2DJUA

Solution structures of the fn3 domain of human receptor-type tyrosine-protein phosphatase f
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
106
structure length
106
Chain Sequence
GSSGSSGPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTEGPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-type tyrosine-protein phosphatase F
publication title Solution structures of the fn3 domain of human receptor-type tyrosine-protein phosphatase F
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 106
sequence length 106
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2djuA00
2M2DA 4QHMA 4ZUVA 4UTAL 4Q6IB 1UWEL 4DTGL 3GB7A 2CRYA 4P46D 2YEZA 3PGDB 1GXEA 4LEXL 3QEQB 3V5KA 4KRMB 3HMXA 1FYTE 2AXHA 4Y4FD 3QUMH 2VZVA 5J0BA 3FB6B 3QCUL 1AD9A 5HHPB 4KHXL 2BSTA 3HCVA 2VLRE 5I8CA 4P2OB 4XB8A 4XVSL 3QJFB 4Z7VE 4LLQA 4QHNA 4M9OA 4GMSH 1C5CH 4QRUA 5INDA 2OP4H 3SDDB 1FO0L 3BT2L 3BKYL 2ATKB 4BQ8A 2VMFA 5CZXC 2J7LA 2BVOB 5F7UA 5IJVB 1T2XA 4M48H 2OSLB 4XVJH 5BW7A 2A83B 4POZC 1XIWD 1VFBA 4FQ2L 4TTDD 4MDIA 1DBMH 4QXUL 2KZWA 5J6GB 3SDYH 3X3GH 3AB0C 3GMLA 4WVRA 3HRPA 2VLME 5DJ6A 5EZLB 1A7OH 1SY6H 5D1XA 5GRZA 1QACA 3LIZL 3PQYD 1G0DA 4PJAB 3RVXD 2B4CH 3LKNB 4DJMA 1IILE 1T4KB 4J1UA 1MHEB 2HRPH 3S35H 4EQ2A 1AGFA 2VDRH 1KXQE 1FFOB 3ZKNC 4PJFE 4WUUD 2AK4A 5DMGD 2GJ6B 3GRWA 4G3YH 2EO1A 4WFFD 3GUTB 1S9XB 3OR6B 1RURH 3IFPB 4TQEH 3BKJL 1OPGH 3KPLB 5AZEL 4JO3L 5CD5C 4G8GD 2BY2A 4JY5H 2XKNA 1A4KB 4NBYB 1JHKH 5J13C 1JK8A 5SWSA 3D3VD 1D6VL 2X1OA 4ZXBB 5DHYB 1R5IA 4R90L 1QRNB 5I1DB 1ACYL 4RZCA 5EPMA 2VABB 5A2FA 4ACPA 5DVOA 3SCMA 3AXLB 4WWKC 3CFBB 5C0AD 1LEGB 3IJHA 3TFKC 1CGYA 2AABL 1V7MH 1NMCC 4ZUWB 2B4CC 4XNMA 3SGDH 2JJTA 1KSRA 1B0GB 2CGRH 3U7YL 4H88L 4QRSA 2HA1A 3O3DB 3ECBB 2A1WH 4E0RA 3PHQA 5I8OH 1CG9A 1KLGB 2FX9H 3P4MB 3OKEB 5FCSH 1GIGH 3L3DA 3AS3A 1EO8L 1LHZA 1Z6JT 4DW2H 5IW1B 1BFOA 3BSZL 2R0WH 3DO7B 2J6EL 1SJXA 2GTWA 1JV5B 1IEAB 1OM3H 5E94A 3KPSD 1G0XA 2PR4H 4KJYB 2ESVD 1X5GA 1HK6A 1NEZG 3L1OH 1NMAH 3C2AH 3DV6B 1UYWH 4L4TB 3RFZC 2AV7A 4OLUL 5FUZL 2LV4A 4M6OH 4IRZL 1X5LA 4MS8D 4OGYH 2XYCA 3Q6FB 5FUOH 1MIML 1KACB 5HHQA 1RZJC 5C09B 1TZHB 1WBYB 3BP6B 3C2SA 5JHLH 4KRLB 2VR9A 4LSVH 3CXDL 4IMLB 3V8CA 1IEBA 4WENB 3SKNA 1RZKH 3QDJD 3B3IB 3DUSB 5FEBA 4X7SL 2NY3B 4YHOL 4F7TB 5I6XB 3PUCA 5MI0C 4ZSOE 1DBBH 5DDHA 3SY0B 1DBAH 1MRCH 4N8VG 4OGXL 3X3FH 1KEGH 5HHVL 1I7ZB 1YJDH 1N26A 2X4OB 5JIKA 5I9QB 2EIZB 5IT2H 1NSNL 3OXRB 4G6KL 5JUEH 3HUJA 2ZCKH 1YEHH 1R0AL 5AZ2L 1OGAE 2R8SH 1JUFB 1JGDB 3VWKA 4L3ED 3L6FB 4KJWD 4JG0H 3BPOB 5CZKA 3T3PE 3QPXL 4UOW1 2D31B 3LN4B 2GAZB 1KPRB 2FGWL 5GSRB 3MJ7B 5J89A 1RZKC 4JGUA 2YPLA 1DQML 4GAFB 4MB4A 1G7MA 4DKAA 3CPLA 1DLFL 4W4OA 2K7QA 3EOBA 1WWCA 3DJ9A 4TUKH 3GHEH 1R24B 3HMWL 1F4WH 3DURB 4QRRD 3V6BR 5HVGB 5B3NA 4QRTA 1MQKH 3FB8A 1IAIL 1G1CA 1K8DB 5FHBH 3B6SB 4YGVB 4IDJL 3PGFL 3CCHA 2OK0H 1IGMH 2F74A 1KYOK 2FX7H 5EO9A 1CDCA 3AU1A 1U8HB 5GGVH 3V0VB 4DK3A 3MC0A 5J6HB 2Q86A 1ONQA 1EMTL 4U6HB 5E8EA 3OAZH 2X70A 2DQTH 5D2LB 1MFCL 1LO0L 1MWAA 4OCLC 3HC0B 4RIRB 3MJGX 3E6FA 3REVA 3UDWA 2B0SL 1BJMA 1QLEH 2DKUA 5B8CC 4YEEA 2R15A 4OD1L 2XZCH 4C56D 3BD5A 2CKBL 4XPGH 3TZVD 1KULA 3I6LD 3C09C 4DUVA 1P4BL 3P73A 1HNFA 2G75B 3QG6B 4W4OC 3MLWL 3QDHA 1Q0YH 2EYTB 1D5BB 1OGTB 1CXKA 2WINB 5DD1H 3IXAB 3UXFA 5ACLA 4GKZB 1C7SA 4L1HA 2F5AL 2IADA 1M05A 4XVTL 1LO4H 4JQIL 4EDWH 1NAMA 3MA7B 4UV7H 1UM6L 4JFPB 4HH9A 1XGPB 1C5DA 2VQ1B 3GI8L 4MA3A 2IQAB 4NGHL 1U2CA 1AI1H 4NIKB 4EUPB 3RI5K 4GRMA 4PJGE 2AJZA 4Z7QE 3HR6A 4S10A 2CQVA 3RDTA 5LXGL 4PRHA 4NO5B 3L95A 4MXWL 1EVUA 3TN0C 4KK9D 3LS5H 1LK3H 1JPSH 4U1LB 1SHMA 1KJ2B 1TNNA 2CLVB 1A7QL 2IC2A 5KSAB 4OD3L 4Z18A 4P99A 8CGTA 4XP4L 1TPXB 3BP4B 2EKSA 4GMTL 1IGTA 4R8WH 4ZPTA 3EGSA 4YPGB 3SGEI 2AXGB 2ARWA 1SEBB 1PZ5B 1X5XA 2PUQT 3L5XL 2WW8A 1IGYA 5D1ZC 3EDEA 1DSFL 3QUXD 1JNLL 4P2YA 2EO9A 1FL3B 3WNPA 1I8MB 1KGCE 4JY4A 1XF5A 3GK8L 1MRDH 1JZ6A 4ZFOL 2BVTA 5BVJA 1J12A 3HE7D 4P5TC 4I0PB 1EDQA 3MBXH 3VDBA 5D2NA 4JZNB 1IC4H 1P5UA 2C5DC 3L9RB 2ED8A 2HJKA 4AK1A 3DTXA 1CGUA 4CBPA 4JN1H 2ADFL 3VXSA 4QXGL 1HOCA 2O5YL 3QCVL 1PVHA 4P3DB 4XXCC 2HVKA 4YXKL 3SDCA 4BQ9A 1MAML 3A67H 4BFBD 4AEIL 3HC3H 3RL2B 3PP3H 4PP2A 5BXFB 2MWCA 2H1PH 3N9GL 5DUBB 1E6OH 1UB5A 1T1XA 4FFWD 2FNBA 2A2QT 1M6OA 1W72B 3WIIH 2HKFL 5JOPE 1U42A 1F2XK 2PCPA 1RD6A 5CP7A 3VXMB 5B38G 5EU6B 3QDMB 3PGCA 3B5TA 4KMLB 4HAGA 3UTTA 1BBJB 3L3JB 2ITCA 3GJFK 3KLAB 1MY7A 1ZKAA 3D39D 3MRBB 3IDGA 1YPZB 5DUPL 2XFXB 4Y88A 4ZPVA 5IESL 3ZE1F 5E2WL 3SDAD 1K9TA 2HKHH 1FCGA 3KJ4C 4LOUD 2R1XA 3L7FB 1W0WA 5C0ND 4EN3D 4DKEL 5D6DA 2Z8VC 2FGZA 4IHOA 2JTDA 1TVHB 4E41D 5CSZA 1RIHL 3OJVC 1YYML 2ILLA 4FXKB 5F1NA 5T1LD 3W39A 5T33H 2VLKD 2F53A 3OAUH 4G6AC 3ALPA 4H1LG 1BVZA 1G7JA 5C07B 4KI5F 5T3XE 3BJLA 4FMFA 5FV2A 5EU5B 2LVCA 4NKDA 4OQTL 3UROR 1HCVA 1ZGLM 2ZNXA 4YFLF 3CDCA 1R5VA 4W6XB 4KRPB 43C9B 1P4LA 4DZBA 4I3RL 1X5FA 4S1DD 1EH9A 5J1SC 4ZAKB 4D3CH 3KYOB 3CVHB 4NWUH 2RIKA 2VITB 3VRJB 5DJCA 1YEJH 4DN3H 5I1LB 2WQRA 3FONA 1HN1A 1CD1B 3KLHD 1RZ7L 1B2WL 5HGHA 3ARPA 5E8PA 2GIYA 5D6DC 2BNQA 1MCCA 1YN7A 3MRCB 1S7QB 3PWPA 5FM5O 3O6KL 3RGVD 2WWKO 1T03H 4FFZL 3V6OE 2IPUG 3FRUA 1UCTA 1I7RB 3HNTH 4OCYH 1A0QH 4MJ2A 5E6IB 3IDJA 1ZVHA 2CUMA 2X4UA 2FCBA 4O51A 32C2A 3QWOB 3O4OC 4Y16A 1LEKA 5T1DH 1ZLVH 1TJIL 4P9ML 2OTWA 3P9LA 4X6CB 2X89A 3LZFH 1JPFB 4LF3A 3GJEA 43CAB 2R0ZL 4NNPL 3SGDI 3WXVL 1YEIL 4OKVA 3PJSA 3DETC 3Q3GA 5CILH 2HT2D 2FATH 5BV7B 4HWBH 4Q9RL 3MO1B 4NN6B 4HMDA 5IGXL 3TO4A 4LSTH 1AGEB 3RBGA 1G6VK 4M93B 3VFVA 4DOHB 1C8PA 4BZ2H 3L3GB 5CJQH 4IRSD 5CKGA 2DI9A 3V4VH 2WUBH 2NYYD 3H3PL 2HFFA 1G7IA 3CAFA 2WK2A 3HFML 2V7NA 5E2VL 3DXAD 3DUUB 3VMPA 4JLRA 1HHKB 1WF5A 1NDGB 3QFJE 1AC0A 5INCA 5EUOA 2PO6C 2W9DH 3FFCA 5FKPA 5I73B 3BDYH 2DBLL 2JJWA 5TE6H 4DAGH 1SM3L 5FO7A 4F33A 1SBSH 3GBML 3QWRA 1NDMB 4PY7B 1YQVH 4I3GA 4NKQB 5MENB 4UOW0 3UTZA 5A2JH 4XPHL 5JHDD 2XZAH 1GC1L 4BZ1L 3V0AC 1I1AA 3DYPA 4HMEA 4RFOL 4JQXC 4M7JL 4GKNB 4HHAA 2VERN 5D8JH 5D9SB 4N8VA 3B2UC 1NBQA 2FR4B 3BH8B 5BQ7B 3WV0A 4KK5C 5FAAA 4PJFF 3BPLB 3T0XA 1G9MC 1I7UB 1EUUA 3OKLA 5ENWB 2QLVB 4PG2C 3MFGB 3T0EE 2UY7A 5ESAA 4ODSH 5C0DA 1I8KB 2WBWB 3TO4C 2R4RL 4KI5C 1MFBH 4XPBL 1FYTA 1PZUB 3WSQH 3MSPA 1ZHLB 2AI0L 2JCCE 4PIRF 5HXMA 1TVDA 5C0CE 1EZVX 1MQ8A 4KKLC 5F88A 3DSFH 3V5HB 3ROLB 1BZ7B 2VLRA 2EE6A 2QR0B 2W1NA 4Z7VA 3BI9X 5T3ZH 2ZSVA 7CGTA 3P0GB 4PJDE 4QHMB 2LU3A 4ZUVB 5D5MB 1KJVB 3MOAL 2J8UE 3ZKQD 5ADOL 1A5FL 3ZE0E 2DDQL 1T7WA 3GB7B 1HHJA 4WI6A 3Q2CA 5D7KD 2YEZB 3KWWA 1E4KC 4PJ9D 5DR5L 4M7KL 3V5KB 4WU5A 5F71A 1AY1L 1NLDL 4I48A 4NQEB 3LAFA 1AD9B 2ZZUT 3VGEA 3O3AA 1FIGL 3QEGL 4JJ5B 3E2HC 2EDXA 3EYFA 2KL6A 3ULUF 4QHNB 3OAYK 4HC1A 4XMPL 3O2DH 2BXZA 5INDB 3GBLA 1JMXA 1JGUH 3OJDA 2YPVL 3RHWF 4BSVB 1MJUH 4XWGH 1EXUA 3QIUD 2VO5A 2WLZA 4WGWB 1DVFD 4JHWL 4M7ZC 5BO1H 2D4FA 4AZ8A 4WFED 4MDIB 4BQ6A 4CN1A 5HY9A 2Y06H 4LPCA 3GMLB 5MP6L 1H3XA 1UXWA 4P2RA 4OF7A 3ARBC 5I1GH 5IFHL 3U7WH 1EJ6A 3I50L 3P0VL 4O00A 1O7VA 3X13B 5C8JA 3T2OA 4HS3A 5KANG 3FAWA 1KTLA 3RX8A 4NJAH 2YA1A 5GGTL 1AGFB 4PLJC 4BH8B 3S97C 3EDJA 1PKQB 4DCQA 4V1DD 1A1NA 1VHPA 2ZOLA 3TJHC 5IB2A 4OFDA 3I6KA 1VEOA 4K94H 2H45A 1FG2A 3EYUH 1EZVY 3QRFM 5SWSB 1IBGL 4J4PD 3RHWK 3EJZD 1F3RB 4PGDA 4C58B 4G8EA 1R5IB 5CGYD 4ENED 1PQZB 4RZCB 5EPMB 1OARL 1KB5H 3SCMB 5JW5B 4N9GA 4J3WA 2OX5A 4DEPB 5ITBH 1W0VA 5TE4H 3IJHB 4ESKA 4XNYH 3JTSB 4FTVB 3UX9B 1N5AA 2AQ2A 4WW2F 4XNMB 5JO5B 4IEFB 4Z9KB 3MV7D 4QRSB 3G6JB 2BVQA 4E0RB 4MNHA 3MRRA 1RY7B 2EZ0D 3ETBF 3F6IA 5I1IH 3UEZA 3QT2A 3LV3B 5F7YC 4LLAA 2HLFD 3BE1L 15C8H 3U9UA 1PX3A 3OZ9H 1J88A 1ES0A 4JCMA 1WAAF 1BFOB 1OAYH 4UDTA 3QBTB 3HG1E 5IVNA 1B0RA 2GTWB 2EECA 5DD3L 3O41A 2ITDA 4YQXL 3AREC 4TSCH 4JZOB 3WD5L 3JWDL 5DUMH 4LRIA 4FFYL 3VXUD 1MCOL 3U30C 1DQLH 5L2KA 4OZIE 2VL5A 3ULUC 1TZGL 5LAXB 2ZUUA 5HHQB 1JZ8A 5DMJB 3OJ2C 1KTRL 4X6BA 4GRWB 5BJTA 1AO7D 2VLLB 1OGAA 3VXPA 3AVEA 1IEBB 2H2SD 35C8H 3VXRA 4PV9A 3R06B 4F7EB 4QOKE 4OF5A 4WHTA 4PJ5A 3BN9D 1KCUL 3KGRA 2R2EA 3O4LE 3WXWL 1EX0A 1G7LA 5DDHB 4KTDH 5B38A 2H3NB 2VH5H 2BERA 1CICA 2HJLA 3V52H 2XOTA 1U8OA 1ZVSB 4W6WB 1EVTC 4M03A 4JHAH 5HYJD 3C08H 3EYVA 3HUJB 3U0PB 4I2XB 2NY7L 3VWKB 1V7NL 1DBJH 4L4VE 4N0CC 4PB9L 1DTUA 2BZDA 1T21B 2Q87A 4XC3L 1R3KA 5JW4Q 3WJJC 1BLNB 4KZDL 4TUOA 2C1OA 3CH1A 4EVNA 1KJ3L 3BDBA 3LRHA 4PJGF 4M3KB 2FECL 4Y4KC 2GJZA 3LRGA 2FHFA 4XGZA 4Z7QF 1I8IB 4FMKA 4H1LA 3VH8G 4UB0H 2Y6SC 2Q7NA 5SX5K 2DOCA 5CZVL 2DS4A 5LGHL 3VW3H 1KIPB 3MLUL 3CPLB 1DEDA 4MA7L 5D71L 4UNUA 3CLFH 4X7CC 4JQVA 3EFFA 4FQXB 4PP1C 3BXNB 2IAND 3MGOA 4WCYH 1F4XL 1D5IL 1EEYA 5CWSB 3FB8B 5FHAH 4MQTB 2IG2H 5L7XH 4WW2C 1ZTXL 3ZTNH 2DQDH 1T04B 2XI9A 3KXFE 4S0TD 4QRQA 2F74B 1ZE3C 1ZT4B 2PXYC 2BJMH 3MJ9L 2KBGA 3AU1B 5I74C 3DIFA 4MQ7B 2QSCH 2Q86B 3ZYJA 2JF1A 2IPUK 3BX7C 4Y19E 1ONQB 2LTQB 2HLAA 3BWAA 5E8EB 2X70B 5IQ9A 4HV8A 3V6ZA 3O0RL 3CZFA 3GGWB 3T4YB 1KLFA 1MWAB 5GISH 1Z3GL 1CGXA 3GSNL 4IJ3B 5E8DH 3E6FB 3REVB 1TJHH 4LCCC 1RK0A 1A64A 4UT6H 4YR6B 4P5MA 2DTMH 3EHBD 1R3IH 2F54A 2ICWI 5IB3A 4YE4H 1YQ2A 3KR3H 3P73B 1G9NL 2E7MA 4F9LA 5DJDA 1MCEA 1OAXH 2RR3A 4U7SA 1CIDA 2IADB 2EEBA 1M05B 2A38A 3D69A 3UBXG 1HZHH 1D5MB 1MLCA 2J8OA 1NAMB 5DZNA 2EH8H 4XMKH 3CH8A 1AP2A 5GRJH 3KS0H 4HH9B 1C5DB 3O11A 1FL5B 3N1FC 4MA3B 2C26A 1P2CA 5GRUL 3WHXA 3ZDXE 1MVUB 3LH2H 5ILTH 1K3ZA 2P43B 4OT1L 3IDNB 3IYLW 4OQ1A 4P2CG 3ILQD 1FJ1A 4ETYA 3QIBD 5HDQH 1MHCA 2MTPA 3CGTA 4PRHB 2DL2A 4HJ0C 3L95B 2NW2A 3QIWC 5C3LD 2P7TA 2E6JA 2PYEE 3FN0H 2NY4D 4M9PA 4RGNB 3VDCA 3IU4L 1X7QA 2A6DB 4MZ3A 4OZFG 2F5BL 1IGTB 3O6FD 4QHKI 4K3HA 2XNAB 3EGSB 2W9EH 3WE6B 1BD2D 4FOMA 4JO2H 1JF6A 1FNHA 4PY8J 5E2TL 2APTA 4MMXC 5GGRA 3MPCA 3BUYB 1IGYB 3CLEL 2P5EB 3F7RA 2WLYA 4LHJB 5I30H 4X9HA 2NMSA 2IF7A 4HCRA 4JRXE 5D96C 4FFVD 1JYXA 3FFDB 4OZHB 2GYSA 4FN0A 5IB5B 2Q76A 1M7IB 1Q9LA 5I76A 1IFHH 1JNNH 1AR1D 3MACL 1RK1B 4JANA 2HJKB 4Z0XA 4JZJB 2LAGB 3VXSB 5B39G 1HOCB 1YY9D 3P11L 1N2RB 2VYRE 1QR1A 2HVKB 3SDCB 2OI9C 3BEWB 4R4ND 5IOPA 4FXGA 2ORBL 1UB5B 1T1XB 4ZO9A 4X8XA 1FLRL 1J1XH 1AGBA 4NP4H 4NOFA 4GQPH 4NO0B 4ODXA 4FG6D 1HI6A 3GDBA 5TH2A 2PCPB 1GJIA 4O4YH 3HI5H 3WO3B 1MI5D 5CP7B 3PGCB 1CLYL 4KMQA 2V17L 1PD6A 3UTTB 4GXUN 5FYKD 2K9UA 5C92A 1F58H 4XBPA 2ITCB 3H2WA 4KJPD 1VKXA 2HMID 5F96L 3IDGB 1T0MA 2F58H 4URTB 3E8UL 3V9FA 3UO1H 4ZPVB 2BHYA 2VZOA 5EA0H 2R1XB 1MCBA 3RWCA 5C07D 2CRIA 5F7EL 5KJRH 1BMGA 1A7NL 5CSZB 4YFEA 5F1NB 2WBJA 1RVFH 4XNUH 3U9PL 2F53B 4K7FA 1G7JB 3QUMA 4XWOC 5FXCH 2RFXB 4Y5YC 1T1WA 3H0TA 3KPNA 1QBBA 3QCUH 3VFOA 3RL1A 2JJSC 5C9JA 2R9HC 1MEXH 4I18A 4ZAKD 5K33A 2GCYA 3NACH 1RUPL 1R5VB 3UJTH 2VZTA 1IM9A 4D2NA 4XCCL 1FO0H 4R26L 1P4LB 4IRJC 3BKYH 1KJMA 4FXLA 2G5BA 1C16A 2CR3A 4KZEL 1T0NA 5IMOB 4KKCC 3GI9H 1UZ8B 3MLVL 4JFOA 5BOZG 3R0MA 3HZVB 4KFZC 4FQ2H 1UKTA 5DLML 5H37H 4OB5L 3WIFA 1FN4B 2JCCF 5HGHB 1I1YB 4FQHB 1SY6A 4KMTL 1CDUA 3PL6D 2JK5A 3W0WD 1INQA 1U9KA 5DFWH 4E42A 3OKOA 3LIZH 3PWPB 2FEEL 4PJDF 4NQDB 5HHMB 4PJEF 3MUJA 1U36A 2J8UF 3FRUB 5LQBL 2YC1A 3ZE0F 3MLTA 1ZANL 2R0LL 4MAYA 5DO2D 4YXHH 4DKDC 1E6JH 1WVZA 5EZJA 4Y16B 4XPFL 2DQIH 4L8SA 1QFHA 2ZP0T 2DQGL 1OWWA 3P9LB 4I18C 4U6TA 3QFJA 2BY0A 4NC0B 3CX2A 5HD8C 1H5BA 1OAKH 3NA4A 1ITCA 4OKVB 3TCLA 3PJSB 3Q3GB 5F7DB 4JO3H 3D2UA 1NC4A 2NY0D 1Q1JL 2EYSA 5F7HA 5HVHC 5C0GB 4PV8A 3V6OC 5F8RC 4R7NB 2UWEE 3VFVB 3WLBA 1EEUA 1U91A 3L7EB 2OLDA 1ACYH 2HFFB 1G7IB 4ZS6D 2V7NB 4TOYL 3MYJA 1X4YA 4HIXL 4JLRB 3UTPE 3OXSA 5INCB 4JRWA 5EUOB 1F6FB 5FKPB 3FFCB 1FAKT 3ULVD 2PETA 4YDVB 2ZOKA 5FO7B 4F33B 3T0EA 5FDWA 1HQRA 1WZ1L 2EDHA 3DROB 2YA2A 2EIBA 4OM1H 3TVMA 2OL3L 4PRPD 3SQOL 3ARDC 1JN6A 2JCCA 4XP6L 4HUUB 5HI3C 3GSXA 5C0CA 4AM0A 5CZXD 1DN0A 4HHAB 4AIXA 1WBZA 3L5IA 1XGQA 1EJOH 2ZUXA 5I17A 1H5BC 3GMQB 2J8UA 5JIPA 1P7KA 4LCIH 1UB6A 3TA3A 1FZJA 5ESAB 4MB5A 3BOVA 4B0MM 3WIHH 3IRZA 1CDBA 5C0EB 4LFHG 3HNVL 5JORA 3PG2A 4AENA 2CD0A 2V9RA 3C8DA 4WW1A 5EIIB 5F88B 3U4BL 5KVEL 1MIMH 2V2TA 3H3BC 4XNXH 4GKSB 4W68A 4Z7VB 1IZKA 3B43A 2ZSVB 2X1XR 3RTQA 2ED9A 1M7XA 1RV6X 3FZUD 5E2JA 3ZKND 3RUGB 4JFDE 1HSBB 3O3EB 4KUZH 4OTXH 2IFGA 1HHJB 5JZ7D 1D9KC 4QLRA 2AV1A 4YDJB 4NQXA 4QHUB 2Q20A 4WU5B 1XAUA 4OLZH 1MUJB 4I48B 4Y5XA 3TVMC 4ELME 5CD5D 5MEOA 1MCIA 3O3AB 3M17B 3WDJA 1KPUA 2CH8A 5CEXA 5HYFA 3EYFB 3P30L 1YYLH 2P42B 1KC5H 1Q72L 1QFUL 2JB6A 1P6AB 1Z9MA 2XZQH 2DMBA 4WI9A 1F97A 1EXUB 3MMEA 4LU5H 2ARJQ 4UOJA 4UQ3A 5KZCD 1CR9H 3SE3A 1A14L 5E8OB 4CNIB 2YA0A 1T3FA 5D1XD 4GW4A 1Z0NA 4IOFC 1JZ7A 5DVLA 3IT8D 1N7MH 2YUWA 3BHBA 4X4XB 3SE9H 1U8QA 1KCRL 4ODWA 4OZIF 5HY9B 5TDOA 1ZLSH 3RTQC 4P2RB 1DLFH 3VFMA 2JE8A 1NMBL 5HI4D 4EDXA 2AK4D 5CJ5A 1BQLL 2ZCHL 1J1PL 4WHYG 1XCQA 1CLCA 4KPHL 5C8JB 4HS3B 1LO3H 2R4SL 3MLXL 2V9TA 3PV6A 3GBNL 2DQFA 1UACH 5H94A 4MJ6B 3OAZK 3PDDA 2ERJC 5SWSD 3CFDB 3UBXA 1IAOA 3O2VH 4DN4H 3CFCL 5TQ2L 1XT5A 1S7TA 4RA0C 2A9ML 4YIQA 4DGIL 3I6KB 4B53A 1BFSA 1FG2B 1EHLH 5GGVY 4AEFA 1ZT1A 2DQHL 3S37L 4G9FE 4ZD3H 1LO0H 3TH3T 5I1CH 4LP4A 3W9EB 4G8EB 1K6QH 1M1SA 1MNUH 4ODUA 3VGAB 4X0KA 1Q9OB 2DLIA 4N9GB 4K3EH 1W0VB 2P8MA 3HG1A 2X6MA 3QUYA 1CFSA 2VDKL 4D0DB 1P4BH 4X7EC 4U0RC 1UJ3C 1JFQL 4O9HL 5FYJU 1UJTA 1VADB 4NC1C 4CU6A 2BVQB 2V5SA 3MRRB 4MNHB 4APQA 3WKNA 4WJ5A 3MLYL 4B7IA 4HZLB 2VISA 4OI9A 1QTYT 4RGMB 3ZZ1A 1EFXB 3D85B 2HG5A 5FV1L 4OZIA 4UIKL 2Z31C 3G5ZA 3U9UB 1MAJA 1KN2L 1KN4H 1NJ9A 1L6XA 1I1CA 1MRFH 1B0RB 1H0DB 3O41B 1WFUA 5ETUA 2ITDB 3ZSSA 4NOBA 5A1AA 5BZWA 3GSRA 4TUJA 4TNWF 5DK0A 1IQWL 4OGAD 1KJ2L 4QOKA 1FLTX 1CFQA 2FD6L 1PYWB 1BFVL 3BIKA 1QFWM 3O4LA 4YHLL 3D9AH 4FQIL 3LKPA 3R8BB 5L2KB 2VL5B 4LSQH 5B39A 1S9YA 3B9DA 1T7VA 2YBRA 3J8F7 4X6BB 3MCG1 5BJTB 1A6TA 5DTFA 2P44B 1OGAB 3VXPB 5IMLA 2P49B 2UV3A 1J86A 4R4FL 1IKFL 3OBAA 1QNZH 4F8QA 3VXRB 4PV9B 4L4VA 4UT7H 4BH7A 4OV5B 4M7LH 1NLBL 4WHTB 4PJ5B 5CLTA 4PR5B 3K8MA 4NJ9H 2H9GA 4S11A 2R2EB 2EYRA 3FT4B 3R1GH 1G7LB 4R97C 5D1QA 4RAVB 5B38B 1NC2D 4QWWC 1FGNL 2PKDA 1CICB 2HJLB 3VFTA 4D9QE 4XMLL 1U8OB 5F89B 1K4DA 3MR9A 4LSUH 3M45A 3FQUA 3EYVB 1GHFL 2XKSA 1N0LA 2R2HB 5E1AA 5CIPH 5KSUA 2DLFH 2XWBA 2GW5A 4TVPD 1MCQA 3QUZC 4TNWK 1HKLL 1NFKA 2YPLD 1W72L 2QQLL 3UZQA 1PG7W 4HIHA 4QXGH 1R3KB 2V7HB 4WY7L 5FUCC 3QCVH 1AHWC 4TUOB 5DRWA 2APWA 3H42L 3IB4A 2NY1B 4EVNB 1OB1A 2ZPKL 5BS0E 2R1YA 4AEIH 2GJZB 4QTHA 3TBSB 3PWLA 4H1LB 4Z8FL 3N9GH 3KXFA 3MRMB 5DVNA 4RFNB 1RZGA 5I15H 1MJJB 4ZS7L 3QEUA 3CFJA 1B88A 4PB0L 2HKFH 4Y19A 3O6MH 4NHCH 2XA8H 5IFAL 1B6UA 2YD3A 3EFFB 5LBSH 4GG6F 1CGSL 3HA0A 1BIIB 1EEYB 5CFHA 4QT5A 5D93B 4YZFE 1EERB 5IG7A 3B83A 3HE6A 4TSAH 4KY1H 1CDJA 4UQ2B 4JREB 5DUPH 2Z9TA 4P3CL 4HULB 5IESH 5JPNA 3V4UH 1O5DT 1XR9A 1TENA 2DYPA 3DIFB 1WBXB 1J8HB 3MZGB 3TN0D 5IQ9B 5IVZB 5J4MA 2AEPH 4HV8B 3V6ZB 3CZFB 1I3RB 3TP4A 3QNZA 1DQJB 1PEZA 1IGCL 1A1OB 3QEQE 4OQTA 1OSZA 2B7DT 5FDYA 4G43A 1RK0B 4LSRL 5CJXA 5HYEA 1YA5A 4WO4C 2XACC 3CVHL 2F54B 4OLWH 5IB3B 3BH9B 3K74B 1J9CT 3SGKA 4OCSL 3WL9A 4MYWB 4Y5VA 4G6FB 4OUUA 5DHVH 4GAGL 1AE6H 4P5TD 4X7DC 1ORSB 4RWYL 2R56H 4LLUB 3QWQB 3WEXA 3D69B 2XN9B 4NPYA 3C6LB 3VFPA 3INUH 5C2BL 3QHZL 1MLCB 4RRPA 2ICEB 4UDUA 2PYEA 3S9DB 4PBXA 1FVDA 1BM3L 3ARXA 4QCIA 3RDTD 1S9VB 4UIMB 4MGXA 3O11B 2FJGA 4PRHD 4P46C 3TJEL 5TQ0L 2YOCA 4BZYA 1P2CB 2VZ1A 1R3HA 2FEDD 3EJYD 4F57L 1QYGL 3STLA 1H3PH 3O6KH 4ONGL 1FJ1B 3JWNC 4RGND 1VPOH 1FDLL 4AMKL 4PJCE 5BV7L 3TH4T 3VJ6A 2NW2B 4JRXA 3ARZA 1GZQB 3O9WA 2P7TB 1U0QA 3PWJB 2HT4C 2GJ6E 5GSVB 1X7QB 4P4KB 3LMJH 3ZKSD 1CLZH 4DVBA 4GS7B 4H0HB 5I1JH 1JNHA 2QBWA 4UV4H 3S96B 2IGFL 3OTTA 1XIWC 4UT9H 1Q9WA 1BEYL 2YUXA 4TTDC 3BDXA 4ZNCD 1UM5L 5EZOL 2XRAH 1QRNE 3H9HB 3H3PH 4I3SL 3AS1A 2QQKH 2OZ4L 3VXSD 1DP0A 4G6AD 4JFQA 5ADPH 1Q9LB 4M8QA 4CMHC 4KUCF 4EI6A 3RVXC 5MEQA 4RISL 3ULVL 1CK0L 1NGXB 2GSIA 4JANB 1H3WM 1RFDL 1B4JL 4U7KA 1DL7H 2BHUA 3S3SA 1UENA 2X5PA 4H0IA 1I9JL 4M6NH 3OX8A 1KCSH 1IRAY 4JM2F 3C60A 2DQJL 5IOPB 1JPGB 4P23C 5DMIL 1FG9C 1GC1H 1A9BA 4U0QB 1KNOA 1Q94B 5FCUL 5GJSH 4MJ5A 1XGRB 4ODXB 5LKNA 1HI6B 4KXZH 4L8DA 4UTBH 1F02I 3K4AA 5TH2B 2VNCA 5E4EB 3DX9B 1FORH 2GK2A 2AW2A 4LVNC 4YXLL 3NTCH 1QBML 4M6MH 4RQQA 1VKXB 4XRCB 1AKJD 2IALA 3ROOA 2UWEF 3K3QA 2LU7A 1RHFA 2FO4A 1A6WH 1SJVA 3HMXL 5GQBA 1B90A 5KVDH 1E4XL 1KYOJ 1RZIA 2EIEA 1UVQA 2J3SA 3MXWL 4OIIL 2IMMA 1J10A 4JDZA 3FMGL 2YD9A 4HLZH 3C87A 3PP4L 5D7LE 3LKQA 2ICES 3K4ZA 4PS4H 2WBJB 4MB3A 1GC1C 1BOGB 2NY6B 4JGMA 2AVGA 4K7FB 3QUMB 2GSGA 1T1WB 3H0TB 1NLDH 5IM7A 3WNMA 3VFOB 3RL1B 5FO8A 4HLJA 4GQ9H 3WUWA 4XPAH 5JOFA 3FT2B 1OAQL 1FIGH 4YHIA 1KCKA 1XGUB 2XTLA 1MIEL 3FN3A 4CVZA 2GCYB 1TLKA 4JDVA 5C2UB 1I8LC 4HJJH 4HKBA 1PX4A 1XGTB 3WHE1 1FGVH 1I9EA 3HI1A 1QR4A 2QL1A 5BVPH 1IM9B 4JM2A 1B3JA 1DEEB 1U95A 5DC9B 2X4NA 4B7LA 1BQHB 1KJMB 4MS8C 2AJVH 1T5XB 3VFGL 3OF6A 2X42A 2G5BB 4XNZC 5IB4A 5F7KC 1LD9B 1UEYA 2BNQD 1T0NB 4JO4L 3KYAA 3PWPD 1LO5B 4JFOB 3JV4B 5IROA 2JKXA 4ZYKB 3WIFB 3ARFA 4NRXA 2C3WA 4RBPK 3MLRL 4WWKB 3A6BL 5BZDB 2AJXL 4LRNL 1P4IH 2O61A 5MP6H 3BMVA 1INQB 3QSKB 4G6JL 1U93A 2Z35A 3ZDZE 4YAQA 3GRWL 4MJIA 5J1AA 3SPVA 5F9JA 2X89D 3VG0L 1V3MA 5F9AC 2UWEA 2YC1B 4PTUB 4G7YL 1T2QH 5DQ9A 3MLTB 2DWDA 1RMFL 1ADQA 4WEBL 5EZJB 1QBAA 5GHWL 3ZT6A 3P4LA 4U05A 2ARJA 1KEML 5KVGL 3TO4D 3WLWC 4KI5D 4KJWC 1BP3B 1A7RH 2R29H 4YC2B 1MJ7L 3SJVE 5HGDA 1UA6L 3VA6A 3SKUD 5ID1A 4KKLD 3D2UB 1NC4B 5F1IB 3N1QC 2EYSB 2W9LA 4JM2C 3GMRB 4LEOA 1KG0A 5I1KH 1QA9B 4PV8B 1IBGH 1XMWA 1MHPL 4TSBL 3F65A 1U91B 1F11A 3FFCD 4GSDH 1NGWA 1KB5A 1LGVA 1N3NA 3QA3B 3MYJB 1X6LA 1GZPA 1U3HA 1IGIH 3ARFC 1CTOA 4D9LH 4HUMB 1HHGB 2OMBA 3GMOA 1ETZB 5I1HH 4FNLL 1A8JH 4BFGA 1BVKA 1KIUA 3QXWA 4G80A 4NZTL 4XCYA 3O45A 1I1AD 7FABL 1TXKA 3MV8E 1TVBA 5EBLB 1IL1A 3H9SB 2AJSH 5FDWB 2YKLH 4XVUC 3B9VA 3SE4A 3QXDA 3KNBB 4JPVL 1CLOH 1NQBA 2JCCB 5DD5L 4N0FA 3GSXB 5C0CB 2FBOJ 5C86A 3MNVA 2O5XL 1WBZB 1SJEA 3IAQA 2X2YA 1LE5A 1XGQB 1YMME 2Z4QA 1YEFL 1FYTD 1FIEA 5CUSH 3F5WA 4Z78A 5FGBC 4C83A 5I17B 3KPTA 2J8UB 1P7KB 3TA3B 1UB6B 4Z7WE 4NUJA 3U2SA 1NCAL 4OUOA 2VLRD 3RWDB 4I0CC 3P4OA 2XG5A 3JWDH 1H15A 2D7PA 4FFYH 3CVIL 2Q3ZA 4ELMA 5JORB 4AENB 3RIFF 1KF9B 3TZVC 4K7PX 2GHWB 3WFDH 2CRZA 2UVFA 4FABL 4LBEA 5EBMA 2GTZA 3DYMA 3MODH 1S7VA 5E7BA 3TPUB 12E8L 3JWOL 4RAUB 4RMSA 4PLJD 1CS6A 3BAEL 1KTDA 1CZ8L 2NW3A 3SO3C 2AV1B 3LQAL 4NQXB 3TJHD 2VLMD 3LY6A 1X6NA 4J6RH 3CDGA 1JRHL 4Y5XB 3LPGA 3O8XA 3NCJH 5MEOB 4OCRL 3U0WL 1DQDH 4KK6D 4NRYB 3JVGA 2FB4H 3AFLA 5CEXB 3FO1A 2I25N 2ZJSL 3TESA 1S5HB 2B1AH 3WYRA 3UTQA 1QFWH 2AKRA 5ICXA 4EI5A 1H8NA 3JWDC 3ZTJG 4TVPL 1NAKL 2Y5EA 2HVJB 1UQSB 3MMEB 1ZSDB 2G9HA 5DRNB 4KK9C 4NBZB 5DJXB 5I75C 1SVCP 3GIVA 1T3FB 1QEWA 4GW4B 4OM0H 4F2MA 2OTUB 3P0YH 3BHBB 3RIFK 1U8QB 3BZEB 1JTPA 4OAWA 4ODWB 3DX6B 2APXA 2NZ9D 2YXMA 1GPOL 3MV01 2MKWA 5LGHH 4PRIE 5GJTH 2DTSA 3WO4C 4EDXB 1IGJA 1UZ6E 3ARGC 5TPWL 3QUXC 4G9FA 3VXME 5EU6E 1U8IA 1MCPL 1F4XH 3ARED 3PV6B 2VXTL 2DQFB 5H94B 3HE7C 4HUXA 4Z77A 4AYFA 4GXVL 4Z7OE 1SMOA 5J7CC 1A6VL 1MWAL 5CSBA 2CKNA 5D7JA 5DK2A 4OLVH 4AEHH 3DWTA 4YIQB 3LSOA 4P2QE 4XCNA 2VN4A 5DEFA 1H8SA 1ZT1B 3QXAA 3TBWA 3GSNA 4K7PY 5CHNB 5HBBA 2GY7B 4MA1C 1KFAL 4FFWC 2ZUTA 4EKXA 3KPQA 1NBYB 1CFVL 1KPVA 3QR2A 4JE4B 4P57A 3BGAA 2P8MB 2EH7L 4U1KB 3QUYB 4O5LL 1CFSB 1BAFL 2MJWA 3BZ4A 1F6LL 3F12B 1NAML 4M5YL 2OS7A 5BOPA 1WC7A 2W38A 4WFGE 4RFEB 4O58L 2VISB 5C0RH 1OQOA 3SDAC 5I8EA 5E6ZA 2HG5B 5E0QA 4LOUC 1LILA 3G5ZB 4N0CD 5EOTA 4WI3A 4U3XA 3NFSH 1X5YA 2AGJL 4YZFF 1YY8A 2E7HA 3IDMB 4ONHA 5ETUB 2PW1A 1WCQA 3FO0H 3KYNA 3T0DA 2NCMA 1EK3A 3P4NA 3RWEA 4QOKB 1CFQB 4U1JA 3CFIC 2Y6SD 3JV5A 3DGGA 1YNTA 3O4LB 2JB5L 1OGAD 1ZGLA 1T89A 4JKLA 4X6DB 5DGQA 5EC1B 5DSCA 5B39B 3CUPA 1Y18A 1RIUH 5D6CA 1S9YB 3WKML 1G9NC 3ZDYF 2FH8A 2HH0H 5HYIA 1JVKA 4WHCA 1ED3B 3MOBL 3TBVB 4HJGB 1IC5H 4KH2A 5TDNB 1WWWX 4X6CE 3LHPL 4EUPG 5IMLB 4ERSH 3UYPA 4HPOH 3PQYE 4YHZL 3JXAA 4Y4HA 3MRHB 4L4VB 4BH7B 2JJVA 1F8TL 4JHZA 3OR7A 4MCZB 4JY6A 2H9GB 2AJUH 2EYRB 2AK1H 4UAOB 2YMXL 5D1QB 4C59B 3GHBH 3KLHC 5BS0A 4HPYH 1NCNA 3W2DL 5GS3A 1U2HA 3VFTB 1LNUA 1K4DB 2DIJA 4K8RD 3T1FA 3FQUB 3PDOB 2VZUA 4WU7B 4KXZI 3DSNA 4G8GE 2MHAA 2XWBB 2XQBH 3QO1B 1N59A 3WFEL 3HPJB 1WIOA 2VDPL 3MXVH 4HIHB 3CFKA 5KS9E 3A6CL 3NZHL 5DRWB 4HBCL 3UJJL 1KELL 1OB1B 2R1YB 1G6RH 4LASL 5MENE 2VUYA 4QTHB 3PWLB 3QDGD 4HIIA 4ZQKA 1IC7L 4U6VH 4PJCF 2C7UB 3BKMH 3CFJB 3CSYA 3MRJA 5F97E 4EBQL 1ZEAL 2IBGA 5C6TH 3N85L 4Y19B 3SGJC 5GZOD 2NXYB 1KUMA 4R0LB 1ZWIA 1KENH 2F8VA 3FT3B 4IRSC 4JPKL 4Q6IA 3D5OF 4Q9QL 5EG6C 2E7BA 4QT5B 4YUEH 5FYJL 5IG7B 1VENA 2L4OA 3BD3A 2AEQH 4K3JH 5JPNB 1IQDB 3NIDE 2WWMD 1XGYH 3PHSA 1XR9B 1JGVL 2DYPB 1QSZA 3D1MC 1GGIL 1N64L 4H8WH 4LCWE 3QJFA 4P2OA 5IWLA 1A3RH 1K3IA 4HJ0D 3TPKA 1YECL 3D87B 4OCXL 4OV6F 1OL0A 1I9RL 2ZUWA 1N6UA 5L6YH 5D5ME 4ZFGL 1AH1A 3SDDA 2BSSA 4YBQC 1MCLA 3QNZB 2ATKA 3TV3L 4R7DA 2BVOA 5GRVL 4QGTA 1FE8L 1OSZB 4JFZH 4L3CB 2BSED 4NKIH 4NQEE 2FIKA 1MFEH 2A83A 3O2WH 1QSEB 2GITB 4FP8L 4Z95H 1I85A 2H26A 3FKUS 4JM4H 5LG1A 2PTVA 1J1OH 3L3KB 4JGJA 3WL9B 4CU7A 4Y5VB 2D03H 4K71B 4OUUB 3EDKA 4XCCH 4TPRL 3WEXB 2A74A 1YNKH 4PGJA 2BVYA 5IBTH 1RUML 3RA7H 3OHXA 1DJSA 3K2UH 4C55A 4PJCA 3IXTB 5EN2B 4KZEH 4RMTA 4AEEA 1MHEA 4Q7DA 2PYEB 4BA8A 4NDMA 2ICWB 5D7IE 5ALCL 1U8KA 4OB5H 4EXKA 4QCIB 1CBVH 3T3ME 1UWGL 2E27L 2FJGB 3QB7C 3IFPA 1R3HB 3AM8C 1KGCD 1RUQH 3STLB 3MBEA 5HI5C 1REIA 2DD8L 1A4KA 5BRZA 2VXQH 3G6DL 1HWGB 1MH5B 1WJ3A 2X9XA 3RGHA 5L8LB 5LQBH 1HINH 2B2XL 1WT5C 1ZANH 4ZXBA 2FBJL 1AJ7H 3VJ6B 1KXVC 1QRNA 2R2BB 2VABA 3BPCB 1AFVL 1C5BL 4ONFH 2VSDA 1ZXQA 3BW9A 1PKQE 3QIUC 3DVGB 1TZIB 4DVBB 2VXUL 2Z93B 1JNHB 2PYFA 2W65A 1R3LA 1DVFC 2D7MA 1CQKA 1N6QL 2H32H 1MFDL 1HILA 2NY2B 1BHGA 1FFQA 1KLGA 3GSOA 4PJ8A 3MRQA 5JOPD 4X7TB 2Y36L 3TYGH 1MFAH 2DLGA 2R69H 2DQEH 2XV6B 5FGRA 1HIMH 4JFQB 4M8QB 5IW1A 2FLRT 4XWOD 1LQSR 1GGBL 4FTVE 4EI6B 1L9MA 1T22A 2GSIB 1MF2L 5DMYA 2DJSA 3TO2A 2MQ3A 2R9HD 4OJFH 1MCRA 4F58H 3G6JE 3ZDZF 2BNRA 3MA9H 3C60B 1FH5L 2OL3H 1RSFA 2QQNL 4XP6H 3X11A 5KVFL 1A9BB 2D9QB 5C6PB 4P4RB 3Q6FA 5IUSA 1TETH 1WBYA 2GJJA 3BP6A 6FABL 4L8DB 3O3BB 1CE1L 4J4PC 4R2GB 3EJZC 4KKCD 1YEKL 5T3XD 2KDGA 1KIQA 4IMLA 5CGYC 4J8RA 5D7LA 3ABZA 1S7WB 3PNWB 3EYSH 3S8WA 1I3VA 5LWYL 4RQQB 3BPNB 4F7TA 2K7PA 4DUXA 4KQ4L 3SKMA 3ISWA 4JEGB 2IALB 4H0GA 1TDQA 2YR3A 1I7ZA 5D2LF 2DQUH 3FAXA 1INEH 2NY6D 4M7ZB 1PLGL 3ZKXB 3U36B 4QNPF 5HVWA 1QFWI 2EZ0C 4GRWE 1MFNA 5CJOL 1JPST 4JDZB 4W70A 1JUFA 4DGYH 1H3GA 2CO6B 3F62A 2HLFC 3OV6A 4MQSB 5DK3A 3HPLA 1AXTL 3CMOH 4HC1L 4XAKE 5HD8D 1FP5A 1AD0B 4S1RL 5AAMA 5IM7B 5F70A 4GXUM 1IM9D 5FO8B 5JOEA 3WUWB 2GAZA 2J4WH 4YHIB 5ANME 5GSRA 5C0FA 3MJ7A 3VFSA 1H9VA 1A7PL 5IHBA 4PGCA 5C1MB 4JDVB 3HUJE 4HKBB 3JUYA 4NT6B 4P9HH 4I2XE 2X4NB 3AMLA 4LQFH 1NGQH 2ADJA 3IRPX 5I6XC 5IB4B 3BD4A 3L5WA 3MRNB 1EA9C 4J2XA 1XCTA 4QXWA 2CO7B 5DURD 2E9BA 1KV3A 1QBLL 2H2SC 3B6SA 1OT1A 4HLZG 4YGVA 1ZLWH 4YPJA 3OKYA 5ECJE 5I9QC 4MAYD 3SJVA 1N6VA 3BYTA 2O61B 3KDMA 4B5EA 1OAZL 1RQ5A 2Z35B 1U8HA 4JVWA 4OSUL 4YAQB 3V0VA 3VWJA 4MJIB 4PJ7B 5J1AB 2W07A 4WTXA 5EU3A 5F9JB 3NABH 1BQLH 3QFJD 3BPOC 1RZFH 2UWEB 5DQ9B 2DWEB 3N1MC 1SYVA 3MLXH 4XC1H 2DWDB 3RZCA 4ZNEE 2WV3A 1INDL 4X80H 1N0XH 3HC0A 4JDTH 4RIRA 4WFHE 3BISA 2ARJB 2X4RB 4JFFD 2C3HA 2DIBA 4PJBB 5ERWA 4KDTA 1F3JA 5F7LB 1G7PB 2G5RA 5AEAA 2A9MH 4FZ8L 4U1SA 1YEGH 5ID1B 4X99A 2ZUVA 3MV8A 5K9QG 3PHOB 1JHTB 2DQHH 1J05A 4HS8H 1D5BA 1OGTA 2AS5M 4X4ME 5T5FL 3IXAA 2CDEA 4GKZA 2UUDK 1F11B 5HVFB 1KB5B 5HHXL 1N3NB 3T0ED 1FAIH 3G9AB 1GZPB 1BGXL 3LEVL 1YMMA 3UC0L 3TVMD 3GMOB 4KDVA 4X5WA 4JFPA 2VDKH 4YDKL 1BVKB 5C0CD 2VQ1A 4G80B 3ARYA 4XCYB 4Z7WA 2IQAA 1TVBB 1IL1B 4M1GL 2KQNA 4EUPA 5F6IB 2GUOB 4KC3B 3FTGA 1UZ6F 4N0FB 5K93A 4LPXA 4GG8A 3MNVB 4XP5H 4NO5A 3LEXA 4FQCH 2NNAA 1V3JA 1LE5B 1ZMYA 3F5WB 4Z78B 4Z7OF 1YPZF 2CLVA 1P69B 3QNYB 1UM4L 2UZXB 3IDIA 2G60H 5F3HB 3U2SB 1JHLL 3BP4A 2NPLX 1KJ2H 3P4OB 4YPGA 3DMMA 3UJIH 1T66D 1AQDA 1H15B 3RTQD 4YHLH 2C3VB 5GGQH 4PGEA 3EHBC 4ELMB 1SEBA 4N0YH 4KTEH 3VD7A 4GJTB 3LN5A 4LBEB 2GTZB 1LMKA 1YEEL 1S7VB 4I0PA 5EO1A 1JMZA 4S1SH 2CRMA 3QQ3B 1IKFH 4JZNA 4O02L 4MD0A 2NW3B 4LL9A 4FZEH 2ADIB 4RGOL 4DVRL 4OF6A 3CDGB 3WFBL 1RJYB 3HZYA 3PWVB 3O8XB 2B1HH 2KKQA 1PJ9A 5IF0A 4JG1H 3U82B 2BDNH 2P5EE 4K8RL 5DFTA 3FO1B 5DUBA 4BUGA 4OZHE 4Y1AB 4TRPL 2XTJE 3UTQB 4KROB 4EI5B 5HDBE 4PRIA 2VXVL 1EGJH 3QIBC 5KSAC 2OJZH 4JFHE 5DQDL 5JDSA 4HKXA 1TPXC 5IB1A 3VXMA 1JZ4A 1Z0MA 4UBDD 5EU6A 4G7VH 2VE6B 2P1YA 2QQLH 3DARA 2DRUA 3MLSH 4WY7H 3NCMA 2X09A 4FQLL 5C0BB 2Q7YB 1BBJA 2DB8A 1K4CB 4LSPL 1F2QA 1QLRA 2DAVA 2IBBA 3DXAE 3LKOA 2NY5L 4JN2A 4GLRH 4LCCB 3VRIB 4GFTB 4AIOA 2F19L 3EFDH 4P2QA 3GKWL 4PUBL 3W11D 2Z31D 4GRLB 3NH7H 1X5AA 3HS0A 4ZTPH 4MA8L 2ZKHL 1IGJB 3G6AB 4LAJH 4X6CF 5AWNL 4M43L 1T1ZB 4ELKA 1TVHA 1U8IB 5FYKH 1T83C 4YJZL 3UTTE 1V3KA 1P9MA 3I3BA 3NA9L 2OYPA 3THMH 2EDNA 4Z77B 1QSFA 4LAQL 1AR1C 4Z0BL 5D7JB 3FO9A 4HF5L 5EU5A 2FL5A 3MZTA 1P1ZB 5L88L 3STBA 2HFGH 1YY9C 4P5KA 1S7XA 5I0DA 1CL7H 4WUKH 5DEFB 5CEZL 3TBWB 3QXAB 1EHXA 5IHZA 2ZCLL 5L8JB 3BKCH 5FYJE 4KKBC 4NN5B 3HG1D 2J8HA 2VOTA 3QUYD 4L29B 4RDQF 4WDIB 4HKZB 4GBXA 3ZL4H 5ALBH 3BP5A 4U31A 3KPQB 1MREL 4HBQA 1JNJA 2RCSH 3MYZA 2VXSL 3KYOA 1KPVB 1ND0A 4FG6C 4Q0XL 1U3JA 4OZGE 4PJXE 1J0KA 1UCBH 2O5ZH 3UYRH 4APQD 4LSRH 4Y2DA 5I1LA 4XP1H 2V6HA 3F58H 3QIWB 2BHZA 3BZ4B 1CD1A 1RIVH 2QQQA 5DFVC 1D6EA 3ZLQC 1X5ZA 5F1KC 2YK1L 4HFWA 4RA3A 3RWHA 2HMIC 3MRCA 1K85A 1S7QA 3CJJA 1FRGH 4JO1L 4LKCB 5I8EB 2MCPL 1F90L 1O7SA 4XPTL 5EOTB 1YDPB 3QUZD 3TIDB 4QOKD 3QWOA 1YY8B 2A6JA 1L7IH 3O4LD 1VGKB 3OL2A 4OCWL 4ONHB 4RNRA 4X6CA 1JPFA 3K2MC 3PQYA 3NIDF 3P4NB 5EZIL 2E8YA 4U1JB 4PPTA 3DGGB 4KRPC 3ZHDA 4NQDE 2CUHA 4PRAA 5D5MF 1ZGLB 1FDLH 4I5BA 4ZAKC 5DSCB 1N4XH 1I9IL 4L4VD 4YBLC 3L3GA 3BRGC 4WFEE 1W8OA 2D3VA 4ZUSB 1KT2A 1SEQL 2X1PA 2D9CA 1HDMB 3WN5A 1UH3A 1NDGA 1LO2L 1VGEH 4HUVB 4HCRL 4G8GA 4M62H 2CSPA 3OR7B 3D3VA 3QZWB 2IGFH 4HKJB 5KS9A 1OAUL 1CGTA 4PY7A 5LGJA 5BS0B 4ODHH 3DVNB 5ACZB 5E6IC 5MENA 3MFFA 3V5DB 5JIHA 4JKPL 3T1FB 5FYLL 4M61B 3QISA 2GT9A 3BH8A 4J3XA 5BQ7A 2V5MA 3ET9F 4P59H 5JIIA 4RISH 2MHAB 2Q8AH 3ULVH 3ULSB 1FNSL 2BP3A 4XBEL 1RFDH 1B4JH 3T3MF 1N59B 3KXFD 1W8NA 3JV0A 4WO4D 4NO3B 3FCTA 5ENWA 5BV7C 3CFKB 4NN6C 4JHBA 3ALWA 3CSGA 3TWCH 3EO9L 4Y19D 1ZHLA 4HIIB 1WIUA 3V0WL 3UYOD 2QR0A 1EBPA 4LCWA 4Y8AA 3CSYB 3MRJB 3HE6D 1J0HA 5GS0L 2ID5A 5T3XL 4ZUUB 4BQBA 3DPBA 4JKMA 1ZWIB 5D5MA 1KJVA 2P8LB 1I4FB 2Z0BA 1YEDA 2OM5A 1PGRB 1QQDB 2DYPD 4ZS6C 4PY8I 3MCLH 3CFEA 3QPQD 2IQ9L 4IRJB 4K23H 5ABDE 3ESVF 2CXKA 5DRZB 5CEYA 3DRTA 1FPTH 4NQEA 3H8NA 3QAZC 4NUGL 4XZUA 3ULVC 3QUML 1J0ZA 4JJ5A 4F80A 4WNQA 1PEWA 1OVZA 1WIPA 1JZ2A 3QDJA 3BPLC 3B8SA 4C54A 3RUGE 4EOWH 2BSSB 2HT4D 4GMSL 4OF8A 4HK3N 1C5CL 4BSVA 2OP4L 4R7DB 5AG8A 4M1DH 3BYYA 3I02B 1T6WA 4CN4A 4Y2OA 1JTOA 3G6JF 2FIKB 4JFYB 5D72H 1D5ZA 2IH1B 1KB9K 5KOVC 4CVUA 4P0DA 2H26B 4ZOCA 1LDSA 4M48L 5D7IA 5D7SL 4XVJL 2D2OA 4BJLA 3RVUD 1KBGL 1GSMA 3ARRA 3DI2B 1DBML 1FO0B 2PYED 3X3GL 1UWXK 5EBWA 4JB9H 4TULH 2I24N 1YC7A 3FHAA 4HWNA 1SBBA 1A7OL 1SY6L 2I5YL 2A74B 2YD4A 4H25A 3X13A 3OHXB 4PJCB 2B4CL 3KAAA 3NAAH 1WQVT 4IS6A 2RB8A 3FZUC 4OD2A 5HYJE 1C1EH 4NDMB 4OLXH 1U8KB 4BH8A 2HRPL 3S35L 3SBWA 3MLRH 2WIIA 5JZ7C 2VDRL 1PKQA 3QRGH 2AJXH 4ALAL 4P23D 1TCRA 5I19H 2EC8A 4RMVA 4G3YL 4P2RE 4JRXD 1VEPA 3O9WD 1U8NB 3BZFA 3MBEB 4TQEL 4GRWF 5BRZB 4Q2ZA 3VG0H 4M5ZH 4KRNA 3NFPA 5TF1H 5D4QA 4UMGA 1JF1A 4JY5L 2M8XA 1JHKL 1MVFA 5LCVH 4WEBH 1PQZA 5BW7C 1U58B 1RUAL 4AL8H 5CAYB 5JW5A 1J0YA 1WSST 5KVGH 3ARDB 2YD5A 3BW9B 1NCWH 2OQJA 4GKOA 3JTSA 4FTVA 4U1MB 3RWIA 4FQ1H 1UA6H 1UFUA 4K9EH 1Z9LA 1RZJH 5JO5A 4XXDB 5D1XC 1GAFL 2PYFB 2W65B 5I8KL 1R3LB 3ZHLA 4LFHD 1V7ML 2HAZA 3HUJF 2O26U 3G6JA 2J5LB 2V2XA 1HILB 2CGRL 4PJ8B 3GSOB 1NCCH 3MRQB 4DQOH 2M26A 3LV3A 1RUKH 1GGYA 5I8OL 2FX9L 4C56A 5HI4C 1GIGL 4KHTL 2HP4A 1L0XA 4DW2L 2OTPA 1T22B 1S3KH 3MUGA 1E28A 3TO2B 2R0WL 3P2TA 4BM7A 1NL0L 2DL9A 1OM3L 2PR4L 4JZOA 2BNRB 2I9TA 3RY6A 2JIXD 2VN7A 1NBVL 4R2GD 3RKDD 3L1OL 4JPVH 1NMAL 5DD5H 3X11B 4R4BA 3C2AL 4F7PA 5DXWA 1UYWL 3SCMC 5LAXA 4K9EC 4JKWA 4DEPC 4M6OL 5K9OB 4ODBD 1YEFH 4J23A 2BRRH 1HHHA 5FUOL 5EORH 4QRPB 4AH2A 2VLLA 1N5YH 1KIQB 4ZG1A 1OP9A 4J8RB 5D7LB 2JJTC 2WANA 4LSVL 5TE7H 3R06A 4F7EA 1AGDA 2CIIA 5EC2A 2BVPA 4YWGH 4NWTH 3SKMB 3CVIH 5FF6B 2H3NA 5L2KE 4XH2A 1WK0A 5ANMA 1DBBL 3HI6H 2QHLA 1DBAL 1MRCL 3X3FL 1KEGL 1ZVSA 5H2BA 1YJDL 4EZMA 1RULL 3OKDA 3U0PA 3NGBC 4KUCD 2QHRL 4FQPA 4A6YH 12E8H 4I2XA 3T0AA 5IT2L 5F6HJ 2P24B 3WLWD 5JUEL 1CU4H 1KOAA 2ZCKL 3HPLB 3VXRE 4ZUTA 2R8SL 1CZ8H 1NUDA 4PJ5E 1T21A 3LQAH 2L7JA 4JG0L 1BLNA 1MCWW 1S5IH 3RVWD 4JM2D 1T7ZA 4RMWA 3U0WH 2A0LC 2HFEA 5C0FB 5I16A 1I8IA 3VFSB 4OGAC 1GH7A 3OF6D 1FZMB 3EAKA 4GLRI 2D7TH 2ZJSH 4PGCB 3RJQB 4CJ0A 1KIPA 1QLFB 2ENSA 1IAKA 2FX8H 1NAKH 2GK0A 3TCXA 5I0ZA 3ARFD 1EEZA 2C1PA 2ADJB 4FQXA 3BXNA 2BNUA 3EYOA 3L5WB 4TUKL 3GHEL 5CWSA 2YSSA 4ZNEA 1XCTB 5TFSL 1MQKL 4XVUD 1YUHB 3T4AB 5JR1H 5GGSA 2IFFH 5A40E 2AJYH 1T04A 3JWOC 1Q9KB 4WI4A 3E6HA 3SJVB 1ZT4A 1I3GH 4NQCB 5GGSY 3S98A 1FNGB 2IAMA 3KDMB 3VWJB 4MQ7A 3LQAC 1MCSA 1CL7I 3ME0A 2OK0L 1IGML 4XCFL 3VWKC 5EU3B 2FX7L 2K1MA 3UTPD 1XR8A 4U0RB 5GGVL 4X4MA 3GGWA 1A6AA 1GGCH 1MCPH 1SYVB 3QQ9C 3T4YA 2VXTH 3RZCB 3MRDA 2DQTL 5ERWB 1A6VH 1FCCA 1CT8B 1F3JB 3HKFA 5E2UL 4YR6A 1QLEL 1QD0A 4U1SB 3S88L 5FM8A 4X99B 1MI5E 3RU8H 3MV8B 4OZHF 2XZCL 1U3HD 4G6MH 2P5WB 1J8HE 4XPGL 5T1LA 3MJ6A 5HDBF 4AT6A 1J05B 5FYKE 2Y5TB 1CD9B 4FQXC 2CDEB 3L3HA 2PTUA 1Q0YL 5EOCL 4IOIB 1D5MA 3KYKH 1VA9A 4TN9A 1LO4L 2VDQH 4ETQB 2YXFA 1YMMB 2E7LA 4WGVB 5CEZE 2EH7H 4EDWL 2V5TA 4LGRB 5JQ6H 4O5LH 3LEYL 4X5WB 1K2DB 4I1NB 2F54E 3NIFE 5CGMA 4M5YH 4Q58C 4L5FH 1FL5A 4Z7WB 1MVUA 4HIJB 3GNMH 2YWZA 3IDNA 5L0QB 4OI8A 4V2BA 5CBEA 4K3DH 1AI1L 3FTGB 4F7CB 3T2QA 3FQTA 1JGEA 4JFDD 2XN9E 4IJ3C 1J11A 2CR6A 4GG8B 3PXJA 3UDWC 3LEXB 2NNAB 4XHJC 3GO1L 5E24E 4J3UA 4BK4A 3LS5L 1LK3L 1JPSL 2A6DA 3DUHA 3IDIB 3RGVA 2YD2A 3MGTA 4O2EB 5LGKA 2XNAA 3H9YA 3WE6A 3DMMB 1NCDH 1AQDB 1AR2A 5MEPA 3GSVA 2YD1A 3FB5A 4PGEB 3ARGD 3BUYA 4YHML 4BSWA 3LN5B 1AHWB 2P5EA 5L9DL 2VR4A 5IK3A 5EIVA 2E7LC 4PD4J 5DS8A 3FFDA 4OZHA 1EHAA 4OFYA 3VXTA 4OZGF 5IB5A 4IMKA 1M7IA 5EO1B 1LE9A 4EIGB 2R23B 4F37F 2HTLD 5EU7E 1RK1A 3IFLL 4MD0B 4HAFA 2VZ3A 4UI2A 3KJ6H 4JZJA 1IC4L 3NN8A 4KROD 3HZYB 1N2RA 4F15B 4JPWH 1TQCB 3RDTC 5F9OL 3W2DH 2EDYA 4JN1L 5IF0B 3BEWA 2MPAH 3DXAA 3E0GA 3RBSA 5CINH 2FEDC 3EJYC 1HH9B 3A67L 3HC3L 3HNSH 4LVHB 2H1PL 5CIPB 4PRIB 4RGNC 1E6OL 4NO0A 5JDSB 4HKXB 5IB1B 2DMCA 3E3QE 3W82A 5DC4B 3TT1H 1JYWA 4HXBH 4YHNA 1G6RA 5ESVA 4HBCH 2Y07H 1NGYA 5FYLE 2YZ1A 1QLRB 5EWIH 4G9FD 3LKOB 1WFOA 3AC0A 4JN2B 3EJJX 4BYHA 5LVEA 5IFJB 4LCUA 2YZ8A 3GIZL 2EKJA 4P2QB 5J1TC 3HS0B 1ZEAH 3FN9A 3ZMRA 1FL6A 5D2NC 3SQBA 2HKHL 1L6ZA 4F37K 2J88H 5DWUH 5D7JD 4ELKB 4NM8L 3QFDA 5CP3A 5GS1A 1ZHKA 5CD3A 3GJFH 4HWEH 2APBA 2GFBA 3SDCC 1A6UH 2RFXA 4HT1H 4LLVA 1QSFB 5GRVK 4OZGA 4PJXA 3OAUL 4X6EA 4PGBB 5T1KA 2W60B 5K59E 3SKJH 5E5MA 4Z5RA 3FO9B 1JGLH 2FL5B 1JGVH 4NZDA 5CSGA 3D0VA 3DNKA 1A3LH 3LB6D 4P5KB 1S7XB 4GUPA 2OMNA 4OCXH 5F44A 1EHNA 5IHZB 4P46B 4HK3J 3CU7A 1N8ZA 1NFIB 5EUOF 4RMRA 4Y4FB 4GBXB 3BP5B 5AYUH 2A73A 4HUWA 1EO7A 1ND0B 3CZJA 5IMOA 4D3CL 4Y2DB 1UZ8A 2DBJA 4NWUL 1FC2D 1WGOA 2DI8A 3HZVA 4AG4H 3DX8A 3GSQA 4DN3L 1FN4A 1DFBL 1I1YA 4FQHA 1D6EB 2VLJE 4HFWB 3RWHB 3OGCA 1OF2B 3LQZA 3T2PA 1OP3K 3H7BB 4NQDA 2CJUH 1XIWB 2IPTH 1T03L 5JMOC 3OB0K 2BY1A 2DM4A 3HNTL 3WNOA 2A6JB 1IVLA 4OCYL 1A0QL 1EFQA 3TIEA 2ZG2A 3TC9A 1TJGL 4RNRB 5ALCH 1CDYA 2E27H 3PQYB 4D9QD 5F9DC 5ID0B 1TIUA 3EO1A 5F7DA 4Z7VF 3QH3B 1VACB 4PRAB 5C0GA 4PJHE 5CILL 3MTRA 4I5BB 4R7NA 1FSKB 3RUGF 1G9MH 4HWBL 4Y4HD 2FBJH 3L7EA 4WUUB 1BOYA 4LSTL 2OR9H 1KT2B 2CMRL 4V1DA 4BZ2L 1AFVH 5CJQL 4AQ1B 3WN5B 2WUBL 3FOMA 3AY4A 4G8GB 1MHHB 4N8CL 2Z92A 2YRPA 4LIQH 4MVBC 2VDMH 5J11B 3D3VB 1U41A 4YDVA 4X5LA 5KS9B 1N6QH 1CF8H 2L7UA 4RAHA 3LD8C 4L9LA 1MFDH 5LGJB 3MQIA 5TE6L 4LQ1A 1FFPB 1NUFA 3DROA 5JPMA 4DAGL 1IEHA 1SBSL 2X9WA 1MCNA 3MFFB 5C0AB 3KVQA 4HUUA 4LPWA 4Y16C 1YQVL 4YBQD 3IFOB 2EDWA 3N50A 3ORJA 5KSBB 2YHGA 1WEJH 3UCRA 2XZAL 1DQQB 1I3UA 4Q9BA 2GT9B 4QTIH 1GGBH 4OCMC 1S78C 3GMQA 5D8JL 1MF2H 3FCTB 2P47B 2LQRA 3H9SE 1U8PB 1S9KC 5J3HC 2CK2A 4Z7UB 5IIEB 3SE8L 4ODSL 4GOSA 2IWGA 5C0EA 4OGZA 5KVFH 1CFTA 1MFBL 4XCEB 5EIIA 2DLTA 3GM0A 3WSQL 3TNNA 3HC4H 1BZ9B 2XT1B 4LCWB 3BP7B 4GKSA 3KPSB 3QEQD 3ZT5A 2ESVB 2VAAA 3DSFL 3W9DB 2HN7A 5SWQB 5IQ7L 4PLKD 1YEDB 4KWUA 5T3ZL 1FZKA 5TF0A 3RUGA 1HSBA 3O3EA 3M1BA 4P2OD 3CFEB 3GMMA 4OF3A 4YDJA 4QHUA 5CEYB 4YDIH 3DRTB 1MUJA 3QG7H 3SDDD 5HI5D 4XZUB 1S9WA 1QSVA 3WS6A 1I1AC 4M00A 4KVCH 3M17A 4WNQB 4NFDA 2Y1VA 1I7TA 3QDJB 2L0DA 5F9WB 5EOQH 2FH6A 2A6KA 3IDYC 4HGWB 3VGGA 3RPIB 3LKSB 5KTEL 1PKOA 2B5IC 3D48R 1JGUL 2PN5A 3ARUA 3G5VA 5E8OA 1U8MA 1WFNA 4CNIA 2ZUSA 1MJUL 4XWGL 2VDNH 2LVEA 4S0SD 3JSSA 1D5ZB 5KAQG 5HYJA 3QO0A 5A43C 4AJ0A 5D7IB 1T7XA 4JFEE 4X4XA 5IV2B 3H3KA 3OAYH 3VGBA 4LNRA 5BO1L 1OLLA 3TNMA 4L3EB 1MJ8L 1OP5K 5BMFH 4NYLB 4H5SA 2Y06L 3L3IA 5EBWB 4YDLB 1WTLA 1AXSA 2GJ6D 4H25B 2VWEE 5E8NB 5I1GL 1X5IA 5HDLA 3U7WL 3K81A 4ODTH 5KVMC 4MJ6A 3DHMA 4IS6B 3DYOA 4OD2B 4NJAL 1YZZA 3CD4A 1BF8A 4DZ8B 3CFDA 3WFHA 2WIIB 1ADQL 1Q38A 4ZXBD 2NXZB 1F3DJ 4YK4B 1TCRB 1QRND 1XZ0A 1BQHG 4QRRB 4OSUH 3C9NA 3HZKB 3BZFB 4K94L 1B6DA 4Q2ZB 3WBDA 3NFPB 3EYUL 1JF1B 4KK6C 3C5ZA 3GEWB 3W9EA 3O6LH 1KCVH 4MD4B 4UUJA 3T3PF 1CD8A 1U6AH 3QQ4B 1Q9OA 1OHQA 3OKKA 2I60L 2OQJB 2MQCA 3DBXA 3S36H 4PJ8D 1KB5L 3PABB 4OZ4B 3ULUH 3RWIB 3RKPA 3VXOB 3ZYOA 5TE4L 4XNYL 1OY3B 4D0DA 1NGPL 3IKKA 3WJLA 1VADA 5I1EL 3BIBX 1C08A 2YD8A 2V2XB 1R6VA 4UILH 4HZLA 3DRQA 3OKNA 2NZ9C 1EFXA 1JI2A 3D85A 5HHXH 5I1IL 2JJUA 1MSPA 5K9JH 4O2CB 4C56B 1OCWL 4BFEA 15C8L 2AXFA 3UC0H 4L4TD 3OZ9L 1H0DA 4KTYA 3MREB 3B9KA 3MUGB 1E28B 1OAYL 1UKQA 1BF2A 1HE7A 4MHHI 2FIRT 2H2PD 4TSCL 5C09D 4M1GH 4F7MB 1PYWA 2I9TB 1LP9A 1TQBB 3U48A 4HD9A 4R4BB 4LPVA 5D7LD 1VFUA 4JAMA 3K46A 5DUML 4F7PB 3B2VH 3VGAC 2V5RA 5A16B 2EXWC 3QDAA 2NY3D 1DQLL 4LVOB 4MCYB 1HHHB 2Z8WC 5DI8A 4AH2B 1UM4H 3KPRE 4XAWH 4OV5A 5E08H 4NNYB 1AGDB 4PR5A 2CIIB 35C8L 5EC2B 2BVPB 2ZUQC 5IHUH 3FT4A 4RAVA 4XI5C 5L2JA 2P8PA 3FRPG 4X6DE 4XH2B 5ANMB 1U92B 2GEEA 1A2YB 1XEDA 1KCLA 1PSKH 5F89A 4WIQA 5H2BB 2VH5L 1ZGLP 3OKDB 4KK8D 1IAIM 3QI9A 3V52L 2UYLA 3O6FA 5AAWA 1A47A 1TITA 2R2HA 3QQNA 2PNDA 4JHAL 4Y89A 1A6PA 4FQJH 3HLAA 25C8H 4ZUTB 1ZHNA 3WO4B 4W6YB 1H3UA 2D0HA 4KKAD 4QXTA 1IKNA 1DBJL 3QUXB 2V7HA 4LRIC 2C9AA 3F7VA 2W0FA 4LLMB 2XZZA 2NX5E 2HFEB 3HE7B 4K8RH 1WITA 3SOBL 5I16B 1I1FA 3TBSA 3VI4E 1YMHB 3MRMA 5EUKA 1DUYA 5TGBA 2UY6A 1MJJA 3BIAX 5AG9A 1M7DA 3UAJC 1IAKB 3MROA 2GK0B 2EICA 5DJAA 4MAUH 1EEZB 3VW3L 2C1PB 2DN7A 2C4XA 1CE6A 3SJVD 2EDKA 2BNUB 3EYOB 1BIIA 4MA1B 2CIKA 2YSSB 3CLFL 4OLYH 2D0FA 1F4AA 4WCYL 1MLBA 3S34H 1Q0XH 5FHAL 1CICC 2IG2L 1UC6A 5GGSB 4UQ2A 4XX1E 4GW1A 5SX5H 3E6HB 5L7XL 1BFTA 2IAMB 3GKWH 3WDHA 2DQDL 3ZTNL 1MI5A 2XXCB 1WBXA 2K3TA 4FS0A 2BJML 1J8HA 4QY8A 1XR8B 5E1HB 5IVZA 4ZTOH 3G5XA 2LU4A 2QSCL 5E9DE 4CADA 1A6AB 4K7PL 1I3RA 4K8RC 2PW2A 1DQJA 2WUCH 3MRDB 4HK0A 1AC6A 1A1OA 4F3FA 3MNWA 1CFBA 3SDAB 1ODAA 4U49A 5DD6A 4GH7B 3IJSB 4EN3B 4HF5H 1PG7H 4RFNC 5DT1H 1LDPH 5L88H 3BH9A 5EFIB 4UT6L 3OPZL 4M1CD 4E41B 1QZ1A 4JVUA 2DTML 1Y6MR 1HKFA 5T1LB 4WI2A 4YE4L 3KR3L 1YMMD 4NNXB 1L7TH 4AT6B 4JQVC 5A2KH 3L3HB 1ORSA 4G8IB 4MNQE 4J3VA 3RWJA 5A2IH 4LLUA 2NY5C 5DD0L 1OAXL 2XN9A 1MREH 4H20H 5ICYB 5GRWA 3C6LA 2X4QA 2ICEA 4LSSL 3NCCB 4N90E 5GZOC 1HZHL 4LLDA 4ODVH 1QSEE 4JREC 2WQ8A 4WHDA 5EBGA 1CDHA 4LARH 5CGTA 4LHUG 1WWAX 2EH8L 4XMKL 1S9VA 4UIMA 2RQ8A 3BO8B 3QUKA 1BZQK 3SKOA 3SN6N 4YHPA 5GRJL 2WIMA 1G7QA 4KDWA 4M4RA 1R3JB 2IMNA 3O3UN 1F5WA 2A6IA 5CBEB 3FQTB 3LH2L 4E5XB 1MPAH 5ILTL 2WWMC 1JGEB 5KSAD 1F90H 3BUTA 4LHQB 1WWBX 2R1WB 5HDQL 4L4JA 5C6WH 2JELH 1GZQA 2CLRB 3BQUA 3QHFH 3RAJH 4RSVA 3PWJA 3EOAA 3PL6A 4UINH 5FOBA 1UXSA 3C6SA 5GSVA 5K59F 4JRYE 5F7NC 5IW6B 3FN0L 3RGVB 4P4KA 2DQCH 2RHEA 4YFLI 1OSPL 5EZIH 4F9LC 3MGTB 2DIAA 2QSVA 3GSVB 5MEPB 3S96A 3U4AA 5DMKA 3MRPA 4I0PD 4HH8A 3FB5B 4WV1A 2W9EL 4JO2L 4MDJA 1I9IH 4BSWB 4IIQA 2HWZH 5IK3B 3H9HA 4PRNA 5DS8B 4PRBA 4G5ZH 1PY4A 2XTJB 3VXTB 3VMNA 5I30L 4OBSA 1LWRA 2DKMA 1LE9B 1MCJA 3BGMB 1LO2H 3OMZA 4HCRH 4BFIB 1NGXA 5T5NG 1IFHL 4YHKH 1JNNL 1A9EB 3VGDA 1QHOA 5JXAH 3NN8B 3T0BA 4HG4K 1OAUH 2VDLH 4PRID 1TNMA 5E5RB 1VFAA 2WWKT 4KKBD 3LVEA 3DXAB 3VXMD 1JPGA 5I18H 5EU6D 3QDMD 1WUNT 4MHHG 3S5LB 1Q94A 3SDXA 3NFNB 2A77L 1RPQA 1XGRA 4K2UH 2PTTA 4LIQE 2W92A 4P4KC 1CIUA 4NP4L 2NLJA 2CDGB 3S35X 3DX9A 4GS7C 3HAEH 4P2QD 4O4YL 4YHNB 1E4WL 1G6RB 4PRPA 5DFVD 5ESVB 1NGYB 4GAYB 5C9KA 5HHNA 2Y23A 4XRCA 2OBGA 1F58L 1T20B 4LCUB 2VDOH 3RVTD 4MX7A 4HXAL 2OR8A 3UO1L 2AERT 1RI8A 1FL6B 3TYFA 5EA0L 3R8QA 1P53A 4LGSB 1F4HA 4UTAH 3E3QC 3BGFB 3QFDB 5GS1B 1UWEH 5KJRL 1ZHKB 4DTGH 5CD3B 4ORGB 2E6QA 4XX1G 1BOGA 4LEXH 2FHCA 2IQ9H 5J8OA 2GFBB 4PRDA 4LLVB 1RVFL 4R9HA 4WFGD 4OZGB 4PJXB 4XNUL 2ADGB 3D18A 3HR5A 4X6EB 2R39A 5T1KB 4U1NA 4NUGH 5E5MB 3MV11 4KHXH 4KRPD 3FT2A 4Z5RB 3BJ91 3C8HA 4GBXD 1QHPA 3B8YA 1P5VA 1XGUA 3D0VB 4XVSH 5T3ZE 4GUPB 5HHOE 2VLJA 5HTSA 2D7NA 1MEXL 1XGTA 1DE4B 4Y2DD 1VDGA 1N8ZB 5E4EC 1RU9L 1DEEA 4PJ9B 3NACL 3BT2H 5FGCB 1BQHA 3KPMB 3UJTL 2YN3A 1T5XA 2A73B 4HUWB 4LLYA 1LD9A 1P7QA 3D25B 4Y0GA 5M94B 5DGRA 5GS0C 1LO5A 3IFNL 3JV4A 3DX8B 5D7SH 3GSQB 4ZYKA 4QXUH 5HGBB 3GI9L 1KBGH 4WWKA 5E6ID 1EPFA 4HWZB 5BZDA 5JXEA 1NANH 3OGCB 1BQSA 3LQZB 3QIUB 2E3VA 5DYOB 2WBJC 4PJHA 2I5YH 3KLDA 3V6FB 3NOIA 1DVFB 2NY6C 4PTUA 3K8LA 2APVA 1CD0A 5FK9A 3TIEB 1I1RA 1C12A 4YXHL 2Q6WA 1E6JL 1XF3A 4EEEA 2DQIL 2UZYB 4F9PA 2BCKA 1CDIA 4ALAH 3BKJH 5IMMA 2G2RA 5AZEH 4MSWB 1Z9SA 3EO1B 5F1IA 4MJIE 4PJ7E 1A1MA 3GMRA 1OAKL 3MV9E 1FQ9C 1X44A 4RRPG 5IVXB 3HRZB 1QA9A 1D6VH 4U1GC 2HYMA 1E4JA 5FECA 4R90H 4YX2L 1GGUA 1RUAH 4V1DB 1U3ZA 2P48B 3QA3A 5IKCA 1QVOB 4PJBE 3FOMB 4PREB 3CIQA 1HHGA 5MEND 1ETZA 2QV2A 2Z92B 5JXEC 2AABH 3UMTA 1BJ1J 4RCAA 1GAFH 5I8KH 2H32B 3U7YH 3DI3B 5EBLA 4H88H 3H9SA 3DLQR 1UGNA 3DVIA 4L9LB 5JPMB 2CXGA 3KNBA 4MAYC 3ARWA 5IEKB 2Z8RA 4OM1L 4L8SC 1EO8H 1L9NA 3FQXA 3HN3A 4ONOA 3FRPA 3ULUE 4KHTH 3BSZH 4C57C 4F9PC 2IPKA 1JI1A 3D0LB 2J1KA 2J6EH 4RX4A 3V7AE 3MV7B 5FB8B 4YC2C 1EJOL 1NL0H 5ITFA 4R96A 3RWDA 5JLZA 4LCWD 5F3BB 2NZIA 1SYSA 4LCIL 1HYRC 5GRYA 2OL3B 4NFBA 1NBVH 3BZDA 1GOFA 3PWUB 4NQVB 2X4TA 4OLUH 5FUZH 1GOGA 1CFTB 4IRZH 4KV5E 3WIHL 3TNNB 1U8LA 2X1WL 3U79A 4CVXB 4JR9L 4HDIA 1ZS8B 2BVEA 2VAAB 2HN7B 4YBHA 4NQED 4XNXL 3AGVA 3CXDH 3IJYA 2DF3A 3TPUA 4B50A 4HIEA 1FZKB 4PGZA 4RAUA 3GSUA 3M1BB 4HMCA 3VXUB 4W81A 3T0EC 5A2LH 4X7SH 5FOJA 4YHOH 3RNQA 3GMMB 4KUZL 2QKIA 4OTXL 4RMQA 3VXNB 2IH3A 3MNZB 4OGXH 5HHVH 1S9WB 1AO7B 1RZ8B 4JFEA 4OLZL 1BBDL 4X5XB 4WEUD 4NRYA 4ZOBA 2D0GA 2X4PA 1RULH 1I7TB 1NSNH 4G6KH 1S5HA 5MHSE 4A6YA 1R0AH 5AZ2H 4D9RE 2QHRH 1ZK9A 2A6KB 3VG9B 1YYLL 3TA3C 1KC5L 3VFNB 4YH6A 2HVJA 1UQSA 1ZSDA 1NC2A 3G5VB 5C3TA 5DRNA 1U8MB 2XZQL 1UADC 3MRFB 5DJXA 4ZFZB 3G08A 4LU5L 4X8JB 3QPXH 1CR9L 5HYJB 3QO0B 2FGWH 2OTUA 3HHRB 5FM5M 5B21A 3BZEA 4LNRB 3TNMB 3DX6A 3IF1A 1N7ML 4Y1AE 3U4EB 1T66C 1DQMH 2QADB 3SE9L 5B8CA 3AS2A 4I0KA 5IVOA 4AY0A 1ZLSL 4H5SB 3L3IB 1AXSB 3NPSB 1MCKA 2DJUA 3HMWH 4KVNL 1ZA3B 2NXZD 3WUWG 1MCDA 3P40A 1BX2A 2BK8A 1IAIH 5C0BE 4Y5XC 3OKMA 1YJDC 5GIRB 1LO3L 1ZA6A 3P77B 5TFSH 1UACL 2E7CA 4IDJH 1WAAE 5T5NF 3WFHB 4X6DF 5HPOA 3PGFH 1JWUA 1URLA 1XZ0B 3C5JA 3O2VL 4DN4L 3C9NB 3SCMD 2IANB 5B3JE 1K5NA 4XCFH 4LHUA 1CFNA 1EMTH 5CHNA 2DM7A 4FTVD 1EHLL 5GZND 2VWEC 1MFCH 2AAVA 3C5ZB 3PV7A 4R6UA 3RI5F 3V8OA 3SE3C 3CDFA 4U4BA 4UUJB 3QDGE 1NBYA 4ZD3L 2HT3C 4HSQA 5I1CL 4NN7B 3MGAA 1K6QL 2B0SH 1AXIB 3OKKB 1MNUL 3DBXB 3NCFB 5E2UH 3WFCL 5J12B 3A6OA 4OD1H 1EAJA 4U1KA 4UBDC 3S3JA 4K3EL 3S88H 3IS1X 3TN0A 2CKBH 3F12A 3VI4F 1YNLL 1FNEA 3MLWH 2H6PA 4CN6A 2HTKD 3NBNA 1C08B 4IOSD 4RFEA 1WZKA 1WICA 3DRQB 5EO0B 2F5AH 5EOCH 3OKNB 1HXYA 4XVTH 4JQIH 3W11C 4NHUA 4P49A 2HJFA 3G5YB 4OZFH 1HCFX 2AXFB 5D1ZA 3IDMA 1KN4L 3LEYH 1UM6H 3B9KB 2FJFB 1ZLUH 3KPRA 3GI8H 1MRFL 3GFUA 4P5TA 2A0LD 1VFOA 3KPPB 1A7BA 4NGHH 5HPMB 1NGZA 2V9QA 1LP9B 1TFHA 1F42A 3OG6B 1FBIL 3EUUA 4X6DA 5LXGH 4YEFA 4JAMB 5EC1A 3D9AL 3V7AG 4XXCA 4XAKD 4MXWH 3DV4A 4LSQL 1X4ZA 2WBKA 1ED3A 3TBVA 4HJGA 1CI5A 3GO1H 3QUYC 4I13B 5DI8B 1A7QH 5TDNA 3CXHK 1WCBB 2BOCB 4OD3H 1JZ3A 4XP4H 4GMTH 4EQ3A 3MRHA 3QIBB 1CCZA 4MCZA 4APQC 1QNZL 4UT7L 1F6AA 4M7LL 5L2JB 2P8PB 4NJ9L 3L5XH 3VWKD 4YHMH 2NX5A 4I8DA 1DSFH 3R1GL 2NY4B 5L9DH 1JNLH 4I77L 3QQ9D 2XG4A 3VD9A 2DM3A 3GK8H 3PDOA 3QI9B 4ISVB 2UYLB 3O6FB 3CX5K 1Z5LA 4LSUL 4WU7A 1DANT 2NTSP 1BD2B 3PP3K 3O81A 5FA4A 1YN6A 4LGPB 3HLAB 3OQ3B 3IFLH 1ZHNB 3QO1A 5IR1B 1EAPA 3HPJA 4QXTB 2ADFH 2DLFL 3ZDXF 3F7VB 2O5YH 2W0FB 3NZ8B 4YXKH 1FV1B 2FLBT 5F9OH 1MAMH 4MQXD 1DANU 1KB9J 1I1FB 4FQXD 3G04B 3CK0L 1BREA 3K8KA 5DJ8A 5E00B 5EUKB 1DUYB 5I71B 5TGBB 2C7UA 1OTTC 1M7DB 5AD0B 4WFHD 3MROB 4CGTA 1GYAA 1X9QA 5DJAB 1CGVA 5I15L 2X7LB 4CMMA 4R0LA 3FT3A 3WS3B 1CE6B 5E9DA 1OTUC 3O6ML 4NHCL 2IAMD 2XA8L 2CIKB 4UAOC 5D1QC 5LBSL 2KUTA 1S7SA 4N5ED 4PJIB 1MLBB 3LDBB 3OG4B 2N7BA 5IBLD 4TSAL 3REWA 4GW1B 2V2WA 1IQDA 5E2WH 3GIZH 4KY1L 3NCYS 5A3ID 2EXYD 1MI5B 1D5XA 5ISZE 4QF1A 4DKEH 5KANI 3V4UL 4QY8B 4XHJD