2DJQA

The solution structure of the first sh3 domain of mouse sh3 domain containing ring finger 2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDENWYQGEINGVSGIFPASSVEVISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 domain containing ring finger 2
publication title The solution structure of the first SH3 domain of mouse SH3 domain containing ring finger 2
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 6
structure length 68
sequence length 68
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2djqA00
2O88A 3H0FA 3I5RA 2AK5A 1XOVA 4AFUC 4OMOA 1UECA 2D1XA 4Z88A 2JS2A 1NLPC 2XMFA 2VKNA 1BBZA 2GTJA 2ROTA 4RTZA 2LJ1A 1YWPA 4ORZA 1K76A 4RTVA 2RQTA 1W6XA 1FYNA 1J3TA 2J6KA 1NEBA 1UHCA 2AZVA 1SRMA 1CKAA 2PZ1A 4D8DA 2X3WD 2DL5A 1RLQC 3I35A 1E7OA 1UG1A 5L23A 4J9CA 2CSIA 4CC2A 1Z9ZA 1PRLC 2CT3A 1PKSA 3EG0A 1ARKA 4WCIA 2EPDA 2DYBA 1GRIA 2RMOA 1K1ZA 2CUDA 1JO8A 4J9BA 3QWYA 3M0TA 1PWTA 4OMNA 1PKTA 4OMQA 2QDLA 1X2QA 2KXDA 2B86A 3SEMA 2AKKA 4CC3A 4J9EA 1U5SA 2JM8A 1U06A 2DX1A 5GJWB 2LCSA 4CC7A 1GFCA 2K7AA 2EYYA 3NHNA 2NWMA 4F14A 2EGEA 1OEBA 1JU5C 1A0NB 5IXBA 2AKLA 1AVZC 1ABQA 2CUBA 3EG1A 4LN2A 1RUWA 2L0AA 3C0CA 1KSWA 2A28A 1ZX6A 2EYXA 2EYZA 1X2KA 1M3CA 4F17A 2MIOA 3CQTA 2J6FA 2X3XD 2W0ZA 4LUEA 2KRNA 1PNJA 2DJQA 3PVLA 2J06A 4CC4B 1T3SA 4J9DA 1AWOA 2KR3A 1CSKA 2RQRA 2L2PA 2CSQA 3VRYA 2RQWA 2KBTA 1YNZA 1YP5A 4QT7A 1HSQA 2V1QA 4HVVA 1RLPC 1ZBJA 3VRZA 2YUNA 1S1NA 2JXBA 3RBBB 1AOJA 2FPEA 1B3QA 2SRCA 1UGVA 2DM1A 2EGCA 4GBQA 2LNHB 2O9VA 2DL3A 3UATA 2F2VA 1V1CA 1VYTA 3LH5A 2DRMA 1MUZA 3EG2A 2ESWA 1X69A 2ED0A 1SSHA 4DEXA 4K11A 4LNPA 1PHTA 2ROLA 3H41A 3KFVA 2KT1A 3NGPA 3VS1A 1OOTA 2ED1A 1AEYA 2H8HA 2KGTA 4R0KA 2FPFA 2W10A 3R6NA 4OMMA 3THKA 1FMKA 2L3SA 5GJVB 4D8KA 5FWBA 4J9GA 2CT4A 3TSZA 3SHWA 4X1VA 4EIKA 3U23A 4JZ3A 3FJ5A 1SRLA 1X6BA 4RTWA 2D8JA 2C0OA 2FRYA 1H3HA 1AD5A 2JT4A 1GCQA 2RN8A 2FG0A 3M0RA 2L3PA 4OMPA 2K79A 1I1JA 1AWJA 1H92A 1T3LA 2VWFA 2DL8A 1GBRA 2KXCA 5FW9A 2GNCA 2GQIA 2KROA 1ZLMA 2JM9A 1SHGA 2E5KA 2IIMA 2J05A 3REAB 2PNIA 2YUQA 2G6FX 1QWEA 2L3QA 1JQQA 3M0UA 2YDLA 2JMAA 1H8KA 1CKBA 3GBQA 4IIMA 2O9SA 1W1FA 2HCKA 1NEGA 4DEYA 2LQWA 3M0PA 1OPKA 2A37A 1KJWA 2DMOA 1QKXA 2K2MA 3EHQA 2BTTA 3M0QA 4OMLA 2FEIA 4A63B 1G83A 1PRMC 3REBB 5HCKA 3VS0A 2K9GA 1OPLA 1G2BA 3VS3A 3VS6A 2EGAA 5I11A 3A98A 1OV3A 3EGUA 2GBQA 2DA9A 2RQVA 1UTIA 1QWFA 1X43A 4KRTA 4AG2C 1M3AA 1E6GA 1VYUA 1RI9A 1WIEA 2M51A 5IHNA 1LCKA 2MCNA 5IXFA 2EYWA 2LX7A 1TUDA 2O2OA 3RNJA 4HCKA 2CREA 2M0YA 1M27C 1WXUA 2DILA 3UA6A 1NLOC 1YWOA 3M0SA 4JZ4A 3ULRB 2YT6A 1MV3A 2KNBB 1UJYA 4M4ZA 4AFQC 1Y57A 2CH4A 1M3BA 4GLMA 5ECAA 3UA7A 3QWXX 1YN8A 2YUPA 1I07A 4AFZC 4JJCA 1B07A 1MV0B 5IH2A 2HDAA 1WX6A 2EW3A 2DBKA 2F2XA 2CDTA 2DE0X 1M30A 1WFWA 1NYFA 4Y92A 3NMZC 2O31A 2KRMA 2P4RA 3TSWA 2BZXA 2HSPA 1KFZA 3VS4A 2RQUA 3I9QA 1JXOA 1QKWA 2V1RA 2RNAA 1WA7A 4IIOA 2RPNA 1I0CA 1SPKA 2VVKA 3ZL7C 2EBPA 1X27A 2RF0A 2GTOA 1UDLA 1JXMA 2LJ3A 4RTTA 2J7IA 1GCQC 2HBWA 3H0IA 1T0HA 2MOXA 1QLYA 2FRWA 4JJBA 2KEAA 2YSQA 2DF6A 1TUCA 2C0TA 4Z8AA 1AWXA 1ABOA 3NPFA 2PTKA 3PVQA 2LZ6B 2NUZA 2F2WA 1U3OA 3EHRA 1SEMA 1WI7A 2KRSA 1NYGA 2D8HA 1HJDA 1BU1A 1K9AA 1JEGA 2EKHA 1NG2A 1KIKA 2JW4A 1UUEA 2HEQA 5EC7A 2JMCA 4JJDA 4Z89A 1WDXA 2CH4W 2ABLA 2FPDA 4HVUA 4AFSC 2DL7A 4RTYA 1QCFA 1T0JA 1X6GA 1K4US 4ESRA 1WXBA 5IHKA 5IHIA 3I5SA 1E6HA 2I0NA 4J9FA 1GL5A 1WLPB 4LUDA 1ZUYA 1K0XA 1UFFA 1W70A 1WXTA 1ZUUA 1UJ0A 2BZ8A 2EQIA 3PE0A 2JS0A 2A36A 1M8MA 2A08A 3IQLA 3VS7A 4HVWA 2ENMA 1ZSGA 2LQNA 2DBMA 1AWWA 4J9IA 2OAWA 2KE9A 4RTUA 2LMJA 4HXJA 1AZEA 2DVJA 3O5ZA 2LP5A 1AZGB 2KT8A 5I22A 2K6DA 2KYMA 1HD3A 1IO6A 3EG3A 1N5ZA 4E6RA 1ZUKA 2KYBA 1EFNA 4FSSA 1VA7A 2JTEA 4F16A 2YUOA 4JPBW 1BB9A 2OJ2A 3JV3A 2D0NA 1TG0A 4RUGA 2DL4A 1UE9A 4RTXA 2DLPA 1GBQA 1YCSB 4LE9A 2OI3A 2EVRA 3H0HA 2SEMA 1BK2A 1NM7A 2K3BA 1GFDA 4ZNXA 2BZYA 3VS5A 1GCPA 2ECZA 5FWCA 1K0SA 2C0IA 2AZSA 2DRKA 1SHFA 1Z9QA 1WYXA 2FO0A 4J9HA 3UF4A 2LJ0A 3VS2A 2DNUA 1UHFA 4AG1C 2J6OA 2GGRA 1Y0MA 3TVTA 1VYVA
chains in the Genus database with same CATH superfamily
4J5YA 2QA4T 4L59A 2AK5A 4M77C 2DYIA 5J39A 3CCLQ 3CCET 3X26B 4FCYA 3CC4T 1NLPC 2FL7A 2ROTA 4RTZA 4J6YA 2EJ9A 1K76A 4N4GA 3EH1A 2RQTA 2FZKB 3M58A 1J3TA 2M9UA 3VU3C 3G4SA 4M7AD 1XQHA 2AZVA 1CKAA 2PZ1A 2K5IA 4J9CA 2CSIA 1VQOQ 2CZ6B 2CP5A 4JLGA 4ZTJA 2CYZB 2V26A 1JJ2S 2QK0A 2RMOA 4XU0A 1RAAB 1DJ7B 3CC7A 3PGGA 1PWTA 4OMNA 1PKTA 3QZ9B 2OAUA 1SKUB 2MAMA 2COZA 1Y96A 1M9SA 1KD1U 2AIRB 4BY6B 4ZN3A 1K73R 2QAZA 4CC3A 1U5SA 2RJFA 2X4YA 5A0DA 4M78B 3G1JA 3PTAA 3CMAT 2OTJQ 3M4YA 2DX1A 4M77D 4EPCA 4CC7A 2NWMA 2PUOB 3CXCA 3WVEB 3E1SA 5KYYB 2E10A 1G3TA 2K4YA 2AKLA 2G3RA 5LJ5h 1K8AC 1B34B 2HL3A 1Q86U 1VQ4T 3OSSC 5GAOp 2A28A 1ZX6A 1RAGB 2VV5A 2I2LA 2EYZA 1X2KA 4F17A 2MIOA 3CQTA 2X3XD 3URGA 2NYSA 4V2SA 3KUFA 3PVLA 1IGQA 4CC4B 4C8QG 4J9DA 1VQ8Q 3MP6A 1YITA 1GXIE 2RQRA 5FLXE 2EFIA 3E9GA 1D1BA 1ZHIA 2RQWA 1UGQB 1VQ5A 1R8OB 3EAEA 2QQ9A 1HSQA 1LOJA 4QVDA 5GMKm 2YUNA 2JXBA 1I81A 3RBBB 1OI1A 4QQDA 2YLBA 1VQ4Q 2DM1A 4GBQA 1VQ9T 3BDLA 4OGCA 2O4XA 5CAIA 2BE7D 1QVGP 4DOVA 2DRMA 3LW5E 3CCUT 1Q7YC 4PJOG 2BKDN 3H41A 2JNGA 2RHUA 4IURA 2KGTA 4R0KA 2FPFA 3MEVA 3V8JA 4BB7A 5D7UA 2DTOA 2MI6A 3RMQA 5GJVB 1EIFA 4D8KA 3G71A 1Q81U 1SRLA 1KC8U 2D8JA 1FXXA 2FRYA 2QG9B 3CD6T 1AD5A 4M75B 1YIJT 2E41A 2V8IA 3M0RA 3CCUQ 3CCMA 2E6ZA 2K79A 5GAOn 1VIEA 4BE1A 1ZQ1A 1K73U 2WSFE 1W2BS 4C92F 3H6ZA 1Q82C 1M90R 1H641 1D3BA 5GAMe 2WSCE 2JM9A 2J05A 2M16A 4B9WA 2ZPFB 1QWEA 2L3QA 4LDUA 1ZA2B 1NBEB 3RR6A 3Q1JA 3GBQA 4RCBA 2O9SA 3M4GA 3G6EA 3MKDA 3WXMB 3CD6Q 3A1PA 1WZOA 2LQWA 3C4SA 1OPKA 1YIJQ 3HPWA 2A37A 2DMOA 1QKXA 1QVFS 3EFOA 4FYWB 4A63B 3D7SB 1ACMB 1WHLA 2K9GA 3VS3A 3VS6A 5LJ5d 3A98A 2BE9B 5GAMd 1C6VX 1VQMQ 1MHNA 4XTVA 3OW2A 4KRTA 1M3AA 1VYUA 2LTOA 2QGFB 3CBPA 4IUPA 2RI2A 1M1FA 5FU7C 3GLXA 2QEXA 1YJNT 4HKEA 2DAQA 2M0YA 2O01E 4C92A 1KQSP 2L89A 1YWOA 3M0SA 4C5IA 5KYXB 2R5AA 2KNBB 3SB2A 4C0DC 1Q95G 1Y57A 2CH4A 5GANh 4GLMA 3UA7A 1HK9A 2CS7A 1YJ9T 3SWNA 4AFZC 4JJCA 1MV0B 5IH2A 4OGEA 5FRNA 5GAN3 4IKFA 1Y71A 4MMLA 1UEBA 3L2VA 4XK8E 3M56A 2O31A 2KRMA 2L3RA 3CMEA 5AT1B 2BZXA 3VS4A 2RQUA 3I9QA 1D0XA 5KH6A 1N27A 2RNAA 3FLGA 1NPPA 1BI2A 3M55A 3C12A 2DIQA 1EX4A 3OBWA 1YHQA 3CC2A 2RPNA 2PQWA 3V7RA 1I0CA 1X75C 2KK4A 2VVKA 2Y4YA 2CKKA 1X27A 2QQBA 5DY9A 2HNIA 2J7IA 3OYJA 5HK3A 1SG5A 1YJ9Q 1MMAA 2MK5A 4E7KA 3HP9A 3S6WA 3PNWC 2YSQA 3GPLA 1TUCA 4Z8AA 3DLMA 4DBRA 1ABOA 3NPFA 1M90U 1R0CB 1SEMA 2PVOB 1LNXA 2KRSA 2D8HA 1HJDA 3JCMh 5I2MA 4ZTFA 1I8FA 1UUEA 2X51A 2Z0WA 4HVUA 1K4US 2RI3A 4ESRA 5IHIA 1RABB 2I0NA 4M78A 2EIFA 4A4HA 1QVGA 1WLPB 2LQKA 1K0XA 1WXTA 1ZUUA 3VUBA 2BUDA 2JN0A 3IQLA 4HVWA 1F1BB 2OTLT 5KYYA 4C5GA 2E70A 1AZEA 3EH2A 3BFMA 3O5ZA 3A5ZB 4Y91A 1I5OB 4F7UG 2KYMA 2ZZDA 5GAN6 5D6YA 4M78E 1B34A 1IO6A 3MCAB 4N0AA 1ZUKA 5GAMf 3NTKA 2KYBA 2YUOA 3JB9F 1UGPB 1BB9A 2OJ2A 1KQ2A 4C92G 1TG0A 2MMPA 1YCSB 3OYLA 3H0HA 2LCLA 2SEMA 4C92C 1GCPA 4M75F 1K0SA 1YJWA 2C0IA 2DRKA 1WYXA 2OTLQ 3CXCP 4J9HA 3UF4A 4BD3A 4JJNK 2DNUA 4M7DB 2GGRA 4ZGDB 3SWNC 1Y0MA 3CCLA 1TWBA 4LD9K 3QPHA 3H0FA 5GANd 4JS4A 3I5RA 1XOVA 4AFUC 3OYBA 3LWHA 3HFOA 2D1XA 2ATCB 2ZCFB 1WHMA 1BBZA 1WNLA 5GMKe 4KULA 4RTVA 1W6XA 2H3JA 2XK0A 2IPOB 3CCVT 1RAEB 1KQ1A 1NEBA 1WQWA 3CCSA 2JVVA 2X3WD 2LC4A 4HCZA 4N4HA 3VYGA 3E19A 3FEOA 2DXUA 1ARKA 1MMNA 4WCIA 2EPDA 2DYBA 4OB3B 2RO0A 3RKYA 5LJ3j 2E65A 5CQXA 3E9FA 1K8AR 4C92D 3M0TA 3QO3A 3LYIA 3UDCA 4M75A 4PJMA 3GNFB 2OTJA 4PFOA 2DZCA 4OB0B 4FYYB 1RI0A 3SEMA 3CCQQ 4XTXA 1KQSA 3I56Q 1U06A 3OYKA 4O5VA 3JCMd 4BY6C 2XDBA 1QP2A 2X4XA 2E64A 2EYYA 4M78C 4F14A 2EGEA 3LWIA 4LDWA 4PNOA 3QKJA 1JU5C 1A0NB 4M7AG 2XI9A 4LN2A 3MJXA 4X9DA 4QQGA 2EYXA 2WSEE 4BI3A 1VQ8A 5AYFA 1VQ6Q 3OYFA 2KRNA 2QQAA 1T3SA 2KR3A 1VQLQ 2L2PA 2A3LA 1BI1A 1Q7YR 2CSQA 4PLLA 1SSFA 1M5Q1 1TOVA 3GNGA 3M9QA 1VQ4A 3TCJA 1O9SA 4E7ZA 2D0QB 3VRZA 5LJ5g 3BDUA 4M77G 1S72T 5GAMg 2FPEA 3UT1A 4HCCA 2SRCA 1UGVA 2EGCA 1Y07A 4YTLA 2DL3A 2FZGB 4M78D 1VYTA 2E6NA 3NTHA 3OMGA 5KYXA 1I4K1 1K9MR 3CCRQ 2ESWA 2RHIA 2ED0A 5GMKj 1SSHA 2QTXA 4FU6A 5CKHA 4MDXA 4JS5A 4C8QE 4K11A 4LD6A 1VQKQ 3OW2P 4VUBA 2NUTB 2HZYA 5I21A 1Q82R 1VQPT 1YFNA 2H8HA 2RI5A 2EJGA 4WF2A 3R6NA 2D9TA 2P4TA 1FMKA 1PD0A 3P8BB 5FWBA 1TS9A 2CT4A 2EQUA 1VQNQ 4EIKA 4DBQA 2XHCA 2QGGA 3FJ5A 1K8AU 2QA4Q 1NJIC 1H3HA 4WTOB 3CCEQ 1YCYA 2KQWA 1XTDA 3CC4Q 4E7IA 2RN8A 5CO7A 4BE2A 2L3PA 3I55A 1U8RA 4OMPA 2CZ1B 4M75C 1AWJA 2CP3A 2M0OA 1H92A 1T3LA 2VWFA 2DL8A 1BI0A 4MMKA 5HKCA 1GBRA 4PJOE 2QI2A 1ZBXA 1ZLMA 2FZCB 3LLRA 2YUQA 2HSEB 4J6XA 3CCJT 3CD6A 3JCMb 3M0UA 2YDLA 3MEWA 3S3OA 4A53A 2NUPB 3EGXB 4M7DF 4XTWA 1NEGA 4DEYA 2CP0A 3M0PA 2F5TX 1KJWA 5A2QE 3OYAA 1VQMA 2EJFA 1G83A 4FM4B 3VS0A 3M54A 1OZ3A 3EGUA 2DA9A 1Q7YU 5A0LA 3C94A 2DK3A 2ZPHB 1UTIA 3CMAQ 1FMVA 1X43A 3OA6A 3JB9D 4AG2C 1E6GA 3F70A 3INZA 1RI9A 5CVIA 1QMCA 5IHNA 3CCJQ 4AMCA 4RCCA 2DFUA 4M75D 4HT9A 2KVQG 5J26A 2CREA 2DERA 1M27C 1WJQA 1OYXA 1WXUA 2DILA 4EMGA 1AT1B 4A4GA 2DTIA 5FU6B 1JJ2P 2Y90A 4PJJA 3ULRB 2RHZA 2PVGB 4KGZB 4M4ZA 4AFQC 1TXQA 1WJRA 5ECAA 3FB9A 2RK2A 1YN8A 5GAN2 1B07A 2HDAA 3G4ST 2X9HA 1WX6A 2EW3A 3OS0A 2NLUA 2YXYA 1Q86C 4M7DA 4Q5WA 1WFWA 3HL8A 1MNEA 4EMHA 3OYMA 2EQKA 5KYNA 1QKWA 1XNIA 2RK1A 4RG8A 2HL5C 1VQ9Q 1TTHB 3ZL7C 3GOXA 4M7DE 1B7TA 2LQ8A 5L8RE 5C6SA 5CR2A 2GTOA 4XTZA 5GANg 2LJ3A 4HT8A 1EZZB 4L6V5 1QCNA 2E4HA 3JCMJ 5GAN7 3JB9I 1K9MC 3H0IA 1T0HA 2FRWA 2DTHA 4JJBA 2LZ6B 5LJ5e 2YRCA 3C95A 2F2WA 3MPUB 3VJPA 1WI7A 1OU8A 1NYGA 2ZPBB 2DPPB 2RD1A 2DJZA 1NG2A 4JJDA 1M2VB 1WDXA 2FPDA 4MZTA 3J80E 4AFSC 2DL7A 4CRIA 1QCFA 1X6OA 3JCMX 4CI0C 2P84A 3A8GB 1W70A 1YITT 5KE2A 3GF5A 2A08A 2ENMA 1VQ5T 5HK0A 2LQNA 3HHTB 5GAN8 3RMSA 4J9IA 2HKQB 1Q81C 5LJ3h 3JSCA 1NZ9A 1AZGB 2KT8A 4E7LA 4ANJA 3JCMg 3QSUA 2KSSA 3EG3A 1H3ZA 2X4WA 4E6RA 5D6WA 3PMTA 4FSSA 1RL2A 2JOYA 1VA7A 4HA8A 4HCBA 4BACA 2JTEA 4QQ6A 4JPBW 4C8QB 3OYDA 5CKFA 4RUGA 1UE9A 4FW1A 2RB6A 4RTXA 3OYYA 2L5QA 4LE9A 2EVRA 4C5EA 1PSFA 2GCXA 2Y4XA 2QQRA 1BK2A 3QXEB 4ZNXA 1YITQ 2BZYA 3J7AF 5FWCA 4PJLA 2AZSA 3X25B 2FO0A 2ZPIB 5EG2A 1N9SA 1UB4A 4LXCA 1NPRA 1UHFA 3GP8A 3FRNA 4BI4A 2FHDA 2VGNA 1ZSZB 3QHSA 5CKBA 2E5QA 1VYVA 2K2VA 2DXBA 4M78F 3OYEA 2PUKB 1W2BP 4M7DC 1PG5B 4F7UE 2B8AA 3V8KA 2R58A 5GMKl 1YJNQ 4XU2A 4PJOB 2LJ1A 4ZGJB 1JB0E 1FYNA 1PD1A 5I2SA 3CCMT 1N9RA 2F69A 2NUTA 5CKEA 3QG1A 1RLQC 1E7OA 1OX9A 3BY7A 4ME7A 3HTRA 5L23A 1QVFP 2RJCA 1PKSA 3EG0A 3CPWS 3VYHB 2VGMA 3META 2CP7A 2C06A 2YLCA 1K1ZA 4EMKB 2A0FB 5GAMj 2CUDA 1JO8A 3QWYA 2R5MA 4OMQA 3CCQA 3I56A 3G6ET 2RA2A 4PJNA 1R77A 1PCXA 3QYHB 2B86A 2LT4A 1VQ7T 3BW1A 2RJEA 3QUIA 1JJ2A 2IG0A 3OYHA 4M7DD 2LCSA 1M2OA 3AHUA 3GIBA 3NHNA 5KYWB 5DLQE 1OEBA 4OP0A 1IZ6A 4E2FB 5IXBA 4IUVA 1AVZC 1VQ6A 2CUBA 3EG1A 2NUPA 2HMAA 1RUWA 3EGXA 3C0CA 3DKMA 2GFAA 5GAOm 2LX9A 5LJ5f 4F04B 1VQLA 2FYKA 1M8VA 2HQEA 1QVPA 2LCCA 5GANe 1PNJA 1MMDA 1VQ7Q 5LJ3d 3HFNA 1AWOA 4A4FA 1U1SA 1HXDA 4E7JA 3V8LA 5FU7B 3VRYA 2KBTA 3LGFA 3X28B 3PT9A 1YP5A 4QT7A 5KCHA 2V8KA 4HVVA 1RLPC 1ZBJA 5LL6S 4EDUA 2RH2A 1S1NA 4J7IA 2DD5A 1AOJA 4JDSA 1B3QA 5KYUB 3CMET 2LNHB 4M7AE 2ZAEA 2O9VA 1MNDA 3CCRA 2F2VA 1NJIR 1V1CA 3SFMA 3CC2T 4BDZA 1MUZA 1QP3A 1VQKA 2CP2A 2HQXA 1X69A 1C1AA 2L8DA 3J81E 2RJDA 1PHTA 2ROLA 2COWA 2RM4A 2KT1A 1O75A 4J6WA 3HKSA 1VQOA 3VS1A 4KUIA 1OOTA 4PK4A 1VQNA 3H9NA 2W10A 3JCMe 2H3EB 3ER0A 4FL6A 2QA4A 1IRXA 2L3SA 4QVZA 5GAN5 3CCEA 1KK7A 4DOWA 3CC4A 5D6XA 4M77E 1X6BA 2VB6A 3NTIA 4RTWA 2C0OA 3FIFA 4FIBA 4NS5A 2P0PA 1GCQA 3CC2Q 3EFRA 4XQ3A 4XU3A 3A8MB 1BCMA 1D1AA 4C8QF 1UGRB 4KGXB 1D3BB 2P0QA 2KXCA 5FW9A 4M78G 2GNCA 3EGDB 1G8XA 3CCVQ 1N8RC 4NL3A 3ZEHA 2QASA 1SHGA 4NOYA 2E5KA 2IIMA 3HRSA 2PNIA 4C0FA 1FMWA 3VKIA 1TUGB 3JB9J 4UC4A 3L2ZA 4IIMA 1W1FA 3UPUA 2KMTA 1M2VA 3JCMW 1W2BA 1RACB 2XKOC 2DEUA 4QW2A 1IB8A 2K2MA 5CKDA 3EHQA 3M0QA 4D6WA 4DA4A 1PRMC 3CMAA 4QVCA 4XTYA 1OPLA 1G2BA 5I11A 2EGAA 3VUZA 4N0AC 4PKCC 1OV3A 4FT2A 2HAXA 2GBQA 4J7FA 3N5BB 4PJOF 2RQVA 3QJYA 2EQMA 4DBHA 4F7UB 3PIPA 3QYGB 1Q86R 1M1KC 2M51A 4JRKA 1LCKA 4JLIA 2LX7A 2DXTA 1TUDA 3CCLT 5C0MA 2DZ9A 1QVFA 1QCOA 2K57A 2O2OA 3H8ZA 4KGVB 2EAYA 3KBGA 2VC8A 4HCKA 3ZFJA 3RERA 4C8QA 1Y7XA 2FB7A 2GF7A 1NJIU 2GQVA 4FSXA 2YT6A 1MV3A 1UJYA 2E12A 5HY6A 3EFSA 3OS2A 5FU6C 3QWXX 1KG1A 1FWZA 4KH1B 1TU0B 2DBKA 5GANf 3CCST 2PU9B 2VXFA 1ZSZA 1M30A 4N4IA 1RAHB 4Y92A 3LGLA 1YI2T 1PSEA 1VQ9A 1KFZA 3TREA 1JXOA 2V1RA 3JB9G 3QDRB 1S72Q 4IIOA 4C0ZA 1OULA 3OB9A 4PJOA 1RAFB 3CCUA 3MP8A 2RF0A 3ASKA 1UDLA 2OTJT 4M75G 1D1CA 3DB3A 4ELZC 1GCQC 3KXTA 1OQKA 2XDPA 2MWPA 3CCSQ 2DF6A 2C0TA 3JCMV 3TU4K 2PTKA 5GMKi 2EKOA 4P5NA 2HD0A 2NUZA 2CZ0B 1QVGS 4GY5A 1Q81R 3SDZA 1VQPQ 4X34A 1KC8R 1U3OA 1YI2Q 4EMKA 2JJ9A 1BU1A 1K9AA 1TSFA 2VYTA 1JEGA 8ATCB 3OS5A 1KIKA 2JW4A 2MPXC 2HEQA 3JAME 2JMCA 1YIJA 4Z89A 2CH4W 3JCMf 1VQ8T 4OMFB 4RTYA 3CPWA 1X6GA 2DKGA 5IHKA 3S3NA 4BI8B 1E6HA 4FW2A 4J9FA 2E3HA 3OBYA 1ZUYA 3EG9B 1UFFA 3HRUA 2KI7A 2EQIA 1R0BG 3PE0A 2BZ8A 5A0GA 2QDYB 4BE0A 1M8MA 3MEUA 5KYWA 3VS7A 4MZPA 2DBMA 2LRQA 4M7AB 3PMIA 2KE9A 4RTUA 4PFPA 2LMJA 2ZPGB 1BKBA 2DVJA 3OYIA 1RADB 2LP5A 5GAMh 3WVDB 2E3IA 3NFCA 5I22A 2DIGA 1YBYA 4E7SA 2AT1B 3SD4A 3CBOA 3RDVA 1N5ZA 4FYVB 4F16A 1KD1C 2D6FA 3DB4A 3JV3A 2D0NA 2QTVA 1GBQA 2KAFA 4C0GA 4Z02A 1BIAA 4C8QC 3OS1A 3L2WA 5KE3A 3LX7A 3VS5A 2ECZA 1WQ7A 1Z9QA 1K9MU 1LJOA 4QKUA 5LJ3g 2ZPEB 3VS2A 3L2RA 4M77B 2RHXA 2FVUA 2JZ2A 2ZGWA 1YJNA 1Q82U 2O88A 4E47A 5KYUA 3CPFA 2YWWA 2XU8A 1ZSZC 4OMOA 4J8OA 4RKUE 2PVDB 1WPYA 3M59A 3OY9A 3CBMA 1UECA 4Z88A 2JS2A 3FDRA 1QQJA 2XMFA 1G3YA 3V7CA 2VKNA 2GTJA 5CQYA 1YWPA 1WHHA 1JBMA 4ORZA 3CC7T 1WHJA 2XD0A 1YJ9A 2DEQA 1IREB 2J6KA 3I55T 4PJOC 3LH0A 3M5AA 1UHCA 4IUQA 1SRMA 4D8DA 3VV0A 2DL5A 3I35A 2F1LA 2M02A 2MYSA 1SF9A 4R56A 1UG1A 4CC2A 3X20B 3G4SQ 1Z9ZA 1PRLC 2CT3A 1KQSS 1VOMA 1GRIA 4B6MA 4LDVA 4C8QD 4BUGA 2KDSA 4F7UF 1IGUA 3QZ5B 3HSBA 1BCOA 4J9BA 4X9CA 2EQJA 2YRVA 3JRZA 2QDLA 4EMKC 3R6OA 2CZ7B 1G3WA 1X2QA 2KXDA 3CC7Q 1LPLA 4PLIA 2AKKA 4J9EA 3A8OB 4NL2A 3PFSA 2JM8A 1VQMT 2JTFA 3I55Q 2HBPA 4A54A 3DLLA 5GJWB 4BDYA 3EGDA 1GFCA 2K7AA 4DQ2A 1BIBA 1D0YA 1V29B 3P8HA 5DLOA 2HQHA 4MZMA 3L2QA 1ABQA 1LVKA 2MWOA 5GAOr 1KC8C 1OZ2A 2L0AA 1VQ7A 1KSWA 3JCMc 4PJOD 1C0MA 2LVMA 5M9OA 2EYQA 3S3MA 1M3CA 1NE8A 3PIOA 2J6FA 4LUEA 2W0ZA 3A8LB 2DJQA 1K73C 2J06A 3V7SA 9ATCB 1CSKA 5FROA 4JRQA 4KT0E 3MHXA 2JTMA 3RKXA 1YNZA 2OTLA 2QXFA 2A7YA 4F7UA 4L5GA 2IVWA 2V1QA 1VQ5Q 4JUVA 5IAYA 2CGHA 5CCAA 4M7DG 1WHGA 5J3BA 3M53A 3UATA 2HKNA 4XAXB 3A8HB 1V76A 3TQ7P 3G71T 3LH5A 2MF2A 3FC3A 3EG2A 2K3YA 1PM3A 4FT4A 4DEXA 5DM7R 4LNPA 4C92E 3KFVA 4LDYA 1G3SA 3JCMQ 3G7ZA 3NGPA 1N8RR 2ED1A 3QIIA 4A4KA 1IXDA 1AEYA 1IHWA 3L42A 4IUUA 3QJ6A 4OMMA 4JRPA 3THKA 4MDWA 4E7HA 1IHVA 1UGSB 4J9GA 2DD4A 3TSZA 3SHWA 4X1VA 3U23A 4M7AF 4B9XA 5LJ5j 4JZ3A 7AT1B 2AHJB 3OYCA 3G71Q 3CXCS 1Y96B 2JT4A 3RKWA 1W4SA 2FG0A 4KBMB 4R55A 3CCVA 1AHJB 1I1JA 2XG8D 3OMCA 5GMKh 4XU1A 4RMOA 5LJ3e 2GQIA 4O6JA 3CCMQ 2KROA 4J83A 2K3XA 3REAB 1N6AA 3QBYA 2E1HA 2K5FA 1M1KR 2G6FX 1JQQA 3OSVA 4AT1B 3MEAA 3T9NA 2JMAA 1H8KA 1CKBA 2GFUA 5FRMA 4M77F 2CP6A 1D09B 2HCKA 3AT1B 4Y28E 1BYMA 2QEXT 4OVAA 2BIVA 2BTTA 3G6EQ 4OMLA 2FEIA 3REBB 5HCKA 1ZA1B 3EG9A 1WHKA 5KCOA 1RAIB 5CIUA 2R57A 1M90C 1QWFA 4M7AA 4ZN1A 2LT1A 3QDFA 1WIEA 3TEEA 2MCNA 5IXFA 2EYWA 3CEYA 1MMGA 3RNJA 2K5LA 3OYNA 4ELYC 1JRIA 2O4XB 3UA6A 1NLOC 3MO8A 4IUTA 4C0DB 3HRTA 1KHCA 2QEXQ 3CPWP 4OF1A 1QW1A 1WGSA 5IN1A 4JZ4A 4LDXA 3FJPA 1YHQT 1M3BA 2YUPA 1I07A 1VUBA 4DBFA 1MGQA 5GAOq 2F2XA 2CDTA 2DE0X 2LDMA 4C5HA 3ME9A 4M77A 2DETA 6AT1B 8AT1B 1G5VA 1XJWB 1N8RU 4FYXB 1NYFA 1S72A 1FX7A 3NMZC 4RG2A 2P4RA 3OYGA 4PFZA 3RIRA 3TSWA 2HSPA 5GAN4 2VASA 2WACA 1TH7A 1WA7A 4PL6A 3CMEQ 2M1HA 3X24B 4TVRA 1SPKA 1HYOA 3E2UA 2EBPA 2YRDA 3CCQT 3I56T 4KUDK 1JXMA 4RTTA 3RUXA 1WJSA 1YHQQ 3BE3A 2HBWA 3L2UA 2MOXA 1QLYA 3RESA 1VQPA 2KEAA 2DO3A 1YI2A 1AWXA 1OU9A 3PVQA 3ZBDA 2P0KA 3P8DA 2QYZA 3EHRA 1M1KU 2DVEA 2EKHA 1VQ6T 3M57A 5EC7A 2X35A 2ABLA 3OW2S 3JCMP 3O8VA 1KD1R 2X4JA 1P92A 2V8JA 1T0JA 1VQLT 1BI3A 1WXBA 2VXEA 5IT9E 3EFOB 3I5SA 2JUFA 1GL5A 4LUDA 3JB9H 4KH0B 1UJ0A 2COYA 2YHTA 4II1A 4M75E 5CK9A 2JS0A 1VIFA 2A36A 2OX7A 5GANj 4OB2B 1ZSGA 4XTUA 1AWWA 2KY9A 2F5KA 2OAWA 3CCJA 4HXJA 3MP1A 1YJWT 2DXCA 4JRIA 2K6DA 1U1TA 4ATOA 1HD3A 4M7AC 5LJ3f 2EWNA 4OB1B 1M1GA 1EFNA 3L1AA 1PC0A 1M4ZA 3UWNA 3OQ5A 4C92B 3CCRT 2DL4A 2DLPA 2OI3A 2VUBA 2QQSA 1D0ZA 5GAOl 1NM7A 1GFDA 2K3BA 2RHYA 1KHIA 1VQKT 4GLKA 1I5LA 2XICA 3SWNB 1OX8A 1SHFA 2XDDA 1X01A 2LNVA 4A4EA 2XIDA 4ZGEB 2LJ0A 4AG1C 2J6OA 1VQOT 1YJWQ 1VQNT 3TVTA
chains in the Genus database with same CATH topology
2O88A 3H0FA 3I5RA 2AK5A 1XOVA 4AFUC 4OMOA 1UECA 2D1XA 4Z88A 2JS2A 1NLPC 2XMFA 2VKNA 1BBZA 2GTJA 2ROTA 4RTZA 2LJ1A 1YWPA 4ORZA 1K76A 4RTVA 2RQTA 1W6XA 1FYNA 1J3TA 2J6KA 1NEBA 1UHCA 2AZVA 1SRMA 1CKAA 2PZ1A 4D8DA 2X3WD 2DL5A 1RLQC 3I35A 1E7OA 1UG1A 5L23A 4J9CA 2CSIA 4CC2A 1Z9ZA 1PRLC 2CT3A 1PKSA 3EG0A 1ARKA 4WCIA 2EPDA 2DYBA 1GRIA 2RMOA 1K1ZA 2CUDA 1JO8A 4J9BA 3QWYA 3M0TA 1PWTA 4OMNA 1PKTA 4OMQA 2QDLA 1X2QA 2KXDA 2B86A 3SEMA 2AKKA 4CC3A 4J9EA 1U5SA 2JM8A 1U06A 2DX1A 5GJWB 2LCSA 4CC7A 1GFCA 2K7AA 2EYYA 3NHNA 2NWMA 4F14A 2EGEA 1OEBA 1JU5C 1A0NB 5IXBA 2AKLA 1AVZC 1ABQA 2CUBA 3EG1A 4LN2A 1RUWA 2L0AA 3C0CA 1KSWA 2A28A 1ZX6A 2EYXA 2EYZA 1X2KA 1M3CA 4F17A 2MIOA 3CQTA 2J6FA 2X3XD 2W0ZA 4LUEA 2KRNA 1PNJA 2DJQA 3PVLA 2J06A 4CC4B 1T3SA 4J9DA 1AWOA 2KR3A 1CSKA 2RQRA 2L2PA 2CSQA 3VRYA 2RQWA 2KBTA 1YNZA 1YP5A 4QT7A 1HSQA 2V1QA 4HVVA 1RLPC 1ZBJA 3VRZA 2YUNA 1S1NA 2JXBA 3RBBB 1AOJA 2FPEA 1B3QA 2SRCA 1UGVA 2DM1A 2EGCA 4GBQA 2LNHB 2O9VA 2DL3A 3UATA 2F2VA 1V1CA 1VYTA 3LH5A 2DRMA 1MUZA 3EG2A 2ESWA 1X69A 2ED0A 1SSHA 4DEXA 4K11A 4LNPA 1PHTA 2ROLA 3H41A 3KFVA 2KT1A 3NGPA 3VS1A 1OOTA 2ED1A 1AEYA 2H8HA 2KGTA 4R0KA 2FPFA 2W10A 3R6NA 4OMMA 3THKA 1FMKA 2L3SA 5GJVB 4D8KA 5FWBA 4J9GA 2CT4A 3TSZA 3SHWA 4X1VA 4EIKA 3U23A 4JZ3A 3FJ5A 1SRLA 1X6BA 4RTWA 2D8JA 2C0OA 2FRYA 1H3HA 1AD5A 2JT4A 1GCQA 2RN8A 2FG0A 3M0RA 2L3PA 4OMPA 2K79A 1I1JA 1AWJA 1H92A 1T3LA 2VWFA 2DL8A 1GBRA 2KXCA 5FW9A 2GNCA 2GQIA 2KROA 1ZLMA 2JM9A 1SHGA 2E5KA 2IIMA 2J05A 3REAB 2PNIA 2YUQA 2G6FX 1QWEA 2L3QA 1JQQA 3M0UA 2YDLA 2JMAA 1H8KA 1CKBA 3GBQA 4IIMA 2O9SA 1W1FA 2HCKA 1NEGA 4DEYA 2LQWA 3M0PA 1OPKA 2A37A 1KJWA 2DMOA 1QKXA 2K2MA 3EHQA 2BTTA 3M0QA 4OMLA 2FEIA 4A63B 1G83A 1PRMC 3REBB 5HCKA 3VS0A 2K9GA 1OPLA 1G2BA 3VS3A 3VS6A 2EGAA 5I11A 3A98A 1OV3A 3EGUA 2GBQA 2DA9A 2RQVA 1UTIA 1QWFA 1X43A 4KRTA 4AG2C 1M3AA 1E6GA 1VYUA 1RI9A 1WIEA 2M51A 5IHNA 1LCKA 2MCNA 5IXFA 2EYWA 2LX7A 1TUDA 2O2OA 3RNJA 4HCKA 2CREA 2M0YA 1M27C 1WXUA 2DILA 3UA6A 1NLOC 1YWOA 3M0SA 4JZ4A 3ULRB 2YT6A 1MV3A 2KNBB 1UJYA 4M4ZA 4AFQC 1Y57A 2CH4A 1M3BA 4GLMA 5ECAA 3UA7A 3QWXX 1YN8A 2YUPA 1I07A 4AFZC 4JJCA 1B07A 1MV0B 5IH2A 2HDAA 1WX6A 2EW3A 2DBKA 2F2XA 2CDTA 2DE0X 1M30A 1WFWA 1NYFA 4Y92A 3NMZC 2O31A 2KRMA 2P4RA 3TSWA 2BZXA 2HSPA 1KFZA 3VS4A 2RQUA 3I9QA 1JXOA 1QKWA 2V1RA 2RNAA 1WA7A 4IIOA 2RPNA 1I0CA 1SPKA 2VVKA 3ZL7C 2EBPA 1X27A 2RF0A 2GTOA 1UDLA 1JXMA 2LJ3A 4RTTA 2J7IA 1GCQC 2HBWA 3H0IA 1T0HA 2MOXA 1QLYA 2FRWA 4JJBA 2KEAA 2YSQA 2DF6A 1TUCA 2C0TA 4Z8AA 1AWXA 1ABOA 3NPFA 2PTKA 3PVQA 2LZ6B 2NUZA 2F2WA 1U3OA 3EHRA 1SEMA 1WI7A 2KRSA 1NYGA 2D8HA 1HJDA 1BU1A 1K9AA 1JEGA 2EKHA 1NG2A 1KIKA 2JW4A 1UUEA 2HEQA 5EC7A 2JMCA 4JJDA 4Z89A 1WDXA 2CH4W 2ABLA 2FPDA 4HVUA 4AFSC 2DL7A 4RTYA 1QCFA 1T0JA 1X6GA 1K4US 4ESRA 1WXBA 5IHKA 5IHIA 3I5SA 1E6HA 2I0NA 4J9FA 1GL5A 1WLPB 4LUDA 1ZUYA 1K0XA 1UFFA 1W70A 1WXTA 1ZUUA 1UJ0A 2BZ8A 2EQIA 3PE0A 2JS0A 2A36A 1M8MA 2A08A 3IQLA 3VS7A 4HVWA 2ENMA 1ZSGA 2LQNA 2DBMA 1AWWA 4J9IA 2OAWA 2KE9A 4RTUA 2LMJA 4HXJA 1AZEA 2DVJA 3O5ZA 2LP5A 1AZGB 2KT8A 5I22A 2K6DA 2KYMA 1HD3A 1IO6A 3EG3A 1N5ZA 4E6RA 1ZUKA 2KYBA 1EFNA 4FSSA 1VA7A 2JTEA 4F16A 2YUOA 4JPBW 1BB9A 2OJ2A 3JV3A 2D0NA 1TG0A 4RUGA 2DL4A 1UE9A 4RTXA 2DLPA 1GBQA 1YCSB 4LE9A 2OI3A 2EVRA 3H0HA 2SEMA 1BK2A 1NM7A 2K3BA 1GFDA 4ZNXA 2BZYA 3VS5A 1GCPA 2ECZA 5FWCA 1K0SA 2C0IA 2AZSA 2DRKA 1SHFA 1Z9QA 1WYXA 2FO0A 4J9HA 3UF4A 2LJ0A 3VS2A 2DNUA 1UHFA 4AG1C 2J6OA 2GGRA 1Y0MA 3TVTA 1VYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O88 A;  3H0F A;  3I5R A;  2AK5 A;  1XOV A;  4AFU C;  4OMO A;  1UEC A;  2D1X A;  4Z88 A;  2JS2 A;  1NLP C;  2XMF A;  2VKN A;  1BBZ A;  2GTJ A;  2ROT A;  4RTZ A;  2LJ1 A;  1YWP A;  4ORZ A;  1K76 A;  4RTV A;  2RQT A;  1W6X A;  1FYN A;  1J3T A;  2J6K A;  1NEB A;  1UHC A;  2AZV A;  1SRM A;  1CKA A;  2PZ1 A;  4D8D A;  2X3W D;  2DL5 A;  1RLQ C;  3I35 A;  1E7O A;  1UG1 A;  5L23 A;  4J9C A;  2CSI A;  4CC2 A;  1Z9Z A;  1PRL C;  2CT3 A;  1PKS A;  3EG0 A;  1ARK A;  4WCI A;  2EPD A;  2DYB A;  1GRI A;  2RMO A;  1K1Z A;  2CUD A;  1JO8 A;  4J9B A;  3QWY A;  3M0T A;  1PWT A;  4OMN A;  1PKT A;  4OMQ A;  2QDL A;  1X2Q A;  2KXD A;  2B86 A;  3SEM A;  2AKK A;  4CC3 A;  4J9E A;  1U5S A;  2JM8 A;  1U06 A;  2DX1 A;  5GJW B;  2LCS A;  4CC7 A;  1GFC A;  2K7A A;  2EYY A;  3NHN A;  2NWM A;  4F14 A;  2EGE A;  1OEB A;  1JU5 C;  1A0N B;  5IXB A;  2AKL A;  1AVZ C;  1ABQ A;  2CUB A;  3EG1 A;  4LN2 A;  1RUW A;  2L0A A;  3C0C A;  1KSW A;  2A28 A;  1ZX6 A;  2EYX A;  2EYZ A;  1X2K A;  1M3C A;  4F17 A;  2MIO A;  3CQT A;  2J6F A;  2X3X D;  2W0Z A;  4LUE A;  2KRN A;  1PNJ A;  2DJQ A;  3PVL A;  2J06 A;  4CC4 B;  1T3S A;  4J9D A;  1AWO A;  2KR3 A;  1CSK A;  2RQR A;  2L2P A;  2CSQ A;  3VRY A;  2RQW A;  2KBT A;  1YNZ A;  1YP5 A;  4QT7 A;  1HSQ A;  2V1Q A;  4HVV A;  1RLP C;  1ZBJ A;  3VRZ A;  2YUN A;  1S1N A;  2JXB A;  3RBB B;  1AOJ A;  2FPE A;  1B3Q A;  2SRC A;  1UGV A;  2DM1 A;  2EGC A;  4GBQ A;  2LNH B;  2O9V A;  2DL3 A;  3UAT A;  2F2V A;  1V1C A;  1VYT A;  3LH5 A;  2DRM A;  1MUZ A;  3EG2 A;  2ESW A;  1X69 A;  2ED0 A;  1SSH A;  4DEX A;  4K11 A;  4LNP A;  1PHT A;  2ROL A;  3H41 A;  3KFV A;  2KT1 A;  3NGP A;  3VS1 A;  1OOT A;  2ED1 A;  1AEY A;  2H8H A;  2KGT A;  4R0K A;  2FPF A;  2W10 A;  3R6N A;  4OMM A;  3THK A;  1FMK A;  2L3S A;  5GJV B;  4D8K A;  5FWB A;  4J9G A;  2CT4 A;  3TSZ A;  3SHW A;  4X1V A;  4EIK A;  3U23 A;  4JZ3 A;  3FJ5 A;  1SRL A;  1X6B A;  4RTW A;  2D8J A;  2C0O A;  2FRY A;  1H3H A;  1AD5 A;  2JT4 A;  1GCQ A;  2RN8 A;  2FG0 A;  3M0R A;  2L3P A;  4OMP A;  2K79 A;  1I1J A;  1AWJ A;  1H92 A;  1T3L A;  2VWF A;  2DL8 A;  1GBR A;  2KXC A;  5FW9 A;  2GNC A;  2GQI A;  2KRO A;  1ZLM A;  2JM9 A;  1SHG A;  2E5K A;  2IIM A;  2J05 A;  3REA B;  2PNI A;  2YUQ A;  2G6F X;  1QWE A;  2L3Q A;  1JQQ A;  3M0U A;  2YDL A;  2JMA A;  1H8K A;  1CKB A;  3GBQ A;  4IIM A;  2O9S A;  1W1F A;  2HCK A;  1NEG A;  4DEY A;  2LQW A;  3M0P A;  1OPK A;  2A37 A;  1KJW A;  2DMO A;  1QKX A;  2K2M A;  3EHQ A;  2BTT A;  3M0Q A;  4OML A;  2FEI A;  4A63 B;  1G83 A;  1PRM C;  3REB B;  5HCK A;  3VS0 A;  2K9G A;  1OPL A;  1G2B A;  3VS3 A;  3VS6 A;  2EGA A;  5I11 A;  3A98 A;  1OV3 A;  3EGU A;  2GBQ A;  2DA9 A;  2RQV A;  1UTI A;  1QWF A;  1X43 A;  4KRT A;  4AG2 C;  1M3A A;  1E6G A;  1VYU A;  1RI9 A;  1WIE A;  2M51 A;  5IHN A;  1LCK A;  2MCN A;  5IXF A;  2EYW A;  2LX7 A;  1TUD A;  2O2O A;  3RNJ A;  4HCK A;  2CRE A;  2M0Y A;  1M27 C;  1WXU A;  2DIL A;  3UA6 A;  1NLO C;  1YWO A;  3M0S A;  4JZ4 A;  3ULR B;  2YT6 A;  1MV3 A;  2KNB B;  1UJY A;  4M4Z A;  4AFQ C;  1Y57 A;  2CH4 A;  1M3B A;  4GLM A;  5ECA A;  3UA7 A;  3QWX X;  1YN8 A;  2YUP A;  1I07 A;  4AFZ C;  4JJC A;  1B07 A;  1MV0 B;  5IH2 A;  2HDA A;  1WX6 A;  2EW3 A;  2DBK A;  2F2X A;  2CDT A;  2DE0 X;  1M30 A;  1WFW A;  1NYF A;  4Y92 A;  3NMZ C;  2O31 A;  2KRM A;  2P4R A;  3TSW A;  2BZX A;  2HSP A;  1KFZ A;  3VS4 A;  2RQU A;  3I9Q A;  1JXO A;  1QKW A;  2V1R A;  2RNA A;  1WA7 A;  4IIO A;  2RPN A;  1I0C A;  1SPK A;  2VVK A;  3ZL7 C;  2EBP A;  1X27 A;  2RF0 A;  2GTO A;  1UDL A;  1JXM A;  2LJ3 A;  4RTT A;  2J7I A;  1GCQ C;  2HBW A;  3H0I A;  1T0H A;  2MOX A;  1QLY A;  2FRW A;  4JJB A;  2KEA A;  2YSQ A;  2DF6 A;  1TUC A;  2C0T A;  4Z8A A;  1AWX A;  1ABO A;  3NPF A;  2PTK A;  3PVQ A;  2LZ6 B;  2NUZ A;  2F2W A;  1U3O A;  3EHR A;  1SEM A;  1WI7 A;  2KRS A;  1NYG A;  2D8H A;  1HJD A;  1BU1 A;  1K9A A;  1JEG A;  2EKH A;  1NG2 A;  1KIK A;  2JW4 A;  1UUE A;  2HEQ A;  5EC7 A;  2JMC A;  4JJD A;  4Z89 A;  1WDX A;  2CH4 W;  2ABL A;  2FPD A;  4HVU A;  4AFS C;  2DL7 A;  4RTY A;  1QCF A;  1T0J A;  1X6G A;  1K4U S;  4ESR A;  1WXB A;  5IHK A;  5IHI A;  3I5S A;  1E6H A;  2I0N A;  4J9F A;  1GL5 A;  1WLP B;  4LUD A;  1ZUY A;  1K0X A;  1UFF A;  1W70 A;  1WXT A;  1ZUU A;  1UJ0 A;  2BZ8 A;  2EQI A;  3PE0 A;  2JS0 A;  2A36 A;  1M8M A;  2A08 A;  3IQL A;  3VS7 A;  4HVW A;  2ENM A;  1ZSG A;  2LQN A;  2DBM A;  1AWW A;  4J9I A;  2OAW A;  2KE9 A;  4RTU A;  2LMJ A;  4HXJ A;  1AZE A;  2DVJ A;  3O5Z A;  2LP5 A;  1AZG B;  2KT8 A;  5I22 A;  2K6D A;  2KYM A;  1HD3 A;  1IO6 A;  3EG3 A;  1N5Z A;  4E6R A;  1ZUK A;  2KYB A;  1EFN A;  4FSS A;  1VA7 A;  2JTE A;  4F16 A;  2YUO A;  4JPB W;  1BB9 A;  2OJ2 A;  3JV3 A;  2D0N A;  1TG0 A;  4RUG A;  2DL4 A;  1UE9 A;  4RTX A;  2DLP A;  1GBQ A;  1YCS B;  4LE9 A;  2OI3 A;  2EVR A;  3H0H A;  2SEM A;  1BK2 A;  1NM7 A;  2K3B A;  1GFD A;  4ZNX A;  2BZY A;  3VS5 A;  1GCP A;  2ECZ A;  5FWC A;  1K0S A;  2C0I A;  2AZS A;  2DRK A;  1SHF A;  1Z9Q A;  1WYX A;  2FO0 A;  4J9H A;  3UF4 A;  2LJ0 A;  3VS2 A;  2DNU A;  1UHF A;  4AG1 C;  2J6O A;  2GGR A;  1Y0M A;  3TVT A;  1VYV A; 
#chains in the Genus database with same CATH topology
 4J5Y A;  2QA4 T;  4L59 A;  2AK5 A;  4M77 C;  2DYI A;  5J39 A;  3CCL Q;  3CCE T;  3X26 B;  4FCY A;  3CC4 T;  1NLP C;  2FL7 A;  2ROT A;  4RTZ A;  4J6Y A;  2EJ9 A;  1K76 A;  4N4G A;  3EH1 A;  2RQT A;  2FZK B;  3M58 A;  1J3T A;  2M9U A;  3VU3 C;  3G4S A;  4M7A D;  1XQH A;  2AZV A;  1CKA A;  2PZ1 A;  2K5I A;  4J9C A;  2CSI A;  1VQO Q;  2CZ6 B;  2CP5 A;  4JLG A;  4ZTJ A;  2CYZ B;  2V26 A;  1JJ2 S;  2QK0 A;  2RMO A;  4XU0 A;  1RAA B;  1DJ7 B;  3CC7 A;  3PGG A;  1PWT A;  4OMN A;  1PKT A;  3QZ9 B;  2OAU A;  1SKU B;  2MAM A;  2COZ A;  1Y96 A;  1M9S A;  1KD1 U;  2AIR B;  4BY6 B;  4ZN3 A;  1K73 R;  2QAZ A;  4CC3 A;  1U5S A;  2RJF A;  2X4Y A;  5A0D A;  4M78 B;  3G1J A;  3PTA A;  3CMA T;  2OTJ Q;  3M4Y A;  2DX1 A;  4M77 D;  4EPC A;  4CC7 A;  2NWM A;  2PUO B;  3CXC A;  3WVE B;  3E1S A;  5KYY B;  2E10 A;  1G3T A;  2K4Y A;  2AKL A;  2G3R A;  5LJ5 h;  1K8A C;  1B34 B;  2HL3 A;  1Q86 U;  1VQ4 T;  3OSS C;  5GAO p;  2A28 A;  1ZX6 A;  1RAG B;  2VV5 A;  2I2L A;  2EYZ A;  1X2K A;  4F17 A;  2MIO A;  3CQT A;  2X3X D;  3URG A;  2NYS A;  4V2S A;  3KUF A;  3PVL A;  1IGQ A;  4CC4 B;  4C8Q G;  4J9D A;  1VQ8 Q;  3MP6 A;  1YIT A;  1GXI E;  2RQR A;  5FLX E;  2EFI A;  3E9G A;  1D1B A;  1ZHI A;  2RQW A;  1UGQ B;  1VQ5 A;  1R8O B;  3EAE A;  2QQ9 A;  1HSQ A;  1LOJ A;  4QVD A;  5GMK m;  2YUN A;  2JXB A;  1I81 A;  3RBB B;  1OI1 A;  4QQD A;  2YLB A;  1VQ4 Q;  2DM1 A;  4GBQ A;  1VQ9 T;  3BDL A;  4OGC A;  2O4X A;  5CAI A;  2BE7 D;  1QVG P;  4DOV A;  2DRM A;  3LW5 E;  3CCU T;  1Q7Y C;  4PJO G;  2BKD N;  3H41 A;  2JNG A;  2RHU A;  4IUR A;  2KGT A;  4R0K A;  2FPF A;  3MEV A;  3V8J A;  4BB7 A;  5D7U A;  2DTO A;  2MI6 A;  3RMQ A;  5GJV B;  1EIF A;  4D8K A;  3G71 A;  1Q81 U;  1SRL A;  1KC8 U;  2D8J A;  1FXX A;  2FRY A;  2QG9 B;  3CD6 T;  1AD5 A;  4M75 B;  1YIJ T;  2E41 A;  2V8I A;  3M0R A;  3CCU Q;  3CCM A;  2E6Z A;  2K79 A;  5GAO n;  1VIE A;  4BE1 A;  1ZQ1 A;  1K73 U;  2WSF E;  1W2B S;  4C92 F;  3H6Z A;  1Q82 C;  1M90 R;  1H64 1;  1D3B A;  5GAM e;  2WSC E;  2JM9 A;  2J05 A;  2M16 A;  4B9W A;  2ZPF B;  1QWE A;  2L3Q A;  4LDU A;  1ZA2 B;  1NBE B;  3RR6 A;  3Q1J A;  3GBQ A;  4RCB A;  2O9S A;  3M4G A;  3G6E A;  3MKD A;  3WXM B;  3CD6 Q;  3A1P A;  1WZO A;  2LQW A;  3C4S A;  1OPK A;  1YIJ Q;  3HPW A;  2A37 A;  2DMO A;  1QKX A;  1QVF S;  3EFO A;  4FYW B;  4A63 B;  3D7S B;  1ACM B;  1WHL A;  2K9G A;  3VS3 A;  3VS6 A;  5LJ5 d;  3A98 A;  2BE9 B;  5GAM d;  1C6V X;  1VQM Q;  1MHN A;  4XTV A;  3OW2 A;  4KRT A;  1M3A A;  1VYU A;  2LTO A;  2QGF B;  3CBP A;  4IUP A;  2RI2 A;  1M1F A;  5FU7 C;  3GLX A;  2QEX A;  1YJN T;  4HKE A;  2DAQ A;  2M0Y A;  2O01 E;  4C92 A;  1KQS P;  2L89 A;  1YWO A;  3M0S A;  4C5I A;  5KYX B;  2R5A A;  2KNB B;  3SB2 A;  4C0D C;  1Q95 G;  1Y57 A;  2CH4 A;  5GAN h;  4GLM A;  3UA7 A;  1HK9 A;  2CS7 A;  1YJ9 T;  3SWN A;  4AFZ C;  4JJC A;  1MV0 B;  5IH2 A;  4OGE A;  5FRN A;  5GAN 3;  4IKF A;  1Y71 A;  4MML A;  1UEB A;  3L2V A;  4XK8 E;  3M56 A;  2O31 A;  2KRM A;  2L3R A;  3CME A;  5AT1 B;  2BZX A;  3VS4 A;  2RQU A;  3I9Q A;  1D0X A;  5KH6 A;  1N27 A;  2RNA A;  3FLG A;  1NPP A;  1BI2 A;  3M55 A;  3C12 A;  2DIQ A;  1EX4 A;  3OBW A;  1YHQ A;  3CC2 A;  2RPN A;  2PQW A;  3V7R A;  1I0C A;  1X75 C;  2KK4 A;  2VVK A;  2Y4Y A;  2CKK A;  1X27 A;  2QQB A;  5DY9 A;  2HNI A;  2J7I A;  3OYJ A;  5HK3 A;  1SG5 A;  1YJ9 Q;  1MMA A;  2MK5 A;  4E7K A;  3HP9 A;  3S6W A;  3PNW C;  2YSQ A;  3GPL A;  1TUC A;  4Z8A A;  3DLM A;  4DBR A;  1ABO A;  3NPF A;  1M90 U;  1R0C B;  1SEM A;  2PVO B;  1LNX A;  2KRS A;  2D8H A;  1HJD A;  3JCM h;  5I2M A;  4ZTF A;  1I8F A;  1UUE A;  2X51 A;  2Z0W A;  4HVU A;  1K4U S;  2RI3 A;  4ESR A;  5IHI A;  1RAB B;  2I0N A;  4M78 A;  2EIF A;  4A4H A;  1QVG A;  1WLP B;  2LQK A;  1K0X A;  1WXT A;  1ZUU A;  3VUB A;  2BUD A;  2JN0 A;  3IQL A;  4HVW A;  1F1B B;  2OTL T;  5KYY A;  4C5G A;  2E70 A;  1AZE A;  3EH2 A;  3BFM A;  3O5Z A;  3A5Z B;  4Y91 A;  1I5O B;  4F7U G;  2KYM A;  2ZZD A;  5GAN 6;  5D6Y A;  4M78 E;  1B34 A;  1IO6 A;  3MCA B;  4N0A A;  1ZUK A;  5GAM f;  3NTK A;  2KYB A;  2YUO A;  3JB9 F;  1UGP B;  1BB9 A;  2OJ2 A;  1KQ2 A;  4C92 G;  1TG0 A;  2MMP A;  1YCS B;  3OYL A;  3H0H A;  2LCL A;  2SEM A;  4C92 C;  1GCP A;  4M75 F;  1K0S A;  1YJW A;  2C0I A;  2DRK A;  1WYX A;  2OTL Q;  3CXC P;  4J9H A;  3UF4 A;  4BD3 A;  4JJN K;  2DNU A;  4M7D B;  2GGR A;  4ZGD B;  3SWN C;  1Y0M A;  3CCL A;  1TWB A;  4LD9 K;  3QPH A;  3H0F A;  5GAN d;  4JS4 A;  3I5R A;  1XOV A;  4AFU C;  3OYB A;  3LWH A;  3HFO A;  2D1X A;  2ATC B;  2ZCF B;  1WHM A;  1BBZ A;  1WNL A;  5GMK e;  4KUL A;  4RTV A;  1W6X A;  2H3J A;  2XK0 A;  2IPO B;  3CCV T;  1RAE B;  1KQ1 A;  1NEB A;  1WQW A;  3CCS A;  2JVV A;  2X3W D;  2LC4 A;  4HCZ A;  4N4H A;  3VYG A;  3E19 A;  3FEO A;  2DXU A;  1ARK A;  1MMN A;  4WCI A;  2EPD A;  2DYB A;  4OB3 B;  2RO0 A;  3RKY A;  5LJ3 j;  2E65 A;  5CQX A;  3E9F A;  1K8A R;  4C92 D;  3M0T A;  3QO3 A;  3LYI A;  3UDC A;  4M75 A;  4PJM A;  3GNF B;  2OTJ A;  4PFO A;  2DZC A;  4OB0 B;  4FYY B;  1RI0 A;  3SEM A;  3CCQ Q;  4XTX A;  1KQS A;  3I56 Q;  1U06 A;  3OYK A;  4O5V A;  3JCM d;  4BY6 C;  2XDB A;  1QP2 A;  2X4X A;  2E64 A;  2EYY A;  4M78 C;  4F14 A;  2EGE A;  3LWI A;  4LDW A;  4PNO A;  3QKJ A;  1JU5 C;  1A0N B;  4M7A G;  2XI9 A;  4LN2 A;  3MJX A;  4X9D A;  4QQG A;  2EYX A;  2WSE E;  4BI3 A;  1VQ8 A;  5AYF A;  1VQ6 Q;  3OYF A;  2KRN A;  2QQA A;  1T3S A;  2KR3 A;  1VQL Q;  2L2P A;  2A3L A;  1BI1 A;  1Q7Y R;  2CSQ A;  4PLL A;  1SSF A;  1M5Q 1;  1TOV A;  3GNG A;  3M9Q A;  1VQ4 A;  3TCJ A;  1O9S A;  4E7Z A;  2D0Q B;  3VRZ A;  5LJ5 g;  3BDU A;  4M77 G;  1S72 T;  5GAM g;  2FPE A;  3UT1 A;  4HCC A;  2SRC A;  1UGV A;  2EGC A;  1Y07 A;  4YTL A;  2DL3 A;  2FZG B;  4M78 D;  1VYT A;  2E6N A;  3NTH A;  3OMG A;  5KYX A;  1I4K 1;  1K9M R;  3CCR Q;  2ESW A;  2RHI A;  2ED0 A;  5GMK j;  1SSH A;  2QTX A;  4FU6 A;  5CKH A;  4MDX A;  4JS5 A;  4C8Q E;  4K11 A;  4LD6 A;  1VQK Q;  3OW2 P;  4VUB A;  2NUT B;  2HZY A;  5I21 A;  1Q82 R;  1VQP T;  1YFN A;  2H8H A;  2RI5 A;  2EJG A;  4WF2 A;  3R6N A;  2D9T A;  2P4T A;  1FMK A;  1PD0 A;  3P8B B;  5FWB A;  1TS9 A;  2CT4 A;  2EQU A;  1VQN Q;  4EIK A;  4DBQ A;  2XHC A;  2QGG A;  3FJ5 A;  1K8A U;  2QA4 Q;  1NJI C;  1H3H A;  4WTO B;  3CCE Q;  1YCY A;  2KQW A;  1XTD A;  3CC4 Q;  4E7I A;  2RN8 A;  5CO7 A;  4BE2 A;  2L3P A;  3I55 A;  1U8R A;  4OMP A;  2CZ1 B;  4M75 C;  1AWJ A;  2CP3 A;  2M0O A;  1H92 A;  1T3L A;  2VWF A;  2DL8 A;  1BI0 A;  4MMK A;  5HKC A;  1GBR A;  4PJO E;  2QI2 A;  1ZBX A;  1ZLM A;  2FZC B;  3LLR A;  2YUQ A;  2HSE B;  4J6X A;  3CCJ T;  3CD6 A;  3JCM b;  3M0U A;  2YDL A;  3MEW A;  3S3O A;  4A53 A;  2NUP B;  3EGX B;  4M7D F;  4XTW A;  1NEG A;  4DEY A;  2CP0 A;  3M0P A;  2F5T X;  1KJW A;  5A2Q E;  3OYA A;  1VQM A;  2EJF A;  1G83 A;  4FM4 B;  3VS0 A;  3M54 A;  1OZ3 A;  3EGU A;  2DA9 A;  1Q7Y U;  5A0L A;  3C94 A;  2DK3 A;  2ZPH B;  1UTI A;  3CMA Q;  1FMV A;  1X43 A;  3OA6 A;  3JB9 D;  4AG2 C;  1E6G A;  3F70 A;  3INZ A;  1RI9 A;  5CVI A;  1QMC A;  5IHN A;  3CCJ Q;  4AMC A;  4RCC A;  2DFU A;  4M75 D;  4HT9 A;  2KVQ G;  5J26 A;  2CRE A;  2DER A;  1M27 C;  1WJQ A;  1OYX A;  1WXU A;  2DIL A;  4EMG A;  1AT1 B;  4A4G A;  2DTI A;  5FU6 B;  1JJ2 P;  2Y90 A;  4PJJ A;  3ULR B;  2RHZ A;  2PVG B;  4KGZ B;  4M4Z A;  4AFQ C;  1TXQ A;  1WJR A;  5ECA A;  3FB9 A;  2RK2 A;  1YN8 A;  5GAN 2;  1B07 A;  2HDA A;  3G4S T;  2X9H A;  1WX6 A;  2EW3 A;  3OS0 A;  2NLU A;  2YXY A;  1Q86 C;  4M7D A;  4Q5W A;  1WFW A;  3HL8 A;  1MNE A;  4EMH A;  3OYM A;  2EQK A;  5KYN A;  1QKW A;  1XNI A;  2RK1 A;  4RG8 A;  2HL5 C;  1VQ9 Q;  1TTH B;  3ZL7 C;  3GOX A;  4M7D E;  1B7T A;  2LQ8 A;  5L8R E;  5C6S A;  5CR2 A;  2GTO A;  4XTZ A;  5GAN g;  2LJ3 A;  4HT8 A;  1EZZ B;  4L6V 5;  1QCN A;  2E4H A;  3JCM J;  5GAN 7;  3JB9 I;  1K9M C;  3H0I A;  1T0H A;  2FRW A;  2DTH A;  4JJB A;  2LZ6 B;  5LJ5 e;  2YRC A;  3C95 A;  2F2W A;  3MPU B;  3VJP A;  1WI7 A;  1OU8 A;  1NYG A;  2ZPB B;  2DPP B;  2RD1 A;  2DJZ A;  1NG2 A;  4JJD A;  1M2V B;  1WDX A;  2FPD A;  4MZT A;  3J80 E;  4AFS C;  2DL7 A;  4CRI A;  1QCF A;  1X6O A;  3JCM X;  4CI0 C;  2P84 A;  3A8G B;  1W70 A;  1YIT T;  5KE2 A;  3GF5 A;  2A08 A;  2ENM A;  1VQ5 T;  5HK0 A;  2LQN A;  3HHT B;  5GAN 8;  3RMS A;  4J9I A;  2HKQ B;  1Q81 C;  5LJ3 h;  3JSC A;  1NZ9 A;  1AZG B;  2KT8 A;  4E7L A;  4ANJ A;  3JCM g;  3QSU A;  2KSS A;  3EG3 A;  1H3Z A;  2X4W A;  4E6R A;  5D6W A;  3PMT A;  4FSS A;  1RL2 A;  2JOY A;  1VA7 A;  4HA8 A;  4HCB A;  4BAC A;  2JTE A;  4QQ6 A;  4JPB W;  4C8Q B;  3OYD A;  5CKF A;  4RUG A;  1UE9 A;  4FW1 A;  2RB6 A;  4RTX A;  3OYY A;  2L5Q A;  4LE9 A;  2EVR A;  4C5E A;  1PSF A;  2GCX A;  2Y4X A;  2QQR A;  1BK2 A;  3QXE B;  4ZNX A;  1YIT Q;  2BZY A;  3J7A F;  5FWC A;  4PJL A;  2AZS A;  3X25 B;  2FO0 A;  2ZPI B;  5EG2 A;  1N9S A;  1UB4 A;  4LXC A;  1NPR A;  1UHF A;  3GP8 A;  3FRN A;  4BI4 A;  2FHD A;  2VGN A;  1ZSZ B;  3QHS A;  5CKB A;  2E5Q A;  1VYV A;  2K2V A;  2DXB A;  4M78 F;  3OYE A;  2PUK B;  1W2B P;  4M7D C;  1PG5 B;  4F7U E;  2B8A A;  3V8K A;  2R58 A;  5GMK l;  1YJN Q;  4XU2 A;  4PJO B;  2LJ1 A;  4ZGJ B;  1JB0 E;  1FYN A;  1PD1 A;  5I2S A;  3CCM T;  1N9R A;  2F69 A;  2NUT A;  5CKE A;  3QG1 A;  1RLQ C;  1E7O A;  1OX9 A;  3BY7 A;  4ME7 A;  3HTR A;  5L23 A;  1QVF P;  2RJC A;  1PKS A;  3EG0 A;  3CPW S;  3VYH B;  2VGM A;  3MET A;  2CP7 A;  2C06 A;  2YLC A;  1K1Z A;  4EMK B;  2A0F B;  5GAM j;  2CUD A;  1JO8 A;  3QWY A;  2R5M A;  4OMQ A;  3CCQ A;  3I56 A;  3G6E T;  2RA2 A;  4PJN A;  1R77 A;  1PCX A;  3QYH B;  2B86 A;  2LT4 A;  1VQ7 T;  3BW1 A;  2RJE A;  3QUI A;  1JJ2 A;  2IG0 A;  3OYH A;  4M7D D;  2LCS A;  1M2O A;  3AHU A;  3GIB A;  3NHN A;  5KYW B;  5DLQ E;  1OEB A;  4OP0 A;  1IZ6 A;  4E2F B;  5IXB A;  4IUV A;  1AVZ C;  1VQ6 A;  2CUB A;  3EG1 A;  2NUP A;  2HMA A;  1RUW A;  3EGX A;  3C0C A;  3DKM A;  2GFA A;  5GAO m;  2LX9 A;  5LJ5 f;  4F04 B;  1VQL A;  2FYK A;  1M8V A;  2HQE A;  1QVP A;  2LCC A;  5GAN e;  1PNJ A;  1MMD A;  1VQ7 Q;  5LJ3 d;  3HFN A;  1AWO A;  4A4F A;  1U1S A;  1HXD A;  4E7J A;  3V8L A;  5FU7 B;  3VRY A;  2KBT A;  3LGF A;  3X28 B;  3PT9 A;  1YP5 A;  4QT7 A;  5KCH A;  2V8K A;  4HVV A;  1RLP C;  1ZBJ A;  5LL6 S;  4EDU A;  2RH2 A;  1S1N A;  4J7I A;  2DD5 A;  1AOJ A;  4JDS A;  1B3Q A;  5KYU B;  3CME T;  2LNH B;  4M7A E;  2ZAE A;  2O9V A;  1MND A;  3CCR A;  2F2V A;  1NJI R;  1V1C A;  3SFM A;  3CC2 T;  4BDZ A;  1MUZ A;  1QP3 A;  1VQK A;  2CP2 A;  2HQX A;  1X69 A;  1C1A A;  2L8D A;  3J81 E;  2RJD A;  1PHT A;  2ROL A;  2COW A;  2RM4 A;  2KT1 A;  1O75 A;  4J6W A;  3HKS A;  1VQO A;  3VS1 A;  4KUI A;  1OOT A;  4PK4 A;  1VQN A;  3H9N A;  2W10 A;  3JCM e;  2H3E B;  3ER0 A;  4FL6 A;  2QA4 A;  1IRX A;  2L3S A;  4QVZ A;  5GAN 5;  3CCE A;  1KK7 A;  4DOW A;  3CC4 A;  5D6X A;  4M77 E;  1X6B A;  2VB6 A;  3NTI A;  4RTW A;  2C0O A;  3FIF A;  4FIB A;  4NS5 A;  2P0P A;  1GCQ A;  3CC2 Q;  3EFR A;  4XQ3 A;  4XU3 A;  3A8M B;  1BCM A;  1D1A A;  4C8Q F;  1UGR B;  4KGX B;  1D3B B;  2P0Q A;  2KXC A;  5FW9 A;  4M78 G;  2GNC A;  3EGD B;  1G8X A;  3CCV Q;  1N8R C;  4NL3 A;  3ZEH A;  2QAS A;  1SHG A;  4NOY A;  2E5K A;  2IIM A;  3HRS A;  2PNI A;  4C0F A;  1FMW A;  3VKI A;  1TUG B;  3JB9 J;  4UC4 A;  3L2Z A;  4IIM A;  1W1F A;  3UPU A;  2KMT A;  1M2V A;  3JCM W;  1W2B A;  1RAC B;  2XKO C;  2DEU A;  4QW2 A;  1IB8 A;  2K2M A;  5CKD A;  3EHQ A;  3M0Q A;  4D6W A;  4DA4 A;  1PRM C;  3CMA A;  4QVC A;  4XTY A;  1OPL A;  1G2B A;  5I11 A;  2EGA A;  3VUZ A;  4N0A C;  4PKC C;  1OV3 A;  4FT2 A;  2HAX A;  2GBQ A;  4J7F A;  3N5B B;  4PJO F;  2RQV A;  3QJY A;  2EQM A;  4DBH A;  4F7U B;  3PIP A;  3QYG B;  1Q86 R;  1M1K C;  2M51 A;  4JRK A;  1LCK A;  4JLI A;  2LX7 A;  2DXT A;  1TUD A;  3CCL T;  5C0M A;  2DZ9 A;  1QVF A;  1QCO A;  2K57 A;  2O2O A;  3H8Z A;  4KGV B;  2EAY A;  3KBG A;  2VC8 A;  4HCK A;  3ZFJ A;  3RER A;  4C8Q A;  1Y7X A;  2FB7 A;  2GF7 A;  1NJI U;  2GQV A;  4FSX A;  2YT6 A;  1MV3 A;  1UJY A;  2E12 A;  5HY6 A;  3EFS A;  3OS2 A;  5FU6 C;  3QWX X;  1KG1 A;  1FWZ A;  4KH1 B;  1TU0 B;  2DBK A;  5GAN f;  3CCS T;  2PU9 B;  2VXF A;  1ZSZ A;  1M30 A;  4N4I A;  1RAH B;  4Y92 A;  3LGL A;  1YI2 T;  1PSE A;  1VQ9 A;  1KFZ A;  3TRE A;  1JXO A;  2V1R A;  3JB9 G;  3QDR B;  1S72 Q;  4IIO A;  4C0Z A;  1OUL A;  3OB9 A;  4PJO A;  1RAF B;  3CCU A;  3MP8 A;  2RF0 A;  3ASK A;  1UDL A;  2OTJ T;  4M75 G;  1D1C A;  3DB3 A;  4ELZ C;  1GCQ C;  3KXT A;  1OQK A;  2XDP A;  2MWP A;  3CCS Q;  2DF6 A;  2C0T A;  3JCM V;  3TU4 K;  2PTK A;  5GMK i;  2EKO A;  4P5N A;  2HD0 A;  2NUZ A;  2CZ0 B;  1QVG S;  4GY5 A;  1Q81 R;  3SDZ A;  1VQP Q;  4X34 A;  1KC8 R;  1U3O A;  1YI2 Q;  4EMK A;  2JJ9 A;  1BU1 A;  1K9A A;  1TSF A;  2VYT A;  1JEG A;  8ATC B;  3OS5 A;  1KIK A;  2JW4 A;  2MPX C;  2HEQ A;  3JAM E;  2JMC A;  1YIJ A;  4Z89 A;  2CH4 W;  3JCM f;  1VQ8 T;  4OMF B;  4RTY A;  3CPW A;  1X6G A;  2DKG A;  5IHK A;  3S3N A;  4BI8 B;  1E6H A;  4FW2 A;  4J9F A;  2E3H A;  3OBY A;  1ZUY A;  3EG9 B;  1UFF A;  3HRU A;  2KI7 A;  2EQI A;  1R0B G;  3PE0 A;  2BZ8 A;  5A0G A;  2QDY B;  4BE0 A;  1M8M A;  3MEU A;  5KYW A;  3VS7 A;  4MZP A;  2DBM A;  2LRQ A;  4M7A B;  3PMI A;  2KE9 A;  4RTU A;  4PFP A;  2LMJ A;  2ZPG B;  1BKB A;  2DVJ A;  3OYI A;  1RAD B;  2LP5 A;  5GAM h;  3WVD B;  2E3I A;  3NFC A;  5I22 A;  2DIG A;  1YBY A;  4E7S A;  2AT1 B;  3SD4 A;  3CBO A;  3RDV A;  1N5Z A;  4FYV B;  4F16 A;  1KD1 C;  2D6F A;  3DB4 A;  3JV3 A;  2D0N A;  2QTV A;  1GBQ A;  2KAF A;  4C0G A;  4Z02 A;  1BIA A;  4C8Q C;  3OS1 A;  3L2W A;  5KE3 A;  3LX7 A;  3VS5 A;  2ECZ A;  1WQ7 A;  1Z9Q A;  1K9M U;  1LJO A;  4QKU A;  5LJ3 g;  2ZPE B;  3VS2 A;  3L2R A;  4M77 B;  2RHX A;  2FVU A;  2JZ2 A;  2ZGW A;  1YJN A;  1Q82 U;  2O88 A;  4E47 A;  5KYU A;  3CPF A;  2YWW A;  2XU8 A;  1ZSZ C;  4OMO A;  4J8O A;  4RKU E;  2PVD B;  1WPY A;  3M59 A;  3OY9 A;  3CBM A;  1UEC A;  4Z88 A;  2JS2 A;  3FDR A;  1QQJ A;  2XMF A;  1G3Y A;  3V7C A;  2VKN A;  2GTJ A;  5CQY A;  1YWP A;  1WHH A;  1JBM A;  4ORZ A;  3CC7 T;  1WHJ A;  2XD0 A;  1YJ9 A;  2DEQ A;  1IRE B;  2J6K A;  3I55 T;  4PJO C;  3LH0 A;  3M5A A;  1UHC A;  4IUQ A;  1SRM A;  4D8D A;  3VV0 A;  2DL5 A;  3I35 A;  2F1L A;  2M02 A;  2MYS A;  1SF9 A;  4R56 A;  1UG1 A;  4CC2 A;  3X20 B;  3G4S Q;  1Z9Z A;  1PRL C;  2CT3 A;  1KQS S;  1VOM A;  1GRI A;  4B6M A;  4LDV A;  4C8Q D;  4BUG A;  2KDS A;  4F7U F;  1IGU A;  3QZ5 B;  3HSB A;  1BCO A;  4J9B A;  4X9C A;  2EQJ A;  2YRV A;  3JRZ A;  2QDL A;  4EMK C;  3R6O A;  2CZ7 B;  1G3W A;  1X2Q A;  2KXD A;  3CC7 Q;  1LPL A;  4PLI A;  2AKK A;  4J9E A;  3A8O B;  4NL2 A;  3PFS A;  2JM8 A;  1VQM T;  2JTF A;  3I55 Q;  2HBP A;  4A54 A;  3DLL A;  5GJW B;  4BDY A;  3EGD A;  1GFC A;  2K7A A;  4DQ2 A;  1BIB A;  1D0Y A;  1V29 B;  3P8H A;  5DLO A;  2HQH A;  4MZM A;  3L2Q A;  1ABQ A;  1LVK A;  2MWO A;  5GAO r;  1KC8 C;  1OZ2 A;  2L0A A;  1VQ7 A;  1KSW A;  3JCM c;  4PJO D;  1C0M A;  2LVM A;  5M9O A;  2EYQ A;  3S3M A;  1M3C A;  1NE8 A;  3PIO A;  2J6F A;  4LUE A;  2W0Z A;  3A8L B;  2DJQ A;  1K73 C;  2J06 A;  3V7S A;  9ATC B;  1CSK A;  5FRO A;  4JRQ A;  4KT0 E;  3MHX A;  2JTM A;  3RKX A;  1YNZ A;  2OTL A;  2QXF A;  2A7Y A;  4F7U A;  4L5G A;  2IVW A;  2V1Q A;  1VQ5 Q;  4JUV A;  5IAY A;  2CGH A;  5CCA A;  4M7D G;  1WHG A;  5J3B A;  3M53 A;  3UAT A;  2HKN A;  4XAX B;  3A8H B;  1V76 A;  3TQ7 P;  3G71 T;  3LH5 A;  2MF2 A;  3FC3 A;  3EG2 A;  2K3Y A;  1PM3 A;  4FT4 A;  4DEX A;  5DM7 R;  4LNP A;  4C92 E;  3KFV A;  4LDY A;  1G3S A;  3JCM Q;  3G7Z A;  3NGP A;  1N8R R;  2ED1 A;  3QII A;  4A4K A;  1IXD A;  1AEY A;  1IHW A;  3L42 A;  4IUU A;  3QJ6 A;  4OMM A;  4JRP A;  3THK A;  4MDW A;  4E7H A;  1IHV A;  1UGS B;  4J9G A;  2DD4 A;  3TSZ A;  3SHW A;  4X1V A;  3U23 A;  4M7A F;  4B9X A;  5LJ5 j;  4JZ3 A;  7AT1 B;  2AHJ B;  3OYC A;  3G71 Q;  3CXC S;  1Y96 B;  2JT4 A;  3RKW A;  1W4S A;  2FG0 A;  4KBM B;  4R55 A;  3CCV A;  1AHJ B;  1I1J A;  2XG8 D;  3OMC A;  5GMK h;  4XU1 A;  4RMO A;  5LJ3 e;  2GQI A;  4O6J A;  3CCM Q;  2KRO A;  4J83 A;  2K3X A;  3REA B;  1N6A A;  3QBY A;  2E1H A;  2K5F A;  1M1K R;  2G6F X;  1JQQ A;  3OSV A;  4AT1 B;  3MEA A;  3T9N A;  2JMA A;  1H8K A;  1CKB A;  2GFU A;  5FRM A;  4M77 F;  2CP6 A;  1D09 B;  2HCK A;  3AT1 B;  4Y28 E;  1BYM A;  2QEX T;  4OVA A;  2BIV A;  2BTT A;  3G6E Q;  4OML A;  2FEI A;  3REB B;  5HCK A;  1ZA1 B;  3EG9 A;  1WHK A;  5KCO A;  1RAI B;  5CIU A;  2R57 A;  1M90 C;  1QWF A;  4M7A A;  4ZN1 A;  2LT1 A;  3QDF A;  1WIE A;  3TEE A;  2MCN A;  5IXF A;  2EYW A;  3CEY A;  1MMG A;  3RNJ A;  2K5L A;  3OYN A;  4ELY C;  1JRI A;  2O4X B;  3UA6 A;  1NLO C;  3MO8 A;  4IUT A;  4C0D B;  3HRT A;  1KHC A;  2QEX Q;  3CPW P;  4OF1 A;  1QW1 A;  1WGS A;  5IN1 A;  4JZ4 A;  4LDX A;  3FJP A;  1YHQ T;  1M3B A;  2YUP A;  1I07 A;  1VUB A;  4DBF A;  1MGQ A;  5GAO q;  2F2X A;  2CDT A;  2DE0 X;  2LDM A;  4C5H A;  3ME9 A;  4M77 A;  2DET A;  6AT1 B;  8AT1 B;  1G5V A;  1XJW B;  1N8R U;  4FYX B;  1NYF A;  1S72 A;  1FX7 A;  3NMZ C;  4RG2 A;  2P4R A;  3OYG A;  4PFZ A;  3RIR A;  3TSW A;  2HSP A;  5GAN 4;  2VAS A;  2WAC A;  1TH7 A;  1WA7 A;  4PL6 A;  3CME Q;  2M1H A;  3X24 B;  4TVR A;  1SPK A;  1HYO A;  3E2U A;  2EBP A;  2YRD A;  3CCQ T;  3I56 T;  4KUD K;  1JXM A;  4RTT A;  3RUX A;  1WJS A;  1YHQ Q;  3BE3 A;  2HBW A;  3L2U A;  2MOX A;  1QLY A;  3RES A;  1VQP A;  2KEA A;  2DO3 A;  1YI2 A;  1AWX A;  1OU9 A;  3PVQ A;  3ZBD A;  2P0K A;  3P8D A;  2QYZ A;  3EHR A;  1M1K U;  2DVE A;  2EKH A;  1VQ6 T;  3M57 A;  5EC7 A;  2X35 A;  2ABL A;  3OW2 S;  3JCM P;  3O8V A;  1KD1 R;  2X4J A;  1P92 A;  2V8J A;  1T0J A;  1VQL T;  1BI3 A;  1WXB A;  2VXE A;  5IT9 E;  3EFO B;  3I5S A;  2JUF A;  1GL5 A;  4LUD A;  3JB9 H;  4KH0 B;  1UJ0 A;  2COY A;  2YHT A;  4II1 A;  4M75 E;  5CK9 A;  2JS0 A;  1VIF A;  2A36 A;  2OX7 A;  5GAN j;  4OB2 B;  1ZSG A;  4XTU A;  1AWW A;  2KY9 A;  2F5K A;  2OAW A;  3CCJ A;  4HXJ A;  3MP1 A;  1YJW T;  2DXC A;  4JRI A;  2K6D A;  1U1T A;  4ATO A;  1HD3 A;  4M7A C;  5LJ3 f;  2EWN A;  4OB1 B;  1M1G A;  1EFN A;  3L1A A;  1PC0 A;  1M4Z A;  3UWN A;  3OQ5 A;  4C92 B;  3CCR T;  2DL4 A;  2DLP A;  2OI3 A;  2VUB A;  2QQS A;  1D0Z A;  5GAO l;  1NM7 A;  1GFD A;  2K3B A;  2RHY A;  1KHI A;  1VQK T;  4GLK A;  1I5L A;  2XIC A;  3SWN B;  1OX8 A;  1SHF A;  2XDD A;  1X01 A;  2LNV A;  4A4E A;  2XID A;  4ZGE B;  2LJ0 A;  4AG1 C;  2J6O A;  1VQO T;  1YJW Q;  1VQN T;  3TVT A; 
#chains in the Genus database with same CATH homology
 2O88 A;  3H0F A;  3I5R A;  2AK5 A;  1XOV A;  4AFU C;  4OMO A;  1UEC A;  2D1X A;  4Z88 A;  2JS2 A;  1NLP C;  2XMF A;  2VKN A;  1BBZ A;  2GTJ A;  2ROT A;  4RTZ A;  2LJ1 A;  1YWP A;  4ORZ A;  1K76 A;  4RTV A;  2RQT A;  1W6X A;  1FYN A;  1J3T A;  2J6K A;  1NEB A;  1UHC A;  2AZV A;  1SRM A;  1CKA A;  2PZ1 A;  4D8D A;  2X3W D;  2DL5 A;  1RLQ C;  3I35 A;  1E7O A;  1UG1 A;  5L23 A;  4J9C A;  2CSI A;  4CC2 A;  1Z9Z A;  1PRL C;  2CT3 A;  1PKS A;  3EG0 A;  1ARK A;  4WCI A;  2EPD A;  2DYB A;  1GRI A;  2RMO A;  1K1Z A;  2CUD A;  1JO8 A;  4J9B A;  3QWY A;  3M0T A;  1PWT A;  4OMN A;  1PKT A;  4OMQ A;  2QDL A;  1X2Q A;  2KXD A;  2B86 A;  3SEM A;  2AKK A;  4CC3 A;  4J9E A;  1U5S A;  2JM8 A;  1U06 A;  2DX1 A;  5GJW B;  2LCS A;  4CC7 A;  1GFC A;  2K7A A;  2EYY A;  3NHN A;  2NWM A;  4F14 A;  2EGE A;  1OEB A;  1JU5 C;  1A0N B;  5IXB A;  2AKL A;  1AVZ C;  1ABQ A;  2CUB A;  3EG1 A;  4LN2 A;  1RUW A;  2L0A A;  3C0C A;  1KSW A;  2A28 A;  1ZX6 A;  2EYX A;  2EYZ A;  1X2K A;  1M3C A;  4F17 A;  2MIO A;  3CQT A;  2J6F A;  2X3X D;  2W0Z A;  4LUE A;  2KRN A;  1PNJ A;  2DJQ A;  3PVL A;  2J06 A;  4CC4 B;  1T3S A;  4J9D A;  1AWO A;  2KR3 A;  1CSK A;  2RQR A;  2L2P A;  2CSQ A;  3VRY A;  2RQW A;  2KBT A;  1YNZ A;  1YP5 A;  4QT7 A;  1HSQ A;  2V1Q A;  4HVV A;  1RLP C;  1ZBJ A;  3VRZ A;  2YUN A;  1S1N A;  2JXB A;  3RBB B;  1AOJ A;  2FPE A;  1B3Q A;  2SRC A;  1UGV A;  2DM1 A;  2EGC A;  4GBQ A;  2LNH B;  2O9V A;  2DL3 A;  3UAT A;  2F2V A;  1V1C A;  1VYT A;  3LH5 A;  2DRM A;  1MUZ A;  3EG2 A;  2ESW A;  1X69 A;  2ED0 A;  1SSH A;  4DEX A;  4K11 A;  4LNP A;  1PHT A;  2ROL A;  3H41 A;  3KFV A;  2KT1 A;  3NGP A;  3VS1 A;  1OOT A;  2ED1 A;  1AEY A;  2H8H A;  2KGT A;  4R0K A;  2FPF A;  2W10 A;  3R6N A;  4OMM A;  3THK A;  1FMK A;  2L3S A;  5GJV B;  4D8K A;  5FWB A;  4J9G A;  2CT4 A;  3TSZ A;  3SHW A;  4X1V A;  4EIK A;  3U23 A;  4JZ3 A;  3FJ5 A;  1SRL A;  1X6B A;  4RTW A;  2D8J A;  2C0O A;  2FRY A;  1H3H A;  1AD5 A;  2JT4 A;  1GCQ A;  2RN8 A;  2FG0 A;  3M0R A;  2L3P A;  4OMP A;  2K79 A;  1I1J A;  1AWJ A;  1H92 A;  1T3L A;  2VWF A;  2DL8 A;  1GBR A;  2KXC A;  5FW9 A;  2GNC A;  2GQI A;  2KRO A;  1ZLM A;  2JM9 A;  1SHG A;  2E5K A;  2IIM A;  2J05 A;  3REA B;  2PNI A;  2YUQ A;  2G6F X;  1QWE A;  2L3Q A;  1JQQ A;  3M0U A;  2YDL A;  2JMA A;  1H8K A;  1CKB A;  3GBQ A;  4IIM A;  2O9S A;  1W1F A;  2HCK A;  1NEG A;  4DEY A;  2LQW A;  3M0P A;  1OPK A;  2A37 A;  1KJW A;  2DMO A;  1QKX A;  2K2M A;  3EHQ A;  2BTT A;  3M0Q A;  4OML A;  2FEI A;  4A63 B;  1G83 A;  1PRM C;  3REB B;  5HCK A;  3VS0 A;  2K9G A;  1OPL A;  1G2B A;  3VS3 A;  3VS6 A;  2EGA A;  5I11 A;  3A98 A;  1OV3 A;  3EGU A;  2GBQ A;  2DA9 A;  2RQV A;  1UTI A;  1QWF A;  1X43 A;  4KRT A;  4AG2 C;  1M3A A;  1E6G A;  1VYU A;  1RI9 A;  1WIE A;  2M51 A;  5IHN A;  1LCK A;  2MCN A;  5IXF A;  2EYW A;  2LX7 A;  1TUD A;  2O2O A;  3RNJ A;  4HCK A;  2CRE A;  2M0Y A;  1M27 C;  1WXU A;  2DIL A;  3UA6 A;  1NLO C;  1YWO A;  3M0S A;  4JZ4 A;  3ULR B;  2YT6 A;  1MV3 A;  2KNB B;  1UJY A;  4M4Z A;  4AFQ C;  1Y57 A;  2CH4 A;  1M3B A;  4GLM A;  5ECA A;  3UA7 A;  3QWX X;  1YN8 A;  2YUP A;  1I07 A;  4AFZ C;  4JJC A;  1B07 A;  1MV0 B;  5IH2 A;  2HDA A;  1WX6 A;  2EW3 A;  2DBK A;  2F2X A;  2CDT A;  2DE0 X;  1M30 A;  1WFW A;  1NYF A;  4Y92 A;  3NMZ C;  2O31 A;  2KRM A;  2P4R A;  3TSW A;  2BZX A;  2HSP A;  1KFZ A;  3VS4 A;  2RQU A;  3I9Q A;  1JXO A;  1QKW A;  2V1R A;  2RNA A;  1WA7 A;  4IIO A;  2RPN A;  1I0C A;  1SPK A;  2VVK A;  3ZL7 C;  2EBP A;  1X27 A;  2RF0 A;  2GTO A;  1UDL A;  1JXM A;  2LJ3 A;  4RTT A;  2J7I A;  1GCQ C;  2HBW A;  3H0I A;  1T0H A;  2MOX A;  1QLY A;  2FRW A;  4JJB A;  2KEA A;  2YSQ A;  2DF6 A;  1TUC A;  2C0T A;  4Z8A A;  1AWX A;  1ABO A;  3NPF A;  2PTK A;  3PVQ A;  2LZ6 B;  2NUZ A;  2F2W A;  1U3O A;  3EHR A;  1SEM A;  1WI7 A;  2KRS A;  1NYG A;  2D8H A;  1HJD A;  1BU1 A;  1K9A A;  1JEG A;  2EKH A;  1NG2 A;  1KIK A;  2JW4 A;  1UUE A;  2HEQ A;  5EC7 A;  2JMC A;  4JJD A;  4Z89 A;  1WDX A;  2CH4 W;  2ABL A;  2FPD A;  4HVU A;  4AFS C;  2DL7 A;  4RTY A;  1QCF A;  1T0J A;  1X6G A;  1K4U S;  4ESR A;  1WXB A;  5IHK A;  5IHI A;  3I5S A;  1E6H A;  2I0N A;  4J9F A;  1GL5 A;  1WLP B;  4LUD A;  1ZUY A;  1K0X A;  1UFF A;  1W70 A;  1WXT A;  1ZUU A;  1UJ0 A;  2BZ8 A;  2EQI A;  3PE0 A;  2JS0 A;  2A36 A;  1M8M A;  2A08 A;  3IQL A;  3VS7 A;  4HVW A;  2ENM A;  1ZSG A;  2LQN A;  2DBM A;  1AWW A;  4J9I A;  2OAW A;  2KE9 A;  4RTU A;  2LMJ A;  4HXJ A;  1AZE A;  2DVJ A;  3O5Z A;  2LP5 A;  1AZG B;  2KT8 A;  5I22 A;  2K6D A;  2KYM A;  1HD3 A;  1IO6 A;  3EG3 A;  1N5Z A;  4E6R A;  1ZUK A;  2KYB A;  1EFN A;  4FSS A;  1VA7 A;  2JTE A;  4F16 A;  2YUO A;  4JPB W;  1BB9 A;  2OJ2 A;  3JV3 A;  2D0N A;  1TG0 A;  4RUG A;  2DL4 A;  1UE9 A;  4RTX A;  2DLP A;  1GBQ A;  1YCS B;  4LE9 A;  2OI3 A;  2EVR A;  3H0H A;  2SEM A;  1BK2 A;  1NM7 A;  2K3B A;  1GFD A;  4ZNX A;  2BZY A;  3VS5 A;  1GCP A;  2ECZ A;  5FWC A;  1K0S A;  2C0I A;  2AZS A;  2DRK A;  1SHF A;  1Z9Q A;  1WYX A;  2FO0 A;  4J9H A;  3UF4 A;  2LJ0 A;  3VS2 A;  2DNU A;  1UHF A;  4AG1 C;  2J6O A;  2GGR A;  1Y0M A;  3TVT A;  1VYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...