TUG A;  3J80 C;  2ADR A;  4ZYG A;  2VF1 A;  2KON A;  2DMI A;  2EOO A;  2DLK A;  1QU6 A;  2RQL A;  4F6N A;  2MDR A;  2RS6 A;  5A6K A;  2B9D A;  1F2I G;  2EN2 A;  2EMZ A;  2JOX A;  2L33 A;  2HC5 A;  2LE2 A;  3HPZ A;  4P7D A;  5AE1 A;  2EOX A;  1IBM E;  2NUF A;  2L8T A;  4B3S E;  4JI5 E;  1IQO A;  1WXR A;  4WSG A;  4DV7 E;  2GPI A;  2RSI A;  2JP9 A;  1T4L B;  2LJH A;  4DR1 E;  2F8B A;  1IBL E;  1DI2 A;  2UUC E;  4R2A A;  1BBG A;  2EPA A;  4BHB A;  2CT1 A;  4O24 A;  1T39 A;  5KL5 A;  1MGT A;  2EPU A;  3L00 A;  2BB8 A;  4N4R B;  1YUJ A;  5IT9 C;  4GKJ E;  2UUB E;  3F6H A;  4DKK A;  2EL4 A;  2N3H A;  5AC4 A;  1ZBQ A;  2EMY A;  4DV3 E;  2EMX A;  2J7J A;  1LLM C;  4JI7 E;  1ZU1 A;  2EPR A;  2B7V A;  1A1L A;  1G2D C;  2EM8 A;  2L2M A;  1ZR9 A;  2LTR A;  2MC6 A;  2FGG A;  2NUG A;  5A69 A;  4LF6 E;  2K7I A;  2YTP A;  1Z1B A;  1TF6 A;  2EM5 A;  4F54 A;  2EPM X;  5ADZ A;  5KL3 A;  4DR2 E;  2WBS A;  1PJS A;  2YRH A;  4JI2 E;  5KL6 A;  4LF4 E;  2MC5 A;  3QG5 C;  2EMF A;  3LML A;  4JI1 E;  2EM3 A;  2EMA A;  2L3C A;  4LF7 E;  5KL4 A;  1YYK A;  4DUZ E;  1B69 A;  2DLQ A;  2EN1 A;  1HNX E;  3VYX A;  4DR7 E;  4HTG A;  2I13 A;  2EPK X;  1XNR E;  3F6G A;  1ZAA C;  4ZYD A;  2YTF A;  2EM6 A;  4O43 A;  4F9A B;  4DR6 E;  3JAM C;  2EM4 A;  2ENH A;  1P47 A;  1EH6 A;  2NAB A;  2UXD E;  2RTX A;  4R2E A;  3HTX A;  1T4O A;  2EM2 A;  1JK1 A;  5LL6 R;  4F6M A;  1X47 A;  1N32 E;  2EWL A;  2LJU A;  1YFH A;  2EOZ A;  2JPA A;  2UXB E;  2KHX A;  2LT7 A;  2YTE A;  3BBG A;  1EH8 A;  2CSH A;  2EOH A;  3ADG A;  4MLV A;  2L2N A;  2VQE E;  1O0W A;  1SFE A;  4HEI A;  5IXM B;  3EPH A;  2EM7 A;  3MSW A;  2ZM6 E;  3C6M A;  3EPL A;  3JTZ A;  4X9J A;  2EQ1 A;  1A1F A;  3VYY A;  2DSY A;  3P1X A;  2ODR D;  2LV2 A;  2M4I A;  2YTJ A;  4Q28 A;  4J8Z A;  2EL5 A;  5KL7 A;  2DB2 A;  3BGH A;  5CFF E;  3T1Y E;  5A6J A;  4BBY A;  4LF8 E;  2EMC A;  2EN7 A;  4DV0 E;  4Q35 B;  1PJQ A;  2HJJ A;  3MHS C;  2FTX B;  1N33 E;  2L2K B;  3UK3 C;  4BC7 A;  3HPS A;  3MHH C;  2JY9 A;  4DUY E;  3J81 C;  1IBK E;  2YPN A;  5AAS A;  2EOS A;  1GQE A;  3ADJ A;  5KL2 A;  4X8W A;  2M7Q A;  1FJG E;  1G2F C;  2EMI A;  1YUI A;  2DMY A;  2I9I A;  1T38 A;  4BHC A;  5A6B A;  2JWO A;  2N8X A;  2EOY A;  4L8N A;  2EN6 A;  2DIX A;  1DGC A;  2BBG A;  2KOU A;  2WBU A;  2MKN A;  1J26 A;  2V83 A;  2CPN A;  4WSP A;  3EPJ A;  1RC7 A;  4F9B B;  4BS9 A;  2GHF A;  2EPO A;  2IHR 1;  2D9H A;  2EPP A;  4DV2 E;  2YTG A;  2JXP A;  3VHT B;  4X64 E;  4I8O A;  4DR3 E;  4NXN E;  4KHP E;  2E5L E;  2EMB A;  1A1J A;  2EML A;  1YYW A;  1UIL A;  2ENC A;  2EPN A;  4F2J C;  3HQ1 A;  1TF3 A;  2LCE A;  4JI0 E;  4ZYE A;  1EKZ A;  2B3T B;  2EOR A;  4M2Z A;  2V8Q B;  2E1M A;  2EN8 A;  3VK6 A;  2YWQ A;  5DNY A;  1RMD A;  2LUP B;  3KZY A;  4L5N C;  4M30 A;  4F9C B;  5A6A A;  4X65 E;  5FLX C;  2RSM A;  2EQ0 A;  2YSP A;  1NEI A;  3OTO E;  3JU0 A;  4LFA E;  2LBS B;  2YTN A;  4LFC E;  2F4V E;  2EOE A;  4M0V A;  4RH8 A;  4NXM E;  1KJK A;  4R2P A;  4KWY A;  2YT4 A;  2EM9 A;  1YPN A;  1HNW E;  2YTI A;  1UBD C;  2RPC A;  2NUE A;  4O4K A;  5LMN E;  2ODR C;  1J5E E;  1WHN A;  4X66 E;  3KWR A;  2EN4 A;  2DGC A;  4R2C A;  3FIG A;  1A1K A;  2B7T A;  3ZOQ B;  2V85 A;  2R76 A;  3C4B A;  1WJP A;  2V89 A;  2FV4 B;  4WX9 A;  3ADI A;  3ADL A;  1PDA A;  1EH7 A;  1IQS A;  3M99 B;  5BR8 E;  4GZN C;  2L3J A;  2LMZ A;  4JYA E;  3J7Y p;  2EOF A;  1YZ9 A;  4DV5 E;  1DQ3 A;  4RHB B;  2EP3 A;  1IMU A;  2JOB A;  2R1F A;  2ELZ A;  5LMU E;  1UHZ A;  1X3C A;  1QNT A;  4DR5 E;  2HHH E;  4B3R E;  2YSO A;  2MDG A;  2YU5 A;  3KZZ A;  1GTK A;  4IS1 C;  3AV0 A;  5A2Q C;  1WHQ A;  3LLH A;  4ZYH A;  4TUI A;  1ZBT A;  2V87 A;  2NA2 A;  4MLQ A;  4YY3 E;  4JI3 E;  2LUQ A;  3AUZ A;  2EOI A;  2EJ4 A;  2EOM A;  4P78 A;  4BMJ A;  4M9V C;  4GEQ B;  1GZ6 A;  2K4V A;  4R2R A;  2YTQ A;  4NZV A;  2YRM A;  2EOJ A;  4BCA A;  2UU9 E;  2EL6 A;  3BF2 A;  3H09 A;  1PJT A;  1AAY A;  2LVH A;  1YSA C;  1YYO A;  2A25 A;  4GKK E;  4KZS A;  1X49 A;  4R2Q A;  4LTY A;  1N34 E;  3C6K A;  1HNZ E;  3IWD A;  2JVA A;  3C4T A;  4O5G A;  1XMO E;  1FKA E;  2EPL X;  2H36 X;  4DV1 E;  4LF5 E;  2EPZ A;  1T4N A;  1N36 E;  1XMQ E;  1XNQ E;  2EMH A;  5IWA E;  2M9A A;  2YTO A; 
#chains in the Genus database with same CATH homology
 3VK6 A;  4OX9 E;  4WPY A;  4L5N C;  4M30 A;  4F9C B;  1PKP A;  4X65 E;  4LU9 A;  2M1S A;  5FLX C;  4DV4 E;  4AQY E;  2RSM A;  2L92 A;  4OOG C;  2WZO A;  3OML A;  5AE2 A;  3OTO E;  3JU0 A;  4LF9 E;  4LFA E;  3ADG A;  3DJW A;  4TUG A;  2LBS B;  3J80 C;  2L2N A;  2V88 A;  2VF1 A;  2KON A;  2VQE E;  4LFC E;  1O0W A;  1QU6 A;  2F4V E;  2MDR A;  2RS6 A;  2VE7 C;  2B9D A;  3IWB A;  2VQF E;  4M0V A;  1X48 A;  4NXM E;  2UXC E;  3MSW A;  2JOX A;  2L33 A;  2LE2 A;  2YT4 A;  3HPZ A;  4P7D A;  3IWC A;  5AE1 A;  2ZM6 E;  5F3W A;  2L8T A;  4BC9 A;  1IBM E;  2NUF A;  4B3S E;  4JI5 E;  1HNW E;  1WXR A;  2NUE A;  4DV7 E;  3JTZ A;  4X62 E;  5LMN E;  1RQ0 A;  2UUA E;  2ODR C;  3J7A G;  1J5E E;  1T4L B;  3T1H E;  4YHH E;  1WHN A;  2LJH A;  4DR1 E;  2F8B A;  4X66 E;  1IBL E;  3KWR A;  1DI2 A;  3VYY A;  2UUC E;  2YZT A;  4JV5 E;  2DSY A;  3P1X A;  2ODR D;  3FIG A;  2M4I A;  4Q28 A;  2B7T A;  4J8Z A;  4WYQ B;  3ZOQ B;  2V85 A;  3RMP A;  4K0K E;  1STU A;  2DB2 A;  3C4B A;  5T6J A;  2V89 A;  5CFF E;  3T1Y E;  4BBY A;  2G7H A;  2FV4 B;  1SR9 A;  4LF8 E;  5IT9 C;  3ADI A;  4DV0 E;  2UUB E;  3F6H A;  3ADL A;  4DR4 E;  4DKK A;  4GKJ E;  2N3H A;  1ZBQ A;  2FTX B;  4DV3 E;  5BR8 E;  4LFB E;  4WFT A;  2L3J A;  4JI6 E;  1N33 E;  2LMZ A;  2L2K B;  4JYA E;  3J7Y p;  4JI7 E;  4BC7 A;  1YZ9 A;  3HPS A;  4DV5 E;  2B7V A;  1DQ3 A;  2JY9 A;  4DUY E;  4DV6 E;  2JOB A;  3J81 C;  2N3G A;  5LMU E;  1I94 E;  1IBK E;  2L2M A;  1UHZ A;  2LTR A;  2MC6 A;  2V86 A;  5AAS A;  4DR5 E;  2JR1 A;  2FGG A;  2HHH E;  2NUG A;  4LF6 E;  4B3R E;  1GQE A;  3ADJ A;  4X8W A;  2M7Q A;  1FJG E;  3AV0 A;  3HXL A;  5A2Q C;  4F54 A;  1WHQ A;  2DMY A;  2LTS A;  3LLH A;  5ADZ A;  4TUI A;  2LRS A;  1ZBT A;  2V87 A;  2NA2 A;  4YY3 E;  4JI3 E;  2JWO A;  4DR2 E;  4L8N A;  2LUQ A;  4JI2 E;  4LF4 E;  2DIX A;  2MC5 A;  3AUZ A;  4P78 A;  4BMJ A;  4JI4 E;  3LML A;  2EZ6 A;  4B3T E;  4GEQ B;  1GZ6 A;  2K4V A;  4JI1 E;  3K6Q A;  4R8O A;  2KOU A;  2L3C A;  4LF7 E;  1J26 A;  2V83 A;  4BCA A;  2CPN A;  4WSP A;  3DF6 A;  1RC7 A;  1YYK A;  4DUZ E;  2UU9 E;  4F9B B;  4B3M E;  4BS9 A;  2L6M A;  1HNX E;  3VYX A;  1HR0 E;  3H09 A;  4DR7 E;  1XNR E;  2IHR 1;  1YYO A;  4GKK E;  3F6G A;  4KZS A;  1X49 A;  4F9A B;  4DV2 E;  4DR6 E;  4LTY A;  1N34 E;  3JAM C;  1HNZ E;  4X64 E;  4NXN E;  4I8O A;  4DR3 E;  4KHP E;  3IWD A;  2E5L E;  4R03 A;  2JVA A;  2RS7 A;  2RTX A;  3C4T A;  4JI8 E;  2UXD E;  5AE3 A;  1XMO E;  3HTX A;  1YYW A;  1FKA E;  1UIL A;  1T4O A;  2H36 X;  4DV1 E;  3HQ1 A;  4LF5 E;  5LL6 R;  4JI0 E;  1X47 A;  1N32 E;  1T4N A;  2LUP B;  2EWL A;  1EKZ A;  2B3T B;  1N36 E;  1XMQ E;  1XNQ E;  2UXB E;  5IWA E;  2KHX A;  4DMI A;  4M2Z A;  2V8Q B;  2E1M A;  5DNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...