2DJXA

Crystal structure of native trypanosoma cruzi dihydroorotate dehydrogenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCCTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate Dehydrogenase
publication title Crystal structure of native Trypanosoma cruzi dihydroorotate dehydrogenase
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2djxA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2djxA01
1AK5A 1W5PA 3L5MA 1IXOA 4LVDA 3MMTA 4HHPA 1B9BA 2Z1BA 5KINA 3RMJA 3NQEA 3M44A 1JRCA 3L21A 1TPC1 4FNTA 1D3GA 3UXAA 1JCJA 1GWJA 5BW6A 4FO4A 2C19A 3QF0A 2FTPA 1DL3A 1EIXA 2J9XA 2Q8ZA 4JICA 2FPTA 2ZZ5A 4GWEA 1ME9A 2CLKA 3O07A 4O13A 2TMDA 5FF0A 2AAMA 1TSIA 1VJIA 3LERA 1W56A 3B4UA 1W3IA 3EWXA 3RFAA 1LLWA 1ICPA 2QCHA 2WSQA 1R2SA 4O8RA 2NZLA 3BLFA 1RD5A 2DZWA 3BO9A 4UTKA 3EXSA 1L2UA 1FWTA 2YDAA 4XTDA 5EYWA 4HKPA 3QQ0A 1DQXA 4Z1BA 3NPUA 3C52A 1T0OA 4AWUA 5AHIA 2ZA1A 2UV8G 2ISWA 3FKRA 2OT0A 3H54A 2QUTA 3M43A 4UTWA 4FX8A 1FDJA 4PCFA 4HNUA 3PVFA 3AO0A 3NQMA 4AEOA 1WOAA 5HNRA 1SFJA 1B4EA 1SO4A 2C1HA 3NQAA 4HNNA 1P5BA 4RKAA 5U4NA 3MUXA 4QM1A 1EUNA 3MJYA 4GNJA 4GUIA 5D32A 3TAOA 3PUEA 1QNVA 3TUUA 1WXJA 1FXPA 4GJ1A 2CW6A 5H2ZA 3G1VA 3W74A 1EUAA 2DZVA 3BGJA 2DP3A 3KX6A 3HG2A 1UJPA 4QNEA 4JR5A 3KHJA 1J4EA 1UB3A 3TC6A 4JTLA 3W2LA 1TJPA 2ATSA 1Q6LA 1SZFA 4B5NA 1SUXA 1M6JA 4J9JA 5AFDA 4TU1A 1C29A 3VCRA 2ISVA 3OHIA 4FX7A 4BI5A 1SZNA 4NT0A 3GXTA 1KFLA 1HTIA 2GQ8A 1H7PA 4RJEA 4N6EA 1FQ0A 4WXZA 1GVSA 3ABOA 3O15A 3YPIA 4EF9A 1M7PA 5AHNA 2VENA 3HOJA 4RV8A 5D03A 1QMLA 3FKKA 1DBTA 3C0JA 3LB0A 1LOQA 5D2VA 5FF3A 2ZZ7A 4Y90A 1CW2A 1H1YA 1TPVA 4LNYA 2VEKA 1JUBA 1TO3A 4WY0F 5DY3A 3DFOA 2CZEA 3C2EA 3IIOA 3W07A 1WAUA 1JCNA 4RZ6A 2Y7DA 1VHCA 3O6DA 4NJJA 2Z2UA 4HIBA 5EKYA 4O14A 1W3TA 3R5EA 4M7TA 4I7VA 2V30A 3QMSA 4RLIA 1Q6RA 4YLWA 3I68A 1D3HA 5E93A 3B03A 3EWBX 2ZBTA 4YMZA 3KOFA 4OE7A 3LCLA 4NZFA 4OV9A 4LU0A 3W86A 4TR9A 2RDUA 1TPB1 1SO6A 3S1VA 4LV9A 4BF9A 4NJIA 4WOQA 3W1UA 2V81A 3HGJA 4WUIA 4FXRA 2Z6JA 4OQVA 3MO7A 4HNVA 3TQ0A 1SQ7A 1GVOA 4HSOA 5K3VA 4NJGA 3C2FA 3N19B 3SIZA 2A85A 2HTMA 3IRDA 4LC6A 1AW1A 3NQDA 2VFGA 4IMEA 1VGAA 3USBA 3W23A 5K2ZA 3L0GA 4N02A 1F73A 2Y7GA 4LVBA 1FY6A 3UNDA 3UY7A 1O5KA 5FF7A 4KWWA 1YXDA 1MSSA 3DHFA 3RLVA 4FNSA 4RR4A 1CX9A 4UCGA 4WJEA 2ZDRA 1RQEA 4O1CA 2NXGA 4IQLA 1LP6A 2NWSA 4PODA 1MZHA 2ZRXA 1NF7A 5ABTA 2Y70A 3M1ZA 2A6NA 3LRMA 3CWNA 2C3ZA 4O1BA 3BG3A 4RZ4A 1Q6OA 2PRLA 1K8XA 3TSMA 4K8EA 3W2KA 3QW4B 1RR2A 2VFHA 4TO8A 1ZCOA 2ZRZA 3QW3A 2R14A 2P1FA 2V2DA 1ZNNA 2QJHA 1DKWA 3LCIA 1WYIA 3W70A 3MP5A 4O0KA 3KFTA 3NM3A 1AMKA 1P1XA 3BW3A 2GUUA 3W1RA 3PUOA 3Q94A 1SZEA 3HF3A 1YPIA 2H3DA 3W2JA 3W22A 3SSJA 1EP2A 4GXMA 2QAPA 5BNKA 4C1KA 1OFAA 3HMJG 3ABRA 4LVFA 2CLOA 3QJAA 4NJHA 4PL2A 2WNZA 1F74A 4PA8A 4MFEA 5D2TA 3A22A 2VOMA 2TRSA 2YYTA 3PULA 3TW6A 1OF8A 7TIMA 3O16A 2JK2A 5AC6A 5IM51 3CTLA 3LI0A 3DI0A 2O7QA 4GE8A 4N2YA 1OFDA 2XFWA 2TYSA 1QPRA 1PS9A 4FF7A 4ZL1A 1LDCA 3NA8A 1A5AA 5HWJA 5K4XA 4JX4A 3W85A 3A9IA 4DEFA 3ZWTA 3EXTA 1TRDA 1KA9F 1KM4A 4NX0A 1QAPA 2ZCGA 4CLMA 3W1QA 4LWWA 3P74A 2ZA2A 1KFKA 4JS3A 3R2GA 2CLEA 3B0UX 3BGGA 3UWVA 3EKLA 1GYNA 2VFDA 1TV5A 1TTJA 2CLMA 4K38A 3OIXA 1N55A 3N9SA 2AGKA 1V7YA 3S0CA 4JDBA 1H1ZA 2YXGA 1H62A 4GFSA 3NL5A 1JCXA 3LI1A 5KZDA 3G3MA 3S9YA 1YPFA 1L9WA 1AW5A 5FESA 1AL7A 1NAL1 1HL2A 1TREA 4Q32A 3NNTA 4TMBA 4UFMA 5K9XA 1B4KA 1RQHA 2B7QA 3BVJA 2DZSA 2HS8A 3OG3A 5HR7A 3M7WA 3W7LA 3EX3A 1YDNA 4E0CA 1H63A 4FNUA 3GXPA 3LBCA 2H6RA 1I4NA 1KLYA 2YW4A 3RF9A 2A7PA 2R91A 3MI6A 2EKCA 3ZFHA 1G7UA 1YTKA 3TSBA 3M41A 3GAYA 4Y96A 1IXNA 3MHUA 2GOUA 1ZHAA 4UXDA 3N73A 3N2MA 4N4QA 1GG1A 3KAOA 1H51A 5I3IA 4S1FA 3G8EA 4NNCA 2A1YA 2YYUA 2RH9A 1CI1A 1M7OA 1XBZA 1I2PA 1VCGA 3UQNA 2QCLA 4CNOA 5I3GA 3NYZA 3MWAA 4Z08A 3S6DA 1OX6A 5HMSA 1THFD 1TJRA 5HUPA 1BEUA 2E1DA 1U83A 3IVSA 3UY8A 1F76A 1XDMA 5K9DA 1EA0A 1RPXA 3BLEA 1EWDA 2B0MA 1MEHA 4DF1A 3UD6A 3EWUA 4DBEA 2O7SA 2R94A 1E51A 3ZWSA 4Q33A 4UTTC 3QFEA 3TFCA 3NQVA 1NEYA 5HULA 3EWWA 3KRUA 5HQEA 1O5XA 1ZJIA 3TQVA 1OVDA 1ZAIA 2EAWA 3W7JA 5LNRA 1YADA 1OX4B 3BARA 1F6PA 2WNQA 3N14A 3G18A 3O06A 2CZ5A 1HO4A 1QPQA 3QEZA 1IF2A 1YTDA 4RZ5A 1AW2A 3W7HA 1VYSX 1OK4A 3TMLA 4N6FA 1B3OA 3CB8A 1FXQA 3M47A 1RVGA 2Y7FA 3FOKA 3S1WA 5HWMA 1G4TA 3SGUA 1TPDA 3GDKA 2V82A 3UPWA 3W1PA 2OZ0A 3W2MA 2ZRUA 2OX1A 1W31A 3MYPA 4XBSA 2NX1A 2X30A 3CT7A 1AG1O 2DJLA 3W88A 4FIRA 3PBUA 3T40A 1TB3A 3ELFA 3F1QA 3G1AA 3P7YA 4Q4KA 5F2MA 1T96A 4O50A 3P67A 2WV8A 3IGXA 2QCGA 1OJXA 4UMCA 1L6SA 3MHGA 3KVLA 2WO5A 2W79A 4UTTA 1H60A 2NXHA 5AYZA 3Q2DA 4A29A 1ONRA 1OYBA 3WJSA 5BRBA 5C54A 3NL2A 1KM5A 1UCWA 4AWSA 1EP1A 3HGSA 4O15A 5LZLA 1H7WA 1JULA 3EX1A 5CZSA 3BLIA 1VPXA 1VLIA 4JTGA 5CPNA 4JTEA 1XBYA 5F2IA 2BZNA 4O53A 3THAA 4DQWA 3DFSA 4N9DA 3O1NA 5CPMA 2ZQ0A 5CZ0A 1O95A 3H53A 3M0ZA 2ZTKA 4GUHA 1R30A 3LX9A 1RZMA 3MHFA 2YR1A 4UTWC 3SGZA 2Y85A 4NNAA 1V5XA 3G22A 3JS3A 4UC5A 3DI1A 2NX9A 2CLLA 3TW7A 2E6DA 1QCWA 3STFA 4E38A 3GVGA 5AC7A 3IGSA 3B0VC 2I9EA 1SZGA 4Y8FA 4E2BA 2DZXA 3W7KA 4AMAA 2JKAA 1A53A 3WFAA 3GK0A 3W7NA 3AJXA 4DF0A 1LYXA 3SR7A 2CFFA 3MP3A 4N9EA 4LC8A 5AHLA 3M6YA 4DPPA 1TIMA 4JD4A 3NQCA 3G3DA 3GDTA 1FCVA 4FIQA 3P61A 3CU2A 4ZQPA 3CQ0A 4Z1CA 3UWZA 1DORA 2PURA 1GJPA 2XN1A 4A2SA 3QM3A 1YXYA 4RCXA 4CQ8A 3EB2A 4OV4A 3PUDA 4I7WA 4E2DA 3EX2A 3EX6A 4WOZA 5J5DA 1KFEA 4X9SA 2E5DA 1ME7A 2BSLA 4LOCA 3EWZA 3S42A 2A21A 1WQ5A 2FLIA 4Z0JA 3LCGA 2FFCA 2QDHA 2ZRYA 1QOPA 1IIHA 4HSNA 2GVLA 1F6KA 2Z0IA 4AH7A 3W1NA 1SO3A 4NUWA 1H5YA 3GR7A 3NDOA 4M5PA 2BXVA 4JIQA 1VLWA 1OX5A 3PSWA 4PH6A 4LT9A 1W5MA 4UFIA 4QNWA 3HG3A 2X2GA 1GVFA 1T8XA 3VE7A 3A21A 1X6UA 3MI3A 2JGQA 4O18A 3M9YA 4Z1AA 3DFNA 3BW4A 3OEXA 3GAKA 3PM6A 4NX5A 1OF6A 3DENA 1JUEA 3STGA 5E1QA 1LOLA 4OGZA 1MEWA 2GPTA 2GVJA 5K4ZA 5CSSA 5D04C 3T7VA 3C6CA 3UWQA 4O1DA 2ZZ4A 1K8YA 2QEZA 4GRSA 3HGOA 3V75A 4YCPA 5EPDA 1P0KA 1PVNA 3T55A 2FPYA 3SECA 3TXVA 2V8ZA 3LBMA 5FEXA 4BWLA 2C14A 1ICSA 4RX0A 5F1UA 1QWGA 3L9CA 3P80A 3G8RA 3W7IA 4O4WA 4GBUA 1GQNA 4AXKA 4D2JA 4PEKA 3INPA 3TH6A 3O6YX 3I6RA 5SWUA 1PL9A 2V0TA 4PL1A 3L5AA 5D30A 1UUMA 1O60A 4MPQA 2PE4A 5DCEA 2D73A 4LS1A 4O28A 5LNWA 3QC3A 3Q37A 4HPXA 2VELA 3NZ1A 3TKFA 1ZALA 3DXIA 1ML1A 4IOTA 3OBKA 3HG4A 4IX2A 1Q3NA 3IVUA 3A23A 4EVZA 3FJ6A 4ADUA 1QDSA 1H7RA 4AF0B 5G1YA 5LSMA 4NZJA 3VI2A 4NJKA 5EL1A 3JR2A 5CG7A 3TMQA 3W7MA 4BK9A 4TX9A 4JTKA 5FI8A 3S8HA 3QPYA 4IPIA 1UASA 3ZR4A 1G4SA 1JVNA 2ZZ6A 2KZHA 3C4UA 2C15A 3NO5A 1K8ZA 4YCOA 5DBUA 4L4LA 4LRTA 3W73A 1FWWA 2ATMA 3WK1A 4H6KA 4S2CA 4CNNA 2WQPA 4UUIA 1P0NA 4QIUA 1SPQA 1KM6A 3FEMA 4ML9A 1QOQA 1K3UA 4O57A 3E49A 1QPOA 3CWOX 3W7DA 1JCYA 1LM1A 5LNSA 1FDZA 4N4PA 1VS1A 1W5QA 1Z41A 2F7FA 4A3UA 1J5TA 4AB4A 1MXSA 3HIJA 4WD0A 1FCBA 4LS2A 4UTJA 2QDGA 3GDMA 2NX3A 3GYEA 1XCFA 3NGJA 3LTSA 5KZMA 2I1OA 2EF9A 4ADSA 1A5CA 4OHQA 1TV8A 2E09A 1X1ZA 3D0CA 4ORIA 3C2RA 3CPRA 3TQKA 2QCCA 3EEGA 4XBKA 1Z48A 1L6WA 2V5LA 5FF4A 1KM1A 4CCDA 3UZ5A 1IGSA 2WKJA 3PY2A 2QR6A 1KTNA 3B06A 2QF7A 3E9AA 2OT1A 3Q58A 4JEQA 1JQXA 8TIMA 4IWWA 1O4UA 3MBDA 3GX9A 4JTSA 4JX5A 1IXQA 2X1TA 3LOTA 5KZEA 2QCMA 1KFJA 4RXGA 5H91A 4MLJA 4YXGA 3P62A 1KM0A 4MY9A 3V1PA 4O4VA 1KBIA 3VFLA 3OVRA 1F7BA 4YWIA 4IUOA 1PV8A 4AVFA 2TSYA 1PIIA 3F4NA 4GUJA 2YFOA 4FNPA 1VQTA 1A5SA 5DBTA 1PCKA 2BX7A 4EIVA 2GJNA 3HQ1A 5D2YA 5G5IA 1PE1A 4JTUA 3I7QA 3TE9A 1GYLA 3GB6A 1AL8A 3O05A 3LCHA 3MP4A 2YSWA 2RHGA 2B7PA 1KFBA 3W2UA 5EBUA 1TQXA 2WSRA 2AQWA 4NQ1A 4NVTA 1Q45A 1BTMA 2C6QA 2YFNA 4O52A 1VCFA 1O94A 5HUOA 5CGQA 2DZUA 4AAJA 5F4WA 4OT7A 2Q3OA 3P8JA 2X16A 1SO5A 3N9RA 2OJPA 4UR7A 1NFBA 3W76A 5D02A 2YCEA 2E5BA 5T26A 3CHVA 1FBAA 3TC7A 1TCDA 1C9DA 2W6RA 1D9EA 3FIGA 1SFLA 4K36A 5F4XA 1Z44A 3WJYA 4WY0B 4CCCA 2A0NA 3W6YA 3HPSA 5F2LA 1VYRA 1A50A 2NUWA 1DQWA 3M16A 4MJZA 1VC4A 4UFHA 4FNRA 3P82A 4JGDA 1OYCA 5CZTA 2W0UA 5L9FA 4AF0A 2QCDB 5AHFA 5G4WA 3VNDA 2NUXA 1ZFJA 3NPWA 2BLEA 3B8DA 2YPIA 2CLIA 2B7NA 2CZFA 3W71A 2B7OA 4QAIA 1X8FA 4R7JA 3HB9A 3HG5A 3W83A 2BWGA 4UR8A 4O1AA 1FDYA 3F03K 3LHYA 1JR1A 1GEQA 3ABSA 1GTHA 3TJLA 2Y61A 1TMHA 4P2VA 1FX6A 1DV7A 3GXNA 3I65A 5A5WA 4A21A 2J9YA 3LXBA 1ALDA 4M6VA 1OFEA 1T99A 1F5ZA 1FCUA 3NR0A 3DFQA 1W37A 3LM7A 3RK8A 5D37A 1TPEA 1WBJA 3IIPA 1K03A 3T4CA 3R89A 3S5NA 3L5LA 4GC4A 1LCOA 3G1YA 3FYPA 4FEZA 2V2HA 2Z6IA 3NPVA 2TPSA 4QSHA 1I2QA 4XUGA 3MYOA 4QITA 1QFEA 1S5VA 3C61A 3PSVA 5TBOA 5DCDA 3TX9A 3HPZA 3K30A 4JIPA 3UXDA 3R8RA 4R33A 2ZRVA 3ZS4A 3RLUA 3GKFA 2J88A 2G95A 2IQTA 5AHMA 1A5BA 2J9ZA 4O19A 4KFPA 3NL6A 4NXSA 3U6WA 4AHPA 5DXYA 2NV1A 4GUGA 2V5BA 3WJWA 4ZMGA 1S5WA 3LTPA 3NQ6A 2EPHA 3TROA 3LXCA 2YZRA 1F05A 4ZQCA 4ZVJA 1B57A 5G2HA 4O0ZA 3LHVA 5K9CA 4GUFA 4DBDA 4MFDA 3GNDA 3E12A 4FX6M 2P0OA 3LHZA 1H7OA 1OHLA 1Q6QA 1YDOA 3W87A 3U8GA 3LRLA 1KW1A 4NXKA 2YW3A 4FB7A 1QR7A 4DPQA 1XUUA 2DU2A 3W7EA 3B05A 5KTLA 4JTFA 1LZOA 1R2RA 1FWSA 2VEPA 2XN0A 5FEWA 2LLEA 3N34A 3L65A 1TTQA 3LCWA 1LRNA 3ATZA 4OU1A 1XXXA 1OYAA 4ADTA 4U28A 4UMBA 1G7VA 1G69A 4LTSA 3LHUA 1Z42A 5CPLA 2X1SA 4JYDA 2ALDA 1OABA 1H7NA 5AYXA 4CQ9A 3LHTA 2QJIA 3N2XA 4P61A 4K8HA 5HWNA 2E6YA 5IBXC 4A22A 1VYPX 4JTJA 4K37A 4JY8A 1KM3A 5HR6A 1LLZA 1XC4A 3FYOA 3M5YA 3E96A 3NVTA 1JCLA 4WY0A 2GQAA 5LHEA 1J2WA 1XKYA 2J6XA 4CNPA 3G1FA 4JTHA 4Y6GA 1TPH1 4MY1A 3HPXA 2FJKA 4ZQMA 5L6UA 1TYGA 1TPUA 1KV5A 2QCDA 3B0PA 1G4PA 3KVJA 1ZY9A 3LV5A 3W84A 1X7FA 3LV6A 2FPVA 3W1XA 5MHBA 1EWEA 3W7CA 3EXRA 1K7EA 3NL3A 1XDLA 4A2RA 2NUYA 4MYAA 4IPJA 4NNBA 3DFPA 1GOXA 1W54A 2GQ9A 4TIMA 4DO5A 3W2NA 3SFKA 3PBWA 3FJLA 2FIQA 3A24A 2YGYA 3TU9A 3TR2A 5D2XA 4M6QA 5HJLA 1FWRA 3W3OA 4FNQA 2ZZ3A 3ANYA 5IBXA 5CPOA 1I45A 4DO4A 3PAJA 2G96A 3M5XA 2QUVA 4UTLA 3GNNA 3P60A 4KWVA 2P10A 4XKYB 1OFBA 2VEMA 2FQIA 3C2VA 1TTPA 3W7RA 6ALDA 3G1DA 4L4MA 1PCWA 3S5YA 2F84A 1GG0A 4BI6A 3LGEA 1LBFA 4JYEA 4DO6A 3HJZA 1QO5A 2QCEA 5TIMA 3L0KA 1YLVA 1VHNA 3TA6A 3W75A 1MO0A 3NQ8A 3TXZA 3P84A 1Y0EA 1LBLA 4BWLC 4K6AA 3KRZA 4IMDA 1TQJA 3DKJA 1KM2A 3TV8A 5FEZA 4IX0A 4QQ3A 1XI3A 2C16A 3NQGA 3KVMA 4WQ6A 2PC4A 4MUZA 3SY5A 3GR8A 2E68A 5TQLA 4AHQA 3L68A 2ZRWA 5F4SA 1W1ZA 3L0NA 1M5WA 4RK8A 2Y63A 3PG8A 4JYFA 3PBYA 1OFPA 2XN2A 4R53A 1SSDA 1JCMP 2Q8LA 2OCZA 3R13A 1OX4A 2FB2A 2HSAA 3PB0A 5F2GA 2EGZA 5GVJA 3I7SA 1W8SA 2ZYFA 3BV4A 5C5YA 3KXQA 3U2OA 3L67A 4UFLA 1N8FA 1RV8A 1IXPA 5I3JA 4G1KA 2QAFA 3P81A 1K7FA 3BPWA 5KMYA 3SW6A 1HUVA 3FS2A 1BWKA 1DVJA 2V9DA 1LTDA 1WOBA 1EP3A 1W0MA 1K7XA 2A6LA 2A4AA 5F1VA 4CCEA 4OWGA 4O11A 3VKJA 2VXNA 1LORA 3LDVA 2VKZG 4X22A 3G1XA 1GT8A 3UWWA 1YYAA 3IIXA 3JRKA 1I2OA 3R12A 4FHAA 2ZA3A 3QSTA 2H3BA 3B04A 4K7VA 3PWAA 2FDSA 3CC1A 2Y6ZA 3TK7A 4JX6A 1VCVA 2FB3A 3LXAA 2J24A 4O10A 2H90A 5KSWA 3UZJA 3PR2A 4BI7A 4XQ6A 3KRSA 1DJQA 1EB3A 1ZAHA 2Y88A 2PCQA 2WOQA 1C8VA 3BW2A 2YX0A 5KITA 2QCFA 3QSRA 3NM1A 1H61A 1KTBA 4ZQOA 4O16A 1QO2A 5FF2A 5EMUA 2Y7EA 1ZAJA 3FLUA 4N9BA 5CZJA 4UTUA 2J27A 2VC6A 3LLFA 3PF3A 2DZPA 1I2NA 2JKEA 5J5RA 2NV2A 3BK0A 4H4IA 5LHFA 3GLCA 5D2WA 4PC8A 1HFBA 3LLDA 2A5HA 4RXFA 2NLIA 2VEIA 5C6MA 1NSJA 3QMRA 1DHPA 1KTCA 1TPFA 1XBVA 2X1RA 4ONVA 1S5TA 2PRHA 2VFIA 4NU7A 3W1LA 4O54A 4HNTA 1G6CA 5AB3A 2NWRA 1XUZA 2WSYA 3LTYA 5D05A 4MYXA 4HN4A 3C3NA 3NQFA 4XKYA 2E6AA 3TJXA 1OFOA 1G67A 3NPXA 1R46A 3TAKA 1SW0A 1UUOA 4JN6A 3MW7A 1YTEA 2GVGA 2RDTA 3NQ7A 4LVAA 4WX2A 1FCQA 5FEPA 1IIGA 3QQ1A 3T78A 3CM4A 4K7YA 3MI2A 3A5VA 1TPWA 2ISSA 1WA3A 4QJ1A 5EY5A 3DKLA 4QISA 1I2RA 3P5ZA 4MZ8A 1XL9A 5BMXA 1KFCA 3W7GA 1F2JA 3W72A 4C1LA 2C18A 3E0IA 3S1XA 1VZWA 3PB2A 4CQAA 3G0SA 4LUJA 3SI9A 5C2XA 2A2IA 1NF0A 1BWLA 2NXIA 4EWND 1LRTA 1YDVA 1GTEA 4H3DA 1KBJA 3DGRA 1LBMA 2I14A 4DELA 3H55A 3C2OA 3STEA 1H7XA 4M7SA 4MZYA 3ATYA 3LCXA 4UNKA 2X1UA 3EKZA 3F4WA 3STCA 1KV8A 5E0KA 4LRSA 1ICQA 3GDRA 4ZZ9A 1ZENA 4O17A 3IEBA 3DH7A 1L6YA 2WJZA 3I7RA 1SW7A 3W7PA 1R47A 4UNLA 6TIMA 4IMCA 4WZHA 3G1HA 4Z0SA 4UTIA 1XBXA 3CLMA 5DCBA 1LROA 4I7UA 5DN1A 1N7KA 3NG3A 2ZZ2A 4BFAA 3DHDA 5AYYA 2OMAA 4BR1A 3WK2A 3IIZA 3RU6A 5AHEA 3PG9A 4KKXA 1WX0A 3CEPA 1K02A 5HINA 1TTIA 5DELA 4UFKA 3TIMA 1OK6A 4IXXA 2CLFA 3DBPA 2RFGA 2WNNA 4LUIA 1ADOA 4IMFA 4XZ9A 4IJBA 1ME8A 3W9ZA 3W1TA 1GPWA 4I9AA 3GDLA 2A7RA 2V2CA 2CU0A 4ZQRA 5I3HA 2Q3RA 1GZGA 2JBMA 5LGZA 3BG9A 2ZTJA 1YXCA 5G2WA 1U5JA 3TCEA 4IMGA 1WBHA 5LNVA 3CEUA 4IGHA 3HO8A 5BMWA 4OBTA 3LCFA 2QCNA 2WPBA 4AHOA 4MVAA 4KFNA 5DLCA 4HPJA 4LY8A 3M5VA 3TDFA 4JTIA 1WV2A 1DJNA 3C8FA 3QYQA 1H50A 1W5NA 3BG5A 5G4EA 4DXVA 3SJ3A 4UTHA 3S5OA 4ORMA 1P4CA 3HBLA 4UIOA 3M5ZA 3WJXA 1QPNA 2HMCA 3OVPA 1OFRA 3G0XA 4ICNA 1VRDA 4LV4A 3OVQA 1RQBA 3DU0A 3G1SA 1JUKA 2ABBA 3PS7A 1MEIA 5LKYA 2VFEA 1WDWA 4O12A 4MZ1A 1GVRA 1LRQA 1SSGA 3GKAA 3O63A 5K7JA 1VH7A 1XM3A 3W1MA 3W1AA 3FA5A 1FUYA 5LNUA 2CZDA 1EX5A 5D38A 4M6PA 3EX4A 4UMAA 3UWYA 1GVQA 4U4MA 3QH2A 4YL2A 4Y9AA 1HO1A 3ABQA 4MIMA 4EOUA 3NAVA 3TFXA 4PFMA 1VR6A 3A5FA 3O8AA 3MBFA 4MJMA 2RKXA 5I3FA 3NZRA 5D09A 2JGYA 2A7NA 1TV7A 4MLRA 4X2RA 2GJLA 3NOEA 2ZZ1A 3EWYA 2QJGA 2C13A 4MKNA 3QPZA 1UBSA 4UFJA 2BTMA 3CIXA 2E77A 4IXHA 5D33A 2H8XA 5AN7A 3IGUA 3LRKA 3UWUA 1BKSA 2H8ZA 3OA3A 2EHHA 3RNDA 2QKFA 4EF8A 3SZ8A 4MOZA 3WK0A 5A8GA 2DORA 4LW7A 2QUUA 1EPXA 3TSDA 3UPBA 1EEPA 3IVTA 4K39A 1OG0A 3C56A 1JRBA 2G97A 4JDYA 2VFFA 4R34A 3CIWA 4W9TA 4ALDA 5G2IA 2ZFAA 3W7QA 3QRHA 3FFSA 3DAQA 4N9CA 4X3ZA 5DY2A 4AWTA 2PRMA 4FXSA 4LS0A 2ABAA 3VE9A 1W3NA 3L66A 4PTNA 1PHWA 4DF2A 3QMTA 3DZ1A 1HG3A 4TMCA 3WK3A 3HGRA 3T44A 1TRIA 4M19A 4JXCA 4JTTA 2R8WA 3GZ3A 2RDWA 3GIYA 1R2TA 3O6CA 1SW3A 3G0UA 5I3KA 3WJZA 5EA9A 4S2BA 1OFQA 2JKPA 1LOSA 4HT3A 4JY9A 3NXFA 3S1UA 3IIVA 1W5OA 5U7SA 4LVGA 4XTIA 4POCA 5C55A 3TNOA 2CWNA 4Z1DA 3IV3A 3NEVA 2E5CA 2Y62A 1G4EA 4KFOA 2Y89A 3L2IA 2B4GA 1DOSA 3E02A 4UTMA 1XFBA 5AOUA 3N3MA 1JJKA 1I8JA 1SU5A 5DXXA 1JQVA 1SR9A 4JNMA 3S5ZA 3THQA 1KLZA 5CSRA 1PHQA 1X1OA 2DZTA 4XWUA 3NQ2A 2E6FA 4WXYA 1FWNA 4MY8A 5AC8A 3DFTA 3P5YA 3UYCA 5BOOA 3KVKA 2G5WA 3G24A 3QZEA 5CKSA 3LHWA 5LGXA 1S3HA 3PBVA 3W7OA 2DJXA 2C0AA 3PC0A 3P8IA 2CLHA 5G1TA 2HS6A 1NVMA 4ZQNA
chains in the Genus database with same CATH superfamily
5CC5A 4X0NA 2FMOA 3L5MA 1IXOA 3MO4A 3MB9A 2YL8A 1J10A 4HHPA 2Z1BA 5KINA 1J18A 1CXFA 1D3GA 2DT3A 1GWJA 1KWKA 4AEFA 2FTPA 2J9XA 4DZAA 1SZRA 2ZZ5A 1QNRA 2AAMA 2O56A 3BL3A 3EWXA 1LLWA 2WSQA 1BYCA 3LM3A 4ZOAA 5CZKA 2DZWA 1W9DM 3BO9A 2DGAA 2BVDA 1L2UA 3ME3A 2XFFA 2EO7A 3CMFA 3TJIA 4L64A 4LPCA 1HW6A 1IE7C 4Z1BA 4UTWA 4JCLA 3FVMA 3AFBA 1F8MA 3VOHA 2P53A 1GOIA 5D9NA 3GHSA 5LXXA 3AO0A 1VBJA 3HQOA 3NQAA 1IGWA 1P5BA 2ZDSA 4G7EA 4BS0A 2Y5SA 3ZR5A 2D2JA 4GNJA 3TAOA 3T08A 1QNVA 3TUUA 5H8MA 4L65A 2CW6A 3G1VA 3W74A 1QBAA 3C0LA 4HA3A 4PCPA 3WMSA 2CETA 3N6HA 1K6WA 2ZUVA 1IT8A 3CZLA 1FVPA 2WZEA 5D4YA 1M6JA 2UY4A 4J9JA 4DM1A 2J79A 1C29A 1RHCA 3PK7A 2HJPA 2Y2WA 5FJTA 2GQ8A 1H7PA 4RJEA 4N6EA 4WXZA 4NAFA 1GVSA 1W9PA 2PLJA 2W62A 3YPIA 4CUCA 2WKLA 1M7PA 3VOCA 5DMYA 1QMLA 3C0JA 5DT5A 4MJ2A 5D2VA 2YZ5A 4D8ZA 1TR9A 4Y90A 3V7PA 1H1YA 2VGBA 5DY3A 4BA0A 3DFOA 2CZEA 1MW2A 5JBDA 3W07A 1JCNA 4RZ6A 1VHCA 2VYOA 4JTAA 4I7VA 3I68A 4HMDA 3EWBX 4HU4A 3WQ4A 4NRSA 4NZFA 4OV9A 4JNZA 3S1VA 4LV9A 4NJIA 5BROA 3MPGA 3VDAA 1EJ7L 3A3XA 1XLJA 1A47A 4WUIA 4GYPA 4Q4PA 3MO7A 2QF8A 3UJFA 3TONA 4HSOA 5K3VA 2AKZA 1PUDA 1YBQA 1DTUA 3C2FA 2A85A 2V5CA 3VU2A 4D6IA 4LC6A 2ZE0A 2WBGA 3NQDA 1R3TA 3ARVA 3VPLA 2FGZA 4QQUA 5C70A 3L0GA 4KERA 1FY6A 5HJYA 4CN4A 3LEPA 1DWJM 3S2NA 3W29A 2CESA 4X0VA 2ZDRA 3P0WA 4IQLA 1LP6A 3BC9A 1MZHA 1HZYA 1NF7A 1FWEC 1KB3A 3ZJKA 3CWNA 2C3ZA 4W7UA 2CEQA 3TSMA 3W2KA 1EOKA 3QW4B 4LB4A 4YS1A 2WMIA 5DF0A 1TJ1A 2VC5A 3OA5A 1OZQA 2V2DA 1ZNNA 4KEZA 1B30A 3M0IA 3WQ5A 3W70A 2XGBA 3EZ4A 3MP5A 4O0KA 4WGHA 3VK5A 3NM3A 3BW3A 1DPMA 5M1TA 3Q94A 4IT1A 1V6YA 4GIYA 2DT1A 2YDRA 3N13A 1OFAA 1R0MA 1V0MA 4U31A 3A4XA 2Y8UA 2CLOA 4CU6A 3C0SA 1LJYA 3LGDA 4IGNA 1Q5MA 3H8AA 3VNLA 3ONCA 3SCVA 2VOMA 5IFTA 2TRSA 3M46A 3TW6A 3PAOA 4UZUA 3LI0A 2O7QA 1IWBA 3W25A 2QUMA 4N2YA 4OECA 1OFDA 3GW3A 3ES8A 1QPRA 4ZL1A 4FF7A 2F61A 3WF4A 3NA8A 4JX4A 3JZEA 3A9IA 4DEFA 3EXTA 1KM4A 1OM0A 4P7OA 3P93A 1Q8AA 2PDIA 3EB4A 2WVVB 4M56A 3OBEA 3ZMRA 3U2ZA 3IANA 2CLEA 3B0UX 4O1FA 1GYNA 3B9NA 2VFDA 4L1XA 4C7FA 1N55A 1XH0A 4AZ6A 3AIRA 5E6YA 4WIWA 3QGKC 2CYGA 2W67A 3GTFA 4GFSA 2DUAA 2OZTA 3BURA 3LI1A 3G3MA 3S9YA 3PTKA 3RYSA 6TAAA 1C92A 1YMYA 5DMMA 3VIOA 4Q32A 1B4KA 1RQHA 3UETA 3LA4A 1EJRC 4AUBA 2O4QA 4DLMA 1P0DA 2BOFX 3BVJA 1MXGA 2FVLA 1J6OA 1R5YA 3IK4A 1M53A 1PWMA 1XDJA 5EMKA 1LWIA 3PZUA 1H63A 1X6NA 2MUCA 4FNUA 1S1RA 4LJ3A 3AHTA 3RF9A 2A7PA 3FEQA 3MI6A 1WB0A 3VX1A 1GJWA 4TVCA 3SCWA 2NLYA 3VDBA 3WX7A 1IXNA 2GOUA 3CL7A 4UXDA 4N4QA 3AU2A 4IF2A 3N17A 4AZGA 4S1FA 4UNIA 5AC4A 4NNCA 2A1YA 1J2BA 3CNYA 3AMLA 4NZCA 1CT5A 2QCLA 3MWAA 2J7CA 1KXHA 2PPGA 1B0IA 5HUPA 1BEUA 1SFTA 3IVSA 3EDDA 1XDMA 4EX4A 4WF7A 5KZ6A 3IGHX 5K9DA 1E73M 1RPXA 3IJLA 4JFTA 3RM8A 1MUCA 1PIFA 2CKSA 1J6PA 2PDWA 3N1AA 3NQVA 5HQEA 1O5XA 2VUYA 2F6XA 3SGGA 1PX8A 4H9TA 4Q4QA 2V5JA 1ZAIA 5LNRA 5DX7A 3WENA 3S2JA 4A4AA 4QX4A 6PTDA 4H9VA 1IF2A 1YTDA 1I60A 3PTDA 1K9FA 1B54A 3W7HA 1X39A 3N2CA 4N6FA 1AMYA 2WJDA 3URNA 1MDLA 2Y7FA 4JFUA 4BKNA 3WD3A 5E0CA 3VIJA 2XSAA 3BDKA 3MMUA 1ECEA 2ZRUA 1Q65A 3SB0A 7ENLA 1ODUA 1UP2A 3IAPA 2X30A 3CT7A 1AG1O 3UT0A 2DJLA 3W88A 3CZJA 1WZMA 3RO8A 4MNKA 3P7YA 3RPMA 2WV8A 2YCIX 1KCXA 3DECA 4LBSA 4H6EA 1O6IA 1L6SA 3EAUA 3MHGA 3KVLA 2WO5A 1LUCB 4C1NA 3D3FA 4AFYA 4AC7C 3LYEA 1ONRA 3CASA 1OQFA 1EP1A 4RDWA 1UA7A 1JULA 3EX1A 4YWSA 8RUCA 3BLIA 2XM1A 1VLIA 4ZTYA 4RDVA 4JTEA 1WPCA 2BZNA 1TMQA 3FY1A 3JVAA 1ELSA 1V77A 3THUA 4N9DA 4BZYA 1PBGA 2ZTKA 3GUGA 4GUHA 1R30A 4TVDA 1RZMA 2Y5JA 2VUNA 5ENLA 5BOFA 4UTWC 1BYDA 3G22A 3OPSA 3P0XA 7PTDA 2E6DA 4E38A 3R0KA 4U3AA 5AC7A 3RN6A 3B0VC 3MQTA 1F3XA 4E2BA 3K1GA 4AMAA 4C6IA 1A53A 1D7FA 3R58A 3LSBA 3AJXA 3SR7A 2CFFA 1CXLA 4GISA 2BY3A 3UXKA 1J0ZA 4INFA 4DPPA 1EXBA 1JL8A 1E9LA 3WBEA 1F9CA 4XZHA 4FIQA 3P61A 3IARA 1XLLA 1GJPA 4GVIA 4A3YA 3HV9A 2VZTA 5HBFA 1HX0A 1TIWA 3PUDA 4E2DA 4E3VA 3VC6A 2BGQA 4JFWA 3MKCA 2BSLA 1ZBWA 1KKOA 1XYAA 5GNZA 1AH4A 2FLIA 3KCJA 3LCGA 2GVLA 1F6KA 2YA2A 2Z0IA 1SO3A 4FS9A 2V3EA 4NUWA 1P0BA 1V3MA 3CMGA 4UFIA 5CJMA 1TX0A 4E2VA 1NFPA 2WAGA 1T8XA 1RJQA 3UG3A 4WHBA 4RL3A 3Q45A 2JGQA 1VBUA 3M9YA 4G9PA 3PM6A 1H5VA 1JUEA 2GPTA 5K4ZA 2WWDA 3M7SA 3T7VA 4O1DA 2WPGA 2W3ZA 2C8NA 1UUQA 4GRSA 3F5JA 3V75A 3T55A 1PVNA 2GSHA 2FPYA 1R38A 1YX1A 4UQEA 5FEXA 2C14A 2F38A 3AAMA 2GJPA 1QWGA 3P80A 1RUSA 1VFSA 3N15A 4O4WA 1XIIA 3GU9A 3ISIX 1L0PA 4XK2A 2OSYA 4Q4MA 1JXJA 1FWAC 2V0TA 3AXXA 3V18A 4PL1A 3USZA 2ADAA 1UUMA 4MPQA 3AHVA 5LA2A 5DCEA 4YYCA 4HPXA 3CQIA 3F4VA 5J04A 3TKFA 1W3KA 3WQ6A 3WBXA 3HG4A 1Q3NA 1JYNA 3FGCB 3A23A 1QDSA 4AW7A 4YNGA 1XYMA 3R6IA 2EPMX 4NZJA 5EL1A 4ACZA 2J8TA 4WVXA 1CIUA 2OOGA 3VILA 3BSGA 4WKFA 1NFGA 3BLPX 4JTKA 1UR8A 3WBAA 4DJFC 5AVHA 2WYSA 5H8UA 1EZWA 2KZHA 1XICA 4GBDA 2POTA 3UJSA 3VM5A 3HU7A 1EPVA 1V6VA 3K1DA 1SPQA 1KM6A 1S38A 1HL8A 1K3UA 1Q66A 5LIWX 1JCYA 3ARYA 1IR2A 1F4AA 1G9HA 4NZ1A 3WLKX 4B15A 2JALA 4N4PA 1VS1A 4A3UA 1J12A 3GC5A 3PJWA 4J40A 2GJXB 3NGJA 5KZMA 1K70A 1GGOA 4QJ4B 1A5CA 2HVNA 4IICA 5FF4A 4L9XA 3KM8A 4LAOA 5A6LA 1KTNA 2TODA 1NARA 2VGIA 2BY0A 4JEQA 4P7LA 4EP8C 3MBDA 4DX3A 3NURA 3P6LA 2OSWA 4GOAA 3LOTA 3NSXA 1KFJA 4RXGA 5E9AA 4YXGA 1KM0A 3V1PA 3GQYA 4O4VA 1GZ1A 3H2CA 1OZMA 5BCAA 1MDRA 3U3HA 1JNDA 2YFOA 4XAZA 3HTWA 1L6FA 4D6FA 2BODX 1A5SA 4MKSA 4TX6A 5DBTA 3ITGA 1PCKA 2GJNA 5D2YA 3OOQA 5G5IA 1O1ZA 1PE1A 3DGBA 4JTUA 3WN6A 4CN1A 2GK1B 3RITA 3UG8A 1X6LA 3KL5A 2YSWA 2P5NA 3SSZA 3D46A 2POZA 1VRXA 2RHGA 1BSIA 3WQVA 3W2UA 2ALRA 4XV0A 1UPPA 3KTSA 2AQWA 4NVTA 1I6NA 2YFNA 4K68A 1MQRA 1O94A 5CGQA 2G50A 2DZUA 3K8LA 3GHRA 2Q3OA 4YTSA 1WDSA 1A49A 2NQ5A 1UC5A 3P8JA 3BOXA 3N9RA 4M8UA 2OJPA 3CHEA 3VDCA 3WY1A 4B3KA 4PZVA 2YCEA 2YB1A 3WF0A 2WJFA 1C9DA 3GW0A 1S2AA 1O66A 4JOMA 3FIGA 4K36A 3RLGA 4C65A 3CIVA 1VYRA 2NUWA 1DQWA 1FWFC 2Z24A 5A6SA 3OB8A 3AQUA 4C5ZA 1RSCA 5C9UA 1UD6A 5CZTA 5L9FA 3N4FA 1A80A 4AF0A 5AHFA 4KWSA 1ZFJA 1TV4A 2YPIA 2CLIA 5DQPA 3W71A 1X8FA 3K4AA 4XIAA 3W83A 4UR8A 1IZKA 5FAGA 2YBTA 5DFAA 1PSCA 2DW7A 2ZXQA 4R9OA 3U0HA 1XH2A 3GXNA 1FWDC 5A5WA 2J9YA 3LXBA 4M6VA 1V6TA 4IHCA 5I07A 3L4TA 4NZ4A 5EB8A 1W1TA 2INEA 1FCUA 4AY1A 3NR0A 5GPRA 1KNWA 3RK8A 1QU4A 3APGA 4AEEA 2XVPA 1YNPA 4AD3A 1WBJA 3SCSA 3IIPA 2G3NA 3L5LA 4MM1A 3S3GA 3FYPA 1K9TA 2TPSA 3EOLA 4B92A 2CHNA 1RBOB 2YOCA 1OC7A 1B3VA 5TBOA 5DCDA 4NILA 3UXDA 2HE8A 3CXOA 4NIRA 3RHGA 2V5KA 2J88A 4WSHA 3WLHA 3GFXA 4EPEC 1A5BA 3OZPA 2J9ZA 1RVKA 3QYSA 4NXSA 5DXYA 2YCLB 3REQA 3KP0A 1US2A 2VZUA 3W02A 1G5AA 3TROA 1QOXA 4HOWA 2QXWA 2D2OA 4GY1A 2O0TA 1B57A 3N2BA 1NH6A 4GUFA 1KRBC 3AUOA 3RU8X 1GKPA 1LQ2A 3ZOAA 3TOPA 3IUDA 2PDFA 1VEPA 3U8GA 1KW1A 3TQPA 4RV3A 3BLOA 2YW3A 1QHZA 1QR7A 1EYEA 3B05A 3CHCA 4IIFA 5KTLA 4DI8A 4JTFA 4PCNA 5BXSA 1LZOA 3QR0A 1IEWA 4PTWA 2LLEA 1WZLA 1TTQA 3LCWA 4Q8VA 1UG6A 4OU1A 1R8LA 3AIUA 2VCAA 5A8NA 1VEOA 1Z42A 2HVOA 2PU1A 4ZB5A 1EF2A 2X1SA 4JYDA 3GU2A 3W01A 1BRLB 2OB3A 5HWNA 3QR3A 1TUFA 3UJEA 2HK1A 2XGIA 1LLZA 3M5YA 5LHEA 4WY0A 1J2WA 2J6XA 2WVVA 3EPMA 4CNPA 4Y6GA 1I75A 3WUBA 3H2EA 4GI4A 1Y5XA 1W2VA 3UESA 1J0KA 1TPUA 1S3TC 1CDGA 1FA2A 3CMJA 3I3DA 4Z17A 1B2YA 2CBJA 3MWCA 5MHBA 3UBPC 1EF3A 3DFPA 4FPSA 3HQPA 1RCOB 2FIQA 2YGYA 3IUHA 3TR2A 1NDZA 1XH1A 4M6QA 5HJLA 3FA4A 2PBOA 1WUEA 5HAOA 3ANVA 5IBXA 3R1ZA 3KBNA 1EYWA 2G96A 4MGGA 5FJPA 4UTLA 1CB7B 4KRUA 1AZ2A 5XIMA 4XKYB 3H70A 2GJRA 3C2VA 3W7RA 6ALDA 1GYMA 3G1DA 4HU8A 2FHCA 2DIJA 2F84A 3K2GA 1LBFA 3CH9A 2PAJA 3GR4A 1YLVA 1EXPA 1JI1A 5CC7A 4GK8A 1TQJA 5CJNA 3DKJA 4CN6A 3TV8A 3MJMA 2FDMA 3TN3A 2PTYA 2VR5A 4DHGA 2Q6ZA 3F2DA 1TV3A 3PJTA 4NY2A 5F4SA 2BS9A 2Y63A 4S3EA 3PG8A 2JQXA 3E0FA 1AH0A 4GQGA 4UOZA 1UP0A 2BDQA 4F3HA 3PB0A 4IQEA 4NP7A 2VR2A 1UWRA 1M3UA 3BV4A 5HXMA 2J6VA 5AZ1A 3U2OA 4DBSA 2XM2A 3CV2A 4DUVA 5IXEA 1N8FA 5A2CA 1K7FA 3PZIA 4EXAA 3N6JA 2XH4A 5KMYA 3SW6A 1HUVA 1DHKA 4URIA 1WOBA 1W0MA 5IHSA 2DSKA 5F1VA 1YPXA 2VXNA 4KPLA 1AUSL 3UWWA 1UKSA 1YYAA 1FWJC 3JRKA 4J27A 4ZXOA 4TUFA 1LUCA 1YIXA 2ON3A 3CC1A 2X2YA 3TYDA 4Z42C 1FHDA 3TK7A 3LLXA 1W91A 3JU2A 1DEDA 2J24A 2PWEA 3N4AA 5KSWA 3UZJA 3WL0A 3VMPA 2ZOXA 2NVCA 3FDGA 2BG5A 1E70M 1U1HA 1YE6A 1ZAHA 2PCQA 5ECVA 1XRSA 2Z1SA 3K4DA 1C8VA 3BW2A 2BOEX 2ACRA 3ZSSA 2VTFA 5KITA 3OIHA 1R85A 5FF2A 4KCTA 2J8GA 5CZJA 3UWEA 3LLFA 4JPGA 2DZPA 5FL1A 5LHFA 4PC8A 3BAJA 4RXFA 4DZIA 2EPKX 3QMRA 3SN1A 2X1RA 7A3HA 4ONVA 2PRHA 2ICSA 3W1LA 4HNTA 1QT1A 5JQ9A 1XUZA 2WSYA 4MYXA 2CWXA 3FN9A 3TJXA 1OCJA 3GXIA 2XINA 1SW0A 2EPOA 2GVGA 1XRVA 3R8HA 4IMAA 5FEPA 5DMNA 4DJDC 4NYYA 5A8PA 1H0GA 3QBUA 4UOQA 3AHYA 3MI2A 1WA3A 4QISA 1I2RA 4ATLA 5CSYA 4OOUA 4ZB2A 2C18A 4TV5A 4P8UA 4FI4A 1IWAA 4MG4A 2G4FA 2X0HA 3SI9A 1OGGA 1BWLA 2NXIA 4EWND 1D2KA 1GTEA 3PP7A 2I14A 4JN8A 3C2OA 2R9RA 2ZC8A 4XZBA 2X1UA 3S6OA 3EKZA 2FHFA 3TLLA 3U48A 3STCA 1KV8A 1W9UA 1V03A 1ZENA 3WCZA 4QDPA 3I7RA 4UNLA 3EMCA 6TIMA 4B5SA 1MQQA 4WZHA 4DXXA 2EG8A 1EGVA 1XBXA 4EWJA 1EQCA 1LWHA 4DBWA 3NG3A 2D23A 4XZLX 3FX4A 2A3AA 2QVNA 3ARRA 1V8EA 4KKXA 1WX0A 1R6WA 2R24A 3CEPA 4J3TA 4MAZA 4UFKA 1OK6A 3R94A 4US5A 1A5NC 1DJZA 3LG3A 4IXXA 2WNNA 4LUIA 4QHRA 4IMFA 4GZEA 1ME8A 3W9ZA 1KCLA 3KOXA 4LQ1A 3SY8A 1GZGA 3AZTA 3MZ2A 2ZTJA 1YXCA 3TCEA 1Q6FA 4M81A 3POCA 3FGCA 1Z32X 2QCNA 2WPBA 3B0XA 4AHOA 3IJ8A 3VYLA 5DLCA 5HPCA 4H41A 4JTIA 3WD2A 2DSUA 2AAAA 4AD2A 4IPPA 3EDKA 4E4UA 3QYQA 4DLFA 4DXVA 1T5AA 3SJ3A 1OB0A 4UTHA 1RP9A 2C7FA 1P4CA 3ONBA 1UW9A 4LH8A 3M5ZA 3WJXA 1VP5A 1TWSA 3MUCA 1JFXA 4XD3A 1VBHA 2EJAA 2VZVA 4GIEA 3W0KA 5KETA 3G0XA 4ICNA 2UZ9A 4AY7A 9CGTA 4HTBA 1RQBA 4WR3A 5LKYA 4O12A 1CLKA 4C6QA 3O63A 5K7JA 3ALFA 3WLSA 3RM9A 3W1MA 1FUYA 5LNUA 3ITVA 4JFSA 1EX5A 3EX4A 2VNCA 3QH2A 3UF9A 1ESWA 1HO1A 3EA2A 3NAVA 2GJXA 1KR0A 1V02A 1QI5A 1VR6A 1W1IE 1J01A 3VGFA 4MJMA 2RKXA 5D09A 1ZGDA 4E6MA 3NOEA 2GGEA 2YBVA 2QPUA 4MKNA 2CLPA 1TVLA 2JF7A 3BCDA 1QK2A 1BKSA 3U9IA 1P1MA 3RNDA 2QKFA 3U2EA 1E6ZA 3RPTA 5FJIA 3GS6A 3WK0A 3CYJA 2DORA 4LW7A 3AYRA 2C0HA 1EPXA 2PDBA 3TSDA 1EEPA 1POKA 4K39A 1PKLA 5FL0A 1ZBKA 1OG0A 5CG0A 4R34A 2WJEA 3IJ6A 2DIKA 1C3FA 3QV8A 3FFSA 4AWTA 3ZO9A 4DF2A 3QMTA 4L4PA 1R9YA 1O1HA 3DZ1A 4AVNA 4WGXA 2GK1A 3T44A 4GABA 3MVIA 4AWEA 4JTTA 2ZUUA 2D2GA 3H4WA 3O9NA 1LF1A 2RDWA 2QPXA 9XIMA 1SW3A 1GORA 4ATDA 1W17A 2V3GA 1OFQA 3AXMA 4KS0A 3NFUA 2PFHA 1GOOA 3TN4A 4Z1DA 2UY5A 1Q6CA 2E5CA 2Y62A 4XAYA 2WNWA 3PZVA 2ZE3A 1OC5A 2X8RA 4UTMA 3M0JA 3BLKA 1JJKA 1I8JA 3TYZA 4QCEA 2VT0A 1ZS2A 4ZOEA 1PHQA 2JIEA 3QGAC 3N9KA 2E6FA 2REQB 4HVXA 3WH7A 2OKOA 3P5YA 4K1WA 5BOOA 4JBRA 5JBEA 3GG1A 4QRNA 1TX2A 3G77A 5LGXA 3LS9A 2XVNA 3MUY1 3PBVA 2C0AA 3HFYA 4PMJA 5G1TA 3SRHA 3GDBA 1WDPA 3CBWA 4IG2B 3VMNA 2P76A 3MMTA 1JD9A 3EDJA 1XYBA 1ZJAA 3MA8A 3NQEA 2PSNA 1JRCA 3L21A 4NZ5A 1W1PA 2DH2A 3VD5A 1JCJA 3CPGA 5BW6A 3KL3A 4FO4A 4PSRA 3QF0A 3ZXWA 1DL3A 3JUGA 2FPTA 3SBFA 1ME9A 2CLKA 3L23A 5FF0A 1FWIC 1TSIA 1AVAA 4H9YA 1W3IA 3VZZA 1R2SA 4DM2A 4O8RA 2NZLA 3TP4A 2VVNA 3BLFA 1RD5A 3R7MA 3WQOA 3ANUA 3SCUA 3EXSA 1A3XA 2ASHA 3GHTA 3ZLHA 3VINA 3AS3A 2OQHA 1DQXA 3AIEA 3WMBA 5I5RA 5E09A 1DQUA 5H1WA 2IMRA 3FHAA 2FHBA 5AHIA 2ZA1A 4PN2A 3FKRA 5JU6A 1B3WA 4L4OA 4FX8A 3AMDA 3NZQA 1VJZA 4PCFA 3U2CA 4HNUA 1RP8A 4AEOA 2NW0A 2W66A 1B4EA 3MUXA 1Q4NX 2WC7A 1N2VA 4GUIA 5D32A 3PUEA 1ONWA 5HATA 1DJWA 4IP4A 1TR1A 1BQCA 3BGJA 3ZJ7A 2DP3A 4GYJA 3HG2A 2CITA 3AMCA 1MMFA 3BTNA 1J4EA 3KHJA 1UB3A 1PAMA 1PTDA 1TJPA 4C6BA 1SZFA 4AZ5A 1GOKA 3IWPA 1JZ8A 3CUFA 4UBPC 4Q8UA 3VCRA 4PUDA 1E0VA 3OHIA 4BI5A 4HHMA 3GXTA 2NT0A 4LBUA 1HTIA 1FQ0A 2BVYA 1IEVA 3O15A 4I5RA 4EF9A 4W4QA 2PDQA 3FJNA 5D03A 4UQDA 4ZO9A 3FKKA 3T4WA 5FF3A 3GXFA 4EXBA 4S3JA 2E1WA 3ARSA 3B8IA 4CD5A 3S47A 3WLJA 3GG0A 4E4FA 2AL2B 3O6DA 1VFMA 5CLTA 4DAIA 3UG4A 2YXXA 1UD3A 1QNOA 1Q6RA 5C9RA 2P8BA 4H01A 1DTNA 3B03A 3E3HA 2ZBTA 2ZUSA 4YMZA 4OE7A 3TYAA 4J4KA 3LCLA 2A3EA 3Q67A 4A8RA 2VJXA 3GBDA 4BF9A 2WHMA 3W1UA 4AZCB 1ENUA 2VRQA 4ZFCA 1HJVA 5D8ZA 1PYFA 2Z6JA 3WLMA 4NG3A 4XO7A 4HNVA 3TQ0A 3KBWA 2HQAA 2OR2A 4NJGA 5A6TC 4US5D 3N19B 4B4FA 3SIZA 1JPIA 3IRDA 3PWGA 4Q8QA 4IMEA 3USBA 1WDQA 3W23A 4WRHA 1KXQA 2V3DA 1F73A 3WLQA 2Y7GA 3UNDA 3FXYA 5FF7A 1XLMA 4DVOA 1MSSA 3GYCA 1X38A 3RLVA 4FNSA 4GI6A 1M41A 4UCGA 4HK5A 2TAAA 3HMCA 2HZGA 1J8VA 2CERA 1CXIA 2PODA 2ZRXA 4PYSA 3DYOA 5M17A 5ABTA 2WCSA 3M1ZA 2A6NA 3AJ7A 2ANUA 3VNJA 2PF0A 3BG3A 4XB3A 2FJUB 3WMLA 4HYVA 1OSEA 1K8XA 5LIKX 1WAWA 3WNMA 4KF1A 2WW5A 3GUWA 1BXCA 1E0TA 4TO8A 1O12A 3ITCA 2OU4A 4P8XA 1E6QM 4OBSA 1C9WA 2DH3A 3LCIA 4LY4A 3T8LA 1KWGA 3KFTA 1E3ZA 1AMKA 2P3ZA 3EDEA 3PUOA 3TVAA 3HF3A 2OOFA 4IIHA 3WH9A 4DNMA 1F3TA 1X97A 4HJWA 3A3HA 4LF2A 3I4EA 4PUKA 2A79A 3WLNA 4KW2A 2PDMA 2VCCA 3A22A 4LYRA 3NO1A 4Q7BA 4J2PA 3O16A 2VC9A 3EYPA 4HN8A 5DRCA 2IKJA 5AC6A 3DI0A 3R25A 4S3CA 3BLDA 4M1RA 4S3AA 3AOFA 5TF0A 2TYSA 2ISDA 5T9CE 1W1A1 2BGSA 4ZFMA 2EQDA 2MANA 1A5AA 5HWJA 5K4XA 3WFZA 1JGMA 5FIPA 2VC7A 1OEPA 4NX0A 1CB2A 4DJEC 1XGZA 1BG9A 4IIDA 1KFKA 3BICA 3BGGA 5DANA 2CLMA 3PZQA 4PRTA 5A6MA 1BF6A 5C7VA 1HKVA 2PP3A 1AQHA 3S0CA 4JDBA 1H1ZA 3EA1A 2WCGA 3WUEA 4RZBA 1L9WA 1AW5A 3EOOA 4MNJA 2YJQA 1HL2A 5K9XA 3NNTA 1XYLA 1JEZA 1OD8A 1A0EA 1J5SA 2DZSA 2HS8A 3OG3A 3M7WA 3CUZA 1D3CA 3DG3A 3DUGA 1B31A 1TUXA 1CLXA 1EJVC 2H6RA 5HPOA 4EXQA 2YW4A 7CGTA 1E71M 3ZFHA 1NWTA 4HOZA 2OYLA 4EACA 2G0WA 7ODCA 4L56A 1V7AA 3B40A 3WL1A 3MHUA 3ZT6A 2QMKA 3WQWA 1TVNA 4ZO7A 2PDCA 4GCXA 1H51A 5I3IA 2ZUTA 5FJUA 3A9BA 3LPOA 4YTRA 4XAGA 2YYUA 2HE5A 2Z29A 2Q71A 1M7OA 1MW3A 4CNOA 2GSEA 1ZSXA 1OX6A 1THFD 3NEHA 5ABFA 2E1DA 1U83A 3UY8A 3H2OA 3U7VA 3AZRA 3E5PA 5EMLA 2VD9A 1EA0A 1GHSA 1E3XA 3FNDA 4DF1A 2R82A 3EWUA 3VIIA 3CL6A 3R4IA 3GNRA 3TLQA 3ZWSA 2VM8A 4UTTC 3G6LA 1ISZA 1NEYA 2KX9A 3KRUA 5TAOA 2E9MA 4I8DA 2YCKX 2F8QA 1G94A 2UY2A 3WD1A 1Q2RA 3V36A 2BHUA 5AYBA 1OVDA 2EAWA 1OX4B 1M1BA 2ZWZA 1X7IA 1QPQA 1L8NA 5EFDA 3QEZA 1ZPTA 1R9XA 4RZ5A 1AW2A 5C7HA 3B9AA 3CB8A 4AX6A 5A2BA 3S1WA 2IQ0A 2F9RA 3SGUA 2C79A 3VD7A 1XLBA 3AIWA 4HOXA 2V82A 2PLKA 1PEZA 3W1PA 3NDZA 1H09A 4IFRA 1W31A 3GBEA 2QJJA 3MTWA 5MKGB 4Q4KA 1T96A 4O50A 1PDYA 2WM0A 3IGXA 2QCGA 3LENA 2D3LA 3CV6A 4UB9A 4RE4A 1YRRA 1H60A 2P50A 3Q2DA 1PO9A 2PDLA 4MPKA 4KRZA 1HKIA 1KM5A 1UCWA 3URQA 3A4JA 4OTKA 4JZ5A 4AWSA 3HGSA 5LZLA 2H9AB 2J8FA 3WO8A 5AKQA 2OLHA 3RRXA 3BMXA 4JTGA 5CPNA 4Y2WA 4JQ1A 5F2IA 4AC1X 1ZP3A 1VENA 4PB5A 2IS7A 4CD4A 5CPMA 3WLOA 7REQB 1Q7MA 2DSVA 5CZ0A 3H53A 1ZLPA 1WZAA 3LX9A 3SGZA 2Y85A 4NNAA 1V5XA 1Y7VA 3DI1A 4PRWA 4UR9A 3ZZ1A 1QCWA 3STFA 3CT2A 3GVGA 3D3AA 3IGSA 3VKBA 2J66A 2ZXAA 5FSEC 4H04A 3JZUA 3BV7A 1YNYA 3W7KA 4HPNA 5JH2A 4ZE4A 3GK0A 3UJRA 4DF0A 1LYXA 3O0KA 3WUFA 4LANA 3ARPA 3DBNA 3OGVA 4KIRA 4LUSB 4JEJA 3G3DA 3A12A 3GDTA 3R0DA 2XVLA 3CU2A 4GFIA 2PURA 1MRQA 4GH1A 1XQKA 4RCXA 4PBEA 1NTHA 3EX2A 3EX6A 4AVOA 5CQ1A 3THDA 1NDYA 1UC4A 3WBWA 3MSRA 3EWZA 3S42A 2Z00A 1IZCA 2A21A 2OG9A 3H12A 1KCKA 5M3WA 4HSNA 2VX7A 5HNTA 1J79A 3G5EA 2BVTA 3NDOA 5HMDA 4GH3A 1FOBA 2AOSA 3PSWA 1W5MA 4C7GA 1CZ1A 2ZX5A 3UXIA 2X2GA 1GVFA 2VP8A 1JDAA 1GQIA 1TA3B 4IFKB 4O18A 3LD5A 4GC3A 2VOTA 3OEXA 1W6TA 1LOLA 4OGZA 1ONEA 2GVJA 4LAMA 4QBXA 2BY1A 5D04C 3C6CA 2XWEA 1WKEA 2QEZA 4WSJA 3HGOA 1Z6KA 1ZL1A 1K8CA 1QHPA 3L9CA 4I8YA 1ISWA 4D2JA 3TH6A 8XIAA 3HV8A 3K4WA 3GNXA 1EDTA 4HMNA 2Q01A 5IHRA 3P3BA 4J1OA 4O28A 3QC3A 4HMEA 3L4WA 2W4XA 3GC4A 1ZALA 1P7TB 3SQSA 2PWHA 3IVUA 3PFMA 4C6EA 1ADSA 4EVZA 3FJ6A 4C6PA 4RPPA 3KBVA 2EKGA 3VI2A 4NJKA 4PUMA 2FMNA 1UP3A 3PTQA 5CG7A 3WIJA 3TMQA 1C90A 4BK9A 4TX9A 3S8HA 4IM4A 2ZZ6A 8A3HA 1ITUA 1AQFA 2NQHA 4GKTA 5CH9A 4IG2A 2C15A 3FYYA 4IQDA 1NOFA 4YCOA 5DBUA 4LRTA 3SN4A 3TN6A 2P8CA 1VFLA 3H24A 2W5FA 2BMBA 4H9XA 3WK1A 1OCNA 3ECQA 1GOQA 2WQPA 1JD7A 2PDNA 3QY8A 3CYVA 1SMAA 3AMKA 3VOJA 2XSXA 3E49A 3CWOX 4QCFA 4ZSUA 3W4RA 3GVQA 3VIHA 3GG7A 1W5QA 1Z41A 1HF6A 2GLKA 2CNCA 4D6EA 3HIJA 4IH3A 4ZEPA 1JAKA 4LS2A 3UP8A 2I17A 3CHFA 2NX3A 3GYEA 1XCFA 3WQDA 2J74A 4CQCA 2BP1A 5I79A 4L6DA 3SURA 4YTTA 1TV8A 2E09A 2QCCA 2ZKMX 4F0MA 4XBKA 3UR5A 1L6WA 1IGSA 3PY2A 3N3TA 2QR6A 4P8WA 1MZRA 3MSGA 1RA5A 2OLSA 2I5QA 4QE4A 1UMLA 3GX9A 5B7YA 4JTSA 3KBSA 1IXQA 2XH7A 4JX5A 3MSDA 5A3HA 4LYQA 2QCMA 5H91A 3RR1A 4MLJA 4CVUA 3P62A 4MY9A 2E4TA 3WF2A 1V3HA 4YWIA 4IUOA 1PV8A 1UH4A 1I9CB 4CNTA 1LT8A 1IYXA 4ZENA 1RA0A 1UWAA 2YLLA 5IDIA 2BX7A 1BPLB 3AI0A 1GNXA 3TE9A 4B91A 4GG9A 3D5HA 1AL8A 1QW7A 2QGYA 1JDFA 1BD0A 2PWFA 1BSLA 4NASA 4Q4OA 3RXZA 5EBUA 4CD8A 1TQXA 3SFWA 2WSRA 3I3EA 3QQWA 3CV1A 1BTMA 3SCTA 4O52A 4AZIA 3M07A 3RJYA 3PWIA 3EMQA 2XIOA 3SRKA 4CU7A 2X16A 3B8UA 4UR7A 1NFBA 5D02A 2VL4A 3CHVA 1FBAA 3TC7A 5C2GA 1D9EA 2PD9A 1SFLA 4I90A 5F4XA 3WJYA 1EFZA 2A0NA 3B0YA 3HPSA 1KXTA 5F2LA 1JF5A 2CCRA 4KEMA 3EPNA 3NWRA 1EIBA 2Z28A 3P82A 4JGDA 3W6LA 1GOMA 1OYCA 3PZOA 2BXZA 2W0UA 1XW8A 4TXEA 2E8YA 2D0FA 2WHJA 5FCZA 2GOKA 3B8DA 1T6MA 1NDVA 4S38A 2CZFA 4HA1A 1RJRA 3MMWA 3KZSA 3FCPA 4LUYA 1CBGA 3HB9A 4O0QA 1LT7A 5A6AA 2OELA 5I78A 3B8TA 3UFYA 4O1AA 4P8VA 4PTXA 3GWQA 4AZCA 3LHYA 4CNUA 3B8VA 2Y61A 3LGGA 2PI6A 3QR1A 3WNLA 4A21A 1ALDA 2PS2A 1DIKA 3KRBA 4NHVA 5A6KA 5T8GA 1F5ZA 4J35A 2D2HA 3S9ZA 3AZSA 1TPEA 4FXFA 2OEKA 1K03A 3T4CA 3E0WA 4KETA 3NPVA 3L2MA 5HOSA 3GU1A 4B9YA 4ERGA 3DHPA 4QSHA 1SJCA 2OEMA 4XUGA 1UR0A 1GEHA 3C61A 1HNYA 4ZO6A 4JIPA 2ZRVA 3RDKA 4DWSC 3ZS4A 3RLUA 3GKFA 3IUIA 5PTDA 1RK5A 2WLZA 1H1NA 4KFPA 3VVGA 2VQUA 3U6WA 2NV1A 4GUGA 4FSAA 1OG6A 3IPWA 3WNPA 3KWSA 3ZJ8A 4L6HA 4DB7A 3OO2A 3WQCA 5G2HA 4O0ZA 4PTVA 1UR2A 3GNDA 5FD0A 3E12A 4FX6M 3WMCA 2P0OA 3S4TA 4R5EA 1H7OA 1OADA 1F61A 1OHLA 1ZRQA 2G41A 3W87A 3KE0A 4PMUA 2R1KA 5DO8A 4NF7A 4LUTB 4NXKA 2Z25A 5I09A 1E15A 2G8ZA 3ABXA 1XUUA 5XIAA 1FWSA 2VEPA 3NGFA 4KESA 1FKWA 4LXFA 1E0XA 1OYAA 3ID7A 4U28A 4BF5A 1XSIA 4M3PA 5CPLA 4OOZA 5AYXA 2YKKA 3W82A 1J96A 4KT2A 4A3QA 3LMYA 4A22A 1B9ZA 4H6RA 3PNUA 1KM3A 5HR6A 2HXTA 2NT1A 4Z2LA 1UHVA 4G1NA 1JCLA 2GQAA 4BEQA 1IEXA 1E6PA 3BUVA 1E9IA 3T0TA 3UZXA 1EJUC 3XIMA 1REQB 4E8DA 5FOOA 3GIQA 3N04A 1FWHC 1KV5A 3KCLA 1V0KA 1UH3A 3V5FA 2QCDA 5E6ZA 3KVJA 1W2PA 1XKJA 1X7FA 3AICA 1LL6A 3MKKA 3LV6A 2FPVA 3IJQA 3W7CA 3SO7A 3EDFA 3EXRA 1K7EA 3CTTA 4GGHA 4IPJA 4NNBA 1GOXA 1W54A 3BAXA 2GQ9A 3APTA 2V6AA 4DO5A 1WKDA 4FOJA 4GI8A 3HM7A 3KDOA 4B2DA 4AIEA 1FWRA 3W3OA 3M0LA 4QG8A 1KO0A 2ZZ3A 1I45A 3GNNA 3P60A 1CXEA 2IKIA 2Q02A 1OFBA 1P0EA 2VEMA 2FQIA 2CBUA 1DE5A 4EE9A 3S5YA 2VEGA 1GG0A 3HJZA 3CO4A 4X2PA 2FVMA 5TIMA 1XF0A 2QJMA 3L0KA 3U5UA 3MU7A 1VHNA 3WLRA 1Z89A 3TA6A 4GZIA 4PMOA 3GG8A 4DNHA 1Y0EA 3DN5A 1LBLA 3ABZA 3VIPA 1K1DA 4PSPA 1KM2A 1PZ3A 3CH0A 3PANA 5FEZA 1XI3A 1BAGA 3KVMA 4WQ6A 3AMGA 3TTEA 3WG6A 5TQLA 4AHQA 4KIEA 3T81A 3AC0A 3OU8A 1W1ZA 4ATWA 3N4EA 1UR9A 4D6DA 3PJUA 4HB7A 4RK8A 5EFFA 1UA3A 2DPEA 4E3TA 4L9ZA 1JCMP 3UZWA 3UEQA 2Q8LA 1M68A 2CXGA 3T2PA 5BRQA 4PMZA 1OX4A 2QVHA 2HSAA 2EGZA 3FK4A 3RPDA 5C5YA 5JBFA 1UQZA 2GWNA 2MNRA 2VDIA 4D6GA 4PTDA 3U7BA 4UFLA 1RV8A 1IXPA 5I3JA 4G1KA 3P81A 4YTQA 3VA8A 2ACUA 1DVJA 5I0DA 2V9DA 1LTDA 4FZIA 3E6EA 3WDIA 3QTGA 4CCEA 4K3ZA 3VKJA 3DC8A 2VKZG 3HQNA 4GI9A 3G1XA 3MDWA 4AQLA 5CAHA 1PJ9A 1GT8A 2D0GA 1HJSA 2ZA3A 1E6SM 4K7VA 3M4HA 1DWHM 3PWAA 4AX7A 4HYWA 2Y6ZA 4JX6A 2QDEA 3SY1A 4O10A 3B97A 4HNLA 3PR2A 1YKWA 1L2QA 1F8IA 1J0HA 4AIOA 1UZ4A 4XQ6A 1XLEA 2H9AA 4R7OA 1CYGA 4XZMX 3VDGA 2Y88A 2WOQA 3OJGA 5HA7A 3QSRA 1H61A 1KTBA 1QNPA 1C93A 4PUEA 3SIMA 1H4PA 2JKEA 5J5RA 3BK0A 5LXEA 1HFBA 3SCRA 2E28A 1V02E 2AMGA 1UWUA 3LLDA 2ZX8A 3F5LA 3ZJ6A 4XSLA 1NWSA 2V3FA 3MCOA 3A64A 4GINA 1QASA 1ODZA 2PWVA 1S5TA 5CPTA 5AYIA 5REQA 2OTDA 4L1WA 3I6TA 2DFAA 1G6CA 4KCWA 2NWRA 4LUSA 5D05A 4A3RA 1FKXA 5BU6A 3NO3A 1NP0A 1BGAA 1UD4A 1TWZA 3AHXA 1BGGA 3ARXA 1G01A 3TAKA 1UUOA 3NQ7A 2RDTA 4WK9A 1FCQA 4H7CA 3JW7A 3DCPA 3T78A 3CM4A 3N6QA 3URAA 4K7YA 4LFYA 3A5VA 2ISSA 1Q4WA 1SR0A 5EY5A 3DKLA 3FSUA 4MZ8A 4QS5A 4PMRA 1E1EA 1KFCA 3M6DA 5G4HC 3VM7A 2EPLX 1F2JA 4C1LA 3AXKA 4WKHA 4JNYA 3VKDA 2QW5A 1BWVA 3TN5A 3G0SA 5ABHA 1H0IA 1YDVA 4H3DA 1E4NA 1KBJA 1VPYA 2WCAA 3OLIA 1H7XA 4KGJA 3TZFA 4RNFA 4MZYA 3ATYA 1TA3A 1W3JA 5IRPA 4HCDA 2F6KA 4IFKA 4LRSA 1ICQA 3UZZA 4AIUA 1FH7A 4L5ZA 3EEZA 1HGYA 3T07A 2GGGA 4MWAA 2ZX6A 3WQEA 1LROA 3P2VA 1DJGA 3TNBA 1A5MC 2OMAA 4BR1A 3IIZA 4JTCA 1UQYA 5AHEA 3T2QA 5I23A 4IZGA 4PUUA 2CLFA 3DBPA 3APYA 2PB1A 3C3UA 4IJBA 4QDMA 3GDLA 1QNQA 2A7RA 2V2CA 1MNSA 1TVPA 2JBMA 3BG9A 1S2CA 3STPA 3NJ3A 1P7TA 3WDPP 4IMGA 1F3WA 3OQ8A 1WBHA 4IGHA 2IKHA 3HO8A 1IV8A 5BMWA 4OBTA 3WQ8A 1OBAA 4RE0A 4H9MA 4KFNA 1GONA 1K6AA 1QK0A 3M5VA 5HQLA 2O9RA 1A0DA 3H2NA 2QDDA 4X60A 3VOFA 2VDHA 4HSHA 5E0FA 3W6MA 5G4EA 2DVUA 4NI3A 3F4CA 1JPHA 2DUXA 4ORMA 3OLEA 1QWKA 4AD0A 4IGMA 2HMCA 3OVPA 2HWGA 1OFRA 4EPDC 2XHYA 1W1B1 3QFWA 4LV4A 1JUKA 1AH3A 2ABBA 1MEIA 4JKMA 3TCSA 2VFEA 1WDWA 4J3UA 4RE3A 3K5XA 3CJPA 1GVRA 4NRRA 3W28A 1CGYA 1LRQA 3V1HA 1XM3A 4U5IA 4B5XA 1VBGA 3I4KA 4HZMA 4XZIA 4M6PA 3UWYA 4U4MA 4MIMA 4EOUA 4NZ3A 2VZSA 3A5FA 2JE8A 2NQJA 1DIDA 2HVMA 4FOKA 1TV7A 2IPGA 4GO9A 2J13A 2OX4A 1T41A 1R87A 1EO7A 3MUIA 4U10A 1V3LA 1E72M 1IHIA 2E77A 4IXHA 1LL7A 3IGUA 3KOWA 4XSMA 1I0DA 1E9ZB 3UWUA 2HROA 3NUKA 1M65A 4WDUA 1UYQA 3S1GA 3BAWA 2OLAA 1Z9AA 4MOZA 1RLDA 4J3WA 2G97A 4JDYA 4B2DD 3KOYA 1UPMB 4PE8A 2ZFAA 3W7QA 3VIGA 4IL2A 1E0UA 1EH9A 4LS0A 4JQ4A 3VE9A 3L66A 1PHWA 1KGWA 1XLDA 5C9WA 5LA0A 2FZDA 3HJEA 1TRIA 2GVEA 4BQ5A 1HKWA 2BOGX 1R2TA 4NYUA 4C7DA 5I3KA 2OZ3A 3ZT7A 2IPJA 2WMGA 1RK6A 2JKPA 4HT3A 3NXFA 1W5OA 4LVGA 4POCA 3NEVA 4BHYA 1R7AA 1G4EA 2Y89A 1YW1A 2CHOA 4NAFB 4S3FA 4Y9NA 4FLQA 5AOUA 3N3MA 3FA3A 1GK8A 2WKGA 3QXBA 3OZOA 4ACYA 3WYZA 1JQVA 3THQA 2IXVA 2GSJA 3SCNA 1BG4A 3T1GA 1PTAA 3DFTA 4RW3A 2PEVA 3UYCA 4H9UA 1XD1A 2G5WA 3TTYA 4DYJA 2XWDA 1GKRA 1PIGA 4QJ3B 2RGLA 1BXNA 1S3HA 4ML4A 4PBGA 2DJXA 3P8IA 2EJ1A 2CLHA 2Z1WA 4XX6A 1NVMA 1C7TA 1AK5A 1W5PA 2O9OA 3U5YA 4LVDA 5I24A 1MYRA 3WQGA 1XIEA 3R11A 3RMJA 3WBYA 2OO6A 1HKJA 1TPC1 3PZNA 1YBQB 1YQ2A 4FNTA 3POHA 3BOLA 3GH4A 5CSUA 1V6XA 3IJDA 1EIXA 4JICA 3KEHA 4D72A 1EBHA 1KGUA 3UW6A 5EBAA 4MSSA 4GWEA 3O07A 4DRSA 3GH5A 3GIPA 4F48A 4P7QA 1RJPA 4C6OA 1QHOA 3B4UA 4UWMA 2QCHA 2J62A 5M5DA 3GSMA 1W1YA 3PZ9A 1UWSA 1U30A 5EYWA 1BQGA 3ICJA 4HKPA 4X9YA 3QQ0A 3F4DA 3HPAA 2PZNA 2W92A 3NPUA 3W24A 1DP0A 3C52A 4HGXA 4Y9MA 2UV8G 3PTMA 2ISWA 2OT0A 5C9XA 1FDJA 3KWXA 3W27A 5HNRA 5LIUX 4F79A 1SO4A 2C1HA 4HNNA 3N18A 2E7FA 1J93A 2HDJA 4RKAA 5U4NA 3AWOA 2D0HA 1EUNA 3MJYA 3F2BA 4REQB 1FXPA 1U2YA 2DVXA 3GTIA 1K9DA 1R86A 2DZVA 1MI3A 1D8WA 1RY8A 1UJPA 3A13A 3V0TA 2QS8A 4ECLA 2PDHA 3W2LA 3PJXA 4XVEA 1SUXA 1HJUA 3T05A 5AFDA 4GYPC 1DWAM 4MHBA 3RX2A 4Z2GA 1MRAA 3BZGA 2ISVA 4FX7A 2ISFA 3D47A 1XC6A 4F0RA 3OP2A 1EHNA 4WSKA 3LQGA 3O2LA 2HPMA 4C6KA 3ABOA 3B9DA 2XFYA 3L12A 3HOJA 1DBTA 1LOQA 2V5DA 2ZZ7A 2I57A 1CW2A 3O7UA 4Q22A 3VOGA 5BOEA 4LNYA 2VEKA 1TO3A 4WY0F 4R7WA 2F6UA 3GTXA 1RPKA 1REQA 3IIOA 3BAYA 3QY6A 1WAUA 4NAEA 2Y7DA 4ZTXA 4NJJA 2Z2UA 4HIBA 4O14A 7TAAA 3R5EA 3QMSA 1CGXA 3BMVA 1D3HA 1JNEA 1Z8AA 2VWTA 5E93A 3KOFA 4LU0A 3W86A 4TR9A 4MWAD 1TPB1 4N0RA 3W26A 3MMDA 2J4GA 3BMWA 4WOQA 3WF3A 2V81A 3HGJA 4L80A 4FXRA 3RX4A 3WKZA 1SQ7A 1GVOA 1TE6A 2D3NA 3RR4A 4I5UA 1VIZA 3E5BA 4YVPA 4H8VA 4YJ5A 1AW1A 9RUBA 2GDVA 4RW5A 1VFFA 2GDQA 4BF7A 3MKVA 2VGGA 5GJNA 3DG6A 3MV11 4LVBA 1O5KA 2Y24A 2GQ3A 5EMYA 4HU0A 1QXLA 2FYMA 4AZBA 2W61A 3DHFA 4RR4A 1CX9A 3IAQA 5A8OA 4WJEA 1OT2A 1NOUA 3KLKA 1BTCA 4AD4A 2Y70A 2YLAA 4O1BA 4RZ4A 3SQMA 1GOWA 2P3EA 1JZ7A 1RR2A 2VFHA 2ZRZA 3QN3A 2P1FA 3M0HA 1DKWA 1WNOA 1WYIA 2PDPA 4GQ0A 3DEQA 3CL8A 1RD6A 2GUUA 4V27A 1VD6A 1YPIA 3AXHA 4IUGA 3VNYA 4H00A 4M82A 1HVXA 3SSJA 3T2OA 4GXMA 5B7ZA 5CC3A 2XUCA 4R88A 5BNKA 4C1KA 4WDWA 4ZA0A 3ABRA 4GQQA 4F2TA 3QJAA 1T8QA 1J11A 1M9HA 2WNZA 3BCJA 4K8GA 4MFEA 5D2TA 3DYPA 3UA4A 3SEPA 5C9ZA 4PMXA 2GUBA 1OF8A 4O1EA 2JK2A 5IM51 1XINA 3OHMB 2PDUA 4GE8A 1TJ2A 1M7JA 2FZMA 1LDCA 1OIFA 1UIOA 1VJSA 2VX5A 1QTWA 4C1NB 3W85A 3R43A 3WH8A 1TRDA 3CAWA 5FJRA 1KA9F 2CBIA 2WB5A 3V16A 1SMDA 2RGMA 2ZCGA 3S9IA 1DJXA 4CLMA 4H2HA 1X98A 1A5OC 4JKLA 1Q6EA 2ZA2A 4JS3A 1XD0A 3VNMA 2A3HA 4LNCA 1RAKA 3UWVA 3EKLA 3ES7A 4P7RA 3ZM8A 1TV5A 4QROA 3QY7A 4K38A 3OIXA 1QW8A 2O92A 4ROQA 1V7YA 3VD4A 1XPYA 4W7VA 3ALGA 1RCQA 1H62A 1L6GA 3NL5A 4LX4A 1JCXA 5KZDA 1YPFA 3GVWA 1JZ2A 1D8CA 1AL7A 3R0UA 4Y8EA 2CPUA 1NAL1 4TMBA 4UFMA 3KL0A 3A3WA 2Z1VA 5CGMA 3CHDA 2DSWA 3UU0A 1WXZA 4JQAA 4BQ2A 3KS6A 1A4MA 4E0CA 2D1ZA 3GXPA 3LBCA 1I4NA 1KLYA 1R3QA 1OY0A 2XG9A 1DJYA 2R91A 2EKCA 3V3WA 1NOWA 1U33A 1G7UA 2ZIDA 2ACQA 3SUVA 1I1XA 3TSBA 1E56A 4Y96A 3N2MA 3MS8A 3KAOA 2SFPA 2Z1KA 1M7XA 3HA1A 1E6XM 2RH9A 3RCMA 1CI1A 1SYTA 4GIRA 3UQNA 5I3GA 3NYZA 3S6DA 3WUGA 5HMSA 3QC0A 1SJAA 1EJWC 1TJRA 2QIWA 4D71A 1FP8A 1BVWA 3OG2A 2OWCA 3WDRA 1JDDA 2DEPA 3C86A 3BLEA 1HJQA 6XIAA 3OBAA 4FAMA 3UD6A 4QAWA 4MKVA 4UTFA 4DBEA 2O7SA 1GUVA 2R94A 1E51A 2PGWA 3QFEA 3TFCA 3H7RA 3KLLA 3EWWA 2PWUA 5CPQA 4MUPA 1WDDA 3TQVA 1QI0A 1TE1A 1HIZA 2IQDA 5A6BA 3W7JA 1YADA 1FHUA 1F6PA 1UR1A 2WNQA 3BARA 3N14A 1O7AA 3O06A 2CZ5A 1ZQ5A 3LSCA 4FXJA 3TMLA 2OFJA 3CQKA 1B3OA 2WVUA 1RVGA 2OVLA 1NP2A 1G4TA 3BJFA 1B3YA 3GDKA 4L6OA 4JQ2A 4XAFA 3UPWA 3WD0A 3W2MA 5FSDC 3MYPA 4XBSA 2NX1A 5BWAA 3AS1A 3PBUA 3ELFA 2EXOA 5RUBA 5F2MA 1E6RA 2FH8A 1PKYA 1ZJBA 3DOPA 4HNCA 2R1NA 1N8WA 4MB5A 1D7KA 4UMCA 1ZB5A 2W79A 2NXHA 1ZBCA 4R9XA 3WJSA 4IPNB 5BRBA 1FFQA 5C54A 3VIFA 4ACZB 1JG9A 4O15A 3GVVA 1H7WA 5CZSA 3RJXA 2J78A 4DI9A 1I1WA 1XBYA 1BVZA 4U2ZA 3J7HA 3NXLA 2Y1HA 4EKJA 3F5KA 4DQWA 1DXEA 1UWTA 2WMHA 4Q7NA 3TYCA 1O95A 5A69A 1R3WA 3H6OA 1B1YA 1OD0A 3AROA 1NY1A 3JS3A 3VKKA 2CZVA 4UC5A 4N7QA 1YNQA 2NX9A 1S2WA 3TW7A 3FDKA 2I9EA 1H3GA 5G1MA 3WFAA 4PB3A 2PMQA 3W7NA 2PTDA 4BCEA 2WK2A 3BANA 1XG4A 4N9EA 5AHLA 1GPFA 3M6YA 1JXKA 3N2OA 1KC7A 1XIFA 1TIMA 4JD4A 3NQCA 3RIKA 3NSMA 1FCVA 4LF1A 1W8GA 1E0WA 4ZQPA 3CQ0A 4Z1CA 2VDGA 2XN1A 4A2SA 3QM3A 3EB2A 1SM9A 4OV4A 4M6UA 1RLCL 4C90A 4Q6JA 2OYKA 5J5DA 4HBKA 1KFEA 4X9SA 3M64A 2Y8KA 4WDTA 1K9EA 1SVDA 1UWIA 1WQ5A 4Z0JA 5E70A 4ZSTA 2FGLA 4R85A 2HISA 2QPSA 3GR7A 3UZYA 4GNVA 4LT9A 1QBBA 3E0LA 4XG1A 1N82A 4B3ZA 3HG3A 1RCXB 4Q8NA 4B5WA 3OTRA 4KRTA 3KTCA 5C0QA 3ARZA 3WLTA 3GAKA 4GJJA 1WZKA 3VX0A 4AZHA 2QLYA 3DENA 3CUIA 2W9MA 3V0SA 3KCOA 2BY2A 3STGA 5E1QA 1MEWA 4J2MA 1HJWA 4QGCA 4DN1A 5CSSA 2X0YA 3F2CA 1R7OA 2JEQA 5CPSA 1HQTA 4YCPA 5EPDA 1P0KA 3SECA 3DFYA 1KQZA 2PGFA 4FR1A 4KCVA 2JF6A 5A95A 4ZE5A 5CEWA 3FSTA 3W7IA 4W93A 2J7DA 4W85A 1GQNA 1S5MA 4CVWA 1E4MM 1OWQA 4KEUA 5D9PA 4Q3MA 1V3JA 3INPA 3I6RA 3BWWA 4RNJA 3L5AA 2PE4A 1HT6A 1QW9A 2D73A 4LS1A 1T7LA 1FRBA 3Q37A 3VTRA 1JF6A 3NZ1A 2WQDA 3DXIA 1ML1A 4H7VA 3ITTA 4F9JA 3MC5A 4IX2A 7XIMA 4AF0B 1H7RA 5EU9A 3AYTA 3M0KA 3PBGA 5BXRA 2J7BA 1QI2A 1XCXA 4G56A 2FZ8A 3ZR4A 1JVNA 1P6CA 1JCTA 3GNOA 3S83A 3C4UA 3NO5A 2QZRA 3VAVA 1XIGA 1UD2A 1A4LA 5H6HA 4QLJA 1FWWA 2ATMA 4H6KA 4S2CA 4CNNA 2NSOA 1P0NA 1AJZA 4QIUA 1CGUA 3FEMA 4ML9A 4E2OA 1UH2A 2WANA 4JL2A 1HL9A 3SUSA 3W7DA 3BOFA 5FA5A 5LNSA 1GVIA 4CD7A 5T91A 1DXIA 1J5TA 4AB4A 4WD0A 1FCBA 3ENLA 1U1JA 5D8WA 3AU6A 3VOIA 4AZ7A 5M2FX 4OZOA 3GDMA