2DJXA

Crystal structure of native trypanosoma cruzi dihydroorotate dehydrogenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCCTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of native Trypanosoma cruzi dihydroorotate dehydrogenase
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Dihydroorotate Dehydrogenase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2djxA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2djxA01
1KFJA 4QNEA 1TCDA 1WXJA 5DBUA 5K3VA 5CZ0A 3SIZA 4PH6A 1BWLA 2CZ5A 3E96A 5AC6A 5KITA 1K8YA 4IMDA 5AHMA 2HMCA 4X3ZA 3SR7A 3G8RA 3B03A 5BMWA 1VJIA 5E93A 4FB7A 3TC6A 4HKPA 1QOPA 3W7JA 3KOFA 1XUUA 2F7FA 1G67A 1ICPA 5I3GA 3W1TA 4PEKA 1VCGA 4WY0B 3W7OA 3NXFA 4HNNA 1THFD 5DCDA 3MHUA 5G4EA 2XFWA 4NXSA 1YXDA 4IXHA 2A7NA 4Z1AA 5G1YA 5E0KA 3LRMA 3LDVA 5AC8A 5F2GA 5EKYA 4J9JA 3WJWA 1QFEA 1YYAA 3GDLA 5EA9A 1PHWA 3W1PA 5D09A 1XUZA 3TSBA 4DO5A 3QQ1A 4NVTA 3M5XA 3FKRA 1KFKA 1FCBA 1SU5A 2W79A 3CLMA 1PL9A 3L5MA 5D2XA 2Y63A 3W07A 3HG5A 1S5WA 4DF1A 3HO8A 3G1AA 3NQDA 3SGZA 2OCZA 1XDMA 5C54A 5FEWA 1OK4A 1V5XA 2H90A 3DKJA 3W3OA 5CPOA 4PC8A 2X1UA 3W1XA 1LLWA 1LRNA 3FEMA 4UTHA 3DH7A 3QRHA 1I2NA 2QUVA 1H62A 4ORIA 5AHIA 3UWWA 1QPOA 2DZPA 1PCKA 1F74A 2VEIA 3LBMA 2DZWA 2QCDA 1ML1A 3LXBA 4ZQMA 1YTEA 3C8FA 3EX6A 1FCUA 3C2OA 3NR0A 4OBTA 3P81A 3LI0A 3KHJA 1Q6QA 1ZY9A 2OT0A 4OE7A 5D2VA 1D3GA 2EPHA 2TYSA 4RJEA 4JTIA 4S2CA 1BTMA 3F4WA 1DVJA 4MLJA 5CPLA 1H5YA 3NL2A 3EWYA 3GR8A 1L6WA 2PRMA 1RQBA 4K39A 1LYXA 4BI6A 3QH2A 2ISVA 4KFNA 2QCEA 4LUJA 3F1QA 1BWKA 3NQ7A 4WXYA 3B0PA 3TQVA 3WK0A 4UCGA 1ONRA 1XBXA 5J5DA 3TA6A 1EA0A 4FNQA 4EWND 4LV4A 4EVZA 3W1NA 1WOBA 1G4PA 4N9CA 2A6LA 2YZRA 2NXIA 5CKSA 5BW6A 5K9XA 3M9YA 3QMTA 2I1OA 3A21A 2LLEA 5K2ZA 1TQJA 2Y7GA 3DGRA 3LHTA 5BNKA 1GJPA 3CWOX 3TAKA 1RPXA 3HGJA 2B7NA 2ZQ0A 1PV8A 3NQAA 2VC6A 4UTLA 4JICA 1TRIA 4LWWA 4FXRA 2NX9A 1OFAA 1A5CA 3NO5A 3GXTA 4ZL1A 3G3MA 1K3UA 3E12A 1MSSA 3PSWA 5BMXA 2VELA 2NUYA 1IIHA 4Z1BA 3WK1A 1RV8A 4K7YA 3L68A 3NQFA 1KTNA 1VC4A 3M7WA 2NXHA 4IX2A 1H7XA 1C8VA 4ZQOA 2C3ZA 2JKPA 3CIXA 1W5PA 4L4MA 2D73A 4BF9A 3OVQA 3LV5A 2CFFA 4R53A 1B9BA 1OFQA 3S6DA 5SWUA 4YL2A 4MLRA 4K8EA 1LROA 1AL8A 2V8ZA 4N6EA 4CCEA 3HG3A 1K7FA 3LTYA 1KLYA 1R47A 3BW4A 1H7OA 4LC8A 1VPXA 5CZTA 4O28A 2GQAA 3LTPA 2ISSA 4ALDA 1CX9A 2ABBA 1ZAIA 2V2CA 3TW6A 2FB3A 3HPSA 2X16A 2Z2UA 4YXGA 1T96A 5K4ZA 4Y9AA 4GJ1A 1EIXA 3ABOA 4N2YA 3PG9A 4GBUA 4NT0A 4RLIA 1XCFA 2JKEA 3PBYA 4NJIA 4BR1A 3HG4A 1OX6A 2C0AA 2DJLA 2GVJA 1SW0A 3QF0A 1OF6A 3LM7A 3T7VA 1AK5A 4GUGA 4DF2A 3PUDA 1W8SA 5D2YA 3HF3A 2A85A 4FXSA 5F1UA 4UFHA 3TQ0A 3A24A 3LCHA 3PM6A 3C56A 4A21A 1H1YA 2WJZA 2GQ8A 1CI1A 1WV2A 3W83A 1ZJIA 3MMTA 1TO3A 5EY5A 5AYXA 2R94A 2E77A 1AMKA 1F05A 4QIUA 3SZ8A 1YPIA 1Q6OA 3W23A 2E6FA 4NJHA 3P7YA 3LBCA 4QSHA 1XC4A 4IQLA 3N14A 3WJZA 5CPNA 4AF0B 5LHFA 3MWAA 1R46A 3F4NA 1CW2A 2Y7EA 1ZAJA 2VFDA 3GNNA 3JR2A 3LHZA 3VE9A 4DQWA 1FQ0A 1TV8A 3OIXA 4XWUA 3UY7A 4POCA 3IV3A 3L67A 1C29A 4AWSA 3L0KA 4M6QA 4IMFA 4HPJA 4WY0A 3IGSA 4RXGA 4UFKA 4UC5A 1DJQA 3AO0A 3G1FA 3VI2A 4NX5A 5LSMA 1P0NA 2B7OA 5AFDA 2ZZ3A 3LHWA 2GQ9A 3E02A 5L9FA 1TPC1 3STFA 3PBVA 1TPUA 1JUBA 1G7VA 4RZ6A 3ZWSA 4Q4KA 2RDUA 1PS9A 1UASA 1KV5A 3BW3A 2VFGA 3IRDA 3GAYA 3R5EA 1DJNA 3THQA 3LCXA 3TJLA 5T26A 3GX9A 3TNOA 5LNVA 2QJGA 3M16A 1A50A 3PY2A 1HO4A 4NJKA 2B7PA 1XDLA 2PURA 1UBSA 2Y88A 3L0NA 4AVFA 1A5BA 3PULA 1W54A 2QCNA 1DL3A 3JRKA 3M43A 4LS1A 1RD5A 2GUUA 3CWNA 2X1SA 4N4PA 3Q2DA 3Q37A 3M41A 4LVFA 2ZRYA 1NEYA 4JYEA 3LERA 3BLIA 4RCXA 3W1LA 3S5NA 2XN2A 4GXMA 4M19A 3FYOA 3T55A 3OG3A 4JD4A 3NZRA 2X1RA 1OFEA 1G69A 4EIVA 5C2XA 2A1YA 4UR8A 3KVLA 2ZBTA 3IGUA 3W7GA 4UFMA 3UZJA 3B0VC 4Q32A 3KRSA 3W7PA 2QJHA 1TQXA 1TREA 4GE8A 5HULA 5DELA 1GYLA 4LOCA 3TQKA 3VCRA 3GK0A 3HOJA 3EX2A 4JY9A 2NV2A 3YPIA 3W72A 4JY8A 5LNSA 2WPBA 3E0IA 1VRDA 3NPWA 1SUXA 1AL7A 3TROA 3BVJA 2X2GA 4E0CA 2KZHA 2P0OA 3VFLA 2QEZA 3SSJA 1XBZA 1TPFA 3HBLA 4QISA 4TMBA 3S5OA 4MVAA 3U2OA 3LOTA 1K8ZA 2JGYA 2ZRZA 4JTEA 4OV4A 3TXZA 4DBDA 2J9ZA 1OFOA 1VR6A 5FESA 2J6XA 3PF3A 1KTBA 3DI1A 5C6MA 4E2BA 5HR7A 4JX6A 2PRHA 4XBSA 1QO2A 2TRSA 3T4CA 1O60A 2CLEA 4BWLA 2ZZ2A 3BARA 2CWNA 1U83A 3NQEA 1G4SA 2J88A 3S42A 3UPWA 4GFSA 1OX5A 3MUXA 4G1KA 2UV8G 2G96A 4HHPA 4NZJA 4LRSA 2ISWA 3HGOA 4GUIA 4QITA 1H7PA 2FPYA 1YXCA 1OG0A 4I7WA 2YR1A 3DFNA 5FF2A 1KBIA 2G5WA 2NUWA 3W22A 3FFSA 3WK3A 3QPYA 3CC1A 4EF9A 4LY8A 3QZEA 2Z0IA 2NX3A 5FEXA 4MY1A 3G1VA 3TW7A 2GPTA 1KM2A 3PBWA 4X9SA 2VEMA 3W7IA 4HSOA 1GVSA 1TPH1 1IXQA 3EEGA 4MFEA 1W1ZA 1HTIA 4XZ9A 1YDVA 3IIPA 3W88A 1A5SA 4A29A 4E38A 3TH6A 1K03A 4I7VA 4TMCA 4JEQA 4TU1A 3B8DA 3DENA 4CNNA 5K4XA 2FIQA 1XFBA 4AWUA 1KW1A 2CLFA 1FDJA 2C19A 3EWUA 1G4TA 3I7QA 3BPWA 3MO7A 1W5MA 3PG8A 2PE4A 3CEPA 4UR7A 2NLIA 1KFCA 3C2EA 1F7BA 3TJXA 1I4NA 4Y90A 1QDSA 4JIQA 5LNWA 1XM3A 4DPPA 4O0ZA 1FWSA 5DCBA 3NQ8A 3AJXA 4O13A 3LX9A 3FIGA 2YGYA 5LZLA 5HUOA 1H7NA 4FEZA 1HG3A 1KM0A 3B05A 3CPRA 4GC4A 2AAMA 4O12A 2DU2A 1U5JA 2X30A 3DFOA 4BI7A 8TIMA 2R14A 1GVQA 3NAVA 1AG1O 4K6AA 1H50A 3G8EA 2CLLA 2DZVA 2EF9A 2E1DA 5LGZA 5I3IA 4LVAA 1NSJA 3G1XA 4JN6A 5CG7A 1MEWA 3L65A 3P61A 1LOQA 2F84A 4O1BA 5F4XA 3NM3A 1ME9A 4GUHA 3N34A 1GPWA 1HO1A 1F6PA 1IXOA 3OVPA 4MZYA 3HMJG 2GOUA 3HGRA 3RNDA 1TTJA 3PAJA 5ABTA 2TSYA 3P84A 5DXXA 5AHLA 4CQAA 3BG9A 1SR9A 1UJPA 3UWQA 1IXNA 2V81A 3QC3A 1GT8A 3PS7A 2QUUA 3RFAA 1EB3A 4PA8A 3FJ6A 5G1TA 3M44A 4O50A 4IPJA 3KVJA 4UTTA 2AGKA 1TV5A 3QPZA 3S5YA 3B04A 1GVFA 2Y61A 1J4EA 4JDYA 3IIZA 1ADOA 1WAUA 2C13A 3SY5A 2WSRA 2ATSA 1TJPA 4A2SA 2VFFA 2WNNA 6TIMA 2VXNA 1SZGA 1OHLA 4MZ1A 1L2UA 3ATZA 5AC7A 4ZZ9A 2YCEA 2ATMA 4LVGA 1B4KA 4MYAA 3H53A 3NGJA 2FDSA 3SGUA 2DJXA 3DKLA 2CZFA 5CGQA 3S1VA 1BEUA 2YPIA 3WJYA 1EPXA 5HJLA 1QAPA 3MI6A 4LS0A 1BKSA 3CQ0A 3UXAA 1ICQA 5FF4A 1JCMP 4JTLA 4FX8A 3QEZA 3TIMA 2OMAA 3PWAA 4AHOA 5AB3A 3WJSA 3L2IA 3EXRA 4JTJA 4NJJA 1TPB1 1GWJA 4MOZA 2CLOA 3W87A 1SQ7A 1J2WA 1JQXA 1TSIA 4NQ1A 2VEKA 3LRKA 3E9AA 5LNRA 1VZWA 3SECA 4I9AA 3BGJA 1LP6A 1AW2A 3WK2A 5A5WA 3P5YA 3QW3A 4JYDA 1QMLA 2B7QA 3C4UA 1DQXA 3W1UA 1TB3A 1Z41A 1SZNA 4JNMA 1W3IA 5FF0A 3OA3A 4IPIA 4H3DA 4Z1DA 3N9SA 4LRTA 1W5NA 3S9YA 3MYOA 2QR6A 2H8ZA 3NEVA 2Y7FA 1I8JA 5KZDA 1KM4A 4YWIA 2RH9A 1H63A 5AYYA 4D2JA 1W31A 4RZ5A 1G4EA 2DZUA 1KLZA 3Q94A 3UD6A 3W2KA 1JUKA 1YTDA 3O63A 2A5HA 1VLWA 2Y70A 3GIYA 4TR9A 3NNTA 1I2OA 3EX3A 2DORA 2W0UA 4DXVA 2E09A 2A6NA 3L9CA 2A4AA 4JIPA 4YMZA 3LHYA 2YYUA 1N8FA 3TU9A 4N02A 5H2ZA 1TPWA 3G24A 3NZ1A 4JTSA 3P62A 2OX1A 4UFLA 4TO8A 1W3NA 5HWNA 3OHIA 1O95A 4PFMA 2VENA 2YSWA 3OBKA 4H4IA 4O1AA 2YDAA 3QFEA 4OT7A 2E5DA 3O6CA 2HS8A 5DY2A 4ZVJA 1D9EA 2Y62A 3B0UX 3ABSA 2DZXA 4K37A 1MXSA 3LCLA 2QDHA 4CCDA 1JCLA 2ZZ7A 4XTIA 4O14A 3W1MA 4X2RA 4RK8A 5F2IA 2NZLA 1ME8A 3T44A 3LRLA 2WO5A 5LKYA 3P74A 3UWYA 3G1YA 1LBLA 1RVGA 1F76A 1SO5A 2ZRWA 1W5OA 4IMEA 3NM1A 3INPA 1VGAA 2BLEA 3C0JA 3R89A 3RK8A 5EMUA 3PVFA 3CEUA 3W7LA 4ZQCA 3RF9A 1HFBA 3MHFA 5AOUA 4UTIA 5KINA 1W5QA 4UFIA 3SW6A 1PCWA 3QSTA 4MIMA 5CSSA 1VQTA 1IGSA 3G1DA 2ZRUA 3FYPA 5HINA 1M5WA 5H91A 5G2IA 3UYCA 2ALDA 4Z1CA 1T0OA 3I6RA 2QCFA 3W1RA 1LBMA 2DP3A 3LCFA 2BTMA 3UQNA 4FNPA 3ATYA 1QWGA 4P61A 4UNKA 2NX1A 2CU0A 2Z6IA 2ZZ5A 3THAA 1H61A 3STGA 4OQVA 3M5VA 4AWTA 3L0GA 3WJXA 5AYZA 4S2BA 3TX9A 4KFPA 1FWWA 3FOKA 4FIRA 2A0NA 1T99A 1NF0A 3CU2A 2CZDA 1TTQA 4ZQNA 3NG3A 4MJMA 2NV1A 1WBHA 1FWTA 1Q3NA 3F03K 3KRUA 2ZTKA 4LS2A 3EWBX 1LLZA 4GUJA 5D2TA 1HL2A 1VHNA 1P5BA 1Z44A 3BG5A 5D04C 4JXCA 5F2MA 2J9YA 2QJIA 5D38A 2CLKA 5G2WA 2B4GA 3W71A 3W7CA 1SO3A 1Z48A 3MI2A 4UXDA 4ORMA 1WOAA 1VYPX 3TV8A 3A9IA 3GAKA 2VFHA 2Y6ZA 1JRBA 1X1OA 3C61A 3NOEA 1MEIA 1QO5A 3EKLA 4FNSA 2GVLA 1KFBA 3FLUA 5HR6A 3QQ0A 5BOOA 4NUWA 2C16A 1OFPA 1JRCA 1H1ZA 3LV6A 4HIBA 3BK0A 4QJ1A 1LDCA 1D3HA 4PL1A 1PHQA 3O06A 1KV8A 3EXSA 1K7XA 1M7OA 2Z6JA 4IX0A 3I7SA 4IJBA 4JTTA 3P8JA 5A8GA 4O4VA 3G22A 4UMCA 2R91A 2JK2A 1Q6RA 3S1UA 1WYIA 3M0ZA 3A22A 1EWDA 2V2DA 4KFOA 1YDNA 5IM51 3PUEA 4UTMA 4DEFA 1I2PA 2YFOA 4NXKA 3ANYA 4XTDA 3LCIA 4WX2A 3CT7A 1W37A 3H55A 3O07A 1KTCA 3I65A 2C15A 5DY3A 1NVMA 4MUZA 5MHBA 3P60A 4FO4A 1EP3A 4WXZA 3KRZA 3TKFA 4RZ4A 5I3JA 4PODA 3GXPA 2QKFA 1H60A 3L5AA 4XUGA 3MHGA 3HQ1A 1ZFJA 4E2DA 1SO4A 4OU1A 1UUOA 1TRDA 1SZEA 1KM1A 3BO9A 2WV8A 1EWEA 1A53A 1YDOA 4XKYB 2ZYFA 3M5YA 1SZFA 4AXKA 3W7EA 1VCFA 4CCCA 3RLVA 2C14A 4Y8FA 1B3OA 3LXCA 1LCOA 1H7WA 3MW7A 3TSDA 3RLUA 2QUTA 4X22A 2V5BA 2H3DA 1M6JA 2YXGA 2Q3OA 1V7YA 1OYBA 5HNRA 3NA8A 1W0MA 3UZ5A 3G1HA 3MBDA 1UB3A 2ZZ4A 2WKJA 1XBVA 4I7UA 2Y7DA 1EEPA 3DHDA 1FDYA 3IGXA 5K7JA 3DFSA 4CNPA 1E51A 1S5TA 1OK6A 2Z1BA 1W3TA 2WOQA 5FEZA 3NL6A 2FJKA 3V75A 5F2LA 3HIJA 2A7RA 2FLIA 2ZZ6A 3M5ZA 2TMDA 3GXNA 3NQVA 5CZSA 2QCCA 3TMQA 4MJZA 2Y89A 1X1ZA 4UTTC 3ZS4A 4K38A 2O7SA 1TPDA 4CNOA 3FJLA 4O11A 1KA9F 3UWUA 4HN4A 2V0TA 3UY8A 2I14A 3T78A 1I2RA 1Y0EA 4LVBA 1N7KA 4AEOA 4HNVA 5AHNA 4OV9A 4ONVA 1FUYA 3TE9A 1XXXA 4O52A 2A7PA 5G4WA 4AMAA 1FX6A 1ZAHA 1F2JA 3H54A 4WJEA 3PB2A 4LVDA 2H6RA 3M1ZA 5D32A 3MP5A 5DCEA 4UFJA 1VH7A 5D03A 4WUIA 1MO0A 3NYZA 2J27A 1TMHA 2BXVA 1R30A 3VKJA 1LRTA 3DFTA 2VEPA 1QR7A 2AQWA 1O5KA 3R13A 2VFEA 1QCWA 4XQ6A 1JVNA 4JDBA 2XN0A 3LLDA 3W2UA 3GDMA 1EP1A 2WNQA 1K8XA 1JULA 1FXPA 3USBA 1WDWA 1FDZA 2E68A 2ZZ1A 7TIMA 3TUUA 5F1VA 3M47A 3LCGA 1IIGA 1JR1A 2NWRA 1OFRA 1GQNA 2HTMA 3A23A 3DXIA 3LGEA 5CSRA 3KX6A 1G6CA 1TTPA 3N2XA 4O8RA 3MYPA 1F6KA 1L6YA 1EUAA 4R7JA 2H3BA 3EXTA 4S1FA 2RHGA 3KFTA 2FFCA 1OFDA 3C2VA 1EUNA 1G7UA 3GLCA 3DFQA 1OVDA 4LU0A 4UMAA 4MZ8A 3S0CA 4GRSA 5U4NA 4BWLC 3HPZA 1I2QA 1NF7A 3W1AA 5EBUA 5KSWA 5DBTA 1TYGA 2A21A 1DOSA 3HB9A 2RDWA 5D33A 3I68A 5CPMA 3UWZA 2GVGA 4NNCA 3QYQA 2R8WA 4MY9A 4RV8A 5FEPA 1GTHA 2O7QA 2P10A 4Z0JA 1M7PA 1VS1A 3W1QA 1HUVA 4QNWA 2NUXA 1FCQA 5AN7A 3C2RA 2OZ0A 3IEBA 3NVTA 3O05A 4WOQA 5J5RA 3S1WA 4GWEA 5I3FA 2QCMA 3RMJA 3BG3A 1NAL1 2FB2A 2ZA2A 3V1PA 2A2IA 2HS6A 3ELFA 5F4WA 4UTWA 3I7RA 1F5ZA 4XBKA 2ZRVA 1XBYA 4M7SA 3N19B 2QCDB 1RQHA 1OX4B 4NJGA 3G0UA 3N3MA 3CTLA 3W7HA 3IIXA 3W75A 4C1KA 1YTKA 4JGDA 5CZJA 4A22A 4M5PA 4NU7A 3L5LA 3HJZA 4Y6GA 1SFLA 4IUOA 3UNDA 4Y96A 3B4UA 2VFIA 2ZCGA 5C55A 1VLIA 1WQ5A 1LRQA 4AHPA 1JCXA 1L9WA 4FHAA 1JCYA 1YADA 4GUFA 1XKYA 3CB8A 1JUEA 1QNVA 5C5YA 4KWVA 3CHVA 1R2SA 4IWWA 3C52A 3PUOA 4JX4A 4AB4A 1XL9A 4N6FA 4JTGA 2B0MA 1ZHAA 4DO6A 1W56A 4Z0SA 2J24A 4RKAA 2W6RA 2YW3A 2QDGA 3QM3A 1FBAA 3UPBA 3U8GA 3NQGA 4KKXA 5DN1A 1ZCOA 4O57A 4N9EA 5AHEA 2ZDRA 2X1TA 4ICNA 1N55A 4JTHA 4L4LA 3GKFA 4LUIA 3ABQA 5KZMA 3N73A 4QM1A 4O16A 4JR5A 2VKZG 4UTKA 4O53A 4OGZA 2QAFA 5LNUA 5BRBA 2JGQA 4LTSA 4AH7A 4FX7A 5D02A 2QCLA 3DHFA 3CIWA 1OYAA 4NZFA 3G0XA 2J9XA 4ADUA 1IXPA 3GDTA 4YCPA 1DV7A 3PR2A 4DO4A 3GNDA 3G3DA 4HNTA 1OF8A 3TCEA 1L6SA 3NQCA 1UCWA 1Q45A 1SW7A 4O19A 3HPXA 3GB6A 4IGHA 2C6QA 2EGZA 3C2FA 3W84A 1NFBA 1FWRA 3FA5A 5LGXA 4EF8A 3QMRA 1J5TA 2BWGA 1WBJA 4IMCA 4PTNA 2H8XA 3S1XA 1X8FA 2Q3RA 1OX4A 2E6DA 1PIIA 1RR2A 3BGGA 1VCVA 3ABRA 3VNDA 3O15A 4PL2A 1PVNA 1QPRA 2I9EA 3OEXA 3W7MA 2JKAA 1SW3A 1DQWA 1X6UA 4IOTA 1R2RA 3S5ZA 1TTIA 4MYXA 1GEQA 1DORA 3W7QA 3W74A 1ZENA 3R2GA 3C3NA 4DELA 5KTLA 1O94A 4JTKA 2ZRXA 4M7TA 2CZEA 3QMSA 5I3KA 1B4EA 2Q8LA 2YYTA 3G1SA 5K9DA 4DBEA 1GVOA 3W70A 2P1FA 3P67A 4Q33A 4Z08A 1DKWA 4K7VA 4DF0A 4UTJA 1VHCA 1VYSX 4UNLA 1LM1A 5K9CA 3QW4B 2NXGA 5KMYA 4UUIA 5D05A 4JTFA 3O16A 2BSLA 4ZMGA 3LHUA 4RXFA 2XN1A 2G95A 2WNZA 2IQTA 3DAQA 3DZ1A 1FXQA 2RDTA 1YLVA 3U6WA 1I45A 3W2JA 1OABA 1ICSA 1LORA 2QF7A 3ZWTA 3BLFA 1GOXA 3SJ3A 3NQ2A 4BI5A 3L21A 4BK9A 2ZTJA 3DFPA 4UTWC 5D37A 3TK7A 3WFAA 1P0KA 4FNTA 2FPVA 4UMBA 3OVRA 1H7RA 6ALDA 4UTUA 4CLMA 3GDKA 4U4MA 3UXDA 2WQPA 4LW7A 4KWWA 3SFKA 3PBUA 1O5XA 4EOUA 5GVJA 2YFNA 1GG0A 3BLEA 2FPTA 4FX6M 4O0KA 4JYFA 3LXAA 4HNUA 5F4SA 5IBXA 3W6YA 1Z42A 5D30A 3W76A 3PC0A 1TV7A 2PCQA 1P4CA 4QQ3A 2ZA1A 5TBOA 4LT9A 3A5VA 3GZ3A 4O4WA 3T40A 4ADTA 4N9BA 3TMLA 4YCOA 3LB0A 1GZGA 4O15A 1LOLA 3K30A 5E1QA 5LHEA 3D0CA 4O54A 3NL5A 1LOSA 2TPSA 2ZA3A 4AAJA 3NQMA 2BZNA 4JTUA 5IBXC 3TR2A 1GG1A 4HSNA 3L66A 3N9RA 3QJAA 4MFDA 1AW5A 2Q8ZA 1SPQA 3NPXA 1WX0A 1RZMA 1AW1A 1QPNA 3STEA 1QOQA 3W2MA 4W9TA 1X7FA 4M6PA 5TQLA 3RU6A 3TFXA 2CLMA 1PE1A 4AF0A 3DBPA 1OJXA 3EWWA 1KFLA 3P80A 4RR4A 2OJPA 3EKZA 2VOMA 3KAOA 3FKKA 1P1XA 5DXYA 3EWZA 3IIVA 2DZSA 4NNAA 3KXQA 5FF3A 1H51A 3PSVA 4R34A 1Q6LA 1TPVA 1K7EA 1ME7A 3GDRA 4GNJA 5DLCA 2BX7A 2QCHA 2CLHA 2GJLA 5HWMA 1KM3A 5HMSA 1YPFA 4TX9A 3O6YX 1GYNA 3R12A 5D2WA 4ADSA 3LHVA 2V30A 3P82A 3TFCA 3GYEA 1WA3A 2V82A 5FF7A 3W86A 3M6YA 3BW2A 3JS3A 4IXXA 3R8RA 4HT3A 2FTPA 4WOZA 1A5AA 5I3HA 3UWVA 4NX0A 1VYRA 1LBFA 4P2VA 4MY8A 4R33A 1TIMA 1K02A 2QAPA 5KZEA 2ABAA 3NPUA 3W7NA 1EP2A 1SSGA 4QAIA 2OT1A 2RKXA 4A3UA 1JQVA 1KFEA 3N2MA 5EL1A 5EPDA 2E6YA 5HWJA 3O1NA 1T8XA 4FNUA 4UIOA 3STCA 1DBTA 4TIMA 2E6AA 1JCNA 1XI3A 4C1LA 3GR7A 1DHPA 2DZTA 1KBJA 3EB2A 1ZALA 4O1CA 1S5VA 1ZNNA 2V2HA 4DPQA 4JX5A 3O6DA 2V5LA 3W9ZA 2PRLA 3TC7A 2ZFAA 2EHHA 4O10A 2NWSA 4YLWA 3G18A 3HG2A 1OFBA 5HQEA 4A2RA 4N9DA 4FNRA 3W2LA 4FIQA 1TJRA 3S8HA 3FS2A 1FCVA 4LC6A 2E5CA 3ZR4A 1MZHA 2WSQA 3ZFHA 3W73A 2CW6A 2GJNA 2Y85A 1JCJA 3LLFA 1LZOA 3W85A 3IVTA 4CQ8A 3W2NA 1QPQA 5G2HA 4BFAA 1EX5A 1ALDA 4CQ9A 3MP4A 5U7SA 5L6UA 2V9DA 4HPXA 1GVRA 4LNYA 3TSMA 3IIOA 4WQ6A 1MEHA 2QCGA 1LTDA 5TIMA 3NPVA 2C18A 4ZQPA 4LV9A 1UUMA 2PC4A 3Q58A 3PB0A 4IMGA 4AHQA 4XKYA 3EX4A 5G5IA 3IVSA 1GTEA 4MPQA 1SSDA 3KVKA 3LCWA 1YXYA 4WZHA 3NDOA 3MP3A 2YX0A 4OHQA 3DI0A 5AHFA 3GVGA 3A5FA 4O1DA 2RFGA 2EAWA 4K8HA 4WD0A 4PCFA 4O18A 3QSRA 1F73A 1C9DA 3P8IA 4JS3A 1SFJA 3G0SA 4ZQRA 3MJYA 3LTSA 4WY0F 4U28A 5EYWA 1R2TA 4RX0A 3MI3A 2G97A 2YW4A 3B06A 3HGSA 1JJKA 4NNBA 1FY6A 1KM5A 4FF7A 1SO6A 1OYCA 1TPEA 4OWGA 5FI8A 2WSYA 4K36A 1B57A 4M6VA 3BV4A 3O8AA 3E49A 2EKCA 3TDFA 1RQEA 3TXVA 1S3HA 1KM6A 1O4UA 3W7RA 3LI1A 1IF2A 4H6KA 3GKAA 3DU0A 2FQIA 4B5NA 4ML9A 3NQ6A 2JBMA 2CLIA 3CM4A 3EWXA 3W7KA 3P5ZA 4MKNA 2C1HA 3W7DA 3KVMA 5HUPA 4O17A 2E5BA 3SI9A 3EX1A 1FWNA 3TAOA 3IVUA 2HSAA 3VE7A 4N4QA 3MBFA 3NL3A 3C6CA
chains in the Genus database with same CATH superfamily
1TCDA 5K3VA 8XIMA 4HYRA 4QG6A 5AC6A 1PDZA 1K8YA 2QV5A 3WH9A 3M07A 2BY0A 3TCSA 4HNOA 3PZVA 4FMVA 7A3HA 1I9CB 4P8WA 4CQCA 1BAGA 4FF5A 1QOPA 1E1EA 1ITCA 1XUUA 4XD5A 2MNRA 5I3GA 2ANUA 3W1TA 1V02A 1GQIA 3SEPA 4XX6A 3FGCB 3LGDA 7REQA 3KRBA 4NZ1A 4NXSA 1YXDA 3VIJA 5I06A 3KEHA 4KWUA 3LDVA 5AC8A 5CJNA 4ATWA 1QFEA 1A47A 5EA9A 1V3HA 5D09A 2I17A 1DJYA 2Z7GA 4DO5A 1UKQA 2YOCA 3M5XA 4DZAA 2J74A 5FKYA 1M53A 3NUKA 2J13A 2OPJA 3UXIA 1SU5A 3SCWA 3ALGA 3PTQA 2VYOA 1KQYA 5D2XA 3MV01 4H04A 3R43A 1B90A 4WR3A 5D9MA 3H2CA 3M0KA 3MUIA 2OCZA 4U33A 1OK4A 2H90A 2BS9A 3NZQA 3W1XA 1I2NA 3QRHA 1DWHM 2VEIA 3SY8A 3LXBA 1QI3A 1J96A 2VZVA 4GCXA 3EX6A 1F9CA 1XLLA 3C2OA 3LI0A 1JXKA 2ODOA 3ARVA 4IM4A 4XO6A 3MVTA 5M5DA 3AMCA 2D2GA 3T0BA 2EPHA 2G3FA 1XIBA 3AIBA 3RXZA 4CEUC 1H5YA 4ZSUA 3CHCA 1ITQA 3SY1A 1L6WA 2PRMA 4LB3A 2OKTA 1QHZA 4GZ7A 1IZCA 1OINA 2VC5A 4LSBA 2QCEA 1A5MC 3WH5A 3CBWA 3IUIA 2ASHA 1NOFA 2V5KA 2Z25A 4HOXA 4EWND 2G4JA 3ME3A 5TNVA 3WF1A 4N9CA 3MS8A 5CKSA 5K9XA 4B15A 4ZFCA 1FWHC 1UWUA 3DECA 2WYSA 5K2ZA 1EDTA 1GORA 2Y7GA 2GJPA 1B31A 1UBPC 2QF8A 4GX8A 3NQAA 3EB4A 1UW9A 5BXPA 1RXOB 3NO5A 4ZL1A 3E12A 4JL2A 2B31A 4ZEPA 2DIEA 4K7YA 3L68A 3CGTA 1KTNA 4B5TA 2W63A 4L4MA 1W5PA 2PDNA 3WMSA 2CFFA 1JZ5A 1ISXA 3S6DA 1XQLA 1M65A 1V08A 2OWXA 5GJPA 1MFUA 1R9ZA 4GI9A 2YA1A 3CO8A 1R47A 3BW4A 3CUJA 2BOGX 3VNLA 2GQAA 2C91A 2YCKX 3IAQA 3HPSA 2X16A 4Z2JA 5GNZA 1XIEA 3E5BA 1S1RA 2R1NA 4H8UA 3DIPA 4GJ1A 1UD2A 4RLIA 2D3NA 3AS0A 3AS2A 1XCFA 3VD4A 4NJIA 4IQDA 4XAGA 1OF6A 4KEZA 3UXKA 1KKRA 1WKYA 3AAMA 3TN3A 3PUDA 1JFHA 5D2YA 1XP3A 1EHNA 3SQMA 3MV11 4X0NA 1QNPA 3PM6A 1E4IA 2WVUA 2HXTA 1Q65A 2Y0FA 1BVWA 1WV2A 1X6NA 3W83A 1ZJIA 4AYGA 3W27A 2R94A 2GGIA 2DSWA 2J7HA 1EF3A 1YPIA 2XU2A 5EMKA 2E6FA 1WDPA 4NJHA 1UWSA 1V51A 1XC4A 3UZZA 4J2PA 3BH4A 2RDXA 4Z2HA 5LHFA 2AQVA 3R0UA 3F4NA 2VO5A 1CWYA 1ZAJA 2VFDA 4IP4A 3JR2A 4FI4A 3VE9A 5FJUA 2BODX 1TV8A 3OIXA 1B9ZA 3L67A 4CN4A 3VKBA 4WY0A 5C7VA 4DZIA 1W1A1 3LHWA 2GQ9A 3E02A 3RLHA 4IIEA 4GY0A 3TONA 1TPC1 3WQOA 3STFA 3DEQA 4EPDC 3LY0A 5HQMA 1JUBA 3RCNA 4UQBA 2Q01A 1KV5A 1FKWA 3V5OA 2VFGA 2P88A 1OC5A 3H2OA 1REQB 1PXGA 3LCXA 2QJNA 3TJLA 3GX9A 2J77A 1HO4A 2QUNA 4NKCA 4AVFA 1A5BA 1DL3A 1I1XA 2GGGA 2Z1WA 4Q8MA 4DJED 4Z2GA 2X1SA 3LU2A 3Q37A 3MMUA 2QULA 2XH4A 3H12A 4IH3A 2ZRYA 2PZ0A 3L4VA 3S5NA 3QOMA 1WDDA 3VM5A 3FYOA 1R9XA 4BQ2A 1RSCA 4JD4A 4KESA 3WLHA 3DFHA 3NZRA 3UGVA 2D2JA 3L2MA 4S23A 4ZXLA 3S9IA 4EIVA 1D7FA 5D9NA 1ZL1A 3UZJA 3GFZA 3OPSA 5I0DA 3ARTA 1P6BA 1WUEA 5JXQA 1J0KA 4GE8A 5HULA 4LAKA 2OXNA 3GK0A 2XTKA 3EX2A 3E2SA 2BMBA 2OR2A 3JZUA 3AHXA 1QWKA 1VRDA 4CN6A 1ZRQA 1GONA 1E5JA 2P0OA 2OYLA 4ACZA 1NP0A 1TPFA 1CT5A 4TMBA 3RGTA 4A6GA 1XWYA 4MVAA 2Z7KA 3M0YA 2JGYA 4B4HA 4JTEA 1OC6A 2J6XA 5C6MA 3V5FA 2Y8VA 2X2YA 3BXWA 2ZZ2A 3BARA 3ZSSA 1B2YA 1G4SA 1E3XA 2XDFA 4ROQA 4G6CA 3GC2A 2F6XA 3UPWA 1J0ZA 2W27A 1NTHA 3C86A 2V3GA 4NZJA 1MQPA 1H7PA 2FPYA 2A3AA 2DPEA 3A6OA 2G5WA 3OODA 2F9RA 4IFRA 3QPYA 2NVAA 3CC1A 1IZJA 1X7IA 3DDMA 3G1VA 1OT2A 2GPTA 3PJTA 4X9SA 3TW7A 4B16A 5A3HA 3W7IA 2J7CA 1IXQA 1TE6A 3N29A 3EEGA 1DJGA 4GOAA 1TWWA 1OCNA 1XLEA 3IJLA 4A29A 1UWRA 4PMJA 3N12A 4TMCA 4JEQA 4TU1A 3FXYA 1G01A 2E28A 4YVXA 1FDJA 1JF5A 1DWGM 3PG8A 2PE4A 3BLKA 1UA7A 4DBSA 1KFCA 1L6GA 2GJXA 2ZOXA 3C2EA 4E2OA 3OLIA 2J47A 1Z32X 4ZB0A 4DPPA 2R1LA 1E9IA 4LALA 3ONBA 4FP1A 3DG6A 1EZ2A 3FIGA 3R4IA 3D6NA 5HUOA 3K8LA 3WDRA 2WW5A 3EPOA 3CPRA 2AAMA 1BGGA 3T0AA 4B9YA 3ZT5A 5JH1A 4BI7A 4M56A 2Z00A 1GVQA 1MUCA 3EDJA 3THUA 1H50A 1BVZA 2CLLA 5LGZA 3P14A 4LVAA 4W5ZA 2POTA 5RUBA 2Z1VA 5F4XA 4IICA 3GNPA 3NM3A 2AMGA 4GIEA 3OVPA 1CYGA 1E1CA 4QDWA 3GTIA 3RNDA 5EB8A 5ABTA 2TSYA 5DXXA 1E0WA 2VL4A 4DAIA 3UWQA 1IXNA 2V81A 1CB2A 1R9YA 3QC3A 3PS7A 3FJ6A 3UT0A 5G1TA 4IPJA 3QPZA 3V0TA 2OQLA 1ITXA 4BEUA 1MVYA 3UP8A 1R3TA 3IIZA 4GACA 3W02A 1F61A 4H7ZA 4YNGA 1G0CA 3GG8A 2VNCA 3MKKA 4UQDA 2WNNA 1EO7A 2O9PA 3ATZA 4ZZ9A 5LA2A 3IJ7A 4HA4A 1DTUA 2ATMA 4C7DA 4DZ5A 3GHRA 3H53A 3NGJA 4I3GA 1QHPA 3KBWA 1MW0A 4JQ2A 2YPIA 3WJYA 1EPXA 5HJLA 3TOYA 4MNJA 7CGTA 2GVYA 3WNLA 4NY2A 1ZU8A 3CQ0A 1C92A 5FF4A 2NLYA 3UW6A 4RW5A 3B9DA 2PDGA 3QEZA 4AHOA 1GVIA 3ONCA 4KEUA 3L2IA 1EYWA 4GZJA 3WLIA 5HA7A 3AROA 3W87A 1QRQA 1J2WA 1JQXA 4YIWA 3LRKA 3MSGA 4HD5A 2WB5A 1AW2A 4RE0A 4FALA 1TUFA 3QFWA 3C4UA 3HN3A 1TB3A 3M0MA 4A35A 4CNUA 1W3IA 3GWQA 3N9SA 1Y8BA 2PU0A 4LRTA 1W5NA 3S9YA 1RY0A 1Q6EA 2QVNA 2Y7FA 3IV8A 4LBSA 4J3SA 5AYYA 4D2JA 1X97A 1O6IA 1UR1A 5M3WA 4NF7A 2QJMA 1JUKA 3O63A 3BURA 2Y70A 2XYLA 3CS2A 3NNTA 3EX3A 2W0UA 4DXVA 1B30A 4ZO6A 2A6NA 4JIPA 4YMZA 4UBPC 1V3JA 1N8FA 1GVEA 1BKHA 1HZYA 3AIQA 5A6TC 3REQA 5H2ZA 1H11A 4JTSA 3L4TA 3JW7A 5D9PA 4KGJA 4YYCA 3ABZA 3K13A 3OHIA 3I4KA 4S3BA 3QFEA 2UY5A 3MZ2A 4U2YA 5DY2A 3VUPA 3AMKA 3ABSA 3V0UA 1VIWA 1CGTA 4XZLX 2DT2A 3FHQA 1E9YB 4O14A 4FA3A 4PUKA 3AYRA 3RAOA 4RK8A 3U7BA 4I8YA 4LGXA 2NZLA 3T44A 3LRLA 2JF6A 5DRCA 5LKYA 3CXOA 1RVGA 1F76A 1SO5A 2VCBA 4M24A 1XD1A 1W5OA 3F4VA 2WZEA 3NM1A 4I6KA 2SFPA 3C0JA 1DWIM 3KLKA 5EMUA 4HB7A 3CEUA 2BASA 3RX3A 4AZCA 3WLPA 2PAJA 5AYIA 4UTIA 2FHCA 4ACYA 4HYWA 4UFIA 1FKXA 3BUVA 1XLBA 3EA2A 2YCIX 1VQTA 3U5YA 1Y5XA 3FYPA 1I6NA 5HINA 5G2IA 3GIPA 1IHIA 2BTMA 3DFYA 4FNPA 1XH1A 4P61A 4RPPA 3W81A 2ZUWA 3H2NA 1FHVA 5EGRA 5IXEA 3THAA 3STGA 2JALA 2O0TA 3GHSA 3TX9A 3CO4A 3L4UA 2EG7A 1T99A 3AXXA 1MRQA 3LZ5A 3CU2A 4R7WA 4D71A 3D3AA 4PUDA 1FH8A 4H01A 3DOPA 1WBHA 1FWTA 2PWEA 2YXXA 3MWCA 3KUMA 6REQA 3EWBX 2D22A 3PWGA 4GUJA 5D2TA 4GMEA 1P6WA 1FFRA 1P5BA 3PFMA 2V68A 2VD9A 4JXCA 2J9YA 4I9TA 2G0WA 2B4GA 4IL2A 1SO3A 1V3LA 2GDVA 4E8CA 4H8VA 3JVAA 1WOAA 3WF4A 3VX1A 3HZ3A 2CETA 4CU7A 4Q4MA 1CGXA 4FNSA 1FVPA 3AXIA 2DSUA 1YE4A 2C16A 1OFPA 3SB0A 2OKOA 4YPJA 3BK0A 1LDCA 1PHQA 3N4FA 3O06A 3XINA 1M7OA 5E09A 2CXGA 4IJBA 3RX4A 4JTTA 3GH4A 2JK2A 4D72A 3AXMA 1EFZA 5A6MA 3FGCA 2D0GA 3T81A 4KFOA 3WF2A 3UCQA 5IFTA 3VO0A 4DJFC 1UIOA 1PZ0A 2ALRA 2YFOA 4U2ZA 4XTDA 4C6MA 4CNSA 3CIVA 4WVXA 3CT7A 1RY8A 1TKKA 3O07A 1HKVA 4ZO8A 1NVMA 1UP3A 3VIOA 2PBGA 1P6CA 1PZ3A 4FO4A 1AODA 4PODA 3AIUA 2P50A 1XX1A 3GXPA 4H9YA 2HNHA 1SO4A 1W1VA 3BO9A 1TZ9A 1W1TA 2VDIA 3WLTA 4W7WA 4AXKA 2PP3A 3RLVA 4NYYA 5HMDA 2TODA 1XSJA 1EBGA 1G94A 2HQAA 3LXCA 4LYKA 1H7WA 2H9AB 4PCPA 3EWCA 3LMZA 4CEXC 5I77A 2XH2A 2D24A 1RJQA 4X22A 2V5BA 1M6JA 3REQB 2HXUA 4W84A 4B9ZA 3MBDA 4NZCA 2BVWA 2Y7DA 3TJ4A 1RP9A 4PSRA 2J66A 1XRFA 2ZVRA 4QCFA 3NL6A 4WDWA 2NSOA 4XZIA 4QR6A 3VVGA 3DYOA 4DN1A 3HIJA 2VI0A 2ZDSA 1X96A 2PDQA 3IJ6A 4AW7A 4JQ4A 1VD6A 3G1RA 3S5SA 3WLKX 3NQVA 2QCCA 3TMQA 4O1EA 1AZ2A 4RV3A 1PDYA 3UA4A 3WQ4A 3UWUA 4G2DA 3WCZA 3IJ9A 2V0TA 2IXVA 3UY8A 1V8EA 4LVBA 1N7KA 1ESWA 4ONVA 1XINA 1TJ2A 1OM0A 2VMFA 1CXKA 2C7FA 2EPKX 3P0XA 5CLWA 3PB2A 4LVDA 3FSTA 2ICSA 4AY7A 1SJDA 1VH7A 5D03A 3L12A 2G41A 3NYZA 2J27A 2QUMA 1TMHA 4ZE5A 2BXVA 1R30A 3GG0A 1LRTA 1WDSA 3R13A 2VFEA 2VR5A 4JHOA 1JVNA 3PBMA 2XN0A 1UUQA 2I5IA 1F4AA 1K8XA 1QK2A 3VXGA 4HU0A 1FDZA 2E68A 7TIMA 3TUUA 3AUOA 1GJWA 5CJ5A 3EKGA 3APGA 1NOWA 2HTMA 3DXIA 3LGEA 3KX6A 2JFEX 3MYPA 2ZXQA 1V7AA 3SCSA 4F2BA 1KCKA 2Q71A 4H6QA 2A3CA 1EUNA 1D8WA 1HJSA 4LU0A 1W2PA 4IIHA 1F3TA 5FSDC 4PUWA 4PUMA 4GRSA 1XGZA 1I2QA 5BXTA 4CD5A 1V03A 5D9OA 3WH7A 5KSWA 1R0MA 1W3JA 3HB9A 2RDWA 4HU4A 3BV7A 3UWZA 4PMZA 4EP8C 1TWSA 1GTHA 3PZUA 1GKQA 3ZYZA 4AY8A 1OQFA 1M7PA 3SRDA 4QNWA 2Z4GA 2OSWA 1FCQA 1OGSA 1A5NC 3KM8A 2X09A 3S1WA 2QCMA 4ML4A 3APTA 3V1PA 2A2IA 2HS6A 3B9AA 1HP5A 2G3NA 4YHGA 3PUGA 3PNZA 3T0TA 2YLAA 4MWAB 4ERGA 5HPCA 1EEXA 4HHLA 1MW1A 4L1WA 2PGRA 3CTLA 3FAWA 3S2JA 4C1KA 5A69A 3CUXA 5CZJA 5FOOA 4UQCA 4IQEA 2IMRA 2WLZA 4IUOA 4L65A 2VZSA 4Y96A 3WQPA 2ZCGA 5C55A 1VLIA 2XGZA 1WQ5A 3HQNA 2WQDA 4AHPA 4B3LA 1L9WA 5KETA 4FHAA 1JCYA 2OLSA 1NFGA 3W6LA 4AXNA 1JUEA 2YDQA 3ZLGA 4IWWA 4AZCB 2WZMA 2PP1A 1KBBA 3B0YA 1XL9A 3ARUA 4C6EA 1Z3NA 1ADSA 4JTGA 4QE4A 2B0MA 3GU9A 4FPSA 1R3SA 2J24A 3DN5A 2QDGA 2ZXDA 4DI9A 4XD4A 4LQ1A 4N9EA 5KZMA 3N73A 4QM1A 4AVOA 1FFQA 4WJXA 2PFHA 3F7JA 2G3IA 2QAFA 2Y5EA 2JGQA 4AH7A 3LMYA 2QCLA 1OYAA 4ADUA 3GDTA 2UBPC 3CAQA 1DV7A 4M51A 3ERPA 4DX3A 2XUCA 3GNDA 3G3DA 1LT8A 3NQCA 1P0BA 1Q45A 3HPXA 3GB6A 3TTEA 3QGVA 5AVNA 2QJJA 3TWBA 3W84A 2WZHA 4QHRA 3U0HA 4XVEA 1C8YA 3BAJA 1OX4A 2BGSA 2VHLA 1RR2A 4EWJA 1VCVA 2HVOA 3ZQ9A 6ENLA 3O15A 3OEXA 4ZA0A 1SW3A 1UKPA 4JNYA 1X6UA 4QG9A 2UY3A 3R7MA 2PWUA 4TTUA 1G1YA 4MYXA 3W7QA 3I3EA 4DYJA 3MUCA 2UY2A 1XIMA 3R2GA 3C3NA 1W9PA 2AL2B 5KTLA 3QMSA 1DJHA 5A8PA 3LPOA 5K9DA 2PGFA 4DBEA 4S3FA 2HZGA 3KP1A 2P1FA 2OWWA 2EPOA 5J04A 2OSXA 2WK2A 4PUJA 3RHGA 4H00A 4NI8A 2XN1A 4PMXA 2WNZA 3DAQA 1I45A 2W67A 3EOUA 2QF7A 3ITVA 3M0LA 3TLQA 3KHDA 4G7EB 4LUSB 3V16A 3WD0A 4BI5A 4PCTA 3LQLA 4H9ZA 1C9WA 4BK9A 3DFPA 2W9MA 4X61A 4TVDA 4UTUA 1JXJA 4XVDA 3GDKA 4U4MA 4JZ5A 4Q8VA 4S3DA 2OTDA 3SFKA 1C90A 4Q6JA 1O5XA 1GZ1A 2O9OA 2YFNA 5BXRA 1GG0A 3APYA 1YE6A 3LBOA 2FZ8A 4IIGA 5F4SA 1IV8A 5IBXA 2PSNA 1WNOA 2XPKA 5D30A 5M03A 3MB9A 4D6HA 2UY4A 2ZA1A 3A5VA 4URIA 4O4WA 4ADTA 1AH3A 4XZNX 1GZGA 2DIJA 4O15A 1V6XA 1VB9A 3K30A 3LNPA 2NVDA 4XV0A 1LOSA 4C6LA 2YA0A 2BZNA 2HDJA 3NSMA 5JBDA 4HSNA 2CITA 2ZWYA 4DUOA 3QJAA 1AW5A 2Q8ZA 1ONXA 1WX0A 1BXNA 1DHKA 1AW1A 1EDGA 1QPNA 3STEA 4W9TA 3RU6A 1X7FA 4M6PA 1WDQA 1PE1A 4S3JA 2FZDA 2HV5A 5CSYA 3D47A 3EKZA 4L6OA 4BY3A 3UYIA 3TWAA 2WC4A 4HNLA 2CWXA 3H4XA 3KXQA 1H51A 3PSVA 2A3EA 1K7EA 1ME7A 4GNJA 2BX7A 4MB1A 1IT0A 2QYGA 5CBIA 3B9OA 1K1DA 1WXZA 3EMQA 3QKEA 4JEJA 2CYGA 4EKJA 4MAZA 4ADSA 3CZEA 1M3UA 3GYEA 1TA3B 3M6YA 2D69A 1UR9A 3VIKA 1HJXA 1A5AA 1MXDA 2HPIA 4NX0A 4D8LA 1TIMA 5I03A 1K02A 3WD4A 1CCWB 2OT1A 1KFEA 1LJYA 4MSSA 5HWJA 3WUGA 1EYEA 2FVKA 3OJGA 1EJVC 1W3HA 3CNYA 4AD0A 1JCNA 4H9UA 4MWAC 1SZRA 2MANA 2ZUUA 3I6EA 1K6AA 3ZR6A 3BANA 4MNMA 4W7UA 1CENA 4XAYA 1S5VA 3VGDA 4JX5A 3O6DA 4J5NA 2V5LA 3W9ZA 2PRLA 3H21A 2VD8A 4YLWA 3SRHA 3G18A 4KETA 3CJPA 3CL7A 1DIKA 1KC7A 2GUBA 4BKNA 3W2LA 4INFA 4AX7A 3WKZA 4D6DA 4Z42C 3WQ8A 3CUFA 3PPFA 4YTUA 3LLFA 1UMYA 3W85A 4QEEA 1QBBA 1EX5A 3W6MA 3URQA 3W24A 5JH2A 5L6UA 5AY7A 4PTMA 3IS4A 3SCUA 4ZOCA 1DIEA 1FHUA 2GSEA 1LTDA 2C18A 4LV9A 2PLJA 2PC4A 2WKLA 2OX4A 4IMGA 4XKYA 4U31A 3ZJ8A 4ZCWA 2CC0A 3CH9A 1ZPTA 4I9MA 1S2UA 3WF0A 3T9PA 3WELA 4UQ9A 4DXXA 4R5EA 3WF3A 3OGVA 4GXWA 4LYRA 4C6QA 2PWGA 2OZ8A 1F73A 1EC9A 3N2OA 1C9DA 1SFJA 3G0SA 2J62A 4H7VA 2FHBA 4ZFMA 4GPNA 3IWPA 3WX7A 2J78A 2XFFA 1R2TA 3MI3A 1PKNA 2YW4A 3EMCA 4U3CA 2OYMA 1NJJA 4NNBA 5FJIA 4UOJA 4HK6A 4Y2WA 1AQMA 2J6VA 4M6VA 3BV4A 1B1YA 3TDFA 5CPTA 5BRPA 3TXVA 2C0HA 4K8GA 2D1ZA 3TTOA 3CHDA 3WQEA 3LS9A 1MWOA 4D6CA 4ML9A 2HCVA 4DJDA 3GRIA 4XZHA 1RK6A 2C1HA 4O17A 4AIBA 2X7WA 1RCOB 1GHSA 3IVUA 3DYPA 4PMRA 2D23A 1BYDA 3WDPP 3NL3A 3S3GA 4YU1A 3WY1A 1IE7C 1WXJA 4GG9A 3DG3A 4PH6A 2E67A 3QV8A 1DJIA 2PD9A 1YW1A 3TZNA 1H49A 1JPIA 1ZBWA 3WO8A 5I02A 3HQOA 4FOJA 3H2EA 5GJMA 1VJIA 1EZWA 1N8WA 4FB7A 5A1AA 1W32A 4KRTA 4HKPA 3VMNA 3ZT7A 3GNXA 1GOMA 4PEKA 2GGEA 4WY0B 3W7OA 3NXFA 2DY3A 3SO7A 1THFD 1R6WA 2QNEA 3MHUA 2XFWA 4IXHA 5G1MA 3UR7A 2A7NA 5F2GA 5BU6A 5BZAA 5EKYA 2POZA 4J9JA 1XLDA 2AOSA 4MHBA 1YYAA 3GDLA 2YIHA 3WFZA 2WZTA 1PHWA 3W1PA 1XUZA 4HTYA 3WQVA 3QQ1A 4NVTA 4C60A 2FFIA 5C9UA 1CDGA 2CKSA 5FAJA 3S4TA 5LXEA 3CLMA 1PL9A 4D6IA 2WWDA 3LA4A 4FSAA 1ECQA 1E4NA 3G1AA 4KQNA 2OODA 1OT1A 1XDMA 5C54A 5FEWA 1C7SA 2PI6A 3K5XA 3LEPA 4PC8A 3E5PA 1O5QA 5LIYX 3VA8A 3FEMA 1MDLA 4HMDA 2H9AA 3QKZA 1PCKA 3MT1A 2QCDA 5LA0A 2YL6A 4X60A 3U48A 4ZQMA 9XIAA 3L4WA 1YTEA 2YJQA 4OBTA 3LD5A 3BLPX 3WNMA 1Q6QA 4P7LA 1ZY9A 5AYBA 1NIUA 3BCJA 2WMKA 4DB7A 3MKVA 4JTIA 4RJEA 3F4WA 1KRAC 1RQBA 1LYXA 3QH2A 4HJWA 5A95A 2ISVA 4KFNA 3CH0A 2J7GA 2JIWA 1TX0A 1FWIC 3F1QA 2VDGA 1UD4A 2VGBA 3TJIA 3TQVA 4UCGA 1ONRA 3MCMA 7REQB 1IWAA 1EA0A 3SSZA 4JFSA 3MO4A 4LV4A 3VAVA 3VM7A 1G4PA 2QDDA 1HKJA 3B9NA 2A6LA 2YZRA 4DJDD 2NXIA 4XAZA 3M9YA 3QMTA 1S2CA 2I1OA 4RE3A 3A3HA 2IXUA 4RUBA 4MB3A 3S2MA 3CWOX 5EMYA 1QTWA 2Z26A 3ECQA 4UTLA 4FXRA 1A5CA 3TTYA 3G3MA 4PUNA 4Z2IA 3PSWA 2VELA 2NUYA 2PDPA 4R27A 1Y5VA 1VC4A 3GXIA 2NXHA 4IX2A 1H7XA 3AZTA 4V33A 4H6RA 3AOFA 4GH3A 4RZBA 4MUPA 1GJUA 2E9BA 3UJRA 4K8EA 3L4YA 2V8ZA 2GLKA 2QMJA 3LTYA 1OG6A 3EZ4A 1Q66A 3BOXA 1CGVA 2F6KA 5CZTA 2ISSA 3CZKA 4EPKA 4ALDA 1CX9A 3VNMA 3PAOA 2Z2UA 1B3WA 4M0XA 2XH7A 2XIOA 2X42A 1V93A 2WXDM 2Z24A 4TVCA 4NAFB 3PBYA 4DNHA 3HG4A 2DJLA 3CYJA 4HCHA 4B3ZA 1AK5A 3NSXA 4FOUA 4DF2A 4GD0A 3WL1A 1W8SA 1H41A 4UFHA 4J3ZA 1G9HA 4HCLA 2WBGA 4Q4OA 3HPAA 3N13A 1XH0A 2G3JA 1TO3A 2C8NA 1JZ6A 5EY5A 5AYXA 2ZX5A 2O92A 3WQCA 1F05A 4QG8A 1SMDA 3SZ8A 1FP8A 4DWSB 1KR0A 3GVWA 1Q6OA 4WKHA 3W23A 1HT6A 3LBCA 1DE6A 4TV6A 4HU8A 3OO2A 3N14A 3EA3A 3IJDA 5IFPA 4MWAA 1PTAA 5CPNA 4RW3A 4QSFA 1HN1A 3ZO9A 2OZ3A 4GYFA 1XH2A 3UY7A 3IV3A 2PD5A 1KQZA 4M6QA 1S5NA 2BVYA 4UFKA 2OGJA 2Z28A 3TVAA 3VI2A 1V77A 1P0NA 1E0XA 3N6QA 4NAEA 3S1GA 2XIQA 1J6PA 5L9FA 3AIEA 1YDYA 4JN7A 3POCA 5B80A 1VJZA 1TPUA 1DJZA 3ANVA 5FJOA 1U1HA 4RZ6A 3ZWSA 1ZP4A 1PS9A 2RDUA 4IG2A 4QROA 4CD6A 4R3UA 3IRDA 4M29A 1YHTA 1DJNA 1M04A 3N04A 5T26A 1NWTA 5LNVA 1BLIA 5BWAA 1JZ7A 2PURA 4NSBA 1QVBA 3PULA 1W54A 2NW0A 2QCNA 2PDJA 1AH0A 3B8SA 4LS1A 1RD5A 2GUUA 3CWNA 3Q2DA 3VK5A 1S5MA 4LVFA 1R86A 3LERA 4E6MA 1X98A 3ES8A 4LF2A 4M19A 3T55A 3OG3A 2DVXA 2NQ5A 4FLSA 2XVPA 4LB4A 1EQCA 1OFEA 5TF0A 3TW9A 3SCPA 2ZBTA 3IGUA 4UFMA 1JPDX 4JTQA 3KRSA 2QJHA 3UETA 1TREA 1UOKA 2IS7A 1GYLA 4QAWA 2QPUA 3YPIA 4JFUA 3K8MA 1B54A 4JY8A 4LJ3A 5LNSA 2WPBA 3NPWA 1GQKA 1JYWA 1IEWA 1SUXA 1AL7A 1EIBA 3KBSA 4E0CA 3DG7A 4Q8PA 4ZO9A 4H8NA 4E3VA 4AZ5A 2DUAA 1E6SM 4DLFA 3SURA 3MCNA 2PDCA 4BS0A 3LOTA 3PNUA 4PTXA 2ZRZA 5LIKX 3TXZA 3AZRA 5KZ6A 2J9ZA 1OFOA 1VR6A 5FESA 1CGWA 1IWPA 3PF3A 4A3RA 4Q8UA 3DI1A 5HR7A 4GNKB 4XBSA 3XISA 1KXHA 3T4CA 4XISA 4BWLA 5I79A 3MUAA 3RLGA 1J0JA 3N15A 2CWNA 2PDKA 3VOJA 2DSVA 5A6BA 2YCLB 2WKGA 2YB4A 1VEPA 3E2VA 4WGHA 4GFSA 3MUXA 2I9UA 3E0FA 2UV8G 2IPWA 4HHPA 5HJYA 4ATLA 3HGOA 4GUIA 4C91A 2FMNA 3TYZA 4ZSTA 3WLJA 3OBAA 4S3CA 4I7WA 5FF2A 2D20A 1RA5A 1J8VA 3FFSA 1LWJA 5I2UA 3RO8A 4EF9A 1GW9A 4HMNA 2EPMX 1E71M 2Z0IA 4M81A 4MY1A 1KM2A 3PBWA 1ONEA 2WC3A 3RUBL 4MFEA 1W1ZA 3VOHA 1YDVA 5ABGA 1A5SA 2GWGA 4E38A 3VKKA 4I7VA 4K1GA 1XDJA 3DENA 3CV1A 2FIQA 3URNA 2C19A 3EWUA 1G4TA 3MO7A 4JIHA 1SJBA 4UR7A 2NLIA 3KTCA 1WO2A 1E43A 3F5JA 3TJXA 4H7CA 1QDSA 4JIQA 1E1FA 4O0ZA 4XIAA 3GBEA 3QC0A 4C1NB 1BF2A 5DCBA 2P76A 3GSMA 3A4WA 4O13A 1XG3A 2ONEA 1Q6DA 5FL1A 1H7NA 1REQA 3T0CA 3TZFA 4GQ0A 1TIWA 2D2HA 3KBJA 1E15A 4O12A 2EPLX 3SRFA 8CGTA 2DU2A 1U5JA 2X30A 1I1WA 6XIMA 2VZOA 4JFTA 2R14A 4JAWA 2PDBA 1BG4A 3NAVA 4HHHA 3UG8A 4AZ6A 2ACQA 1RK5A 2DZVA 5I3IA 3PTKA 1Q2RA 3G1XA 3ALFA 4JN6A 3T8QA 1MEWA 1S2VA 1QBAA 2F84A 4O1BA 4GUHA 1F6PA 3SCQA 3BCDA 2O4MA 3N2TA 3RM9A 1IXOA 4W87A 3M6DA 4DYEA 2OO0A 2ZKMX 1KXQA 4CD7A 3OLDA 3P84A 5AHLA 3MDWA 4ZR8A 3NJ3A 2QUUA 3GTNA 4PA8A 2AGTA 4QBXA 4F3HA 3G6MA 1C8XA 4GIYA 1F3EA 5DO8A 1LF1A 1ODZA 2Y61A 4HPGA 4JDYA 2C13A 3SY5A 2V3EA 1JYVA 3UU0A 1TJPA 3KOXA 6TIMA 2VXNA 1SZGA 4MZ1A 4AZBA 3O0FA 5AC7A 1U2YA 4HYVA 5C9XA 3BAKA 3S6TA 4I8DA 1AD1A 1W3LA 4ERAA 3VD7A 3T4WA 2A3BA 2FZ9A 3VD5A 3S1VA 3F5LA 2YB1A 1QAPA 4LS0A 4YJ5A 3RG6A 1US3A 3E6EA 4H9XA 4JTLA 3I3BA 3TIMA 2OMAA 1UPMB 4S3EA 4C6OA 2OWCA 5HATA 3EXRA 1TPB1 3BZGA 4Q8OA 2CLOA 4G9PA 4WCJA 1SQ7A 1TSIA 4NQ1A 1RAKA 3E9AA 1LWIA 2VCAA 1VZWA 4C5ZA 1S2WA 5DF0A 1LP6A 3ENLA 4US5D 3QW3A 4JYDA 3AQUA 4A4AA 3QXBA 3W1UA 1OZMA 1PIFA 1K77A 1SZNA 4FLQA 4JNMA 3PZGA 1MI3A 3DX5A 3OA3A 2AL1A 1E6ZA 2QR6A 2RGLA 2H8ZA 3BDKA 3NEVA 1KM4A 3E2RA 3JU2A 2DGAA 2RH9A 4YWIA 1JPHA 3C0LA 1W31A 3GO2A 5CAHA 1KLZA 1RHCA 4CVWA 3QHNA 1BSIA 4B4FA 3HURA 3W2KA 2XZ7A 1VBUA 3GIYA 1I2OA 4K3ZA 3BC9A 1TWDA 1HP4A 1MFVA 3L9CA 2A4AA 1BSLA 3QGAC 3AMGA 4I5RA 2YYUA 3TU9A 4LBUA 1QW7A 3NZ1A 4C1NA 3I10A 4UFLA 4TO8A 4NI3A 3FV9A 1W3NA 1NH6A 2PTDA 1VFLA 3ID7A 1O95A 2VENA 3E74A 3WUBA 3SM0A 4OT7A 1UZDA 2E5DA 1Y65A 2OB3A 4B90A 3CTTA 3KDNA 4ZVJA 8A3HA 1D9EA 3B0UX 1XIGA 1WB0A 3MA8A 2DZXA 4J2MA 1MXSA 1CIUA 3A3XA 4IIDA 2Y2WA 1JCLA 2ZZ7A 1XF0A 4YVPA 1LQ0A 5F2IA 1CZ1A 1ME8A 1UQYA 3R10A 4BQ5A 2Y24A 4LCQA 1J79A 4J40A 2O55A 1LBLA 3XIMA 1M68A 3INPA 3AXKA 3IACA 3NURA 3AIVA 3AS3A 3PVFA 1KXVA 4JIIX 3GC5A 4ERIA 3MHFA 5AOUA 2FJUB 3W25A 4LNCA 3SW6A 4MIMA 3G1DA 1M5WA 4PMOA 3I6RA 1J6OA 2QCFA 3W1RA 2GFTA 2D3LA 1JEZA 1LBMA 3LCFA 4FXFA 1NP2A 2F2KA 1XIHA 1QWGA 1H3GA 1GQLA 2Z6IA 1HVXA 1UC5A 3H2FA 3KBVA 1H61A 3BJFA 1HKIA 4DBUA 4OQVA 3BQ5A 1BQGA 3WJXA 3U4AA 3IK2A 3VINA 4IFKB 1E5NA 1QPKA 1FWBC 3B8IA 2C71A 1NWUA 1EGVA 1PWLA 1Q6FA 3NG3A 4IIFA 3M0XA 1A0CA 4MJMA 1Q3NA 3F03K 2PTXA 2ZTKA 4LS2A 1TVLA 2J25A 3FX4A 4B5XA 1Z44A 3JZEA 3BG5A 4H83A 3T07A 1ZQ5A 3I6TA 5D38A 1E9ZB 4J35A 1CPUA 4Q3MA 1H0IA 1CB7B 3VOFA 3WDIA 3TV8A 3IJ8A 1DJXA 2BDQA 3QV6A 1X1OA 3EKLA 2GVLA 4JTAA 3FLUA 5HR6A 3MDUA 3WL0A 4NUWA 2D2OA 4KMQA 3R25A 1H1ZA 5HPOA 4EXBA 4PL1A 3PHAA 1KV8A 4GINA 5FJTA 1K7XA 4D9PA 1NDVA 4IX0A 1PX3A 3R79A 4O4VA 1JDDA 3G22A 3W37A 2FYMA 3J7HA 3M0ZA 3O6AA 2V2DA 1HKWA 3NFUA 1YDNA 6TAAA 1Q5MA 3VDBA 3QY8A 4G7EA 3VKDA 3H4WA 1F3XA 2RUSA 4JCLA 4PBFA 3ANUA 3LCIA 3PFRA 2OEKA 1L2QA 3Q67A 4WF7A 2PODA 2OZTA 3P60A 3AJ7A 3KRZA 3DHPA 3WMCA 5DMYA 2Z1KA 4HP5A 1FWAC 4MF4A 2R1KA 3FN9A 3MHGA 3FJNA 3HQ1A 4E2DA 3K1GA 3QLDA 1SMAA 4P8XA 2PMQA 1RJRA 2Y8UA 4F0KA 2YZ5A 3AMLA 1SZFA 3CAVA 3W7EA 1A5UA 3IANA 2BXZA 2C14A 1B3OA 3BMXA 4WRHA 3VGEA 3TSDA 2QUTA 3O3RA 3AWNA 1BYCA 3EDEA 1KGWA 1OYBA 3NA8A 3NDZA 3UZ5A 4HTBA 2WKJA 3VNYA 4GZIA 3IGXA 4KIEA 3DFSA 5HJXA 3RMEA 4M6UA 4CNPA 4GGHA 2DZAA 1S5TA 1X39A 2Z1BA 1W3TA 4GGBA 2PWVA 5F2LA 2W61A 3M5ZA 1U5VA 3IGHX 4KWSA 4QDPA 5CZSA 3RU8X 4UTTC 2F61A 1GPFA 4FZIA 4NG3A 4CNOA 4B2DA 4D1IA 5DMMA 3F2CA 1CGUA 1KA9F 1MUWA 4HN4A 5A2BA 1GNXA 3T78A 1I75A 1Y0EA 1S2TA 3A4JA 3ZOAA 3BOFA 1NM9A 4AEOA 4DUVA 2GUYA 3RITA 4OV9A 2WHKA 1FUYA 4QRNA 1FX6A 4E5TA 3H54A 4WJEA 5D32A 4GYJA 1QT1A 1XLIA 1KO0A 4H9TA 4UFJA 4UWMA 1MO0A 1ZBKA 1IT7A 4LUSA 3SIMA 3PK7A 3U2ZA 1EF2A 1TWZA 3PZNA 5AKQA 3LSBA 4XQ6A 3VMPA 4JDBA 1XD0A 1JULA 5MKGA 1FXPA 3NO3A 2ZZ1A 2J7EA 1IIGA 5M2FX 1GK8A 1JGIA 4QEHA 2EXOA 1GQNA 2WJEA 3A23A 5CSRA 3T42A 3WD3A 3I4EA 1G6CA 5HAOA 4O8RA 1F6KA 1DIDA 3DYMA 2RHGA 3KFTA 1OFDA 3C2VA 1KCLA 2VJXA 2WMIA 4D6GA 3DFQA 5A8QA 1OVDA 4PBGA 1E6NA 4MZ8A 3B0XA 3GS6A 5U4NA 2R82A 3HPZA 3KW3A 1NF7A 1PO9A 2XM2A 5LA1A 5DBTA 1DOSA 5DT7A 3ES7A 1BRLA 3I68A 5CPMA 4KH2A 3PPHA 3QYQA 1AQHA 3TTSA 3FAXA 4D6FA 3T2OA 2OGYA 4Z0JA 5HDRA 2IPFA 1DJWA 3UERA 1L8PA 1HUVA 3CAKA 3IEBA 1WAWA 4WOQA 4E2VA 4IF2A 3CHFA 3RMJA 1NAL1 3OZMA 2FB2A 2ZA2A 4NASA 3AXHA 4OUIA 4UTWA 3WUFA 1HKKA 1LG2A 4XBKA 2ZRVA 4M7SA 3N19B 4ZB2A 1BVNP 2HVNA 1F4HA 1UH3A 4JGDA 5E6YA 2AAAA 1R3RA 4K1WA 4M5PA 4NU7A 1FHLA 4Y6GA 2VRKA 3B4UA 2HBXA 5REQA 1LRQA 3MSYA 3GXDA 4PCNA 3SN4A 2IW0A 4IIBA 1XKYA 1Z89A 3KZSA 1QNVA 1YNPA 3IJIA 4U3AA 3W01A 5HXMA 4JX4A 1DYSA 4AB4A 4N6FA 4GIAA 5ABEA 5T9BG 1ZHAA 4DO6A 3UPBA 3VCNA 3NQGA 4OVXA 5DN1A 2R1PA 1N55A 4JTHA 2EPNA 3CQHA 3ABQA 2QW5A 3RPTA 3GZAA 4JR5A 1FA2A 4HOZA 4ZXOA 4DJFD 4E4FA 4KF1A 1SFTA 1T5AA 2D0HA 3CIWA 2GK1B 3G0XA 2DQWA 1IXPA 2QPSA 2PA6A 4YCPA 1OCJA 4HNTA 3H7VA 3EBVA 2C6QA 2EGZA 4HZ6A 4QXIA 2AL2A 3FA5A 4ENLA 4KCTA 5LGXA 2NT0A 3WLRA 3O9NA 4V27A 4HU3A 2E6DA 5I24A 2XGIA 3ABRA 3VNDA 2MUCA 3KBMA 3BJTA 1BF6A 1Z9AA 3BLOA 1PAMA 2I9EA 2G50A 4UR9A 4AZIA 4DJEC 3BTNA 2O4QA 4IOTA 2IKJA 3AISA 1TTIA 4CCZA 3W74A 1FWFC 4EANA 1WP6A 4C6CA 2ACSA 1O94A 1B0IA 4JTKA 4QX4A 2ZRXA 4X0VA 5C70A 1B4EA 4ZE4A 3NWRA 5E70A 3W70A 3WENA 2VT0A 4Q33A 4UTJA 1VHCA 1LM1A 3S2NA 2WHJA 2BSLA 2EQDA 2IQTA 4L9ZA 3LM3A 4DO7A 3W2JA 1OABA 3E0WA 1QOXA 1Q13A 2YLLA 4AMCA 3NQ2A 3QYSA 1S38A 3L21A 4M80A 2ZTJA 3TK7A 1P0KA 2BXYA 4FNTA 1TJ1A 1UROA 3HJEA 3R11A 2QGHA 4R9XA 1NOUA 3C5QA 2VURA 5MKGB 3RILA 5I6SA 1IYXA 4UQEA 4KWWA 1O1ZA 2FZNA 2VOTA 4GVIA 3OZPA 2VC9A 3BLEA 3H8AA 4FX6M 3LYEA 4JYFA 3LXAA 3W6YA 4XB3A 1TV7A 2PCQA 1P4CA 2WVTA 4LT9A 3UR8A 4Q8WA 3T2PA 4N7QA 2V67A 3KOWA 5LHEA 3D0CA 3NL5A 5DX7A 4AAJA 1GKPA 3NQMA 5IBXC 2W62A 1GG1A 4DWSA 4YYFA 4MWAD 2NQZA 1LL6A 2DT1A 3L66A 3D46A 1RZMA 1A3XA 3W2MA 4C5YA 2V5JA 5T91A 1JZ8A 2CLMA 3ITOA 1QXLA 1TE1A 3UZXA 1OJXA 4FOKA 3FHAA 1KFLA 4YHEA 5I00A 3GC4A 3UCDA 5GNXA 3FKKA 1XRTA 3ARXA 5GPRA 3OW1A 4XAPA 4R34A 1XG4A 2QPXA 1PYMA 3WDHA 2DDXA 2GJLA 3CZLA 3FDKA 3F5KA 5CBJA 2OLAA 3GU1A 5HMSA 4LBRA 3AYVA 2W4XA 3CZJA 4TTGA 1BGAA 3P82A 4IG2B 2I5GA 3W86A 3BW2A 4IXXA 3BAXA 3WBEA 3R8RA 4HT3A 5C7HA 3UWVA 4PMNA 3GH7A 3G6LA 4KEMA 4RDZA 5KZEA 4KW2A 4QAIA 1WUFA 4L4PA 4JFVA 5H8UA 1ZTVA 3H22A 3O1NA 4FNUA 3AHVA 5AVHA 4QP0A 3STCA 1V0KA 4TIMA 1OIMA 2DH2A 2BGNE 4EAMA 3E1F1 4C1LA 3CQKA 1DHPA 2ZC8A 1FP9A 2V2HA 2CBIA 3GXMA 1FTXA 3TC7A 1EJXC 1TMQA 2EHHA 2ZFAA 3EA1A 2ISFA 1V4YA 2QMKA 3S2CA 3UGRA 2YDSA 3HG2A 4A2RA 4AYSA 3CMJA 2XSAA 1TJRA 2BHYA 3VKCA 4LC6A 3FS2A 3KBNA 1A0EA 2WSQA 2CW6A 1BXCA 4IT1A 1TZ7A 4CQ8A 4K2SA 1UR8A 1QPQA 1IEIA 1UP0A 4CQ9A 3MP4A 1JDFA 4MB5A 3OLGA 4LAOA 1GVRA 4LNYA 1IEVA 5PTDA 2DVUA 1K4GA 1MEHA 3UZYA 2QCGA 5IHRA 2GZXA 4HCDA 5A6JA 4F9DA 1UUMA 1V6WA 3Q58A 3V7PA 1D3CA 5G5IA 2F38A 3LCWA 3N17A 5E0FA 2BY1A 3WNNA 3GVGA 4IPNB 3VKAA 4WD0A 4O18A 1KKOA 4DYKA 1OEPA 1B3VA 3SJNA 3QHOA 4LAZA 1CBGA 3MJYA 2PLCA 4U28A 1WXYA 5EYWA 1F8IA 4ICCX 2G97A 3B06A 4MPKA 3VOGA 1JJKA 1CLXA 4M1RA 4GQBA 3R94A 1ISZA 1SO6A 1OYCA 2EKGA 1B57A 1QJWA 5JVLA 1ADDA 1RQEA 2ZX7A 1S3HA 1VAHA 3B8UA 1XLAA 3GTHA 2QIWA 1VFOA 2ZXAA 3LLXA 3GKAA 4B5NA 5HBFA 2QGYA 2CLIA 2PWDA 2PUZA 5C9RA 4MKNA 3KVMA 3W7DA 4QLLA 1EJUC 4PRWA 3NXLA 1HF6A 3VE7A 3RR1A 4W5UA 4WEVX 4QNEA 3U3HA 1WKFA 4LAMA 1XYMA 3SIZA 5KITA 4IMDA 4LEFA 5AHMA 2HMCA 4TUFA 4X3ZA 4HGXA 3VABA 3OBEA 4L80A 1TA3A 4ZOAA 5CH9A 5BMWA 4LAUA 2E8YA 1KGUA 5E93A 4HPHA 1VEOA 3W7JA 1G67A 3FNDA 4AD2A 1B3YA 4HNNA 2VEGA 5DCDA 2QDEA 4GVFA 3WBAA 3RDKA 2OFJA 5CPSA 1NQKA 4Z1AA 1AD4A 5G1YA 5E0KA 3LRMA 1ENUA 1DQUA 1YBQB 4PRRA 3WJWA 1J0IA 3OGSA 5EBAA 1VFHA 3TSBA 5DEZA 3FKRA 1KFKA 4IJRA 4HJFA 4ES4A 3TC3A 1FCBA 3SUVA 3L5MA 1WKDA 4QDMA 1QI4A 2Y63A 3T1GA 1VFSA 1S5WA 4DF1A 4GABA 1B3XA 4GI8A 1RUSA 2V69A 5EU9A 3POHA 5CPOA 3CWHA 1XLFA 3QZ6A 1LLWA 1LRNA 4F66A 3DH7A 4ORIA 5AHIA 1H62A 2W5FA 2DZPA 1ZP3A 1UP2A 3OVGA 3O2LA 1XC6A 1ML1A 2VWTA 1FCUA 3IARA 1A3WA 5FSEC 3KHJA 3AFBA 2Y4SA 1CXFA 3URAA 4OE7A 3EB3A 5D2VA 4KIRA 1BTMA 1DVJA 2VQUA 2XISA 3NL2A 3EWYA 3GR8A 4WDXA 4BI6A 2CHRA 2X41A 2HISA 4Q7IA 1PKLA 4LUJA 2QT3A 3NQ7A 4WXYA 1TWIA 3WK0A 1XBXA 1W9VA 4PB3A 3WMBA 5J5DA 1K9EA 4FNQA 2PTZA 2GWNA 4J3WA 5CPQA 4L56A 1V6YA 5BW6A 1NFPA 3A21A 1RJPA 4L5ZA 1KWGA 2LLEA 4GBDA 4Q8NA 5BNKA 1GJPA 2VGIA 3TAKA 1RPXA 3ZJ6A 2B7NA 2ZQ0A 3AICA 4QE1A 1EJWC 1E3ZA 1PV8A 3RJYA 1QW9A 3GXTA 3L2LA 1IIHA 3WK1A 1U22A 1RV8A 1HJUA 2XGBA 3NQFA 4ZQOA 1D8CA 2G37A 1IR2A 2QQ6A 2X0SA 3GU2A 4B91A 4BF9A 3CIXA 3LV5A 4R53A 2ZVIA 1B9BA 1OFQA 3O0KA 2EEXA 4MLRA 2WVSA 2X7VA 1AL8A 1LROA 2IKIA 4RDWA 3HG3A 1K7FA 1KLYA 3LUTA 4LC8A 1VPXA 3LTPA 1KFWA 4US5A 2YBVA 4EXQA 1HXJA 2ZUTA 4FXJA 2ABBA 2V2CA 4P5UA 3CUIA 2O9RA 5A6KA 5K4ZA 4AD4A 4Y9AA 3QV9A 2AKZA 3AI0A 2PTWA 3ABOA 4NT0A 3EAUA 1OX6A 2Z1SA 2VDHA 4GVHA 3QF0A 4MKSA 3VIGA 3LM7A 1VEMA 2QXWA 2OVLA 4GUGA 4PYSA 3LQGA 3HF3A 5A94A 2XWEA 3GFXA 3CQIA 3A24A 3C56A 4A21A 1H1YA 3M64A 1PPIA 4US6A 3MMTA 1W3KA 1X1NA 2IPJA 2WNWA 4R88A 2Q02A 1NQ6A 3GNOA 3WDQA 1XS2A 3ZLFA 4TQTA 4J28A 5FJPA 4CD4A 2YL5A 4C7GA 1QW8A 5B7ZA 6REQB 3P7YA 4QSHA 4H9MA 3V1HA 3MWAA 1R46A 1CW2A 1HJQA 2Y7EA 4DQWA 2QV4A 1FQ0A 1ZCCA 1N8IA 2HNEA 1E40A 2DSZA 4AWSA 4IMFA 4ZTXA 3VDCA 1DJQA 1L6FA 4NX5A 5AFDA 1RBAA 5AZ0A 1UR3M 2ZE0A 3I3DA 3VTRA 1M01A 1LUCA 1YBQA 4WJ8A 2E9MA 1G7VA 1GUVA 3OZOA 3GAYA 1GCYA 3THCA 1R87A 1BXBA 1A5OC 1MRAA 5DQPA 2QJGA 3M16A 5ECVA 1A50A 3PY2A 4M8UA 2OELA 2YBTA 2B7PA 1XDLA 4GYKA 1UBSA 2GVEA 5I5RA 3TOPA 3M43A 4FLRA 4J3VA 3SGGA 1FH9A 3B8WA 4K68A 4JTDA 3L23A 3VNKA 4AFYA 3WIJA 3SCOA 3VNIA 1XHGA 3BLIA 4RCXA 3EWDA 2XN2A 4GXMA 1JF6A 3W26A 3MU7A 4NHVA 3PJUA 5C2XA 2A1YA 4UR8A 1Z7AA 3KVLA 1YRRA 3B0VC 3O7UA 3GDBA 3SN0A 5AC4A 1TQXA 2VR2A 3CPUA 1H0GA 4N0RA 4FK9A 4LOCA 3BAYA 3TQKA 3TQPA 2B81A 2NV2A 3W72A 2HBVA 2J75A 2PDXA 3E0IA 3T2QA 4Q7BA 3CL6A 3BVJA 3B97A 1LG1A 2KZHA 3UFYA 1SJAA 2ZX8A 3VFLA 2QEZA 1W1YA 3HBLA 6A3HA 1XYLA 1E70M 2J7FA 3VILA 3BGAA 4U5KA 3U2OA 1K8ZA 3UNTA 1R3WA 1JPMA 1X8CA 4Q8QA 1U5HA 4E2BA 4JX6A 2PRHA 5REQB 1QO2A 5D8ZA 1O60A 2CLEA 4TV5A 3C0QA 3RYSA 1UD5A 4PTVA 1U83A 3ITGA 1Q63A 1GOQA 3S42A 3KOZA 4MJ4A 2C1GA 1EC8A 3GG7A 1XLCA 2G96A 3GTFA 2ISWA 3USZA 4F0MA 2GSHA 2YR1A 4AZGA 1KBIA 2NUWA 3W22A 4HZ8A 1XGDA 1GEHA 3WK3A 5FIPA 1J11A 3QZEA 2ZE3A 4GC3A 5FEXA 2Z2BA 1P48A 3WG6A 1GVSA 2GSJA 3SDOA 4HA1A 3KS5A 1KGXA 4CQBA 3VZYA 4XZ9A 1HTIA 3ARYA 1GOWA 4JCMA 4L1XA 3MPGA 5XIMA 3WLNA 4HVXA 3B8DA 2EJ1A 3LG3A 5K4XA 5DRIA 4AWUA 2CLFA 3DGBA 4EAYA 2QS8A 1FRBA 3ZJKA 3LN3A 4AD5A 1GZJA 4F2TA 2X1IA 1POJA 2P53A 2CIPA 3WLLA 1F7BA 1XICA 3DUGA 1I4NA 4Y90A 5LNWA 4O0QA 1BFNA 2NV9A 4RPQA 5HNUA 1FWSA 4IP5A 3NQ8A 3DBNA 1MUMA 3LX9A 1UMLA 2YGYA 2YL8A 4FEZA 4AG0A 2O56A 3B05A 1VBGA 1GVYA 3CQJA 1JAEA 4F0SA 3DFOA 5D8WA 3VNJA 1AG1O 4K6AA 4C65A 2A79A 3GG1A 4EE9A 2FGLA 2G4FA 3L65A 3P61A 7ODCA 1LOQA 2IQ0A 4A3HA 1H5VA 4IFKA 5E9XA 1GPWA 5E5CA 1HO1A 3R1ZA 1OCBA 3HMJG 3EOOA 4GQRA 1R3YA 3PAJA 1R3QA 3BG9A 1SR9A 1JDAA 4CNTA 3CK5A 4CGTA 2V63A 2GGJA 1CXEA 1EB3A 3C0SA 4O50A 1V6VA 2PDYA 1W8GA 4UTTA 4C90A 1TV5A 3IPWA 1XIJA 1LL4A 3S5YA 3KTSA 1SR0A 3B04A 1WAUA 2WSRA 4A2SA 2XFYA 1OHLA 1UWTA 2PDWA 1L2UA 3HQPA 3SN1A 1XISA 3PJXA 3GUGA 2AMXA 4LVGA 3KDOA 4AUBA 4MYAA 4H19A 3EOSA 3PBGA 2J79A 2GOKA 4IMAA 5ABFB 2DJXA 3DKLA 4Y9MA 4W7VA 2BV9A 1BEUA 2VVNA 1NDYA 3S47A 2PLKA 3MI6A 1BKSA 3UJ2A 3VOCA 3TYUA 1JCMP 2HE5A 3OU8A 5CQ1A 3FA3A 3A47A 4MTVA 3A4AA 1RA0A 2CXEA 4JTJA 4KWOA 1GWJA 1EDQA 1EH9A 4PN2A 5LNRA 2REQA 3T05A 4C6IA 5FJRA 3BGJA 4MADA 5DMLA 5A5WA 4W8AA 3P5YA 1QK0A 1LT7A 4D8ZA 1QMLA 5A8MA 4A3QA 1YNQA 3MUZ1 5CJMA 1Z41A 1TFVA 4ZGYA 1OD0A 3OP2A 4GY1A 4IPIA 3WSUA 3MSRA 1L0PA 1YX1A 1I8JA 5KZDA 4XUYA 4TVUA 3UG4A 1S46A 3WQWA 4L1GA 4RZ5A 1G4EA 2DZUA 1RP8A 4HNCA 2P3EA 3UD6A 1ISWA 4NILA 2WMIB 3GNRA 2A5HA 3UZWA 1UD6A 1J5SA 2DORA 2E09A 3VGBA 2XM1A 4A8LA 3LHYA 3VGGA 4N02A 1XSKA 3CAWA 5XIAA 1TPWA 1TMLA 2UWFA 5HWNA 1V3KA 2YSWA 3OBKA 4H4IA 4O1AA 2YDAA 2J7DA 2OSYA 4ZOBA 1BHGA 1IEXA 3QN3A 3O6CA 1OIFA 3W4RA 2O9TA 3L4XA 1JDCA 3CV6A 4OUEA 5CAKA 4Q4PA 4C6PA 2ZUNA 1SYTA 3C8NA 2QDHA 4CCDA 4XTIA 1J18A 2WM1A 2XIMA 3W1MA 3SAZA 4X2RA 2HEJA 2QZRA 3SCRA 1T8QA 9RUBA 3EEZA 4P7RA 5C71A 3ZVHB 5JBFA 4HMCA 2WO5A 4LY4A 2A3LA 3P74A 3P93A 2JIEA 3G1YA 3WEOA 1VFTA 2DUZA 2CHOA 1BG9A 4IMEA 4HK7A 5MF5A 1VGAA 3N2CA 3UXLA 2BLEA 5C2CA 4JKMA 4QS5A 1S3TC 4G7FA 3W7LA 5KINA 1W5QA 5BOEA 1O1HA 1XKJA 4IFOA 3QSTA 2Y5SA 2ZRUA 1AQFA 3NGFA 1T0OA 1OADA 1R38A 3UQNA 4PE8A 4UNKA 2NX1A 2ZZ5A 1EOMA 4AWTA 4LYQA 4KFPA 1FWWA 1ZUAX 3WQ5A 1J2BA 3FOKA 3SRKA 3B8VA 5H6HA 2A0NA 1NF0A 3WQDA 2CZDA 1TTQA 2INZA 3ZZ1A 4F0RA 5BYWA 2NV1A 4PB4A 5ABHA 4ILSA 1VHNA 1E0UA 2F2HA 3IJQA 5D04C 3FSUA 1BYAA 5F2MA 5G2WA 1R5YA 3AHYA