2DJXA

Crystal structure of native trypanosoma cruzi dihydroorotate dehydrogenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCCTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate Dehydrogenase
publication title Crystal structure of native Trypanosoma cruzi dihydroorotate dehydrogenase
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2djxA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2djxA01
2WNZA 1SO6A 4RXGA 4MVAA 3MW7A 3W75A 4JTJA 5AHLA 4FX6M 4NX5A 5F4WA 3W1LA 3IIPA 5IBXA 1EEPA 1XKYA 5DBUA 4MY9A 2QCDA 3QJAA 3GNNA 2Z6JA 1H7OA 3STEA 4UFLA 2RDTA 4O1DA 1TYGA 5TIMA 3TSDA 2DZVA 4NZJA 3V75A 5BOOA 3W7QA 3TH6A 3CB8A 4JD4A 5KZMA 1ZJIA 2NX1A 2W0UA 3W1PA 1LLWA 2R94A 3LX9A 4NNAA 1EP3A 2QDHA 3U2OA 2R14A 3LCGA 3C0JA 3MHFA 5AHEA 2GPTA 1OYBA 3M0ZA 2C6QA 3BGJA 1K7XA 2WNNA 1JCXA 2V2DA 3HG5A 1F2JA 3DHFA 3QPZA 2V2HA 3W7EA 1YDVA 3LTPA 4N6FA 1SQ7A 4WQ6A 3VKJA 2H3DA 3LHVA 4IMDA 2YYTA 4MLJA 1XUUA 4UIOA 4O4VA 5C6MA 1H1YA 4A22A 1DJNA 3FKKA 4MFEA 1KTNA 2J88A 5AN7A 2X30A 4LTSA 3SI9A 1P1XA 3TNOA 1QOPA 1QPQA 2Y85A 3PG8A 2ZZ7A 3RU6A 2CLOA 3B04A 2NXHA 1SFLA 1QO5A 3DFSA 4DF2A 3P67A 4CQ9A 5G4EA 1VGAA 3L5LA 3LRLA 4YLWA 3TXVA 1LOQA 1GG0A 3OBKA 2RKXA 3DFPA 2Z2UA 5HUOA 3BV4A 4JX6A 3UNDA 2E6AA 4BFAA 1F05A 4PH6A 4IPJA 1UJPA 5AHMA 4KWVA 3S5OA 3NM3A 2P1FA 3M47A 5AHIA 4DELA 1B3OA 1D9EA 1FWRA 1EPXA 4HIBA 2Z6IA 4QISA 3B8DA 4GUIA 2V9DA 3NQAA 3QSRA 3LRKA 4LUIA 5F2MA 2QCGA 5DLCA 3G0XA 3W2MA 3FYPA 5J5DA 4UFMA 4FEZA 2CLMA 1DQWA 2AGKA 4RV8A 3I7SA 1JJKA 1O60A 3QF0A 2V30A 3W7JA 3N9RA 1R2TA 1FWTA 3AJXA 2B7PA 1AL8A 1CW2A 3BG9A 5U4NA 4IMGA 1I2QA 5LSMA 3LBMA 3W9ZA 1KFCA 2AQWA 4BI6A 4Z0JA 1KV8A 5C54A 5LNUA 1QPOA 1DL3A 2EGZA 5CSRA 1W37A 1EA0A 1FCVA 4GUHA 2D73A 2J9ZA 1V5XA 1OFRA 4X9SA 5AHFA 1GPWA 2CLHA 3T55A 1O5KA 2ZRVA 2A7PA 2FIQA 4NNCA 3E12A 2PRMA 3HGRA 2QCLA 2E68A 4YMZA 2E09A 4O50A 1ICSA 3NQCA 3UWZA 4XZ9A 3LCWA 1U5JA 1MEWA 3PUOA 2PRHA 1W3IA 3S1WA 1XDLA 4HKPA 3TXZA 4O52A 5I3FA 3A24A 3CT7A 4X2RA 3G0SA 3R89A 1BWLA 3W7RA 2RDWA 4CCCA 5G2HA 3GK0A 2YX0A 2TRSA 2X1TA 4M7TA 3GDMA 4KFPA 4WY0B 1TSIA 3E0IA 4MZ8A 3GAKA 3CC1A 1WQ5A 4S1FA 3STCA 4R53A 3GNDA 4GBUA 2I1OA 2C1HA 3W7KA 5MHBA 4DEFA 1H63A 3WK3A 3BARA 2C0AA 4N9BA 2E6DA 4UFKA 1OX4A 2BXVA 3S1UA 2VENA 5T26A 3MI3A 3C2RA 1KM1A 2BTMA 2HTMA 3LRMA 1LRNA 2CLFA 1BWKA 2ZA2A 4IMEA 4HSOA 3TMLA 3UD6A 4UTMA 3ABSA 1VCFA 3O6CA 2NWRA 4AAJA 1I45A 5DXYA 4DBEA 5KITA 2F7FA 2EPHA 1L2UA 3A5VA 4G1KA 2VEPA 1KW1A 1H50A 1LOLA 3KFTA 3DFNA 3IVSA 1SZEA 3GDKA 5I3JA 1PV8A 1MSSA 4WJEA 2VXNA 4FNSA 3G0UA 2FPYA 3DI0A 5E93A 4QIUA 1WX0A 2HMCA 2Y7GA 1T0OA 2V82A 4JIPA 1NF7A 2Y88A 3MP4A 1EIXA 3M9YA 4UTUA 3EX6A 2OZ0A 3G22A 5I3HA 2HSAA 4LV4A 1NF0A 1M6JA 1B57A 4L4MA 3THAA 5LNWA 1TTIA 3KXQA 1VCVA 1SR9A 1AW5A 3DAQA 2LLEA 3W7OA 4O19A 4LUJA 3BO9A 4QNWA 2WJZA 1I2NA 1VS1A 2WOQA 3NZ1A 4NXKA 4YXGA 1FX6A 1D3GA 3PB0A 2GVJA 1O95A 4NJJA 5CZJA 2QKFA 4Y96A 2Y6ZA 1NAL1 3W83A 4LS0A 4N4QA 3LXCA 2A4AA 4ORMA 3NQ7A 1VH7A 1WYIA 4IPIA 2Z0IA 3LLDA 3GR7A 3W6YA 1ME7A 1FWWA 4OV4A 5KTLA 5D04C 5HR7A 1EWDA 1Z48A 1XL9A 4MJMA 4UMCA 2NUWA 2ZCGA 1T99A 1FDJA 4Q4KA 5AB3A 5HWNA 4EIVA 2X16A 3W1TA 2A6LA 4J9JA 2YZRA 2Y7DA 3UPWA 1O5XA 1ZALA 3B0PA 1W3TA 1XXXA 5D32A 2Y7FA 3R13A 3H53A 4K7YA 4JEQA 3WK0A 4FO4A 4ZQOA 2XN0A 4I7WA 5G5IA 3BLIA 4UR8A 1YTEA 3G3MA 1LRTA 2YGYA 3B0VC 2FQIA 3LTSA 4YCOA 4IQLA 5EYWA 3W7MA 1YYAA 2VFEA 4O10A 4O13A 3QEZA 1YPFA 1Q6OA 1NSJA 1KM6A 1QOQA 3S1VA 5E1QA 3C3NA 1GYNA 5LNRA 3PS7A 3P5YA 4CQAA 2C18A 3MBFA 1DJQA 3UYCA 1VLWA 3FLUA 3DENA 4GRSA 5BNKA 1MXSA 3I68A 2W6RA 1K7EA 1TPB1 3PBYA 4JDYA 3GXPA 2G5WA 1Z41A 4AHPA 1KFLA 3G1HA 1C8VA 2QCDB 1VHCA 3E96A 3MWAA 3CIWA 4O57A 3L66A 2DZSA 3TMQA 1UCWA 2DP3A 1KM3A 3TQVA 1OABA 1MEIA 2ZFAA 3W1XA 5D38A 1F6PA 3NAVA 3FYOA 3EX2A 2ZZ5A 3SJ3A 2YFNA 3ABQA 3WJYA 5AHNA 4K7VA 2QUUA 3TSBA 3NL5A 2E5DA 3EB2A 3NPVA 1J2WA 1Q6LA 4FX8A 3NQFA 3F4NA 3T44A 1C29A 2ALDA 5AC7A 3I7QA 4ADUA 5C2XA 1TPH1 2QCMA 3G1YA 3TX9A 4I7VA 3W07A 3FOKA 4DF0A 4ICNA 4N4PA 3KX6A 3JR2A 4AWSA 2A7NA 1RZMA 4AHOA 4XTIA 5FEZA 2NWSA 4JTLA 2GOUA 3NL2A 2V5LA 1H7RA 3OA3A 5I3GA 1YDNA 1OX6A 1WDWA 3LI1A 4JY9A 2X1RA 1JQXA 1QMLA 2IQTA 3LCIA 3NL6A 3TC6A 4MYXA 1W0MA 2WSRA 3EXSA 1WBJA 1W8SA 2DZWA 1G6CA 4R34A 3MHUA 2ZZ6A 3SY5A 1KTCA 1K02A 3MHGA 2ATSA 1O94A 3MI2A 1Q6RA 1ICPA 3CWNA 4UTHA 3SECA 3NZRA 3W1UA 1H5YA 4ZQPA 4IJBA 3RNDA 4BWLC 5AYXA 1OF6A 2WO5A 3NXFA 4LVBA 5CPMA 2B7OA 5DY3A 1JUBA 3OVRA 4A21A 1XFBA 3UY8A 5A5WA 3I65A 3RLVA 1R46A 1KTBA 5K4ZA 3VCRA 2C16A 2H3BA 5FI8A 4MKNA 1ZAHA 3S8HA 3W85A 1FXQA 1FUYA 1KFKA 3WFAA 4IXHA 1A5BA 4Y90A 2DZUA 1XUZA 5AC8A 5HINA 1WOAA 3F1QA 4UTWA 3QRHA 2TYSA 1VZWA 3O63A 2VC6A 4M6PA 3GYEA 4Q33A 4JTTA 3DFTA 2Q3RA 4O54A 3VE9A 1G69A 4UFIA 4UTKA 1GEQA 3TV8A 4BR1A 3T40A 4UR7A 4H3DA 1Z44A 2PCQA 4TU1A 3PBVA 1FDZA 2GQ8A 3QW4B 4JYEA 3M44A 1F74A 3R2GA 4I9AA 1OFAA 5DXXA 4E38A 1SW7A 2ZTJA 2P0OA 1TQXA 4QAIA 1TTPA 5HJLA 3BW4A 3NNTA 3T78A 3AO0A 2ISSA 2GQ9A 2XN1A 3LCHA 4K8EA 1H60A 2DZXA 4DO4A 1X1OA 4K6AA 3VI2A 4O28A 5CG7A 3HG2A 1GVFA 3O6YX 6TIMA 1SW0A 1O4UA 5D03A 3TR2A 1DHPA 3FJLA 4BF9A 4RZ5A 3B06A 1SZFA 4Z1DA 3M1ZA 2YDAA 3PAJA 1LOSA 2WV8A 4PA8A 1PHQA 1HFBA 1GTHA 1GVOA 1XC4A 4FNRA 3GLCA 4IXXA 1G4EA 2ATMA 3M16A 3QFEA 1F76A 3G3DA 3LLFA 5CGQA 3EEGA 4C1KA 1YXYA 4N6EA 3U8GA 1TCDA 4ML9A 2O7QA 3L0NA 3M5YA 4P2VA 2W79A 1EB3A 1OX4B 1OHLA 1TPC1 2C3ZA 3EWXA 3IV3A 4X3ZA 1GOXA 3PUDA 1KA9F 4MPQA 5SWUA 4UXDA 5G4WA 4RKAA 5HUPA 2CW6A 1PHWA 4FNPA 1YLVA 4ONVA 4UMBA 4S2BA 1JUKA 3FKRA 4O16A 3LXBA 3TAKA 4O15A 2VFIA 1C9DA 3N3MA 4IWWA 3BW2A 4S2CA 5IBXC 1KM4A 3G24A 3W3OA 3W7HA 3Q94A 3L9CA 3KOFA 4ZQRA 3DGRA 1YDOA 1LM1A 2X1UA 3MP5A 4WUIA 5EL1A 4GFSA 4ALDA 3W73A 5FESA 3HPXA 1RD5A 3BG5A 4XKYA 4CCDA 5DCBA 3HOJA 3W7PA 2YCEA 3H54A 1SZGA 3N2MA 5BRBA 3EX4A 3MUXA 1XDMA 3ABOA 1FQ0A 3NQDA 4HNVA 3E02A 4NXSA 3LERA 2Z1BA 1CI1A 1PIIA 2FB2A 1JCJA 3S0CA 1QAPA 3IEBA 2QCEA 2Y63A 2CWNA 2ZRUA 4JXCA 1F6KA 4O17A 1TV7A 3P60A 2CU0A 4RZ4A 1EWEA 1W3NA 4UTTA 1JCMP 4FF7A 3NM1A 1K8ZA 3S5ZA 4MIMA 5CPOA 4BI5A 4HT3A 2TSYA 2CZEA 4Z1AA 5LGXA 1VJIA 4GNJA 3PC0A 1Q3NA 4OWGA 5DBTA 3C6CA 3S5YA 1JVNA 1AL7A 4AWTA 3IRDA 3Q2DA 1HL2A 5FEWA 1H7XA 3GVGA 5IM51 3BLFA 2ZZ2A 1TPFA 1AG1O 3UWQA 3M5VA 1RQBA 2EKCA 1DQXA 2WKJA 3NR0A 1OG0A 3MYOA 4LS2A 4LU0A 5CPLA 1WAUA 1UBSA 4RJEA 1QFEA 1MO0A 3G1SA 5KZEA 5BMWA 3Q37A 5BMXA 3GX9A 1SO4A 1IXNA 2NX9A 4TMBA 5HQEA 2JK2A 3HPZA 2Y89A 3UXAA 3ZWTA 1UASA 1YPIA 5ABTA 3R8RA 1FCUA 2QJIA 4K38A 3LBCA 4W9TA 3UWUA 2FFCA 4NU7A 3HPSA 4NVTA 4O4WA 1K03A 1VYRA 1VR6A 3HQ1A 4CNPA 3IIOA 5CSSA 2R91A 4M7SA 3TFCA 1KM0A 4CQ8A 1LP6A 1IXOA 3IVTA 2E5CA 2B4GA 2PRLA 4ORIA 4JTSA 3E9AA 2JGYA 1SUXA 1LCOA 3PBUA 3HG4A 2QAPA 1N7KA 4ADSA 3ZR4A 4BK9A 3DH7A 3EWWA 1N8FA 3LDVA 1N55A 3SR7A 3OHIA 3TDFA 1XI3A 1VHNA 4CCEA 4JS3A 4XBSA 1J4EA 1W5PA 2UV8G 3DXIA 2Y70A 2VKZG 3EXTA 2O7SA 4HN4A 1IXQA 1PCKA 3QMSA 5L6UA 3A5FA 1UB3A 5D09A 3T4CA 2DJXA 2J6XA 4B5NA 1VYSX 4N2YA 2I9EA 5D2VA 3STFA 4AF0A 4LC8A 1YXCA 3QM3A 3STGA 5EKYA 3W84A 2A0NA 2ZZ3A 3HMJG 5F2GA 3S5NA 4YL2A 1LZOA 3W7LA 4K36A 5K7JA 4FXSA 1I2PA 1ZHAA 3C4UA 4TMCA 2QUTA 1M7PA 2CLIA 3LV5A 1GVQA 1GT8A 4AWUA 4TX9A 4RX0A 1GYLA 4JR5A 3QSTA 5FF7A 3GKFA 1I4NA 4P61A 3LM7A 3NQMA 3OEXA 1QO2A 1ZFJA 2VEMA 3WJSA 1B9BA 4MY1A 1GVSA 3UWVA 3LHYA 3PB2A 2B7QA 5AFDA 3EKLA 3LV6A 5AYZA 1OYCA 5D2WA 4IMFA 5D2XA 3W87A 1OFDA 3PM6A 1LYXA 2V2CA 3H55A 2NV1A 2RH9A 5HMSA 1GQNA 1KLYA 4JTKA 4A29A 3W88A 3G1XA 2G95A 3U6WA 4HHPA 3W2NA 3W7GA 3VE7A 3VFLA 1P0KA 1OF8A 2V5BA 1XCFA 2XFWA 3LTYA 3CPRA 5F2LA 1X6UA 2EAWA 4AH7A 3L65A 4JTUA 4Y9AA 2G97A 3SIZA 3ZS4A 5FF4A 1L9WA 4X22A 3TROA 3S6DA 3G1DA 2YXGA 4M5PA 3GDLA 2JKEA 2X1SA 3G18A 1JCNA 3DBPA 2DJLA 1R30A 2C19A 4LC6A 4ZMGA 1M7OA 3NEVA 5A8GA 4LNYA 5FF2A 3JRKA 2JGQA 1IGSA 4Z0SA 2C13A 2J9XA 3O07A 1UUMA 4HSNA 4TO8A 4MUZA 4DBDA 4JN6A 4PFMA 3M6YA 3TJLA 2YW3A 2JBMA 1TRDA 4XBKA 5G1TA 3TUUA 2E1DA 4AHQA 2PURA 1YTDA 3PSVA 5AC6A 1VQTA 1LBMA 4Z1CA 2QCCA 4UMAA 1VLIA 2C14A 3VNDA 5L9FA 5DCEA 2NUYA 1QWGA 4IX0A 2ZBTA 1MEHA 3CQ0A 1IIHA 4IUOA 4M6QA 4O1AA 4EWND 3KVKA 3P8IA 3P82A 2H6RA 3P74A 2QCFA 4PL1A 3C2FA 1L6YA 2QF7A 1RPXA 1G4TA 1ADOA 1KV5A 1BTMA 3IGXA 4H6KA 1LORA 1GTEA 3DI1A 3LOTA 2CLLA 3EWYA 1W54A 3HGSA 2ZZ1A 3QYQA 3BK0A 1DV7A 3HJZA 3S9YA 2VFHA 1GG1A 3C2EA 1LBFA 3PBWA 1G4PA 5KSWA 2QJHA 1PCWA 2Y61A 1R2RA 3A21A 3IGUA 4AEOA 3Q58A 2Y7EA 4E2BA 5EMUA 2V0TA 1P0NA 1FCBA 3NPXA 1OFBA 1F73A 1U83A 3G1AA 4MJZA 4MYAA 4LVFA 3WK2A 3GZ3A 5FEXA 4KFOA 1J5TA 1K3UA 1H1ZA 1Z42A 2A5HA 4RK8A 3C52A 5AOUA 3N19B 5DELA 4XKYB 4PODA 3A9IA 1L6SA 2PC4A 3EWBX 4JTFA 2E6YA 5C5YA 1XBYA 3KRSA 4LOCA 3L21A 1ZAIA 1TQJA 3N2XA 2ZRYA 3O8AA 4E2DA 1LRQA 1SU5A 1IF2A 5H91A 2XN2A 3CIXA 3NA8A 2J24A 4KWWA 2H8XA 4NT0A 4CNNA 2GJNA 2ZTKA 2J9YA 3MYPA 5G2IA 2GVLA 5HULA 1V7YA 1H61A 3PWAA 4LW7A 1SFJA 5LNSA 2ZRXA 1ZENA 1A50A 1RQEA 1PL9A 4DPQA 5D02A 3DKLA 3M5XA 1ALDA 4POCA 5FF0A 3CLMA 5E0KA 3PG9A 3CWOX 4DO6A 1W5QA 3BLEA 3O1NA 3SFKA 4UTIA 2YR1A 5K9DA 1TPEA 3B0UX 3OVPA 4IGHA 1H51A 1BKSA 3NQ6A 4A2RA 3LB0A 3A23A 2WNQA 3W1RA 5C55A 1VCGA 3EXRA 5D2YA 3QZEA 3WJWA 1SW3A 2NLIA 4NZFA 1W56A 2Q8LA 4O0ZA 3R12A 5F1VA 3SW6A 3TFXA 1TRIA 4HNNA 4GUGA 4FNQA 4A2SA 3W22A 2H8ZA 4M19A 3NQ2A 5TQLA 3UPBA 4NUWA 4YCPA 2QUVA 4N9DA 4MZ1A 3GDTA 1TPDA 4QITA 3BGGA 2R8WA 2RFGA 1VRDA 1WV2A 1JRBA 3M7WA 4UNLA 3HGJA 1OJXA 3GDRA 1EUNA 4OU1A 3RMJA 2TMDA 4JNMA 1KM5A 2EHHA 3TAOA 4N9CA 5AYYA 4UTWC 2BZNA 2HS6A 3NPWA 1LBLA 5LZLA 1HO1A 4WZHA 3HGOA 3QPYA 1FDYA 5D2TA 5U7SA 3P84A 1WA3A 3S1XA 4JICA 3W72A 3TA6A 2YYUA 5K2ZA 1KFBA 1AK5A 3EX1A 2HS8A 5J5RA 2FDSA 1A5AA 3QH2A 4LRTA 1RR2A 3BVJA 2WPBA 2NV2A 2OCZA 2ZRZA 1OFEA 1TV5A 3DZ1A 3W74A 2FB3A 3W1QA 3C56A 4JTEA 1EP1A 4JTGA 1JCLA 1HUVA 3ABRA 5K4XA 5EBUA 1SSGA 4NJHA 3GXTA 4UCGA 2QEZA 3O6DA 1OFPA 4CLMA 4IOTA 5F2IA 4O12A 1H7WA 1JCYA 2RHGA 2QAFA 3MBDA 2OJPA 4KFNA 3TJXA 5CKSA 1QDSA 5KZDA 2A6NA 1TB3A 1TO3A 2DU2A 4WD0A 4O53A 2CLEA 4LVDA 1UUOA 4UFJA 4JY8A 4FX7A 2VEIA 3TU9A 3YPIA 2CZFA 3TC7A 3WJXA 3IVUA 1H62A 1TMHA 4MY8A 4NX0A 4XQ6A 3MO7A 1ME9A 4K8HA 3LXAA 4ZZ9A 2DZTA 1SSDA 2V8ZA 1TTQA 1G4SA 3C2OA 1KLZA 2TPSA 4OE7A 5DN1A 3W2LA 1KFEA 1S5WA 2ZZ4A 5D30A 1JQVA 3W7NA 1OFQA 3NYZA 3PVFA 4HNUA 4PTNA 4AF0B 3M43A 2Y62A 4UUIA 3CU2A 1WXJA 1FWNA 3G8RA 5I3IA 5CZTA 3KVMA 5G1YA 3O05A 1X7FA 5LKYA 1NFBA 1TREA 2BWGA 3HO8A 3W2UA 4OBTA 5D37A 1T96A 4FB7A 7TIMA 3EWZA 2VFGA 1F5ZA 1YADA 4Z1BA 3I6RA 2BSLA 2YW4A 4HPJA 3G1VA 3MMTA 3GAYA 3OVQA 4FNUA 4PCFA 3L5MA 4TIMA 3G8EA 4LVGA 4FXRA 1ML1A 2A21A 4PC8A 2ZRWA 3ATYA 3ELFA 3GIYA 4ZQCA 3TCEA 1ONRA 1OK6A 1VC4A 1WOBA 3A22A 3DKJA 3PUEA 3LCLA 1HG3A 4MLRA 4NJIA 4Y8FA 2NX3A 3UWYA 4FHAA 1JUEA 1IIGA 2VOMA 3NQGA 1I8JA 1TJRA 4WX2A 5BW6A 1TIMA 3LHTA 2FJKA 1TPVA 1ICQA 2VEKA 5LHFA 3UZJA 3KHJA 1FXPA 3UWWA 3P5ZA 4RLIA 3IGSA 1FWSA 3W1NA 3R5EA 2GVGA 3LCXA 3LI0A 2E5BA 2GQAA 4I7UA 3LHUA 4QNEA 4IMCA 4DF1A 1T8XA 1AW1A 1PS9A 4E0CA 1K8YA 1M5WA 4UTTC 3LGEA 3W70A 4O18A 1F7BA 1VYPX 4BI7A 3NQEA 4QM1A 1XM3A 3LHZA 4EVZA 4JGDA 4EOUA 3DFOA 4GJ1A 4JYDA 3TW7A 2QCHA 4UFHA 2ISVA 3C61A 4FIQA 3IIZA 4AMAA 4XWUA 3UY7A 3NQ8A 1EP2A 2C15A 1TTJA 2FPTA 2E77A 4MFDA 5HWJA 2YPIA 2ABBA 3L68A 3NQVA 1KM2A 4WOQA 4M6VA 3BG3A 5KMYA 2X2GA 3MI6A 1KFJA 1W5NA 3NOEA 1HO4A 1LROA 3F4WA 3QQ1A 4UTLA 3TE9A 2E6FA 1GJPA 3D0CA 3KRZA 4OHQA 1RQHA 1SPQA 1DVJA 1R47A 4MOZA 3RLUA 3W1AA 5CZ0A 3RK8A 3NPUA 1TV8A 2KZHA 2OMAA 4YWIA 3W7DA 3HB9A 3W7CA 1A53A 1JR1A 3M41A 4HPXA 4RZ6A 1MZHA 1ZY9A 4D2JA 1JULA 3W2JA 3QC3A 4GWEA 3E49A 1DORA 1X8FA 2A1YA 3I7RA 4IX2A 4TR9A 4K39A 3CM4A 2FPVA 3L2IA 5FEPA 2Q3OA 1Y0EA 4N9EA 3SGUA 2QCNA 3K30A 2B0MA 1EUAA 4XTDA 2Q8ZA 4GUJA 2GUUA 3ZFHA 3UQNA 4WOZA 3IIXA 1PVNA 4AB4A 3O15A 4OT7A 4O0KA 1H7NA 1DOSA 3QMTA 4DXVA 1QCWA 1YTKA 2BX7A 4LWWA 4Q32A 4WXZA 4ZL1A 5DY2A 1K8XA 1YXDA 5FF3A 1EX5A 2H90A 1K7FA 3N14A 3NGJA 2WSYA 3W76A 3DHDA 4ZQMA 1S5TA 1KBIA 1I2OA 4C1LA 3JS3A 3NG3A 4UTJA 1A5SA 1XBXA 2ISWA 3G1FA 2NUXA 1G7VA 2J27A 3MP3A 3P7YA 3UZ5A 5HWMA 3QW3A 1TPWA 4JYFA 4H4IA 3GXNA 1WBHA 3SZ8A 4DPPA 4OV9A 1P4CA 3WJZA 2I14A 3C2VA 3UXDA 1GWJA 8TIMA 1GVRA 2FTPA 4ZQNA 3RF9A 3P80A 2NZLA 3MJYA 3O06A 4AVFA 1FY6A 3INPA 3USBA 5CZSA 1CX9A 3DU0A 1BEUA 3IIVA 3L0GA 4GXMA 4QJ1A 3KVLA 3NVTA 3B4UA 4AXKA 2ZQ0A 3PY2A 5F4SA 2B7NA 3CTLA 2YSWA 1DKWA 4R7JA 2OT1A 3W23A 3HG3A 4MZYA 3QQ0A 3PSWA 5LGZA 2A2IA 3N73A 4QQ3A 4A3UA 3GR8A 3ANYA 1PE1A 5LHEA 2ABAA 3ZWSA 3LCFA 3GB6A 3W71A 1QNVA 1AMKA 3W7IA 4JIQA 5EY5A 5TBOA 3EX3A 3L0KA 4K37A 1I2RA 5EPDA 1OK4A 4FNTA 3B05A 1RVGA 1E51A 5LNVA 1FBAA 1QPRA 3P81A 4DQWA 3FS2A 3LHWA 3P62A 4ZVJA 3PF3A 1TPUA 4N02A 4WY0A 1FCQA 4XUGA 5D05A 3FFSA 1QR7A 1W1ZA 4JTHA 3TSMA 6ALDA 5F1UA 5EA9A 2CZ5A 3KAOA 3SGZA 4O1CA 5K9CA 1R2SA 4EF8A 2WSQA 1B4KA 2A85A 2RDUA 3EWUA 3B03A 3GKAA 1NVMA 1W5MA 4LVAA 1JRCA 1XBVA 4HNTA 4JDBA 3OG3A 1GZGA 4U28A 4GUFA 1ZAJA 3FEMA 3ATZA 5D33A 2P10A 2CZDA 2F84A 4BWLA 3FIGA 1D3HA 1IXPA 3HIJA 3N34A 4OGZA 3PULA 4PEKA 2OT0A 1B4EA 5DCDA 5GVJA 1NEYA 4LS1A 3TIMA 2QR6A 2ZA3A 3TW6A 1LDCA 1AW2A 4Z08A 4RR4A 1Q45A 3CHVA 5HR6A 3W2KA 3L67A 4WY0F 3BW3A 1ZNNA 3TQKA 2G96A 3HBLA 4QSHA 3O16A 3BPWA 2PE4A 2GJLA 3F03K 4O14A 3KVJA 1QPNA 2DZPA 3FA5A 4GE8A 4O8RA 1Q6QA 1H7PA 1VPXA 1ZCOA 2ZYFA 4RCXA 4FIRA 2FLIA 4L4LA 4UNKA 1XBZA 1DBTA 2BLEA 4KKXA 3NL3A 3TK7A 4UC5A 5I3KA 3TQ0A 4JX5A 4Y6GA 5CPNA 4CNOA 2OX1A 3TKFA 3CEPA 4NJKA 1SO3A 2JKPA 1THFD 4R33A 5F4XA 4LY8A 3N9SA 3PR2A 2NXIA 1HTIA 3DFQA 3SSJA 2QJGA 5K9XA 4JTIA 5K3VA 2DORA 1S3HA 3NDOA 1P5BA 1A5CA 4LT9A 5G2WA 2WQPA 1RV8A 2VELA 4NJGA 4NNBA 3S42A 1W31A 1X1ZA 3P8JA 1W5OA 4LV9A 5HNRA 1OYAA 3RFAA 1SZNA 3C8FA 5H2ZA 2EF9A 4NQ1A 1L6WA 1SO5A 4PL2A 2CLKA 2AAMA 3M5ZA 2QDGA 4OQVA 4GC4A 4LRSA 4O11A 2JKAA 2VFDA 1OVDA 2A7RA 3WK1A 3EKZA 2NXGA 2VFFA 2ZA1A 2CFFA 5KINA 1OX5A 1LLZA 3QMRA 3HF3A 3KRUA 2YFOA 1G67A 2ZDRA 3FJ6A 1OFOA 4U4MA 3OIXA 3W86A 1TJPA 3W1MA 4JX4A 2V81A 4EF9A 1S5VA 4O1BA 3CEUA 1KBJA 4RXFA 3T7VA 1G7UA 4WXYA 3P61A 4ADTA 3NO5A 3V1PA 1ME8A 3L5AA 4DO5A 3THQA 1LTDA
chains in the Genus database with same CATH superfamily
4JTJA 4NX5A 1FP9A 2XSAA 3IIPA 2DH3A 3QJAA 2DT3A 1TZ7A 1H7OA 1W9VA 4UFLA 2RDTA 3WQ6A 4O1DA 5TIMA 1V3MA 3KLLA 2DT0A 1P0DA 3V75A 4P8UA 2AGTA 3W7QA 5BOOA 5KZMA 3KZPA 2R94A 2XIJA 4NNAA 2QDHA 4AD0A 1TCMA 2R14A 2ALRA 3ZJ7A 3C0JA 3STPA 5CSUA 1OYBA 3QTPA 3M0ZA 5E6YA 3BGJA 2WNNA 2X41A 3D3AA 4BZYA 4FLOA 2X8RA 3UA4A 3BCJA 3QPZA 3GHTA 4NIRA 1YDVA 3LTPA 2VC7A 2H3DA 4D6HA 4IMDA 2YYTA 4UIOA 4O4VA 2XVGA 5EGRA 4A22A 3GVWA 5LIXX 4B2DA 5A6JA 2XVKA 1AZ1A 8XIMA 4LTSA 3VA8A 1SJCA 4JHMA 1RUSA 1QOPA 2Y85A 1EH9A 1QO5A 3DFSA 2X7WA 4AZ5A 3VD4A 3P67A 1VGAA 3L5LA 3NJ3A 1R0MA 1W3LA 1LOQA 3OBKA 4GQRA 2E3ZA 5HUOA 3UNDA 4LCQA 3IANA 3AHXA 4E4PA 4KWVA 3E5PA 2ZUTA 5AHIA 4DELA 1H11A 4HIBA 1TVLA 1ZPTA 3MCNA 2V9DA 4LUIA 3GVRA 4ZOCA 3NWRA 4M0XA 5J5DA 4GIEA 4ES4A 4FEZA 3M64A 4RV8A 3TN4A 1FWJC 1VFTA 1KWKA 4IMGA 1KRCC 1PUDA 1VAHA 3SEPA 3W9ZA 1KV8A 2RJHA 5LNUA 1QPOA 2W4XA 2EGZA 1JEZA 1EA0A 1OFRA 3IK2A 3DG3A 3M07A 4GX9A 4H9VA 3NOYA 2A7PA 4NNCA 2C71A 3DC8A 1TX2A 2WMHA 4A8RA 3VINA 3RX4A 4HJFA 3CASA 1ICSA 3NQCA 1U5JA 1MEWA 3PUOA 1EDQA 3UERA 4Y7EA 5E6ZA 2DT2A 3TXZA 4XZWA 4YVXA 2PGEA 4X2RA 2ZIDA 1BWLA 3SCVA 4PUUA 4CCCA 1RJQA 5G2HA 1ISYA 1VFSA 3GK0A 3M0XA 2TRSA 2HNHA 4IIGA 2HZGA 4PRRA 3TW9A 4WY0B 4KFPA 3ARWA 2BOGX 3T07A 3BOFA 3VMOA 4C7DA 2VDIA 4BQ3A 5JVLA 2ZX8A 1XLDA 3H7UA 1RLDA 3BARA 1PAMA 4UFKA 1OX4A 3S1UA 3RAOA 4YVVA 3C2RA 1NDWA 2BTMA 1BRLB 2HTMA 2VL4A 1TVPA 2CLFA 2QVHA 4GQGA 4HSOA 2BOEX 3TMLA 5A6AA 1KFWA 4UTMA 3ABSA 1VCFA 4IIBA 3CAKA 3O6CA 1I45A 1ONXA 2F7FA 2EPHA 1L2UA 3A5VA 1KW1A 1R5YA 5CEWA 1LOLA 3KFTA 3DFNA 3W28A 2C0HA 3ITXA 3AIWA 3G0UA 1ZLPA 3M0KA 2B81A 4L1XA 4QIUA 3ARRA 1WX0A 2VQUA 2Y7GA 2V82A 4JIPA 5CGMA 3A13A 4G7FA 4RDYA 2XGIA 4RNJA 1NF7A 1KRMA 4LV4A 4S3GA 1OEPA 1B57A 1IEIA 3THAA 1TTIA 2WZMA 3KXQA 1SR9A 4O19A 1UKSA 4DZIA 4EPBC 5JUVA 3MDUA 4QXIA 2WOQA 2OO0A 4H04A 3PPHA 3NXLA 1E0VA 4YXGA 3LPOA 1D3GA 2WYSA 2GVJA 3R94A 4Y96A 1UKOA 3FNDA 3A47A 3R0DA 5FJJA 4GXPA 3EZ4A 2Y5SA 3NQ7A 4LYQA 3DFYA 4TUFA 1FWWA 5TD4A 4OV4A 3AHTA 3ZSTA 4OIFA 4ZTYA 4D6EA 2PA6A 2YCJA 1TZ9A 5DRIA 3B0PA 3MTWA 1BQCA 2V68A 1CLVA 3VD5A 1DJIA 2Y7FA 3R58A 4WKHA 2HXUA 4NL1A 3P2VA 3H53A 1DIEA 1JPKA 1ZJHA 4BF7A 4V15A 1LQ0A 1XIHA 2PDJA 2HNEA 5G5IA 1YQ2A 3F4CA 5CSYA 3BLIA 3G3MA 1M7JA 3B0VC 4YCOA 2O92A 4HK6A 4CVUA 1GJUA 1JYVA 3W7MA 1YYAA 1BGGA 4AIEA 2VFEA 4O13A 2G3IA 1PIFA 1E1EA 3S1VA 5D8WA 3C3NA 4JHZA 1GYNA 4AIOA 3WH7A 2C18A 4E2VA 3VDGA 1J6OA 2VGGA 3DENA 4WKAA 3SUUA 4M51A 3WFLA 3PBYA 5BXPA 1CB2A 4AHPA 1Z41A 5E09A 4AW7A 4LB3A 5EB8A 1E0UA 1VJZA 1KM3A 1XS2A 3UA3A 4IHCA 2NSXA 3WLIA 2DFAA 1F6PA 2J7FA 5D9NA 1IZJA 3EX2A 2YFNA 3WJYA 1VD6A 1OC7A 1IHIA 3EB2A 3ZYZA 2FZ8A 3E0LA 5AC7A 3I7QA 2X7VA 2NQ5A 6REQB 2QCMA 3DG6A 3FOKA 2BFGA 4N4PA 4AWSA 5HNTA 2X0HA 1RZMA 4AHOA 2XFYA 3NVDA 2F6XA 4L6DA 5FEZA 2D69A 4I5XA 3VAVA 2VEFA 5I3GA 1VIWA 1OX6A 1WDWA 5IFTA 2G3MA 4JY9A 5D8ZA 2GWGA 5DMMA 5FJTA 2P3ZA 2YDRA 3F2CA 1GQIA 2NSOA 2DGAA 3HTWA 4NP7A 3SY5A 3AU6A 4JFVA 1I9CB 1Q6RA 1ICPA 3KEHA 3BGAA 4WDXA 3U57A 3MUY1 4ZXLA 4ZQPA 3RNDA 2WO5A 5CPMA 2B7OA 3CBWA 4JHOA 3UY8A 1EBGA 2ASHA 3N6QA 4WJ8A 5DX7A 3RLVA 1KTBA 5K4ZA 3VCRA 1AUSL 2C16A 5HPOA 5FI8A 1ZAHA 3S8HA 1FXQA 1KFKA 4B3KA 5DANA 1A5BA 4CD7A 1ZJAA 5FKYA 1Q7QA 4I6KA 2DZUA 5AVHA 3S4TA 1EJSC 3F1QA 1F6YA 1DXEA 3QRHA 2E4TA 3O63A 2VC6A 4M6PA 4Q33A 5A2AA 1A47A 1G69A 2VZTA 4BR1A 2Z29A 3A6OA 4H3DA 5FJIA 3QPEA 2WSKA 1EBHA 2FZNA 2GQ8A 4HU4A 1MQQA 1JIBA 4URIA 1F74A 1V93A 2NVCA 1PXGA 4J35A 1XQLA 1SW7A 2ZTJA 2ZADA 5HJLA 2Z00A 3BW4A 3NNTA 3AO0A 4AY1A 4Z2JA 3E2VA 1X1OA 2POZA 1ODUA 5AC5A 2DIJA 1E71M 1D8WA 2Q71A 2RJGA 1W9PA 1O4UA 3TR2A 3I4EA 1NM9A 1DHPA 3FJLA 4Z1DA 4FOJA 1ZUAX 2YDAA 3L2LA 1YMYA 3PAJA 3RX2A 1S2CA 1K4HA 1PHQA 1HFBA 1GTHA 3V0TA 3DERA 1N8IA 2VUNA 1BAGA 2ATMA 2AL2B 3BJTA 2I7GA 1E6PA 4C1KA 3QOMA 4N6EA 3U8GA 2PB1A 2P5NA 5BXRA 2WQDA 1TCDA 1PTDA 3QYSA 1BWVA 3LM3A 1OHLA 1TPC1 3UJEA 1GOXA 4XZNX 1KA9F 2JF7A 4MPQA 1KXQA 4QGCA 2EJAA 3BLDA 3DDMA 4RKAA 5HUPA 4FNPA 3FXYA 3TTQA 2RGLA 3FKRA 3FSUA 4PCNA 1H09A 3WH5A 1C9DA 5C2CA 4S2CA 1SVDA 2G4JA 1A5MC 5IBXC 3VOGA 1KM4A 2OYLA 1F07A 3KOFA 4PUWA 1YDOA 1LM1A 1UR1A 2YBUA 4WLCA 4ALDA 4ZSTA 5DFAA 3VDBA 3IUHA 1GEHA 1Y5XA 1F3XA 3BG5A 3GG1A 1G0CA 3ZMRA 5A3HA 4H9MA 5BOFA 3CH9A 3KL0A 5FSDC 4LYKA 3B9EA 5BRBA 4JFUA 3EX4A 3ABOA 1Q4NX 4W89A 2XSXA 1M41A 1JCJA 3MSDA 3W25A 4Q8OA 2XJ7A 3OZOA 2QCEA 4JXCA 4S3DA 2VTFA 3SCSA 1W3NA 1TUFA 2O56A 1GJWA 3NM1A 2WVVA 3S5ZA 2HQAA 2TSYA 4YTTA 3NO1A 2P8CA 1O5QA 3DYMA 4OWGA 1M04A 3C6CA 3S5YA 4L65A 3Q2DA 2J7CA 1HL2A 5IM51 5ABGA 1B3WA 1EHNA 2R1LA 3VIKA 1V03A 1BXBA 4LS2A 5ABFA 5CG0A 4MDOA 1UBSA 4RJEA 2ZXDA 4ZB0A 1W1IE 3T2OA 3CK5A 1J12A 3VGHA 2XZ9A 1SO4A 2V63A 1X38A 3E5BA 2JK2A 1GKQA 2Z26A 1XH0A 3GSMA 3WNPA 1EC8A 3FY1A 4W9TA 4K68A 2IMRA 1CXEA 4L80A 2A3BA 3MMWA 1K03A 3ABZA 4IG2B 2HROA 1JYWA 4DBUA 2R91A 3DX5A 1ECEA 4CU8A 1QNSA 3OP2A 4Q3MA 4QRNA 2P3EA 3DH7A 3GFZA 1NWUA 1DTNA 4H9UA 3SR7A 2HVNA 4XBSA 6XIMA 1J4EA 3C3UA 2Z7KA 2XZ7A 3SY8A 5A94A 4C91A 3AI0A 2UV8G 2A3EA 4GK8A 3WH9A 2Y70A 2OR2A 1X8CA 1O66A 3H4GA 3N12A 3PK7A 1UKPA 3EXTA 5HMFA 4ZCWA 1Q8JA 1IXQA 5A6MA 3N04A 3OLDA 5L6UA 4GY0A 2HPMA 1WCGA 1UB3A 3VPLA 3T4CA 2DJXA 1SFSA 1VYSX 2O4QA 3MUCA 1TKKA 3STGA 1XLFA 4HZ8A 1OCBA 2REQA 4FS9A 2ZZ3A 1VBRA 1RA0A 3S5NA 4MF4A 3ZJ8A 2QVNA 1GVIA 4YTRA 3UWEA 3QY8A 5A8MA 1FFRA 5JIWA 3P93A 1XPGA 3NZPA 2EXOA 2CLIA 3NTYA 3LK6A 1GVQA 2W63A 1SM9A 3PTQA 5H8PA 4JR5A 1PX4A 1W3HA 4LANA 4CVWA 2VEMA 3WJSA 6XIAA 3PB2A 4GI8A 5AYZA 1R8LA 3SURA 2Z1SA 1AH0A 1ZQ5A 2V2CA 2RH9A 3R10A 1UH4A 4JQ3A 2G95A 4HHPA 2RDXA 3W7GA 5LIKX 3VFLA 1QJWA 3UJRA 1UWIA 1XFCA 4KWUA 1S39A 4QSFA 5F2LA 4OTKA 3L65A 5HQLA 3S6DA 2YXGA 3PZOA 2D24A 3LPPA 2DPEA 1TMQA 3DBPA 1R30A 2GGIA 1Z3NA 4JQAA 3OTRA 3QV7A 2UY4A 4D1IA 3RJXA 2JGQA 4F9JA 2EO7A 2C13A 3S2CA 3P0WA 1DQUA 2QULA 4JN6A 4PFMA 1TRDA 4XBKA 3PTDA 1RBOB 1Y5VA 1YTDA 5AC6A 2XISA 1LBMA 1KCZA 4Z1CA 2CKSA 3FGCB 3I3DA 3UW6A 1VLIA 1BF6A 5CC5A 2A3LA 2NUYA 3W00A 1DE6A 4QG9A 3RPTA 4HOXA 3HJEA 3CQ0A 2XIQA 4UZUA 1LUCA 4PL1A 3RG6A 4MM1A 1RPXA 1G4TA 1KV5A 1R3RA 1GTEA 4BEQA 4DB7A 3LOTA 3L12A 1W54A 5T8GA 2WZIA 4MDPA 3HJZA 3CV6A 2VFHA 4Q8QA 3RN6A 4NF7A 1BYDA 3IGUA 4AEOA 3SO7A 3O3RA 1P7TB 3PN8A 2J77A 1OFBA 1GHRA 1S2UA 4MJZA 4MYAA 1JPDX 3IWPA 4ROPA 4LVFA 3WBEA 2DSUA 4ZO9A 4GH1A 5AOUA 4ZBCA 1MUCA 4FR6A 1DP0A 5DELA 4GA8A 3A9IA 2J8GA 1L6SA 3EWBX 1EJVC 3EPOA 3CQHA 3L21A 1V6YA 3RLGA 1XYAA 2ZRYA 3CAVA 1EJRC 2WNWA 1IF2A 1R87A 4MNJA 3UP8A 2GJNA 1WUEA 3MYPA 5HULA 1SGJA 2I5IA 4HA4A 3H2OA 3WUBA 1SFJA 3H8AA 1S5NA 2PGFA 5LA1A 4DYEA 4JAWA 1ALDA 4QR6A 3CUHA 2QPXA 1I0DA 3OVPA 4J1OA 1H51A 4A2RA 4ACZA 4C7GA 2HVOA 2CITA 2PZ0A 4GZJA 4LCRA 3SW6A 5F1VA 1LT8A 1TRIA 4HNNA 4NRSA 4DXKA 4FR1A 3NQ2A 4N9DA 4Z17A 2OOFA 3GDTA 2R8WA 1VRDA 1WV2A 3M7WA 1A5LC 4Q4MA 5H8UA 3VIFA 1EUNA 3O0FA 3CL6A 4OVXA 2HS6A 1FWHC 1LBLA 1JZ2A 4ZO8A 1E9YB 3HGOA 4ML4A 3QPYA 3TA6A 1AK5A 2X42A 1VRXA 5C7VA 2FDSA 1A5AA 3GO2A 3S2JA 3DYOA 2FVLA 3BVJA 2WPBA 4QCFA 3VGFA 3PAOA 1GOMA 2ZRZA 1RALA 1OFEA 5MKGA 2FB3A 2V3EA 3QQWA 1EP1A 1J11A 1GKRA 4JTGA 1DWHM 5EBUA 4NJHA 3GXTA 3VZXA 1H0IA 3VC6A 3DN5A 5F2IA 2RHGA 3SSZA 4LUTB 2OJPA 2XVNA 1QDSA 5IHRA 3OLGA 1J0KA 1MDLA 1TO3A 3FK4A 2VDHA 4LVDA 4JY8A 4AZCB 2RGMA 1AQ0A 4ILSA 3LXAA 3AIRA 1RP8A 4X63A 4QE4A 3O2LA 2ZZ4A 3UR7A 4UBPC 3J7HA 4AF0B 3M43A 3CV7A 2Y62A 5BYWA 1E4MM 1H49A 1EO5A 4PMDA 4XSMA 2FHBA 3ZXWA 1V6VA 2E8YA 4FB7A 3M0LA 4Z1BA 4UOQA 4HPJA 2PSNA 4GI6A 2ICSA 1SMAA 3IJ6A 3E2SA 4D71A 3TCEA 1WOBA 1VC4A 3A22A 3UG4A 4MLRA 3VDCA 1UG6A 2NX3A 3UWYA 4FHAA 4WGXA 3KW3A 1JUEA 4Q8MA 1XLAA 1PZ3A 3F5JA 4IFOA 1I8JA 2BASA 1UPPA 1V8EA 1ZP3A 4WX2A 2XG9A 3FCPA 1ICQA 2ACUA 1CNVA 4Q4OA 2J7GA 3UZJA 1R9XA 5FCZA 3G77A 3IGSA 3URAA 3BV7A 3R5EA 3C0LA 2OLHA 2E5BA 3RLHA 3G2GA 4U2ZA 2GQAA 3HURA 3V16A 4DF1A 3N11A 1AW1A 1PS9A 4F3HA 4DWSD 4UTTC 4MKSA 1UZHA 4D9PA 4L9YA 3AMCA 4AYSA 1RPKA 4DWSB 4QM1A 1OCNA 5I06A 3HFTA 3TLLA 3DFOA 4JYDA 1QK0A 4UFHA 3MPGA 1ZTVA 2DQXA 4FIQA 4XV0A 4AMAA 4Y9NA 4U10A 3QKEA 3TZFA 3KP0A 3VOCA 2JEPA 3BAYA 4RE0A 5C71A 5AYBA 3PZUA 3R0UA 4M6VA 1UA7A 2X2GA 3T0DA 2ZX5A 3CT2A 4AISA 1LROA 3TE9A 4NI3A 3POCA 3D0CA 4MKVA 2CHNA 3CAQA 1N82A 4W8LA 1RQHA 4RW3A 3MY9A 8RUCA 2Q01A 3RLUA 3WMLA 1HVQA 3T05A 4Q8UA 4GKTA 2D0GA 4F9DA 1VFHA 2PP1A 4YWIA 3W7CA 2YOCA 1AQHA 2TODA 3CWHA 1MZHA 1QVBA 4EACA 3QC3A 3E49A 3KP1A 3QC0A 1X8FA 2BGQA 4J2MA 1J10A 2MANA 1XLBA 2A1YA 3I7RA 3OGVA 3L2IA 4GZIA 3COTA 1Y0EA 5FJUA 5CQ1A 3VKCA 5I2UA 3U9IA 3GY1A 5DO8A 3VIPA 3OA5A 1PVNA 4OT7A 3ZVIA 4NHVA 4GNKB 4KS0A 3LZ3A 3R4IA 2R1PA 3ZT7A 5FF3A 4C6OA 1R3TA 3WQFA 2VZOA 3WLKX 1YNYA 3W76A 2DIEA 1S5TA 4FI4A 1KBIA 1EO7A 4AZBA 1QNOA 1BXCA 2DH2A 2EJ1A 4IFKB 2ISWA 5DT7A 3W81A 2WC4A 4WJXA 4WVXA 1MRAA 4XD3A 1MNSA 3SZ8A 4DPPA 3WJZA 4KIEA 1KCXA 1QTWA 3C2VA 3VC5A 4UQCA 3T8LA 2OZ8A 2E0PA 2ON3A 3P80A 4Y2WA 2NZLA 3O06A 4KCTA 3VOFA 1U33A 2ZX7A 1FWDC 3INPA 2JIWA 3VNYA 3DU0A 1WKDA 3B4UA 2ZQ0A 5IOBA 4GIAA 4C6LA 3BOLA 3PSWA 5BRQA 2ABAA 4LUYA 5C9ZA 2OQYA 3LCFA 3W71A 4HPGA 3Q4DA 1QNVA 3W7IA 3EX3A 3UCCA 2OWCA 1G1YA 1GK8A 4FNTA 1RVGA 3H2NA 5LNVA 3O0KA 4KETA 3P81A 3VOIA 1JZ5A 3P62A 3EDKA 1TPUA 2VC5A 4WY0A 5LIWX 3LEPA 5D05A 4JTHA 1FHLA 4IQJA 4DM2A 1E6SM 4H8UA 4XAGA 1NVMA 1UD8A 2R6OA 3FA4A 3THCA 2XGZA 4HNTA 1PX8A 1Q4WA 3TVAA 1TWSA 2P10A 1WZLA 1BRLA 1EEXA 2WVUA 2GGEA 1RBAA 3CZ8A 1D3HA 3ZZ1A 1C9WA 1XGEA 6TAAA 4RDVA 1WXZA 2YA0A 4AEEA 1QT1A 4CCZA 6ENLA 3D47A 2F2KA 4WSHA 1JZ8A 5FL1A 2FHCA 2ZA3A 1EJTC 4CNUA 1LDCA 1U1UA 4Z08A 2BOFX 5LIYX 3W2KA 3L67A 4KH2A 3LGDA 3EKGA 2ACQA 3VXGA 3VM7A 2VGIA 1A5NC 4JKLA 3MC5A 4QSHA 1P1MA 4B4HA 2GJLA 1HIZA 1ISXA 1S2VA 3F5KA 4J2PA 1GNXA 4M82A 1VPXA 4XAYA 2HJPA 3AMKA 1UD3A 2PDQA 4GYJA 3MJMA 2NV9A 1JCTA 4HPHA 1XBZA 3TYAA 1AJZA 2QPSA 4AD1A 4UC5A 5I3KA 4JX5A 5CPNA 1TWIA 4DAIA 3VIMA 4IF2A 4PN2A 4CNTA 5F4XA 4XUYA 1GOIA 3EMQA 1NARA 4HYWA 4JIHA 4JTIA 2DORA 2PWUA 3R11A 1FWEC 1P5BA 2BHUA 2IUZA 4LT9A 2VELA 4NNBA 3S42A 3AYSA 1E15A 2EF9A 1L6WA 1YW1A 3TA9A 3TJIA 2AAMA 3M5ZA 4OQVA 2QDGA 4GC4A 1VEPA 5EMYA 4O11A 2JKAA 1OVDA 1XIGA 4PEEA 3OPSA 5M2FX 2OZ3A 3OQEA 3TJ4A 2HISA 4JOMA 4PCTA 2E25A 2G8ZA 3HF3A 1PKLA 1G67A 4ENLA 4UNIA 2H9AB 3W1MA 4UWMA 4JX4A 3CXOA 4O1BA 1KBJA 3BLLA 3T7VA 1SJDA 4LBUA 1RK5A 3NO5A 1R9ZA 1ME8A 3DECA 4QDMA 4DNHA 4JIIX 3W75A 5AHLA 4FX6M 4F0HA 5IXEA 4CUCA 5IBXA 3FAWA 4MY9A 1D7KA 4BHYA 1NP2A 3GNNA 2F38A 1C8QA 1TYGA 2DZVA 3IAQA 1YX1A 1UQYA 1R86A 1B5TA 1OD0A 3AZTA 5C0QA 2OELA 4AZGA 3GH7A 4IP4A 4C6IA 1E4LA 3TONA 4A05A 3T42A 4Z42C 1UJQA 1K7XA 2D1ZA 3HG5A 4HVXA 6REQA 2HWGA 1XX1A 3N6HA 4MLJA 2BS9A 1QNPA 5EBAA 4LUSB 2ODOA 3OO2A 5AN7A 1ZBWA 1EDGA 3UCDA 4EP8C 5FJOA 4W88A 1P1XA 4QJ4B 4AQLA 3T0TA 1QPQA 1YDYA 1REQB 3PG8A 4B5WA 1S46A 4TTGA 3RU6A 2CLOA 3B04A 3PJUA 1E6RA 2NXHA 2D2OA 1W17A 3UZZA 1SFLA 3UBPC 3UU0A 4CQ9A 3KL5A 4KW2A 4Q4SA 7REQA 3PP7A 4I3GA 3UESA 2G4FA 1TE1A 1GG0A 4W7UA 3DFPA 3QZ6A 2E6AA 3VD3A 2R82A 4PTVA 4KF1A 4IPJA 1XRFA 4HZ6A 3S5OA 2W91A 3I6TA 3NM3A 2P1FA 2CBIA 3M47A 4XD5A 1PZ2A 1XIBA 3TCSA 1D9EA 1BSIA 1FWRA 1JPHA 1OB0A 2WJEA 2Z6IA 5FL0A 1XP3A 1K4GA 4QISA 3B8DA 4GUIA 4H7CA 1JZ7A 1MW1A 5F2MA 3WQ4A 1RY0A 2QCGA 1HL9A 3NQBA 3FYPA 2AGKA 2AQVA 3I7SA 1JJKA 4PZVA 2V30A 1UHVA 1E6QM 1R2TA 1A5OC 3GTIA 1EYWA 2D0FA 3AJXA 2QW5A 1NU5A 3E38A 4OBRA 5CXPA 1VENA 2ZWZA 1KXVA 3ANVA 2J47A 1VEOA 4AYGA 2X40A 3V5CA 3TWAA 3FYYA 2HEJA 1V6UA 1W37A 1EC9A 2D73A 2O4MA 4X9SA 5AHFA 2DIKA 1D3CA 3BAJA 1HVXA 1GPWA 2CLHA 1OY0A 5F7UA 2ZRVA 2FIQA 4B5UA 2PRMA 1J0ZA 2QCLA 2E68A 4HPNA 4M1RA 4YMZA 2E09A 2OYKA 3LCWA 4HKPA 1GW1A 3MMUA 2UWFA 4H41A 4IM4A 5I3FA 3SCOA 3A24A 3H21A 2IPWA 3W7RA 4XSLA 1Q7MA 2IPFA 2XVLA 1UC4A 2X1TA 3GDMA 1BVNP 3II1A 1TSIA 2AL2A 1I6NA 4H8NA 3GAKA 1K9FA 1WQ5A 4L6HA 3STCA 4R53A 1FWCC 4H9ZA 4IH3A 1H63A 4L6OA 4FSAA 2E6DA 5CH9A 2BXVA 4PB4A 2VENA 3JZUA 4XIAA 1KM1A 2ZX9A 4IIDA 3HV8A 2OQHA 1PWMA 4CD5A 4IMEA 2FHFA 4C1NB 3N4FA 2NWRA 3EOOA 4AAJA 1XWYA 2NVAA 5DXYA 4DBEA 3APTA 4F0SA 1F3TA 3ITVA 1H50A 3AISA 2PWDA 1BQGA 1SZEA 1PV8A 1MSSA 4E5TA 2VXNA 4HU0A 4D8LA 3OIHA 3VKAA 1NJJA 4P8WA 2HMCA 1JF6A 2Z2AA 4AUBA 3SY1A 4FAMA 2GUYA 3BH4A 3CHCA 2F6KA 4F66A 4NZ1A 5HQMA 2Y88A 1EYEA 3G22A 1NF0A 1M6JA 4L4MA 3T0AA 4XAFA 2KAUC 3GXMA 2LLEA 1DXIA 3BO9A 1HT6A 1VS1A 3H12A 5PTDA 1Z6KA 1UIOA 3WD2A 7ENLA 2P88A 3PB0A 4B9YA 3PZQA 5HOSA 3OOQA 3EDDA 5CZJA 4W86A 2BHYA 1IEVA 3CNYA 3F7JA 4KGJA 3W83A 1RCQA 4LS0A 2W61A 4IPNB 2XUCA 2FVKA 3IJ9A 4HJWA 4G5DA 3RILA 3WD4A 5KTLA 5GJPA 5HR7A 3LSCA 4S3BA 3UFYA 1XL9A 1AD4A 4MJMA 4UMCA 5EFDA 1T99A 2A3CA 1FDJA 3WF0A 5AB3A 3TTYA 2X16A 3RU8X 3O6AA 5B80A 3DOPA 1O5XA 5REQB 1ZALA 1W3TA 1W1PA 3CMGA 2WZHA 3POHA 2ZKMX 2VEGA 5I03A 3R13A 4K7YA 4JEQA 1C8XA 1IE7C 1V79A 2P76A 4FO4A 4MADA 2HRWA 4F0RA 3TNBA 1EL3A 2XN0A 1M3UA 3GC2A 4UR8A 1YTEA 1ZP4A 3U7VA 3LU2A 3PFMA 4UTFA 5EYWA 3JZEA 4O10A 1XLKA 1YPFA 1NWTA 1Q6OA 1NSJA 4L4PA 2V5JA 1KM6A 5E1QA 2ZC1A 3WL1A 3PS7A 4CQAA 4NKCA 1LL7A 4J5NA 4GRSA 3U5YA 5D4YA 1MXSA 4AU0A 3I68A 3QXBA 3HQPA 4IG2A 4GBDA 3G1HA 3E96A 1VHCA 3MWAA 4RNFA 4O57A 3L66A 4K1GA 3P14A 1JI2A 1RD6A 2DP3A 3CL8A 4C6QA 1MEIA 5A6TC 2ZFAA 3W1XA 5D38A 1R3VA 5AHNA 5JXQA 4K7VA 1XF0A 2QUUA 5J8LA 4B16A 2VD8A 3TSBA 3VMPA 4E3TA 3NQFA 3ARVA 3LUTA 4JNYA 1Q5MA 2YXOA 1C29A 5H6HA 1UD4A 2C7FA 4W5UA 4LPCA 4F40A 1TPH1 3TX9A 2OTDA 1L6FA 3KUMA 2OVLA 5HA7A 1WZKA 4AZHA 3QHMA 3GUWA 4IIHA 1WP6A 2V5LA 1H7RA 3OA3A 2NQZA 1WXYA 1IYXA 3DC0A 3LI1A 1JQXA 1QMLA 2IQTA 2OG9A 1WDDA 3TC6A 1XYFA 4MYXA 1H0GA 3ICJA 2WSRA 1MUMA 1WBJA 1W8SA 5BXSA 1UWTA 4R34A 3MHUA 2YL6A 3MHGA 1Z89A 2ATSA 4KGLA 2CNCA 4KIRA 2C1GA 4EXAA 5LA0A 1BTCA 3CWNA 4GLEA 3NZRA 3PANA 1QWKA 1V0LA 1OF6A 1I1XA 3NXFA 3M4HA 5DY3A 3T81A 4A21A 5ENLA 3SQMA 1TR9A 1GOKA 1R46A 1XJBA 2BVTA 2H3BA 5IDIA 2PDLA 5A2CA 4Y90A 1JF5A 4GYPC 4M80A 2DUXA 3LENA 4GZ7A 4ATLA 1XUZA 1ESWA 5AC8A 3DHUA 3AIBA 1JNEA 1WOAA 2WANA 3HMCA 4AD5A 4XX6A 2V5DA 4PBFA 3WEZA 1RSCA 4O54A 3VE9A 4UFIA 4UTKA 4H8HA 5AKQA 3T40A 4UR7A 1Z44A 3PJTA 4NI8A 4TU1A 2QIIA 1FDZA 4HP5A 4V1XA 2PDKA 3QW4B 4LQ1A 1XSJA 3M44A 1CGWA 4RE4A 1QI0A 3R2GA 4NRRA 1SJBA 2PLMA 3QOKA 2P0OA 1EGZA 1TTPA 3R0KA 1US0A 1IT7A 1X98A 3VMNA 4JTAA 3WMSA 3EBVA 4MB3A 2DZXA 3H6OA 2QMKA 1XYCA 4K6AA 3VKBA 3H2EA 3O6YX 3AHYA 5HDRA 1N2VA 5D03A 1KWGA 1RXOB 1CGUA 2J6VA 1V6XA 3ITLA 1LOSA 4PA8A 3FGCA 1GVOA 3N6JA 4M3PA 3KWXA 1XCXA 1LWHA 4U3CA 3M16A 1KGWA 1A5UA 3D3FA 3QFEA 5CGQA 4GIYA 1MI3A 4H01A 3BL3A 2O7QA 4P2VA 4P7QA 2FDMA 3CUZA 1M03A 3CLWA 1HKWA 1S3TC 5SWUA 2JFEX 3MUIA 2XTKA 2QDDA 2GSHA 3WLHA 2CW6A 2PDHA 3CGTA 3K46A 1JUKA 1H2JA 1V4YA 4KCVA 2WWDA 1JXKA 1UOKA 4FOKA 1P7TA 2VFIA 2ZXBA 4IWWA 4PBGA 3BW2A 3GHSA 4D6JA 4GCXA 3W3OA 3LMZA 3URBA 2Y24A 3L9CA 4ZQRA 4HU3A 1I0BA 3UG3A 5A6KA 4GGBA 4WUIA 4GFSA 4AVOA 1XICA 4EPEC 3HOJA 4MSSA 2YCEA 3ALGA 3N2MA 1MW2A 4XVDA 1NWRA 1XDMA 2OZTA 3WDRA 4HNVA 1MUWA 4XAPA 2Z1BA 1PIIA 2FB2A 3WIJA 3S0CA 4IQEA 2OSYA 5E9XA 2Y63A 2CWNA 3TN5A 3WQOA 2W67A 4O17A 2CCRA 1TV7A 5LIUX 4GJIA 1ENUA 5E0FA 4UTTA 1JCMP 5M3WA 1V3JA 2TAAA 3HU7A 1K8ZA 1XSKA 4DJFC 3WLJA 2PDWA 2C1IA 4HT3A 2G3NA 4Z1AA 4CEXC 2VX4A 1VJIA 1B0IA 3QHOA 2J78A 4PSPA 4DJEC 1X97A 2VVNA 2YDQA 1V77A 1Q3NA 5DBTA 2VC9A 4L61A 1AL7A 4A8NA 2XIMA 1R7OA 1LWJA 4B15A 2CPUA 1VF8A 2GWNA 5FEWA 1E6NA 4GYKA 3GVGA 1TPFA 1AG1O 4C6MA 3UWQA 1QXLA 1QRQA 4GPNA 5CC3A 2EKCA 1B31A 1QPKA 3NR0A 1OG0A 1K9EA 4C6FA 3H2AA 3U0HA 1B9ZA 1IZKA 1DYSA 5BMWA 4DJDD 3CUGA 3IJ8A 5BMXA 1FH9A 1IXNA 3HPZA 1J6PA 3AQUA 1A4MA 1HGYA 2YA2A 3AZSA 3QV8A 3LBCA 3UWUA 1GPFA 4NU7A 3HPSA 4PTWA 2L5HA 3HQ1A 3KL3A 4RPQA 4UQDA 2MUCA 4UB9A 2EPMX 2ZVRA 3U7BA 1ITCA 2CETA 1KM0A 3UT0A 1BPLB 1Q65A 2B4GA 3EDFA 4JTSA 1L8PA 3PBUA 2QZRA 3HG4A 2QAPA 1MQRA 5CLTA 4ADSA 4JTDA 4BK9A 3SB0A 2XH7A 3D46A 4NZ5A 4LUTA 1B54A 3M0YA 3PBMA 1FP8A 3TDFA 3OHIA 2GGJA 4REQB 4CCEA 3AIQA 4K8GA 2XYLA 1CGXA 4QHRA 3DXIA 3VIIA 1PZ1A 2VKZG 2OSWA 3CTTA 3L4VA 4GOAA 2ZE0A 2X05A 3A5FA 3BZGA 2BGNE 3RXZA 4JN7A 5D09A 4B5NA 1MZRA 3WQCA 4N2YA 4KEMA 3STFA 4AF0A 4LC8A 1YXCA 1OD8A 2F2HA 4PUDA 2CXEA 3QR1A 4ATDA 3H22A 3O7UA 2PD9A 1R85A 4DWDA 3W7LA 1L0PA 5K7JA 1PJ9A 3BWWA 4FXSA 1ZHAA 3JU2A 2QUTA 3FVDA 3MANA 3BICA 4NY2A 3BSGA 4TX9A 4XZBA 4PMUA 2PEVA 4TOQA 4Q7IA 3EOSA 1PEZA 4L56A 1I4NA 1V02E 4P61A 3SN4A 1ZFJA 2OEJA 3W4RA 4MY1A 2GDUA 3UWVA 2QGYA 2GDQA 5AFDA 3S2NA 1AH4A 3PZMA 2FVMA 2WM0A 1W1A1 4GVGA 3WH6A 1OFDA 1NDZA 1LYXA 2ZUWA 1MFUA 1UR9A 4IPLA 2PWGA 3VOHA 3G1XA 4QS5A 1W1YA 4DI9A 4JTCA 3UETA 3W2NA 3FVMA 3V4BA 4MWAE 3V7PA 2V5BA 4XB3A 1XCFA 3LTYA 1X6UA 2EAWA 5CJ5A 4JTUA 4KESA 4Y9AA 5FF4A 1L9WA 2FZBA 3GDLA 1Q85A 4C5ZA 2JKEA 3G18A 3VK5A 4LC6A 4ZMGA 4LNYA 4R88A 3CHEA 4HHLA 4LAMA 2VGFA 4Z0SA 3WDPP 1UUMA 4HSNA 4TO8A 5M17A 1IWAA 4OOZA 4DBDA 5E70A 5A8PA 3TJLA 3M6YA 4DM1A 2JBMA 1TWZA 3GU9A 3QR0A 3TUUA 2PDPA 4O8AA 3PSVA 1VQTA 4CU6A 3OGSA 2AKMA 3R7MA 3AZRA 4EXQA 1QWGA 4PUNA 1EJWC 4MNKA 1Q6DA 2PDFA 4ICMA 3P74A 4YTUA 4WIWA 1ADOA 4DYKA 2CLLA 3EWYA 4G6CA 1E4IA 4EPDC 2ZZ1A 3QYQA 3Q67A 2I56A 4Y9PA 2BB0A 1GW9A 1LBFA 5KSWA 1WDPA 2Y61A 3T2PA 3A21A 1PX3A 3V36A 1P0NA 3NPXA 1F73A 4O1FA 3G1AA 1R3SA 4KCUA 2IS7A 4ZTXA 4LB4A 1XHGA 1E4NA 2ZVIA 1HKVA 1K3UA 4RK8A 1FVPA 3V0SA 2V38A 2HVMA 1XIJA 4XKYB 1HZYA 1C93A 4JTFA 5C5YA 1Q6FA 4OUIA 4FA3A 5HK4A 2WLYA 3FDKA 1CXLA 4ZOAA 5C8BB 1Q8AA 2XN2A 2OQLA 4KWWA 2EBNA 1VKFA 2ZTKA 5A8OA 5G2IA 2GVLA 3SCPA 2FYMA 5LNSA 2BMBA 4PMXA 1PL9A 3CZGA 4LJ3A 5A95A 3WEOA 4DPQA 1GQLA 3DKLA 3BC9A 2ESCA 4IFKA 3ZT6A 5E0KA 4MWAB 3CWOX 2Z1XA 3A64A 3IJ7A 4GY7A 3VKDA 4DO6A 3RJYA 2Q02A 1FH7A 3O1NA 4E4UA 3SFKA 4UTIA 3EPMA 2YR1A 2HE5A 3VILA 1AVAA 1TVNA 2FGLA 1BKSA 2I5GA 3LB0A 3W1RA 4XKMA 5XIMA 3EDEA 5C55A 1QHZA 3QVQA 1M1BA 3URQA 4NZFA 3TTOA 1FFQA 4GUGA 3QGAC 4FNQA 5M03A 2XPKA 4UQAA 5LA2A 4A2SA 2DT1A 4GHRA 1NOFA 2WPGA 3CL7A 1NP0A 1OC6A 4YCPA 4DUXA 4QITA 1BD0A 3OHMB 1A0DA 3UJ2A 1JRBA 4A8LA 1TJ2A 4UNLA 3S2LA 1DJYA 5H1WA 3LSBA 3UXLA 5CBJA 4GIRA 5GJMA 1KM5A 3SRHA 5JBDA 1V3IA 2E8ZA 3WF4A 3TAOA 4UTWC 3OYXA 3NPWA 5FSEC 2AOSA 3SUTA 5D2TA 2NT1A 1BSLA 5U7SA 3P84A 1WA3A 3SRKA 2YYUA 3I10A 1KFBA 2PDBA 3ITCA 4GXWA 2XFRA 3R8HA 3CMFA 2HS8A 5J5RA 3QH2A 1RR2A 2NV2A 3MSGA 1K9DA 2BG5A 3KBMA 2J25A 1TV5A 3DZ1A 3W74A 1PYFA 3GUGA 3W1QA 3H7VA 4BF5A 1JCLA 1TUXA 2Z7GA 3ABRA 4G2DA 1EJUC 1SSGA 1XH1A 1XLGA 4LGXA 1PWLA 2QEZA 4CLMA 3MSRA 3VIHA 1XLMA 4XZIA 3VUSA 4E8GA 4O12A 1H7WA 1A4LA 3GXIA 2Z27A 4RNIA 3TJXA 5CKSA 4ASTA 1HJWA 4WKFA 1C3FA 2A6NA 1TB3A 1XW8A 3KBSA 3BLKA 1UUOA 2PPGA 4UFJA 4FX7A 2VEIA 2JF6A 1L8NA 4JQ4A 3TC7A 1DIDA 3WJXA 4Z2HA 4NX0A 4XQ6A 3MO7A 3AALA 3VIJA 3MT1A 3UXKA 4K8HA 2IXUA 4TV6A 3WQWA 2DZTA 4YHGA 2TPSA 4YPJA 1IT8A 4D8ZA 1KFEA 5GNZA 3AIUA 4CQBA 3W7NA 3ZO9A 3CU2A 2XH2A 1ELSA 1WXJA 3WG6A 2XDFA 4BKNA 3LA4A 4INFA 4LALA 2DVXA 3FV9A 2UY3A 1PPIA 2EPNA 3HO8A 1B90A 5FOOA 5D37A 3CH0A 1T96A 4ZA0A 2VFGA 4PRTA 1VP5A 4AIBA 1YADA 3HQOA 1Q2RA 3I6RA 2YW4A 3IS4A 2OX4A 2GVYA 1QNQA 3ZLHA 3B4YA 3W26A 1C8YA 1MYRA 3IRSA 4TIMA 3G8EA 1JDDA 4FXRA 3WL0A 4F0LA 3PFRA 2A21A 3ATYA 4TVDA 1E0TA 1N8WA 3DKJA 2OO6A 2QJMA 4L64A 1DJZA 4F4RA 1Z32X 4QLLA 2VOMA 1US2A 1CGTA 5I02A 5BW6A 1TIMA 3LHTA 1BHGA 2FJKA 4UZSA 1TPVA 2VEKA 3CPGA 5LHFA 3KHJA 3MO4A 3UWWA 3P5ZA 4GI9A 1FWSA 2DQWA 4GZEA 2D0HA 4IP5A 3F4DA 3HPAA 3LHUA 4QNEA 1T8XA 1XYMA 4F48A 1A0CA 1K8YA 1M5WA 2Z4GA 3WLNA 3AXIA 4PRWA 2WMKA 3MZNA 3C8NA 1OZQA 4MWAC 1F7BA 4OOUA 1VYPX 1PKMA 1MW0A 4YHEA 3RO6A 4JGDA 2JALA 4GJ1A 1TELA 3TW7A 2QCHA 4P7RA 3VD7A 4MB1A 4XWUA 4IMAA 4FMVA 1BVZA 3UY7A 3NQ8A 1OINA 2V3DA 3NURA 4PMVA 3VIOA 3EB3A 1IEWA 5HWJA 2NVDA 4NAEB 3QV6A 4Q6XA 3REQB 4G9PA 2WBGA 3S46A 2PMQA 5KMYA 3MI6A 1W5NA 3NOEA 2BVYA 3RPDA 4UTLA 4KEVA 2E6FA 1GJPA 1G94A 3SUWA 4P8XA 4QDPA 3EWDA 1DVJA 1R47A 3BCDA 4MOZA 3SQSA 4O1EA 5CZ0A 4DLFA 5I00A 1ZGDA 2WMJA 3PWGA 1TV8A 2KZHA 4LUSA 3HB9A 3S9ZA 3HV9A 3ARYA 1VBUA 3LQLA 3M41A 4F0MA 4RZ6A 5LYRA 1ZY9A 2WZEA 1REQA 2RUSA 3U48A 3GC5A 4R85A 4H19A 5ABEA 3MB9A 1TV4A 4TR9A 2ZXQA 3TYEA 4XK2A 4HCLA 4N9EA 3SGUA 1EUAA 2VZSA 4XTDA 3VNLA 4ZO7A 2Q8ZA 3CZKA 3S2MA 3C0SA 1XH2A 1OT1A 3UQNA 1XIFA 1EQCA 3IIXA 4WOZA 4AB4A 5T9BG 4Y9MA 3BQ6A 4O0KA 1RH9A 3QMTA 4FLRA 5CLWA 3TYUA 2BX7A 4IICA 4LWWA 2OEMA 4ZL1A 1K8XA 1YXDA 1F8IA 4HZ7A 4C6EA 1Z9AA 3RRXA 2H90A 2YL5A 1EQPA 4ZQMA 1I2OA 4C1LA 3JS3A 3NG3A 4UTJA 2NUXA 1UR8A 2J27A 5HWMA 3QW3A 1KR1A 4JYFA 4PMQA 3EEZA 1PSCA 2HE8A 4XO7A 1WBHA 1ITXA 5DQPA 1XISA 2PU0A 4B4FA 4HBKA 5CZSA 1CX9A 1TJ1A 3L0GA 4QJ1A 1W3JA 3KVLA 4MNLA 2B7NA 4TQTA 2YSWA 3RCNA 5HMEA 1DKWA 2OT1A 4MZYA 1H3GA 3DHPA 5CAHA 3N73A 3ANYA 4B9ZA 2EEXA 3WDJA 2VDGA 3H7RA 4K37A 2WHMA 2FGBA 3GHRA 1I2RA 4OKDA 3VNMA 1OK4A 3H70A 3B05A 1W9BM 2OYMA 3B97A 1FBAA 2J4GA 4DQWA 1S2AA 3LPFA 3PF3A 4N02A 3AUOA 4GISA 4D1JA 4YU1A 3M0IA 1KKRA 5EA9A 2CZ5A 2Z1WA 2A85A 2DSVA 3CUIA 1JRCA 3LGGA 3VDHA 4QLJA 1GZGA 1ZZMA 3FEMA 1GZJA 3ATZA 5D33A 4LAOA 2CZDA 2WMIB 4RUBA 5T9CE 1C90A 4B5SA 1ZSXA 2YCLA 3KTXA 4C1NA 2BGSA 1IXPA 5BRPA 4OGZA 3B0YA 4IISA 4LYRA 2Z25A 1B4EA 3LBOA 5DCDA 3MMDA 5GVJA 2QR6A 3N15A 1VFLA 1ZB5A 4KERA 1Q45A 4GYPA 5I24A 4WY0F 4IQDA 3S5SA 4DVOA 2G96A 3O16A 3S83A 1CXKA 2PE4A 3F03K 4GVIA 4O14A 2PAJA 2FTWA 3KVJA 1QPNA 3NIYA 2DZPA 4CN1A 1F9CA 1UQZA 1Q6QA 3N25A 4RCXA 2PS2A 2WCSA 1YE4A 4L4LA 4V33A 4UNKA 1DBTA 3VX1A 1L2QA 3SCTA 2PCEA 3TK7A 3TQ0A 1IR1A 3R25A 4Y6GA 3TR9A 3EOUA 4FALA 3TKFA 3FJ4A 3CEPA 1CBGA 4NJKA 2ISFA 4FLSA 4D8AA 4LY8A 2NXIA 1HTIA 2XM2A 2WVVB 5K9XA 1Q6CA 5EMLA 1TA3A 1A5CA 3WLQA 1CCWB 1OC5A 3RYSA 1X1ZA 3P8JA 4LV9A 1SO5A 5REQA 4KQNA 3QGVA 4GQQA 4I90A 1UP3A 4XO6A 3U2CA 1PKYA 2VFDA 5I77A 4MGGA 2P0IA 2NXGA 2OLAA 2CFFA 2QPUA 4S3KA 4HYVA 1LLZA 1E70M 4GABA 2G37A 2A3HA 3HM7A 3FJ6A 1OFOA 1JZ6A 2Y4SA 3F2BA 2ZUVA 3CEUA 4IJCA 3P61A 2DUAA 3K8KA 3VKKA 3L5AA 5BU9A 1KRBC 2WNZA 1SO6A 1RCOB 3MW7A 5F4WA 1RHCA 3W1LA 4PFHA 4A35A 2VCCA 4W4QA 3V3WA 2VD9A 1LWIA 3I6EA 1P6BA 4S39A 3APYA 1O1HA 2DW6A 4TX6A 1IWBA 2Z6JA 1V6TA 3STEA 1HF6A 4X0NA 3B8IA 5I3DA 3TSDA 5CCZA 1UMLA 1Y65A 4NILA 3TH6A 3CB8A 1ZJIA 4W5ZA 3W1PA 3EA1A 1LLWA 1F4AA 5DMYA 3FJNA 3ID7A 4GQBA 2J8FA 1KNWA 3LCGA 3VDAA 5XIAA 3MHFA 4Q7NA 4JFSA 4EPKA 1R3QA 2C6QA 2ZC8A 2V2DA 4FOUA 1F2JA 3DHFA 2V2HA 3UNTA 1SQ7A 3LHVA 1K6WA 1XUUA 1E55A 4PMNA 5C6MA 1CDGA 2VJXA 3AXXA 4L5ZA 9CGTA 1DJNA 4X61A 1BG9A 1XRVA 4MFEA 5CC6A 1KTNA 2X30A 3THUA 4DJFA 5HNNA 1W1VA 3TNOA 3GTFA 2YCKX 1DHKA 1EJ7L 4XZMX 4GJJA 4DJEA 3W01A 4IT1A 5G4EA 2EPOA 1XR2A 5JBEA 3LRLA 2BVDA 2RKXA 2PLKA 3JW7A 3EMZA 3T8QA 4H6RA 5C70A 4BFAA 4PH6A 1UD6A 1UJPA 1OWQA 2EG6A 5EFFA 1QNRA 5AHMA 1XYLA 4R27A 8XIAA 4ERGA 4LBSA 3T9PA 3A4AA 1B3OA 1EPXA 4BCEA 2OGYA 2VT0A 4AXNA 3NQAA 2OODA 1MW3A 2VM8A 1VBHA 4HTYA 5DLCA 3WDQA 4CQDA 3B9DA 3FEQA 3BJFA 1DQWA 1HX0A 2WK2A 1J0HA 3QF0A 4DI8A 2ZX6A 1Q6EA 1UC5A 1KQYA 3W7JA 1UKQA 3N9RA 3S3GA 1J0IA 1YIXA 1E1FA 3SIMA 3ZM8A 1AL8A 2QMJA 3LZ5A 2CHRA 1XLIA 1I2QA 4RDZA 5LSMA 1XLLA 4G7EB 4AY7A 3LBMA 4MJ4A 4Z2IA 2YKKA 1D7FA 2AQWA 2CBJA 4JQ1A 4Z0JA 4BI6A 1DL3A 3AYVA 4M6UA 4MHBA 1JNDA 2J9ZA 1FWBC 3ITGA 4U2YA 2Y1HA 3T55A 1GUVA 1O5KA 5KZ6A 3E12A 3HGRA 4I9MA 3C5QA 4IUGA 4O50A 1TFVA 5GQBA 3UWZA 4KRTA 4XZ9A 3UZXA 1KB3A 2V67A 2PRHA 4ZO6A 5HNUA 4O52A 3GG7A 3G0SA 3R89A 2XIOA 4DUWA 4HA3A 5D9OA 4ZR8A 2YX0A 4M29A 4QCEA 1UH2A 4M7TA 4MB4A 3KBVA 3T2QA 3E0IA 5AC4A 4HGXA 4MZ8A 3CC1A 2WHLA 4S1FA 3GNDA 4GBUA 2C1HA 3W7KA 7CGTA 5MHBA 4DEFA 3WK3A 2C0AA 2E9MA 1LUCB 4H9YA 3GDBA 1OT2A 2VX7A 3OZMA 3BE7A 4J3UA 3MI3A 2ZUNA 4EAYA 2VHLA 3A4XA 2DV0A 1UUQA 3LRMA 5TNVA 3BAIA 2GSJA 5BOEA 3WMCA 1HJUA 2ZA2A 1OCQA 2HK1A 3HZ3A 5KITA 1FKXA 3H23A 4HN8A 1V6WA 4G1KA 3DUGA 2VEPA 1X1NA 3IVSA 3GDKA 4WJEA 3T09A 1EX1A 1H5VA 3RR4A 2G41A 1E73M 1VFUA 2PF8A 5E93A 2DDXA 3KDNA 1T0OA 3WMBA 3GTNA 4QG6A 1GZ1A 1OZMA 1SMDA 3MP4A 1EIXA 3M9YA 3EX6A 3ZT5A 5JH1A 1QW7A 2YLAA 5A2BA 1VCVA 3FHAA 1D2KA 3W7OA 1OGBA 4GVHA 3K4AA 4QNWA 4FLQA 2WJZA 1I2NA 1GGOA 2XH0A 2YXXA 3H26A 3NZ1A 4US5A 1LL4A 4B90A 1V3HA 3VFCA 1XLCA 4QX4A 4FF5A 1NAL1 3GZAA 1AQFA 3E3HA 4FP1A 2JE8A 4ORMA 4ZEPA 1VH7A 1ITUA 1WYIA 3GBEA 4IPIA 2J13A 2Z0IA 4LAUA 3R8GA 3BLOA 3W6YA 2PU1A 1ME7A 3HQNA 5D04C 3LLXA 2ANUA 2ZCGA 3AUJA 2ACRA 5HWNA 4EIVA 3W1TA 1YBQB 4ACZB 4J9JA 3N3TA 2YZRA 3KCLA 2XIIA 2Y7DA 1RJRA 1HN1A 2CBVA 1XXXA 4YS1A 4C90A 3NO3A 2QF8A 2DSKA 3SN0A 2WMGA 3CAWA 3WK0A 4KBXA 1KKOA 4ZQOA 1T7LA 2WAGA 1E43A 4Y8EA 3AYRA 1MVYA 2E67A 2FQIA 3LTSA 1U5HA 4IQLA 4V27A 3MUZ1 2Z2BA 4J3TA 1XDJA 2BVWA 2OU4A 3CQJA 3UYCA 5AY7A 2YL8A 3FLUA 1E5JA 5C2GA 5BNKA 4ROQA 2QHAA 2CKRA 5BXTA 1W32A 3PZTA 2G5WA 3BUVA 1KFLA 3CHFA 2QCDB 2X09A 3MWCA 3FX4A 3TQVA 4BEUA 1OABA 2IPGA 3K1DA 3NAVA 2ZZ5A 3ABQA 2WHJA 1UD2A 2E5DA 3NPVA 1J2WA 4FX8A 3FN9A 1OIMA 1Q66A 2AKZA 2PLJA 2QUNA 3GHUA 2ALDA 3ES7A 3CO4A 4X2PA 3CV2A 4GD0A 4DF0A 4ICNA 2GL5A 3B8UA 3KX6A 3JR2A 2A7NA 3W29A 5C9XA 2NWSA 1GKPA 2GOUA 4U33A 3WLMA 4DXXA 1BYCA 2P8BA 4JKKA 5FAJA 3LCIA 3NL6A 1HGWA 3AAMA 3WSUA 1IV8A 1M01A 3WNMA 3EXSA 4ZE4A 2DZWA 3L4XA 3W27A 2ZZ6A 3ALFA 4QEHA 1KTCA 1K02A 1O94A 1P6WA 3SFWA 3S6OA 2VRQA 1J96A 1B3VA 5FJRA 1JPIA 1EJXC 3W1UA 1H5YA 4BWLC 3QZAA 4DY1A 1A3XA 4LVBA 1JUBA 3OVRA 4W93A 3KS5A 1BVWA 3L4WA 3I65A 4QROA 1IEXA 3W85A 3WFAA 4IXHA 1O12A 1K6AA 4UTWA 4AX6A 2TYSA 4XIMA 5CBBA 1CB7B 4I9TA 4MJ2A 3ZVHA 3KBWA 2HV5A 3TV8A 4B92A 1FA2A 2AAAA 3GIQA 3W37A 3ONCA 4J40A 4F0KA 4CNSA 2ZUSA 3LN3A 4EWJA 2V3GA 3H4XA 4Q4PA 2UY5A 1OFAA 3WNNA 4E38A 4E8CA 1DWFM 1TQXA 4QAIA 2WCAA 5CBIA 3GE7A 1LQAA 2ISSA 3SUSA 1X7IA 2GQ9A 2XN1A 3WH8A 2PZNA 4LXFA 4NZ3A 3GH5A 5IFPA 1H60A 2OPJA 5HMDA 4UOJA 4DO4A 2J62A 1WZMA 6TIMA 3SADA 1UR0A 1JAEA 3JVAA 2CXGA 1CT5A 1E56A 1V08A 3AMDA 2WV8A 1XC4A 4JZ5A 3GLCA 4IXXA 2INEA 1G4EA 3K13A 4PR4A 2G3FA 1F76A 3SDOA 3EEGA 4YYCA 1YXYA 4QS6A 2YLLA 1PBGA 1A80A 4ML9A 3L0NA 1JDCA 1WDSA 3M5YA 4ZSUA 2C3ZA 3VZYA 4LY4A 3WELA 3A3WA 4PB3A 4QJ3B 1ISVA 3WUFA 3E1F1 5E9AA 3TYBA 3G6LA 4HD5A 3TWBA 2JQXA 2PDIA 4ONVA 4UMBA 3WKZA 4O16A 1IEQA 4O15A 5ECUA 5DMNA 3TLQA 3V18A 3N3MA 1ONEA 2GLKA 2EPLX 2PP0A 3G24A 4PMOA 3SRDA 1EA9C 3DGRA 4JTRA 4S3JA 2X1UA 3MP5A 5EL1A 3B8SA 1Q13A 5AZ1A 1RD5A 4XKYA 4CCDA 5DCBA 3CYJA 1DE5A 1V02A 3W7PA 1S1PA 1GCYA 3EDJA 3H54A 1SZGA 3OB8A 1O5RA 2YA1A 2IQ0A 3ARZA 3MUXA 3B8WA 1JD7A 3WLRA 1G9HA 1FQ0A 3NQDA 4DNMA 3E02A 3VGGA 2VMFA 4NXSA 1I75A 3IEBA 1JDFA 1QI5A 1W6TA 1J5SA 1SJAA 4K2SA 3P60A 5A6BD 2CU0A 2D22A 4H8VA 1T8QA 1FHDA 3AJ7A 1YNQA 1QOXA 1WPCA 3EOLA 5C9UA 4MWAA 1CYGA 5CPOA 1VIZA 4HB7A 4BI5A 2CZEA 1HJQA 3WNLA 4KRUA 5LGXA 3ISIX 1JPMA 2FKPA 4GNJA 3E2QA 1JVNA 4AVNA 1E9LA 5AZ0A 3A12A 2Z24A 1OCJA 3DG7A 1LF1A 1H7XA 3BLFA 2ZZ2A 2MNRA 4QFUA 3GU2A 2DZAA 3M5VA 1V3LA 1RQBA 1LG2A 2WKJA 3MYOA 4LU0A 1WAUA 3FAXA 4AEFA 1DJXA 4GG9A 3QY7A 1KCLA 1QFEA 3Q37A 1O6IA 4PUJA 4RV3A 2WJDA 3GX9A 5DF0A 4TMBA 5HQEA 3CQKA 1UASA 1YPIA 2GDVA 5D9MA 4UQ9A 1FCUA 4GCAA 4EK7A 4LEQA 1EKOA 3VOJA 1XG4A 1PTGA 2W66A 2HXTA 3TFCA 1LP6A 1IXOA 2E5CA 1NDYA 2PRLA 3L4ZA 2DW7A 2ACSA 2JGYA 1SUXA 1LCOA 1V0MA 3AMGA 4N7QA 5I78A 3EWWA 3T1GA 1N8FA 2CIPA 3LDVA 4AD2A 2EQDA 3GW0A 5LXXA 3W82A 1H4PA 1FHVA 4JS3A 1W