2DJUA

Solution structures of the fn3 domain of human receptor-type tyrosine-protein phosphatase f
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
106
structure length
106
Chain Sequence
GSSGSSGPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTEGPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-type tyrosine-protein phosphatase F
publication title Solution structures of the fn3 domain of human receptor-type tyrosine-protein phosphatase F
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 106
sequence length 106
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2djuA00
4M3KB 4ZOBA 3GO1L 4PLOB 2I5YL 5FYJU 5HHMB 1KULA 1HSAB 1FL6B 3C5ZC 1LO0H 1NGWB 4IS6B 4I2XA 4YWGH 4PJ7E 4H8WH 4OCXL 4ODXB 3RI5F 5GS0H 1DVFA 1HZHH 3TNMB 1HHKB 1KV3A 5DJCB 3U7WH 4NQEB 3C09C 3QXAA 1DFBL 1LO3L 1WUNT 2ZUYA 4ZQKB 1K8IA 5EUOA 4J3UA 1FLRL 1IGCL 4HPYL 4ZTOL 1KJMA 3ILPA 4M48H 3RU8H 5EIQA 4JFZL 4KPHH 4AIOA 3T1WA 2YPLA 2Z31A 1HXYB 2Q87A 1OTTD 4LBEA 4XPBL 3S35L 4D8PA 3ULUD 2VZOA 3I6LD 4EDXA 5KVGH 3LB6D 4UAOB 2CLRA 4OSUH 4C58B 5I1KH 2FATL 3MYZA 4MSWB 3RVXC 2VITB 2EKSB 3C5ZA 3GM0A 2JCCB 2FBJL 4EQ3A 5C9JA 1HHJA 5KS9B 1KPRB 1RY7B 4JRYB 1MHHB 4OZHE 1M7IB 3O9WC 1IQDB 5KANG 1PW3A 2FEEL 4XH2B 4MD4A 4GG6B 4JKMA 4ENED 1NBVH 5D2LB 1W8OA 3LKSB 4H88L 1HNFA 3TBTB 1PKOA 5CINL 1L7IH 2G9HA 5DUBA 2FWOA 1T22A 1QO3A 5CJ8A 5F7KC 2AJYH 3C60D 4Y88A 3BE1L 1UGNA 4DKEH 1U3HC 3QO0B 4RFEA 2G60H 4X83A 5DO2D 4WJ5A 2GSGB 2OR9L 2MWCA 4J6RH 5EU5B 5GGRA 5CBEA 4V2CB 1RJLA 3BN3B 2HRPL 1WICA 4WFHD 5DJ2B 3JXAA 4APQD 1WWCA 2W60B 1IFHH 1VADB 2DIAA 3KPPB 1N6QH 5I74C 4J23A 5DMYA 5IWLC 2VDKH 1C08B 4TNVK 5T3XE 3EOTL 2NZ9D 3IF1B 4I0PB 4KRPB 3ZLQC 4JEGB 1CGTA 3O9WA 1YQ2A 4HK0A 4XAKD 3P0GB 2Q86B 4X4ME 4RWYL 4W6WB 4Y4HB 3PWPE 3NCJH 1YEKH 3RKDC 1BREA 3TYGH 2AXFA 3MJ7A 1J0IA 4KAQL 4XCNA 4HIEA 1OT1A 1P5VA 3LKOA 2HFFB 3RUGB 2GFBA 5ICYA 2IADA 1FL5B 1U3HA 3H3PH 5I71C 4TUOA 4BUGA 3MRLA 3W5MA 4M6OL 3WEXA 3VD3A 2VDLH 2XTLA 1UCBH 4YXLL 2C1OA 3O41A 4U1SB 1CLOL 5C0IA 3GMMA 5K9QI 3T2OA 1HXMB 1F8TH 1SYSA 5IWLA 2EIDA 1QFHA 3PHSA 2XWJB 1I8KB 3BP5A 4GXUN 1S9VB 1ZS8A 4J1UA 2EXYC 4N8CL 4UV4L 4K8RL 2LQRA 3AREC 4L9LB 4PRDA 4IRZL 2VISB 4WENB 4OLXH 4MX7A 2LAGB 4P2QB 4FA8A 1PDKA 1BZQK 5D1XB 3MRNB 3S98A 3PHQB 3DURA 1EV2E 4W4NA 1LWRA 3RGVD 2ESVD 1JF1A 1TVBB 3ESUF 2XN9D 5D7LB 3REVA 3V7MA 1A3RH 3R0MA 1CI5A 4LSRH 3RIFK 3E3QE 4N9GB 4YXKH 3KDMB 4S1SL 4DZ8A 2VZUA 2GJZA 4Z7UB 3AY4C 4NO0B 1XCQB 3KPRA 1TDQA 5EC1B 2J5LC 3SY0A 3VE0A 3PHOB 5D7JC 2D31A 3D39D 1INDL 3PDGA 2GKIA 2OZ4L 1R3HA 4QXTB 1YNKL 3AREA 1A2YA 1PG7H 1XF4A 4X8JB 4JO2H 4LLAA 1YPZE 3BYYA 4NUJB 1U58A 3ZKMC 1ND0A 1F3JB 2JB6A 3LMJL 2YBRB 4NKDB 1L7TL 2Z8VC 4HS8L 1UKQA 1YEIH 4U1NA 4LLQB 4XBPB 3RX7A 5DWUL 1QHPA 1A6UL 1MEXL 4PJDA 5HDBF 5J6GA 4OZIA 4I77H 3QWOB 4OFIA 1P7KB 3C2SA 3U82B 1GGCH 2IQAB 2IAMD 1HHGA 2XXCB 3AY4A 5DJYA 1QBLL 2VE6A 2EO9A 3LS4L 5D7JA 3VXME 4L4JA 1OTSD 3RHWF 1DQLL 1XF5A 1JMXA 1S78D 4UT9H 5F9AC 1LD9B 5LGJB 1HCFX 1X3DA 1A6WH 4PS4H 3KNBB 2VKXA 3U79A 1ZVYA 1N0XH 2G5BB 2ENSA 3WD5H 1LEIA 2X89A 5F44A 1U8NB 4ZFOA 4NQDA 5DRXA 2D0FA 1BFOA 4IRSD 2JJSC 4U05A 1TFHA 3CLEH 1Z2KA 3L3OB 1T0MB 4WU5B 4XVTL 2DKSA 3HPJA 2MNUA 1PAMA 4WDIB 3L95A 3FB5B 4MXVE 2YD8A 5I8OH 1ADQL 4JJHA 1YYMH 3L3HB 3V6BR 1C5CL 2HH0L 1K85A 4Z95H 4L8SB 5GGUB 4QRPA 2XZQL 1IT9L 1P69B 2W38A 5I19L 1UWGL 3QDGD 4OCXH 3HLAB 3IGAA 1MI5E 2EDHA 4J4PD 1O0VA 1OP3K 1X5JA 1A9EA 3T2NL 3GHBL 3FB6A 1DFBH 1QSFA 1WCQA 5JIPA 1IGCH 5L2JB 4ZTOH 2JJSA 4NZTL 5EIIA 2VDQH 4LKXA 5DJ6A 5J8OA 4HEPG 3P77B 3N1FC 3QQNA 2ADJB 5EG6C 1IZJA 2NR6D 3HUJB 2HT4C 3BKJL 3V6OE 5EBWB 4WY7L 3GIVA 4JFHE 4XPBH 3S35H 1T1ZA 1NGQH 2LAAA 2CMRL 1PGRB 4U1MB 1SJHB 2NY4B 3ZTJG 2PTTA 4YHZL 1NKOA 5MEPB 2FATH 5D71L 1FJ1B 3UTOA 3GSVA 1MY5A 4X8XA 2WQ8A 2FBJH 4TSBL 2P1YA 1H0DB 1QP1A 2HKHL 4K8RC 5L7XL 3OJDB 1U8MB 3KYNA 3KXFD 2YXFA 4GMTL 3PF2A 5CINH 1CTNA 2F9BT 3UP1A 4Q0XL 1BVLA 5C0DB 3K80A 3QI9D 4UDUA 4K23L 2VKWA 2W0FA 3MBEB 4PJXB 3VFMA 1XF3B 5BRZD 5HHOA 3RWJA 2HWZH 4DQOH 3ABZA 5IR1A 1S9YB 5HHQB 3FN3A 2OR9H 2C3VA 43CAA 3OG4B 4X9FA 1EEYB 4CVWA 5ERWA 4W6YB 2HRPH 1ORQA 4ZUUA 5JHDD 2W0LA 4Q6IB 3BGMB 2EDNA 3BP4A 3VH8B 4WNQB 3WHE0 4DCQB 2H3NA 2WWMD 4NO2B 3BWAA 1JIBA 3Q5OA 5ANMB 1KACB 1TQBB 1WC7A 4FXKA 3MLZH 3ARRA 4Q58C 3CDFA 4RWYH 12E8L 3V6FB 3ULVF 1OTUC 5TQ0L 4QHLB 1YEDB 3IFPB 5IHUL 4KAQH 4KRMB 4D9RD 1BJ1J 1ZTXH 4Q2ZB 3LDBB 5TJWK 2BNRD 4X99B 2NNAA 5DMGD 2CDEA 3HE7D 1IL1B 3VGFA 4LU5H 2RFXB 4M6OH 1DUYA 3FRUA 4PGJA 3D18B 2VDNH 4RMRA 1F97A 5E99L 3MA7B 4YXLH 2NX5A 4XCYA 5KVFL 4OD3L 5F9OL 1CLOH 3KHOA 1FO0B 3O45A 3W11D 5DK0B 1MFCL 1JGEB 5IB3B 1D5IL 5JO5B 3VCLA 4LCWE 2OZ4A 3VXSB 4AM0B 4JPWL 5GJSH 4ODHL 3T4YA 3GB7A 4PJIF 4N8CH 4UV4H 3MRJB 3DXAE 4K8RH 3BO8B 4HIJA 4POZC 4CJ1A 4QHNA 5F97E 1I3UA 4IRZH 1CDYA 4WUKL 5FYLD 1KCUH 4MQTB 3WL9A 1F3RB 3SJVE 1M6OA 5TDNA 2DBLL 3QHFH 1V3LA 3FCTB 5GS3A 5E2TL 3PWNA 1F4YH 3UTTA 5FUCE 3CU1A 4GOSA 2YD9A 1S5IL 4O9HL 1FFNA 1V05A 4X7EC 4L8CB 5SX5K 2X4SA 2F5BL 4C56A 2AERT 4S1RL 1U2CA 4U31A 3PIQB 4S1SH 2NW2B 3C9NB 4XX1E 4QT5A 1CLCA 3NGBB 2BC4A 3DGCR 3QB7C 4J8RB 1S5HA 4GAYB 1INDH 3TVMB 1T4KB 5IVNA 1UXSA 3I3BA 1NAKH 3UJTL 3WFEL 2C5DC 4B5EA 1ONQB 2XWTA 4OZGF 4JG0L 4KI5F 1T2QH 4P57A 4DN4H 4OQTH 4RIRB 1C5BH 4H20L 4UBDD 4YGVA 3LMJH 3QNYA 3IVKB 2HG5B 2XTJD 3U4EA 1A5FL 4ZNEE 4XMKL 3NZHL 2JB5L 4PJ9B 4X4ZA 3TZVB 4P3CL 1MCEA 4LSSL 4U3HA 5FXCH 4HPOL 1OW0C 1NCWL 5DWUH 3M45A 1A6UH 1V5JA 1MEXH 2ARWA 1NSNL 1IM9A 5EH1A 5DT1L 4GW5A 4DOHB 4HGWA 3WCYA 1RZ7L 5GGSB 4X6BA 1QVOA 1AQDA 2GYSA 5J4MA 1QBLH 5EU6E 3FZUC 4L3ED 3RRQA 3LS4H 43C9B 4RMSA 1EBAA 3O8XB 4OBSA 3ARFC 4NJAL 4LIQL 1DQLH 1WAAA 4GH7B 1UB5B 4DKDC 1TITA 5F6IB 5ILTL 4MLIA 3QJFB 4L8BB 4XB7A 1KJ3L 5DHYA 3RQ3A 2C3HA 4U0QB 2HTLD 4AEEA 4M7ZB 4MVBD 1T5WA 1RVFL 3DX6A 1OW0A 4HH9A 4XVTH 3BGFB 3GIZL 4I2XB 1I1FA 5MEQA 1BX2A 4X9IA 3U7YL 3ZTJH 1ADQH 3QXAB 3P9MA 3V79C 1C5CH 1QFPA 2HH0H 4U7MA 3WFCL 4FFZH 5FKAA 4XC1L 2CPCA 1KJMB 3IKCA 1IT9H 1OARL 1LE5A 4D2NA 5I19H 3ARFA 3WFHB 4GQ9H 5DEFB 2YPLB 5HHMD 3F5WA 1MRCL 2RBLA 3T2NH 3GHBH 1G7PB 4LBEB 4D8PB 4PJHA 1JGLH 4EDXB 2CLRB 3GRWL 4NZTH 4NHUA 4JN1L 3C8DA 1OGAB 3GJFA 3C5ZB 4QRSB 3FO0L 2MMXA 3EZ8A 4N1CA 5C9JB 1HHJB 1BQHA 1T20A 5H37H 2X9XA 4NHCH 3BKJH 2IG2L 4LRNL 3CXHK 2CMRH 2P45B 3CMGA 5JXAL 3OR6B 3RZCD 5DUBB 1YZZA 5D71H 4P59L 1T22B 4D0BA 1QO3B 5JZ7D 1EZVY 2ARJA 2EH7L 4TSBH 4PRHB 3IXAB 4UQ2A 2HKHH 2AV1A 3H6JA 1X4ZA 4RFEB 4ZDHA 5DA0B 3OZ9H 5GS2D 4CVXB 2WSKA 4JRYD 5CBEB 4GMTH 4KDWA 1RJLB 3DIFA 1XZ0B 3QDMB 1H3UA 1X7QB 4Q0XH 5T3XL 4HUUB 4HC1H 4K23H 1S9WA 5GS1B 5AZEL 1K8DA 4O2FA 4S11A 5IFJB 3DHMA 5C6TL 4WI2A 3V0VA 2FJGA 1EUUA 4L4VD 3GJFH 1Z0MA 2VMFA 1B6UA 1EEZA 3O9WB 4HK0B 4HUNB 4I8DA 5KOVC 4CVZA 4LSPL 4CDGC 5IK3B 2AK4E 1QR1A 4PGBA 2OYPA 4QHMA 1F4HA 2AXFB 3V9FA 1N5YL 5EZOL 3LKOB 3LKQA 4JFYA 2GFBB 2IADB 4XVUD 4S2SA 3L6FA 1U3HB 4KTEL 4TUOB 3MRLB 3WBDA 4FTVE 5CJBA 1BQSA 4I0PD 5JDSA 1OSZB 2QJDA 3LHPL 12E8H 1FFOA 4P4RA 3PXHA 2B0SH 3K4AA 2IANA 2C1OB 4PRBA 5TQ0H 1I8IB 3B2VH 4Y4HD 5IHUH 2DMCA 2YRZA 5C0IB 2CD0A 3VGAC 5JHLL 1SYSB 1OLLA 1IGIL 1E4JA 2QEJA 3I9GH 1TNNA 1I3VA 5E99H 1WVZA 5KVFH 4NGHH 4PRDB 4OD3H 2YWYA 5F9OH 3WIFA 4MX7B 5I0ZA 3C87A 2XACC 2YZ1A 3T3ME 1MFCH 2ZUUA 4NQTA 2DQEH 1CG9A 1D5IH 2EYRA 3DURB 3EOYG 1JYNA 3IDNA 3B8YA 3KYMB 5GZOD 4ODHH 2BY1A 2IEPA 2K1MA 1GZQA 1T0NA 3QG7L 4YC2B 4BK4A 2W0KA 4WUKH 2FLBT 5A1AA 1B88A 4RFNC 5CD3A 3F7YA 5EOQL 2XA8L 4P2QD 2HP4A 2DBLH 3KPRB 5D1XD 5E2TH 3H42L 4F9LC 1OB1A 1BOYA 3RI5K 1S5IH 4O9HH 5F70A 1P53A 1U42A 1R3HB 4ZUTA 3DVIA 1YN7A 3PQYA 5LXGL 1A2YB 1H5BC 4CVUA 1XF4B 4LHUG 4S1RH 2V2WA 5D7LD 3AU1A 1U58B 1ND0B 2JB6B 5E7BA 5F89B 4PJBF 3I84A 1FPTL 1SEBA 3TIDA 4YDLB 2A9ML 2AQ1A 4NO0D 3UTPE 3UJTH 3TH3T 3WFEH 3ZDXF 5J9PA 3G5XA 4PJDB 4NM4L 4JG0H 5J6GB 4KDTC 4HV8B 5FHBL 3WNMA 4OZIB 3QEQE 2ATPA 3O6KL 4PJ7A 4H20H 4WFFD 1HHGB 1A5FH 4LSUL 3NZHH 1QEWA 2JB5H 2J5LB 5DJYB 2VE6B 4LSSH 1XR8A 4FN0A 5FO8A 4F9LA 1NCWH 4G6FB 3DMMB 5HYQA 2A0LC 3VI3F 3OKKA 1RAMA 1KTLA 4XXDA 5DT1H 1H5BA 4A6YL 4UOJA 4OLUH 4PJCE 1AKJB 1LEIB 4ETQA 3DUHA 3O0RL 4NQDB 5DRXB 4G9DA 2GEEA 4NJAH 4LIQH 5L9DL 5F7DA 4F7TA 5KZCB 3BDBA 3VWJB 5F7LB 5IW3A 3S5LA 3HMWH 3KAAA 3RNKB 4KDTA 2EDWA 1KJ3H 1P84J 4XHJD 5TDPB 2ZJSH 4OZHA 5L8LB 4W6XB 5I1EL 4IM8A 5F71A 5IBLD 5J0BA 4MNHA 4F9PA 2FB4L 3L3KA 4NCDA 1RVFH 1WK0A 2BY2A 3HI1B 5GZNC 1HYSD 3S96B 3V4UH 4F15C 3U0PA 1A4JB 3IGAB 4X80L 2BOCB 2Z93A 3U7YH 1P5UA 1QSFB 1OF2A 3WFCH 3LN4A 4XC1H 3DETD 5D70L 1MCOL 4OAWB 1W0VA 1F3DH 2Z35A 3RWEB 5I76A 5D96B 2DM2A 5EFIA 4LMQE 3WLWD 2QV2A 1CD9B 3GRWH 2XA3A 4LOUD 4X4MA 2PTTB 4JN1H 5DJAA 4HLZH 3PWPA 3GSVB 4XWOC 1B6DA 4HIIA 5DZLA 3FO0H 2YN5A 4QWWC 4H1LA 2B4CH 2IG2H 4LRNH 3E1F1 4DVRH 5EBMA 3PWVA 5JXAH 1BVLB 4P59H 1D9KC 5TE6L 3MRHB 3MUGA 2NY4D 4MXWL 4UDUB 1P7QA 3A67L 2EH7H 1JGDA 2P8MA 2RCSL 2W0FB 5F7NC 5CD5C 3E3QC 3B9EA 1AR2A 3HHRB 3RWJB 4PRIE 1NC4B 4ZAKC 5K9KA 2C3VB 1A21A 4X7TA 1A6TB 5ERWB 4RMUA 4WO4C 1FBIL 3OGCB 2XV6B 1GOFA 5AZEH 1T66C 5C6TH 2H3NB 4O4YL 3BWAB 3OB0H 3B5HA 4Y1AE 2Y9RT 4UOW1 5IVZA 3U0WL 4OIBA 3MBED 4FXKB 4CU6A 2QSVA 3HKFA 5FK9A 2Y5EA 1HH9A 1D9KA 2X05A 4HQQH 5EZOH 4I3RL 1BOGB 3FQWB 2NNAB 1QA9B 4KDVA 5CMAB 2CDEB 4OZFA 1MHCA 1YA5A 4KTEH 4HIHB 2EDTA 1MRFL 1DUYB 4YBQC 1JZ7A 3NIFF 1A1OA 4XCYB 3WFBL 2ZNXA 1SMOA 4ZD3L 2JELL 3EO9L 2DICA 4WO4A 3MZTA 5I18L 4BZ2H 1H8NA 5LCVL 2BXYA 4FQHA 4JM2D 1RHFA 1YPZA 3RHWK 4FFYL 1JNLL 3GB7B 2EDOA 4HIJB 1MCLA 4QHNB 2H45A 1SY6L 4U7KA 1C5DA 4NRXB 1A7BA 4X4YA 5I15H 3JTTB 5FDWB 4HUXA 5E94A 1B0WA 4WTZA 2WP3O 1A6ZA 1M6OB 2ICWA 3IB4A 1S7VA 4J3TA 5TDNB 3S34L 3O3DB 1OY3B 2XY2A 3PWNB 3T2QA 4KC3B 4K3JL 5I1GL 5AZ2L 3VXSD 3H0TA 4FFWD 4GKZA 3VFRB 1UM4L 3VXMA 2X4SB 2I07A 3V5HA 4C56B 4HIXH 2XA8H 3T4AB 4I13B 1PLGL 1IKFL 2VLJB 1GPOL 4QT5B 2BC4B 1XT5A 4U6XB 2HYMA 2V5RA 2JKXA 4URTB 3H42H 4FNLL 2V7HB 1Q8MA 1AGFA 4A6YA 5C09D 3X14A 3JV6A 2GTWB 2DJUA 3WHXA 5LXGH 3B4NA 2X6MA 2HJKA 4OGAC 3QUKA 2XWTB 3TNNA 4P57B 3STLB 3U83A 2J6EL 4U6TA 3AROA 4JM2F 1NUFA 4NWTL 1DE4A 2VN4A 1N3NB 1FQ9C 3D2UB 1IEAA 5F72S 3V6OC 4X7DC 4AG4L 3QUXB 2QSTA 2Y6SC 2A9MH 5HI5C 3MV7D 1CN4A 1GOHA 1A14L 4JR9L 4PJAF 1IM9B 2ZUWA 1FFRA 1ZT1A 4GW5B 3O6KH 4HGWB 4J7RA 3UBXI 1IEBA 1MI5A 1QVOB 5SWSD 4LGRB 3TF7C 2AV7A 3F12A 5DTFB 4MZ2A 3OHXB 4PJ9D 3TZVD 3O6ML 5MHSD 2Y23A 1OP5K 3D3VB 1NQBA 3L5HA 4DKFH 5GS0D 5DD3L 2O61A 4U1IA 1IAIL 3OAZK 4XNZC 1SBBA 4XPFL 1FDLL 5DHYB 1CYGA 3FO9B 4WEBL 1NEZG 3K7UA 1VFBA 4LPCA 3V6OA 4DGYL 5HYJB 3CJJA 4EIGB 1T5WB 5L9DH 2WW8A 3DX6B 4OJFL 3OKEA 3T3PE 3GI8H 4N8VG 3O8XD 3RWFA 3GSWB 4XBEH 3LN5A 3O4LB 1MVUA 4PUBL 5DEZA 2VZVA 3CX2A 3NCYS 1D5BB 1INEH 5I1EH 5DGQA 5FKAB 3ARVA 3IKCB 2FB4H 5HHNA 1MCBA 2B5IB 3P30L 4X6CB 2NQCA 4ZS7H 1LE5B 3ARFB 5JPNA 3BMWA 3HN3A 3QIUD 4HAGA 2H8PA 4MJ6A 3DLQR 4WFHE 5F8QC 3F5WB 1TXKA 5I75C 4KKLC 4DUVA 3LRSA 1H3XA 5TGBA 3RWGA 4JFEA 1GJIA 2DJ4A 1FNHA 2N7BA 2Y7QB 5HI3D 4JANA 2DM3A 1RJCA 5D70H 4NHUB 4P2OC 1MWAL 1MCOH 1GHFL 3GJFB 4TUJA 1KEGL 4B41A 5DQJA 2CLZB 4H5SA 1BQHB 4GAJL 1IQWL 3PV7A 4N0CC 4RDQG 2YD3A 2YPLD 1KCRH 2OJEA 3EYVA 4C54A 1IGTA 3MRDA 3QR2A 2ICCA 4Q9CA 3DSNA 1ED3A 4PJGA 3TT1L 2E7LC 2F19L 4D0BB 2ARJB 1XCTA 2N7AA 3QCVL 1OGAD 2AV1B 3C5ZD 4D9LH 2F54B 4ZDHB 4D9QD 5F88A 1E4XH 1VFUA 1XFPA 3VU2A 2ZZUT 4YNYA 2AKRA 1QG3A 5FUCC 3GHEL 5GRUH 5I8CB 4P2OA 3UTZA 2DDQL 5EUKA 1S9WB 2J8HA 2RCSH 4O2FB 3ARDC 1A7NH 3V0VB 4Y4KA 5L8KB 4S1DC 1BF2A 5HDBE 3KPQA 2Q8AL 1EEZB 4PRHD 3CVIL 3QEHA 4JCMA 4CVZB 5E8DL 4PJ8B 4PGBB 1BZ7A 2E7LA 4QHMB 3DXAA 5HGHA 3S6CA 3B9KC 3BIKA 3QDMD 3CDGB 4Z6AT 4O4YH 1WZLA 3LKQB 1RJYB 1NFIA 2G2RA 4LNRA 1NUGA 4OBRA 3C08L 4WI6A 2VZ3A 2BNQB 3BEVA 2GK0A 4BSJA 4P4RB 1FFOB 4PRBB 3GMOA 2IANB 3WJJC 2VSDA 3CLFL 3D39E 3SHSA 1VA9A 4R0LC 4EN3B 1YEEL 1IBGL 1MQKL 1CDGA 4KUZH 5SWQB 1ACZA 4I3RH 1FSKC 5KW9H 5DURD 3ARDA 3ARTA 5ENWB 2XKNA 1MRFH 5KSUB 1U3HD 3QT2A 2OXGA 1CT8B 3MC0A 3WFBH 1N8ZA 5LBSL 3D9AL 4ZD3H 2BSRA 3EO9H 4GFTB 1F6AA 3B9KA 5I18H 2UWEE 1AXTH 1CG9B 2NY1C 5LCVH 5HDQH 1N2RB 4FXGB 1NCDL 4RBPK 3CU7A 3IDNB 2HTKC 2EDJA 4MMXC 4RMTA 4NQCD 1JNLH 4JFQA 5DI8A 4ZNEA 1OD7A 1UJTA 1UZ6E 2J6EA 2QADC 5FO9A 2X7LA 1GZQB 1T0NB 3UBXB 4XPTL 4BKLA 1SY6H 3S9DB 2GCYB 5I1CH 2C26A 4R0LA 3KJ6H 5CD3B 4P2CG 3F7YB 3VGAB 3RKDD 4NKOB 4Z76A 1B2WL 2DD8H 5IKCA 4PGZA 4Y89A 4K3JH 5I1GH 2ZUVA 5AZ2H 4U2ZA 2GAZA 5EU6A 3KYKL 4NC2B 1FNEB 1YN7B 3PQYB 5T1LA 3D25B 2DYPA 3IDMB 2V2WB 3AU1B 1PLGH 1IKFH 5T1KD 5C0GB 5FECA 1GPOH 2OMNA 1QR4A 1DP0A 5F93C 4FFVC 1UACL 4FNLH 1SEBB 1L9MA 3KPRD 2H26A 4N0FA 2LVEA 5J9PB 2AEIT 3AS3A 4KWUA 4RFNB 4NWTH 4PJ7B 2UUDK 2F74B 2XNAA 2YA1A 1QEWB 1X5YA 4AG4H 2GUOB 4IOSD 5HYQB 1OL0A 1A14H 4JR9H 3OKKB 1PFCA 1RUPL 1H5BB 1DBAL 1EO7A 2X9YA 3VWKB 3WXVL 1ZGLM 2HFGL 3NAAL 4Y5YC 2VL4A 3G5YA 4G42A 3AUVA 4G9DB 1OP3H 1FV1A 4YPGB 1Q38A 1I7ZB 4GMSL 4NN6C 5F7DB 4CDHA 3O6MH 1AXIB 2A77H 3C5JA 1N5AB 3I02B 2Y07L 3DMMD 1IAIH 2OP4L 4XPFH 3TBYB 4C55A 3L5JA 1FDLH 4WEBH 4D0CA 4OZHB 5AAMA 1ZT7A 1CD0A 3KXFE 5ADPH 4DGYH 3MODL 1IAOA 1AKJD 1UKSA 4NQDD 4W81A 5CSZA 3NOIA 4OJFH 3U0PB 4P46C 4WFGD 3VWJD 2IMNA 4Y0GA 3TO4B 5L8JB 2R2EB 4PUBH 5BRZE 1MCPL 2YHGA 5CZVL 3MCKA 1OF2B 4Y5YA 2J1KA 1S7SB 4CKVX 3P30H 1U3JA 4YHNA 4PJIE 1G7LA 4OCLC 5JHDE 2Z35B 1Z5LB 2X4NB 4G8IA 1CICC 3F7PC 1WFTA 25C8H 4LQ1A 5EFIB 2CGRL 2E8YA 4I18B 1Z0NA 2R2CA 3DI3B 4PRAA 1MHEA 1WBXA 4XB8A 3LEXB 1MWAH 3EKCA 3PWPB 2AK4A 1J1OL 5KAQF 4HIIB 3QNXA 4ORZC 4F15B 4P46A 1W0WA 4GAJH 1IQWH 4DW2H 1U93A 2BNRE 3MRRA 3LV3A 5HGGS 5HVFB 2AEWA 3UROR 3PWVB 1IC4H 5D5MF 3QFJD 3TT1H 2NY2C 4X9BA 4FTVA 4LKCA 4B7LA 4NO3A 2F19H 3HTLX 4JAMA 5GRYA 4UQ3A 3WUWG 1P7QB 3IS0X 1JGDB 3BIBX 4ZFZB 3TJEL 5D1QC 5FM4A 3O2VL 3S4SG 4Z0BL 5F1IA 1CICA 2H2PD 1XR9A 4LARL 5K9KB 1C12B 4ZTPH 1E4XI 4X7TB 2H9GA 4KK8C 4CGTA 1KUMA 1KTDB 2DQHL 5BCAA 4KQ3L 3OF6D 5DZNA 2DDQH 1QFWL 4S1QL 3FRPA 1N0LA 1CVRA 5FYLE 5FGCE 4ZODA 5A2IH 2P24A 4LHUB 2VUYA 5IVZB 2Q8AH 4MYWB 1CD1A 3BEWA 1FZJA 3HFMH 2DQJL 2HT4D 1MCRA 1NC4D 4Z8FL 2XKUA 1LO5A 1HH9B 3TBSB 3CX5K 1D9KB 1W8NA 4HD9A 3NZ8A 2D7TL 3CSBA 3WO4C 5D1QA 1RK1A 5DJDA 5IGXH 4E0RA 1RHHA 3EOAB 1LNUA 3VFSA 5JPMA 4P5TD 3ZKNC 4ZAKB 5DMIH 2M2DA 1FHGA 2FCBA 1NPUA 1MREL 2GI7A 2FGZA 1YEEH 5HGAA 5HPMA 1IBGH 1MQKH 4WO4B 5DRWB 4QY8A 1PBYA 5SX5H 4FQHB 1YPZB 1EGJL 4PTUB 4M62L 1NGZB 3GMQA 4JE4B 5B3JF 4ZUSA 1QSVA 2XTJE 5INCB 1IILE 1EEQA 4MJ5A 4Q7DA 2BRQA 5H94A 3K3QA 5LBSH 4EBQL 1RMFL 5I9QC 1G9MC 1C5DB 4X4YB 4UDTA 3VXRB 1KELH 4JPKH 1JUFB 5JW5B 1A6ZB 3QEQA 2F58L 1DR9A 4F7EB 3MLVH 3ZDYF 2FX9L 3TFKC 4KK9D 3MACL 1AQKL 4FOMA 4NKIL 2CDGA 1U8HB 4L3EE 4XPTH 2W65B 1JZ5A 3H0TB 3IXTA 1J7VR 4RMWA 4UUJA 3RKPA 3G6JF 4GS7C 3K1DA 5H2BA 3V5HB 1A7RL 1UEMA 4BQ9A 2JIXA 3I2CL 1B2WH 2Z0BA 3QEUB 4X5XB 1J0KA 1QLRA 4PJCA 3AAZB 4ELMF 1YJDC 1KT2B 5L0QC 1KIPA 1AGFB 4A6YB 1DEEA 3VRIB 2HJKB 4X4XA 3TNNB 3HI6H 4YEEA 2LTQC 2EIZA 2VXQL 1AO7B 1YEHL 5INDA 1MHPL 5DJZB 4C56D 1UACH 3OKLB 4XNMA 2VLJD 3TIEA 2WWKT 3H9HB 2L7JA 3R1GL 1VGEH 4QXGL 4HUMB 4PP1D 5E8OA 1ZT1B 2HLAB 5H8DA 4M43H 1AGBA 5FEBA 2V5MA 1IEBB 4Z9KB 5ADOH 1MI5B 4LHQB 2DM4A 4G6ML 3GUTB 1WLHA 2AV7B 3BPNC 4HUKB 4R4FH 3D2UD 3F12B 4F33B 3QUXD 4LPXA 2F53E 3VRLF 1ZHLA 3HNSH 2D7MA 2O61B 4U1IB 1DBAH 4HW6A 4WEMB 4RGOL 2OL3L 5TH2B 3WXVH 1VFBB 3NAAH 4U6YA 1I9JL 4GBXC 4M5ZL 4XRCB 2C3XA 5E6IC 3OKEB 5F9WC 2A6JA 4QHKI 2Y07H 3S88L 3GSNA 1IAII 3D3VD 3QCTL 4U1GB 4Q97A 4JFDE 3LN5B 1MVUB 3BP6A 4HJJL 3NFSL 2BK8A 4NPYB 3LD8C 3PL6C 3BZ4A 4BFIA 3MODH 3CDCA 2Q1EA 1TJGL 4OKDA 4UZGA 2ZKHL 5TE7L 5JPNB 5HYJD 1LP9E 1ZHKA 5FYKU 3U6RA 5DRZA 5D2LE 4O2CA 4ONHA 1KIQA 2O93L 5E1HB 3LRSB 1NL0L 5J57B 5TGBB 4UTAH 4L4VE 4HG4J 4PRIA 4R97B 3VFPB 4YQXH 4JANB 1FH5L 3O4LD 3GSXA 3IYLW 1A3QA 4GBXA 1QBML 5E6IA 5D7KD 2DB8A 4YDVA 4TUJB 4DAGL 3WFDH 5DQJB 1EHAA 3ARFD 4IRJB 5BVPL 1P2CA 2CGRH 3TN0B 2OJEB 3EYVB 1IGTB 2RB8A 3MRDB 1TTUA 4RAVB 4Y1AA 1ED3B 3PL6A 5E00A 4HDIA 3ZSSA 4ELKA 5B3NA 2BY3A 2J8UA 3N85L 1DJSA 5D1ZB 1G7IA 5GIRB 1XCTB 2BVYA 3HE6D 5DJXA 1I1YA 4P3WA 5JLZA 4J3VA 4AJ0A 1RJZA 1C7SA 1Q0YL 1JYXA 4MA7L 4YNYB 4HJ0C 2E7BA 3MLUL 4JVUA 5KBNC 3RUGE 1JHLL 2D03L 1MCSA 1WT5C 3UTZB 1GGBL 2NY0C 4ZS6D 3TJEH 3O2VH 4EI6A 1KGCD 5DVNA 4Z0BH 3HZYA 3ZDXE 3L5XH 3QULA 4LARH 3QEHB 4OFYA 4LCWB 3ETBF 3D0LA 1WBYB 1PZUB 2WINB 2F54D 3DROA 1NJ9A 4YFLI 1BZ7B 3ZKXC 2DQHH 3AC0A 3BIKB 1QFWH 4S1QH 5CIPA 1T1WA 5J1TC 5IMOA 3P11H 5E7FA 3VI3E 1NFIB 1BFVH 2G2RB 4LNRB 2AEPL 4NQSA 4PV9A 4Y5XC 3SJVB 4Z7WF 2DBJA 4MXQC 3D69A 5ALCH 2GK0B 2Q76A 5DJ0A 3GMOB 4Z8FH 1ZT4B 2GSIB 4YHML 1AIFA 1BWWA 3SCMB 1Q9OA 1RFDL 4PJ8D 2C1PA 1MFBL 1WT5A 1JZ3A 2D7TH 1FNSL 2PXYD 4G9FB 1U8LA 3ARDB 5D7LE 1A7OL 2UZIL 4NBZB 2XKNB 3G9VA 1S7WB 4HMCA 2FIKA 1OTTC 2XYCA 1UWEL 4LEOA 3C6LB 2BNQD 1MREH 2BSRB 3LB6C 3QIBB 2IAND 5E9DE 3RBSA 1J12A 1EIBA 5F21B 3MV8D 3RVVD 4EN3D 3CFDA 1EGJH 1TLKA 4Y5XA 1OCWL 3PWJA 5CIPH 5FO9B 1S7XB 2X7LB 4JM4L 1ZV5A 2CJUL 4ENEC 4EBQH 1RMFH 1AJ7L 4R0LB 4XGZA 4PREB 4JQXC 1KXQE 3QWRD 4RMVA 1T6VN 1TZHA 2EXWD 3P9WB 2XG4A 1FSKB 2F58H 1CF8L 1G9NL 5IKCB 2BHUA 1I9IL 2FX9H 2BOBB 3TA3D 1AQKH 4XMPL 5DO2C 2GAZB 2JCCF 3RP1A 1HDMA 4CNIB 5T1LB 5BZDB 1QLEL 1TZIB 2DYPB 1Y6KR 3RWHA 1A7RH 4APQC 4DK3A 1JTPA 5H35B 2VDPH 5D7SH 5F1NA 2HMID 5FECB 4GG6F 3I2CH 4CW1B 1QBBA 2PYED 2NZ9C 3LN9A 5IQ7L 3F7RA 1CGVA 1G1YA 1HK6A 2H26B 4KUCF 1ZVSA 5IM7A 4NNPL 2VL5A 5ABDE 4RRPA 3QXDA 1KLGA 4JQXA 2F5AL 2NYYD 3TBVB 1YEHH 1MHPH 5AWNL 2AXGB 4HKZA 2XNAB 3O3AA 2DOCA 1CFNB 2APTA 3R1GH 1DDHA 3CFEA 2EDBA 4XPAH 1I7UA 3OPZL 3P3YA 1YMHA 3RWCB 4APQA 1J18A 3U46A 2HJLA 3PWLB 5HD8D 4MGXA 3VXUD 5C0EA 3GBLA 4ODBD 3G5YB 1IZKA 4G42B 1Z9OA 2FR4A 3BX7C 2X4OA 2CLVB 1FV1B 2V5YA 2C9AA 2A9NH 4ETYA 4V1DD 3KPMA 2VZSA 1BFTA 3BAEL 1RUML 4X0KA 4P99A 3WMSA 3K1KC 4NJ9L 4WI4A 1U8JA 4RGOH 2OL3H 4OZ4A 4HK3N 1MWAB 4WEUD 2V2TA 1AGEA 1ZT7B 4MB3A 5FCSH 2QQNL 1F13A 1I9JH 1IAOB 3VWKD 4ODSH 3N9GH 4M5ZH 3RGVC 1SVCP 3O6FD 4UNUA 3WYRA 1WWBX 1VACA 1NLBL 3S88H 4JCLA 3NIFE 5B39G 1X5KA 2ZSWA 4XBGA 4N68A 3SKMB 3QCTH 1UCTA 3PUCA 4RGMB 4HJJH 3NFSH 2P5WB 3KWWB 4LQFL 3MCKB 1UADC 1FG9C 3INUL 5IOPA 4HFWA 1TJGH 3OAUH 2EDRA 1RK0A 2F15A 2W92A 1B3JA 4KKNA 4XNYH 1BJ8A 2ZKHH 5TE7H 4YHNB 4NN6B 4DZBA 1MCWM 2FIRT 3ZHKA 2HT3D 4M7JL 2BSSA 1I7TB 2A0LD 2IH3B 4JHWL 3BZDA 5EZIL 1NL0H 5T3ZH 5IV2A 1K6QH 1F58L 4ONGH 4K2UL 2ENYA 3TO4D 1FH5H 4PRAB 4XCEA 3RGVA 4ZXBD 1RIHL 1QBMH 2ESVA 3VFTA 5KVDL 1UKTA 3ESVF 4WGVB 2E5EA 3UJIL 2XN9A 3R8BB 2E9WA 1CK0H 5AEAA 1W0WB 3LKPB 1UQSA 5CEYB 1U93B 4PY7A 1B4JL 2PF6A 4PIRF 2IAMC 3SDAC 3N85H 4LKCB 4M5YH 4QYOA 5C0JA 4NO3B 2B1AL 4JAMB 3H3BC 1ZGLP 4DN3L 3D39A 2GY7B 4GXUM 5B8CB 4EXPX 5DA4A 1CIDA 3LQZA 4XHQA 1XR9B 3WV0A 1Q0YH 1U8QA 5AAWA 5KSBB 3MRMA 4MA7H 4MB4A 3RVTC 3MLUH 5FYLL 4QRRB 5K93A 4ZO6A 1JHLH 2D03H 3MCLH 5IQ9B 4IRSC 1G9NC 5FM8A 3A6OA 1GGBH 1SJEA 2A38A 3E6HA 1BVKA 1JWUB 1HEZA 5BS0E 4XNQA 2YKLL 4DGVL 2P24B 2UWEA 3QH3B 2HVKA 4LF3A 1CD1B 2XWBA 1FZJB 1EAPA 2IAMA 5A16A 2C4FT 7FABL 2NY2B 3SDAA 3W82A 3C6SA 2DI7A 3S3PA 1LO5B 1NFDB 4MQ7B 3VXSE 3FT4A 3NZ8B 1QFWI 3CUPA 3EJYC 1RK1B 5DJDB 4K9EL 5EU3B 1RHHB 2AEPH 1I3GL 1LNUB 5JPMB 1GVIA 4J4PC 2GY5A 1NEUA 4LHUD 5CS7A 5DYOB 4OF0A 5C09E 4IRSA 3MOAH 4IHOA 3MFGB 1FNSH 4QRUA 2GJJA 3FQTA 4ZOCA 1CS6A 2NR6C 4AT6A 4NC1E 4ZUSB 4QOKD 4OF3A 1UWEH 4QLRA 4ZAKD 1GH7A 3MV7E 4WW1A 3F6IA 3V5KB 2CKNA 1X4XA 1FNGA 4WWKB 4HUWA 2EIBA 3NFNB 1NDMB 1CL7L 1R0AL 3QEQB 4WO4D 4MJIE 1OCWH 4M03A 3ZZ1A 1FG2B 2UY6A 4YAQA 4J4PA 5SWSE 3DARA 2IC2A 2CDGB 4ZPTA 5CAYB 3IXTB 2AI0L 3BMVA 3DX8A 1KB5H 1AJ7H 3HUJF 3V8OA 2QKIA 5MHSE 2YD1A 3QI9C 5FF6B 1GGYA 3OQ3B 2Y5TA 4KROD 5E2VL 3VXRD 4MCYB 1QLRB 2EKJA 4PJCB 1HHHA 3H8NA 4F58L 1P6FA 4OGZA 3L5WA 3BQUD 1U8KB 3JVGC 5F1KC 1QLEH 2WMPA 5I9QB 4ODWB 3UPRB 3U36B 1VEPA 4DVBB 1OP5H 1FFPB 3UTQA 5INDB 1GCFA 4QHUA 1BD2E 3JTSB 2WWMC 2P49B 3IFLL 1Q1JL 3OAZH 4LK4A 3VFNA 5IQ7H 5C3LD 3QQ9D 4EIZC 3MSPA 4M1DL 5LGKA 3TIEB 3UDWC 2ZSVA 1N59B 3KXFA 3AS1A 4NNPH 4TPRL 4L4TE 5KSAB 4NT6A 5HDOA 5E8OB 1D7FA 2FO4B 2F5AH 1AGBB 1Q9LA 4OCRH 1A4KB 3ULSA 1BMGA 5I1DA 1R3LB 3QI9A 4YHLH 1RZIB 5AWNH 5DR5L 4RZCA 5DMGC 3GKWL 4OT1L 5BRZA 1AO7D 1TJIH 5B22A 3HE7C 1RD6A 4WGWB 3VD9A 5I66A 3VXNA 3RPIB 4BH8A 5F9JA 4WW2F 3OPZH 3BUYA 2V9TA 4PJIA 5JHDA 1VFAA 2LTQB 1AY1L 3PABA 5M94B 1NBYB 4LLVA 5LQBH 1MI5D 3LCYA 4U6YB 3N1PC 3ULVH 3MA9L 1YQVL 1FNFA 5D6CA 3UDWA 5FCUL 3S37H 3BAEH 2A6JB 1RUMH 1K4CA 4XP6H 1FFQA 4ALAH 5MP6L 3RJDA 1PKQA 3BP6B 4M93C 1NAMA 3P73A 4NP4L 3UYOD 3G9AB 2BNRA 3BZ4B 4D9QE 2QQNH 3G6DH 4U6HA 1X9QA 3HE7A 1Z9SA 1MAML 3MJ6A 3MJ8B 1SVZA 2ICEA 3C5SB 3MPCA 1NLBH 3FAWA 4O2CB 1KIQB 5JQ6H 2DWDA 5F3HB 2FSEA 1HI6A 2VH5L 3FB7B 1GC1H 2W9DL 3QUYC 4UI2A 4LQFH 3QQ3A 1IM3B 4PRHE 3INUH 4RSVA 2YC1B 3TO2A 1PG7W 4GBXB 2QTEA 2YUWA 4K9EC 1NCBH 4YDVB 4PD4K 2CK0H 3IETB 4JPVL 5F9WB 3IDXL 5HJ3B 2UZYB 3ZHDA 4BH7A 2NZIA 4M7JH 1U8OB 1Z3GL 3SKJL 1P2CB 3MRGA 4M7LH 4NN5C 2WK2A 3U0TB 3PNWA 4K2UH 4Y1AB 4UBDC 4EI5B 3PL6B 1AGCA 2XTJC 4HDIB 3P40A 2YPKB 1VKXB 1RIHH 3DX9A 1G7IB 5FUZL 3SN6N 3MV9E 4PRNB 3UJIH 2CIIA 5DJXB 5JLZB 5K9OA 4QRQA 4ZUVA 1B4JH 1WBZB 3I85A 1QKZL 3M1BB 1A64A 3QUYA 4IRJD 4G80A 5IB1A 3TN0D 4ZFFB 5BZWA 5FYJH 3OXRB 2B1AH 2XKSA 4DN3H 5E8NA 4YE4H 1WFOA 5IBTL 2APFA 1YMME 5IIEA 5D1ZD 2ZUTA 2ZCKH 2FL5B 2Z4QA 4KJYA 1RZFL 2J7LA 1NGYA 1NJ9B 1SHMA 4NQCE 2HTLC 1G0XA 3AMKA 4KHTL 2BVOA 3WNKA 4MVBC 5CIPB 2YUZA 5IMOB 3SO5A 1W2KT 2YKLH 4DGVH 3DV6B 2BHZA 4NQSB 1DN0A 4PV9B 1FN4B 1S7UB 4G43B 4OLZH 3QNZA 3WN5C 3D69B 5IMLA 1JF5A 4TSAL 2YUVA 2Y06L 2Q76B 4RBPH 7FABH 1AE6H 4LCWD 1AIFB 2I24N 2XFXA 3BGAA 4ZO8A 2MQ3A 1Q9OB 4L3EA 3VMNA 3VDAA 2NY0B 3O2DH 2BSTB 3NIDE 1PZ5B 4PJ5E 4K9EH 4P23C 3FOLA 3HAEH 1I3GH 4MNQE 3WKNA 1IAKA 2VXSL 4UILL 2P5EE 3BDXA 1QTYT 1NMAL 1T1YA 2W1NA 3G08B 1Q9KA 2UY7A 3SJVD 2X5PA 5IFHL 4LEOB 2R1WA 4N5ED 4NIKB 3ZKXB 5JOEA 3SGEH 3M17A 3SCMD 3VW3L 4ZNCD 5EUOF 2QR0A 3CK0H 4UU9A 5D72L 3FHAA 4G9FD 3WN5A 3ARDD 4KHXL 2Z8RA 4HZAA 1SM3L 3EJJX 3I50H 1DQJA 1UVQA 3X17A 4JHAL 8FABA 3RZCC 3SDYL 5BQ7B 3C6LD 4CMMB 4UAOC 2VR5A 3QIBD 5JZ7C 1R0AH 3VGDA 1OAZL 1HSAA 2UVEA 1FL6A 1U9KA 2UUDH 3O2WL 4ODXA 1E6OH 2BVTA 5JORA 1ZA3B 2AI0H 4X9HA 4ZPVB 1KXTB 2KQNA 1EJOH 2F53A 3RWHB 3BSZH 4K7PL 4OCMC 1UJ3C 5LGHH 5F1NB 1Y6MR 2KL6A 4KMQA 5E2VH 3Q1SL 2CSPA 4K3EL 2FHBA 3CZFB 3BN9C 1KJ2H 4F58H 2NXZD 2OX5A 1AGDB 2ZOKB 1UENA 2ITCA 1FRGL 2VNCA 5IM7B 3S3SA 1G7MB 2OL3B 4YDIL 5D5ME 3NACL 3NPZB 3VMOA 4Z7NF 1JVKA 3QXDB 3RZCA 2L7UA 3HRZA 4ERSL 2R8SL 4WUUE 3ARZA 5IEHA 4WFGE 3MJ9L 4HKZB 4PBVC 3IFLH 4JFDA 1Q1JH 3LEYL 2VITA 4XVUC 3I6GB 4M1DH 4KVCL 5J13C 3CMOL 1NGPL 2HTKD 4I0PC 4Y4FC 5AG9A 1MHHA 2ZCLL 3CFEB 1X5ZA 5GRJL 4LCIL 1LP9A 4QTIL 1U2HA 2YRPA 3TV3H 3DV4A 3MO1A 5D2LA 4APQB 3LKRA 5JIIA 2HJLB 4IEFB 2VUOA 2VABA 5DR5H 4U1JB 3IDYC 5C0EB 4L4VA 3MMEA 4U1KA 3G5ZB 3ZE0F 5BV7H 1S7TA 3Q6GL 4IIQB 4X0KB 4EUPA 1ACYL 1MFEL 5CUSH 4BFBD 4LGSB 4JKPH 1JGUL 4JFFE 3KPSE 5FHAH 2PKDA 2RGSA 5SX4H 1AGEB 2C3GA 5DQDL 1EZVX 4QHKJ 1REIA 1F42A 3FO2B 3KPPA 1YQVH 3QFJE 4NN7C 2EDFA 5ICZA 4FFVD 5GZOC 5FCUH 2MTPA 4I0PA 4Y4FA 1VACB 2EIEA 3EDFA 2I26N 4PYHA 1QLFA 4M4RA 2ZSWB 3JV4B 4XBGB 2R4RH 2EE2A 2O5YL 5MP6H 4GKOA 4N1EA 1ZLSH 5DFWH 3MRBA 1U8IA 4L9LC 1DQDL 4RISL 4NP4H 2Q7YA 2QSQA 5IOPB 5CILH 5D1XC 1MAMH 1RK0B 1G9EA 2KKQA 1JNNH 3HCVB 2V17L 2X42A 2HFFA 2LU7A 4XWGL 1FAIL 3RUGA 3VXPA 4YXHL 1FL5A 4EVNA 3T0EE 2BSSB 2VH5H 5JMRA 1IJ9A 2W9DH 1JPSH 4U1SA 3OKMA 4EUPH 4LSTL 2YD4A 3F62A 3OBAA 4RDQF 4BA8A 2P5WD 5IJVB 3VFTB 4JZOA 4KTDL 4JPVH 1EAJA 4IOFD 1S9VA 2VYRE 1R5IB 1UQSB 1Z3GH 4ODUA 3SKJH 2OS7A 4L8DB 3UCRA 4C57C 4L9LA 1ORSB 4HUVA 1Q94B 2E3VA 1AC6A 4NUGL 4G6KH 2JJTC 2E9IA 3K0WA 5D1XA 5C0JB 4ELME 2QHLA 1J5OL 4LDEB 4J2XA 3PHQA 1SBSL 3P4NA 5MEOB 1OPGL 4JDTL 3D39B 3FN9A 4JVPA 2GIYA 3X11A 1TCMA 2FD6L 1X6NA 3LQZB 4JHBA 3DO7B 2X1PA 1QKZH 5D7LA 1U8QB 3MRMB 4PJDF 4FRWA 1NCAL 4OZIF 1JHTB 4HF5H 1T1XB 4NO0A 1XCQA 1SJEB 3GSRB 5IBTH 5EC1A 2F8XC 2CH8A 3PHOA 3HPLB 4PGEA 2HVKB 4LF3B 1INQA 2XWBB 1RZFH 2DTML 1JRHL 3ORJA 4JKLA 4XHJC 1EAPB 3HI5L 4I0CC 5A16B 2B20A 3SDAB 3C6SB 4UTBL 32C2B 1I1AC 2JJTA 1VB9A 4G7VL 4KHTH 5IBLC 2FH8A 2YBRA 4QRRD 3QDHA 5GGVY 1HYSC 3CUPB 4XBPA 3VRLE 5CCKL 4RGNB 5IESL 1KB5B 3CD4A 2Y06H 1YNLL 1WIOA 3CFCL 3QWOA 3UYRL 4XCFL 3U7AA 4IRSB 3DETC 4IHOB 4KVNL 2A6IA 1JL8A 4FABH 4XZUB 3HR5A 3FQTB 1QUNA 2X70A 4AT6B 4UILH 2VXSH 2VLLA 1NMAH 1LD9A 5E08H 5CFHA 5IFHH 5LGJA 1J8HE 3OJ2C 3QIWD 4WW1B 5LAXB 1I1AA 2EC8A 5MERA 4LOUC 1FNGB 4HUWB 1U8NA 2EO1A 3SGEI 4D0DA 4BELD 1JPGB 3L3OA 1YC7A 3J8F7 1ZLWK 1LO0L 3VD4A 4KHXH 4YWGL 4H8WL 4WDIA 5DD5H 4G5ZL 3FB5A 4MD0B 5GSRA 4Z77A 1BM3L 4F7CA 4JHAH 3MJ9A 3U7WL 3V8CA 4GRLB 2QKIB 2NY4C 2OTUA 4R2GB 3OTTA 1WF5A 4OCWL 2K3TA 4QNPF 1CL7I 1FLTX 1KBGH 2Y5TB 4WWKD 5E0QA 5B39B 4LHJB 1OAZH 1XGRA 1JI1A 3K2UL 35C8L 4R4BB 1HHHB 3F8UB 3PGFL 3FN0L 3O2WH 3QEQD 4B0MM 3L5WB 2BERA 4LLYB 3HZVB 4XVJL 3DSFL 2DF3A 5HYIA 5A2KH 2E6JA 1K5NA 2D7QA 5E8PA 4YDKL 2IPKB 1MCHA 3GMNA 1OOAA 3UTQB 1F4XH 4Y2DC 3EYOB 4OSUL 1O5DT 4QHUB 2XQBH 3D3VE 3Q1SH 4K3EH 1OP9A 1WCBA 3VFNB 3P77A 4UV7L 1CXHA 1I8LC 2ZSVB 2ADJA 3KXFB 1IRAY 4YDIH 4NT6B 3NACH 5EBWA 1ZLVK 5HYJE 2V9QA 1Q9LB 2VXVH 4ERSH 5K33A 4HFUL 2V9RA 4U1MA 3ULSB 2R8SH 3QI9B 5GGSY 2PNDA 1EO8H 1G0YR 1L7IL 5MEPA 4GW1B 1FJ1A 3LEYH 4Q6IC 4RZCB 4KVCH 1GYAA 1A7PL 3CMOH 1NGPH 2AJYL 3VXNB 3OJDA 1U8MA 2ZCLH 1TQBC 5GRJH 4JPIA 1TTGA 5D7KE 3MLYL 4PJIB 5JHDB 5KSAD 1VFAB 5I8EA 4X6CE 2M8XA 3SKOA 4EKXA 3PABB 1LK2B 4Y2DA 5C0DA 1JTOA 1LDSA 4JM2C 4LLVB 3QZWA 4Z7WE 1N6QL 3VGGA 1CXIA 1I8LA 3Q6GH 4YZFF 5AG8A 3S36X 4P2RD 1ACYH 5I17B 1MFEH 3BXNB 1JGUH 2CKBH 1QYGL 1T83C 1YEKL 5IFAL 2KBGA 2DS4A 3P73B 2BNRB 5SX4I 1L9NA 4Q6IA 4U6HB 3HE7B 4YX2L 4OLEA 4WNQA 1UM5L 4GT7A 3R8QA 3Q5YA 1KXVC 1X5FA 2NLJA 5ANMA 3H3PL 5CP3A 2H1PH 3KPOB 2VC2L 2DWDB 5FA4A 2O5YH 3SPVA 3VJ6B 1HI6B 1WIUA 2VTFA 1KGCE 1DQDH 5T1MB 4RISH 3CXHJ 3MLPA 4TN9A 4OZGB 4M6NL 1E28A 1VSCA 4JM2A 1EK3A 4A2LA 4DJMA 5IUSA 1EUTA 1U6AL 2V17H 3ROLA 1A6PA 2GTZB 2J88L 4XWGH 1ZMYA 4YXHH 1PY9A 3D0VA 1IL1A 4BH7B 3MRGB 3H7LA 4WRLA 5FGCB 4X6DE 1T83A 3DHJA 3PNWB 4M93B 5EOCL 5DSCB 4NC1C 1AGCB 5DK0A 5IB3A 5JO5A 2WZPD 3DX9B 3NGBC 4KTDH 2Z91A 4AIZA 3VXSA 4AM0A 4Z78A 4FQCL 2COQA 4N0UE 3AXLA 3O3BB 2AJSL 1XIWB 4BQCA 2EZ0D 3TLRA 3QUYB 2WUCL 5IB1B 4V2BA 5BZWB 4LSRL 3FL7A 4Y1AD 4EI5D 3NIGF 1J5OH 1SBSH 3V4VL 4JDTH 3HAEB 4TVPE 2BNQE 2EDKA 2GJ6D 3FCTA 3TZVC 5C09A 5IIEB 4H8WC 3KJ4C 5C07D 3EYFB 3MV8E 4KJYB 4HWUA 1NGYB 1DEDA 1NCAH 3X3GL 5J3HD 2BVOB 2NW2A 5TF0A 3C9NA 1NCCL 3MV7A 4OI9A 1CFVH 4GAYA 5HYSG 5IF0A 1OT2A 5IMLB 2DTMH 3QNZB 1JRHH 3PWUA 4YR6A 1ZWIA 3HI5H 1ONQA 5F6IC 4I77L 4UTBH 5SWSA 4RIRA 4G3YH 4G7VH 5DXWA 1R6VA 4LCYB 3IVKA 2HG5A 4M7ZC 3TZVA 3QIUC 2PR4L 5CCKH 2IH1A 4PBXA 3FOLB 1H3GA 2MKLC 5IESH 1J10A 1IAKB 1JI2A 1T1YB 2PYEE 1Q9KB 1WGOA 1YNLH 4LEXH 1MUJB 3NCFB 3CFCH 2R1WB 1A6VH 5HI3C 4XCFH 3UYRH 5C6WH 2BVQA 2VLRE 4KVNH 1WWAX 3M17B 5T1DL 1KJ2B 4YO0A 4PRPB 2BXZA 43C9A 5GGTH 5ESAA 2CDFA 4XPHH 3WN5B 5C71A 1BD2A 4XPGL 4KH2A 5CEXA 5C0BD 3VA6A 1DQJB 1UVQB 4LIQE 1X5GA 2BP3A 4DUWA 3MGOB 3CPLB 2OLDA 3QUZD 2RR3A 1EFXD 5ALBH 1TENA 3QIUA 4PJHF 4X6FA 3SDCD 1HSBB 4P23B 3PXJA 3VGEA 4UNVA 3JV5A 4UMGA 1XGPB 3C8KA 5HGBA 1I9RH 1D5XA 1TTFA 3VXUE 5I1AB 4G5ZH 3BH9B 5ACMA 2BMKB 5AD0A 4MXQD 4C4KT 5JORB 1BM3H 1MRDL 2HFEB 4V1DE 4AK1A 2F53B 5HHXL 3ISWA 1OD9A 4KV5F 4OCWH 1I4FB 3GM8A 2VDQL 3SDXF 3K2UH 35C8H 5F7MC 3WFHA 3PGFH 1A1NA 1HQRA 3FN0H 5DEFA 1IEHA 3BD4A 1LVEA 1QHOA 2BVEA 2ITCB 4XVJH 3DSFH 1T3FB 4MAUH 2EYSB 1G7PA 4O5LL 4YDKH 3UZQA 3RZCB 3HRZB 1NGQL 5IP4A 3L3JA 3MCG1 5IEHB 5HSFA 1OGAA 4JFDB 4P4KB 4QRSA 5GS1C 4UV7H 1VEOA 3MRFA 1G84A 4LSVL 5EOTA 4GRWF 3CFJA 4UIMA 4O2EA 1LP9B 1WTGT 4XXCC 4KJQD 3DV4B 3MO1B 2CK2A 4HFUH 3LKRB 5KAQG 1UJ3B 3OR6A 3U1SH 2VABB 4FQQB 3QDJB 2ZG3A 1OQOA 2NY7L 4L4VB 3MMEB 3C8HA 1JYVA 4U1KB 2Y1VA 1A7PH 4PRHA 3IXAA 1S7TB 2IBZY 3V4PL 3MROA 2HWZL 4DQOL 1I75A 3MLYH 4U3XA 3RL1A 4EUPB 3JWNC 4CVXA 2MQ0A 3QDMA 2R9HC 1XZ0A 1X7QA 4HUUA 1MH5A 5C8JB 4JRXB 1W0YT 5GS1A 5ICZB 5IFJA 5J13B 4Y4FB 2WM0A 3KYAA 3FT2A 1QLFB 3MLZL 4KQ4L 1DTUA 5T3ZD 4XXCA 5IK3A 3MRBB 1U8IB 3AS0A 1QYGH 3EBAA 5IFAH 3MQIA 2Q7YB 3IDYB 5IW1B 1ZTXL 4YX2H 2RJMA 1UM5H 2HKFL 3VXPB 4PJBB 3ARBC 1MOEA 4LU5L 4EVNB 2VC2H 5FOBB 1OSZA 2VQ1A 2VDNL 3QA3B 1MELA 1YEFL 1I8IA 4YC2C 3OKMB 3UC0L 4M6NH 1AD9A 1U6AH 3EAKA 4NN7B 4JZOB 4NQCA 2J88H 2DQGH 2E9JA 1NCTA 1NGXA 5GJSL 4LVOB 5TPWH 5CWSA 4ODUB 6FABH 5IBUG 5IB5B 2IWGA 2ERJB 3P0VL 2E7MA 5EOCH 4HUVB 2ZG2A 1YYLL 5KG9A 1KCUL 3NCCB 1S8DA 3STZB 3BKYL 1EH9A 2GK2A 1M71A 3P4NB 4Z7OF 5IMKB 3QSKB 3QHFL 3ARBA 2HAZA 3KYMA 4YDLC 3X11B 4FQCH 1F4YL 1EEUA 2ATKA 2AJSH 5KSVB 4PJ5A 5B38G 2WUCH 4QRTA 5D9SB 1DLHA 2W59A 4MNQA 3TPKA 3MRIA 5T1KA 4R90L 1ZKAA 2P5EA 2AEQH 4QOKE 3LS5L 4XI5D 3V4VH 1BLNA 5EB9A 2DWEA 4K71B 4MA1C 1J0YA 5JNYB 3FQXA 5E9DB 3DMMC 4PGEB 3AVEA 5TQ2H 1INQB 4WV1C 5LG1A 1NAKL 1IKNC 1KN4H 2XIDA 3EFFB 4DN4L 1T2QL 3X3GH 3MOBL 4OQTL 1C5BL 1NCCH 5F89A 3QPQD 3SE3C 5DHXB 3ARUA 3VWJC 2ID5A 1KC5L 1V3MA 4G8FA 1JRHI 3VXRE 1T03L 4HV8A 2OTWB 5ID0A 4U7SA 1EA9C 3B2UD 1P7HL 2A6IB 1BQLH 3P9LB 3SDAD 1KCVL 3HR5B 4OZHF 4DWHA 2PR4H 4HJGB 2DL9A 2X1QA 3DMMA 3BWUC 4FQXC 2X70B 3O4OB 2YR3A 2VLLB 4WV1A 5EBGA 1IKNA 3IDGB 4RGND 3MNWA 4JFPA 1M05A 4OGYH 4OKVA 4YIQA 3EOBA 4U2YA 1I1AB 1IGJB 5MERB 3RVTD 4HGKC 1AKJA 3QQ4B 5D5MA 5T1DH 4D0DB 1LDPL 3SE3A 1IGMH 4ESKA 4Z7QE 5ITBH 2HLFD 1CFTA 3VWJA 2DQCL 4LP4A 4XPGH 5C86A 3LRHA 3RNKA 1AO7E 2YA0A 5GSRB 4Z77B 4OUOA 3GSOA 5D96C 1NFKA 3KLAB 3WNLA 4F7CB 5F7HA 5TDPA 4YUEL 2OTUB 4FFZL 1Q9WB 1P1ZA 1XGRB 3HI1A 4FQXA 5F96H 5JMOC 2H2PC 1TVHA 4GQ9L 3MLRL 3EJYD 3S96A 1A4JA 1DBBL 2Q8BL 1AHWB 2E7HA 4JDVB 1SJVA 1MRDH 2BOCA 2R1XB 2ZP0T 1K5NB 5E8PB 3N50A 5FV2A 1U8PB 5HHXH 3GMNB 1JGLL 1IC1A 3T0EC 4GRLD 1HINH 3KPSA 4OAWA 1MCFA 1WCBB 4R2GD 4I48A 5CGMA 3BD5A 1DUZB 2FJHA 15C8L 3RWEA 3QRGH 1AXSA 3QFJA 4NHCL 2X4UA 5IVXF 4O5LH 3PJSA 1RQ5A 2XRAH 3ULVD 3TH4T 2D9CA 3PGDA 1SYVA 4P5TC 4LSVH 1T21A 3SOBH 1CXFA 1CR9L 4JPIB 3OZ9L 1QRND 4FP8L 1WSST 3V0WL 5JOFA 5I8EB 3OF6A 3SKOB 4Y2DB 4OF8A 5I1JH 4ZOEA 3MRHA 2NY7H 3QZWB 4NQVA 4HC1L 3BW9A 3MTRA 3V4PH 3FB8B 2ZWLT 4JY5L 1NC4A 4KTYA 1A6TA 3P0YH 3ZL4L 1GRWA 5M95B 1JHKL 1P6AB 3P4LA 4KJWD 1GOGA 3OGCA 1WV7T 5FAAA 4KK9C 4P5TA 1CZ8L 2NLJB 4ELMA 4KQ4H 4AY0A 1QZ1A 5FA4B 3U4BL 4AENA 3SPVB 2DIJA 2B0SL 3LPFA 3O3EA 3TCLB 3FQNA 3B2VL 3K4DA 1E28B 1K9TA 5EUOE 4JM2B 3QJHB 3ROLB 1BOGA 2HKFH 3FQWA 1QA9A 5CMAA 5CJ5A 2IPUK 5DUPH 4NQXA 3D0VB 4HIHA 3H9SB 3I9GL 1ZSDA 1OQXA 3V0AC 1YEFH 3QFDB 5BS0B 4LASL 4NGHL 2JJUA 1WZMA 4G8GE 5DUMH 3UC0H 4PJAB 3BVNA 1VPOL 5FYJD 2DQEL 3IDIA 4KI5D 3HZKB 3QXWA 5CHNA 2DAVA 4GAGL 1I3RA 2Z91B 3CNKA 4AIZB 4K3GA 4Z78B 1XGQA 4M61A 1OVZA 4PP1C 5JR1L 3AXLB 4OQTA 2MHAA 3P0VH 1YYLH 4MHHI 4NRXA 4TVPL 3BKYH 3JTTA 5FDWA 5IB4A 1CDCA 4NZRL 2P4AB 1CGSL 1N64L 3O3DA 3RVUD 3QUXC 4M1GL 5C09B 2H6PB 4X7SH 3V6ZA 5C0AD 1II4E 3VFRA 4G9FE 4R90H 1XIWD 5JW4R 4YK4B 1A47A 1WZKA 3QUYD 2W07A 3T4AA 4OGXL 1KLUB 2VLJA 3LS5H 3WDIA 1J8HA 2XOTA 4JFOA 3MV7B 1I1CA 4U6XA 3FQUA 2V7HA 5IF0B 2GTWA 1JN6B 4Q9QH 3PWUB 4YR6B 4MJIB 1ZWIB 4MWFB 1R3IH 3PV6A 3STLA 4MAYB 4RNRB 1HWGB 5SWSB 2MSPA 3MOBH 4YJZL 1N3NA 3DJ9A 1JV5A 3D2UA 3T0XA 4PR5B 1T2XA 4OTXL 3ZE0E 3VMPA 3QUXA 3QAZB 2PN5A 3KJ4B 2IH1B 1F2QA 2D0HA 3NPSB 4YGAB 5C9KA 1KC5H 1MIEH 1J1PL 5J6HA 1ADQA 2Q6WB 1T03H 1MSPA 3EW3B 1AD0B 5E1AB 4DFHA 1H8SA 3CDYA 3SE8L 3CC5B 1DBMH 4TNVF 4OLUL 4AEIL 2BVQB 2AVGA 3L7EA 1KCVH 4YO0B 4E5XB 3X13B 4J12A 4XNXL 2B5IC 3KLSA 5ESAB 5DTFA 3OHXA 2CDFB 2X44D 4PGDA 5MI0B 5C08E 4XTRD 2OBGA 3D3VA 1BD2B 3QP3A 4JO3H 3HMWL 3NA9L 5CEXB 1FORH 1UM6H 2LU3A 3FO9A 4GSDL 2ZJSL 4L4TB 4FS0A 1UH3A 5C0CD 3TEUA 1XH3B 1LDPH 5HYJA 4BSWA 3QIUB 2YN3A 4X6FB 3AM8C 3HE6C 4WHYG 3LPWA 3DTXA 4PRPD 3CGTA 3C8KB 5JUEH 2DQCH 4PJFE 5HGBB 3V4UL 1D5XB 2YZ8A 3IFOB 5AD0B 4JRWA 3GSWA 2DLTA 4G6AD 1X44A 3O4LA 1CTOA 4YUEH 3PG2A 1D5BA 3OX8B 4QO1A 4PJGF 4ZS6C 2ZPKH 4X6CA 3LPGA 1U3YA 5DD1L 1A1NB 1HQRB 3MLRH 2AGJH 3HRPA 4MCZA 4P23D 2ADGA 1DBBH 4J3SA 2Q8BH 5KANI 1FCGA 3A6BL 4Z7WA 5DJ8A 3MRKA 3ZKQD 4HH8A 5D7IE 4Y5VC 2Y7QA 3L3JB 4Q6YA 4HC1A 4NM8L 2F53D 4RMQA 1JYWA 4XNUL 1YEGL 2C4XA 3AM8A 3HE6A 3DX7A 3AB0C 2BHYA 3AGVA 1JE6A 3MRFB 15C8H 2CLZA 1OAXL 2FGWH 5EOTB 4RQQA 3CFJB 2B4CL 4UIMB 2AJXL 4O2EB 3THMH 4DVRL 4QTHA 1JZ6A 3UPCA 2V5TA 4PJ8C 5FGBC 4I4WB 2XZZA 3MJGX 2PXYC 3T2PA 4Y19B 1KG0B 2FHFA 3Q5TA 5FB8B 1L0XA 1Y0LA 4JFDD 4Q74A 3KG5A 1ZA6B 3OJVC 2P5WE 3MROB 2F54A 4P4KD 5E4EB 3GGWA 1OM3L 1CR9H 1KCLA 3DGGA 3OGOE 3WIHH 1BIHA 1A9BB 3RL1B 4FP8H 3V0WH 2R0KH 5JW4Q 2ITDA 4Y5VA 4ZYKB 2R56L 2EDDA 5I8CA 1J8KA 3RVVC 4EN3C 3FONA 1RZGB 1MH5B 3ILQD 4NRZA 4X6DA 4S0SD 2EICA 2ZUSA 3QDJD 3BN9D 2YMXH 5TE4L 4JY5H 1KEML 1NKRA 3W39B 3LIZL 3FT2B 3TT3H 3H3KA 3MV9B 3REWA 4LGPB 4E9LA 4PJ8A 3ZL4H 1MJJA 5FGBA 1Z9MA 4JZNB 2JLLA 1JHKH 2PXYA 4N0UA 4UIKL 4CADB 2EXWC 5DURB 1VESA 5JIHA 1G1CA 2CRIA 3CDGA 4HQQL 2FHCA 3TA3C 1RJYA 1CZ8H 4GO6B 4JRXD 1U91B 4OIAA 3U4BH 1PX3A 2BNQA 2DI9A 2YSSA 4WCYH 1YMMB 4JO4H 4Y4FD 2VQ1B 4AH2B 3NCBB 2HMIC 3T09A 3MV8A 4EN3A 4LP5A 2HVJB 3VXQA 1AD9B 5SWQA 4P5MA 3EJZD 4BZ2L 4NQCB 2SEBA 5KSBE 4LSQH 1NGXB 4YHOH 5ENWA 5GRZA 4QRRE 5KSUA 5CWSB 2G75A 4OD2B 4PFEA 1CT8A 4LSDA 4LASH 2NYYC 3QWRA 3RY4A 1VPOH 5KG9B 1S8DB 5I15L 3L3IA 1N2RA 1M71B 4FXGA 4GAGH 3TA3A 3ARBB 1WJ3A 5JR1H 2ATKB 3FO1A 1NFDE 2P42B 3SDDD 3GSUB 3UBXA 3K74B 4PJ5B 1A02N 2GCYA 4QRTB 1CU4H 1DLHB 2UVFA 2VDRL 5DRNA 5EO1A 5HD8C 4MNQB 4DGIL 3MRIB 4TVPH 5T1KB 5C0NC 3BZEB 2P5EB 4HIXL 5J1AA 2PYEA 2BNUA 4NKOA 1LEKA 1FC2D 4NZRH 3CX5J 1CGSH 1N64H 3NMEA 1BLNB 2PO6B 2DWEB 4M1GH 3QXVA 1X5AA 5JXED 2VLRA 3WIIL 1T2JA 3BKCH 3FQXB 4ODTL 1G6RH 3E8UL 3TESA 3VGBA 1FNEA 4R7NA 3D25A 3RY6C 4NZJA 4OQ1A 3IDMA 2EYTB 4OGXH 3VWKC 4UOW0 3CFIC 5C0GA 5CKAA 2Y25A 1IMHC 3N1MC 3O6FC 1ZHBA 3BDYL 2R2BA 5DD6B 1FC1A 5I16A 3NA4A 3DO3A 4L29A 3CAFA 4QXUL 3RNQA 1UG9A 4G8FB 5E9DD 1EPFA 3PDOA 5K9QG 2X41A 1IE5A 5DFVD 1ZLWH 3EO0A 2R4SL 3VXUA 5ID0B 5T33L 3NN8A 4WHYH 2XQYG 2F74A 4OTXH 4HBCL 4YZFE 4V1DA 4Y2OA 4OFKA 4MA1B 2GUOA 2HT3C 4MA8L 2B4CC 1J1PH 4WV1B 4HXBL 4DKFL 3RY6A 3MNWB 4JFPB 1M05B 4OKVB 4YIQB 3SE8H 1I9EA 2BVUA 2NX5E 3TO4C 2VAJA 4AEIH 3EOBB 3VWKA 4ZXBC 2FZ3B 3VH8G 5D5MB 3PP4L 3O6FA 3WS6C 4PGCA 4XNXH 2CO7B 3CFBA 4YPGA 1I7ZA 2H2SD 4WUUB 2OK0L 1CFTB 3L1OL 4P9HH 5E70A 2MOVA 2OQJB 1N5AA 1LGVA 3I02A 3GI8L 4UB0L 4X7CC 3WNNA 3NA9H 1PEWA 3GSOB 2B1HL 3TBYA 4XBEL 4GLRH 3GRWA 4I18C 5ECJE 4GSDH 1KPUA 1KNOA 3ARGB 4ONFL 1INEL 1I1AD 5EZJB 4TSCL 1ZLVH 1P1ZB 2WLYA 4ZS7L 4FQXB 1LILA 1TVHB 3B3IA 4NRYA 3CVHL 4W4OC 3UTTE 4NNYB 1VFMA 3TO4A 3KS0H 2R2EA 1BBJB 4TYUA 4P2RE 4ZXBA 2E9BA 1FIGL 1S7SA 3WS6A 4JFFB 1QQDA 3KPSB 4GKNB 4I48B 5DD1H 4RCAA 1CGYA 3WSQL 3WXWH 2FJHB 4C83B 1YDPB 1AXSB 1Z5LA 2ED8A 2X4NA 3A6BH 4HKBB 3QFJB 1NDGA 1QSED 2X4UB 1KCRL 4I18A 1JGVL 1CDIA 3PJSB 3UEZA 4RFOH 5K9JH 4NM8H 2DLGA 1KENL 4YDJB 3V52L 4XNUH 1YEGH 3LEXA 4IOIA 4FXLA 2APVA 1KIRB 3PGDB 1SYVB 1J05A 4W4OA 3L3DB 1U95A 1OAXH 1T21B 4D9LL 3T3MF 2AJXH 2OR8A 1L0YA 3KPNB 3DPBA 1E4XL 5JOFB 3T0EB 3HC0A 5GRUL 1B90A 5IW6B 4NQVB 2P48B 3P4OA 4ZFZA 3BW9B 1A7NL 1BEYL 1OM3H 1DBJH 3RDTB 1C12A 1L6XA 1KTDA 2R56H 3G6JB 3J7HA 2VZ1A 1LK3L 3MUZ1 4LFHG 4KJPC 4Y2DD 3HA0A 4P5TB 2NCMA 3FAXA 5TE4H 1SEQL 5J11C 1KEMH 5K59E 2CQVA 3LIZH 4LHUA 4K7FA 4ELMB 2WAHA 1KSRA 1BAFH 2GJ6E 3WUZA 4AENB 5C07E 4OF7A 3O3EB 3ZT6A 4WW2C 4UIKH 3B8SA 3FQNB 2C4FU 3TBSA 3LVEA 4KROC 4U4BA 1TZGH 5IEKB 4KUZL 4LDOB 4TVSa 2HA1A 3BPCA 3OKDA 4Z18A 3D85D 5KW9L 3TGXA 3U4AA 3BQUC 3EOAA 4QOKA 4NQXB 5F3BB 4ZAKA 1ZSDB 1IGFL 2WQRA 5F6HI 2BCKA 3BVNB 3PP3K 3K8LA 2PYFB 5DRWA 1AXTL 3IDIB 1A7QL 1MNUL 4M02A 3QQ9C 5HDQL 2MCPL 1KB9K 5CHNB 1IC7L 3Q3GA 4PTUA 1I3RB 1NGZA 3FMGL 4N1HB 1ZXQA 4QF1B 5BMFL 5INCA 3G04A 1XGQB 4M61B 5D8JL 4H0IA 3H9SD 2MHAB 2CXKA 1NMBL 1RURL 4WW2A 5I1CL 4KV5E 4LAQL 3V5DA 3KJ6L 5BS0D 5IB4B 1M1SA 3VXRA 3SDXE 3A6CL 4XAWL 5FV1L 1U36A 1JUFA 5JW5A 2DD8L 4F7EA 3BQUA 1V7ML 2DKUA 4K55A 1I1RA 4RA0C 1OWWA 3V6ZB 1U8HA 4JKKA 2W65A 4EOWH 2VDRH 3ZT5A 4IBLT 4DGIH 3HS0B 5IROC 4L1DA 1P4LB 3MUY1 5DMKB 4RWHA 3QEUA 5C0BE 1J8HB 4HS6A 4X5XA 4JFOB 3AAZA 1GAFL 3WIIH 1GXEA 4X7FC 4GRWE 3FQUB 4ODTH 1KT2A 1ZOXA 5BJTB 3E8UH 2HJFB 5KN5B 3VRIA 4LVNC 3DECA 3PV6B 1R3KB 2EE6A 5C6PB 5C92A 1AO7A 1JV5B 5DJZA 3FQRB 3BDYH 5ID1A 2Y36L 3OKLA 3MXWL 4Z0XB 1WFNA 2IALA 3CSPA 3H9HA 4QXUH 1DLFL 5J6HB 1N4XL 5IROA 5GGVH 2HLAA 4U1GC 2Q3AA 2R4SH 4MJID 4MQSB 4E41E 4LPUA 5T33H 4MAYD 3L7EB 4NFCA 4HBCH 3GUTA 3CVHA 2ILLA 4YFDB 3S3JA 4F33A 4QXWA 4MA8H 4ZOAA 4PGDB 2ADIA 4HXBH 2A77L 1GZPB 4Q9RL 3OSKA 2ZG1A 2WBJD 1T7YA 3JUZA 3ET9F 5TH2A 3BT2L 4M8VA 3GDBA 3PP4H 4R97C 2X09A 5ADPL 4BSWB 4XRCA 4MNGB 3DTXB 2OK0H 3L1OH 1RUAH 4HX1A 1R5VB 2HRLA 4UB0H 1I7RA 3GMPA 4IRJC 5FUOL 2B1HH 1BD2D 3TN0C 3SO3C 1CE6B 4NPYA 4HKXA 4ONFH 3IAGC 1PX4A 3EDJA 4TSCH 1DL7L 4L4TD 5SWZD 5IT2L 5D1ZC 2J8UF 2X4TB 4MCZB 3CVHH 2ADGB 5C1MB 3QO1A 1FZOA 4NZUH 3KR3H 1FVDB 4Z7WB 5LKNA 1QD0A 25C8L 5DJ8B 3MRKB 2BZDA 1FIGH 3VFPA 1CFQB 5CGYD 5GJTH 3WNPA 2P8LB 2Z31C 5T3ZE 3HE6B 3DX7B 4NSKA 3UJJL 2AAVA 3SKNB 2JF1A 3WSQH 1H8OA 4IRJA 4RQQB 4DW2L 1PYWB 3TN0A 1JGVH 1ZGLB 3FHQA 2PW1A 4QTHB 4RAVA 1IC4L 4U33A 1KENH 3V52H 3P2TA 4JB9H 4KU1A 1RZJH 5D1ZA 1CGUA 5GIRA 3SE4C 1OAQH 3VDCA 1JK8A 1Y0LB 1D5MB 3V2AR 1RIUH 2QSCL 4J3WA 5E8EB 3U30C 3GGWB 3DGGB 3O11B 4KZEL 4N5EC 4ZFOL 4ZTPL 5JW4M 2ITDB 4Y5VB 3SCMC 3AB0B 2YD7A 1MJ7L 3B43A 3FONB 4NRZB 1X5XA 4X6DB 3ZYZA 1KLFA 1TQCC 4G8GA 3X12B 4Y19D 2MJWA 4BUHA 2I27N 1BEYH 3A0OA 5ACZA 3S97C 2WUBL 1WBYA 4LCWA 1FVCA 2WINA 2BVPA 3HFML 3REWB 2P7TA 2BY0A 5DLMH 1MJJB 2EECA 2UZXB 3C6LC 4LLDA 4N0UB 2PXYB 2D7OA 1D5ZA 1LK3H 3QIBC 2DTSA 2J12B 2APBA 5I1HH 1FYTD 3SE4A 4FQ1L 1SEQH 5IGXL 3SJVA 1SY6A 5E2WL 4HHAA 2XPGB 3EDDA 2YSSB 4XMLL 5DMIL 2VXTL 3G5VB 1ZT4A 3MV9D 2GSIA 3MLTB 3SCMA 1BPVA 3MV8B 3VG0L 1O7SA 3VXQB 2IPUG 3MXVL 5JW3L 4P5MB 1DQML 4G9FA 1ZLUK 1JFQL 2NXZC 2SEBB 1BBDL 1G6RB 1L0QA 5ISZD 1S7WA 2G75B 3EIFA 1IGFH 1GL4B 2A74B 3TYFB 2XY1A 3UXFA 3C6LA 4XP4H 3IAQA 3NH7L 1YMMD 4I3SL 3QIBA 4Y16B 1HILA 3ULUF 2A83A 5T5NF 3L3IB 1TVDA 4LRIC 2R9HD 1MPAL 1A7QH 1KELL 1MNUH 2FX8L 2MCPH 4JPKL 2B2XL 1AR1C 1IC7H 4HK3J 4X5WB 3TA3B 3E2HC 3MLVL 4EEEA 3FMGH 1MFDL 4NC0B 5BMFH 5EOCJ 3FT3A 5D8JH 1N7ML 4JREB 3HG1E 1NEZA 5I1LB 3FO1B 1S7XA 2X4RB 4M8QB 3WJJA 1K3ZA 1DCLA 1NMBH 1RURH 5DRNB 2R39A 5EO1B 4LAQH 5A3ID 4PREA 2VWEE 3OV6A 5GGQL 5J1AB 2PYEB 2BNUB 3A6CH 1QRKA 1LEKB 4XAWH 4RGNE 4N8VA 3T3PF 3OAYK 5C7XL 3MRCA 2VLRB 1C7TA 2BOBA 3GZKA 3WLBB 1V7MH 4TOYL 4PLKD 4RX4D 1AFVH 5IVXE 3ARBD 1JBJA 2IFGA 5FGRA 4R7NB 4CNIA 1CFSB 5JDJA 5BZDA 1TZIA 3HI6L 3FJTA 4PJ5D 5C08A 2X4QB 4LRIA 5H35A 1KN2H 1XMWA 4MNQD 1RUQL 5EWIL 3KPLA 5B4MD 5MEND 4CW1A 2P5ED 4XP5L 1ZHBB 2BX5A 1GAFH 3S8WA 3EGSA 2R2BB 2PO6D 4OFPA 2X1OA 5I16B 4ZMAT 4L29B 1VGEL 1TMCB 3DUUA 3RNQB 4G8EB 1AI1L 3PDOB 4PB0L 3IKKA 4M43L 4PJFA 4M7KL 3EO0B 3RWDB 3VXUB 4KKBC 3TBVA 1RULH 1DSFL 4HWZA 3NN8B 5ADOL 2AXGA 5EIVA 3MLWL 4Y8DC 2Y36H 3BISA 3MXWH 3LQMA 4V1DB 4R4FL 1TNMA 3VRJB 1KYOK 1CFNA 2RAMA 4U0RB 4U1HA 1DLFH 1A6AB 3DYOA 1N4XH 3HNSL 1KCKA 4I9WD 3RWCA 4QKXB 2E27H 9CGTA 2ADFL 4RGMC 1WEJL 2FBOJ 3PWLA 5A2LH 5EU4A 3O6FB 2UYLB 4IOFC 3EYSL 4PGCB 5D7IA 1MLCB 2CLVA 3CFBB 3F7VA 1JWSA 5LJYH 4Q9RH 4K7PX 3ULVE 4N90E 3LH2H 4IJ3C 4I5BB 1EMTL 3BT2H 1MWAA 1KPUB 2F8OA 1KNOB 4R9HA 5C0FB 4PLJC 1E27B 1QRNE 4MS8C 3V7AG 4U1LA 4NRYB 3B3IB 3IJHA 4KMLB 4WUUD 5FUOH 3SKMA 5CSBA 5AUMA 2NXYD 2P5WA 3KWWA 3RVWC 3MYJA 4UTAL 3RTQC 4ZXBB 4YQXL 1FGNL 1DL7H 1MF2L 5IT2H 1QQDB 3ARGD 3L5IA 2JE8A 5B8CC 1M7XA 1GGIL 3WFDL 1QOKA 4P9ML 4QCIA 4FQXD 4JJ5A 1KPVA 1I7TA 2IH3A 1NDGB 2CIKA 3DVFA 3RX8A 4Z7VF 2DLEA 1YY8A 3DRQA 2JK5B 3Q6FB 4FQLH 3ZYJA 4Z5RB 3ZKSD 2V2XA 3UJJH 1A1MB 1NH6A 4IOIB 5HHVL 4JFFD 1J05B 3KPSD 1TCRB 3ZMRA 1U95B 3LKPA 3GO1H 5CEYA 3E6FA 2VN7A 2I5YH 2UWEF 3Q2CA 5IMMB 2ZOLA 5CJOL 3RTQA 2E7CA 5EPMA 3HR6A 5IG7B 2DQIL 3HC0B 4CUCA 3AS2A 3FKUS 4HSQA 1FGVL 1UZ6F 4HULB 3P4OB 1LO3H 1BFSA 5B8CA 5FYJE 1IGYB 1FLRH 2QSCH 1FZMA 3L5XL 4R4NC 4HPYH 1DANT 4QGYA 4OZGE 4KI5E 2JJWA 4KZEH 3QIWC 4JFZH 4N9OB 5KSBA 1B4RA 4IMLA 4QRRA 3K8KA 2IFFL 5IQ9A 1MJ7H 4WHTB 3HMXL 3T0ED 1JWUA 3BJLA 3O3UN 3MRPA 5E2UL 3P11L 4PD4J 1BFVL 3QH3A 4K7FB 3U48A 2WUBH 5ALCL 3T08A 4HCRL 2L0DA 1F5WA 2R15A 5EA0L 3RDTD 2YRLA 2A6KB 3IU4L 1EHNA 3NVQA 5C0AE 1NFDA 4MQ7A 4WWKC 4TTDD 1TPXB 1MJUL 3BPCB 3JWOL 3OKDB 4H88H 4FQ1H 5HYFA 2PTUA 5EU3A 1YNTB 4QOKB 4XC3L 5E2WH 4JLRA 3QIWA 5DYOA 5EC2B 3VXOA 4XMLH 2VXTH 2BCKB 3BE1H 5HXMA 4JFEE 1VFOA 1VGKB 3VG0H 1MFAL 5F7EL 3MXVH 5JW3H 4HT1L 5DVOA 1DQMH 1JFQH 4KK5C 5H37G 2DQTL 1BBDH 3Q3GB 5J11B 3NCMA 2YEZA 4BSVA 1BZ9B 3D6GA 3G04B 2XXMB 5IJKC 5A2JH 4TRPL 3EOTH 3NH7H 4I3SH 4WW2B 3V5KA 2NW3A 4PJGE 3V5DB 4WWKA 4KROB 3NFNA 1MPAH 1NDMA 2FX8H 3OR7A 2B2XH 3BQUB 1NANH 1MFDH 1FG2A 3MR9A 1N7MH 3JSSA 4PJEF 1MCCA 5KSAC 5D4QA 3VXTB 2FDBP 5GGQH 4MA3A 3R0NA 4NZDA 2OSLB 5FF6A 2VDPL 5D7SL 5E6ZA 2OR7A 5C7XH 1OSPL 4HS6B 2KZ1B 2B8OT 4MCYA 1BQHG 4TOYH 3FTGA 5EO9A 5C0CE 1H3PL 3VFUB 5IJKA 2VLKB 4U3CA 2EDYA 1U8KA 3BH8A 4PRPE 5EO0A 2P8PA 4ODWA 3UPRA 3EHBD 3B6SB 3U36A 2X40A 4DVBA 5EWIH 1RUQH 1FFPA 3GJEB 4XP5H 5D93B 3JTSA 2WWKO 3M8OL 5GHWL 3T1FA 5ID1B 5ESVB 1J8HD 3UAJC 3T04D