2DJQA

The solution structure of the first sh3 domain of mouse sh3 domain containing ring finger 2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDENWYQGEINGVSGIFPASSVEVISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the first SH3 domain of mouse SH3 domain containing ring finger 2
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords SH3 domain containing ring finger 2
total genus 6
structure length 68
sequence length 68
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2djqA00
4R0KA 1OPKA 3TVTA 2D0NA 2SRCA 2BZYA 4JPBW 3M0UA 4HCKA 2BZ8A 2C0OA 3REAB 1PHTA 4JZ4A 2DVJA 4RTYA 1ZSGA 1CKAA 1ZUYA 3PVQA 2ED0A 2X3XD 1GBRA 4LUDA 1NG2A 4RTUA 2KT1A 3RBBB 2CT4A 1U3OA 1KIKA 1WYXA 2LJ1A 3VS6A 5L23A 2KYBA 4J9DA 5IXBA 5I11A 1YP5A 2YSQA 2KYMA 2YUQA 1U06A 1LCKA 2LX7A 2EVRA 1M3BA 1ARKA 4JZ3A 2E5KA 1HD3A 2K3BA 2KR3A 4IIOA 3U23A 4OMNA 2FPFA 2I0NA 1AOJA 1GFCA 3EHQA 2JMAA 2AZVA 3VS0A 1WXTA 3NHNA 4J9GA 4A63B 3EG2A 4OMMA 2DBKA 3FJ5A 2J7IA 2W10A 1M30A 1SHGA 1JO8A 1PKTA 1B3QA 2DX1A 2VWFA 3H41A 2KGTA 1JQQA 1OPLA 1X43A 4J9BA 1T3LA 2LZ6B 2PNIA 1M8MA 1UHFA 4HVWA 3O5ZA 4K11A 1UG1A 2DL3A 1H8KA 1E6HA 1RI9A 1SHFA 2FEIA 1CSKA 2L3PA 1QWEA 4F17A 1VYVA 1G83A 4LUEA 2RNAA 2X3WD 1X6BA 3EHRA 3VS2A 2K7AA 2L0AA 4DEYA 2AK5A 2G6FX 1SSHA 1UTIA 2D8HA 2QDLA 2EW3A 5HCKA 2M51A 3EG3A 1GL5A 5GJVB 1UJYA 1X6GA 2NWMA 5IH2A 1RLQC 3LH5A 1Y0MA 3ZL7C 4OMQA 2W0ZA 4GBQA 1AVZC 2AZSA 3VRYA 3H0FA 3VS3A 4AFQC 1TG0A 1T0HA 1WA7A 1Z9ZA 2JT4A 5IHIA 1AEYA 2CSQA 4RTVA 2C0IA 1YCSB 2FG0A 1WDXA 2JM9A 3CQTA 4AFZC 1SRLA 4J9FA 4OMOA 1IO6A 1K0SA 4RTZA 2GBQA 2EGAA 1ZBJA 1AWOA 1GFDA 2L3SA 1QWFA 3M0PA 4RTXA 3I5SA 1H92A 2FO0A 1MV3A 2CH4W 4LN2A 1UECA 1VA7A 2RQTA 1AWJA 1M3CA 2AKLA 5FWCA 1PWTA 1ZUUA 3NPFA 5IHKA 5FWBA 2EYWA 1E6GA 1EFNA 1RUWA 1V1CA 2CUBA 2VKNA 3EG1A 1NEBA 3ULRB 2M0YA 2GTJA 2P4RA 3SEMA 2H8HA 2JW4A 3THKA 2CH4A 2RPNA 3UATA 1KFZA 1FMKA 1NM7A 4AFSC 1YWPA 3M0SA 1H3HA 2V1RA 5FW9A 4HXJA 2ENMA 1AZGB 1WXBA 1GCQA 3TSZA 2KNBB 1X2QA 1K1ZA 2RQUA 1G2BA 4DEXA 2GNCA 2C0TA 1X27A 1QLYA 2EGCA 2LQNA 2FPEA 2LQWA 1T0JA 1VYUA 2JXBA 1MV0B 2D1XA 4Z88A 2RN8A 1AWXA 1JXOA 2DILA 2V1QA 2DL4A 2ED1A 2O31A 4RUGA 2F2WA 2DL7A 2J6KA 4CC4B 3VRZA 1JU5C 2O9VA 2CUDA 4J9EA 4OMLA 2JTEA 2LJ3A 1VYTA 4OMPA 1JEGA 2YT6A 2MOXA 4CC7A 4EIKA 2A37A 1T3SA 1K76A 2PTKA 1CKBA 2KRSA 1QKWA 2L2PA 2EQIA 3A98A 1Z9QA 4QT7A 1OOTA 1NEGA 1TUCA 1WIEA 3I35A 3PVLA 2O2OA 2RF0A 3VS4A 2IIMA 2O88A 1KJWA 2ESWA 1A0NB 1OEBA 2O9SA 2A08A 5EC7A 1UJ0A 2KT8A 2FRYA 2RMOA 3M0TA 2RQVA 1X69A 2DL5A 1K0XA 2EPDA 1Y57A 2LCSA 2D8JA 1SRMA 2CREA 2DRKA 2XMFA 3PE0A 4ZNXA 4GLMA 2B86A 2DNUA 1SEMA 3NMZC 2YDLA 2RQRA 2CDTA 1TUDA 2HSPA 4E6RA 2DJQA 4JJDA 1HSQA 3VS5A 1YNZA 1WXUA 1GBQA 2DYBA 2DLPA 1BB9A 1ZX6A 1WLPB 4F16A 2EGEA 3UA7A 2J6OA 2YUOA 2KRNA 4CC3A 2DE0X 3RNJA 1UDLA 1UHCA 2AKKA 1AZEA 1NLPC 1S1NA 2DL8A 2KBTA 4Z8AA 2A36A 1WFWA 2DF6A 1NLOC 3SHWA 3VS7A 2OAWA 2J6FA 1E7OA 2LJ0A 1FYNA 1PKSA 3I9QA 2JS0A 2LP5A 2RQWA 2HBWA 1K9AA 4J9CA 4JJCA 3QWYA 2BTTA 2LMJA 3UA6A 1RLPC 2EKHA 3M0RA 2KE9A 1JXMA 3C0CA 1KSWA 4RTTA 1SPKA 4D8DA 1U5SA 1BBZA 2HCKA 2HDAA 2MCNA 2ROTA 3UF4A 1ABQA 2OI3A 2EYZA 1UUEA 2DMOA 2ABLA 2F2VA 3H0IA 1ZUKA 2J05A 2L3QA 2K6DA 1X2KA 1I0CA 1PNJA 3NGPA 2OJ2A 4KRTA 1ABOA 1W1FA 4JJBA 1AWWA 3M0QA 2EBPA 1M3AA 4HVVA 3EG0A 1BK2A 4LE9A 3TSWA 1B07A 4AG1C 4IIMA 1BU1A 1GCPA 2CSIA 5GJWB 2BZXA 2VVKA 2J06A 1NYFA 1I07A 2CT3A 2HEQA 3GBQA 3IQLA 5IXFA 1N5ZA 1QCFA 2KRMA 1W6XA 4J9IA 1J3TA 1UGVA 2KXCA 1NYGA 2DBMA 4X1VA 2PZ1A 4AFUC 4HVUA 1AD5A 3KFVA 2LNHB 2EYYA 2NUZA 2F2XA 4M4ZA 5IHNA 1WI7A 2YUPA 1OV3A 1M27C 3VS1A 2K9GA 2ECZA 2KROA 4J9HA 3R6NA 4RTWA 4WCIA 3QWXX 3REBB 2ROLA 1YWOA 4ORZA 1K4US 4CC2A 1GRIA 2KEAA 2GTOA 2SEMA 1UE9A 2GGRA 4LNPA 4F14A 3EGUA 2EYXA 4Z89A 2JMCA 2FRWA 1MUZA 2DRMA 2GQIA 2YUNA 4ESRA 2JM8A 1PRMC 1GCQC 1I1JA 1HJDA 2DM1A 2DA9A 1YN8A 4AG2C 1XOVA 1PRLC 2JS2A 3I5RA 5I22A 1QKXA 3JV3A 4Y92A 2K2MA 2K79A 2MIOA 1W70A 2FPDA 1UFFA 4FSSA 2A28A 5ECAA 4D8KA 1WX6A 1ZLMA 3H0HA 2KXDA
chains in the Genus database with same CATH superfamily
3EGDB 1M1KR 2XDDA 5LJ5d 1VQ8A 2COWA 2FB7A 2DVJA 4JZ4A 3OS0A 3JCMP 3OYNA 3PVQA 2PU9B 1GBRA 5GAN2 3OSSC 1VQ5T 2KT1A 4M7DF 2F1LA 3RBBB 3RMQA 3VS6A 5L23A 3G6EQ 2YSQA 5I2SA 3E19A 1M3BA 2EQMA 2HAXA 4OGEA 1VQOQ 1VQKT 3A1PA 1UGSB 4IIOA 2ATCB 3PNWC 1VQ9T 2F5TX 1QVFA 2JMAA 2AZVA 4M75A 2L8DA 5GANj 3RDVA 2ZPBB 3X24B 4J9GA 4OMMA 3FJ5A 2R57A 3X20B 2W10A 4KUDK 4ELYC 2RK2A 1WHGA 1JO8A 5FRNA 1U1SA 1WPYA 2VWFA 2PVOB 3DKMA 3H41A 2KGTA 4M77C 1JQQA 1OPLA 1TS9A 1T3LA 5J3BA 2HL3A 3PFSA 1UHFA 3CCLA 2K3XA 3MJXA 1G3TA 2DFUA 1CSKA 1M2VB 1KHCA 2CZ6B 4B6MA 1MMDA 2M1HA 2HQHA 4LUEA 2RNAA 4B9XA 2PVDB 2EW3A 1ZSZC 2M51A 2VC8A 5HCKA 1KC8U 4KT0E 4PL6A 4BI4A 3LH5A 5FLXE 1RI0A 1FXXA 4LDUA 4MMKA 5KYYB 4GBQA 3ZBDA 2A0FB 3WVEB 1M90U 5D6WA 2HKQB 2XI9A 2JT4A 3CCRQ 1XNIA 2WSEE 4M78D 2C0IA 3QHSA 3META 1WDXA 1YJWA 2JM9A 4B9WA 4OMOA 3PIOA 4RTZA 4HT8A 1B7TA 2GBQA 4NL2A 3G6ET 4MZPA 1Q86R 2CP0A 3CPFA 2L3SA 1I5OB 2BIVA 4RTXA 5AT1B 2NUTA 5KCOA 3I5SA 3QJ6A 1UECA 4C5GA 5IHKA 2Y90A 2EYWA 1E6GA 3GOXA 3P8HA 3L2QA 5GMKi 3QIIA 1M2OA 4DBQA 2JW4A 4N0AC 5KYUA 3UATA 4F7UA 1D0ZA 1D1CA 5C0MA 4HXJA 2ENMA 4Q5WA 1IRXA 4C8QG 2E65A 2KNBB 2VXFA 4KBMB 4QVCA 2C0TA 3BY7A 1X27A 4TVRA 2HNIA 4C92D 3PMTA 1T0JA 2LNVA 4FW2A 2JXBA 2D1XA 3CCUT 4Z88A 2V1QA 3JCMW 1Y07A 2DL4A 2ED1A 2OTLA 2DEQA 2V8JA 2O31A 3LH0A 1YFNA 3E9GA 2CUDA 1BI0A 5D7UA 2QA4A 4M7DE 2LJ3A 4E7HA 1VYTA 4OMPA 2QQAA 4ZTFA 2DERA 2MF2A 1QVFP 2A3LA 2K5FA 3JB9H 3A5ZB 1YJNT 3I56A 3V8LA 4WF2A 4PJOG 2KRSA 2QQSA 1VQ9Q 1Y96A 1TUCA 1K73R 2E5QA 2H3EB 5I21A 1K73U 2RF0A 2E6ZA 1FX7A 2O88A 2ESWA 2O9SA 3G4ST 5LJ5h 1VQ6Q 5EC7A 4NS5A 2P0KA 1UJ0A 4EMKA 2G3RA 5GANg 3CCVT 1X69A 2DJZA 2DL5A 2EQKA 1TU0B 3CCST 3X25B 5A0DA 2P84A 4E7LA 4N0AA 3PE0A 1K8AC 2V8IA 2PUOB 3OYLA 5LL6S 4GLMA 3VUBA 2DNUA 1Y71A 3RR6A 5GANf 2YDLA 2RQRA 2Z0WA 3J81E 2E70A 3OMGA 4E6RA 2DJQA 4JJDA 3I55A 1RACB 3KXTA 1HSQA 3HHTB 3P8BB 4M7DB 1GBQA 1X75C 4QVDA 4F16A 2EGEA 2EJGA 4J7FA 2KRNA 2CS7A 3G1JA 2QTVA 1KG1A 3CCSA 1UDLA 1AZEA 3L2UA 3CCRT 1C1AA 2A36A 1WFWA 2AIRB 5LJ3d 1NLOC 4KUIA 3OS2A 5A0GA 4JRKA 2JS0A 2LP5A 2GCXA 2HBWA 1K9AA 4JJCA 4F04B 3QWYA 5AYFA 4NOYA 4BDZA 1QP2A 5GAN7 2V26A 1YCYA 3OBWA 3M0RA 4D6WA 1HXDA 3RKWA 2QTXA 3CCMQ 1JXMA 3C0CA 2IG0A 4C92F 1SPKA 4D8DA 4XTYA 1N9RA 1BBZA 2JUFA 5LJ5e 3UF4A 4JS4A 1ABQA 3HTRA 2XIDA 1VQ5A 1SKUB 2ABLA 2F2VA 3H0IA 2J05A 4HT9A 4M7AC 4R55A 2QEXT 1PSFA 2ZPGB 3HPWA 1D1AA 5KYUB 2EBPA 3QUIA 2YXYA 1LOJA 3OBYA 5DM7R 3EG0A 4JRQA 4LE9A 2OX7A 3E1SA 1K8AR 4RMOA 1YI2A 3RESA 2M16A 3DB3A 1PD1A 4E47A 1VQ9A 2VVKA 1YJNA 1VQNA 1NYFA 5DY9A 1I07A 2CT3A 3PT9A 4M75D 3V7RA 3GBQA 2LCCA 1W6XA 3J80E 3HL8A 1NYGA 4V2SA 5GANe 2DXBA 2PZ1A 2DZ9A 5I2MA 2ZPIB 1ZHIA 3N5BB 2DAQA 4M4ZA 5IHNA 3RUXA 3JSCA 1M27C 1RAHB 3QDFA 4HCZA 1BI2A 2ECZA 4J9HA 3R6NA 1Q81C 4WCIA 3V7SA 3JCMg 4OP0A 5KYYA 1KD1R 2ROLA 1YWOA 2LQ8A 2YRVA 4ORZA 2OTJQ 1MHNA 4M7DD 2SEMA 3QKJA 1UE9A 2LRQA 3OYJA 4EPCA 2HSEB 1KC8C 3QG1A 2DRMA 2YUNA 2GQIA 4ZGJB 2DM1A 3CC2Q 4J5YA 4BI8B 3I5RA 3LYIA 3F70A 2RO0A 3VUZA 1EZZB 5CIUA 4XTVA 2FPDA 5ECAA 2PUKB 4PJOE 2XICA 3CCQT 2KXDA 2BZYA 5LJ5g 5GMKl 3SFMA 4E7SA 3OYEA 2C0OA 8ATCB 3EFOB 2MWPA 3JCMJ 2D9TA 3CCSQ 1X01A 4J6YA 5GAN6 1CKAA 1ZUYA 4LUDA 4EMKC 4FYVB 4RTUA 4FIBA 1MMAA 3CMAQ 3H9NA 2LJ1A 3INZA 4M77G 2CZ0B 3QDRB 2LDMA 2DO3A 3JRZA 1SF9A 5LJ3j 2E12A 5IN1A 5I11A 1XTDA 2QXFA 2FVUA 3CCET 2QQ9A 3L1AA 3GP8A 2LX7A 1M5Q1 2YRCA 4JZ3A 4C92G 4OGCA 1LJOA 4FYYB 2X51A 2A7YA 2RHZA 2I0NA 3CC4T 1MGQA 1AOJA 4PJLA 2ZCFB 1WXTA 1BIAA 4BY6C 1YIJT 2HMAA 1KD1C 3EG2A 2DBKA 1H3ZA 1WZOA 2OTLQ 1R8OB 3GF5A 5L8RE 1M30A 4F7UB 1W2BP 1SHGA 1B3QA 3JCMe 1U1TA 2K5IA 4FYWB 3FDRA 1PM3A 1O75A 4HVWA 3O5ZA 2MPXC 1UG1A 2DL3A 1H8KA 4IURA 2X35A 2R5AA 2KMTA 1X6BA 3EHRA 3VS2A 2K7AA 4DEYA 2G6FX 2Y4XA 2D8HA 4LDVA 1OX9A 5GAN5 3EG3A 5GJVB 1UJYA 1ZA1B 2NWMA 4DA4A 3CC2A 3PIPA 3G71Q 1Q86U 5HK0A 4IUQA 4Z02A 4OB0B 4M78G 1Y96B 3JB9D 3OW2P 4OMQA 2MAMA 4X9CA 2LX9A 3VRYA 1YBYA 1TG0A 3OB9A 1PCXA 3JCMV 3E9FA 2Y4YA 4JRPA 5IT9E 2FG0A 3OYGA 3CQTA 4AFZC 1WQWA 1ZSZA 3CCJA 2EGAA 4M75F 1W2BA 5KYXB 1AWOA 1JRIA 1GFDA 4BUGA 3HRUA 4M7DG 1QWFA 4XQ3A 4II1A 3PTAA 2FO0A 3JCMh 4R56A 1VQLT 2RQTA 5KYWB 3H8ZA 4IUPA 5FWCA 5IAYA 2L5QA 3EG1A 1RUWA 2QDYB 3PMIA 2CGHA 3RKXA 1R0BG 3OYCA 1YJWT 2P4RA 2EIFA 2AT1B 4M77A 3CBMA 3RERA 3THKA 2CH4A 4BB7A 2RPNA 4M7DA 3EG9B 4JRIA 2DPPB 4NL3A 1SSFA 2E3IA 1WXBA 1AZGB 3TSZA 1VQLA 2QA4T 2RI5A 4ZTJA 4KGZB 2XHCA 1K1ZA 3M57A 2D6FA 4UC4A 1PG5B 5GAOm 2CP3A 2GNCA 4M77F 4XTXA 3LWHA 2GQVA 2FPEA 3JCMb 2VUBA 2RN8A 1AWXA 5GAN4 2EJ9A 2QQRA 3URGA 2QEXA 3OYMA 2DL7A 4CC4B 2GFUA 3DLLA 4J9EA 1KC8R 1OYXA 4XU0A 5CO7A 2YT6A 5GAOp 3JCMQ 1IGQA 1WGSA 2ZAEA 3EH2A 4C8QC 2JTMA 1WNLA 1LVKA 4FT2A 1D09B 3MEAA 2CZ1B 4CC7A 4YTLA 2K57A 3CCLQ 2RK1A 1K76A 2PTKA 1CKBA 2ZPFB 2R58A 1QKWA 2BE7D 1YJ9A 2D0QB 2M02A 3SWNA 1Z9QA 5CKFA 1WIEA 3EGDA 3FIFA 1KQ1A 1KD1U 4PLLA 1G3SA 2DK3A 3JB9F 2FL7A 3QSUA 4J7IA 1MNDA 1QP3A 3BDUA 2FRYA 5D6YA 1GXIE 3M0TA 1K0XA 1S72A 5KYWA 1Y57A 1WJRA 3C12A 1SRMA 2CREA 2DRKA 1F1BB 1DJ7B 2MK5A 4ZNXA 3OQ5A 4E7ZA 7AT1B 3DB4A 1M9SA 3WVDB 2B86A 1IXDA 5KYXA 4C92C 5CAIA 4KGVB 3X26B 1G5VA 4M78B 3CXCS 3MHXA 5GANh 2HQEA 1MNEA 5CK9A 4ELZC 2J6OA 3RKYA 4CI0C 1QQJA 2YWWA 5EG2A 4CC3A 1UHCA 2AKKA 1NLPC 1ZQ1A 2O4XA 1S1NA 3C94A 2K2VA 4QQDA 2DF6A 3WXMB 2F5KA 2KDSA 2X9HA 3MP8A 3CCQA 1VQNQ 3M55A 3QBYA 2BTTA 4RG2A 3M4YA 1RLPC 2EKHA 4PJOA 1Q82R 1V76A 3LX7A 3O8VA 2KE9A 1KSWA 3ASKA 5FU6C 3CPWA 1U5SA 1YI2T 1LPLA 3FC3A 3JCMd 2DEUA 4A4FA 1UEBA 2OI3A 1UUEA 2ZPHB 2VGNA 3TEEA 1VQNT 1Q81U 2FZCB 3CCEQ 3MO8A 3KBGA 3JB9I 4M78C 4M77B 2FZKB 1I0CA 4O6JA 4PLIA 2OJ2A 2OTJA 1VQOT 5CKBA 3CCJQ 1K9MC 1XJWB 1AWWA 1OZ2A 4HVVA 5KH6A 3OYDA 5CKHA 3TSWA 4KH1B 1B07A 4PJOF 4FL6A 4AG1C 3EH1A 1BU1A 2LTOA 3L2RA 3OYHA 1H641 3JCMf 5IXFA 4BE2A 1N5ZA 3OS1A 1J3TA 1UGVA 3NTHA 1I5LA 1NE8A 4X1VA 1VQPT 4AFUC 2K3YA 2CP7A 2LNHB 4Y28E 4OB3B 2NUZA 3QZ9B 2EAYA 3OS5A 5CQXA 2RD1A 4JS5A 1WI7A 4BY6B 1PC0A 4JLIA 5LJ3h 3QPHA 1OV3A 2AHJB 3HFOA 2K5LA 3QWXX 1NPPA 1UB4A 3REBB 3HSBA 2GF7A 4CC2A 4FW1A 3G71A 1RAAB 1G8XA 4RG8A 4LNPA 3A8OB 5HKCA 3I55T 4JUVA 2JM8A 2M0OA 4M75G 4JLGA 1GCQC 1I1JA 4DOVA 3EFRA 2JS2A 1VQ6T 1RAEB 4VUBA 4OVAA 1QKXA 2KK4A 1VIFA 2K79A 2EFIA 2A28A 4D8KA 2K4YA 2QA4Q 2VB6A 3NFCA 4R0KA 1YITT 4ATOA 2YHTA 2DTOA 3E2UA 2B8AA 2LCLA 4HCKA 1NJIR 1PHTA 2BKDN 4RTYA 1YIJQ 1KQSA 2GFAA 1VQKA 1Q81R 2KSSA 3CC7T 5GAMd 1OULA 2X3XD 1K8AU 3M56A 5J39A 1NG2A 3A8GB 3EGXA 4LDXA 2CKKA 2CT4A 1U3OA 4PKCC 2EKOA 1M1KC 2OAUA 1OQKA 2KYBA 5IXBA 1YITA 4IKFA 2KYMA 4C0GA 1BCOA 4PNOA 2P0QA 1JJ2S 1ZSZB 1TWBA 1HD3A 3M5AA 2KR3A 4N4GA 2NUPA 3RIRA 3U23A 4OMNA 2DIGA 4ZGEB 1GFCA 4X34A 1NJIU 3VS0A 3I55Q 3NHNA 4M7AE 3OYAA 3CMEA 2J7IA 3EGXB 3CD6A 2LQKA 2XDPA 3NTKA 2XDBA 2JN0A 5KCHA 3CC2T 3EFOA 3CCQQ 1D0XA 3VYGA 4J9BA 1I4K1 1Q7YU 2LZ6B 2X4XA 1M8MA 1WHMA 3D7SB 3UPUA 1OU8A 2DYIA 4RCCA 1W4SA 4C5IA 1RI9A 2RHUA 1RAFB 1QWEA 2L3PA 3A8MB 4DOWA 1VYVA 3MKDA 1M8VA 2L0AA 1YIJA 1SSHA 2VYTA 4XU2A 1VQPQ 1UTIA 2QDLA 3QXEB 3G71T 1BI3A 1GL5A 3UT1A 2MI6A 5IH2A 4C8QF 3MPUB 1RLQC 2RHXA 3CCJT 3G6EA 1Y0MA 3ZL7C 4BD3A 3CCLT 1D1BA 1P92A 1AVZC 2AZSA 3H0FA 3VS3A 1ACMB 1PD0A 1QVGS 1S72Q 4A54A 3LGLA 1WA7A 5IHIA 1Q7YR 2CSQA 4JDSA 1YCSB 1K9MR 2MYSA 5GAOl 4M7DC 2JZ2A 3MP1A 3HKSA 1RAGB 3M58A 4OB2B 1ZBJA 1YI2Q 5FU7B 4RKUE 4PJNA 1D0YA 3SD4A 2QK0A 3L42A 5LJ3g 1JJ2P 2JJ9A 4KGXB 1M4ZA 2E41A 3CMEQ 1H92A 1KQSS 1VA7A 2QEXQ 1AWJA 1M3CA 3CCMA 2AKLA 1SG5A 1PWTA 1ZUUA 5FWBA 3VYHB 2VKNA 4FU6A 2CUBA 4C8QD 4QVZA 2RJFA 4E7IA 1NEBA 3BFMA 3ULRB 2M0YA 2GTJA 3CCRA 1VQMT 3SEMA 3VU3C 3CMAT 2H8HA 3MP6A 9ATCB 3EG9A 4C92B 2C06A 1KFZA 1FMKA 1NM7A 1FMVA 4XTWA 1H3HA 2V1RA 4OF1A 4M75E 1K9MU 4ANJA 2WSFE 3OYBA 1TOVA 4C8QE 1G2BA 1M90C 4DEXA 1I8FA 1QLYA 2EGCA 4BACA 2LQWA 1VYUA 5GAOr 2HZYA 2QASA 3CD6T 3QO3A 5CKDA 2CZ7B 2PQWA 4M7AD 2DXCA 1YJ9T 4F7UG 4RUGA 4QW2A 2RA2A 3CBPA 1RL2A 4QQ6A 2CP6A 3JCMX 4RCBA 2F2WA 4PJOB 2J6KA 3VRZA 1JU5C 3G4SA 3CPWP 3SWNB 4OMLA 1QVGP 4P5NA 5GMKh 3CD6Q 1W2BS 1HK9A 2CYZB 3CCVA 5KE3A 2DIQA 1EX4A 5LJ5f 2DXUA 3T9NA 2A37A 4A4GA 4J6XA 2DXTA 2L2PA 2IVWA 2EQIA 2FZGB 3OY9A 4XU3A 4J83A 1OOTA 3I35A 1TH7A 1KJWA 4E2FB 3QJYA 1OEBA 1Y7XA 2A08A 5FROA 2JVVA 5FRMA 2XKOC 1VOMA 2KT8A 2RMOA 1OX8A 1VQ8Q 2EPDA 1JB0E 3OSVA 4FCYA 2LCSA 1WHLA 2D8JA 3TU4K 1OI1A 4C8QA 3OW2S 2MWOA 2XMFA 1M2VA 4ZN1A 1SEMA 2X4YA 4C0FA 3NMZC 2CDTA 2HSPA 4C5EA 2WSCE 4LXCA 3OYIA 3FRNA 1WXUA 2DYBA 2ZZDA 1WLPB 2E6NA 5HK3A 1VQ6A 3A8LB 3RNJA 4M75B 1YHQQ 5J26A 2DL8A 2KBTA 4Z8AA 2DD4A 3V8KA 3CMAA 1B34A 1TUGB 2HD0A 4KH0B 3VS7A 2OAWA 2J6FA 1E7OA 2LJ0A 4AMCA 3TREA 2RQWA 5GMKe 1OZ3A 3EAEA 4IUUA 1QVGA 5CVIA 2LMJA 2NYSA 1VQKQ 3UA6A 2RH2A 4QKUA 4RTTA 4C92E 2HCKA 2HDAA 3AHUA 2ROTA 2EQUA 2EYZA 2DMOA 4IUTA 3JB9G 2DD5A 2EWNA 1ZUKA 4J6WA 1WHKA 3KUFA 2L3QA 2K6DA 1VIEA 2PVGB 3P8DA 1ABOA 1W1FA 4JJBA 4C92A 3JCMc 4PJJA 1M3AA 3GNGA 2XD0A 2KQWA 3SB2A 2P0PA 4IIMA 5GJWB 4C5HA 1MMGA 2NUTB 2FHDA 5CKEA 2HEQA 1QCFA 4A53A 5CR2A 2LT4A 1BI1A 4J9IA 2KXCA 3M54A 2DBMA 2RHYA 4O5VA 5HY6A 4HVUA 1IGUA 3NTIA 2COYA 5DLOA 2EYYA 4IUVA 4XTZA 1ZA2B 1AT1B 2F2XA 4M78E 3VKIA 2YUPA 1I81A 3VS1A 2K9GA 4RTWA 3AT1B 2BE9B 2NLUA 3PGGA 5LJ3e 3FLGA 1K4US 3OW2A 1GRIA 1QCNA 1YJNQ 4N4IA 1VQMQ 2GGRA 4F14A 3RMSA 1BYMA 4M78A 5FU7C 2BUDA 2JMCA 4C0DB 4ESRA 4PJOD 1PRMC 5GAMf 2DTHA 2KAFA 3BDLA 3OYKA 3FB9A 1YN8A 1YHQA 1YITQ 3GIBA 1PSEA 1PRLC 1WHJA 1VQ7Q 3CC7A 1IZ6A 4XU1A 4Y92A 4EMKB 1Q7YC 4EDUA 2K2MA 1RADB 2MIOA 1W70A 4M7AF 1UFFA 4FSSA 2YLBA 1ZLMA 1OPKA 3TVTA 2D0NA 2SRCA 4JPBW 3L2WA 3M0UA 1WHHA 1AHJB 2BZ8A 3REAB 5D6XA 2DVEA 1TSFA 2QQBA 4DQ2A 2QGGA 2QYZA 1LNXA 1ZSGA 3LGFA 1XQHA 4FYXB 2ED0A 3TQ7P 4M75C 2VV5A 4EMHA 2JNGA 3CCMT 1G3WA 4M77E 1NJIC 1KIKA 1WYXA 4XK8E 3G7ZA 4HCCA 2E4HA 5LJ3f 1N8RC 3LWIA 4J9DA 4XTUA 1YP5A 2YUQA 1U06A 1IB8A 1LCKA 2DZCA 2EVRA 3M4GA 3GNFB 4BE0A 1ARKA 3GPLA 1K73C 2E5KA 1JJ2A 2K3BA 4GY5A 4M77D 6AT1B 2FPFA 3HP9A 4BE1A 2L3RA 1IREB 3EHQA 2QGFB 4A63B 1QVPA 2CP5A 4DBRA 1PKTA 2DX1A 1Q82C 1X43A 2KVQG 2PNIA 4A4EA 4K11A 3MEVA 1E6HA 1Q95G 3CCVQ 1SHFA 2FEIA 1QCOA 4F17A 1G83A 1N9SA 2DKGA 3UWNA 2X3WD 3DLMA 4PFOA 3JB9J 1R0CB 2DETA 2AK5A 1ZBXA 2P4TA 3FEOA 4FSXA 1WJSA 3CXCP 2XU8A 2X4WA 1X6GA 5GAMh 3C95A 2RI2A 5KE2A 2RJCA 1VQ7A 3S3OA 4LDWA 4L5GA 2W0ZA 4E7KA 3QYGB 2QI2A 2V8KA 4AFQC 2O4XB 2XK0A 1T0HA 3LW5E 1Z9ZA 2YRDA 1AEYA 2KY9A 2ZGWA 3OYFA 1VQ4A 4J8OA 4RTVA 4PFPA 2HKNA 3EFSA 1SRLA 2NUPB 4J9FA 1IO6A 1K0SA 4ZN3A 3S3NA 3V7CA 2HBPA 1VQ8T 2HL5C 4MZTA 1VQLQ 3CPWS 4WTOB 3M0PA 5GMKm 3MEUA 2EQJA 1MV3A 2CH4W 4LN2A 2LVMA 2M9UA 1OU9A 4M7AG 3ZEHA 2JTFA 4L59A 3NPFA 4FM4B 4FT4A 1NPRA 4XAXB 4A4HA 1VQ4T 1EFNA 1V1CA 3CCEA 4Y91A 4C0DC 1VUBA 2H3JA 3UDCA 2VGMA 5CQYA 3BW1A 4AFSC 1YWPA 3M0SA 5FW9A 5GAMe 2R5MA 1VQ5Q 3SDZA 1X6OA 3OA6A 1GCQA 1BCMA 1X2QA 4PJMA 5C6SA 2RQUA 5GAOn 1RABB 4JJNK 1D3BA 2LQNA 4DBHA 2DTIA 1YJ9Q 1QMCA 1MV0B 3SWNC 4HA8A 4MDWA 1JXOA 2RM4A 2DILA 2X4JA 2KI7A 3M9QA 2QG9B 1O9SA 5GAOq 1VQ4Q 3CEYA 2OTJT 2O9VA 1B34B 1BIBA 3Q1JA 1M1GA 1TTHB 3ER0A 3VV0A 3ZFJA 2JTEA 1JEGA 2WACA 4LDYA 3QZ5B 2EJFA 3OMCA 2MOXA 2E3HA 1RAIB 5FU6B 3FJPA 4EIKA 1T3SA 1FMWA 1FWZA 3X28B 1Q82U 4HKEA 3A8HB 3JAME 1QVFS 1KK7A 2OTLT 1KHIA 3A98A 3QYHB 3CC4Q 4QT7A 1VQ7T 1NEGA 3J7AF 2VXEA 3PVLA 2O2OA 3VS4A 2O01E 1VQPA 2IIMA 2VASA 4AT1B 1A0NB 5A2QE 4EMGA 4BI3A 1KQ2A 1WJQA 1N8RR 3R6OA 1N8RU 2RQVA 3I56Q 3HFNA 3LLRA 4QQGA 4C8QB 2F69A 4CRIA 2QAZA 5DLQE 1M90R 5LJ5j 4LD9K 1TUDA 1QW1A 1M1KU 2RI3A 3ME9A 1R77A 5M9OA 3VS5A 8AT1B 3S3MA 1YNZA 2ZPEB 2DLPA 4LD6A 4OMFB 1BB9A 1NZ9A 1ZX6A 1MMNA 4KULA 3UA7A 5GMKj 4E7JA 2YUOA 1S72T 2DE0X 2XG8D 5GAMg 3MCAB 1VQMA 4F7UE 5GAN8 2FYKA 4L6V5 3SHWA 2RHIA 1FYNA 1PKSA 3I9QA 3C4SA 4PK4A 2JOYA 4J9CA 1VQOA 1IHWA 5CCAA 1G3YA 3L2ZA 3CXCA 5GAN3 2L89A 2I2LA 4F7UF 3MEWA 1C6VX 2MCNA 1N6AA 5GANd 2RJDA 1UGPB 4ME7A 2YLCA 1TXQA 4BDYA 1UGQB 3CCUA 5A0LA 3M59A 1X2KA 4C0ZA 4GLKA 4X9DA 1PNJA 3NGPA 1HYOA 4KRTA 4DBFA 3M53A 3M0QA 1JBMA 1BK2A 3BE3A 3CBOA 4MZMA 4HCBA 3VJPA 1GCPA 2CSIA 2BZXA 3CC4A 3I56T 3HRSA 2J06A 2EYQA 3G4SQ 1UGRB 1NBEB 3IQLA 3TCJA 2COZA 4OB1B 2KRMA 3CMET 1IHVA 2E64A 1AD5A 3KFVA 1D3BB 4M7AB 1YHQT 1C0MA 2LC4A 4PFZA 2KROA 3L2VA 2E10A 3CC7Q 1EIFA 4A4KA 1M1FA 3H6ZA 3HRTA 1U8RA 1Q86C 2KEAA 4N4HA 4M7AA 2GTOA 3EGUA 1KQSP 2EYXA 2RB6A 4Z89A 4PJOC 3V8JA 2CP2A 2IPOB 3CCUQ 2FRWA 2HQXA 1MUZA 3GLXA 1HJDA 1YJWQ 4ZGDB 1V29B 5KYNA 2DA9A 2MMPA 4AG2C 5GAMj 1XOVA 4MDXA 2E1HA 3S6WA 1BKBA 5I22A 3JV3A 4M78F 4MMLA 1WQ7A 3OYYA 1WX6A 2RJEA 2LT1A 3H0HA 1N27A
chains in the Genus database with same CATH topology
4R0KA 1OPKA 3TVTA 2D0NA 2SRCA 2BZYA 4JPBW 3M0UA 4HCKA 2BZ8A 2C0OA 3REAB 1PHTA 4JZ4A 2DVJA 4RTYA 1ZSGA 1CKAA 1ZUYA 3PVQA 2ED0A 2X3XD 1GBRA 4LUDA 1NG2A 4RTUA 2KT1A 3RBBB 2CT4A 1U3OA 1KIKA 1WYXA 2LJ1A 3VS6A 5L23A 2KYBA 4J9DA 5IXBA 5I11A 1YP5A 2YSQA 2KYMA 2YUQA 1U06A 1LCKA 2LX7A 2EVRA 1M3BA 1ARKA 4JZ3A 2E5KA 1HD3A 2K3BA 2KR3A 4IIOA 3U23A 4OMNA 2FPFA 2I0NA 1AOJA 1GFCA 3EHQA 2JMAA 2AZVA 3VS0A 1WXTA 3NHNA 4J9GA 4A63B 3EG2A 4OMMA 2DBKA 3FJ5A 2J7IA 2W10A 1M30A 1SHGA 1JO8A 1PKTA 1B3QA 2DX1A 2VWFA 3H41A 2KGTA 1JQQA 1OPLA 1X43A 4J9BA 1T3LA 2LZ6B 2PNIA 1M8MA 1UHFA 4HVWA 3O5ZA 4K11A 1UG1A 2DL3A 1H8KA 1E6HA 1RI9A 1SHFA 2FEIA 1CSKA 2L3PA 1QWEA 4F17A 1VYVA 1G83A 4LUEA 2RNAA 2X3WD 1X6BA 3EHRA 3VS2A 2K7AA 2L0AA 4DEYA 2AK5A 2G6FX 1SSHA 1UTIA 2D8HA 2QDLA 2EW3A 5HCKA 2M51A 3EG3A 1GL5A 5GJVB 1UJYA 1X6GA 2NWMA 5IH2A 1RLQC 3LH5A 1Y0MA 3ZL7C 4OMQA 2W0ZA 4GBQA 1AVZC 2AZSA 3VRYA 3H0FA 3VS3A 4AFQC 1TG0A 1T0HA 1WA7A 1Z9ZA 2JT4A 5IHIA 1AEYA 2CSQA 4RTVA 2C0IA 1YCSB 2FG0A 1WDXA 2JM9A 3CQTA 4AFZC 1SRLA 4J9FA 4OMOA 1IO6A 1K0SA 4RTZA 2GBQA 2EGAA 1ZBJA 1AWOA 1GFDA 2L3SA 1QWFA 3M0PA 4RTXA 3I5SA 1H92A 2FO0A 1MV3A 2CH4W 4LN2A 1UECA 1VA7A 2RQTA 1AWJA 1M3CA 2AKLA 5FWCA 1PWTA 1ZUUA 3NPFA 5IHKA 5FWBA 2EYWA 1E6GA 1EFNA 1RUWA 1V1CA 2CUBA 2VKNA 3EG1A 1NEBA 3ULRB 2M0YA 2GTJA 2P4RA 3SEMA 2H8HA 2JW4A 3THKA 2CH4A 2RPNA 3UATA 1KFZA 1FMKA 1NM7A 4AFSC 1YWPA 3M0SA 1H3HA 2V1RA 5FW9A 4HXJA 2ENMA 1AZGB 1WXBA 1GCQA 3TSZA 2KNBB 1X2QA 1K1ZA 2RQUA 1G2BA 4DEXA 2GNCA 2C0TA 1X27A 1QLYA 2EGCA 2LQNA 2FPEA 2LQWA 1T0JA 1VYUA 2JXBA 1MV0B 2D1XA 4Z88A 2RN8A 1AWXA 1JXOA 2DILA 2V1QA 2DL4A 2ED1A 2O31A 4RUGA 2F2WA 2DL7A 2J6KA 4CC4B 3VRZA 1JU5C 2O9VA 2CUDA 4J9EA 4OMLA 2JTEA 2LJ3A 1VYTA 4OMPA 1JEGA 2YT6A 2MOXA 4CC7A 4EIKA 2A37A 1T3SA 1K76A 2PTKA 1CKBA 2KRSA 1QKWA 2L2PA 2EQIA 3A98A 1Z9QA 4QT7A 1OOTA 1NEGA 1TUCA 1WIEA 3I35A 3PVLA 2O2OA 2RF0A 3VS4A 2IIMA 2O88A 1KJWA 2ESWA 1A0NB 1OEBA 2O9SA 2A08A 5EC7A 1UJ0A 2KT8A 2FRYA 2RMOA 3M0TA 2RQVA 1X69A 2DL5A 1K0XA 2EPDA 1Y57A 2LCSA 2D8JA 1SRMA 2CREA 2DRKA 2XMFA 3PE0A 4ZNXA 4GLMA 2B86A 2DNUA 1SEMA 3NMZC 2YDLA 2RQRA 2CDTA 1TUDA 2HSPA 4E6RA 2DJQA 4JJDA 1HSQA 3VS5A 1YNZA 1WXUA 1GBQA 2DYBA 2DLPA 1BB9A 1ZX6A 1WLPB 4F16A 2EGEA 3UA7A 2J6OA 2YUOA 2KRNA 4CC3A 2DE0X 3RNJA 1UDLA 1UHCA 2AKKA 1AZEA 1NLPC 1S1NA 2DL8A 2KBTA 4Z8AA 2A36A 1WFWA 2DF6A 1NLOC 3SHWA 3VS7A 2OAWA 2J6FA 1E7OA 2LJ0A 1FYNA 1PKSA 3I9QA 2JS0A 2LP5A 2RQWA 2HBWA 1K9AA 4J9CA 4JJCA 3QWYA 2BTTA 2LMJA 3UA6A 1RLPC 2EKHA 3M0RA 2KE9A 1JXMA 3C0CA 1KSWA 4RTTA 1SPKA 4D8DA 1U5SA 1BBZA 2HCKA 2HDAA 2MCNA 2ROTA 3UF4A 1ABQA 2OI3A 2EYZA 1UUEA 2DMOA 2ABLA 2F2VA 3H0IA 1ZUKA 2J05A 2L3QA 2K6DA 1X2KA 1I0CA 1PNJA 3NGPA 2OJ2A 4KRTA 1ABOA 1W1FA 4JJBA 1AWWA 3M0QA 2EBPA 1M3AA 4HVVA 3EG0A 1BK2A 4LE9A 3TSWA 1B07A 4AG1C 4IIMA 1BU1A 1GCPA 2CSIA 5GJWB 2BZXA 2VVKA 2J06A 1NYFA 1I07A 2CT3A 2HEQA 3GBQA 3IQLA 5IXFA 1N5ZA 1QCFA 2KRMA 1W6XA 4J9IA 1J3TA 1UGVA 2KXCA 1NYGA 2DBMA 4X1VA 2PZ1A 4AFUC 4HVUA 1AD5A 3KFVA 2LNHB 2EYYA 2NUZA 2F2XA 4M4ZA 5IHNA 1WI7A 2YUPA 1OV3A 1M27C 3VS1A 2K9GA 2ECZA 2KROA 4J9HA 3R6NA 4RTWA 4WCIA 3QWXX 3REBB 2ROLA 1YWOA 4ORZA 1K4US 4CC2A 1GRIA 2KEAA 2GTOA 2SEMA 1UE9A 2GGRA 4LNPA 4F14A 3EGUA 2EYXA 4Z89A 2JMCA 2FRWA 1MUZA 2DRMA 2GQIA 2YUNA 4ESRA 2JM8A 1PRMC 1GCQC 1I1JA 1HJDA 2DM1A 2DA9A 1YN8A 4AG2C 1XOVA 1PRLC 2JS2A 3I5RA 5I22A 1QKXA 3JV3A 4Y92A 2K2MA 2K79A 2MIOA 1W70A 2FPDA 1UFFA 4FSSA 2A28A 5ECAA 4D8KA 1WX6A 1ZLMA 3H0HA 2KXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0K A;  1OPK A;  3TVT A;  2D0N A;  2SRC A;  2BZY A;  4JPB W;  3M0U A;  4HCK A;  2BZ8 A;  2C0O A;  3REA B;  1PHT A;  4JZ4 A;  2DVJ A;  4RTY A;  1ZSG A;  1CKA A;  1ZUY A;  3PVQ A;  2ED0 A;  2X3X D;  1GBR A;  4LUD A;  1NG2 A;  4RTU A;  2KT1 A;  3RBB B;  2CT4 A;  1U3O A;  1KIK A;  1WYX A;  2LJ1 A;  3VS6 A;  5L23 A;  2KYB A;  4J9D A;  5IXB A;  5I11 A;  1YP5 A;  2YSQ A;  2KYM A;  2YUQ A;  1U06 A;  1LCK A;  2LX7 A;  2EVR A;  1M3B A;  1ARK A;  4JZ3 A;  2E5K A;  1HD3 A;  2K3B A;  2KR3 A;  4IIO A;  3U23 A;  4OMN A;  2FPF A;  2I0N A;  1AOJ A;  1GFC A;  3EHQ A;  2JMA A;  2AZV A;  3VS0 A;  1WXT A;  3NHN A;  4J9G A;  4A63 B;  3EG2 A;  4OMM A;  2DBK A;  3FJ5 A;  2J7I A;  2W10 A;  1M30 A;  1SHG A;  1JO8 A;  1PKT A;  1B3Q A;  2DX1 A;  2VWF A;  3H41 A;  2KGT A;  1JQQ A;  1OPL A;  1X43 A;  4J9B A;  1T3L A;  2LZ6 B;  2PNI A;  1M8M A;  1UHF A;  4HVW A;  3O5Z A;  4K11 A;  1UG1 A;  2DL3 A;  1H8K A;  1E6H A;  1RI9 A;  1SHF A;  2FEI A;  1CSK A;  2L3P A;  1QWE A;  4F17 A;  1VYV A;  1G83 A;  4LUE A;  2RNA A;  2X3W D;  1X6B A;  3EHR A;  3VS2 A;  2K7A A;  2L0A A;  4DEY A;  2AK5 A;  2G6F X;  1SSH A;  1UTI A;  2D8H A;  2QDL A;  2EW3 A;  5HCK A;  2M51 A;  3EG3 A;  1GL5 A;  5GJV B;  1UJY A;  1X6G A;  2NWM A;  5IH2 A;  1RLQ C;  3LH5 A;  1Y0M A;  3ZL7 C;  4OMQ A;  2W0Z A;  4GBQ A;  1AVZ C;  2AZS A;  3VRY A;  3H0F A;  3VS3 A;  4AFQ C;  1TG0 A;  1T0H A;  1WA7 A;  1Z9Z A;  2JT4 A;  5IHI A;  1AEY A;  2CSQ A;  4RTV A;  2C0I A;  1YCS B;  2FG0 A;  1WDX A;  2JM9 A;  3CQT A;  4AFZ C;  1SRL A;  4J9F A;  4OMO A;  1IO6 A;  1K0S A;  4RTZ A;  2GBQ A;  2EGA A;  1ZBJ A;  1AWO A;  1GFD A;  2L3S A;  1QWF A;  3M0P A;  4RTX A;  3I5S A;  1H92 A;  2FO0 A;  1MV3 A;  2CH4 W;  4LN2 A;  1UEC A;  1VA7 A;  2RQT A;  1AWJ A;  1M3C A;  2AKL A;  5FWC A;  1PWT A;  1ZUU A;  3NPF A;  5IHK A;  5FWB A;  2EYW A;  1E6G A;  1EFN A;  1RUW A;  1V1C A;  2CUB A;  2VKN A;  3EG1 A;  1NEB A;  3ULR B;  2M0Y A;  2GTJ A;  2P4R A;  3SEM A;  2H8H A;  2JW4 A;  3THK A;  2CH4 A;  2RPN A;  3UAT A;  1KFZ A;  1FMK A;  1NM7 A;  4AFS C;  1YWP A;  3M0S A;  1H3H A;  2V1R A;  5FW9 A;  4HXJ A;  2ENM A;  1AZG B;  1WXB A;  1GCQ A;  3TSZ A;  2KNB B;  1X2Q A;  1K1Z A;  2RQU A;  1G2B A;  4DEX A;  2GNC A;  2C0T A;  1X27 A;  1QLY A;  2EGC A;  2LQN A;  2FPE A;  2LQW A;  1T0J A;  1VYU A;  2JXB A;  1MV0 B;  2D1X A;  4Z88 A;  2RN8 A;  1AWX A;  1JXO A;  2DIL A;  2V1Q A;  2DL4 A;  2ED1 A;  2O31 A;  4RUG A;  2F2W A;  2DL7 A;  2J6K A;  4CC4 B;  3VRZ A;  1JU5 C;  2O9V A;  2CUD A;  4J9E A;  4OML A;  2JTE A;  2LJ3 A;  1VYT A;  4OMP A;  1JEG A;  2YT6 A;  2MOX A;  4CC7 A;  4EIK A;  2A37 A;  1T3S A;  1K76 A;  2PTK A;  1CKB A;  2KRS A;  1QKW A;  2L2P A;  2EQI A;  3A98 A;  1Z9Q A;  4QT7 A;  1OOT A;  1NEG A;  1TUC A;  1WIE A;  3I35 A;  3PVL A;  2O2O A;  2RF0 A;  3VS4 A;  2IIM A;  2O88 A;  1KJW A;  2ESW A;  1A0N B;  1OEB A;  2O9S A;  2A08 A;  5EC7 A;  1UJ0 A;  2KT8 A;  2FRY A;  2RMO A;  3M0T A;  2RQV A;  1X69 A;  2DL5 A;  1K0X A;  2EPD A;  1Y57 A;  2LCS A;  2D8J A;  1SRM A;  2CRE A;  2DRK A;  2XMF A;  3PE0 A;  4ZNX A;  4GLM A;  2B86 A;  2DNU A;  1SEM A;  3NMZ C;  2YDL A;  2RQR A;  2CDT A;  1TUD A;  2HSP A;  4E6R A;  2DJQ A;  4JJD A;  1HSQ A;  3VS5 A;  1YNZ A;  1WXU A;  1GBQ A;  2DYB A;  2DLP A;  1BB9 A;  1ZX6 A;  1WLP B;  4F16 A;  2EGE A;  3UA7 A;  2J6O A;  2YUO A;  2KRN A;  4CC3 A;  2DE0 X;  3RNJ A;  1UDL A;  1UHC A;  2AKK A;  1AZE A;  1NLP C;  1S1N A;  2DL8 A;  2KBT A;  4Z8A A;  2A36 A;  1WFW A;  2DF6 A;  1NLO C;  3SHW A;  3VS7 A;  2OAW A;  2J6F A;  1E7O A;  2LJ0 A;  1FYN A;  1PKS A;  3I9Q A;  2JS0 A;  2LP5 A;  2RQW A;  2HBW A;  1K9A A;  4J9C A;  4JJC A;  3QWY A;  2BTT A;  2LMJ A;  3UA6 A;  1RLP C;  2EKH A;  3M0R A;  2KE9 A;  1JXM A;  3C0C A;  1KSW A;  4RTT A;  1SPK A;  4D8D A;  1U5S A;  1BBZ A;  2HCK A;  2HDA A;  2MCN A;  2ROT A;  3UF4 A;  1ABQ A;  2OI3 A;  2EYZ A;  1UUE A;  2DMO A;  2ABL A;  2F2V A;  3H0I A;  1ZUK A;  2J05 A;  2L3Q A;  2K6D A;  1X2K A;  1I0C A;  1PNJ A;  3NGP A;  2OJ2 A;  4KRT A;  1ABO A;  1W1F A;  4JJB A;  1AWW A;  3M0Q A;  2EBP A;  1M3A A;  4HVV A;  3EG0 A;  1BK2 A;  4LE9 A;  3TSW A;  1B07 A;  4AG1 C;  4IIM A;  1BU1 A;  1GCP A;  2CSI A;  5GJW B;  2BZX A;  2VVK A;  2J06 A;  1NYF A;  1I07 A;  2CT3 A;  2HEQ A;  3GBQ A;  3IQL A;  5IXF A;  1N5Z A;  1QCF A;  2KRM A;  1W6X A;  4J9I A;  1J3T A;  1UGV A;  2KXC A;  1NYG A;  2DBM A;  4X1V A;  2PZ1 A;  4AFU C;  4HVU A;  1AD5 A;  3KFV A;  2LNH B;  2EYY A;  2NUZ A;  2F2X A;  4M4Z A;  5IHN A;  1WI7 A;  2YUP A;  1OV3 A;  1M27 C;  3VS1 A;  2K9G A;  2ECZ A;  2KRO A;  4J9H A;  3R6N A;  4RTW A;  4WCI A;  3QWX X;  3REB B;  2ROL A;  1YWO A;  4ORZ A;  1K4U S;  4CC2 A;  1GRI A;  2KEA A;  2GTO A;  2SEM A;  1UE9 A;  2GGR A;  4LNP A;  4F14 A;  3EGU A;  2EYX A;  4Z89 A;  2JMC A;  2FRW A;  1MUZ A;  2DRM A;  2GQI A;  2YUN A;  4ESR A;  2JM8 A;  1PRM C;  1GCQ C;  1I1J A;  1HJD A;  2DM1 A;  2DA9 A;  1YN8 A;  4AG2 C;  1XOV A;  1PRL C;  2JS2 A;  3I5R A;  5I22 A;  1QKX A;  3JV3 A;  4Y92 A;  2K2M A;  2K79 A;  2MIO A;  1W70 A;  2FPD A;  1UFF A;  4FSS A;  2A28 A;  5ECA A;  4D8K A;  1WX6 A;  1ZLM A;  3H0H A;  2KXD A; 
#chains in the Genus database with same CATH topology
 3EGD B;  1M1K R;  2XDD A;  5LJ5 d;  1VQ8 A;  2COW A;  2FB7 A;  2DVJ A;  4JZ4 A;  3OS0 A;  3JCM P;  3OYN A;  3PVQ A;  2PU9 B;  1GBR A;  5GAN 2;  3OSS C;  1VQ5 T;  2KT1 A;  4M7D F;  2F1L A;  3RBB B;  3RMQ A;  3VS6 A;  5L23 A;  3G6E Q;  2YSQ A;  5I2S A;  3E19 A;  1M3B A;  2EQM A;  2HAX A;  4OGE A;  1VQO Q;  1VQK T;  3A1P A;  1UGS B;  4IIO A;  2ATC B;  3PNW C;  1VQ9 T;  2F5T X;  1QVF A;  2JMA A;  2AZV A;  4M75 A;  2L8D A;  5GAN j;  3RDV A;  2ZPB B;  3X24 B;  4J9G A;  4OMM A;  3FJ5 A;  2R57 A;  3X20 B;  2W10 A;  4KUD K;  4ELY C;  2RK2 A;  1WHG A;  1JO8 A;  5FRN A;  1U1S A;  1WPY A;  2VWF A;  2PVO B;  3DKM A;  3H41 A;  2KGT A;  4M77 C;  1JQQ A;  1OPL A;  1TS9 A;  1T3L A;  5J3B A;  2HL3 A;  3PFS A;  1UHF A;  3CCL A;  2K3X A;  3MJX A;  1G3T A;  2DFU A;  1CSK A;  1M2V B;  1KHC A;  2CZ6 B;  4B6M A;  1MMD A;  2M1H A;  2HQH A;  4LUE A;  2RNA A;  4B9X A;  2PVD B;  2EW3 A;  1ZSZ C;  2M51 A;  2VC8 A;  5HCK A;  1KC8 U;  4KT0 E;  4PL6 A;  4BI4 A;  3LH5 A;  5FLX E;  1RI0 A;  1FXX A;  4LDU A;  4MMK A;  5KYY B;  4GBQ A;  3ZBD A;  2A0F B;  3WVE B;  1M90 U;  5D6W A;  2HKQ B;  2XI9 A;  2JT4 A;  3CCR Q;  1XNI A;  2WSE E;  4M78 D;  2C0I A;  3QHS A;  3MET A;  1WDX A;  1YJW A;  2JM9 A;  4B9W A;  4OMO A;  3PIO A;  4RTZ A;  4HT8 A;  1B7T A;  2GBQ A;  4NL2 A;  3G6E T;  4MZP A;  1Q86 R;  2CP0 A;  3CPF A;  2L3S A;  1I5O B;  2BIV A;  4RTX A;  5AT1 B;  2NUT A;  5KCO A;  3I5S A;  3QJ6 A;  1UEC A;  4C5G A;  5IHK A;  2Y90 A;  2EYW A;  1E6G A;  3GOX A;  3P8H A;  3L2Q A;  5GMK i;  3QII A;  1M2O A;  4DBQ A;  2JW4 A;  4N0A C;  5KYU A;  3UAT A;  4F7U A;  1D0Z A;  1D1C A;  5C0M A;  4HXJ A;  2ENM A;  4Q5W A;  1IRX A;  4C8Q G;  2E65 A;  2KNB B;  2VXF A;  4KBM B;  4QVC A;  2C0T A;  3BY7 A;  1X27 A;  4TVR A;  2HNI A;  4C92 D;  3PMT A;  1T0J A;  2LNV A;  4FW2 A;  2JXB A;  2D1X A;  3CCU T;  4Z88 A;  2V1Q A;  3JCM W;  1Y07 A;  2DL4 A;  2ED1 A;  2OTL A;  2DEQ A;  2V8J A;  2O31 A;  3LH0 A;  1YFN A;  3E9G A;  2CUD A;  1BI0 A;  5D7U A;  2QA4 A;  4M7D E;  2LJ3 A;  4E7H A;  1VYT A;  4OMP A;  2QQA A;  4ZTF A;  2DER A;  2MF2 A;  1QVF P;  2A3L A;  2K5F A;  3JB9 H;  3A5Z B;  1YJN T;  3I56 A;  3V8L A;  4WF2 A;  4PJO G;  2KRS A;  2QQS A;  1VQ9 Q;  1Y96 A;  1TUC A;  1K73 R;  2E5Q A;  2H3E B;  5I21 A;  1K73 U;  2RF0 A;  2E6Z A;  1FX7 A;  2O88 A;  2ESW A;  2O9S A;  3G4S T;  5LJ5 h;  1VQ6 Q;  5EC7 A;  4NS5 A;  2P0K A;  1UJ0 A;  4EMK A;  2G3R A;  5GAN g;  3CCV T;  1X69 A;  2DJZ A;  2DL5 A;  2EQK A;  1TU0 B;  3CCS T;  3X25 B;  5A0D A;  2P84 A;  4E7L A;  4N0A A;  3PE0 A;  1K8A C;  2V8I A;  2PUO B;  3OYL A;  5LL6 S;  4GLM A;  3VUB A;  2DNU A;  1Y71 A;  3RR6 A;  5GAN f;  2YDL A;  2RQR A;  2Z0W A;  3J81 E;  2E70 A;  3OMG A;  4E6R A;  2DJQ A;  4JJD A;  3I55 A;  1RAC B;  3KXT A;  1HSQ A;  3HHT B;  3P8B B;  4M7D B;  1GBQ A;  1X75 C;  4QVD A;  4F16 A;  2EGE A;  2EJG A;  4J7F A;  2KRN A;  2CS7 A;  3G1J A;  2QTV A;  1KG1 A;  3CCS A;  1UDL A;  1AZE A;  3L2U A;  3CCR T;  1C1A A;  2A36 A;  1WFW A;  2AIR B;  5LJ3 d;  1NLO C;  4KUI A;  3OS2 A;  5A0G A;  4JRK A;  2JS0 A;  2LP5 A;  2GCX A;  2HBW A;  1K9A A;  4JJC A;  4F04 B;  3QWY A;  5AYF A;  4NOY A;  4BDZ A;  1QP2 A;  5GAN 7;  2V26 A;  1YCY A;  3OBW A;  3M0R A;  4D6W A;  1HXD A;  3RKW A;  2QTX A;  3CCM Q;  1JXM A;  3C0C A;  2IG0 A;  4C92 F;  1SPK A;  4D8D A;  4XTY A;  1N9R A;  1BBZ A;  2JUF A;  5LJ5 e;  3UF4 A;  4JS4 A;  1ABQ A;  3HTR A;  2XID A;  1VQ5 A;  1SKU B;  2ABL A;  2F2V A;  3H0I A;  2J05 A;  4HT9 A;  4M7A C;  4R55 A;  2QEX T;  1PSF A;  2ZPG B;  3HPW A;  1D1A A;  5KYU B;  2EBP A;  3QUI A;  2YXY A;  1LOJ A;  3OBY A;  5DM7 R;  3EG0 A;  4JRQ A;  4LE9 A;  2OX7 A;  3E1S A;  1K8A R;  4RMO A;  1YI2 A;  3RES A;  2M16 A;  3DB3 A;  1PD1 A;  4E47 A;  1VQ9 A;  2VVK A;  1YJN A;  1VQN A;  1NYF A;  5DY9 A;  1I07 A;  2CT3 A;  3PT9 A;  4M75 D;  3V7R A;  3GBQ A;  2LCC A;  1W6X A;  3J80 E;  3HL8 A;  1NYG A;  4V2S A;  5GAN e;  2DXB A;  2PZ1 A;  2DZ9 A;  5I2M A;  2ZPI B;  1ZHI A;  3N5B B;  2DAQ A;  4M4Z A;  5IHN A;  3RUX A;  3JSC A;  1M27 C;  1RAH B;  3QDF A;  4HCZ A;  1BI2 A;  2ECZ A;  4J9H A;  3R6N A;  1Q81 C;  4WCI A;  3V7S A;  3JCM g;  4OP0 A;  5KYY A;  1KD1 R;  2ROL A;  1YWO A;  2LQ8 A;  2YRV A;  4ORZ A;  2OTJ Q;  1MHN A;  4M7D D;  2SEM A;  3QKJ A;  1UE9 A;  2LRQ A;  3OYJ A;  4EPC A;  2HSE B;  1KC8 C;  3QG1 A;  2DRM A;  2YUN A;  2GQI A;  4ZGJ B;  2DM1 A;  3CC2 Q;  4J5Y A;  4BI8 B;  3I5R A;  3LYI A;  3F70 A;  2RO0 A;  3VUZ A;  1EZZ B;  5CIU A;  4XTV A;  2FPD A;  5ECA A;  2PUK B;  4PJO E;  2XIC A;  3CCQ T;  2KXD A;  2BZY A;  5LJ5 g;  5GMK l;  3SFM A;  4E7S A;  3OYE A;  2C0O A;  8ATC B;  3EFO B;  2MWP A;  3JCM J;  2D9T A;  3CCS Q;  1X01 A;  4J6Y A;  5GAN 6;  1CKA A;  1ZUY A;  4LUD A;  4EMK C;  4FYV B;  4RTU A;  4FIB A;  1MMA A;  3CMA Q;  3H9N A;  2LJ1 A;  3INZ A;  4M77 G;  2CZ0 B;  3QDR B;  2LDM A;  2DO3 A;  3JRZ A;  1SF9 A;  5LJ3 j;  2E12 A;  5IN1 A;  5I11 A;  1XTD A;  2QXF A;  2FVU A;  3CCE T;  2QQ9 A;  3L1A A;  3GP8 A;  2LX7 A;  1M5Q 1;  2YRC A;  4JZ3 A;  4C92 G;  4OGC A;  1LJO A;  4FYY B;  2X51 A;  2A7Y A;  2RHZ A;  2I0N A;  3CC4 T;  1MGQ A;  1AOJ A;  4PJL A;  2ZCF B;  1WXT A;  1BIA A;  4BY6 C;  1YIJ T;  2HMA A;  1KD1 C;  3EG2 A;  2DBK A;  1H3Z A;  1WZO A;  2OTL Q;  1R8O B;  3GF5 A;  5L8R E;  1M30 A;  4F7U B;  1W2B P;  1SHG A;  1B3Q A;  3JCM e;  1U1T A;  2K5I A;  4FYW B;  3FDR A;  1PM3 A;  1O75 A;  4HVW A;  3O5Z A;  2MPX C;  1UG1 A;  2DL3 A;  1H8K A;  4IUR A;  2X35 A;  2R5A A;  2KMT A;  1X6B A;  3EHR A;  3VS2 A;  2K7A A;  4DEY A;  2G6F X;  2Y4X A;  2D8H A;  4LDV A;  1OX9 A;  5GAN 5;  3EG3 A;  5GJV B;  1UJY A;  1ZA1 B;  2NWM A;  4DA4 A;  3CC2 A;  3PIP A;  3G71 Q;  1Q86 U;  5HK0 A;  4IUQ A;  4Z02 A;  4OB0 B;  4M78 G;  1Y96 B;  3JB9 D;  3OW2 P;  4OMQ A;  2MAM A;  4X9C A;  2LX9 A;  3VRY A;  1YBY A;  1TG0 A;  3OB9 A;  1PCX A;  3JCM V;  3E9F A;  2Y4Y A;  4JRP A;  5IT9 E;  2FG0 A;  3OYG A;  3CQT A;  4AFZ C;  1WQW A;  1ZSZ A;  3CCJ A;  2EGA A;  4M75 F;  1W2B A;  5KYX B;  1AWO A;  1JRI A;  1GFD A;  4BUG A;  3HRU A;  4M7D G;  1QWF A;  4XQ3 A;  4II1 A;  3PTA A;  2FO0 A;  3JCM h;  4R56 A;  1VQL T;  2RQT A;  5KYW B;  3H8Z A;  4IUP A;  5FWC A;  5IAY A;  2L5Q A;  3EG1 A;  1RUW A;  2QDY B;  3PMI A;  2CGH A;  3RKX A;  1R0B G;  3OYC A;  1YJW T;  2P4R A;  2EIF A;  2AT1 B;  4M77 A;  3CBM A;  3RER A;  3THK A;  2CH4 A;  4BB7 A;  2RPN A;  4M7D A;  3EG9 B;  4JRI A;  2DPP B;  4NL3 A;  1SSF A;  2E3I A;  1WXB A;  1AZG B;  3TSZ A;  1VQL A;  2QA4 T;  2RI5 A;  4ZTJ A;  4KGZ B;  2XHC A;  1K1Z A;  3M57 A;  2D6F A;  4UC4 A;  1PG5 B;  5GAO m;  2CP3 A;  2GNC A;  4M77 F;  4XTX A;  3LWH A;  2GQV A;  2FPE A;  3JCM b;  2VUB A;  2RN8 A;  1AWX A;  5GAN 4;  2EJ9 A;  2QQR A;  3URG A;  2QEX A;  3OYM A;  2DL7 A;  4CC4 B;  2GFU A;  3DLL A;  4J9E A;  1KC8 R;  1OYX A;  4XU0 A;  5CO7 A;  2YT6 A;  5GAO p;  3JCM Q;  1IGQ A;  1WGS A;  2ZAE A;  3EH2 A;  4C8Q C;  2JTM A;  1WNL A;  1LVK A;  4FT2 A;  1D09 B;  3MEA A;  2CZ1 B;  4CC7 A;  4YTL A;  2K57 A;  3CCL Q;  2RK1 A;  1K76 A;  2PTK A;  1CKB A;  2ZPF B;  2R58 A;  1QKW A;  2BE7 D;  1YJ9 A;  2D0Q B;  2M02 A;  3SWN A;  1Z9Q A;  5CKF A;  1WIE A;  3EGD A;  3FIF A;  1KQ1 A;  1KD1 U;  4PLL A;  1G3S A;  2DK3 A;  3JB9 F;  2FL7 A;  3QSU A;  4J7I A;  1MND A;  1QP3 A;  3BDU A;  2FRY A;  5D6Y A;  1GXI E;  3M0T A;  1K0X A;  1S72 A;  5KYW A;  1Y57 A;  1WJR A;  3C12 A;  1SRM A;  2CRE A;  2DRK A;  1F1B B;  1DJ7 B;  2MK5 A;  4ZNX A;  3OQ5 A;  4E7Z A;  7AT1 B;  3DB4 A;  1M9S A;  3WVD B;  2B86 A;  1IXD A;  5KYX A;  4C92 C;  5CAI A;  4KGV B;  3X26 B;  1G5V A;  4M78 B;  3CXC S;  3MHX A;  5GAN h;  2HQE A;  1MNE A;  5CK9 A;  4ELZ C;  2J6O A;  3RKY A;  4CI0 C;  1QQJ A;  2YWW A;  5EG2 A;  4CC3 A;  1UHC A;  2AKK A;  1NLP C;  1ZQ1 A;  2O4X A;  1S1N A;  3C94 A;  2K2V A;  4QQD A;  2DF6 A;  3WXM B;  2F5K A;  2KDS A;  2X9H A;  3MP8 A;  3CCQ A;  1VQN Q;  3M55 A;  3QBY A;  2BTT A;  4RG2 A;  3M4Y A;  1RLP C;  2EKH A;  4PJO A;  1Q82 R;  1V76 A;  3LX7 A;  3O8V A;  2KE9 A;  1KSW A;  3ASK A;  5FU6 C;  3CPW A;  1U5S A;  1YI2 T;  1LPL A;  3FC3 A;  3JCM d;  2DEU A;  4A4F A;  1UEB A;  2OI3 A;  1UUE A;  2ZPH B;  2VGN A;  3TEE A;  1VQN T;  1Q81 U;  2FZC B;  3CCE Q;  3MO8 A;  3KBG A;  3JB9 I;  4M78 C;  4M77 B;  2FZK B;  1I0C A;  4O6J A;  4PLI A;  2OJ2 A;  2OTJ A;  1VQO T;  5CKB A;  3CCJ Q;  1K9M C;  1XJW B;  1AWW A;  1OZ2 A;  4HVV A;  5KH6 A;  3OYD A;  5CKH A;  3TSW A;  4KH1 B;  1B07 A;  4PJO F;  4FL6 A;  4AG1 C;  3EH1 A;  1BU1 A;  2LTO A;  3L2R A;  3OYH A;  1H64 1;  3JCM f;  5IXF A;  4BE2 A;  1N5Z A;  3OS1 A;  1J3T A;  1UGV A;  3NTH A;  1I5L A;  1NE8 A;  4X1V A;  1VQP T;  4AFU C;  2K3Y A;  2CP7 A;  2LNH B;  4Y28 E;  4OB3 B;  2NUZ A;  3QZ9 B;  2EAY A;  3OS5 A;  5CQX A;  2RD1 A;  4JS5 A;  1WI7 A;  4BY6 B;  1PC0 A;  4JLI A;  5LJ3 h;  3QPH A;  1OV3 A;  2AHJ B;  3HFO A;  2K5L A;  3QWX X;  1NPP A;  1UB4 A;  3REB B;  3HSB A;  2GF7 A;  4CC2 A;  4FW1 A;  3G71 A;  1RAA B;  1G8X A;  4RG8 A;  4LNP A;  3A8O B;  5HKC A;  3I55 T;  4JUV A;  2JM8 A;  2M0O A;  4M75 G;  4JLG A;  1GCQ C;  1I1J A;  4DOV A;  3EFR A;  2JS2 A;  1VQ6 T;  1RAE B;  4VUB A;  4OVA A;  1QKX A;  2KK4 A;  1VIF A;  2K79 A;  2EFI A;  2A28 A;  4D8K A;  2K4Y A;  2QA4 Q;  2VB6 A;  3NFC A;  4R0K A;  1YIT T;  4ATO A;  2YHT A;  2DTO A;  3E2U A;  2B8A A;  2LCL A;  4HCK A;  1NJI R;  1PHT A;  2BKD N;  4RTY A;  1YIJ Q;  1KQS A;  2GFA A;  1VQK A;  1Q81 R;  2KSS A;  3CC7 T;  5GAM d;  1OUL A;  2X3X D;  1K8A U;  3M56 A;  5J39 A;  1NG2 A;  3A8G B;  3EGX A;  4LDX A;  2CKK A;  2CT4 A;  1U3O A;  4PKC C;  2EKO A;  1M1K C;  2OAU A;  1OQK A;  2KYB A;  5IXB A;  1YIT A;  4IKF A;  2KYM A;  4C0G A;  1BCO A;  4PNO A;  2P0Q A;  1JJ2 S;  1ZSZ B;  1TWB A;  1HD3 A;  3M5A A;  2KR3 A;  4N4G A;  2NUP A;  3RIR A;  3U23 A;  4OMN A;  2DIG A;  4ZGE B;  1GFC A;  4X34 A;  1NJI U;  3VS0 A;  3I55 Q;  3NHN A;  4M7A E;  3OYA A;  3CME A;  2J7I A;  3EGX B;  3CD6 A;  2LQK A;  2XDP A;  3NTK A;  2XDB A;  2JN0 A;  5KCH A;  3CC2 T;  3EFO A;  3CCQ Q;  1D0X A;  3VYG A;  4J9B A;  1I4K 1;  1Q7Y U;  2LZ6 B;  2X4X A;  1M8M A;  1WHM A;  3D7S B;  3UPU A;  1OU8 A;  2DYI A;  4RCC A;  1W4S A;  4C5I A;  1RI9 A;  2RHU A;  1RAF B;  1QWE A;  2L3P A;  3A8M B;  4DOW A;  1VYV A;  3MKD A;  1M8V A;  2L0A A;  1YIJ A;  1SSH A;  2VYT A;  4XU2 A;  1VQP Q;  1UTI A;  2QDL A;  3QXE B;  3G71 T;  1BI3 A;  1GL5 A;  3UT1 A;  2MI6 A;  5IH2 A;  4C8Q F;  3MPU B;  1RLQ C;  2RHX A;  3CCJ T;  3G6E A;  1Y0M A;  3ZL7 C;  4BD3 A;  3CCL T;  1D1B A;  1P92 A;  1AVZ C;  2AZS A;  3H0F A;  3VS3 A;  1ACM B;  1PD0 A;  1QVG S;  1S72 Q;  4A54 A;  3LGL A;  1WA7 A;  5IHI A;  1Q7Y R;  2CSQ A;  4JDS A;  1YCS B;  1K9M R;  2MYS A;  5GAO l;  4M7D C;  2JZ2 A;  3MP1 A;  3HKS A;  1RAG B;  3M58 A;  4OB2 B;  1ZBJ A;  1YI2 Q;  5FU7 B;  4RKU E;  4PJN A;  1D0Y A;  3SD4 A;  2QK0 A;  3L42 A;  5LJ3 g;  1JJ2 P;  2JJ9 A;  4KGX B;  1M4Z A;  2E41 A;  3CME Q;  1H92 A;  1KQS S;  1VA7 A;  2QEX Q;  1AWJ A;  1M3C A;  3CCM A;  2AKL A;  1SG5 A;  1PWT A;  1ZUU A;  5FWB A;  3VYH B;  2VKN A;  4FU6 A;  2CUB A;  4C8Q D;  4QVZ A;  2RJF A;  4E7I A;  1NEB A;  3BFM A;  3ULR B;  2M0Y A;  2GTJ A;  3CCR A;  1VQM T;  3SEM A;  3VU3 C;  3CMA T;  2H8H A;  3MP6 A;  9ATC B;  3EG9 A;  4C92 B;  2C06 A;  1KFZ A;  1FMK A;  1NM7 A;  1FMV A;  4XTW A;  1H3H A;  2V1R A;  4OF1 A;  4M75 E;  1K9M U;  4ANJ A;  2WSF E;  3OYB A;  1TOV A;  4C8Q E;  1G2B A;  1M90 C;  4DEX A;  1I8F A;  1QLY A;  2EGC A;  4BAC A;  2LQW A;  1VYU A;  5GAO r;  2HZY A;  2QAS A;  3CD6 T;  3QO3 A;  5CKD A;  2CZ7 B;  2PQW A;  4M7A D;  2DXC A;  1YJ9 T;  4F7U G;  4RUG A;  4QW2 A;  2RA2 A;  3CBP A;  1RL2 A;  4QQ6 A;  2CP6 A;  3JCM X;  4RCB A;  2F2W A;  4PJO B;  2J6K A;  3VRZ A;  1JU5 C;  3G4S A;  3CPW P;  3SWN B;  4OML A;  1QVG P;  4P5N A;  5GMK h;  3CD6 Q;  1W2B S;  1HK9 A;  2CYZ B;  3CCV A;  5KE3 A;  2DIQ A;  1EX4 A;  5LJ5 f;  2DXU A;  3T9N A;  2A37 A;  4A4G A;  4J6X A;  2DXT A;  2L2P A;  2IVW A;  2EQI A;  2FZG B;  3OY9 A;  4XU3 A;  4J83 A;  1OOT A;  3I35 A;  1TH7 A;  1KJW A;  4E2F B;  3QJY A;  1OEB A;  1Y7X A;  2A08 A;  5FRO A;  2JVV A;  5FRM A;  2XKO C;  1VOM A;  2KT8 A;  2RMO A;  1OX8 A;  1VQ8 Q;  2EPD A;  1JB0 E;  3OSV A;  4FCY A;  2LCS A;  1WHL A;  2D8J A;  3TU4 K;  1OI1 A;  4C8Q A;  3OW2 S;  2MWO A;  2XMF A;  1M2V A;  4ZN1 A;  1SEM A;  2X4Y A;  4C0F A;  3NMZ C;  2CDT A;  2HSP A;  4C5E A;  2WSC E;  4LXC A;  3OYI A;  3FRN A;  1WXU A;  2DYB A;  2ZZD A;  1WLP B;  2E6N A;  5HK3 A;  1VQ6 A;  3A8L B;  3RNJ A;  4M75 B;  1YHQ Q;  5J26 A;  2DL8 A;  2KBT A;  4Z8A A;  2DD4 A;  3V8K A;  3CMA A;  1B34 A;  1TUG B;  2HD0 A;  4KH0 B;  3VS7 A;  2OAW A;  2J6F A;  1E7O A;  2LJ0 A;  4AMC A;  3TRE A;  2RQW A;  5GMK e;  1OZ3 A;  3EAE A;  4IUU A;  1QVG A;  5CVI A;  2LMJ A;  2NYS A;  1VQK Q;  3UA6 A;  2RH2 A;  4QKU A;  4RTT A;  4C92 E;  2HCK A;  2HDA A;  3AHU A;  2ROT A;  2EQU A;  2EYZ A;  2DMO A;  4IUT A;  3JB9 G;  2DD5 A;  2EWN A;  1ZUK A;  4J6W A;  1WHK A;  3KUF A;  2L3Q A;  2K6D A;  1VIE A;  2PVG B;  3P8D A;  1ABO A;  1W1F A;  4JJB A;  4C92 A;  3JCM c;  4PJJ A;  1M3A A;  3GNG A;  2XD0 A;  2KQW A;  3SB2 A;  2P0P A;  4IIM A;  5GJW B;  4C5H A;  1MMG A;  2NUT B;  2FHD A;  5CKE A;  2HEQ A;  1QCF A;  4A53 A;  5CR2 A;  2LT4 A;  1BI1 A;  4J9I A;  2KXC A;  3M54 A;  2DBM A;  2RHY A;  4O5V A;  5HY6 A;  4HVU A;  1IGU A;  3NTI A;  2COY A;  5DLO A;  2EYY A;  4IUV A;  4XTZ A;  1ZA2 B;  1AT1 B;  2F2X A;  4M78 E;  3VKI A;  2YUP A;  1I81 A;  3VS1 A;  2K9G A;  4RTW A;  3AT1 B;  2BE9 B;  2NLU A;  3PGG A;  5LJ3 e;  3FLG A;  1K4U S;  3OW2 A;  1GRI A;  1QCN A;  1YJN Q;  4N4I A;  1VQM Q;  2GGR A;  4F14 A;  3RMS A;  1BYM A;  4M78 A;  5FU7 C;  2BUD A;  2JMC A;  4C0D B;  4ESR A;  4PJO D;  1PRM C;  5GAM f;  2DTH A;  2KAF A;  3BDL A;  3OYK A;  3FB9 A;  1YN8 A;  1YHQ A;  1YIT Q;  3GIB A;  1PSE A;  1PRL C;  1WHJ A;  1VQ7 Q;  3CC7 A;  1IZ6 A;  4XU1 A;  4Y92 A;  4EMK B;  1Q7Y C;  4EDU A;  2K2M A;  1RAD B;  2MIO A;  1W70 A;  4M7A F;  1UFF A;  4FSS A;  2YLB A;  1ZLM A;  1OPK A;  3TVT A;  2D0N A;  2SRC A;  4JPB W;  3L2W A;  3M0U A;  1WHH A;  1AHJ B;  2BZ8 A;  3REA B;  5D6X A;  2DVE A;  1TSF A;  2QQB A;  4DQ2 A;  2QGG A;  2QYZ A;  1LNX A;  1ZSG A;  3LGF A;  1XQH A;  4FYX B;  2ED0 A;  3TQ7 P;  4M75 C;  2VV5 A;  4EMH A;  2JNG A;  3CCM T;  1G3W A;  4M77 E;  1NJI C;  1KIK A;  1WYX A;  4XK8 E;  3G7Z A;  4HCC A;  2E4H A;  5LJ3 f;  1N8R C;  3LWI A;  4J9D A;  4XTU A;  1YP5 A;  2YUQ A;  1U06 A;  1IB8 A;  1LCK A;  2DZC A;  2EVR A;  3M4G A;  3GNF B;  4BE0 A;  1ARK A;  3GPL A;  1K73 C;  2E5K A;  1JJ2 A;  2K3B A;  4GY5 A;  4M77 D;  6AT1 B;  2FPF A;  3HP9 A;  4BE1 A;  2L3R A;  1IRE B;  3EHQ A;  2QGF B;  4A63 B;  1QVP A;  2CP5 A;  4DBR A;  1PKT A;  2DX1 A;  1Q82 C;  1X43 A;  2KVQ G;  2PNI A;  4A4E A;  4K11 A;  3MEV A;  1E6H A;  1Q95 G;  3CCV Q;  1SHF A;  2FEI A;  1QCO A;  4F17 A;  1G83 A;  1N9S A;  2DKG A;  3UWN A;  2X3W D;  3DLM A;  4PFO A;  3JB9 J;  1R0C B;  2DET A;  2AK5 A;  1ZBX A;  2P4T A;  3FEO A;  4FSX A;  1WJS A;  3CXC P;  2XU8 A;  2X4W A;  1X6G A;  5GAM h;  3C95 A;  2RI2 A;  5KE2 A;  2RJC A;  1VQ7 A;  3S3O A;  4LDW A;  4L5G A;  2W0Z A;  4E7K A;  3QYG B;  2QI2 A;  2V8K A;  4AFQ C;  2O4X B;  2XK0 A;  1T0H A;  3LW5 E;  1Z9Z A;  2YRD A;  1AEY A;  2KY9 A;  2ZGW A;  3OYF A;  1VQ4 A;  4J8O A;  4RTV A;  4PFP A;  2HKN A;  3EFS A;  1SRL A;  2NUP B;  4J9F A;  1IO6 A;  1K0S A;  4ZN3 A;  3S3N A;  3V7C A;  2HBP A;  1VQ8 T;  2HL5 C;  4MZT A;  1VQL Q;  3CPW S;  4WTO B;  3M0P A;  5GMK m;  3MEU A;  2EQJ A;  1MV3 A;  2CH4 W;  4LN2 A;  2LVM A;  2M9U A;  1OU9 A;  4M7A G;  3ZEH A;  2JTF A;  4L59 A;  3NPF A;  4FM4 B;  4FT4 A;  1NPR A;  4XAX B;  4A4H A;  1VQ4 T;  1EFN A;  1V1C A;  3CCE A;  4Y91 A;  4C0D C;  1VUB A;  2H3J A;  3UDC A;  2VGM A;  5CQY A;  3BW1 A;  4AFS C;  1YWP A;  3M0S A;  5FW9 A;  5GAM e;  2R5M A;  1VQ5 Q;  3SDZ A;  1X6O A;  3OA6 A;  1GCQ A;  1BCM A;  1X2Q A;  4PJM A;  5C6S A;  2RQU A;  5GAO n;  1RAB B;  4JJN K;  1D3B A;  2LQN A;  4DBH A;  2DTI A;  1YJ9 Q;  1QMC A;  1MV0 B;  3SWN C;  4HA8 A;  4MDW A;  1JXO A;  2RM4 A;  2DIL A;  2X4J A;  2KI7 A;  3M9Q A;  2QG9 B;  1O9S A;  5GAO q;  1VQ4 Q;  3CEY A;  2OTJ T;  2O9V A;  1B34 B;  1BIB A;  3Q1J A;  1M1G A;  1TTH B;  3ER0 A;  3VV0 A;  3ZFJ A;  2JTE A;  1JEG A;  2WAC A;  4LDY A;  3QZ5 B;  2EJF A;  3OMC A;  2MOX A;  2E3H A;  1RAI B;  5FU6 B;  3FJP A;  4EIK A;  1T3S A;  1FMW A;  1FWZ A;  3X28 B;  1Q82 U;  4HKE A;  3A8H B;  3JAM E;  1QVF S;  1KK7 A;  2OTL T;  1KHI A;  3A98 A;  3QYH B;  3CC4 Q;  4QT7 A;  1VQ7 T;  1NEG A;  3J7A F;  2VXE A;  3PVL A;  2O2O A;  3VS4 A;  2O01 E;  1VQP A;  2IIM A;  2VAS A;  4AT1 B;  1A0N B;  5A2Q E;  4EMG A;  4BI3 A;  1KQ2 A;  1WJQ A;  1N8R R;  3R6O A;  1N8R U;  2RQV A;  3I56 Q;  3HFN A;  3LLR A;  4QQG A;  4C8Q B;  2F69 A;  4CRI A;  2QAZ A;  5DLQ E;  1M90 R;  5LJ5 j;  4LD9 K;  1TUD A;  1QW1 A;  1M1K U;  2RI3 A;  3ME9 A;  1R77 A;  5M9O A;  3VS5 A;  8AT1 B;  3S3M A;  1YNZ A;  2ZPE B;  2DLP A;  4LD6 A;  4OMF B;  1BB9 A;  1NZ9 A;  1ZX6 A;  1MMN A;  4KUL A;  3UA7 A;  5GMK j;  4E7J A;  2YUO A;  1S72 T;  2DE0 X;  2XG8 D;  5GAM g;  3MCA B;  1VQM A;  4F7U E;  5GAN 8;  2FYK A;  4L6V 5;  3SHW A;  2RHI A;  1FYN A;  1PKS A;  3I9Q A;  3C4S A;  4PK4 A;  2JOY A;  4J9C A;  1VQO A;  1IHW A;  5CCA A;  1G3Y A;  3L2Z A;  3CXC A;  5GAN 3;  2L89 A;  2I2L A;  4F7U F;  3MEW A;  1C6V X;  2MCN A;  1N6A A;  5GAN d;  2RJD A;  1UGP B;  4ME7 A;  2YLC A;  1TXQ A;  4BDY A;  1UGQ B;  3CCU A;  5A0L A;  3M59 A;  1X2K A;  4C0Z A;  4GLK A;  4X9D A;  1PNJ A;  3NGP A;  1HYO A;  4KRT A;  4DBF A;  3M53 A;  3M0Q A;  1JBM A;  1BK2 A;  3BE3 A;  3CBO A;  4MZM A;  4HCB A;  3VJP A;  1GCP A;  2CSI A;  2BZX A;  3CC4 A;  3I56 T;  3HRS A;  2J06 A;  2EYQ A;  3G4S Q;  1UGR B;  1NBE B;  3IQL A;  3TCJ A;  2COZ A;  4OB1 B;  2KRM A;  3CME T;  1IHV A;  2E64 A;  1AD5 A;  3KFV A;  1D3B B;  4M7A B;  1YHQ T;  1C0M A;  2LC4 A;  4PFZ A;  2KRO A;  3L2V A;  2E10 A;  3CC7 Q;  1EIF A;  4A4K A;  1M1F A;  3H6Z A;  3HRT A;  1U8R A;  1Q86 C;  2KEA A;  4N4H A;  4M7A A;  2GTO A;  3EGU A;  1KQS P;  2EYX A;  2RB6 A;  4Z89 A;  4PJO C;  3V8J A;  2CP2 A;  2IPO B;  3CCU Q;  2FRW A;  2HQX A;  1MUZ A;  3GLX A;  1HJD A;  1YJW Q;  4ZGD B;  1V29 B;  5KYN A;  2DA9 A;  2MMP A;  4AG2 C;  5GAM j;  1XOV A;  4MDX A;  2E1H A;  3S6W A;  1BKB A;  5I22 A;  3JV3 A;  4M78 F;  4MML A;  1WQ7 A;  3OYY A;  1WX6 A;  2RJE A;  2LT1 A;  3H0H A;  1N27 A; 
#chains in the Genus database with same CATH homology
 4R0K A;  1OPK A;  3TVT A;  2D0N A;  2SRC A;  2BZY A;  4JPB W;  3M0U A;  4HCK A;  2BZ8 A;  2C0O A;  3REA B;  1PHT A;  4JZ4 A;  2DVJ A;  4RTY A;  1ZSG A;  1CKA A;  1ZUY A;  3PVQ A;  2ED0 A;  2X3X D;  1GBR A;  4LUD A;  1NG2 A;  4RTU A;  2KT1 A;  3RBB B;  2CT4 A;  1U3O A;  1KIK A;  1WYX A;  2LJ1 A;  3VS6 A;  5L23 A;  2KYB A;  4J9D A;  5IXB A;  5I11 A;  1YP5 A;  2YSQ A;  2KYM A;  2YUQ A;  1U06 A;  1LCK A;  2LX7 A;  2EVR A;  1M3B A;  1ARK A;  4JZ3 A;  2E5K A;  1HD3 A;  2K3B A;  2KR3 A;  4IIO A;  3U23 A;  4OMN A;  2FPF A;  2I0N A;  1AOJ A;  1GFC A;  3EHQ A;  2JMA A;  2AZV A;  3VS0 A;  1WXT A;  3NHN A;  4J9G A;  4A63 B;  3EG2 A;  4OMM A;  2DBK A;  3FJ5 A;  2J7I A;  2W10 A;  1M30 A;  1SHG A;  1JO8 A;  1PKT A;  1B3Q A;  2DX1 A;  2VWF A;  3H41 A;  2KGT A;  1JQQ A;  1OPL A;  1X43 A;  4J9B A;  1T3L A;  2LZ6 B;  2PNI A;  1M8M A;  1UHF A;  4HVW A;  3O5Z A;  4K11 A;  1UG1 A;  2DL3 A;  1H8K A;  1E6H A;  1RI9 A;  1SHF A;  2FEI A;  1CSK A;  2L3P A;  1QWE A;  4F17 A;  1VYV A;  1G83 A;  4LUE A;  2RNA A;  2X3W D;  1X6B A;  3EHR A;  3VS2 A;  2K7A A;  2L0A A;  4DEY A;  2AK5 A;  2G6F X;  1SSH A;  1UTI A;  2D8H A;  2QDL A;  2EW3 A;  5HCK A;  2M51 A;  3EG3 A;  1GL5 A;  5GJV B;  1UJY A;  1X6G A;  2NWM A;  5IH2 A;  1RLQ C;  3LH5 A;  1Y0M A;  3ZL7 C;  4OMQ A;  2W0Z A;  4GBQ A;  1AVZ C;  2AZS A;  3VRY A;  3H0F A;  3VS3 A;  4AFQ C;  1TG0 A;  1T0H A;  1WA7 A;  1Z9Z A;  2JT4 A;  5IHI A;  1AEY A;  2CSQ A;  4RTV A;  2C0I A;  1YCS B;  2FG0 A;  1WDX A;  2JM9 A;  3CQT A;  4AFZ C;  1SRL A;  4J9F A;  4OMO A;  1IO6 A;  1K0S A;  4RTZ A;  2GBQ A;  2EGA A;  1ZBJ A;  1AWO A;  1GFD A;  2L3S A;  1QWF A;  3M0P A;  4RTX A;  3I5S A;  1H92 A;  2FO0 A;  1MV3 A;  2CH4 W;  4LN2 A;  1UEC A;  1VA7 A;  2RQT A;  1AWJ A;  1M3C A;  2AKL A;  5FWC A;  1PWT A;  1ZUU A;  3NPF A;  5IHK A;  5FWB A;  2EYW A;  1E6G A;  1EFN A;  1RUW A;  1V1C A;  2CUB A;  2VKN A;  3EG1 A;  1NEB A;  3ULR B;  2M0Y A;  2GTJ A;  2P4R A;  3SEM A;  2H8H A;  2JW4 A;  3THK A;  2CH4 A;  2RPN A;  3UAT A;  1KFZ A;  1FMK A;  1NM7 A;  4AFS C;  1YWP A;  3M0S A;  1H3H A;  2V1R A;  5FW9 A;  4HXJ A;  2ENM A;  1AZG B;  1WXB A;  1GCQ A;  3TSZ A;  2KNB B;  1X2Q A;  1K1Z A;  2RQU A;  1G2B A;  4DEX A;  2GNC A;  2C0T A;  1X27 A;  1QLY A;  2EGC A;  2LQN A;  2FPE A;  2LQW A;  1T0J A;  1VYU A;  2JXB A;  1MV0 B;  2D1X A;  4Z88 A;  2RN8 A;  1AWX A;  1JXO A;  2DIL A;  2V1Q A;  2DL4 A;  2ED1 A;  2O31 A;  4RUG A;  2F2W A;  2DL7 A;  2J6K A;  4CC4 B;  3VRZ A;  1JU5 C;  2O9V A;  2CUD A;  4J9E A;  4OML A;  2JTE A;  2LJ3 A;  1VYT A;  4OMP A;  1JEG A;  2YT6 A;  2MOX A;  4CC7 A;  4EIK A;  2A37 A;  1T3S A;  1K76 A;  2PTK A;  1CKB A;  2KRS A;  1QKW A;  2L2P A;  2EQI A;  3A98 A;  1Z9Q A;  4QT7 A;  1OOT A;  1NEG A;  1TUC A;  1WIE A;  3I35 A;  3PVL A;  2O2O A;  2RF0 A;  3VS4 A;  2IIM A;  2O88 A;  1KJW A;  2ESW A;  1A0N B;  1OEB A;  2O9S A;  2A08 A;  5EC7 A;  1UJ0 A;  2KT8 A;  2FRY A;  2RMO A;  3M0T A;  2RQV A;  1X69 A;  2DL5 A;  1K0X A;  2EPD A;  1Y57 A;  2LCS A;  2D8J A;  1SRM A;  2CRE A;  2DRK A;  2XMF A;  3PE0 A;  4ZNX A;  4GLM A;  2B86 A;  2DNU A;  1SEM A;  3NMZ C;  2YDL A;  2RQR A;  2CDT A;  1TUD A;  2HSP A;  4E6R A;  2DJQ A;  4JJD A;  1HSQ A;  3VS5 A;  1YNZ A;  1WXU A;  1GBQ A;  2DYB A;  2DLP A;  1BB9 A;  1ZX6 A;  1WLP B;  4F16 A;  2EGE A;  3UA7 A;  2J6O A;  2YUO A;  2KRN A;  4CC3 A;  2DE0 X;  3RNJ A;  1UDL A;  1UHC A;  2AKK A;  1AZE A;  1NLP C;  1S1N A;  2DL8 A;  2KBT A;  4Z8A A;  2A36 A;  1WFW A;  2DF6 A;  1NLO C;  3SHW A;  3VS7 A;  2OAW A;  2J6F A;  1E7O A;  2LJ0 A;  1FYN A;  1PKS A;  3I9Q A;  2JS0 A;  2LP5 A;  2RQW A;  2HBW A;  1K9A A;  4J9C A;  4JJC A;  3QWY A;  2BTT A;  2LMJ A;  3UA6 A;  1RLP C;  2EKH A;  3M0R A;  2KE9 A;  1JXM A;  3C0C A;  1KSW A;  4RTT A;  1SPK A;  4D8D A;  1U5S A;  1BBZ A;  2HCK A;  2HDA A;  2MCN A;  2ROT A;  3UF4 A;  1ABQ A;  2OI3 A;  2EYZ A;  1UUE A;  2DMO A;  2ABL A;  2F2V A;  3H0I A;  1ZUK A;  2J05 A;  2L3Q A;  2K6D A;  1X2K A;  1I0C A;  1PNJ A;  3NGP A;  2OJ2 A;  4KRT A;  1ABO A;  1W1F A;  4JJB A;  1AWW A;  3M0Q A;  2EBP A;  1M3A A;  4HVV A;  3EG0 A;  1BK2 A;  4LE9 A;  3TSW A;  1B07 A;  4AG1 C;  4IIM A;  1BU1 A;  1GCP A;  2CSI A;  5GJW B;  2BZX A;  2VVK A;  2J06 A;  1NYF A;  1I07 A;  2CT3 A;  2HEQ A;  3GBQ A;  3IQL A;  5IXF A;  1N5Z A;  1QCF A;  2KRM A;  1W6X A;  4J9I A;  1J3T A;  1UGV A;  2KXC A;  1NYG A;  2DBM A;  4X1V A;  2PZ1 A;  4AFU C;  4HVU A;  1AD5 A;  3KFV A;  2LNH B;  2EYY A;  2NUZ A;  2F2X A;  4M4Z A;  5IHN A;  1WI7 A;  2YUP A;  1OV3 A;  1M27 C;  3VS1 A;  2K9G A;  2ECZ A;  2KRO A;  4J9H A;  3R6N A;  4RTW A;  4WCI A;  3QWX X;  3REB B;  2ROL A;  1YWO A;  4ORZ A;  1K4U S;  4CC2 A;  1GRI A;  2KEA A;  2GTO A;  2SEM A;  1UE9 A;  2GGR A;  4LNP A;  4F14 A;  3EGU A;  2EYX A;  4Z89 A;  2JMC A;  2FRW A;  1MUZ A;  2DRM A;  2GQI A;  2YUN A;  4ESR A;  2JM8 A;  1PRM C;  1GCQ C;  1I1J A;  1HJD A;  2DM1 A;  2DA9 A;  1YN8 A;  4AG2 C;  1XOV A;  1PRL C;  2JS2 A;  3I5R A;  5I22 A;  1QKX A;  3JV3 A;  4Y92 A;  2K2M A;  2K79 A;  2MIO A;  1W70 A;  2FPD A;  1UFF A;  4FSS A;  2A28 A;  5ECA A;  4D8K A;  1WX6 A;  1ZLM A;  3H0H A;  2KXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...