2DJXA

Crystal structure of native trypanosoma cruzi dihydroorotate dehydrogenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCCTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of native Trypanosoma cruzi dihydroorotate dehydrogenase
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Dihydroorotate Dehydrogenase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2djxA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2djxA01
1FWWA 4TX9A 4Y90A 4XUGA 3WJYA 2RKXA 2G95A 2VFDA 3OHIA 5FF2A 2V81A 1H7OA 1P4CA 1Q6LA 4JXCA 1SQ7A 1GTEA 4NJKA 4IXXA 4K7YA 4AB4A 2VFGA 3NL3A 2NXHA 3W7GA 1F76A 3VFLA 2ZZ7A 3LOTA 2TMDA 1ZCOA 2G96A 1KTNA 1R46A 4IMFA 4ZQMA 1V5XA 1S3HA 1DL3A 4ZQNA 1SFJA 3HG4A 1GYNA 3ANYA 4QSHA 3CEPA 4IMGA 3PBVA 3O05A 3LGEA 4ZQRA 4YXGA 3O06A 1K3UA 1VRDA 3QYQA 3KRSA 4PTNA 1EUAA 2DZTA 1LOQA 2C6QA 3PG9A 3N2MA 2C18A 1FWRA 4LTSA 3C6CA 4RV8A 4BK9A 1P0KA 4H4IA 4BI7A 5G4EA 2YFOA 2J6XA 4HIBA 4O13A 2QCMA 4I7UA 1ML1A 5AHIA 1EWEA 1SU5A 4JTKA 4JIPA 5CPNA 4S2CA 5LNWA 3TKFA 4ZQOA 2I9EA 4TO8A 4E0CA 1W54A 2NWSA 5HQEA 3W1AA 4IPIA 4WQ6A 5D04C 3NQ8A 4XBKA 3R13A 1F7BA 5MHBA 4IJBA 2PRMA 2YR1A 4FEZA 5DBTA 1X8FA 5G1YA 2VC6A 1OFRA 2VELA 4DXVA 3NO5A 4E2BA 2DZUA 4WOZA 1Z44A 2CLKA 2VXNA 2R14A 2NX1A 3HJZA 3GK0A 3LHTA 1IXNA 3EWWA 3QC3A 3FIGA 5E93A 1FCBA 3OA3A 1H63A 3TROA 3UWYA 3MO7A 4ML9A 1YYAA 1XUUA 2QCFA 5L6UA 1S5TA 2RFGA 2YGYA 3W1LA 2B7OA 4NQ1A 5G5IA 3NZRA 3MW7A 1E51A 5H2ZA 1AW1A 4UCGA 4J9JA 3MP4A 4L4MA 3P5YA 3STFA 1S5VA 2VENA 4CNOA 4U28A 4RXGA 3A5VA 4O12A 1K7EA 1DORA 3HG3A 1EP3A 2P10A 2QCEA 3NQCA 1I2QA 1TJRA 1XC4A 4GUHA 4E38A 1RZMA 1L9WA 4JEQA 4RZ6A 3GDRA 2RDTA 2A21A 4OWGA 1SW7A 3IV3A 4K8HA 4EIVA 4AEOA 4N4QA 3P62A 2VFEA 2FB2A 3SW6A 1G4EA 3UYCA 1R30A 1YXCA 3BLFA 1OK4A 2YFNA 3SJ3A 4IPJA 3A5FA 1X1ZA 1GJPA 2TPSA 3Q94A 1TV7A 4WZHA 4JTFA 2BSLA 3P80A 1O60A 4BI6A 4N2YA 2Y61A 1VCFA 4FO4A 1I8JA 3IGSA 4JTJA 2ISWA 4UNLA 3H54A 1KM1A 4UMAA 1RR2A 2Z6IA 3NQ2A 1LORA 5BMXA 2QUUA 4UFJA 3NQVA 3R89A 1H7WA 1UUMA 1BTMA 5CSSA 1SSGA 1MZHA 1KM6A 3JRKA 5HNRA 4OHQA 5CZJA 4A2SA 1X1OA 4MZYA 3M41A 1WXJA 1D9EA 3NVTA 3NPUA 1YPIA 1HFBA 1D3HA 3M16A 3M7WA 4FX6M 3W72A 1ZENA 5D32A 3LRLA 3NL5A 1W5MA 1W31A 3DAQA 3IIOA 4UFIA 5HINA 5KINA 1JVNA 1GEQA 3DH7A 1T96A 4JN6A 2YXGA 3W7KA 4AHPA 3KVLA 3KHJA 2ZA2A 3P8IA 1O94A 3INPA 5J5RA 3Q37A 3RF9A 1L6WA 2XN2A 2WSRA 5A8GA 2C13A 3L5AA 2NX3A 4WXYA 5F2GA 3TUUA 4LC8A 5DY2A 4LY8A 2B4GA 4H3DA 4IUOA 1OJXA 3DFQA 4OQVA 4GUJA 4MYXA 2YDAA 1FBAA 3L67A 2ZZ2A 4RZ4A 3FFSA 1DKWA 3LBMA 4UXDA 5HR7A 4AWTA 1XBXA 2OJPA 4FX8A 3EWYA 1LZOA 3RU6A 3TAOA 3W7IA 4YL2A 1RV8A 2A1YA 4Y9AA 3KXQA 3NQEA 2CWNA 2LLEA 2A4AA 5E1QA 1VYSX 1RQHA 2C19A 3TFCA 2P1FA 4UIOA 4IXHA 3TK7A 3PBUA 1GWJA 3TIMA 3IRDA 2HSAA 4KWWA 4O16A 5K3VA 3SIZA 1KFJA 2J88A 4NT0A 3ABSA 1KLYA 1OYBA 1KBIA 5AYXA 1I2PA 1TPB1 4HNNA 3L65A 1S5WA 3NEVA 3QJAA 3B06A 4R53A 3OEXA 2QDHA 1VYRA 4RZ5A 2DZXA 2EAWA 1R2RA 4WY0B 4QISA 4UFMA 3GKFA 4O17A 4DF1A 4LT9A 1KBJA 2RH9A 1WBJA 3TMLA 4NZFA 3TJXA 3CLMA 1W0MA 2PRHA 1H7PA 2FB3A 2WPBA 2QF7A 1LOLA 2NZLA 1OF6A 2H8XA 4IX2A 5EL1A 3VI2A 4CLMA 3PUEA 2CLFA 4YLWA 3BW3A 4DBDA 3FLUA 4HSOA 4K6AA 1QCWA 3UWVA 4ADTA 2NXGA 3C2FA 1JCMP 3BV4A 1BWKA 3V1PA 1DQXA 4LOCA 5F4SA 1SPQA 2H6RA 3TW6A 3W07A 1TRIA 3TQVA 4DO4A 3FA5A 1W3IA 1L6SA 2E5BA 2ZZ6A 1DBTA 1VGAA 2Q3OA 1YTDA 4IQLA 2GQ8A 1IXOA 1O4UA 4GUFA 1SR9A 4RK8A 1Z48A 3UNDA 2O7QA 2WNNA 3L0GA 1XBVA 3P60A 1UBSA 4LV9A 2V2DA 1VHCA 3PUDA 5EPDA 3TV8A 2V30A 4OU1A 4Y8FA 5KSWA 3UY8A 4FNPA 2V0TA 3U8GA 2ISSA 1TV8A 2V82A 4TMCA 3W86A 1WBHA 1AL8A 3TR2A 1YLVA 3VE9A 1TTJA 4WX2A 3BARA 3ZR4A 3EKLA 3I65A 3N34A 3B0VC 3HGJA 3C0JA 4FNUA 1XI3A 1W5OA 1KA9F 3WK0A 1PHQA 3QSTA 3CPRA 4NX0A 3QRHA 1QPQA 5DBUA 4JX6A 4DPPA 4UTIA 5D30A 3S5ZA 2RDWA 3WFAA 3SGZA 3ELFA 3FEMA 1LP6A 3H55A 1HO1A 4S1FA 3S5OA 1CI1A 3W9ZA 3UZJA 3ABOA 1XUZA 2NUYA 2CLOA 1T8XA 4PEKA 1JQVA 4LRSA 5FI8A 3W7OA 1XXXA 3BO9A 1JUEA 5G2IA 1JCYA 4HNUA 4BWLA 3LTPA 4C1LA 3B0UX 2Q8LA 2DP3A 4WY0A 3BK0A 3IIVA 1TTPA 1YXDA 7TIMA 3W7EA 2RDUA 2F84A 5AHEA 1AMKA 1FCVA 1EB3A 4IMDA 3EB2A 3EX2A 3NQAA 4LV4A 2QJHA 2Y89A 3W22A 3DKLA 2NV2A 3W87A 4Y96A 3D0CA 4OE7A 4GWEA 1A5BA 2YYTA 4DBEA 3TX9A 4DF2A 1XM3A 4AVFA 3W7PA 4IMCA 4R33A 3G8RA 4JTGA 1H7XA 3U6WA 3R5EA 3CEUA 2NWRA 3UXDA 2JBMA 4A29A 3GDKA 2V9DA 4YWIA 5ABTA 1OFOA 2H90A 3CWOX 4AWUA 2QCGA 3QM3A 3HIJA 4JTLA 3GKAA 2ABAA 2QJIA 5EY5A 1MEHA 2YW3A 4RR4A 1IF2A 5K7JA 2C0AA 3UWWA 2Y7EA 3NQ7A 3S5NA 5HJLA 2ZA3A 1QWGA 3NQ6A 4N9CA 5AFDA 3NXFA 4MJMA 4ADUA 1JRCA 1IGSA 3KRUA 4KWVA 3L68A 1FCQA 1NEYA 3C61A 4O4VA 4AH7A 2V5BA 1ZAJA 5C2XA 4W9TA 1F73A 4JYDA 3M5ZA 1LBFA 2C3ZA 3W1TA 1I2RA 4O50A 1TB3A 3EXTA 1J5TA 5T26A 1QOPA 4HPXA 2QUTA 5AHLA 4DQWA 1QFEA 2BZNA 1JCNA 5CKSA 1FDJA 1P0NA 2DU2A 3CHVA 4NU7A 1G7VA 4JX4A 3T4CA 5L9FA 1YDVA 2Z1BA 4NNBA 4O57A 1W5PA 5F4WA 1ICQA 1OHLA 4LU0A 3RFAA 4MLRA 3S1XA 1XDMA 1F6KA 2PCQA 1MXSA 1QNVA 5D09A 4Q32A 1KFCA 2QCHA 1WOAA 2GQAA 1KM0A 5HMSA 1B57A 3DI1A 5D33A 5KMYA 1DV7A 1GT8A 3S1UA 3W2NA 5BOOA 1ALDA 1JCLA 4N9EA 3STCA 1LOSA 2QCNA 1TJPA 1FWTA 1KLZA 3C2RA 1K7XA 3JR2A 1H7NA 3F4WA 1GG0A 4O14A 3M44A 3ATYA 3EWUA 5FEPA 3ZWTA 1QOQA 2QEZA 1JCXA 1I2NA 1FY6A 2BXVA 1G67A 4NXSA 5LHFA 5G2WA 4M19A 5DCBA 5D05A 3SFKA 3S1WA 4UTWC 4MZ8A 2YX0A 4GJ1A 1PV8A 4TU1A 2Y70A 3B4UA 1XBZA 3DENA 3NDOA 5AC6A 2EGZA 4WUIA 3LTSA 3V75A 2ZTKA 1VPXA 3YPIA 4ZZ9A 4IX0A 3QZEA 3KOFA 4MY1A 3G1AA 3OIXA 3G3MA 5KZDA 4GUIA 2VEPA 4Z0JA 1Q6RA 1X7FA 1A5AA 1SZFA 3QEZA 2UV8G 3G18A 4QJ1A 4TR9A 3W7HA 3NG3A 5K9CA 5IBXC 3EX6A 3N14A 1OX5A 1QDSA 1TYGA 4Q33A 4ZMGA 4FIQA 3ABQA 3BGGA 1EP2A 1B4EA 3MI3A 1LTDA 3IGXA 3I68A 3TDFA 1H50A 3HB9A 1P5BA 2ZZ4A 3DKJA 2WJZA 3W1UA 1H51A 5HWJA 1FWSA 1C8VA 2TSYA 3STEA 2J9YA 3BG9A 5LNVA 3QPZA 2VFIA 1PL9A 4RCXA 3T78A 2WSYA 1SZEA 5FF3A 3W76A 3PM6A 1OFBA 4NNCA 4YMZA 3HPXA 3FKKA 1YDOA 3TSDA 4KFPA 4A3UA 1M7OA 3DFOA 3BPWA 1PCWA 1FDZA 4MJZA 5D2VA 1TPUA 4Z1AA 1FDYA 1ONRA 1OX6A 5I3GA 5KTLA 4O15A 8TIMA 4RJEA 1Z41A 4LRTA 2QAFA 4UR8A 6TIMA 2Y62A 3P84A 2IQTA 4JDYA 2CLIA 5LHEA 3TJLA 4N6EA 1TPDA 4FXRA 4CQ9A 1QPNA 2J27A 4MYAA 4DO5A 5CZTA 2E1DA 3PS7A 5AHFA 5CPLA 1BKSA 1KM2A 2XN0A 2VEIA 2A6NA 4DPQA 4MY8A 2JGQA 2Y7DA 3GNDA 4O1CA 4O28A 1KTBA 4M6PA 1N55A 2Q8ZA 3DU0A 3PB0A 1MO0A 3M9YA 3QW3A 3SECA 5AN7A 2H3BA 1MSSA 2ZFAA 4PODA 1XL9A 4EWND 4M5PA 4NNAA 1UASA 3ZFHA 3UQNA 2Y88A 3I7RA 3NPWA 1W1ZA 1ZJIA 3AJXA 4HNTA 2B7NA 1LBMA 1IIGA 2CZ5A 5CPOA 3T55A 3W2JA 4Z1CA 3LHWA 5F1VA 3IVUA 1R2SA 4O53A 2ZZ5A 5G4WA 2ZRZA 4O10A 1O5XA 2ZZ1A 4K7VA 4XTDA 3W2LA 1F2JA 4JS3A 1H1ZA 3EX4A 2GOUA 1LCOA 2E6FA 3W7DA 3G22A 1A5CA 3R2GA 3PB2A 4LNYA 5F2IA 2X1UA 2OZ0A 2ZA1A 5HUOA 2A85A 2WSQA 4UTJA 3VKJA 3TSMA 3IEBA 2E6DA 3LI1A 4QNEA 3GLCA 1WX0A 2ZZ3A 3A24A 1HO4A 3A9IA 4WXZA 3IIXA 5HULA 3LHUA 4ALDA 1AG1O 1FWNA 3E49A 3SGUA 3ZS4A 4IMEA 3LCGA 4IOTA 4OT7A 2JGYA 3PSVA 3SSJA 1RD5A 4UTTC 4M6QA 2QCLA 2OT1A 3DI0A 4FXSA 3S1VA 1OX4B 3DFSA 1LRTA 1TIMA 4MOZA 3EWZA 4ZQCA 3TE9A 3QF0A 4M7SA 5BW6A 2NV1A 3GX9A 4LVBA 1BWLA 5SWUA 2Z0IA 1F05A 4QAIA 5H91A 4B5NA 1XCFA 5HWMA 4PH6A 4K39A 3G8EA 2CLHA 4O18A 1ZHAA 5CG7A 1KFLA 1RVGA 5KITA 4YCOA 3MYOA 3QW4B 4PFMA 1HTIA 2W79A 1QMLA 1R47A 1HL2A 2GVLA 3G24A 4XBSA 2QCDB 1SW0A 3LDVA 1OFDA 1CX9A 2WNQA 1WA3A 2DZVA 5TQLA 4A22A 1DJQA 3W84A 3W75A 1AW2A 1IXQA 3LRMA 3N73A 4KFNA 3W71A 5C5YA 2BWGA 3TA6A 4S2BA 3UPBA 3E12A 2A6LA 3HG5A 4NJJA 5EBUA 4O52A 3GR8A 5E0KA 2JKAA 3L9CA 1K03A 3SR7A 3O1NA 1YXYA 2Y6ZA 1EX5A 1H62A 2AAMA 1NFBA 3RLUA 3RNDA 4AF0B 2QAPA 3W2MA 1B9BA 2EKCA 2ZRUA 5G1TA 4CNNA 1TTQA 3E9AA 3IVTA 4BR1A 1H1YA 4Q4KA 1VHNA 4I7WA 5FEZA 3SZ8A 6ALDA 2YZRA 4G1KA 1LDCA 1C9DA 4I9AA 4LS2A 3GDLA 2J9XA 1YTEA 1KFEA 5CZ0A 2ISVA 2X16A 4X3ZA 3GB6A 4U4MA 4UTKA 5F2MA 4C1KA 3M5YA 1LBLA 2CFFA 2YSWA 1SO3A 1GTHA 4DF0A 2B7QA 1UUOA 4UR7A 3OBKA 1ZNNA 2B7PA 3FOKA 2WO5A 4ONVA 4I7VA 3BVJA 1TREA 1LROA 5AB3A 4PCFA 1SSDA 2AQWA 4O8RA 2CLEA 2YYUA 1DVJA 3I6RA 3IIZA 3B04A 1A50A 2GJLA 4O0KA 1VCGA 2OMAA 4JR5A 1SO5A 4LUIA 4AXKA 1P1XA 5DLCA 3DXIA 3LXCA 1B4KA 1KV8A 4CCCA 3TCEA 3O6DA 2PE4A 4JDBA 1OFEA 3BG3A 5U4NA 2TYSA 4BFAA 4GXMA 1VZWA 1QR7A 3LCLA 3A22A 2H8ZA 1K7FA 3QMSA 4FB7A 3LHYA 3QFEA 3R12A 5D03A 2ABBA 5LGXA 5AYYA 3CC1A 3FYPA 2FJKA 3LLDA 1JR1A 3LCIA 4ZQPA 1PCKA 2D73A 3LCXA 1EPXA 3LRKA 3OVRA 2P0OA 2DZWA 1VR6A 5DXXA 5K9XA 1SZGA 3P67A 1VJIA 1VH7A 4M7TA 3UZ5A 3T40A 4ADSA 4JTSA 3GXNA 1G6CA 1VQTA 2ZRWA 5LGZA 1THFD 1OABA 1WQ5A 3STGA 3W23A 1G4SA 4XTIA 1ME9A 4UTHA 3F1QA 3MHGA 4JGDA 4LC6A 3GYEA 1ADOA 2R8WA 2Y7FA 1PVNA 1UB3A 4LW7A 4N4PA 5C6MA 3UPWA 5HUPA 4X9SA 3WJZA 3WJSA 3TW7A 2NX9A 3P82A 3C3NA 2J24A 3MYPA 4MVAA 5A5WA 3W7QA 1KM5A 3P74A 4OV4A 3THAA 4FX7A 4LVAA 2DZPA 4MPQA 4P2VA 3P7YA 1GOXA 1NF7A 5C54A 4DEFA 1Q45A 4NVTA 3RK8A 5D2YA 3ABRA 2VKZG 3W73A 2V2HA 5CPMA 5TIMA 2AGKA 3M5XA 3C2OA 3HBLA 1TO3A 1DQWA 2Y63A 4D2JA 5FESA 4NX5A 3QH2A 2FPVA 3PF3A 2ZDRA 1VCVA 4AHOA 3NL2A 3LB0A 2O7SA 1RPXA 4XWUA 4WJEA 4JY8A 5EYWA 2FFCA 4R34A 3DGRA 5KZMA 3PR2A 3TH6A 2ALDA 3L0NA 3EX3A 4FNSA 3HPZA 1KFKA 2X1SA 3MI6A 3NPXA 4RX0A 4N9DA 1NVMA 4E2DA 3S0CA 1TV5A 2ZCGA 3NR0A 3PULA 3W1MA 3W1XA 3NGJA 4UTMA 4GBUA 3PC0A 3WJWA 5D2TA 2JKPA 2V2CA 4PL2A 5AC7A 3DFTA 4LVFA 3SI9A 1DOSA 4Y6GA 3B0PA 2CLLA 3HGOA 1QPOA 2I14A 1KM3A 1KM4A 3CT7A 1K8ZA 3UWUA 2E68A 3GZ3A 2J9ZA 2C16A 4CNPA 4DELA 3VCRA 1FXQA 4A21A 4HT3A 1KV5A 5AHNA 2VFFA 1W56A 5F4XA 4HNVA 1FCUA 2WKJA 3IIPA 1J4EA 4O19A 3LV6A 3M1ZA 4O4WA 1KW1A 4UFHA 5CGQA 2HTMA 2YPIA 3MP5A 2A7PA 3PBWA 3TQ0A 5D2WA 1Y0EA 3EWBX 5LZLA 3MUXA 5DY3A 1OF8A 4GRSA 4CQAA 1SUXA 3R8RA 4OGZA 3SY5A 1SZNA 2ZRVA 3CIWA 4EVZA 2VOMA 2BLEA 3W70A 3WJXA 1LM1A 1X6UA 3U2OA 1A53A 1UJPA 1JUKA 3EKZA 3E0IA 4JTTA 2FDSA 3N3MA 3G3DA 3CIXA 3C2VA 2C15A 4JTUA 4JD4A 3GNNA 1Z42A 1JJKA 1PHWA 1W8SA 4O1AA 5I3KA 3H53A 3VE7A 1I2OA 1TMHA 2Z6JA 3MHUA 1K02A 4IWWA 1R2TA 3MBDA 2DJXA 4AF0A 2GQ9A 3CU2A 2CW6A 4N9BA 1MEWA 4LUJA 3KVKA 3GXTA 2E6YA 4BWLC 1HUVA 1O95A 3FS2A 4UUIA 1VC4A 3L66A 3HQ1A 4NJIA 2ZRXA 4EF9A 3W1NA 3NOEA 2F7FA 5J5DA 2EF9A 4CQ8A 5FEXA 4JIQA 3BLEA 3W74A 4K38A 2FTPA 2TRSA 4HSNA 1OFAA 3P8JA 2A5HA 1TPFA 2GVJA 1OG0A 3O6CA 1H5YA 4FNRA 1PS9A 1D3GA 4GC4A 5F2LA 2OX1A 4IGHA 4WD0A 4Z1BA 3L5MA 2VEMA 4K37A 4UFLA 1VYPX 1LLZA 1LLWA 3NQMA 2G5WA 4MKNA 1A5SA 3L5LA 2PURA 3EXSA 1N7KA 3CTLA 1G4PA 2GPTA 3NNTA 1ZALA 3DHFA 1LRNA 1ME8A 2A7RA 1SW3A 3KX6A 1FXPA 2EPHA 2NUWA 3UWZA 3O63A 5FF0A 2QR6A 1DHPA 4JTEA 3W7LA 1ME7A 3HG2A 3UXAA 3A23A 3DFNA 2X1TA 3EWXA 5BMWA 3Q58A 4MFEA 4OBTA 3W88A 2FIQA 3N2XA 3T44A 1YPFA 3FYOA 3E96A 1RQBA 5K4XA 2X30A 3G1DA 5G2HA 1HG3A 1ZY9A 1JCJA 1GG1A 1QO2A 3O15A 3RLVA 1W3TA 4OV9A 3BW4A 4GE8A 5BRBA 3NM3A 3M6YA 1GVFA 3G1HA 3NAVA 5I3HA 2X1RA 3EXRA 4NUWA 3TMQA 3HO8A 3W83A 3HGSA 1FUYA 4O54A 5U7SA 1WOBA 2E5CA 2QDGA 3PVFA 4MLJA 2QKFA 3P5ZA 1M6JA 1JUBA 2V8ZA 1NAL1 2QJGA 2E5DA 3DHDA 4RXFA 3LI0A 3EX1A 4O11A 3TC6A 1O5KA 2C1HA 2NXIA 3TFXA 3G0XA 3NZ1A 5TBOA 2DORA 4QQ3A 2WQPA 3W3OA 2WNZA 1JQXA 5K2ZA 1M5WA 3HMJG 1G7UA 1OFQA 4H6KA 2GVGA 3G1SA 3DBPA 5EKYA 3Q2DA 5F1UA 3TSBA 3LXBA 4QNWA 2CU0A 3IVSA 5C55A 3NQGA 1JRBA 3TAKA 2R91A 3GDTA 4NJHA 1TPC1 4Z08A 3IGUA 4UTUA 3MJYA 1C29A 5AOUA 3W2UA 4KFOA 4WOQA 1B3OA 3CM4A 2A0NA 3OG3A 4O1DA 5D38A 3USBA 3LCWA 3L0KA 1W3NA 1U83A 1LYXA 1YTKA 3B8DA 5BNKA 1GYLA 3GAYA 1LRQA 3BG5A 3O6YX 4KKXA 1Q6QA 4FNTA 4TMBA 4BI5A 1UCWA 4NXKA 3BW2A 5AHMA 1GZGA 3NM1A 1XDLA 3S8HA 2Q3RA 1K8YA 3L2IA 4A2RA 1DJNA 2VFHA 3C4UA 2E09A 3PSWA 4JYEA 5I3JA 1YDNA 1W5QA 3C2EA 3FKRA 3E02A 3FJ6A 4GUGA 3PAJA 5D02A 5LNRA 2QUVA 3W7JA 4M6VA 5FF4A 1EUNA 1EP1A 4JICA 4LVGA 1EA0A 1XFBA 4K8EA 2JKEA 1M7PA 2PC4A 3EEGA 1I4NA 1T0OA 1TPEA 3LBCA 4JNMA 1L6YA 2YCEA 4MUZA 4O0ZA 4HKPA 4XZ9A 3KAOA 3G1VA 2JK2A 5LSMA 3O8AA 1H7RA 2ZQ0A 3UD6A 3LERA 3LXAA 3TXVA 2CZFA 2XFWA 2DZSA 1GVSA 3MBFA 4XQ6A 3MP3A 3S42A 5HR6A 4UTWA 2WOQA 4ORIA 3TNOA 5DELA 3M5VA 1H60A 5CSRA 4ORMA 3N19B 2FPTA 4UC5A 1W5NA 3LHVA 1KTCA 2C14A 3N9SA 3CB8A 3C8FA 3C56A 3N9RA 4JTHA 4N6FA 2H3DA 1OFPA 4HPJA 1NF0A 1TPH1 1TPWA 1VLWA 5D2XA 3WK1A 3WK2A 3GXPA 2HS8A 1GQNA 3F03K 4QM1A 2FPYA 3GR7A 3O07A 3F4NA 4FIRA 3LHZA 3MMTA 5IBXA 3W7MA 2W0UA 3CQ0A 1WAUA 1GVRA 4N02A 4PA8A 4NZJA 1U5JA 2ATSA 4UTLA 3QMTA 2Y7GA 3PBYA 4P61A 4AMAA 1SFLA 3PWAA 3W6YA 3KFTA 2ZTJA 3GIYA 1EIXA 2E77A 4CCDA 3GAKA 3W1QA 3RMJA 3M0ZA 4LS1A 3MHFA 2VEKA 3FJLA 4MFDA 1AW5A 3NYZA 3LTYA 3G0UA 3NL6A 4ZL1A 4BF9A 3I7SA 1VLIA 4FF7A 3W1RA 1RQEA 1TTIA 1N8FA 3TQKA 2YW4A 4RLIA 1ZAHA 4ICNA 1YADA 3GDMA 1GVOA 4UNKA 1Q6OA 4UMCA 1W37A 3MI2A 4UTTA 1G69A 1EWDA 1QO5A 2GUUA 2ZRYA 4UFKA 1IXPA 4L4LA 2G97A 5KZEA 1NSJA 3L21A 3UY7A 4TIMA 3W1PA 5DCEA 1TPVA 2OT0A 3DFPA 4Z0SA 2KZHA 2CLMA 4MY9A 4AWSA 3JS3A 1OYCA 5DN1A 3THQA 1TSIA 3LCFA 4R7JA 2EHHA 2W6RA 3NQDA 3NA8A 3W7NA 1J2WA 3BGJA 3QMRA 5FF7A 1OX4A 3KVJA 3S6DA 2A2IA 2CZDA 3LM7A 3PG8A 2HMCA 2X2GA 5DCDA 4JX5A 4AHQA 4XKYB 1F74A 4HN4A 1WV2A 5D37A 1KFBA 3B05A 5I3FA 4WY0F 2QCDA 4MIMA 4XKYA 5LNSA 3ATZA 3BLIA 4LS0A 3LLFA 4FHAA 3P61A 2DJLA 1MEIA 1OK6A 4JY9A 1SO6A 3DZ1A 1V7YA 4X22A 5DXYA 4HHPA 3C52A 2QCCA 3K30A 3MWAA 3PUOA 5I3IA 3QQ0A 1GPWA 4X2RA 1IIHA 2HS6A 3HPSA 1L2UA 4Z1DA 3HF3A 2GJNA 3TU9A 4UMBA 4O1BA 3PY2A 2ATMA 4EOUA 2B0MA 2OCZA 4FNQA 3M43A 1ICPA 2FQIA 4EF8A 3NQFA 3T7VA 1CW2A 3ZWSA 3W2KA 2Z2UA 1FX6A 5GVJA 1TCDA 4LVDA 3G0SA 3A21A 1TQXA 2I1OA 1AK5A 4QITA 3CWNA 1K8XA 1EEPA 3QQ1A 1WDWA 5HWNA 3OVPA 4RKAA 3O16A 4QIUA 5AYZA 4PL1A 2FLIA 5LNUA 1Q3NA 3LCHA 3S5YA 4CCEA 3GVGA 1BEUA 5CZSA 3W7RA 3G1FA 5K9DA 3HGRA 5EA9A 1F5ZA 1QAPA 3W7CA 1F6PA 1OYAA 1ZFJA 3M47A 1VS1A 2V5LA 5EMUA 3G1YA 1QPRA 5AC8A 3VNDA 2PRLA 3TC7A 2R94A 1PE1A 3G1XA 1GVQA 1XKYA 2A7NA 4GFSA 3B03A 1TQJA 4DO6A 3I7QA 1ZAIA 3TXZA 4PC8A 2NLIA 4NJGA 4ZVJA 3OVQA 1SO4A 5FEWA 3QSRA 3QPYA 2CZEA 1JULA 1WYIA 4POCA 2ZYFA 3LV5A 1OVDA 2RHGA 1ICSA 4AAJA 1G4TA 4JYFA 1TRDA 1FQ0A 2NUXA 4GNJA 1XBYA 3W85A 2Y85A 3KVMA 5LKYA 5K4ZA 2ZBTA 2BX7A 2XN1A 1AL7A 3LX9A 3NPVA 1I45A 3WK3A 3S9YA 2BTMA 3P81A 4YCPA 1H61A 2E6AA 4LWWA 3HOJA 4MZ1A 4JTIA 3AO0A 3UWQA 2WV8A 3KRZA 1PIIA 4K36A 5IM51 1T99A
chains in the Genus database with same CATH superfamily
4LFYA 4XUGA 4N42A 3W02A 2VFDA 3VD7A 4FAMA 3UPMA 3QV7A 3DC0A 1Q6LA 4P5UA 1ZS2A 1SQ7A 1GTEA 4NJKA 3T2QA 2HRWA 1M53A 5B7YA 4DHGA 2O9OA 2ZZ7A 2TMDA 2CHRA 1SGJA 3UCQA 4KGJA 3TC3A 4ZQMA 1YE4A 5FOOA 3CHEA 3HG4A 4QSHA 3PBVA 5HPCA 1OGGA 3VUSA 3ES8A 3O06A 9CGTA 4Z2KA 1K3UA 1QNSA 4HMNA 5D4YA 1EUAA 2ON3A 2WC7A 4DO7A 4D6DA 5CPTA 1EJRC 1N8WA 4TUFA 4ZFCA 4BI7A 4R9OA 1XIIA 3S47A 1AJZA 2J6XA 2QCMA 4JIPA 1Q6FA 4JQ4A 1HKMA 1A0DA 1JZ4A 1LLOA 2YLAA 3CUFA 5HQEA 4IIGA 3CUXA 1F7BA 5MHBA 2PRMA 1TCMA 4FEZA 1X8FA 2W9MA 1V03A 1EOKA 2VELA 1GNXA 3NO5A 4AXNA 1XCWA 3A3HA 4GQGA 1JFHA 3WLRA 2WM0A 4ASTA 1RBOB 3GK0A 3H2OA 3QC3A 3EWWA 3FIGA 1NOUA 3OA3A 1H63A 3O6AA 1FH8A 1XUUA 1NOWA 4OTKA 1IWAA 2YGYA 3MSYA 1O5QA 3SCPA 5G5IA 4XO7A 1HP4A 3CT2A 1AW1A 5H2ZA 2Z7KA 4ICCX 3CO8A 4RXGA 3KTXA 1JGMA 4LALA 1XIMA 4UQEA 4GUHA 3OQEA 1RBAA 3GDRA 2PTYA 2RDTA 2XIQA 4HD5A 1S2AA 2PWDA 3ZLHA 4A3RA 1Y5WA 3VNIA 4RNFA 3P62A 4DBUA 1OEPA 3NSNA 3LMYA 2FTWA 1R30A 1OK4A 1HKIA 3ITXA 3A5FA 4G7FA 3RM8A 1TV7A 1MRQA 2QMJA 5ENLA 4PCPA 3QN3A 3DYPA 1O60A 2D20A 1MMFA 3MZNA 1V6UA 4FO4A 4JL1A 1J6OA 3IGSA 3AIWA 3H54A 1KM1A 2BGQA 3NQ2A 1N8IA 3P0XA 3BLLA 4L1GA 2PWUA 3R89A 2VC7A 2X42A 1P7TA 2I9UA 1ODZA 2PDMA 2PC8A 1SSGA 1A3WA 2FZDA 4MZYA 1DWFM 1CGVA 4J27A 5KETA 2PSNA 1YPIA 1HFBA 1V3HA 1SJBA 4NF7A 3M16A 2FGLA 1OBAA 1M41A 3LRLA 3NL5A 1W5MA 3IIOA 4MWAC 1PO9A 5EBAA 1JNEA 1JVNA 4PSRA 2VDHA 2Y8VA 2QPUA 3DH7A 4JN6A 3W7KA 3ZJKA 1FFRA 3K2GA 2XIOA 1O94A 2ZWZA 2RGLA 5BU9A 2REQA 5IHRA 3E0FA 1KKOA 4NAEA 1J79A 4LC8A 4LY8A 2B4GA 3WBAA 2WMKA 4IUOA 4HA3A 3KS5A 4HNOA 3TLQA 4AQLA 4YTSA 2YDAA 2ZZ2A 3RGTA 4JKLA 4PUNA 1A3HA 1TV4A 3SCQA 4FX8A 1EZ2A 2BGNE 2OZ8A 3NQEA 4Q3MA 2C7FA 2QJMA 2A3EA 4A35A 1WAWA 5E6ZA 3APYA 3IRDA 2HSAA 4O16A 1P48A 3SIZA 4US5D 1WKFA 4JTAA 2WSPA 2X2YA 3OZYA 5AECA 1I2PA 1TPB1 3VM5A 1JPKA 2OEMA 3NURA 3QJAA 3IJLA 1S38A 3LZ3A 4CVWA 4WK9A 2JIWA 3QOKA 1JDDA 4Y2WA 3ABZA 3S9IA 2OYKA 3HM7A 5I6SA 1WBJA 3TMLA 3VILA 3BCJA 1W0MA 2PRHA 2YDSA 4LCQA 1Y5XA 1H7PA 5TD4A 3DFHA 4GA8A 2H8XA 4CLMA 3PNZA 1UR4A 4E3TA 4YLWA 3BW3A 1JCMP 2IXVA 4JNYA 1DQXA 3GXIA 1W2PA 3TJ4A 3FHQA 3VX1A 1PKYA 1JL8A 3OYXA 3W07A 1TRIA 1NIUA 5GPRA 2DW6A 2PB1A 1HKVA 3O0FA 1QU4A 1VJSA 1UR9A 3GXMA 2Q3OA 3GTNA 3VK5A 1JXKA 4M0XA 1V51A 1F61A 2GQ8A 4B4FA 3TTQA 2XIIA 2PP0A 4RK8A 3SUTA 2WNNA 1XBVA 2Y5JA 4IICA 5DT7A 1AJ0A 5EPDA 2BVYA 2V30A 3HQOA 3IUDA 2XWEA 3HV8A 4QLKA 2YJQA 1U1JA 2MNRA 2ZADA 2GGEA 2AQOA 4G7EB 1QATA 4C6NA 3QLLA 3VE9A 1W1TA 3N13A 3C0JA 4FNUA 4AY1A 1XI3A 1W5OA 3B97A 3VNJA 2I56A 3QRHA 1QPQA 3WMLA 4DPPA 3ZR6A 4KIEA 4UTIA 5D30A 3VM7A 3TONA 1WB0A 1E73M 3FEMA 3H55A 1R3QA 4XD3A 4HHHA 5D9OA 4EAYA 1DJIA 2WNWA 3ABOA 1G01A 2PLJA 1EQCA 3WQDA 2ACSA 2WMIA 1AFSA 4PEKA 2PTZA 1JQVA 3OGVA 5FI8A 5MF5A 1LG1A 3VO0A 4YYCA 2Y2WA 3M46A 1JZ8A 1JUEA 2HCVA 1XICA 5G2IA 4DAIA 4XSLA 1RUSA 1CLXA 2Q8LA 3ONBA 3RLHA 5CJMA 3IIVA 1YXDA 5FL1A 2Z4GA 3HURA 3TZNA 3NQAA 4XBJA 2OGYA 2Y89A 3M0KA 2VZVA 1TVPA 4JEJA 1A5BA 1PZ2A 1XLLA 4Q8NA 1RVKA 3VIOA 3T09A 5JMUA 3SUWA 3AAMA 2CESA 4A29A 3WYZA 4NZCA 3GU9A 4Y9NA 1Y7VA 3L4YA 3QM3A 4QX4A 4HK7A 3HIJA 4GIEA 4YHEA 4ZB0A 2CWXA 1UH2A 1QRQA 3FXYA 4YNGA 4DXXA 1XW8A 2Y7EA 5C8BB 1K9TA 4U10A 2AOSA 4GI6A 5AFDA 1IGSA 4KWVA 5G1MA 1FCQA 1NEYA 4O4VA 1TKKA 1S2VA 3L4ZA 1EGMA 2YL6A 4NAFB 2C3ZA 1I2RA 1R6WA 4BF5A 2WC4A 4L61A 1JCNA 1CDGA 1LT8A 2E9LA 1G7VA 1ZJBA 1TZZA 3VMNA 1FVPA 2GSHA 4B5TA 3A12A 4I5RA 2Z1BA 4O57A 4BCEA 5BXPA 4A8IA 4RDYA 1UG6A 4LU0A 1TZ9A 4D1JA 3PWGA 1XDMA 1F6KA 4UCFA 1KRAC 3UR2A 2GQAA 1KM0A 5C9UA 1QPKA 2C8NA 5HMSA 2IPWA 2PDUA 3DI1A 4JL2A 4DN1A 4JIIX 5D33A 3WBEA 1KR1A 1V3JA 1TA3A 5BOOA 2E25A 3P14A 1S3TC 3K8LA 4ZTXA 3BLPX 1CB2A 1TJPA 1DXFA 1KLZA 4J5NA 1GG0A 3ATYA 3EWUA 4M81A 1I2NA 4PMXA 5XIMA 1WO2A 4DWSC 4MDPA 3S1WA 1J5SA 4UQDA 1PV8A 2Y70A 4PUWA 1J0ZA 2D2JA 3NDOA 3OPSA 4AZHA 3UCCA 5AC6A 4WUIA 3V75A 4Q8PA 2ZTKA 1JF5A 3GW0A 1DIDA 3CAWA 3KOFA 3OOQA 2D69A 5A3HA 2HPIA 5EMKA 1HJSA 4Z0JA 5C2GA 3CHDA 2PZ0A 1NWUA 3ZVHB 3QEZA 1WPCA 5IDZA 3EX6A 1OX5A 1QDSA 4Q33A 2XHYA 1KB3A 2DQWA 1GOQA 4UTFA 4QLLA 1Q8AA 1LTDA 2IPFA 4Z1YA 4IG2A 1H50A 1UC5A 4XV0A 1P5BA 4ZB2A 4WEVX 3KEHA 2WJZA 4PB5A 1VFSA 2OEKA 5LNVA 3QPZA 3GC4A 1G5AA 2VGBA 3PM6A 3SUVA 4LBUA 3RYSA 4KFPA 3DFOA 4MJZA 3BPWA 1FDZA 4W5UA 4Z1AA 2JQXA 4GYJA 3OBAA 4A6GA 3A4AA 6TIMA 4AZ6A 2Y62A 4HMEA 1JPDX 3N18A 4LAZA 2XIBA 1NP0A 4I8DA 1TPDA 1QPNA 4G9PA 3VGBA 4MYAA 3H4WA 1K1DA 4HCDA 3KBNA 4IGNA 4MY8A 1JPMA 2Y7DA 4O1CA 5AKQA 5DRCA 1KTBA 1N55A 4MF4A 1RPKA 3KOWA 3PPCA 1M9HA 1MO0A 3M9YA 3QW3A 1UOZA 2J7CA 1XLAA 3CZEA 4IG2B 5I2UA 2I5GA 3KBVA 1PWMA 2P50A 2GDVA 3KZSA 2BDQA 3ZFHA 5HPOA 2W66A 2D1ZA 2PDKA 3I7RA 3N2BA 3E38A 2ZUNA 1ECQA 2B7NA 1VB9A 5CPOA 3T55A 3LHWA 1M1BA 1MUMA 2ZZ5A 3SEPA 4O10A 3S1GA 1FKWA 1F2JA 3R43A 1LCOA 4JTQA 2E6FA 3IRSA 4RNJA 4S38A 4ZENA 2OZ0A 3KBJA 1PX3A 5HUOA 3I3DA 2WSQA 1EJVC 1B2YA 1WX0A 2ZZ3A 3IIXA 1TZ7A 5HULA 4OZOA 3LHUA 1AG1O 3E49A 3ZS4A 2WCSA 4OT7A 2ZWYA 3GBEA 4XISA 5CCZA 4YPJA 1D8CA 2OT1A 3S1VA 1OX4B 3DFSA 1LRTA 2Q8XA 1TIMA 4J3WA 4ZQCA 3MKKA 4Q4OA 1Q2SA 3G77A 4HZMA 2GK1A 2Z0IA 1XHGA 3M0YA 1XCFA 3II1A 5EMMA 2HWGA 4WVXA 3WDHA 4UZSA 4K39A 1WKYA 3G8EA 4AVNA 1GZJA 4DWSB 1KFLA 1K9FA 2IUZA 5KITA 3CLWA 4YCOA 1KXQA 4PUDA 1I1WA 3QW4B 4PFMA 2A3AA 3NO3A 1B1YA 2GVLA 4JAWA 3UJSA 4XBSA 4J1OA 3LDVA 2O56A 2VJXA 1CGYA 4HZ6A 1ZTVA 5LXXA 1IXQA 4DZ5A 5C70A 3LRMA 1X98A 1R3WA 2OB3A 3W71A 1VEMA 3TA6A 4S2BA 3E12A 2A6LA 2HE8A 3FDGA 2I17A 3MUZ1 1Q65A 3AHYA 2FVLA 3L9CA 1YXYA 3ZR5A 1H4PA 3RR1A 4AF0B 4X9YA 4RNHA 3W2MA 1VBGA 1B3XA 1QNOA 4YS1A 1VHNA 2BY2A 1QHPA 5FEZA 4G1KA 4UQCA 4I5UA 3CMFA 2UY2A 1OGBA 2YBTA 1RD6A 2FFIA 4Q4QA 3H70A 3REQA 3IUHA 4X3ZA 2HVOA 1E6PA 4UTKA 2OVLA 4KWSA 2Z26A 4NY2A 5M5DA 4PMDA 1KGUA 4EPKA 1GTHA 2RJGA 2WW5A 2V69A 3WENA 3PZ9A 4UR7A 1CWYA 5A6BA 1I60A 1PKNA 1ZNNA 4U5IA 2WO5A 4I7VA 3EEZA 2XU2A 4YTQA 1UW9A 1OC7A 4S3DA 2YYUA 5DFAA 3B04A 1A50A 2HVMA 4XVEA 2GJLA 3PZOA 1BRLA 1EF2A 4TQTA 1EC9A 3DXIA 3W27A 1B4KA 1KV8A 2G3JA 2PE4A 1BYBA 3B9DA 3ZLFA 4D72A 1DIKA 3UXKA 5A1AA 1WKDA 4PMOA 2OKTA 1BVZA 3W00A 1I75A 4PTMA 1PTGA 3UJ2A 2O9RA 4DJEA 1K7FA 3LHYA 1A80A 3APGA 1TIWA 3FYPA 2AKMA 1XX1A 4C7GA 1E6ZA 4ZQPA 3NZPA 3LCXA 4HNLA 4MNJA 4QE4A 5F7UA 2DZWA 1VR6A 5D9PA 2PLMA 1K4GA 3WNLA 2XZ9A 4Y9PA 1AUSL 3GXNA 1NOFA 1G6CA 3UJEA 4PRRA 3R0KA 4FF5A 2A3HA 4C6CA 5LGZA 1OABA 1WQ5A 4V33A 3PTKA 1Q5MA 3STGA 1ME9A 1T6MA 3MHGA 3S83A 4DNHA 4H8HA 1YRRA 1ADOA 3KBSA 4HN8A 4LW7A 3VIPA 4LEFA 4ZOAA 1FHLA 3WJSA 3WY1A 3TW7A 4JFUA 3FXGA 2J24A 4I8YA 3MYPA 1ELSA 1UHVA 1TUFA 4S3BA 1WE5A 3W7QA 1KM5A 1P0DA 2OWXA 4L4OA 5AYIA 2DZPA 4MPQA 4P2VA 3VZYA 2WZEA 3L2MA 1GOXA 5JH2A 2PI6A 4NVTA 3H23A 1EQPA 3UEQA 2F38A 2ZX5A 4N0RA 2C79A 4IL2A 4D2JA 3PF3A 1IEVA 2YKKA 4C6JA 1V3KA 3NL2A 2OZTA 3PBGA 2O7SA 3RO8A 4MGGA 1RK6A 4JY8A 4R34A 1FHDA 3M0XA 4W7VA 3PR2A 3CUHA 1B54A 2PGFA 4AD4A 4E2DA 2WCGA 2ZCGA 2ZXDA 4UTMA 1EEXA 5ABFB 4GBUA 3EMCA 2GUYA 3CK5A 4J28A 5AC7A 3DGBA 3FVDA 1DOSA 1W2VA 4IUGA 2XFRA 2I14A 1KM3A 1TR1A 3OW1A 2E68A 4AG0A 1XLFA 4CNPA 1KCXA 4HT3A 3WQVA 1W56A 4P7RA 2WKJA 3V0UA 3IIPA 4J3ZA 1KW1A 4UFHA 3QGAC 2VP8A 2HTMA 2XZ7A 4Z2JA 2A7PA 3PBWA 3RIKA 1Y0EA 4P7NA 4OKDA 1OF8A 4W4QA 3RCMA 3GTIA 3R8RA 5A6MA 2ZRVA 4O1EA 3MMUA 4S3CA 3W70A 3QTPA 1BXBA 3RLGA 3U2OA 3WBWA 2WSKA 4ZGYA 2XH4A 2PFHA 2VUYA 1ZL1A 4XAYA 1UWAA 2FDSA 3N3MA 3CIXA 3MA8A 3C2VA 4QR6A 2FH8A 4G8TA 5HDRA 1PHWA 3F2DA 3R25A 3H53A 1GYMA 3GYCA 3VE7A 3VDAA 1V0LA 2Z6JA 1Q13A 1Y5VA 3WUGA 4IWWA 4XX6A 1KRMA 3PJWA 2NVCA 1TMQA 2GQ9A 3UYIA 3ZVHA 3CU2A 1SJCA 4LUJA 3ANVA 4LX4A 1PB0A 1BVNP 4UUIA 1ZBWA 4NJIA 2ZRXA 5J5DA 1X97A 4HMDA 3RM4A 4CQ8A 2R82A 4GXPA 1ZUAX 4GX9A 3LZ5A 4DLMA 1J8VA 2FTPA 1TPFA 1E15A 3G2GA 1WXZA 4KEVA 1CGXA 4KRZA 4Z1BA 4GI9A 2Z2AA 3L5MA 1E43A 2KAUC 2WJFA 4PUMA 4E8CA 2Y5EA 4M3PA 3NQMA 2G5WA 3VD3A 3N4EA 2RAGA 4H9ZA 3EXSA 1QJWA 3NNTA 4H04A 4DZIA 1V6TA 3UVIA 2W62A 1PIGA 3UWZA 1ZJHA 5FF0A 2ZXBA 4MWAD 5FAJA 1DHPA 1R87A 2YDRA 2D0HA 2WZTA 3DFNA 4HA4A 5BMWA 4V15A 3GNOA 1V3IA 4HOZA 3W88A 2JF6A 2FIQA 3T44A 1M7JA 4QEHA 2QS8A 3HV9A 3RILA 5TAOA 3WQGA 3VGFA 3RLVA 3BSGA 4OV9A 3BW4A 4GE8A 1C93A 4L64A 4QE5A 3G1HA 1GOKA 2VRQA 3W83A 1H5VA 1V6XA 4XG1A 2E5CA 2QKFA 3U5UA 3GNPA 1JUBA 2E5DA 2FDMA 4HBKA 4O11A 1K8CA 5GJMA 2E40A 3NEHA 2ZXQA 3TC6A 3VNYA 2NXIA 2CKRA 2O55A 3T05A 3G0XA 3NZ1A 5TBOA 4H8UA 4LBSA 3TTYA 4H6KA 1U1HA 2GVGA 5D9NA 3QZAA 5EKYA 3GHSA 4GACA 1MNSA 2QHAA 2X0SA 1GKQA 3UG5A 1H0GA 1QVBA 4QNWA 2CU0A 2F61A 2DDXA 3NQGA 2WBKA 2VC9A 4UTUA 3MJYA 1JYNA 3L23A 4QFUA 1FOBA 3U4AA 1C29A 4C65A 3W2UA 4KFOA 3CM4A 4MG4A 4C6MA 3OG3A 2EQDA 2HISA 3K5XA 4ACZB 3VCNA 4KEMA 1BVWA 1EC7A 1LYXA 1YTKA 4LQ1A 3KS6A 4W7UA 2XWDA 2Z00A 4TMBA 3WLMA 5DQPA 1SR0A 4J4KA 4BI5A 3BAKA 3GH4A 2OSWA 2ANUA 2Q09A 1FWFC 3L2IA 4A2RA 3QBUA 3WDJA 6ENLA 7ENLA 3UVAA 4DB7A 4AD3A 4L1XA 3PAJA 3W7JA 1JYWA 4XIAA 5FF4A 3BMXA 1ZBKA 4JICA 3WKZA 1EOMA 1V02A 4NZ4A 3I10A 4C91A 3R0UA 5H1WA 4GY7A 3LBCA 1BFNA 4O0ZA 4XZ9A 3H21A 4FLSA 1H7RA 1RP8A 3UD6A 3LXAA 3OODA 4HP5A 4XQ6A 6A3HA 4GO8A 2VZOA 3GG0A 5EFFA 5HR6A 1A0CA 4ERGA 4UQAA 1ISYA 3TYUA 3TNOA 2FPTA 4UC5A 3IJ9A 3H2EA 3N9SA 2YDQA 3CB8A 1OFPA 3SSZA 3WK2A 3GXPA 4R5EA 1GQNA 3O07A 3QV9A 3LSBA 4FIRA 4WKFA 3W7MA 1NY1A 1WAUA 3WNPA 4HPGA 3TVAA 4PA8A 4UTLA 5ABGA 1SFLA 4X0VA 3KL0A 4GI4A 3RMJA 3W1QA 3M0ZA 3AZSA 2OODA 3PZQA 4AD0A 3NL6A 4W8BA 4BF9A 3I7SA 4AX7A 4HU3A 1RQEA 3GTHA 3TYEA 3TQKA 4RLIA 5BRPA 1YADA 3GDMA 3HFTA 4KW2A 5CGMA 1Q6OA 2C0HA 2PDNA 4B92A 1F3EA 3MI2A 3GNRA 1EWDA 1F4AA 2WB5A 2ZRYA 2OG9A 4WJ8A 1PIFA 4IGMA 1ITCA 2G97A 5KZEA 2QLYA 1U1UA 4TIMA 3AZTA 1TPVA 2OT0A 3DFPA 3QGKC 3TTSA 3KLKA 2CLMA 3CZJA 3RR4A 4KH2A 4AWSA 5DN1A 1JPHA 4PTVA 4R7JA 3ZLGA 3NQDA 3NA8A 2X40A 1CXEA 4UZUA 2WHLA 3EOSA 5FF7A 1QW7A 1N82A 2A2IA 2CZDA 3AS3A 1MWOA 3LM7A 3PG8A 1JD7A 4PMRA 4F0RA 4JX5A 1S1PA 3OJGA 3ANUA 4DM2A 3GBDA 4HSHA 4XKYB 1QHOA 4LUTA 1J93A 1F74A 5FJUA 1M01A 5I3FA 3ATZA 5CC3A 3DN5A 3LLFA 3UGVA 4K3ZA 3ZIZA 2VL4A 4JY9A 2VRKA 4H6QA 4AIOA 4X22A 3DESA 3GW3A 3ISIX 4JFTA 3QQ0A 1E0UA 2OXNA 3V35A 1XGZA 4Z1DA 5GNZA 4JN7A 1Q8JA 2ESCA 4LGXA 3HA1A 3AUOA 4O1BA 1XC6A 4EOUA 2OCZA 3RPTA 4HJWA 4MAVA 2FQIA 1MFUA 1FH9A 1CW2A 5GVJA 1TCDA 5DANA 5A2BA 4GK8A 1TQXA 4NYYA 1VF8A 1X7IA 1EEPA 1WDWA 1CENA 3O16A 4PL1A 5LNUA 1PX8A 3S5YA 1IV8A 3GVGA 3W7RA 3G1FA 5EA9A 1W9BM 2OLSA 1UMYA 1F5ZA 3W7CA 4R27A 1UBPC 1OYAA 3W0KA 1VS1A 2BVTA 5A6JA 3G1YA 4J3VA 3O9NA 3V5CA 3TC7A 3M6DA 3TQPA 3G1XA 1GVQA 1XKYA 2A7NA 3CWHA 3B03A 5A6KA 1ZAIA 3TXZA 5GNXA 3HMCA 2NLIA 1OG6A 1AD4A 2H9AB 3GG7A 2Z27A 1UWIA 3V0TA 4XD6A 1Q2RA 5JIWA 5DMLA 4DZAA 2CZEA 3N4FA 1YMYA 3MS8A 2ZYFA 4IFKA 3LV5A 1OVDA 4AAJA 3U5YA 3VOFA 3U48A 2NUXA 4GNJA 2PBGA 1XBYA 2Y85A 2INEA 2XN1A 1AL7A 5IHSA 3QHMA 5CG0A 1RCQA 3S9YA 2OEJA 3QV8A 4DXKA 1F8IA 3GM8A 2R1LA 4JTIA 3UWQA 2WV8A 3KRZA 1PIIA 4K36A 4GCAA 1XLEA 4TXEA 2WAGA 1FWWA 3OG2A 5LA2A 4TX9A 4Y90A 2DH3A 1GQJA 4P8XA 2CKSA 1S5NA 1VBJA 1P4CA 4LEQA 5CAKA 4JXCA 2JIEA 5I3DA 4K8GA 4ZE4A 2YZ5A 2DVTA 1BSIA 1TX0A 2X7WA 3LOTA 2J7EA 1ZCOA 2WVUA 1BXCA 2HNHA 1DL3A 1A3XA 3ANYA 1XIDA 3OQ8A 3WLNA 3LGEA 1HKWA 3PZIA 3WH5A 4JTRA 3KRSA 1OADA 4PTNA 1BTCA 3LD5A 1AH0A 1LOQA 2C6QA 3VZXA 4ENLA 1FWRA 3WG6A 3WDIA 2ZUUA 2G4JA 5A8PA 4RV8A 1EGVA 1MW1A 2GFTA 1P0KA 4MNLA 3ZMRA 1RHCA 4O13A 1ML1A 4LY4A 5LNWA 1SU5A 3E5BA 1BYAA 5CPNA 3BLKA 5FA5A 3TKFA 5H8MA 2ZUMA 1ZJAA 4E0CA 2NWSA 4UNIA 2J77A 3L4UA 5LA0A 4JIRA 5DMMA 1XWYA 2X0HA 1CXHA 3V7PA 3K1GA 5D04C 2DV0A 4FSAA 4LJ3A 4IJBA 3B9EA 3P6LA 2YR1A 5DBTA 5E9AA 3QY7A 2VC6A 1OFRA 3KCLA 2R9RA 1XH1A 4ROQA 3V5OA 3KUMA 3SDOA 4E2BA 4Z2GA 2DZUA 5JBFA 1WDQA 3KTSA 4WOZA 1Z44A 2DEPA 2NX1A 3CZKA 1REQA 3M0IA 4FP1A 1FCBA 4W86A 1Z89A 5GQBA 5E70A 5L6UA 1V79A 1GOIA 3W1LA 3B40A 3VUPA 4H9MA 1MW2A 2V5DA 3MW7A 1E51A 2YB1A 1E9ZB 5DF0A 4XZLX 3STFA 5EMYA 2VENA 4CNOA 4U28A 1Y65A 3VGEA 3A5VA 1TWIA 2P10A 1JZ5A 3NQCA 1I2QA 1TJRA 2XSXA 2OQLA 1VIZA 2Y1HA 4UWMA 1L9WA 4AZIA 3WFLA 4OWGA 2YOCA 4NI8A 4H9UA 2WHJA 4AEOA 1V6WA 2FB2A 3D6NA 3SW6A 1K4HA 3TOYA 3ALFA 3H8AA 2HE5A 3AIRA 1X1NA 4KCTA 4IPJA 1G94A 4R3UA 1A5UA 2TPSA 4JTFA 2BSLA 3AYRA 4AY7A 1OD0A 4BI6A 4N2YA 4Q8QA 2A3LA 3LSCA 3KCOA 1I8JA 2GK1B 3SN4A 4G1NA 4JTJA 2YBUA 3WD2A 2ODOA 2FJUB 4MB3A 3OBEA 2WXDM 4LUYA 4QJ5B 1MZRA 4PUUA 1BTMA 1KM6A 3SCTA 3AUJA 4A2SA 1X1OA 1R3VA 2OYLA 1TVLA 4B90A 1PYMA 4EKJA 1D3HA 3WLKX 1ZENA 3K46A 1BQGA 1XD1A 1W31A 3EA1A 4UFIA 5HINA 3AISA 4JTDA 1GEQA 3N9KA 5CC5A 4JQ1A 3CH0A 3NCOA 2QMKA 2ZA2A 1I9CB 5J5RA 3Q37A 5BXTA 1L6WA 2XTKA 5A8GA 2C13A 3PWIA 3AS1A 3L5AA 4QTGA 3GNXA 2WMGA 4AZCA 4H3DA 3TYZA 1BKHA 3F4CA 2IPJA 1OJXA 3B3DA 4OQVA 3MPGA 2PTXA 4MYXA 4J2PA 4W84A 4JIEA 3LBMA 5HR7A 1XBXA 1H49A 1QK0A 1VKFA 3EWYA 3ARXA 3TAOA 1VBHA 3W7IA 4YL2A 1CECA 2A1YA 4HPNA 4C6QA 4HU8A 2CWNA 2LLEA 1VYSX 1RQHA 2Z1SA 2EJAA 4UIOA 4GKTA 3DFYA 2J7FA 3OGSA 4BA0A 3RXZA 2VD9A 2C71A 4PTDA 5C9WA 4NT0A 1KLYA 1KBIA 2BP1A 3MUY1 1HVQA 3AI0A 3PTDA 5AYXA 1Q7MA 1S5WA 3BJFA 4H19A 3IJ7A 2ISFA 1VYRA 1JFXA 1DYSA 5I78A 2NQHA 3T0AA 5J8LA 4QISA 4QE1A 4HOXA 2EG8A 4O17A 2DVUA 2F6XA 3LBOA 2I57A 1LUCA 4LT9A 3TJXA 4JCMA 4QG6A 3CLMA 1OM0A 3SRKA 1HP5A 2D0FA 3MV01 2NZLA 3THCA 3PUEA 4GOAA 1WZKA 4RPPA 1O68A 4DBDA 4QCEA 2NXGA 1NQKA 1XGDA 3DECA 5HJXA 5F4SA 1XQLA 4DIAA 4A8RA 1BF6A 1KQYA 3TW6A 3VDCA 3BH4A 1RALA 1E1CB 3TQVA 3RPMA 4DO4A 3FA5A 1DBTA 4CVUA 5E0FA 1YTDA 4IQLA 4HYVA 4QG9A 1SR9A 1S2WA 2INZA 3MDWA 1UBSA 2V2DA 4TVCA 2PGWA 1UD6A 3DERA 3TV8A 4Z42C 3SN0A 3CGTA 1UKQA 1IHIA 3U8GA 4QAWA 4GMEA 2J8FA 1UD8A 4TMCA 2W91A 2PBOA 1AL8A 3WEMA 3CZGA 1AODA 2GDQA 2BB0A 3EKLA 3I65A 3SRFA 3N34A 3B0VC 3HGJA 1IWPA 2A3BA 1Q66A 3NUKA 3WK0A 1PHQA 3QSTA 3CPRA 2F2KA 3F5LA 1OD8A 3V3WA 2FZNA 4QS5A 3T2PA 1LP6A 3L4VA 2J78A 4QG8A 1HO1A 3TN4A 3S5OA 1RP9A 1CI1A 3W9ZA 2E9MA 4J3XA 2VDIA 1L8PA 3LU2A 2O9TA 2CLOA 1EHAA 2HEJA 1NWRA 3T42A 1EJWC 3RPDA 3FAXA 4NZ1A 1OCNA 4PYSA 1DJXA 1JCYA 4HNUA 3LTPA 3B0UX 2HZGA 2PDYA 5JBDA 3C0SA 3UFYA 4XZWA 3N17A 4PB4A 1CT5A 1FCVA 4LV4A 1QI0A 2QJHA 3W22A 2NV2A 1MYRA 3CO4A 3W87A 5C7HA 1VBRA 4OE7A 3WEOA 4GWEA 4AC1X 3ZSSA 3TX9A 4QDWA 1XM3A 3W7PA 4R33A 1MW3A 3G8RA 4JTGA 1H7XA 3U6WA 1LG2A 1VFFA 4JIHA 3CEUA 3CZLA 2JBMA 1JNDA 3N25A 4W89A 4GINA 5ABTA 1P1MA 2H90A 3AIVA 3T8LA 3WLPA 3WUEA 4AWUA 4YTTA 2QCGA 1I0DA 2D22A 4G56A 1YW1A 4B5UA 5EY5A 3AYTA 2QW5A 2YW3A 5K7JA 3UWWA 1L6FA 1O5RA 2VGFA 3VIMA 3WF4A 2ZUVA 3RX2A 3MUCA 4FLRA 3C61A 4AH7A 1P43A 1UR3M 1UIOA 4D8LA 1JAKA 4W9TA 1US3A 4B91A 1JPIA 1TB3A 3EXTA 1J5TA 3QHNA 4H01A 5T26A 3FSUA 2DGAA 4J7RA 4DQWA 1BHGA 5AHLA 1HJXA 1GGOA 2BZNA 5AVHA 1FDJA 3RAOA 3KTCA 2NSOA 1PBGA 2DZBA 4YYFA 2DU2A 4NU7A 4KRTA 1GOMA 4QS6A 3M0LA 4WR3A 1EDGA 1YDVA 3CMGA 4JTCA 1ICQA 2PD9A 3RX3A 1X6LA 3NZGA 4HTYA 3RHGA 4MLRA 1J6PA 5D09A 1KFCA 1WOAA 1SMAA 3SCRA 1ITUA 5KMYA 1DV7A 2DSVA 3EB4A 4WLCA 1OCBA 4KBXA 3H2NA 1BQCA 3STCA 4LYQA 1LOSA 4S3EA 4LCSA 1K77A 1P6CA 3RRXA 4O14A 6CGTA 3ZWTA 3BMVA 1FY6A 2BXVA 1E0TA 3WD4A 5LHFA 2VYOA 5DCBA 1DWJM 3GG8A 3BJTA 4H8VA 1PEZA 4MZ8A 2YX0A 4GJ1A 4PRTA 5T9CE 3UR8A 4HU4A 2PDQA 2EGZA 3QOMA 1W3LA 1UIPA 3THUA 1RCXB 3YPIA 4IX0A 3RCYA 3N1AA 1QNPA 5IXEA 3G1AA 4PCTA 1A5KC 5KZDA 4S23A 1A5AA 4ACZA 1FWEC 2DIKA 3AS0A 2J79A 1PKLA 2UV8G 3S9ZA 2J74A 5IBXC 2CHNA 4M29A 1TYGA 1EBGA 4PR4A 1A5NC 1JXJA 1SJDA 1EP2A 3MU7A 3IGXA 5REQA 2ZZ4A 3UG8A 2TODA 1FWSA 2TSYA 3VKBA 5JIPA 2P3EA 1E72M 4MB5A 3LEPA 3N6JA 2WSYA 1SZEA 5C9ZA 4NL1A 3VYLA 5B7ZA 2FMNA 1JZ3A 1OFBA 2J4GA 3HPXA 3FKKA 3K13A 2PF8A 4W87A 4A3UA 3TSDA 1R3TA 1NM9A 1TPUA 1HJVA 3BURA 4QGCA 2XINA 2BXZA 4LRTA 2CITA 2QAFA 4UR8A 2PAJA 3CQKA 3IS4A 4JDYA 4NAFA 4FXRA 4CQ9A 2J27A 5CZTA 4KMQA 2E1DA 2D2HA 1BKSA 5KZ6A 8RUCA 2A6NA 4CNTA 1VEOA 1US0A 3ABXA 2PP3A 1GJUA 1FRBA 3W6LA 3PB0A 1SYTA 1REQB 5AN7A 3RUBL 3T0BA 1MSSA 2ZFAA 1DJWA 4A3QA 4NNAA 4X63A 2FZBA 3MO4A 4DI8A 1ZSXA 4J40A 5I02A 5CH9A 3W2JA 2NVAA 1R2SA 4O53A 3WCZA 2BNJA 4GPNA 1ZU8A 4K7VA 4K2SA 4JS3A 1V8EA 1H1ZA 3LENA 2GOUA 3G22A 1A5CA 3PB2A 3OYZA 5F2IA 1JD9A 1QI5A 1XINA 3FGCA 3IJIA 3GY1A 2E0PA 4UTJA 3EMZA 4H7ZA 3VKJA 2E1WA 4WXZA 2IS7A 5I00A 1QBBA 4PRWA 3RITA 4ALDA 5A8NA 2GVEA 4IMEA 3LCGA 1EF3A 3SSJA 1RD5A 1VAHA 1QOXA 3EPNA 4UTTC 4M6QA 4M1BA 4FXSA 3DI0A 3S2JA 3B8WA 4QHRA 4GNKB 5BRQA 3AOFA 2OGJA 1YX1A 1ONEA 1TA3B 2R1NA 3QF0A 4LVBA 1BWLA 4H00A 5SWUA 1F05A 4IJRA 3STPA 4B5NA 1GOWA 2HXUA 1UMLA 4O18A 1A47A 1RJRA 4V1XA 1Z6KA 4GKLA 3WMCA 2BASA 1RVGA 1CXLA 2Z1XA 3RN6A 3UGRA 1HTIA 1AMYA 1R47A 1HL2A 1DPMA 1CGWA 1SW0A 1YPXA 3RJYA 4BF7A 1WA3A 3AIUA 3M07A 3W84A 4BQ4A 3RU8X 2QUNA 4AD1A 2QV4A 2VEGA 3U2CA 3P93A 1T41A 3NFUA 5EBUA 2XYLA 4O52A 1E3XA 1K03A 2WANA 1QTWA 3O1NA 1H62A 1UP3A 1W9PA 3GUWA 4LUTB 4JFSA 5LIXX 4CNNA 3E9AA 4BR1A 1US2A 3H7VA 4B3LA 3KZPA 4M1RA 1XQKA 2YLLA 4HMCA 4I9AA 4LS2A 3GDLA 1UWSA 3LPFA 2GJPA 4AZ5A 3M5YA 3UBPC 3U9IA 2CFFA 3CAVA 4QDMA 5FJOA 1SO3A 4ZCWA 3BSMA 3GG1A 4F9JA 5BCAA 1UUQA 4P7OA 3BVJA 1H41A 1RJQA 1TREA 4FOUA 4PCFA 4K1WA 1SSDA 2AQWA 3ZT7A 2CLEA 1XFCA 4HA1A 1QASA 1DVJA 3I6RA 1RY8A 1P6WA 4AIBA 1XH0A 1UR8A 2OMAA 4JR5A 4AXKA 4W8LA 5DLCA 3T6CA 3LXCA 3PFRA 8A3HA 3TCEA 5FJPA 4L1WA 4QP0A 2PDIA 5I09A 2WHMA 2J7DA 4UB9A 5GNYA 4A8NA 1UPMB 1QR7A 2PDFA 3A22A 3A64A 1KCKA 3QMSA 2PTWA 1EPVA 5FACA 5D03A 2FVKA 5AYYA 3CC1A 3KLLA 1PCKA 3NGFA 2D0GA 1Z8AA 5DXXA 4NP7A 1SZGA 1KKRA 4G2DA 3MZ2A 3HU7A 4BY3A 1Q63A 3CH9A 3ARVA 3UZ5A 4ADSA 2D23A 2ZRWA 1JZ2A 4URIA 1B31A 1VFMA 1TWZA 4J3UA 6TAAA 3N15A 1OQFA 3TEVA 4XTIA 5ABHA 3BC9A 3CUJA 2R8WA 2Y7FA 1ADDA 1E9YB 1WP6A 3VDHA 3WMBA 4JCLA 3LPGA 1F3TA 3IJDA 1TE1A 4AFYA 1C91A 3E5PA 4XK2A 3UJRA 5BROA 4XZIA 2Q01A 4M80A 2HK0A 1T5AA 4AY8A 2GJRA 1UR1A 1Q45A 4GVHA 2VVNA 2VZTA 3ORWA 2W27A 5TIMA 1J0HA 1BSLA 4D6HA 1VENA 3ITLA 4C1NB 1DQWA 2Y63A 5FESA 4NX5A 3QH2A 2YCLB 4BEQA 3LB0A 3KWSA 3ECQA 3FNDA 5AC4A 5EYWA 4PB3A 2FFCA 5KZMA 4CCZA 3UXLA 4XZMX 3TH6A 5T91A 1H2JA 4RX0A 3NPXA 1KQZA 4N9DA 2VVSA 4OIFA 4M82A 3NR0A 3NGJA 2J62A 3PC0A 2V2CA 4PL2A 3N2OA 3DFTA 4LYRA 4GQ0A 2XDFA 1A49A 2DSUA 4I9JA 3MKCA 4WDWA 1E0XA 4D8ZA 4Q6JA 1MXGA 4FS9A 1UD2A 4KERA 1A5MC 1SFSA 3GZ3A 3G5EA 1VD6A 4DY1A 3TYBA 4PE8A 2IPGA 3VX0A 1UQZA 3ICJA 4I9TA 3QFWA 1J4EA 4O19A 3LV6A 2JEPA 4NRRA 1XD0A 1TE6A 1EJUC 3HPAA 1XS2A 1O12A 3TQ0A 2H9AA 1O7AA 2VR5A 2PWEA 1WUFA 4F0SA 1EDTA 3DDMA 1SZNA 2QF8A 2WCAA 5CLTA 4EVZA 4GZEA 3NSXA 1R3RA 3WJXA 3K8MA 1UJPA 1JUKA 3E0IA 2DH2A 2O4QA 2CEQA 5C2CA 4IIBA 3VOJA 2R1MA 5EFDA 3XISA 5CBBA 3GNNA 4TTUA 1EO7A 5I3KA 1JI1A 4LB3A 1TMHA 1UWQA 3VNLA 1K02A 1R2TA 8CGTA 4UQ9A 3XIMA 2DJXA 4AF0A 2CC0A 2CW6A 4MB1A 1MEWA 3WUFA 3KVKA 2E6YA 2Q6ZA 1HUVA 1O95A 3FS2A 2W5FA 7PTDA 1S2CA 2DQXA 3K8KA 3W29A 4F2BA 4EF9A 2BVWA 1M03A 3NOEA 2F7FA 2A79A 5HNTA 5FEXA 5BWAA 1EZWA 2DPEA 1CLKA 3BLEA 4K38A 2TRSA 3QKEA 1OFAA 4C6EA 2A5HA 2GVJA 1H5YA 4FNRA 1PS9A 4GC4A 1HN1A 4WD0A 4ZO9A 2YA2A 4Y8EA 2VHLA 2IMRA 3GH5A 4MB4A 4H2CA 4H9TA 4B2DD 1A5SA 4ZODA 3L5LA 1N7KA 2GPTA 3JZEA 3OO2A 3F7JA 1LRNA 1ME8A 4J35A 2GVYA 4WHBA 5CJNA 2V3DA 1FXPA 1WZLA 4FLOA 3O63A 2QR6A 4WSJA 4EACA 4JTEA 3SJNA 3WQ8A 1ME7A 3HG2A 3UXAA 3A23A 2X1TA 3TCSA 2ZC1A 4WKHA 4MFEA 3GIQA 4OBTA 3IK2A 1NDYA 7CGTA 3AU6A 1DJHA 1HG3A 3AMLA 1QO2A 1G1YA 1CGTA 4F0MA 2I7GA 2AL1A 5BRBA 9XIAA 3BAJA 5HANA 3QTGA 4P7QA 4Q7BA 4H9VA 2PDJA 2Y8KA 4GQQA 4O54A 1E5NA 1GEHA 3CUZA 2QDGA 1CNVA 3SQMA 1VFLA 2J25A 3DHDA 4RXFA 3U4FA 3EX1A 1W1YA 2E28A 3GD6A 1XG4A 1R85A 3IAQA 4Z2HA 4UOQA 4IJCA 3WO8A 3J7HA 4QQ3A 3B9OA 2GDUA 3W3OA 1ECEA 1JQXA 5K2ZA 1M5WA 2BHUA 5TNVA 3FV9A 3ZT5A 3G1SA 3DBPA 3P0WA 4BQ5A 4YVVA 3TSBA 3R94A 3N2CA 4QJ4B 5HNNA 3VKKA 3AJ7A 4XZNX 3RG6A 1JRBA 4U2ZA 2ZOXA 4NJHA 1TPC1 2I16A 3B8TA 1JDEA 4FR1A 4TVDA 4CUCA 5AOUA 2WM1A 3AHZA 1Q6DA 4WOQA 4OBSA 3LPOA 4IISA 4TV6A 1PX4A 5I79A 4KETA 3LCWA 2BXYA 2VEFA 1U83A 4YJ5A 3BAYA 3B8DA 3FEQA 3GAYA 3BG5A 3O6YX 4X60A 4EK7A 4DM1A 5BOEA 2IQ0A 1W32A 5AHMA 1GZGA 5AC5A 4AEFA 1XDLA 1K8YA 3GFXA 4MAZA 2OWCA 2O0TA 2VFHA 4HJFA 4JYEA 1XLBA 2YBVA 1YE6A 5RUBA 4L7ZA 3FKRA 3C0QA 2X1IA 3E02A 4GUGA 2YCJA 5D02A 3QKZA 1POKA 4IFOA 1EUNA 1EP1A 2QVHA 3H7RA 1XYLA 3BQ5A 3T0DA 1FA2A 1M7PA 3VIFA 2DT2A 1I4NA 1TPEA 4NKCA 2YCEA 5E09A 1JF6A 4BQ3A 2ZQ0A 1AQ0A 3TXVA 2CZFA 1GVSA 3MBFA 4L6DA 1EH9A 4MWAB 8XIAA 4MJ2A 3SUUA 3M5VA 1W5NA 3P3BA 1KTCA 1VLWA 5M1TA 1V3LA 2CBUA 2ZXAA 2FMOA 3FVMA 1EC8A 4OBRA 2HS8A 2J66A 3MMTA 5I07A 4C6IA 1LL7A 2W0UA 1J96A 1GVRA 2F2HA 4N02A 4ZTYA 4NZJA 1JYVA 7ODCA 2ATSA 1YHTA 2ZKMX 3PBYA 4P61A 1N2VA 3KL5A 1AH4A 3KFTA 1EIXA 2E77A 1TWDA 4CCDA 1HGYA 1GVEA 5DRIA 2VEKA 1AW5A 3NYZA 3LTYA 3G0UA 3R58A 3W1RA 1H09A 2YW4A 1ZAHA 3DYMA 3M0JA 1PWLA 3NOYA 3ITGA 4UNKA 1W37A 5FD0A 1G69A 2GUUA 1QXLA 3AHVA 4PBEA 1IR1A 1C8XA 1W8GA 3L21A 3EA2A 5DCEA 4NYUA 4DVOA 4GXWA 3OB8A 4GC3A 3PP7A 2KZHA 1TV2A 4F79A 4MUPA 1OYCA 4EANA 1JGIA 4AC7C 4PTXA 3LCFA 2EHHA 2W6RA 1HKJA 1UD4A 3T0TA 4UOZA 1J2WA 2L5HA 3BGJA 4RDWA 5H8PA 1OX4A 1R7OA 1Q7QA 1QW8A 1J0IA 5I24A 1DWAM 3AFBA 3OLIA 3SY1A 3AXIA 5DCDA 2XUCA 1U5VA 3H4GA 2UY4A 3GU2A 1PTDA 1ZB5A 2VCAA 4LAOA 4AX6A 1AD1A 1KR0A 1RA0A 2OU4A 2QCDA 3CS2A 2IKIA 2DUZA 2WLZA 4LS0A 1DJYA 1HQTA 2DJLA 5JXQA 5I06A 4H1ZA 5DXYA 3OTRA 4BZYA 4W8AA 2AQVA 1KRCC 4PUJA 1IIHA 3PHAA 2DSZA 1C8QA 3HF3A 2ZX8A 3TU9A 1WDRA 4MJ4A 3TN5A 1SJAA 4KCWA 5BZAA 3PY2A 1IZCA 2B0MA 1EBHA 3I6EA 4EF8A 2PDHA 1ZZMA 3OHMB 3T7VA 3ZWSA 2TAAA 3W2KA 4PMNA 5HQLA 3A3WA 1PKMA 4NG3A 3EBVA 4LVDA 1CZ1A 3G0SA 3A21A 4GY0A 4HU0A 1AK5A 3CWNA 2RGMA 3QQ1A 3BGAA 3MVIA 1EYEA 4RKAA 5AYZA 3VINA 3LCHA 1FWCC 3BOLA 1JDCA 3HGRA 4ATDA 4HB7A 4IMAA 1F6PA 3M47A 1W1IE 3PZNA 3ARTA 4JKKA 2XIMA 4MADA 1V02E 1JG9A 1PE1A 3I3BA 4GFSA 3I7QA 1AQHA 1POJA 4NJGA 4AIEA 5FKYA 4IH3A 1SO4A 1CXKA 3QSRA 1WYIA 1HNYA 4Z2LA 4POCA 3BOXA 1BG9A 2ZUTA 3IJQA 4JYFA 2GWGA 1Z69A 1JZ6A 1LJYA 3KVMA 5K4ZA 1J0JA 2EG6A 1I45A 3WMSA 3WK3A 3MCOA 3P81A 3R7MA 2QJJA 4YCPA 4GVGA 2VX4A 4MZ1A 1VP5A 4F0LA 3AO0A 4N7QA 5A6LA 4KWOA 4AU0A 2IXUA 2BBFA 2OZ3A 2W61A 5BOFA 1IWBA 3QZ6A 1OT1A 3U7VA 1XKJA 2RKXA 1FFQA 2G95A 1UD5A 4RPQA 1H7OA 2NT0A 4LF2A 1QK2A 1HGWA 4AB4A 2VFGA 1F76A 5M2FX 3D3AA 3TNBA 4D8AA 1R46A 4GO9A 4W5ZA 1R9ZA 1S3HA 1VFOA 1DHKA 4W88A 3CEPA 3L4TA 3AXHA 3O05A 4ZQRA 4YXGA 2WZIA 3D5HA 3EOOA 5EMLA 2P76A 4EP8C 1VRDA 1OC5A 1MW0A 3R10A 1U33A 1JEZA 4GLEA 3N2MA 4M56A 3C6CA 4HK5A 3Q4DA 4H4IA 5CEWA 5G4EA 2E4TA 2YFOA 4FI4A 4HIBA 1IQ8A 1KWGA 4I7UA 5AHIA 1EWEA 4S2CA 3N6HA 4ZQOA 2I9EA 4LUSA 5M17A 4IPIA 2WC3A 1VFUA 3NQ8A 4E8DA 3R13A 2Z1WA 4HQVA 2QPXA 4DXVA 4WRHA 3REQB 2CLKA 2VXNA 2E9BA 3HJZA 3LHTA 1IXNA 5E93A 4AVOA 5FIPA 2OLHA 4HTBA 2NQZA 4GYFA 3TROA 3UWYA 3MO7A 2QCFA 3FAWA 3S5SA 4ES4A 1S5TA 3CIVA 3ZVIA 2RFGA 4EE9A 3IV8A 4PFHA 4CD7A 2B7OA 4C7FA 1A5OC 4J9JA 3P5YA 4UQBA 2DFAA 3R11A 1X38A 2GYIA 2XPKA 1XIEA 4BEUA 1J18A 4O12A 2PS2A 1W1PA 4LNCA 3HG3A 2QCEA 1XC4A 2ZE0A 3AZRA 4RZ6A 3CMJA 3V0SA 4F40A 2V6AA 3GVWA 2A21A 1SW7A 3IV3A 4K8HA 1HXJA 4EIVA 1KNWA 4N4QA 4F0HA 3EMQA 1SM9A 2ONEA 2ACUA 1W91A 1YXCA 4KCUA 1GJPA 3B8IA 1V0NA 1GUVA 3T8QA 3TWBA 4V2XA 3EB3A 2Y61A 1QNRA 1VCFA 1OB0A 4PUEA 1RR2A 1LORA 2QUUA 2DZAA 4H41A 2DW7A 4MKVA 4DJDC 3I6TA 1WDPA 2DIJA 1ITQA 4RE3A 5CSSA 3JRKA 4OHQA 5CZJA 2EPNA 3BJSA 3GIPA 5HOSA 3WNKA 3NPUA 1E70M 3M7WA 4FX6M 2XH0A 3F5JA 1S39A 3DAQA 1ZCCA 2P8CA 2VX7A 3UZZA 1RLCL 3CJPA 3UERA 4C6FA 4HGXA 1EJ7L 4GG9A 2PODA 2YXGA 3N4AA 3RDKA 3P8IA 4M6UA 3INPA 4QQUA 3RF9A 4GCXA 3C3UA 2WSRA 2NX3A 1ZBCA 3CUIA 4WXYA 3TUUA 3KDNA 4E6MA 5DY2A 4A8LA 1IEWA 3VFCA 4FPSA 1L6GA 3C86A 4F2UA 1Z32X 4RW5A 4DJEC 1VJZA 4RZ4A 3FFSA 4XAZA 1DKWA 4AWTA 2OJPA 3ZYZA 1E0VA 1LZOA 3DOPA 3RU6A 1XSJA 2PUZA 1RV8A 2YCLA 3KXQA 2QNEA 2A4AA 5E1QA 5CPSA 3TFCA 2GGIA 1BF2A 2P1FA 2VTFA 4E2OA 1V0KA 3PBUA 2PGEA 1ZBVA 3FY1A 4CQBA 4KWWA 5K3VA 1KFJA 3F4VA 3ABSA 3MV11 3EGJA 1OYBA 2Z1KA 5HA7A 3L65A 4KPLA 3NEVA 3B06A 4CU7A 4R53A 3OEXA 2QDHA 5JU6A 4RZ5A 2EAWA 1R2RA 4WY0B 3WH9A 3PK7A 3F5KA 1GZ1A 3DYOA 1T7LA 2IQDA 4NZFA 2XFYA 4GI8A 4H83A 1RAKA 2WPBA 1LOLA 1UKPA 3VI2A 2CLFA 5DT5A 4PN2A 3MSRA 1LQAA 4K6AA 4B9YA 1QCWA 3UWVA 4ADTA 3C2FA 1ZLPA 2XISA 3BV4A 1BWKA 4GZJA 4Q4PA 3TYAA 1LL6A 4C6KA 1SPQA 2H6RA 4NIRA 4Q8UA 5HK4A 3VMPA 2VX6A 3SURA 4IQEA 2XSAA 1W3IA 3W6MA 1L6SA 3T2OA 1VGAA 4OJYA 3CV1A 3E74A 3BZGA 3IACA 1IXOA 1W1VA 5IOBA 1R9XA 4Q8TA 1Z48A 4CQCA 4H7VA 3UNDA 1F6YA 2O7QA 2V68A 3L0GA 4IGSA 3WQOA 5CXPA 5DX7A 1ZQ5A 1M3UA 3FCPA 3SFWA 1WZMA 1TWWA 1UD3A 3UY8A 3NDZA 1H1NA 5BWFA 2V0TA 2EJ1A 2CETA 1RH9A 4B4HA 3TOPA 3W86A 1WBHA 4ZE5A 3TR2A 1YLVA 1TTJA 4WX2A 2OO6A 4BJHA 4ERIA 2PWFA 1XISA 4MKSA 3ZR4A 3V36A 3G1RA 5CBJA 3DIPA 4LYPA 5DO8A 5IFTA 3M4HA 1QT1A 1XSIA 1KA9F 4JNZA 4ATWA 4CU6A 5DBUA 2FZ8A 4JX6A 2OYMA 4KEUA 3WFAA 1E6SM 3ELFA 3AIEA 3ARYA 4FA3A 3WQ4A 4WKAA 3FK4A 3ZXWA 3UZJA 4P8VA 1E6RA 4M8UA 3E3HA 2NUYA 1UROA 4GIRA 2PLCA 1NH6A 1T8XA 4U2YA 4WCJA 4LRSA 1W1B1 3W7OA 4S3AA 2INFA 5XIAA 2NQJA 3SCNA 3BO9A 2I5IA 3R1ZA 2YCKX 4NZ5A 2DP3A 3IWPA 5FJRA 4WY0A 5A8MA 3H2FA 1XIGA 3W7EA 1F07A 2RDUA 1I0BA 1TELA 3QV6A 1AMKA 1EB3A 3EX2A 3EDEA 3DKLA 4Y96A 1XIFA 4GYPA 1WCGA 4AYGA 3D0CA 4AD2A 3E2RA 4E4FA 4HPHA 1F3XA 2YYTA 4DBEA 2OO0A 2Z28A 4DF2A 2FZMA 1YBQA 1O6IA 4MM1A 3CPUA 3O0KA 3BUVA 3EZ4A 3OU8A 3R5EA 3UXDA 1A4MA 1RXOB 4JHZA 4LXFA 4YWIA 4ZSUA 1LQ2A 4X0NA 3GKAA 4JZ5A 1OINA 3AMKA 2QJIA 4PMZA 1MEHA 4RR4A 1IF2A 2O4MA 5FJTA 2C0AA 3EDFA 1SZRA 1WXYA 3NQ7A 3S5NA 4CD4A 2CNCA 2F6UA 1D2KA 4N9CA 2BFGA 3SGGA 3NXFA 4MJMA 4ADUA 1JRCA 4D6CA 3W25A 2F6KA 3KRUA 3BWWA 1B0IA 3L68A 1U2YA 1E6NA 2QDDA 3CBWA 3PPHA 5A6TC 1R7AA 3GTFA 3M5ZA 1LBFA 1LWJA 1OSEA 4L5ZA 1V93A 4GX8A 5HAOA 1C8YA 4O50A 1QOPA 1DIOA 4HPXA 1AZ2A 4L4PA 2QUTA 1QFEA 2JF7A 5CKSA 1EIBA 3CHCA 1P0NA 2PZNA 4JX4A 5L9FA 1FWJC 2FHBA 2R24A 4NNBA 3VOCA 5CC7A 3WQPA 1OHLA 3QY6A 4D6JA 3ARQA 4U3AA 3VIJA 1BD0A 3DHUA 2PCQA 1MXSA 4Q32A 5D9MA 1DWHM 1B57A 3KW3A 4NAEB 3AXKA 4XIMA 3S1UA 1ALDA 1JCLA 1O1ZA 1XCXA 3PBMA 1KWKA 4DJDA 1FWTA 2SFPA 3C2RA 1K7XA 4C60A 3S4TA 3F4WA 2GZXA 1QOQA 2QEZA 1JCXA 1Q6GA 1D3CA 5AZ0A 1G67A 4KS0A 4M19A 5D05A 3SFKA 3TTEA 1KXHA 1R86A 3ITTA 1UJQA 1OC6A 3H24A 3QC0A 4DAFA 4TU1A 3C0LA 2XM1A 3B4UA 4US6A 1XBZA 3DENA 4M51A 3M0MA 3CASA 3DG7A 3VIGA 3S2NA 4Y9OA 4ZSTA 3BTNA 3QZEA 5I7GA 3H22A 4MY1A 1IR2A 3OIXA 4GYPC 4GUIA 1X7FA 2OOGA 3AMGA 3MVTA 1SZFA 4QJ1A 4B5WA 1UKTA 3G18A 4TR9A 5EMJA 3VXGA 5K9CA 3SB0A 5HATA 2VZUA 2GSJA 1B9ZA 3VDBA 2JE8A 3ABQA 3I68A 3HB9A 3DKJA 3EPOA 1H51A 2XIJA 5HWJA 5CZKA 1C8VA 1W3KA 3STEA 3VCCA 1BAGA 2VFIA 1PL9A 2GLKA 4RCXA 5REQB 3W76A 4YMZA 4NNCA 2WKLA 4W93A 1M7OA 1PCWA 1PAMA 3FDKA 5D2VA 5C9XA 1FDYA 5IFPA 1OX6A 1BXNA 5I3GA 2Y5SA 2C1IA 3CTTA 2ZX7A 1FP8A 4O15A 8TIMA 4F4RA 1EKOA 1GHSA 4GQRA 3F2BA 3D46A 1JCTA 3P84A 2IQTA 1S1RA 5LHEA 4QBXA 1XIHA 2OX4A 3MMDA 4PTWA 5AHFA 2WWCA 1IZJA 4X61A 1QI4A 1KM2A 4CGTA 1EXPA 2JGQA 3ID7A 3GNDA 4O28A 4M6PA 2J6VA 3AROA 2VD8A 3DU0A 2G8ZA 3VD5A 2P0IA 3SECA 3AMDA 4CNSA 4DJED 3BAIA 4TV5A 2P88A 1XL9A 1EO5A 1UASA 3V1HA 3UQNA 4PULA 1W1ZA 2PDBA 3GHRA 3AJXA 1LBMA 4GZ7A 1F8MA 5FJIA 2CZ5A 2G3IA 4XB3A 4Z1CA 3IVUA 5G4WA 1O5XA 3K4WA 6PTDA 2ZZ1A 4EXBA 1OWQA 4XTDA 3W2LA