2DJZA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111a mutation
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
molecule tags Ligase
source organism Pyrococcus horikoshii
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2djzA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2djzA01
3AHUA 2DDZA 3WQZA 4EMKC 1NJ2A 1SETA 4BWAA 2I2LA 3HTZA 4HT8A 4TVYA 1EIYA 4M7AE 4CH4A 4PJOE 5C53B 4YRMA 3RIRA 3JB9G 1BIAA 5GANd 3JCMJ 2FYKA 3HFNA 3GIBA 3A7AA 3CMQA 2FB7A 2K57A 5CAIA 3A31A 4YRRA 4CH6A 5ELNA 2DTIA 3E9HA 1TH7A 1PYSA 3QO8A 2ZIMA 2EWNA 4EMKB 3VQVA 5GANe 1H4VB 5LJ5j 1SESA 1B76A 3HXUA 4P3NA 3VQYA 4CS2A 5GAOn 1N9SA 4YRIA 3G1ZA 4A53A 4M77D 1H4TA 4KR2A 2Q5HA 2QTXA 2J3LA 2ZCEA 4XTVA 5LJ3h 4C92E 2XGTA 4ZIBA 3JCMc 2AKWA 5LJ5d 4NCXA 1WQ7A 4EX5A 2YLCA 2DEQA 3HXZA 4WJ3M 5GMKh 4HWTA 5GANg 2EJ9A 4MMKA 2EJFA 3BFMA 3ICAA 4CS3A 1KOGA 5GAMj 1LYLA 2E65A 4YRKA 3MF1A 3UFGA 1YFRA 2I4LA 5K1PA 4V2SA 3M4QA 4Q15A 1Y96A 1FYFA 4RMFA 4XU2A 4G85A 1NYQA 2QHUA 5GAN4 3FJPA 1D3BB 4M78C 3NENA 4J5YA 4X9DA 3JCMh 5LJ5g 3JCMP 1EOVA 4UP7A 4WI1A 2EAYA 3I7FA 1L0WA 3V7RA 4XU1A 3OD1A 3P8VA 1RIQA 4RDXA 4EO4A 4M78G 5LJ5f 1KQ2A 4M7AC 4PJOC 3QO5A 4CH5A 5LJ3j 1ASYA 4M7DE 2XTIA 1H641 2AMCB 3JB9F 4C8QC 4H2WA 4PJOD 4J6WA 2RHQB 3L4GA 3NELA 4M7AG 4PJOG 2DQ3A 4H2VA 3QO3A 4YRJA 1I81A 1D3BA 5GAMg 3W3SA 4M7AB 4C8QG 4PJOB 2DTHA 3FB9A 3HSBA 3UH0A 1YGBA 4NL3A 3V7CA 2ZTGA 4EMHA 1PYSB 4XEOA 5GAMf 3HY0A 1B7YA 4UP9A 4M78E 3RUXA 4PNOA 4AH6A 1SRYA 1LOJA 4C92C 4LNSA 3QHSA 12ASA 4M78A 2DKGA 2AMCA 4YCVA 4QVDA 2ZZEA 5C51B 4TQDA 3IG2A 3IKLA 1E1TA 1NJ8A 2EL9A 3LSSA 2RHQA 2ZZGA 4F7UE 3PCOB 2VXFA 4C92D 1X54A 1GGMA 3JB9D 4C92G 3INZA 5I21A 3RL6A 3TUPA 3VQXA 2E41A 4M75E 2AKWB 3PGGA 3M4PA 1U1TA 4M7AA 4KR3A 4PJOA 4C8QE 3JB9H 1NJ6A 4C92B 1G5HA 1I5LA 2ZT7A 4UP8A 3L1AA 2RD1A 4C8QA 4P3OA 1WU7A 4K88A 4O2DA 1I8FA 4H2TA 3IALA 4J6YA 4HA8A 1X55A 1M8VA 4YREA 1M5Q1 4RQEA 1EFWA 5LJ3f 1WNLA 1QF6A 4HWPA 3PCOA 1Y96B 2Q7HA 3BW1A 5GAN7 1MGQA 1BBWA 4YRPA 1B34B 4P72C 4HVCA 2IY5B 2ZT8A 3VQWA 1YFSA 2ALYA 3E9IA 4C92A 4H2UA 4XU0A 4XTUA 1BIBA 1EVLA 2ARTA 4P75A 4YRGA 4M7DC 4OLFA 1U1SA 3JCMQ 3LC0A 5HGQA 5LJ5e 4YRLA 3A74A 5GAN3 3HXWA 3RESA 1VQZA 4M7DD 2PMFA 4J15A 4M7DG 4P3PA 4BW9A 3MEYA 3JCMg 4ZTZB 4Q6GA 4M7AF 4PJOF 4K86A 4P73C 4M7DB 1G51A 3L4GB 1B34A 3SWNC 4H2SA 5GAMd 4YROA 3JCMf 2IY5A 3EFRA 2PMEA 1W66A 4A54A 2RHSB 1B8AA 1EQRA 3JB9I 2E5AA 3L2ZA 4DPGA 3QTCA 1YCYA 5GAMe 3BJUA 2DVEA 3ERRA 4TWAA 4M78D 5GANh 4P71C 4HWOA 4M77E 2HNIA 3SWNB 1B7YB 3QUIA 1USYC 4WF2A 2CJAA 4P72A 3TEHB 4CS4A 1HTTA 1X01A 2VXEA 3JCMV 2G4CA 1ASZA 3NETA 4HWSA 3BY7A 5KNNA 4M75C 3LSQA 3EFSA 2Q7EA 4M78B 4C92F 4YRNA 1NJ1A 4XU3A 5GAOr 3RACA 5ELOA 5GMKj 4M7AD 4F7UG 4G84A 4M7DA 4H2XA 2CGHA 2DQ0A 4M75D 1J5WA 1KMNA 2CIMA 5GMKm 4M75G 3V8JA 1WLEA 3V7SA 2RHSA 4C8QD 4F7UB 3A7UA 1LJOA 2Q7GA 3REXA 4XQ3A 5LJ3d 4M75B 1IL2A 1E22A 4EMGA 2ZR2A 4RQFA 3NEMA 4C8QB 4P73A 3TEHA 3SWNA 2DZCA 2ARSA 3HFZB 3BDUA 5LJ3e 5C52B 3HY1A 2ZR3A 4P75C 4YRFA 5GMKe 5GAN6 4YCUA 2YLBA 1ADJA 2DU7A 5GMKl 4NOYA 4P71A 4TVWA 2CJBA 1ADYA 1USYA 4F7UA 3RKYA 5GAOp 2E1HA 4N0AC 4HT9A 2ALYB 3KFUA 2DTOA 4UPAA 4M75A 4TVAA 2ZNIA 1NJ5A 4H02A 1JBMA 4K87A 2Q5IA 5LJ3g 2I4MA 4M7DF 1WPYA 3HFZA 3JCMd 5DY9A 1H4SA 3JCMX 4PG3A 2DZ9A 5E3IA 2ODRC 3M4GA 1HC7A 2YHTA 5GAOm 1KMMA 3PZCA 4ZTUB 3JCMe 2QHSA 4YCWA 3RKWA 4YPFA 2RA2A 3HXXA 4JRIA 3HXYA 1E1OA 5F5WA 2DXUA 4WJ4A 2ODRD 2ARUA 2J3MA 4M77C 4YDQA 3UGQA 3FIFA 1N9RA 1ATIA 4RCBA 1WQWA 4M78F 1NNHA 1X56A 4L87A 4JRKA 3HFVA 3QSUA 3DSQA 4M77G 2VC8A 1LNXA 1JRIA 3TEGA 3VBBA 1B70B 3QO7A 4F7UF 4N0AA 3IKMB 3P8YA 4M77B 3JB9J 4YRSA 4DQ2A 4J6XA 5GAOl 2RM4A 4M75F 1EVKA 4H2XB 3HXVA 3RERA 3HRKA 4C8QF 4EMKA 2QHTA 2ZNJA 2E64A 3QNEA 3JCMb 4YYEA 4QVCA 2CJ9A 5GANf 2JN0A 3SB2A 4YP0A 5K1XA 2ZXFA 2I4NA 4E51A 1Z7NA 3V8LA 5GAN5 2E10A 4TTVA 1YFTA 2C7IA 2C8MA 3MF2A 4NL2A 4P74C 4TQFA 1X2GA 1Z7MA 1B70A 4RCCA 1X2HA 4MMLA 3A32A 4XTZA 3A5YA 4M77A 1JJCB 3HFOA 3RKXA 4XTYA 4H2YA 1WYDA 1BBUA 3RGLA 4XTWA 4JUVA 4YRTA 4JLIA 1HK9A 3RF1A 2ZINA 4Y91A 2DJZA 2ZZFA 3UGTA 4TVAB 5GAN8 4YRCA 2EJGA 1E24A 5GAOq 4KQEA 2ZGWA 2RB6A 4XEMA 5LJ5h 2DU5A 3VU3C 3A5ZA 1SERA 1EIYB 2DXTA 1C0AA 2ZT6A 1KQ1A 1JJCA 3JCMW 2E3CA 2P5IA 1YB3A 4HWRA 3P8TA 4X5OA 2P0LA 1N9WA 4YRQA 4CH3A 1H4QA 3REUA 4OP0A 1I4K1 2ZT5A 5GMKi 3V8KA 1G5IA 4P74A 4PHCA 5GANj 1HXDA 2Y90A 1QE0A 4XTXA 2ZIOA 3A7RA 2QHVA 1NYRA 3R07A 3HRIA 4M77F 4X9CA 5GAMh 2I4OA 11ASA 5GAN2
chains in the Genus database with same CATH superfamily
1GCQA 1K9MR 3OYIA 2DDZA 3CXCA 1SETA 4BWAA 1MMNA 1KHIA 3CCVQ 4HT8A 1K9AA 4CH4A 3UDCA 5FRNA 4PJOE 4YRMA 3JB9G 1FWZA 2YUQA 3CMQA 2DA9A 4AFZC 3TQ7P 1T0HA 3A31A 4YRRA 1T3LA 1TH7A 4OMNA 1YHQQ 2EWNA 1H4VB 3GF5A 2LQNA 1SESA 1B76A 4P3NA 3E9GA 3HRSA 1I0CA 4CS2A 1RADB 2V26A 1NEBA 4HCBA 4ZN1A 1YN8A 1YCSB 3VS1A 4M77D 2LDMA 1Q82R 1H4TA 2OI3A 4A4GA 3L2VA 5KYUB 5LJ3h 2XGTA 4PJLA 2Y4YA 5LJ5d 4NCXA 3G71A 4EX5A 1ZSZA 5GANg 3CBOA 3CMEQ 2X4JA 1LYLA 3PNWC 3WXMB 1Y0MA 4YRKA 3VS4A 1AOJA 3CCUQ 1KFZA 1N8RC 3MF1A 3SHWA 5KYXA 1BI2A 3OYEA 1OU8A 4LDWA 2PQWA 3WVDB 4IUVA 3M4QA 1SRMA 1K1ZA 1SKUB 3LWHA 3A5ZB 2JT4A 3FLGA 2LJ0A 4BE0A 1ARKA 1FYFA 1XNIA 1KJWA 3GNFB 1TUCA 3NTKA 2CT4A 4JPBW 1D3BB 2KAFA 3M4YA 1WJRA 3JCMh 2EAYA 1X43A 2K79A 1L0WA 3UATA 2EVRA 1RIQA 1KQ2A 2MF2A 4M7AC 3KBGA 1ASYA 1PD0A 2CKKA 3OYAA 3M0UA 2AMCB 1CKAA 1D1AA 4HVVA 3E9FA 2CREA 4J6WA 1H3ZA 2RHQB 5C6SA 1EZZB 2EQJA 2D0NA 4IKFA 5IHNA 2DQ3A 1JJ2P 4HVWA 4M7AB 1Y07A 4C8QG 1WLPB 5HKCA 1B07A 2ECZA 2EQIA 1N27A 2W0ZA 1Z9ZA 3V7CA 4NL3A 4XEOA 5GAMf 5CK9A 2XG8D 3HY0A 1B7YA 4FSSA 4M78E 3RUXA 1SRYA 4OMOA 2ZPIB 2WSCE 4J83A 3QHSA 4JRQA 2DRKA 1AHJB 2LX7A 4YCVA 4QVDA 2ZZEA 3VS3A 4TQDA 1M1FA 2NUPA 1E1TA 1LCKA 2MMPA 3LSSA 1D0ZA 3PCOB 3VS5A 2A37A 1XOVA 2O01E 2ZZGA 2DMOA 5IH2A 1WI7A 3JB9D 3EG9A 3INZA 4C92G 1KC8U 2E41A 4GLKA 2QQ9A 3MEUA 1U1TA 2OJ2A 4KR3A 1JXMA 3VUZA 3HHTB 4HCZA 4RTUA 1T0JA 4OMLA 2DBKA 1ZBJA 3H8ZA 3L1AA 1X27A 2DL4A 4O5VA 4C8QA 1WU7A 4H2TA 2WSFE 4N4GA 2CT3A 2RQTA 2JJ9A 1M4ZA 1ZUYA 4HA8A 2J05A 4RQEA 3M55A 4QQGA 1WJQA 2CP3A 4C0ZA 2RN8A 4FSXA 5IHKA 1VA7A 2Q7HA 3BW1A 5GAN7 1QWEA 1TUGB 4C5HA 1G83A 2ESWA 4C92A 2GCXA 4XU0A 3OYGA 4LVMA 1EVLA 2ARTA 2X51A 3TU4K 2J6OA 3HRTA 1WHKA 3JCMQ 1KQSP 5HGQA 4RMOA 2XK0A 3A74A 1VQZA 3J80E 4M7DG 4P3PA 4BW9A 3JCMg 4ZTZB 4PJOF 1VQPQ 4R56A 3CCEA 4EDUA 1B34A 3SWNC 1VIEA 4YROA 2IY5A 1RACB 4DOWA 1R0BG 1JEGA 4B9XA 3L2ZA 4AFQC 4RG2A 2DM1A 4PL6A 3AT1B 1NG2A 3BJUA 1YJ9Q 4PFPA 2ZPGB 4P71C 2HDAA 3UA7A 4J9FA 3CC4T 4M77E 1KG1A 3SWNB 1B7YB 1USYC 2CJAA 1IGQA 3TEHB 5KE2A 1HTTA 2VXEA 3OYNA 2AIRB 1YBYA 4LXCA 4M75C 2Q7EA 1NLOC 3I55T 4XU3A 4M7DA 1WZOA 2DQ0A 5IN1A 5FWBA 3LH5A 4M75D 1J5WA 3EG9B 5GMKm 2KQWA 4C8QD 1TWBA 4F7UB 3A7UA 3OB9A 2MWPA 3D7SB 3REXA 3CCQQ 2JZ2A 2NUZA 4M75B 1E22A 3M0TA 3HRUA 2L5QA 3CCJT 3CCVA 4AG1C 4C8QB 4BE2A 1QVFA 1WDXA 4KBMB 2SEMA 3G6EA 3IQLA 3UWNA 3M54A 1AT1B 4RTXA 4ANJA 2QXFA 4YCUA 3SFMA 1YWPA 3OSSC 4NOYA 4CC4B 1RAHB 1ADYA 1K8AR 3QJYA 3RKYA 2E1HA 1JQQA 1RAGB 3TREA 1YJNQ 5A0GA 2A7YA 2F69A 1NJ5A 4H02A 4K87A 4PJNA 1RL2A 2ABLA 3LWIA 2RJEA 1MNDA 3TSWA 1H4SA 1VQ5T 2Y4XA 4PG3A 4L6V5 4XK8E 2ODRC 2K6DA 4DA4A 3CMEA 1KMMA 4MZPA 4ZTUB 2QHSA 5KCOA 1MMDA 3OW2P 3CCUA 1OX9A 2ODRD 4KULA 4RTYA 1ZLMA 2A36A 2X35A 1IB8A 1YWOA 2L0AA 4M78F 3UA6A 4L87A 1UGQB 1NJIR 4P5NA 2FZKB 2M0YA 3TEEA 4D8DA 2HEQA 1VQMQ 3NMZC 1S72Q 1JRIA 3RMQA 3VBBA 3EG3A 3H0FA 2LQ8A 1P92A 1Q7YC 2B8AA 5GAOl 4FT2A 1M90C 4HCCA 4FU6A 2QHTA 2ZNJA 2QYZA 3JCMb 1NYFA 4B9WA 5HK3A 4DBQA 3OBWA 3SB2A 4E51A 1SHGA 5GAN5 2JNGA 4TTVA 4CC2A 4J9DA 2PVGB 2C7IA 3GPLA 4ATOA 5D6WA 4HXJA 3MF2A 1QLYA 4NL2A 3CXCP 1AVZC 1X2HA 1WJSA 2E4HA 2DX1A 4IUPA 1K0XA 2KDSA 2P0KA 2EYQA 2VWFA 4KRTA 1K73U 4JUVA 4BI4A 1V1CA 3RF1A 1PSEA 2ZINA 2P84A 5GAN8 1ZHIA 3ZL7C 1BB9A 2FPEA 1XTDA 2RB6A 4FT4A 2D8HA 1OPKA 1SERA 4N4HA 4BDZA 2ZT6A 2PVDB 4BDYA 4RTVA 4FCYA 2SRCA 3PMIA 1VQPT 4CH3A 1O9SA 4LDYA 3KUFA 2CP2A 1M1GA 3V8KA 4J9BA 4XTXA 3X24B 1GCPA 3A7RA 1M1KR 2RI5A 2QHVA 2ZPBB 4M77F 2ENMA 2PUOB 2HAXA 2QQSA 1GXIE 3PMTA 2OTLA 2V8JA 2I2LA 3HTZA 5KCHA 4E7IA 1AD5A 3CCRA 5C53B 1VQNA 3RIRA 1Q81C 2PUKB 3JCMJ 2FYKA 3HFNA 1YITA 2FB7A 4E7ZA 1VQ8A 2K57A 2X3WD 5CAIA 1TXQA 4CH6A 5FU6C 5ELNA 1HSQA 1PYSA 3QO8A 2ZIMA 2ZPHB 4PK4A 5CKDA 2QASA 5LJ5j 2DIQA 1VQ6T 3HXUA 1W1FA 4QW2A 3VQYA 5GAOn 1N9SA 4YRIA 2DL8A 1D1BA 4KR2A 2XICA 4TVRA 2F2XA 3CCMT 1ZA2B 4QQ6A 1VQLA 4ZGDB 1NLPC 2ZCEA 2V8IA 4C92E 2AKLA 3CCSQ 1WQ7A 1S1NA 2YLCA 1J3TA 2DEQA 3H6ZA 3HXZA 4WJ3M 3OQ5A 4HWTA 2EJ9A 2QEXQ 1AZEA 2EJFA 4BD3A 2MAMA 2HZYA 4A4HA 2E5KA 4CS3A 1KOGA 3VUBA 1VQ9Q 4AFUC 1UGSB 1BCMA 2LVMA 4C0DC 3S3OA 1ZX6A 1YJNT 5HK0A 1B3QA 1XQHA 2LTOA 4Z8AA 3OW2S 1VQKA 5KYUA 1NPRA 3VYGA 3CCQA 4XU2A 5FRMA 2QHUA 4DEYA 3OYFA 4M78C 2DXCA 4J5YA 2K2VA 1UJ0A 2RQUA 2JS2A 4XU1A 3OD1A 3P8VA 1SHFA 4RDXA 2GFAA 2LQWA 4OMQA 1PM3A 3QO5A 2HKNA 1HYOA 2KRMA 3H41A 4M7DE 1IREB 3QZ9B 5IXFA 1AWWA 1YI2A 3JB9F 1FYNA 2I0NA 4ZTJA 1D1CA 4M7AG 2O4XB 1X6OA 1X6BA 3QO3A 5CO7A 5KH6A 1I81A 1D3BA 4DBHA 4ZGJB 2DTHA 3CEYA 1KD1R 3HSBA 2DL7A 2L3PA 4B6MA 2ZTGA 1FXXA 3C94A 4EMHA 1PYSB 3CXCS 2OX7A 4LN2A 4LNPA 4C5GA 1X69A 2K3BA 1OQKA 2VGMA 5A0LA 1VQOT 2DERA 5CQXA 5GJWB 1UHFA 2RMOA 2CYZB 4LDUA 2AMCA 5C51B 1HJDA 5KE3A 3IG2A 3IKLA 4LVJA 2RHQA 3NTIA 4BI8B 2FZGB 2CH4W 1GFDA 4M7AA 2KROA 2XDBA 1LVKA 2K4YA 1VQ7A 2M51A 1VQMA 1I5LA 2ZT7A 3G71T 3CC4Q 1G8XA 2DJQA 4IURA 4O2DA 1I8FA 1VQ4A 2LZ6B 2PTKA 2ZPFB 4OB0B 3CMAQ 1X55A 1TS9A 1M8VA 3SDZA 4JLGA 1EFWA 1WA7A 3I55Q 5LJ3f 1WNLA 2JM8A 2BE9B 2O2OA 3OS1A 1NJIU 5KYWB 4F16A 4E7JA 1QF6A 1M30A 3PCOA 1BBZA 1PNJA 2IG0A 2L8DA 1G3WA 3X28B 4HVCA 4X34A 2KXDA 3VQWA 1SPKA 4BI3A 2ALYA 2DVJA 2FPFA 4H2UA 3EG2A 4P75A 3CCJQ 2YSQA 4KGVB 1Q86U 5LJ5e 1R0CB 2AK5A 3M9QA 3MEVA 1C0MA 4DBFA 1Y71A 2QI2A 4ESRA 3NHNA 4LVIA 2BE7D 3R6OA 4BE1A 2KYMA 4P73C 1GBQA 3E19A 2HSEB 3JCMf 1TG0A 3NFCA 3EFRA 4J9HA 1KC8C 4FW1A 2EGEA 2KR3A 1YCYA 4KUIA 2DVEA 3LW5E 1FMKA 1K4US 1UGVA 1G3SA 2HNIA 1VQ5Q 2QQRA 2LC4A 5C0MA 3M57A 3BY7A 1U5SA 1M8MA 2V1QA 2KEAA 3LSQA 4C92F 3GNGA 3M5AA 5GAOr 2BZXA 4M7AD 4F7UG 4G84A 5DLOA 1W70A 2A28A 4AMCA 1K73R 1Z9QA 1KMNA 2EYZA 3P8HA 4M75G 1WLEA 1X75C 2BUDA 2G3RA 1UECA 3CCST 1IL2A 2ZR2A 5KYYA 2QEXT 3EGUA 3X26B 1VQ9T 1YJWA 3TEHA 3SWNA 2JM9A 2ZAEA 1M1KU 3HY1A 2AZSA 2X9HA 2ZR3A 4P75C 4Q5WA 1UHCA 1QCNA 3PIPA 5GMKl 3M59A 4P71A 1AWOA 2J6FA 3P8DA 3QDRB 1USYA 4RTZA 4F7UA 4N0AC 4PFZA 2ALYB 4M75A 4TVAA 3OYHA 5I2SA 2FZCB 1PCXA 1W6XA 4PJMA 1JU5C 3EH1A 3X25B 2ED1A 5LJ3g 2I4MA 4M7DF 5L8RE 3NPFA 1MNEA 3QWYA 2YXYA 2IPOB 5DY9A 4PFOA 3ER0A 1W4SA 4E47A 3M4GA 2JTEA 2JTFA 2YHTA 2MCNA 2RPNA 4LUDA 3RKWA 3HXXA 4JRIA 2DXUA 2J3MA 1AWJA 1XJWB 2DIGA 3FIFA 3OYCA 3CD6T 1N9RA 4RCBA 1BYMA 1X56A 1MV3A 2QAZA 1G5VA 1SSHA 3REBB 3TSZA 3QBYA 3CC7Q 3L2UA 3FEOA 3TEGA 2R57A 3P8YA 3IKMB 3O5ZA 1YNZA 2EW3A 2R5MA 3FJ5A 2IIMA 4YRSA 1OU9A 4VUBA 3I56T 1MHNA 4FL6A 5IAYA 2K2MA 4Z02A 3WVEB 3HXVA 3RERA 2E70A 2VASA 1K9MC 3EHRA 3ULRB 2EQMA 2LJ1A 3CC2T 4QVCA 3QJ6A 4UC4A 5M9OA 2JN0A 3OYBA 1NBEB 5K1XA 3OMCA 2VKNA 2F2WA 1Z7NA 3V8LA 2QDLA 1G3TA 3LX7A 4KGXB 4LD9K 5KYYB 1YFTA 2L89A 4P74C 2L2PA 4TQFA 1Z7MA 2MYSA 1V76A 1YP5A 2XMFA 1QCFA 1EFNA 4RCCA 4D6WA 3CMAT 4XTZA 3A5YA 4OGEA 3RKXA 3C4SA 1VOMA 1UB4A 1BBUA 1X6GA 4JJCA 2GQIA 2AKKA 2HL3A 3MEWA 3SD4A 1Q82C 1QVFS 2WSEE 1VQ6Q 4IIMA 2CUDA 2IVWA 2DLPA 4Y91A 3UGTA 4TVAB 3G4SQ 1X2KA 1KD1U 4MZTA 1E24A 4KQEA 2ZGWA 3CCMQ 5LJ5h 2DU5A 4PLLA 4E7HA 3OMGA 3L2RA 5D6YA 2E12A 1EIYB 2OTJQ 2PU9B 5AYFA 3T9NA 3U23A 2FRYA 1I5OB 3PE0A 1YB3A 1YHQA 3CC4A 3ME9A 4OP0A 1I4K1 2XHCA 1H8KA 4GBQA 5GMKi 1QKXA 5EC7A 1F1BB 2Y90A 4RKUE 4IIOA 2ZIOA 2LT1A 1LPLA 2D1XA 1NYRA 1PKSA 5FROA 4II1A 11ASA 5GAN2 3BE3A 3WQZA 4OF1A 1UDLA 3MCAB 3CCLT 4TVYA 3CBPA 2YRVA 4M7AE 4E7SA 2KI7A 1WX6A 1VYVA 5GANd 2COZA 5A0DA 4PLIA 2CZ0B 2NYSA 4PKCC 4Y92A 4OB2B 3CPFA 1WYXA 3M0SA 2DTIA 4J7FA 5GANe 3MHXA 1MUZA 1G2BA 2QA4T 4BACA 1K73C 1DJ7B 4MDXA 3NGPA 3KXTA 1NZ9A 3EGDA 1SEMA 3FDRA 1PWTA 4J9EA 1Y7XA 1UGPB 2RQRA 4IUTA 2Q5HA 1WHLA 1QVGA 2J3LA 4R55A 2KRNA 2DL5A 2HL5C 4XTVA 3JCMc 2CP7A 3EG0A 1OI1A 2COWA 2YDLA 2XKOC 1JJ2A 2AKWA 2KYBA 4MMKA 3BFMA 3ICAA 2B86A 3C0CA 4JJDA 5GAMj 1Q86R 2NS6A 2E65A 2CS7A 4KGZB 1BCOA 2CSQA 1VQOQ 2EKHA 1YFRA 2I4LA 7AT1B 3DKMA 1SSFA 5I2MA 3VV0A 1VYUA 2X4XA 3MQZA 3RBBB 1RAEB 2FO0A 4RMFA 2PZ1A 3QG1A 2CZ1B 3NENA 3G71Q 1RAAB 4X9DA 2EPDA 5LJ5g 4UP7A 1PSFA 1WHHA 5DLQE 3I7FA 2DK3A 2V1RA 2RHXA 4M78G 2LCCA 4PJOC 2DEUA 4L59A 4GLMA 2KVQG 2XTIA 1H641 1TUDA 4LDXA 2R58A 4CRIA 4H2WA 4PJOD 2K9GA 1GRIA 3L4GA 3GOXA 2GQVA 4OMPA 3CC7T 2RJDA 4H2VA 2BZ8A 2OTLT 1QKWA 2P0PA 3W3SA 3OBYA 4PJOB 1UTIA 1IHVA 1OOTA 1ZUUA 3QYHB 3CCRT 1PD1A 3OYKA 2K5FA 3UH0A 4IUUA 4J9GA 1VQ8T 4J7IA 4OMMA 4UP9A 3ZBDA 4AH6A 4LDVA 4PNOA 4LNSA 3EGDB 4M78A 5CKHA 2DKGA 1HD3A 1W2BA 1NJ8A 1BKBA 1OPLA 4F7UE 2VXFA 1X54A 1N8RR 2O4XA 1K0SA 4E6RA 1QQJA 4X1VA 2QK0A 1BI3A 3TUPA 1BU1A 4M75E 2EGAA 2AKWB 3PGGA 3M4PA 2FRWA 2JVVA 4C8QE 3JB9H 1NJ6A 3ZEHA 8AT1B 1M3CA 1NYGA 1YIJT 3I5RA 4UP8A 3QPHA 2HKQB 2RD1A 3J7AF 4FYXB 4P3OA 2VUBA 2ROLA 2FL7A 4LD6A 1RAIB 3IALA 4J6YA 4YREA 1VQPA 1M5Q1 3VS0A 1PRLC 5IXBA 1RI9A 3QKJA 3CQTA 3L42A 3G4ST 5CKFA 1AWXA 1OX8A 5FU6B 2GTJA 1MGQA 2QTVA 4CC3A 4P72C 2VVKA 4J9IA 2DD5A 6AT1B 2OTJT 3DLMA 2ZT8A 1VQKT 1YFSA 3E9IA 1ABQA 1YJ9A 3LYIA 3J81E 3JSCA 1M9SA 3LC0A 3M56A 4FYWB 3S3NA 3QIIA 4YRLA 5GAN3 2LCLA 3HXWA 1I07A 5LL6S 2K3YA 1EX4A 2PMFA 2RJCA 4J15A 1K8AC 3MEYA 4M7AF 5KYWA 3EH2A 3L2WA 1OZ2A 3CBMA 3L4GB 3P8BB 3EFOA 2QQAA 4H2SA 5GAMd 4C0DB 2HQEA 1UEBA 4A54A 1RI0A 2RHSB 2A0FB 1B8AA 3JB9I 3GBQA 2E5AA 2A3LA 4DPGA 3VKIA 3QTCA 4ORZA 3A8GB 3CCMA 5GAMe 4E7LA 1RLQC 3ERRA 4TWAA 4M78D 5GANh 1BK2A 4WF2A 3H0IA 4CS4A 1X01A 2G4CA 2ZZDA 5J26A 3EFSA 4M78B 4FW2A 4YRNA 1NJ1A 2PVOB 3RACA 5HY6A 2CGHA 2RJFA 1R77A 1OEBA 1NJIC 3CCEQ 1BI0A 2CIMA 1YJNA 2RF0A 4FIBA 3CD6Q 1LJOA 2Q7GA 5A2QE 2QGGA 1PKTA 3CPWA 1QWFA 4RQFA 3NEMA 2E3HA 2J06A 3TVTA 1GL5A 4P73A 2H3JA 3MPUB 2DL3A 2CZ6B 1VQ7T 3M53A 3HFZB 1Q86C 3BDUA 3PFSA 1Q95G 3I56Q 1VQ4T 4HCKA 4QT7A 2E5QA 4YRFA 2KNBB 1U8RA 5GMKe 5GAN6 3RR6A 4CI0C 3QWXX 2DPPB 2DU7A 2NLUA 5CKBA 3CC2Q 4TVWA 2HQHA 2LT4A 2CJBA 1ZSGA 3TCJA 4C0GA 2DYBA 2RK1A 1M2VB 2HD0A 3KFUA 2DTOA 3MEAA 4UPAA 2EYYA 3SEMA 4OVAA 1S72A 1JBMA 2YUPA 2Q5IA 1PC0A 1WXBA 1WPYA 2EKOA 1WHMA 3A1PA 2BKDN 2DYIA 2JUFA 2KY9A 3DB4A 4JZ3A 4ELYC 2DZ9A 3G6EQ 1UJYA 1YFNA 4YCWA 1CSKA 4YPFA 2RA2A 3EFOB 4KH1B 3HXYA 5F5WA 4WJ4A 2H3EB 1VQOA 1RAFB 2YT6A 1NM7A 4M77C 3ZFJA 1Y57A 2C0TA 2LX9A 1ATIA 1WQWA 4NS5A 4JRKA 2GGRA 4HVUA 3DLLA 5IHIA 2CSIA 3DSQA 1QVFP 1EIFA 3M0PA 2XI9A 2XU8A 1LNXA 3THKA 1B70B 3QO7A 4F7UF 4E7KA 4N0AA 1WHJA 2X3XD 4M77B 4ZTFA 3JB9J 4J6XA 4A4FA 1M1KC 2O9SA 4M75F 3OY9A 1EVKA 3HTRA 2F5TX 3HP9A 1SF9A 3HRKA 4C8QF 2M02A 3PIOA 4EMKA 2W10A 3BDLA 4KUDK 2EYWA 4O6JA 1KK7A 2I4NA 4EIKA 4LUEA 2CUBA 2KRSA 2C8MA 3CCLQ 2DETA 2EBPA 3GP8A 4PJJA 2LJ3A 3M0RA 5CQYA 5I22A 2MWOA 1X2GA 1KIKA 1K76A 2RO0A 1I1JA 1YJWT 1JJCB 2ED0A 1OV3A 1QCOA 4XTYA 4DOVA 4H2YA 1GCQC 1WYDA 4E2FB 4C5EA 3QXEB 4HKEA 1PRMC 3A8LB 3C12A 4WCIA 5ECAA 5J3BA 2QA4Q 1JXOA 4MZMA 1M3BA 2ZZFA 2JOYA 4YRCA 3MKDA 2CP6A 5IT9E 4XEMA 1WIEA 8ATCB 2O88A 1QVPA 1QVGP 1IGUA 5D7UA 2EQUA 5KYNA 4OB3B 1TOVA 2L3RA 2E3CA 2OAUA 2P5IA 1QP3A 1GFCA 4X5OA 2YUOA 2E6NA 4YRQA 3REUA 3A8MB 1N8RU 2O9VA 2ZCFB 1U06A 1RLPC 2KT8A 1G5IA 4P74A 4PHCA 1D0XA 5GANj 1NE8A 1HXDA 5FWCA 5GJVB 3EGXA 1Q7YR 1ACMB 3N5BB 1OYXA 1ZSZC 3HKSA 1NPPA 5GAMh 1M90R 2KGTA 2I4OA 2E6ZA 3RL6A 2DE0X 2CP5A 2MK5A 3AHUA 4EMKC 2QG9B 1OZ3A 1UUEA 1NJ2A 4A63B 3HL8A 3CCSA 1EIYA 3A8OB 4K11A 1ZUKA 1BIAA 3A7AA 3GIBA 2QEXA 2CDTA 4QVZA 2LNHB 1VQ9A 1N5ZA 4DEXA 1ZSZB 3META 3GLXA 3E9HA 1UGRB 3UPUA 2DFUA 4EMKB 3VQVA 3CCET 2HMAA 3O8VA 4LE9A 5I11A 4QKUA 9ATCB 2NWMA 3M0QA 5KYXB 3G1ZA 4A53A 1KD1C 2QTXA 2OTLQ 4D8KA 2YUNA 4ZIBA 2JTMA 4RTTA 1M2OA 4JDSA 3CCRQ 1VQNQ 3VRYA 4M4ZA 4IUQA 5GMKh 1YITQ 3QDFA 1VQ8Q 1JB0E 4J8OA 3H9NA 2JS0A 3UFGA 2JMCA 3RNJA 2LCSA 4FM4B 2XDPA 1VIFA 4JZ4A 5K1PA 4JS5A 4V2SA 2FEIA 1W2BP 4FYYB 4Q15A 1Y96A 4ZN3A 1WHGA 2M0OA 1M3AA 3CCVT 3CD6A 2GF7A 2YWWA 1VQLQ 3MP8A 4G85A 1T3SA 3MP6A 1NYQA 2RHYA 5GAN4 3FJPA 2KMTA 4JJBA 1YIJQ 3A98A 2RK2A 3G6ET 3JCMP 4WI1A 1EOVA 1IRXA 2FVUA 3V7RA 2KSSA 1CKBA 2J6KA 1RABB 2ROTA 1E6HA 1Q81R 4KT0E 1YHQT 3EG1A 3OA6A 4EO4A 3EGXB 5LJ5f 1X2QA 4JJNK 3I56A 4CH5A 1PG5B 1SRLA 1V29B 1ZQ1A 5LJ3j 2HQXA 2YRDA 3C95A 1AEYA 2L3SA 2NUPB 4C8QC 2FHDA 3CC2A 3KFVA 1UE9A 2D9TA 3NELA 2GBQA 4PJOG 1E7OA 2GFUA 1VQKQ 4YRJA 1ABOA 1BI1A 3E2UA 1TTHB 5FLXE 5GAMg 5CKEA 2J7IA 3LGLA 2ZPEB 1A0NB 3FB9A 4Y28E 1YGBA 1JO8A 3CMAA 4BUGA 3CMET 2VB6A 3JAME 1WFWA 1MMAA 3I55A 3CCUT 4ME7A 1LOJA 4C92C 1VUBA 12ASA 2CZ7B 1GBRA 3OYYA 3OSVA 4ZGEB 1K9MU 1UFFA 1C1AA 2EL9A 2ATCB 4BB7A 4C92D 1GGMA 3NTHA 3EAEA 4JRPA 1YI2Q 5I21A 3A8HB 2M1HA 3VQXA 2GNCA 3CCJA 1MMGA 4PJOA 3MJXA 3E1SA 4C92B 1G5HA 4A4KA 1U3OA 2KBTA 3LLRA 4K88A 2AHJB 1QVGS 4ELZC 2EYXA 2P4TA 2XIDA 1JJ2S 2OAWA 2EGCA 5L23A 4F17A 2LNVA 2QGFB 3JV3A 2RHZA 1Q82U 4HWPA 3VYHB 3UF4A 1Y96B 2K5IA 4YTLA 2VV5A 1BBWA 1M27C 2X4YA 3FRNA 4YRPA 1B34B 2O31A 1G3YA 2IY5B 3Q1JA 1IHWA 3VJPA 3VS2A 1IXDA 5D6XA 2CP0A 4XTUA 1BIBA 4YRGA 3CCLA 4M7DC 4OLFA 2BZYA 1U1SA 1VQ5A 3CPWP 2L3QA 1VQ7Q 5AT1B 2C06A 2RHUA 3I9QA 2AZVA 3RESA 4M7DD 4MDWA 4L5GA 1VQ4Q 4Q6GA 3PT9A 1KSWA 4K86A 2G6FX 4M7DB 1G51A 2QA4A 2LMJA 2K3XA 3R6NA 2H8HA 2PMEA 2P0QA 2YRCA 1FMWA 2DILA 4AFSC 2C0OA 1W66A 2XDDA 3QYGB 1EQRA 3EHQA 4F04B 2M16A 2JW4A 2HBPA 3ASKA 2VGNA 5CCAA 1D0YA 2KT1A 2XD0A 1WXUA 4GY5A 4HWOA 3QUIA 2WACA 4P72A 2V8KA 3JCMV 1ASZA 3NETA 4HWSA 5FW9A 2FG0A 5KNNA 2HBWA 1QP2A 2LQKA 4AG2C 2D8JA 5GMKj 5ELOA 2BIVA 4H2XA 1PHTA 3OS2A 4ZNXA 1KQSS 5CVIA 1E6GA 2D0QB 2DD4A 2F1LA 4LVKA 3LH0A 3V8JA 3V7SA 2RHSA 4AT1B 4XQ3A 2LRQA 1VQNT 2E3IA 5LJ3d 1W2BS 4EMGA 1YITT 2Z0WA 1KQSA 1IO6A 2DZCA 2ARSA 1Q7YU 2C0IA 2RI2A 2RI3A 3DB3A 5LJ3e 1QW1A 3OYMA 5C52B 1O75A 2KXCA 1M90U 3RMSA 3PTAA 3X20B 1ZBXA 1C6VX 2DO3A 2MI6A 3M58A 2YLBA 1ADJA 1AZGB 2COYA 2K5LA 4DBRA 5GAOp 4R0KA 1VQLT 4HT9A 5FU7C 3QZ5B 2ZNIA 2JMAA 3S6WA 2JXBA 3CC7A 2EIFA 4Z88A 1YJ9T 2A08A 4RUGA 3I5SA 4FYVB 3HFZA 1FMVA 2NUTA 3JCMd 2HSPA 1D09B 1KC8R 4Z89A 1YJWQ 3JCMX 2KK4A 2MPXC 3REAB 1UG1A 3H0HA 1IZ6A 2DF6A 2DAQA 5FU7B 5J39A 5E3IA 3PVQA 1HC7A 5GAOm 3PZCA 4OMFB 3JCMe 1R8OB 3OS5A 1QMCA 4N4IA 1E1OA 2ARUA 2M9UA 4YDQA 1M2VA 4EPCA 3UGQA 5HCKA 1MV0B 1RUWA 3I35A 4WTOB 1NNHA 3PVLA 3CCQT 2CH4A 5EG2A 2PNIA 3G1JA 4J9CA 3HFVA 3QSUA 4M77G 2VC8A 5DM7R 1WGSA 3F70A 1YIJA 2RHIA 4DQ2A 2RM4A 1OULA 2X4WA 1VQ6A 4H2XB 3RDVA 4RG8A 2HCKA 4BY6C 1YI2T 2E64A 3QNEA 4YYEA 4HT4A 3VRZA 2CJ9A 3G4SA 5GANf 4A4EA 1H3HA 2EFIA 4YP0A 2F5KA 2ZXFA 2RQWA 4KH0B 2A8EA 2E10A 2QDYB 3VS7A 1FX7A 3MO8A 3MP1A 4LVLA 1Q81U 2RQVA 2OTJA 3JRZA 4BY6B 2R5AA 1B70A 4MMLA 3A32A 4M77A 3LGFA 2GTOA 4XAXB 1NEGA 3HFOA 2K7AA 1SG5A 4JS4A 1TU0B 3OYJA 3CPWS 1B7TA 3RGLA 3OW2A 4OB1B 4XTWA 1H92A 4YRTA 4JLIA 3HPWA 2P4RA 4RTWA 5CR2A 1HK9A 2AT1B 4C5IA 1VYTA 2EQKA 2MIOA 3VS6A 2DJZA 2VYTA 2DBMA 4C0FA 2EJGA 3UT1A 4CC7A 5GAOq 1N6AA 2DRMA 1WXTA 3VU3C 3A5ZA 1VQMT 2NUTB 1TSFA 2DXBA 3G7ZA 1S72T 1ZA1B 2DXTA 1C0AA 1KQ1A 1JJCA 3JCMW 3FC3A 2D6FA 2MOXA 1KHCA 2RNAA 3URGA 3P8TA 4HWRA 3OYDA 2P0LA 1N9WA 3OS0A 1H4QA 2DNUA 3L2QA 2RH2A 2ZT5A 2FPDA 2LP5A 5CIUA 2QQBA 4OGCA 1K8AU 1QE0A 3OYLA 3S3MA 2F2VA 4QQDA 3R07A 2KE9A 3HRIA 4F14A 4X9CA 2BTTA
chains in the Genus database with same CATH topology
3OYIA 2DDZA 3CXCA 1SETA 4BWAA 1KHIA 4HT8A 4CH4A 3UDCA 5FRNA 4PJOE 4YRMA 3JB9G 1FWZA 3CMQA 3A31A 4YRRA 1TH7A 2EWNA 1H4VB 3GF5A 1SESA 1B76A 4P3NA 3E9GA 3HRSA 4CS2A 4HCBA 4ZN1A 4M77D 2LDMA 1H4TA 4A4GA 3L2VA 5LJ3h 2XGTA 2Y4YA 5LJ5d 4NCXA 3G71A 4EX5A 5GANg 3CBOA 2X4JA 1LYLA 3PNWC 3WXMB 4YRKA 1N8RC 3MF1A 1BI2A 3OYEA 4LDWA 2PQWA 3WVDB 4IUVA 3M4QA 3LWHA 3A5ZB 3FLGA 4BE0A 1FYFA 1XNIA 3GNFB 3NTKA 1D3BB 2KAFA 3M4YA 1WJRA 3JCMh 2EAYA 1L0WA 1RIQA 1KQ2A 2MF2A 4M7AC 3KBGA 1ASYA 2CKKA 3OYAA 2AMCB 3E9FA 4J6WA 1H3ZA 2RHQB 5C6SA 2EQJA 4IKFA 2DQ3A 4M7AB 1Y07A 4C8QG 5HKCA 1N27A 3V7CA 4NL3A 4XEOA 5GAMf 5CK9A 2XG8D 3HY0A 1B7YA 4M78E 3RUXA 1SRYA 2ZPIB 2WSCE 4J83A 3QHSA 4JRQA 1AHJB 4YCVA 4QVDA 2ZZEA 4TQDA 1M1FA 1E1TA 2MMPA 3LSSA 3PCOB 2ZZGA 2O01E 1XOVA 3JB9D 4C92G 3INZA 1KC8U 2E41A 4GLKA 2QQ9A 3MEUA 1U1TA 4KR3A 3VUZA 3HHTB 4HCZA 3H8ZA 3L1AA 4C8QA 4O5VA 1WU7A 4H2TA 2WSFE 4N4GA 1M4ZA 4HA8A 4RQEA 3M55A 4QQGA 1WJQA 4C0ZA 4FSXA 2Q7HA 3BW1A 5GAN7 4C5HA 4C92A 2GCXA 4XU0A 3OYGA 4LVMA 1EVLA 2ARTA 3TU4K 3HRTA 3JCMQ 5HGQA 4RMOA 2XK0A 3A74A 1VQZA 3J80E 4M7DG 4P3PA 4BW9A 3JCMg 4ZTZB 4PJOF 4R56A 3CCEA 4EDUA 1B34A 3SWNC 1VIEA 4YROA 2IY5A 4DOWA 4B9XA 3L2ZA 4RG2A 4PL6A 3BJUA 2ZPGB 4P71C 3CC4T 4M77E 1KG1A 3SWNB 1B7YB 1USYC 2CJAA 3TEHB 5KE2A 1HTTA 2VXEA 3OYNA 1YBYA 4M75C 2Q7EA 3I55T 4XU3A 4M7DA 2DQ0A 5IN1A 4M75D 1J5WA 5GMKm 2KQWA 4C8QD 4F7UB 3A7UA 3OB9A 2MWPA 3REXA 2JZ2A 4M75B 1E22A 3HRUA 2L5QA 3CCJT 3CCVA 4C8QB 4BE2A 1QVFA 4KBMB 3G6EA 3UWNA 3M54A 2QXFA 4YCUA 3SFMA 3OSSC 4NOYA 1ADYA 3QJYA 3RKYA 2E1HA 3TREA 5A0GA 2A7YA 2F69A 1NJ5A 4H02A 4K87A 1RL2A 3LWIA 2RJEA 1H4SA 1VQ5T 2Y4XA 4PG3A 4L6V5 4XK8E 2ODRC 4DA4A 3CMEA 1KMMA 4MZPA 4ZTUB 2QHSA 5KCOA 3CCUA 2ODRD 4KULA 2X35A 4M78F 4L87A 1UGQB 4P5NA 3TEEA 1JRIA 3RMQA 3VBBA 2LQ8A 1P92A 1Q7YC 2B8AA 5GAOl 4FT2A 1M90C 4HCCA 4FU6A 2QHTA 2ZNJA 3JCMb 4B9WA 5HK3A 3OBWA 3SB2A 4E51A 5GAN5 2JNGA 4TTVA 2PVGB 2C7IA 3GPLA 4ATOA 5D6WA 3MF2A 4NL2A 1X2HA 1WJSA 4IUPA 2KDSA 2P0KA 2EYQA 1K73U 4JUVA 4BI4A 3RF1A 1PSEA 2ZINA 5GAN8 1ZHIA 1XTDA 2RB6A 4FT4A 1SERA 4N4HA 4BDZA 2ZT6A 2PVDB 4BDYA 3PMIA 1VQPT 4CH3A 1O9SA 3KUFA 4LDYA 1M1GA 3V8KA 4XTXA 3X24B 3A7RA 2RI5A 2QHVA 2ZPBB 4M77F 2PUOB 2HAXA 2QQSA 1GXIE 3PMTA 2OTLA 2V8JA 2I2LA 3HTZA 5KCHA 4E7IA 3CCRA 5C53B 1VQNA 3RIRA 1Q81C 2PUKB 3JCMJ 2FYKA 3HFNA 1YITA 2FB7A 1VQ8A 2K57A 5CAIA 4CH6A 5FU6C 5ELNA 1PYSA 3QO8A 2ZIMA 2ZPHB 5CKDA 5LJ5j 2DIQA 1VQ6T 3HXUA 4QW2A 3VQYA 5GAOn 1N9SA 4YRIA 4KR2A 2XICA 4TVRA 3CCMT 4QQ6A 1VQLA 4ZGDB 2ZCEA 2V8IA 4C92E 1WQ7A 2YLCA 2DEQA 3H6ZA 3HXZA 4WJ3M 3OQ5A 4HWTA 2EJ9A 2EJFA 4BD3A 2MAMA 4A4HA 4CS3A 1KOGA 3VUBA 1UGSB 2LVMA 4C0DC 3S3OA 1YJNT 5HK0A 1XQHA 2LTOA 3OW2S 1VQKA 1NPRA 3VYGA 3CCQA 4XU2A 5FRMA 2QHUA 3OYFA 4M78C 2DXCA 4J5YA 2K2VA 4XU1A 3OD1A 3P8VA 4RDXA 2GFAA 3QO5A 4M7DE 1IREB 3QZ9B 1YI2A 3JB9F 4ZTJA 4M7AG 2O4XB 1X6OA 3QO3A 5CO7A 5KH6A 1I81A 1D3BA 4ZGJB 2DTHA 3CEYA 3HSBA 2ZTGA 1FXXA 3C94A 4EMHA 1PYSB 3CXCS 4C5GA 1VQOT 2VGMA 5A0LA 5CQXA 2CYZB 4LDUA 2AMCA 5C51B 5KE3A 3IG2A 3IKLA 4LVJA 2RHQA 3NTIA 4BI8B 4M7AA 2XDBA 2K4YA 1VQ7A 1VQMA 1I5LA 2ZT7A 3G71T 4IURA 4O2DA 1I8FA 1VQ4A 2ZPFB 4OB0B 1X55A 1M8VA 3SDZA 4JLGA 1EFWA 5LJ3f 1WNLA 3OS1A 1NJIU 4E7JA 1QF6A 3PCOA 2IG0A 2L8DA 1G3WA 3X28B 4HVCA 4X34A 3VQWA 4BI3A 2ALYA 4H2UA 4P75A 1Q86U 5LJ5e 3M9QA 3MEVA 1Y71A 2QI2A 4LVIA 3R6OA 4BE1A 4P73C 3E19A 3JCMf 3NFCA 3EFRA 1KC8C 1YCYA 4KUIA 2DVEA 3LW5E 1G3SA 2HNIA 2QQRA 2LC4A 5C0MA 3M57A 3BY7A 3LSQA 4C92F 3GNGA 3M5AA 5GAOr 4M7AD 4F7UG 4G84A 5DLOA 1KMNA 3P8HA 4M75G 1WLEA 1X75C 2BUDA 2G3RA 3CCST 1IL2A 2ZR2A 2QEXT 3X26B 1VQ9T 1YJWA 3TEHA 3SWNA 1M1KU 3HY1A 2ZR3A 4P75C 4Q5WA 3PIPA 5GMKl 3M59A 4P71A 3P8DA 3QDRB 1USYA 4F7UA 4N0AC 2ALYB 4M75A 4TVAA 3OYHA 5I2SA 3X25B 5LJ3g 2I4MA 4M7DF 5L8RE 5DY9A 3ER0A 1W4SA 4E47A 3M4GA 2JTFA 2YHTA 3RKWA 3HXXA 4JRIA 2DXUA 2J3MA 2DIGA 3FIFA 3OYCA 3CD6T 1N9RA 4RCBA 1BYMA 1X56A 1G5VA 3QBYA 3L2UA 3FEOA 3TEGA 2R57A 3P8YA 3IKMB 2R5MA 4YRSA 4VUBA 3I56T 1MHNA 4FL6A 5IAYA 4Z02A 3WVEB 3HXVA 3RERA 2E70A 1K9MC 2EQMA 3CC2T 4QVCA 3QJ6A 4UC4A 5M9OA 2JN0A 3OYBA 5K1XA 3OMCA 1Z7NA 3V8LA 1G3TA 3LX7A 4LD9K 1YFTA 2L89A 4P74C 4TQFA 1Z7MA 4D6WA 4RCCA 3CMAT 4XTZA 3A5YA 4OGEA 3RKXA 3C4SA 1UB4A 1BBUA 3MEWA 3SD4A 1Q82C 1QVFS 2WSEE 2IVWA 4Y91A 3UGTA 4TVAB 1KD1U 4MZTA 1E24A 4KQEA 2ZGWA 5LJ5h 2DU5A 4PLLA 4E7HA 3OMGA 3L2RA 5D6YA 2E12A 1EIYB 2PU9B 5AYFA 3T9NA 1YB3A 1YHQA 3CC4A 3ME9A 4OP0A 1I4K1 2XHCA 5GMKi 2Y90A 4RKUE 2ZIOA 2LT1A 1NYRA 5FROA 4II1A 11ASA 5GAN2 3WQZA 4OF1A 3MCAB 3CCLT 4TVYA 3CBPA 2YRVA 4M7AE 5GANd 5A0DA 4PLIA 2CZ0B 4PKCC 4OB2B 3CPFA 2DTIA 4J7FA 5GANe 3MHXA 2QA4T 4BACA 1K73C 1DJ7B 4MDXA 3KXTA 1NZ9A 3FDRA 1Y7XA 1UGPB 4IUTA 2Q5HA 1QVGA 2J3LA 4R55A 4XTVA 3JCMc 1OI1A 2XKOC 1JJ2A 2AKWA 4MMKA 3BFMA 3ICAA 5GAMj 2NS6A 2E65A 2CS7A 1YFRA 2I4LA 3DKMA 1SSFA 5I2MA 3VV0A 3MQZA 2X4XA 4RMFA 3QG1A 2CZ1B 3NENA 4X9DA 5LJ5g 4UP7A 1PSFA 5DLQE 3I7FA 2DK3A 2RHXA 4M78G 2LCCA 4PJOC 4L59A 2KVQG 2XTIA 1H641 4LDXA 2R58A 4CRIA 4H2WA 4PJOD 3L4GA 3GOXA 2GQVA 3CC7T 2RJDA 4H2VA 2OTLT 2P0PA 3W3SA 3OBYA 4PJOB 3CCRT 3QYHB 3OYKA 2K5FA 3UH0A 4IUUA 1VQ8T 4J7IA 4UP9A 3ZBDA 4AH6A 4LDVA 4PNOA 4LNSA 4M78A 5CKHA 2DKGA 1W2BA 1NJ8A 1BKBA 4F7UE 2VXFA 1X54A 2O4XA 1BI3A 3TUPA 4M75E 2AKWB 3PGGA 3M4PA 2JVVA 4C8QE 3JB9H 1NJ6A 3ZEHA 1YIJT 4UP8A 3QPHA 2RD1A 3J7AF 4P3OA 2VUBA 2FL7A 4LD6A 3IALA 4J6YA 4YREA 1VQPA 1M5Q1 3QKJA 3L42A 3G4ST 5CKFA 5FU6B 1MGQA 4P72C 2DD5A 2OTJT 3DLMA 2ZT8A 1VQKT 1YFSA 3E9IA 1YJ9A 3LYIA 3J81E 3JSCA 1M9SA 3LC0A 3M56A 3S3NA 3QIIA 4YRLA 5GAN3 2LCLA 3HXWA 5LL6S 2K3YA 2PMFA 2RJCA 4J15A 1K8AC 3MEYA 4M7AF 3L2WA 1OZ2A 3CBMA 3L4GB 3P8BB 2QQAA 4H2SA 5GAMd 4C0DB 2HQEA 1UEBA 4A54A 1RI0A 2RHSB 1B8AA 3JB9I 2E5AA 2A3LA 4DPGA 3VKIA 3QTCA 3A8GB 3CCMA 5GAMe 4E7LA 3ERRA 4TWAA 4M78D 5GANh 4WF2A 4CS4A 1X01A 2G4CA 2ZZDA 5J26A 3EFSA 4M78B 4YRNA 1NJ1A 2PVOB 3RACA 5HY6A 2CGHA 2RJFA 1NJIC 1BI0A 2CIMA 1YJNA 4FIBA 1LJOA 2Q7GA 5A2QE 3CPWA 4RQFA 3NEMA 4P73A 2H3JA 2CZ6B 1VQ7T 3M53A 3HFZB 1Q86C 3BDUA 3PFSA 1VQ4T 2E5QA 4YRFA 1U8RA 5GMKe 5GAN6 4CI0C 2DPPB 2DU7A 2NLUA 5CKBA 4TVWA 2CJBA 2LT4A 3TCJA 4C0GA 2RK1A 2HD0A 3KFUA 2DTOA 3MEAA 4UPAA 4OVAA 1S72A 1JBMA 2Q5IA 1WPYA 2EKOA 2BKDN 2JUFA 2KY9A 3DB4A 4ELYC 2DZ9A 4YCWA 4YPFA 2RA2A 3HXYA 5F5WA 4WJ4A 1VQOA 4M77C 3ZFJA 2LX9A 1ATIA 1WQWA 4NS5A 4JRKA 3DLLA 3DSQA 1EIFA 2XI9A 2XU8A 1LNXA 1B70B 3QO7A 4F7UF 4E7KA 4N0AA 4M77B 4ZTFA 3JB9J 4J6XA 4A4FA 1M1KC 4M75F 3OY9A 1EVKA 2F5TX 3HP9A 3HRKA 4C8QF 3PIOA 4EMKA 3BDLA 4KUDK 4O6JA 2I4NA 2C8MA 3GP8A 5CQYA 2MWOA 1X2GA 2RO0A 1YJWT 1JJCB 4XTYA 4H2YA 4DOVA 1WYDA 4C5EA 3QXEB 4HKEA 3A8LB 3C12A 5J3BA 4MZMA 2ZZFA 2JOYA 4YRCA 5IT9E 4XEMA 1QVPA 2EQUA 4OB3B 2L3RA 2E3CA 2OAUA 2P5IA 1QP3A 4X5OA 2E6NA 4YRQA 3REUA 3A8MB 1N8RU 2ZCFB 1G5IA 4P74A 4PHCA 5GANj 1NE8A 1HXDA 3N5BB 1OYXA 3HKSA 1NPPA 5GAMh 2I4OA 2E6ZA 3RL6A 3AHUA 4EMKC 1OZ3A 1NJ2A 3HL8A 3CCSA 1EIYA 3A8OB 1BIAA 3A7AA 3GIBA 2QEXA 4QVZA 1VQ9A 3META 3GLXA 3E9HA 1UGRB 3UPUA 4EMKB 3VQVA 3CCET 3O8VA 3G1ZA 4A53A 1KD1C 2QTXA 4ZIBA 2JTMA 4JDSA 4IUQA 5GMKh 1JB0E 4J8OA 3UFGA 4FM4B 2XDPA 1VIFA 5K1PA 4JS5A 4V2SA 4Q15A 1Y96A 4ZN3A 2M0OA 3CCVT 3CD6A 2GF7A 3MP8A 4G85A 3MP6A 1NYQA 2RHYA 5GAN4 3FJPA 2KMTA 2RK2A 3G6ET 3JCMP 4WI1A 1EOVA 2FVUA 3V7RA 2KSSA 4KT0E 1YHQT 3OA6A 4EO4A 5LJ5f 4JJNK 3I56A 4CH5A 1V29B 1ZQ1A 5LJ3j 2HQXA 3C95A 3CC2A 4C8QC 2FHDA 2D9TA 3NELA 4PJOG 2GFUA 4YRJA 1BI1A 5FLXE 5GAMg 5CKEA 3LGLA 2ZPEB 3FB9A 4Y28E 1YGBA 3CMAA 4BUGA 3CMET 3JAME 3I55A 3CCUT 4ME7A 1LOJA 4C92C 1VUBA 12ASA 2CZ7B 3OYYA 3OSVA 4ZGEB 1K9MU 2EL9A 4BB7A 4C92D 1GGMA 3NTHA 3EAEA 4JRPA 5I21A 3A8HB 2M1HA 3VQXA 3CCJA 4PJOA 3E1SA 4C92B 1G5HA 4A4KA 3LLRA 4K88A 2AHJB 1QVGS 4ELZC 2P4TA 2XIDA 1JJ2S 2LNVA 2RHZA 1Q82U 4HWPA 3VYHB 1Y96B 2K5IA 4YTLA 2VV5A 1BBWA 3FRNA 2X4YA 4YRPA 1B34B 1G3YA 2IY5B 3Q1JA 3VJPA 5D6XA 4XTUA 1BIBA 4YRGA 3CCLA 4M7DC 4OLFA 1U1SA 1VQ5A 2C06A 2RHUA 3RESA 4M7DD 4MDWA 4L5GA 4Q6GA 3PT9A 4K86A 4M7DB 1G51A 2QA4A 2K3XA 2PMEA 2P0QA 1W66A 2XDDA 3QYGB 1EQRA 2M16A 2HBPA 3ASKA 2VGNA 5CCAA 2XD0A 4GY5A 4HWOA 3QUIA 2WACA 4P72A 2V8KA 3JCMV 1ASZA 3NETA 4HWSA 5KNNA 1QP2A 2LQKA 5ELOA 5GMKj 2BIVA 4H2XA 3OS2A 1KQSS 5CVIA 2D0QB 2DD4A 4LVKA 3LH0A 3V8JA 3V7SA 2RHSA 4XQ3A 2LRQA 1VQNT 5LJ3d 1W2BS 4EMGA 1YITT 1KQSA 2DZCA 2ARSA 1Q7YU 2RI2A 2RI3A 3DB3A 5LJ3e 1QW1A 3OYMA 5C52B 1O75A 1M90U 3RMSA 3PTAA 3X20B 1ZBXA 2MI6A 2DO3A 3M58A 2YLBA 1ADJA 2K5LA 5GAOp 1VQLT 4HT9A 5FU7C 3QZ5B 2ZNIA 3S6WA 3CC7A 2EIFA 1YJ9T 3HFZA 3JCMd 3JCMX 2KK4A 1IZ6A 2DAQA 5FU7B 5J39A 5E3IA 1HC7A 5GAOm 3PZCA 4OMFB 3JCMe 1R8OB 3OS5A 4N4IA 1E1OA 2ARUA 2M9UA 4YDQA 4EPCA 3UGQA 1NNHA 3CCQT 5EG2A 3HFVA 3QSUA 4M77G 2VC8A 5DM7R 1WGSA 3F70A 1YIJA 2RHIA 4DQ2A 2RM4A 2X4WA 1VQ6A 4H2XB 4RG8A 4BY6C 1YI2T 2E64A 3QNEA 4YYEA 4HT4A 2CJ9A 3G4SA 5GANf 4A4EA 2EFIA 4YP0A 2F5KA 2ZXFA 2A8EA 2E10A 2QDYB 1FX7A 3MO8A 3MP1A 4LVLA 1Q81U 2OTJA 3JRZA 4BY6B 2R5AA 1B70A 4MMLA 3A32A 4M77A 3LGFA 4XAXB 3HFOA 4JS4A 3OYJA 3CPWS 3RGLA 3OW2A 4OB1B 4XTWA 4YRTA 4JLIA 3HPWA 5CR2A 1HK9A 4C5IA 2EQKA 2DJZA 2VYTA 4C0FA 2EJGA 3UT1A 5GAOq 1N6AA 3VU3C 3A5ZA 1VQMT 2DXBA 3G7ZA 1S72T 2DXTA 1C0AA 1KQ1A 1JJCA 3JCMW 3FC3A 2D6FA 1KHCA 3URGA 3P8TA 4HWRA 3OYDA 2P0LA 1N9WA 3OS0A 1H4QA 3L2QA 2RH2A 2ZT5A 5CIUA 2QQBA 4OGCA 1K8AU 1QE0A 3OYLA 3S3MA 4QQDA 3R07A 3HRIA 4X9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AHU A;  2DDZ A;  3WQZ A;  4EMK C;  1NJ2 A;  1SET A;  4BWA A;  2I2L A;  3HTZ A;  4HT8 A;  4TVY A;  1EIY A;  4M7A E;  4CH4 A;  4PJO E;  5C53 B;  4YRM A;  3RIR A;  3JB9 G;  1BIA A;  5GAN d;  3JCM J;  2FYK A;  3HFN A;  3GIB A;  3A7A A;  3CMQ A;  2FB7 A;  2K57 A;  5CAI A;  3A31 A;  4YRR A;  4CH6 A;  5ELN A;  2DTI A;  3E9H A;  1TH7 A;  1PYS A;  3QO8 A;  2ZIM A;  2EWN A;  4EMK B;  3VQV A;  5GAN e;  1H4V B;  5LJ5 j;  1SES A;  1B76 A;  3HXU A;  4P3N A;  3VQY A;  4CS2 A;  5GAO n;  1N9S A;  4YRI A;  3G1Z A;  4A53 A;  4M77 D;  1H4T A;  4KR2 A;  2Q5H A;  2QTX A;  2J3L A;  2ZCE A;  4XTV A;  5LJ3 h;  4C92 E;  2XGT A;  4ZIB A;  3JCM c;  2AKW A;  5LJ5 d;  4NCX A;  1WQ7 A;  4EX5 A;  2YLC A;  2DEQ A;  3HXZ A;  4WJ3 M;  5GMK h;  4HWT A;  5GAN g;  2EJ9 A;  4MMK A;  2EJF A;  3BFM A;  3ICA A;  4CS3 A;  1KOG A;  5GAM j;  1LYL A;  2E65 A;  4YRK A;  3MF1 A;  3UFG A;  1YFR A;  2I4L A;  5K1P A;  4V2S A;  3M4Q A;  4Q15 A;  1Y96 A;  1FYF A;  4RMF A;  4XU2 A;  4G85 A;  1NYQ A;  2QHU A;  5GAN 4;  3FJP A;  1D3B B;  4M78 C;  3NEN A;  4J5Y A;  4X9D A;  3JCM h;  5LJ5 g;  3JCM P;  1EOV A;  4UP7 A;  4WI1 A;  2EAY A;  3I7F A;  1L0W A;  3V7R A;  4XU1 A;  3OD1 A;  3P8V A;  1RIQ A;  4RDX A;  4EO4 A;  4M78 G;  5LJ5 f;  1KQ2 A;  4M7A C;  4PJO C;  3QO5 A;  4CH5 A;  5LJ3 j;  1ASY A;  4M7D E;  2XTI A;  1H64 1;  2AMC B;  3JB9 F;  4C8Q C;  4H2W A;  4PJO D;  4J6W A;  2RHQ B;  3L4G A;  3NEL A;  4M7A G;  4PJO G;  2DQ3 A;  4H2V A;  3QO3 A;  4YRJ A;  1I81 A;  1D3B A;  5GAM g;  3W3S A;  4M7A B;  4C8Q G;  4PJO B;  2DTH A;  3FB9 A;  3HSB A;  3UH0 A;  1YGB A;  4NL3 A;  3V7C A;  2ZTG A;  4EMH A;  1PYS B;  4XEO A;  5GAM f;  3HY0 A;  1B7Y A;  4UP9 A;  4M78 E;  3RUX A;  4PNO A;  4AH6 A;  1SRY A;  1LOJ A;  4C92 C;  4LNS A;  3QHS A;  12AS A;  4M78 A;  2DKG A;  2AMC A;  4YCV A;  4QVD A;  2ZZE A;  5C51 B;  4TQD A;  3IG2 A;  3IKL A;  1E1T A;  1NJ8 A;  2EL9 A;  3LSS A;  2RHQ A;  2ZZG A;  4F7U E;  3PCO B;  2VXF A;  4C92 D;  1X54 A;  1GGM A;  3JB9 D;  4C92 G;  3INZ A;  5I21 A;  3RL6 A;  3TUP A;  3VQX A;  2E41 A;  4M75 E;  2AKW B;  3PGG A;  3M4P A;  1U1T A;  4M7A A;  4KR3 A;  4PJO A;  4C8Q E;  3JB9 H;  1NJ6 A;  4C92 B;  1G5H A;  1I5L A;  2ZT7 A;  4UP8 A;  3L1A A;  2RD1 A;  4C8Q A;  4P3O A;  1WU7 A;  4K88 A;  4O2D A;  1I8F A;  4H2T A;  3IAL A;  4J6Y A;  4HA8 A;  1X55 A;  1M8V A;  4YRE A;  1M5Q 1;  4RQE A;  1EFW A;  5LJ3 f;  1WNL A;  1QF6 A;  4HWP A;  3PCO A;  1Y96 B;  2Q7H A;  3BW1 A;  5GAN 7;  1MGQ A;  1BBW A;  4YRP A;  1B34 B;  4P72 C;  4HVC A;  2IY5 B;  2ZT8 A;  3VQW A;  1YFS A;  2ALY A;  3E9I A;  4C92 A;  4H2U A;  4XU0 A;  4XTU A;  1BIB A;  1EVL A;  2ART A;  4P75 A;  4YRG A;  4M7D C;  4OLF A;  1U1S A;  3JCM Q;  3LC0 A;  5HGQ A;  5LJ5 e;  4YRL A;  3A74 A;  5GAN 3;  3HXW A;  3RES A;  1VQZ A;  4M7D D;  2PMF A;  4J15 A;  4M7D G;  4P3P A;  4BW9 A;  3MEY A;  3JCM g;  4ZTZ B;  4Q6G A;  4M7A F;  4PJO F;  4K86 A;  4P73 C;  4M7D B;  1G51 A;  3L4G B;  1B34 A;  3SWN C;  4H2S A;  5GAM d;  4YRO A;  3JCM f;  2IY5 A;  3EFR A;  2PME A;  1W66 A;  4A54 A;  2RHS B;  1B8A A;  1EQR A;  3JB9 I;  2E5A A;  3L2Z A;  4DPG A;  3QTC A;  1YCY A;  5GAM e;  3BJU A;  2DVE A;  3ERR A;  4TWA A;  4M78 D;  5GAN h;  4P71 C;  4HWO A;  4M77 E;  2HNI A;  3SWN B;  1B7Y B;  3QUI A;  1USY C;  4WF2 A;  2CJA A;  4P72 A;  3TEH B;  4CS4 A;  1HTT A;  1X01 A;  2VXE A;  3JCM V;  2G4C A;  1ASZ A;  3NET A;  4HWS A;  3BY7 A;  5KNN A;  4M75 C;  3LSQ A;  3EFS A;  2Q7E A;  4M78 B;  4C92 F;  4YRN A;  1NJ1 A;  4XU3 A;  5GAO r;  3RAC A;  5ELO A;  5GMK j;  4M7A D;  4F7U G;  4G84 A;  4M7D A;  4H2X A;  2CGH A;  2DQ0 A;  4M75 D;  1J5W A;  1KMN A;  2CIM A;  5GMK m;  4M75 G;  3V8J A;  1WLE A;  3V7S A;  2RHS A;  4C8Q D;  4F7U B;  3A7U A;  1LJO A;  2Q7G A;  3REX A;  4XQ3 A;  5LJ3 d;  4M75 B;  1IL2 A;  1E22 A;  4EMG A;  2ZR2 A;  4RQF A;  3NEM A;  4C8Q B;  4P73 A;  3TEH A;  3SWN A;  2DZC A;  2ARS A;  3HFZ B;  3BDU A;  5LJ3 e;  5C52 B;  3HY1 A;  2ZR3 A;  4P75 C;  4YRF A;  5GMK e;  5GAN 6;  4YCU A;  2YLB A;  1ADJ A;  2DU7 A;  5GMK l;  4NOY A;  4P71 A;  4TVW A;  2CJB A;  1ADY A;  1USY A;  4F7U A;  3RKY A;  5GAO p;  2E1H A;  4N0A C;  4HT9 A;  2ALY B;  3KFU A;  2DTO A;  4UPA A;  4M75 A;  4TVA A;  2ZNI A;  1NJ5 A;  4H02 A;  1JBM A;  4K87 A;  2Q5I A;  5LJ3 g;  2I4M A;  4M7D F;  1WPY A;  3HFZ A;  3JCM d;  5DY9 A;  1H4S A;  3JCM X;  4PG3 A;  2DZ9 A;  5E3I A;  2ODR C;  3M4G A;  1HC7 A;  2YHT A;  5GAO m;  1KMM A;  3PZC A;  4ZTU B;  3JCM e;  2QHS A;  4YCW A;  3RKW A;  4YPF A;  2RA2 A;  3HXX A;  4JRI A;  3HXY A;  1E1O A;  5F5W A;  2DXU A;  4WJ4 A;  2ODR D;  2ARU A;  2J3M A;  4M77 C;  4YDQ A;  3UGQ A;  3FIF A;  1N9R A;  1ATI A;  4RCB A;  1WQW A;  4M78 F;  1NNH A;  1X56 A;  4L87 A;  4JRK A;  3HFV A;  3QSU A;  3DSQ A;  4M77 G;  2VC8 A;  1LNX A;  1JRI A;  3TEG A;  3VBB A;  1B70 B;  3QO7 A;  4F7U F;  4N0A A;  3IKM B;  3P8Y A;  4M77 B;  3JB9 J;  4YRS A;  4DQ2 A;  4J6X A;  5GAO l;  2RM4 A;  4M75 F;  1EVK A;  4H2X B;  3HXV A;  3RER A;  3HRK A;  4C8Q F;  4EMK A;  2QHT A;  2ZNJ A;  2E64 A;  3QNE A;  3JCM b;  4YYE A;  4QVC A;  2CJ9 A;  5GAN f;  2JN0 A;  3SB2 A;  4YP0 A;  5K1X A;  2ZXF A;  2I4N A;  4E51 A;  1Z7N A;  3V8L A;  5GAN 5;  2E10 A;  4TTV A;  1YFT A;  2C7I A;  2C8M A;  3MF2 A;  4NL2 A;  4P74 C;  4TQF A;  1X2G A;  1Z7M A;  1B70 A;  4RCC A;  1X2H A;  4MML A;  3A32 A;  4XTZ A;  3A5Y A;  4M77 A;  1JJC B;  3HFO A;  3RKX A;  4XTY A;  4H2Y A;  1WYD A;  1BBU A;  3RGL A;  4XTW A;  4JUV A;  4YRT A;  4JLI A;  1HK9 A;  3RF1 A;  2ZIN A;  4Y91 A;  2DJZ A;  2ZZF A;  3UGT A;  4TVA B;  5GAN 8;  4YRC A;  2EJG A;  1E24 A;  5GAO q;  4KQE A;  2ZGW A;  2RB6 A;  4XEM A;  5LJ5 h;  2DU5 A;  3VU3 C;  3A5Z A;  1SER A;  1EIY B;  2DXT A;  1C0A A;  2ZT6 A;  1KQ1 A;  1JJC A;  3JCM W;  2E3C A;  2P5I A;  1YB3 A;  4HWR A;  3P8T A;  4X5O A;  2P0L A;  1N9W A;  4YRQ A;  4CH3 A;  1H4Q A;  3REU A;  4OP0 A;  1I4K 1;  2ZT5 A;  5GMK i;  3V8K A;  1G5I A;  4P74 A;  4PHC A;  5GAN j;  1HXD A;  2Y90 A;  1QE0 A;  4XTX A;  2ZIO A;  3A7R A;  2QHV A;  1NYR A;  3R07 A;  3HRI A;  4M77 F;  4X9C A;  5GAM h;  2I4O A;  11AS A;  5GAN 2; 
#chains in the Genus database with same CATH topology
 1GCQ A;  1K9M R;  3OYI A;  2DDZ A;  3CXC A;  1SET A;  4BWA A;  1MMN A;  1KHI A;  3CCV Q;  4HT8 A;  1K9A A;  4CH4 A;  3UDC A;  5FRN A;  4PJO E;  4YRM A;  3JB9 G;  1FWZ A;  2YUQ A;  3CMQ A;  2DA9 A;  4AFZ C;  3TQ7 P;  1T0H A;  3A31 A;  4YRR A;  1T3L A;  1TH7 A;  4OMN A;  1YHQ Q;  2EWN A;  1H4V B;  3GF5 A;  2LQN A;  1SES A;  1B76 A;  4P3N A;  3E9G A;  3HRS A;  1I0C A;  4CS2 A;  1RAD B;  2V26 A;  1NEB A;  4HCB A;  4ZN1 A;  1YN8 A;  1YCS B;  3VS1 A;  4M77 D;  2LDM A;  1Q82 R;  1H4T A;  2OI3 A;  4A4G A;  3L2V A;  5KYU B;  5LJ3 h;  2XGT A;  4PJL A;  2Y4Y A;  5LJ5 d;  4NCX A;  3G71 A;  4EX5 A;  1ZSZ A;  5GAN g;  3CBO A;  3CME Q;  2X4J A;  1LYL A;  3PNW C;  3WXM B;  1Y0M A;  4YRK A;  3VS4 A;  1AOJ A;  3CCU Q;  1KFZ A;  1N8R C;  3MF1 A;  3SHW A;  5KYX A;  1BI2 A;  3OYE A;  1OU8 A;  4LDW A;  2PQW A;  3WVD B;  4IUV A;  3M4Q A;  1SRM A;  1K1Z A;  1SKU B;  3LWH A;  3A5Z B;  2JT4 A;  3FLG A;  2LJ0 A;  4BE0 A;  1ARK A;  1FYF A;  1XNI A;  1KJW A;  3GNF B;  1TUC A;  3NTK A;  2CT4 A;  4JPB W;  1D3B B;  2KAF A;  3M4Y A;  1WJR A;  3JCM h;  2EAY A;  1X43 A;  2K79 A;  1L0W A;  3UAT A;  2EVR A;  1RIQ A;  1KQ2 A;  2MF2 A;  4M7A C;  3KBG A;  1ASY A;  1PD0 A;  2CKK A;  3OYA A;  3M0U A;  2AMC B;  1CKA A;  1D1A A;  4HVV A;  3E9F A;  2CRE A;  4J6W A;  1H3Z A;  2RHQ B;  5C6S A;  1EZZ B;  2EQJ A;  2D0N A;  4IKF A;  5IHN A;  2DQ3 A;  1JJ2 P;  4HVW A;  4M7A B;  1Y07 A;  4C8Q G;  1WLP B;  5HKC A;  1B07 A;  2ECZ A;  2EQI A;  1N27 A;  2W0Z A;  1Z9Z A;  3V7C A;  4NL3 A;  4XEO A;  5GAM f;  5CK9 A;  2XG8 D;  3HY0 A;  1B7Y A;  4FSS A;  4M78 E;  3RUX A;  1SRY A;  4OMO A;  2ZPI B;  2WSC E;  4J83 A;  3QHS A;  4JRQ A;  2DRK A;  1AHJ B;  2LX7 A;  4YCV A;  4QVD A;  2ZZE A;  3VS3 A;  4TQD A;  1M1F A;  2NUP A;  1E1T A;  1LCK A;  2MMP A;  3LSS A;  1D0Z A;  3PCO B;  3VS5 A;  2A37 A;  1XOV A;  2O01 E;  2ZZG A;  2DMO A;  5IH2 A;  1WI7 A;  3JB9 D;  3EG9 A;  3INZ A;  4C92 G;  1KC8 U;  2E41 A;  4GLK A;  2QQ9 A;  3MEU A;  1U1T A;  2OJ2 A;  4KR3 A;  1JXM A;  3VUZ A;  3HHT B;  4HCZ A;  4RTU A;  1T0J A;  4OML A;  2DBK A;  1ZBJ A;  3H8Z A;  3L1A A;  1X27 A;  2DL4 A;  4O5V A;  4C8Q A;  1WU7 A;  4H2T A;  2WSF E;  4N4G A;  2CT3 A;  2RQT A;  2JJ9 A;  1M4Z A;  1ZUY A;  4HA8 A;  2J05 A;  4RQE A;  3M55 A;  4QQG A;  1WJQ A;  2CP3 A;  4C0Z A;  2RN8 A;  4FSX A;  5IHK A;  1VA7 A;  2Q7H A;  3BW1 A;  5GAN 7;  1QWE A;  1TUG B;  4C5H A;  1G83 A;  2ESW A;  4C92 A;  2GCX A;  4XU0 A;  3OYG A;  4LVM A;  1EVL A;  2ART A;  2X51 A;  3TU4 K;  2J6O A;  3HRT A;  1WHK A;  3JCM Q;  1KQS P;  5HGQ A;  4RMO A;  2XK0 A;  3A74 A;  1VQZ A;  3J80 E;  4M7D G;  4P3P A;  4BW9 A;  3JCM g;  4ZTZ B;  4PJO F;  1VQP Q;  4R56 A;  3CCE A;  4EDU A;  1B34 A;  3SWN C;  1VIE A;  4YRO A;  2IY5 A;  1RAC B;  4DOW A;  1R0B G;  1JEG A;  4B9X A;  3L2Z A;  4AFQ C;  4RG2 A;  2DM1 A;  4PL6 A;  3AT1 B;  1NG2 A;  3BJU A;  1YJ9 Q;  4PFP A;  2ZPG B;  4P71 C;  2HDA A;  3UA7 A;  4J9F A;  3CC4 T;  4M77 E;  1KG1 A;  3SWN B;  1B7Y B;  1USY C;  2CJA A;  1IGQ A;  3TEH B;  5KE2 A;  1HTT A;  2VXE A;  3OYN A;  2AIR B;  1YBY A;  4LXC A;  4M75 C;  2Q7E A;  1NLO C;  3I55 T;  4XU3 A;  4M7D A;  1WZO A;  2DQ0 A;  5IN1 A;  5FWB A;  3LH5 A;  4M75 D;  1J5W A;  3EG9 B;  5GMK m;  2KQW A;  4C8Q D;  1TWB A;  4F7U B;  3A7U A;  3OB9 A;  2MWP A;  3D7S B;  3REX A;  3CCQ Q;  2JZ2 A;  2NUZ A;  4M75 B;  1E22 A;  3M0T A;  3HRU A;  2L5Q A;  3CCJ T;  3CCV A;  4AG1 C;  4C8Q B;  4BE2 A;  1QVF A;  1WDX A;  4KBM B;  2SEM A;  3G6E A;  3IQL A;  3UWN A;  3M54 A;  1AT1 B;  4RTX A;  4ANJ A;  2QXF A;  4YCU A;  3SFM A;  1YWP A;  3OSS C;  4NOY A;  4CC4 B;  1RAH B;  1ADY A;  1K8A R;  3QJY A;  3RKY A;  2E1H A;  1JQQ A;  1RAG B;  3TRE A;  1YJN Q;  5A0G A;  2A7Y A;  2F69 A;  1NJ5 A;  4H02 A;  4K87 A;  4PJN A;  1RL2 A;  2ABL A;  3LWI A;  2RJE A;  1MND A;  3TSW A;  1H4S A;  1VQ5 T;  2Y4X A;  4PG3 A;  4L6V 5;  4XK8 E;  2ODR C;  2K6D A;  4DA4 A;  3CME A;  1KMM A;  4MZP A;  4ZTU B;  2QHS A;  5KCO A;  1MMD A;  3OW2 P;  3CCU A;  1OX9 A;  2ODR D;  4KUL A;  4RTY A;  1ZLM A;  2A36 A;  2X35 A;  1IB8 A;  1YWO A;  2L0A A;  4M78 F;  3UA6 A;  4L87 A;  1UGQ B;  1NJI R;  4P5N A;  2FZK B;  2M0Y A;  3TEE A;  4D8D A;  2HEQ A;  1VQM Q;  3NMZ C;  1S72 Q;  1JRI A;  3RMQ A;  3VBB A;  3EG3 A;  3H0F A;  2LQ8 A;  1P92 A;  1Q7Y C;  2B8A A;  5GAO l;  4FT2 A;  1M90 C;  4HCC A;  4FU6 A;  2QHT A;  2ZNJ A;  2QYZ A;  3JCM b;  1NYF A;  4B9W A;  5HK3 A;  4DBQ A;  3OBW A;  3SB2 A;  4E51 A;  1SHG A;  5GAN 5;  2JNG A;  4TTV A;  4CC2 A;  4J9D A;  2PVG B;  2C7I A;  3GPL A;  4ATO A;  5D6W A;  4HXJ A;  3MF2 A;  1QLY A;  4NL2 A;  3CXC P;  1AVZ C;  1X2H A;  1WJS A;  2E4H A;  2DX1 A;  4IUP A;  1K0X A;  2KDS A;  2P0K A;  2EYQ A;  2VWF A;  4KRT A;  1K73 U;  4JUV A;  4BI4 A;  1V1C A;  3RF1 A;  1PSE A;  2ZIN A;  2P84 A;  5GAN 8;  1ZHI A;  3ZL7 C;  1BB9 A;  2FPE A;  1XTD A;  2RB6 A;  4FT4 A;  2D8H A;  1OPK A;  1SER A;  4N4H A;  4BDZ A;  2ZT6 A;  2PVD B;  4BDY A;  4RTV A;  4FCY A;  2SRC A;  3PMI A;  1VQP T;  4CH3 A;  1O9S A;  4LDY A;  3KUF A;  2CP2 A;  1M1G A;  3V8K A;  4J9B A;  4XTX A;  3X24 B;  1GCP A;  3A7R A;  1M1K R;  2RI5 A;  2QHV A;  2ZPB B;  4M77 F;  2ENM A;  2PUO B;  2HAX A;  2QQS A;  1GXI E;  3PMT A;  2OTL A;  2V8J A;  2I2L A;  3HTZ A;  5KCH A;  4E7I A;  1AD5 A;  3CCR A;  5C53 B;  1VQN A;  3RIR A;  1Q81 C;  2PUK B;  3JCM J;  2FYK A;  3HFN A;  1YIT A;  2FB7 A;  4E7Z A;  1VQ8 A;  2K57 A;  2X3W D;  5CAI A;  1TXQ A;  4CH6 A;  5FU6 C;  5ELN A;  1HSQ A;  1PYS A;  3QO8 A;  2ZIM A;  2ZPH B;  4PK4 A;  5CKD A;  2QAS A;  5LJ5 j;  2DIQ A;  1VQ6 T;  3HXU A;  1W1F A;  4QW2 A;  3VQY A;  5GAO n;  1N9S A;  4YRI A;  2DL8 A;  1D1B A;  4KR2 A;  2XIC A;  4TVR A;  2F2X A;  3CCM T;  1ZA2 B;  4QQ6 A;  1VQL A;  4ZGD B;  1NLP C;  2ZCE A;  2V8I A;  4C92 E;  2AKL A;  3CCS Q;  1WQ7 A;  1S1N A;  2YLC A;  1J3T A;  2DEQ A;  3H6Z A;  3HXZ A;  4WJ3 M;  3OQ5 A;  4HWT A;  2EJ9 A;  2QEX Q;  1AZE A;  2EJF A;  4BD3 A;  2MAM A;  2HZY A;  4A4H A;  2E5K A;  4CS3 A;  1KOG A;  3VUB A;  1VQ9 Q;  4AFU C;  1UGS B;  1BCM A;  2LVM A;  4C0D C;  3S3O A;  1ZX6 A;  1YJN T;  5HK0 A;  1B3Q A;  1XQH A;  2LTO A;  4Z8A A;  3OW2 S;  1VQK A;  5KYU A;  1NPR A;  3VYG A;  3CCQ A;  4XU2 A;  5FRM A;  2QHU A;  4DEY A;  3OYF A;  4M78 C;  2DXC A;  4J5Y A;  2K2V A;  1UJ0 A;  2RQU A;  2JS2 A;  4XU1 A;  3OD1 A;  3P8V A;  1SHF A;  4RDX A;  2GFA A;  2LQW A;  4OMQ A;  1PM3 A;  3QO5 A;  2HKN A;  1HYO A;  2KRM A;  3H41 A;  4M7D E;  1IRE B;  3QZ9 B;  5IXF A;  1AWW A;  1YI2 A;  3JB9 F;  1FYN A;  2I0N A;  4ZTJ A;  1D1C A;  4M7A G;  2O4X B;  1X6O A;  1X6B A;  3QO3 A;  5CO7 A;  5KH6 A;  1I81 A;  1D3B A;  4DBH A;  4ZGJ B;  2DTH A;  3CEY A;  1KD1 R;  3HSB A;  2DL7 A;  2L3P A;  4B6M A;  2ZTG A;  1FXX A;  3C94 A;  4EMH A;  1PYS B;  3CXC S;  2OX7 A;  4LN2 A;  4LNP A;  4C5G A;  1X69 A;  2K3B A;  1OQK A;  2VGM A;  5A0L A;  1VQO T;  2DER A;  5CQX A;  5GJW B;  1UHF A;  2RMO A;  2CYZ B;  4LDU A;  2AMC A;  5C51 B;  1HJD A;  5KE3 A;  3IG2 A;  3IKL A;  4LVJ A;  2RHQ A;  3NTI A;  4BI8 B;  2FZG B;  2CH4 W;  1GFD A;  4M7A A;  2KRO A;  2XDB A;  1LVK A;  2K4Y A;  1VQ7 A;  2M51 A;  1VQM A;  1I5L A;  2ZT7 A;  3G71 T;  3CC4 Q;  1G8X A;  2DJQ A;  4IUR A;  4O2D A;  1I8F A;  1VQ4 A;  2LZ6 B;  2PTK A;  2ZPF B;  4OB0 B;  3CMA Q;  1X55 A;  1TS9 A;  1M8V A;  3SDZ A;  4JLG A;  1EFW A;  1WA7 A;  3I55 Q;  5LJ3 f;  1WNL A;  2JM8 A;  2BE9 B;  2O2O A;  3OS1 A;  1NJI U;  5KYW B;  4F16 A;  4E7J A;  1QF6 A;  1M30 A;  3PCO A;  1BBZ A;  1PNJ A;  2IG0 A;  2L8D A;  1G3W A;  3X28 B;  4HVC A;  4X34 A;  2KXD A;  3VQW A;  1SPK A;  4BI3 A;  2ALY A;  2DVJ A;  2FPF A;  4H2U A;  3EG2 A;  4P75 A;  3CCJ Q;  2YSQ A;  4KGV B;  1Q86 U;  5LJ5 e;  1R0C B;  2AK5 A;  3M9Q A;  3MEV A;  1C0M A;  4DBF A;  1Y71 A;  2QI2 A;  4ESR A;  3NHN A;  4LVI A;  2BE7 D;  3R6O A;  4BE1 A;  2KYM A;  4P73 C;  1GBQ A;  3E19 A;  2HSE B;  3JCM f;  1TG0 A;  3NFC A;  3EFR A;  4J9H A;  1KC8 C;  4FW1 A;  2EGE A;  2KR3 A;  1YCY A;  4KUI A;  2DVE A;  3LW5 E;  1FMK A;  1K4U S;  1UGV A;  1G3S A;  2HNI A;  1VQ5 Q;  2QQR A;  2LC4 A;  5C0M A;  3M57 A;  3BY7 A;  1U5S A;  1M8M A;  2V1Q A;  2KEA A;  3LSQ A;  4C92 F;  3GNG A;  3M5A A;  5GAO r;  2BZX A;  4M7A D;  4F7U G;  4G84 A;  5DLO A;  1W70 A;  2A28 A;  4AMC A;  1K73 R;  1Z9Q A;  1KMN A;  2EYZ A;  3P8H A;  4M75 G;  1WLE A;  1X75 C;  2BUD A;  2G3R A;  1UEC A;  3CCS T;  1IL2 A;  2ZR2 A;  5KYY A;  2QEX T;  3EGU A;  3X26 B;  1VQ9 T;  1YJW A;  3TEH A;  3SWN A;  2JM9 A;  2ZAE A;  1M1K U;  3HY1 A;  2AZS A;  2X9H A;  2ZR3 A;  4P75 C;  4Q5W A;  1UHC A;  1QCN A;  3PIP A;  5GMK l;  3M59 A;  4P71 A;  1AWO A;  2J6F A;  3P8D A;  3QDR B;  1USY A;  4RTZ A;  4F7U A;  4N0A C;  4PFZ A;  2ALY B;  4M75 A;  4TVA A;  3OYH A;  5I2S A;  2FZC B;  1PCX A;  1W6X A;  4PJM A;  1JU5 C;  3EH1 A;  3X25 B;  2ED1 A;  5LJ3 g;  2I4M A;  4M7D F;  5L8R E;  3NPF A;  1MNE A;  3QWY A;  2YXY A;  2IPO B;  5DY9 A;  4PFO A;  3ER0 A;  1W4S A;  4E47 A;  3M4G A;  2JTE A;  2JTF A;  2YHT A;  2MCN A;  2RPN A;  4LUD A;  3RKW A;  3HXX A;  4JRI A;  2DXU A;  2J3M A;  1AWJ A;  1XJW B;  2DIG A;  3FIF A;  3OYC A;  3CD6 T;  1N9R A;  4RCB A;  1BYM A;  1X56 A;  1MV3 A;  2QAZ A;  1G5V A;  1SSH A;  3REB B;  3TSZ A;  3QBY A;  3CC7 Q;  3L2U A;  3FEO A;  3TEG A;  2R57 A;  3P8Y A;  3IKM B;  3O5Z A;  1YNZ A;  2EW3 A;  2R5M A;  3FJ5 A;  2IIM A;  4YRS A;  1OU9 A;  4VUB A;  3I56 T;  1MHN A;  4FL6 A;  5IAY A;  2K2M A;  4Z02 A;  3WVE B;  3HXV A;  3RER A;  2E70 A;  2VAS A;  1K9M C;  3EHR A;  3ULR B;  2EQM A;  2LJ1 A;  3CC2 T;  4QVC A;  3QJ6 A;  4UC4 A;  5M9O A;  2JN0 A;  3OYB A;  1NBE B;  5K1X A;  3OMC A;  2VKN A;  2F2W A;  1Z7N A;  3V8L A;  2QDL A;  1G3T A;  3LX7 A;  4KGX B;  4LD9 K;  5KYY B;  1YFT A;  2L89 A;  4P74 C;  2L2P A;  4TQF A;  1Z7M A;  2MYS A;  1V76 A;  1YP5 A;  2XMF A;  1QCF A;  1EFN A;  4RCC A;  4D6W A;  3CMA T;  4XTZ A;  3A5Y A;  4OGE A;  3RKX A;  3C4S A;  1VOM A;  1UB4 A;  1BBU A;  1X6G A;  4JJC A;  2GQI A;  2AKK A;  2HL3 A;  3MEW A;  3SD4 A;  1Q82 C;  1QVF S;  2WSE E;  1VQ6 Q;  4IIM A;  2CUD A;  2IVW A;  2DLP A;  4Y91 A;  3UGT A;  4TVA B;  3G4S Q;  1X2K A;  1KD1 U;  4MZT A;  1E24 A;  4KQE A;  2ZGW A;  3CCM Q;  5LJ5 h;  2DU5 A;  4PLL A;  4E7H A;  3OMG A;  3L2R A;  5D6Y A;  2E12 A;  1EIY B;  2OTJ Q;  2PU9 B;  5AYF A;  3T9N A;  3U23 A;  2FRY A;  1I5O B;  3PE0 A;  1YB3 A;  1YHQ A;  3CC4 A;  3ME9 A;  4OP0 A;  1I4K 1;  2XHC A;  1H8K A;  4GBQ A;  5GMK i;  1QKX A;  5EC7 A;  1F1B B;  2Y90 A;  4RKU E;  4IIO A;  2ZIO A;  2LT1 A;  1LPL A;  2D1X A;  1NYR A;  1PKS A;  5FRO A;  4II1 A;  11AS A;  5GAN 2;  3BE3 A;  3WQZ A;  4OF1 A;  1UDL A;  3MCA B;  3CCL T;  4TVY A;  3CBP A;  2YRV A;  4M7A E;  4E7S A;  2KI7 A;  1WX6 A;  1VYV A;  5GAN d;  2COZ A;  5A0D A;  4PLI A;  2CZ0 B;  2NYS A;  4PKC C;  4Y92 A;  4OB2 B;  3CPF A;  1WYX A;  3M0S A;  2DTI A;  4J7F A;  5GAN e;  3MHX A;  1MUZ A;  1G2B A;  2QA4 T;  4BAC A;  1K73 C;  1DJ7 B;  4MDX A;  3NGP A;  3KXT A;  1NZ9 A;  3EGD A;  1SEM A;  3FDR A;  1PWT A;  4J9E A;  1Y7X A;  1UGP B;  2RQR A;  4IUT A;  2Q5H A;  1WHL A;  1QVG A;  2J3L A;  4R55 A;  2KRN A;  2DL5 A;  2HL5 C;  4XTV A;  3JCM c;  2CP7 A;  3EG0 A;  1OI1 A;  2COW A;  2YDL A;  2XKO C;  1JJ2 A;  2AKW A;  2KYB A;  4MMK A;  3BFM A;  3ICA A;  2B86 A;  3C0C A;  4JJD A;  5GAM j;  1Q86 R;  2NS6 A;  2E65 A;  2CS7 A;  4KGZ B;  1BCO A;  2CSQ A;  1VQO Q;  2EKH A;  1YFR A;  2I4L A;  7AT1 B;  3DKM A;  1SSF A;  5I2M A;  3VV0 A;  1VYU A;  2X4X A;  3MQZ A;  3RBB B;  1RAE B;  2FO0 A;  4RMF A;  2PZ1 A;  3QG1 A;  2CZ1 B;  3NEN A;  3G71 Q;  1RAA B;  4X9D A;  2EPD A;  5LJ5 g;  4UP7 A;  1PSF A;  1WHH A;  5DLQ E;  3I7F A;  2DK3 A;  2V1R A;  2RHX A;  4M78 G;  2LCC A;  4PJO C;  2DEU A;  4L59 A;  4GLM A;  2KVQ G;  2XTI A;  1H64 1;  1TUD A;  4LDX A;  2R58 A;  4CRI A;  4H2W A;  4PJO D;  2K9G A;  1GRI A;  3L4G A;  3GOX A;  2GQV A;  4OMP A;  3CC7 T;  2RJD A;  4H2V A;  2BZ8 A;  2OTL T;  1QKW A;  2P0P A;  3W3S A;  3OBY A;  4PJO B;  1UTI A;  1IHV A;  1OOT A;  1ZUU A;  3QYH B;  3CCR T;  1PD1 A;  3OYK A;  2K5F A;  3UH0 A;  4IUU A;  4J9G A;  1VQ8 T;  4J7I A;  4OMM A;  4UP9 A;  3ZBD A;  4AH6 A;  4LDV A;  4PNO A;  4LNS A;  3EGD B;  4M78 A;  5CKH A;  2DKG A;  1HD3 A;  1W2B A;  1NJ8 A;  1BKB A;  1OPL A;  4F7U E;  2VXF A;  1X54 A;  1N8R R;  2O4X A;  1K0S A;  4E6R A;  1QQJ A;  4X1V A;  2QK0 A;  1BI3 A;  3TUP A;  1BU1 A;  4M75 E;  2EGA A;  2AKW B;  3PGG A;  3M4P A;  2FRW A;  2JVV A;  4C8Q E;  3JB9 H;  1NJ6 A;  3ZEH A;  8AT1 B;  1M3C A;  1NYG A;  1YIJ T;  3I5R A;  4UP8 A;  3QPH A;  2HKQ B;  2RD1 A;  3J7A F;  4FYX B;  4P3O A;  2VUB A;  2ROL A;  2FL7 A;  4LD6 A;  1RAI B;  3IAL A;  4J6Y A;  4YRE A;  1VQP A;  1M5Q 1;  3VS0 A;  1PRL C;  5IXB A;  1RI9 A;  3QKJ A;  3CQT A;  3L42 A;  3G4S T;  5CKF A;  1AWX A;  1OX8 A;  5FU6 B;  2GTJ A;  1MGQ A;  2QTV A;  4CC3 A;  4P72 C;  2VVK A;  4J9I A;  2DD5 A;  6AT1 B;  2OTJ T;  3DLM A;  2ZT8 A;  1VQK T;  1YFS A;  3E9I A;  1ABQ A;  1YJ9 A;  3LYI A;  3J81 E;  3JSC A;  1M9S A;  3LC0 A;  3M56 A;  4FYW B;  3S3N A;  3QII A;  4YRL A;  5GAN 3;  2LCL A;  3HXW A;  1I07 A;  5LL6 S;  2K3Y A;  1EX4 A;  2PMF A;  2RJC A;  4J15 A;  1K8A C;  3MEY A;  4M7A F;  5KYW A;  3EH2 A;  3L2W A;  1OZ2 A;  3CBM A;  3L4G B;  3P8B B;  3EFO A;  2QQA A;  4H2S A;  5GAM d;  4C0D B;  2HQE A;  1UEB A;  4A54 A;  1RI0 A;  2RHS B;  2A0F B;  1B8A A;  3JB9 I;  3GBQ A;  2E5A A;  2A3L A;  4DPG A;  3VKI A;  3QTC A;  4ORZ A;  3A8G B;  3CCM A;  5GAM e;  4E7L A;  1RLQ C;  3ERR A;  4TWA A;  4M78 D;  5GAN h;  1BK2 A;  4WF2 A;  3H0I A;  4CS4 A;  1X01 A;  2G4C A;  2ZZD A;  5J26 A;  3EFS A;  4M78 B;  4FW2 A;  4YRN A;  1NJ1 A;  2PVO B;  3RAC A;  5HY6 A;  2CGH A;  2RJF A;  1R77 A;  1OEB A;  1NJI C;  3CCE Q;  1BI0 A;  2CIM A;  1YJN A;  2RF0 A;  4FIB A;  3CD6 Q;  1LJO A;  2Q7G A;  5A2Q E;  2QGG A;  1PKT A;  3CPW A;  1QWF A;  4RQF A;  3NEM A;  2E3H A;  2J06 A;  3TVT A;  1GL5 A;  4P73 A;  2H3J A;  3MPU B;  2DL3 A;  2CZ6 B;  1VQ7 T;  3M53 A;  3HFZ B;  1Q86 C;  3BDU A;  3PFS A;  1Q95 G;  3I56 Q;  1VQ4 T;  4HCK A;  4QT7 A;  2E5Q A;  4YRF A;  2KNB B;  1U8R A;  5GMK e;  5GAN 6;  3RR6 A;  4CI0 C;  3QWX X;  2DPP B;  2DU7 A;  2NLU A;  5CKB A;  3CC2 Q;  4TVW A;  2HQH A;  2LT4 A;  2CJB A;  1ZSG A;  3TCJ A;  4C0G A;  2DYB A;  2RK1 A;  1M2V B;  2HD0 A;  3KFU A;  2DTO A;  3MEA A;  4UPA A;  2EYY A;  3SEM A;  4OVA A;  1S72 A;  1JBM A;  2YUP A;  2Q5I A;  1PC0 A;  1WXB A;  1WPY A;  2EKO A;  1WHM A;  3A1P A;  2BKD N;  2DYI A;  2JUF A;  2KY9 A;  3DB4 A;  4JZ3 A;  4ELY C;  2DZ9 A;  3G6E Q;  1UJY A;  1YFN A;  4YCW A;  1CSK A;  4YPF A;  2RA2 A;  3EFO B;  4KH1 B;  3HXY A;  5F5W A;  4WJ4 A;  2H3E B;  1VQO A;  1RAF B;  2YT6 A;  1NM7 A;  4M77 C;  3ZFJ A;  1Y57 A;  2C0T A;  2LX9 A;  1ATI A;  1WQW A;  4NS5 A;  4JRK A;  2GGR A;  4HVU A;  3DLL A;  5IHI A;  2CSI A;  3DSQ A;  1QVF P;  1EIF A;  3M0P A;  2XI9 A;  2XU8 A;  1LNX A;  3THK A;  1B70 B;  3QO7 A;  4F7U F;  4E7K A;  4N0A A;  1WHJ A;  2X3X D;  4M77 B;  4ZTF A;  3JB9 J;  4J6X A;  4A4F A;  1M1K C;  2O9S A;  4M75 F;  3OY9 A;  1EVK A;  3HTR A;  2F5T X;  3HP9 A;  1SF9 A;  3HRK A;  4C8Q F;  2M02 A;  3PIO A;  4EMK A;  2W10 A;  3BDL A;  4KUD K;  2EYW A;  4O6J A;  1KK7 A;  2I4N A;  4EIK A;  4LUE A;  2CUB A;  2KRS A;  2C8M A;  3CCL Q;  2DET A;  2EBP A;  3GP8 A;  4PJJ A;  2LJ3 A;  3M0R A;  5CQY A;  5I22 A;  2MWO A;  1X2G A;  1KIK A;  1K76 A;  2RO0 A;  1I1J A;  1YJW T;  1JJC B;  2ED0 A;  1OV3 A;  1QCO A;  4XTY A;  4DOV A;  4H2Y A;  1GCQ C;  1WYD A;  4E2F B;  4C5E A;  3QXE B;  4HKE A;  1PRM C;  3A8L B;  3C12 A;  4WCI A;  5ECA A;  5J3B A;  2QA4 Q;  1JXO A;  4MZM A;  1M3B A;  2ZZF A;  2JOY A;  4YRC A;  3MKD A;  2CP6 A;  5IT9 E;  4XEM A;  1WIE A;  8ATC B;  2O88 A;  1QVP A;  1QVG P;  1IGU A;  5D7U A;  2EQU A;  5KYN A;  4OB3 B;  1TOV A;  2L3R A;  2E3C A;  2OAU A;  2P5I A;  1QP3 A;  1GFC A;  4X5O A;  2YUO A;  2E6N A;  4YRQ A;  3REU A;  3A8M B;  1N8R U;  2O9V A;  2ZCF B;  1U06 A;  1RLP C;  2KT8 A;  1G5I A;  4P74 A;  4PHC A;  1D0X A;  5GAN j;  1NE8 A;  1HXD A;  5FWC A;  5GJV B;  3EGX A;  1Q7Y R;  1ACM B;  3N5B B;  1OYX A;  1ZSZ C;  3HKS A;  1NPP A;  5GAM h;  1M90 R;  2KGT A;  2I4O A;  2E6Z A;  3RL6 A;  2DE0 X;  2CP5 A;  2MK5 A;  3AHU A;  4EMK C;  2QG9 B;  1OZ3 A;  1UUE A;  1NJ2 A;  4A63 B;  3HL8 A;  3CCS A;  1EIY A;  3A8O B;  4K11 A;  1ZUK A;  1BIA A;  3A7A A;  3GIB A;  2QEX A;  2CDT A;  4QVZ A;  2LNH B;  1VQ9 A;  1N5Z A;  4DEX A;  1ZSZ B;  3MET A;  3GLX A;  3E9H A;  1UGR B;  3UPU A;  2DFU A;  4EMK B;  3VQV A;  3CCE T;  2HMA A;  3O8V A;  4LE9 A;  5I11 A;  4QKU A;  9ATC B;  2NWM A;  3M0Q A;  5KYX B;  3G1Z A;  4A53 A;  1KD1 C;  2QTX A;  2OTL Q;  4D8K A;  2YUN A;  4ZIB A;  2JTM A;  4RTT A;  1M2O A;  4JDS A;  3CCR Q;  1VQN Q;  3VRY A;  4M4Z A;  4IUQ A;  5GMK h;  1YIT Q;  3QDF A;  1VQ8 Q;  1JB0 E;  4J8O A;  3H9N A;  2JS0 A;  3UFG A;  2JMC A;  3RNJ A;  2LCS A;  4FM4 B;  2XDP A;  1VIF A;  4JZ4 A;  5K1P A;  4JS5 A;  4V2S A;  2FEI A;  1W2B P;  4FYY B;  4Q15 A;  1Y96 A;  4ZN3 A;  1WHG A;  2M0O A;  1M3A A;  3CCV T;  3CD6 A;  2GF7 A;  2YWW A;  1VQL Q;  3MP8 A;  4G85 A;  1T3S A;  3MP6 A;  1NYQ A;  2RHY A;  5GAN 4;  3FJP A;  2KMT A;  4JJB A;  1YIJ Q;  3A98 A;  2RK2 A;  3G6E T;  3JCM P;  4WI1 A;  1EOV A;  1IRX A;  2FVU A;  3V7R A;  2KSS A;  1CKB A;  2J6K A;  1RAB B;  2ROT A;  1E6H A;  1Q81 R;  4KT0 E;  1YHQ T;  3EG1 A;  3OA6 A;  4EO4 A;  3EGX B;  5LJ5 f;  1X2Q A;  4JJN K;  3I56 A;  4CH5 A;  1PG5 B;  1SRL A;  1V29 B;  1ZQ1 A;  5LJ3 j;  2HQX A;  2YRD A;  3C95 A;  1AEY A;  2L3S A;  2NUP B;  4C8Q C;  2FHD A;  3CC2 A;  3KFV A;  1UE9 A;  2D9T A;  3NEL A;  2GBQ A;  4PJO G;  1E7O A;  2GFU A;  1VQK Q;  4YRJ A;  1ABO A;  1BI1 A;  3E2U A;  1TTH B;  5FLX E;  5GAM g;  5CKE A;  2J7I A;  3LGL A;  2ZPE B;  1A0N B;  3FB9 A;  4Y28 E;  1YGB A;  1JO8 A;  3CMA A;  4BUG A;  3CME T;  2VB6 A;  3JAM E;  1WFW A;  1MMA A;  3I55 A;  3CCU T;  4ME7 A;  1LOJ A;  4C92 C;  1VUB A;  12AS A;  2CZ7 B;  1GBR A;  3OYY A;  3OSV A;  4ZGE B;  1K9M U;  1UFF A;  1C1A A;  2EL9 A;  2ATC B;  4BB7 A;  4C92 D;  1GGM A;  3NTH A;  3EAE A;  4JRP A;  1YI2 Q;  5I21 A;  3A8H B;  2M1H A;  3VQX A;  2GNC A;  3CCJ A;  1MMG A;  4PJO A;  3MJX A;  3E1S A;  4C92 B;  1G5H A;  4A4K A;  1U3O A;  2KBT A;  3LLR A;  4K88 A;  2AHJ B;  1QVG S;  4ELZ C;  2EYX A;  2P4T A;  2XID A;  1JJ2 S;  2OAW A;  2EGC A;  5L23 A;  4F17 A;  2LNV A;  2QGF B;  3JV3 A;  2RHZ A;  1Q82 U;  4HWP A;  3VYH B;  3UF4 A;  1Y96 B;  2K5I A;  4YTL A;  2VV5 A;  1BBW A;  1M27 C;  2X4Y A;  3FRN A;  4YRP A;  1B34 B;  2O31 A;  1G3Y A;  2IY5 B;  3Q1J A;  1IHW A;  3VJP A;  3VS2 A;  1IXD A;  5D6X A;  2CP0 A;  4XTU A;  1BIB A;  4YRG A;  3CCL A;  4M7D C;  4OLF A;  2BZY A;  1U1S A;  1VQ5 A;  3CPW P;  2L3Q A;  1VQ7 Q;  5AT1 B;  2C06 A;  2RHU A;  3I9Q A;  2AZV A;  3RES A;  4M7D D;  4MDW A;  4L5G A;  1VQ4 Q;  4Q6G A;  3PT9 A;  1KSW A;  4K86 A;  2G6F X;  4M7D B;  1G51 A;  2QA4 A;  2LMJ A;  2K3X A;  3R6N A;  2H8H A;  2PME A;  2P0Q A;  2YRC A;  1FMW A;  2DIL A;  4AFS C;  2C0O A;  1W66 A;  2XDD A;  3QYG B;  1EQR A;  3EHQ A;  4F04 B;  2M16 A;  2JW4 A;  2HBP A;  3ASK A;  2VGN A;  5CCA A;  1D0Y A;  2KT1 A;  2XD0 A;  1WXU A;  4GY5 A;  4HWO A;  3QUI A;  2WAC A;  4P72 A;  2V8K A;  3JCM V;  1ASZ A;  3NET A;  4HWS A;  5FW9 A;  2FG0 A;  5KNN A;  2HBW A;  1QP2 A;  2LQK A;  4AG2 C;  2D8J A;  5GMK j;  5ELO A;  2BIV A;  4H2X A;  1PHT A;  3OS2 A;  4ZNX A;  1KQS S;  5CVI A;  1E6G A;  2D0Q B;  2DD4 A;  2F1L A;  4LVK A;  3LH0 A;  3V8J A;  3V7S A;  2RHS A;  4AT1 B;  4XQ3 A;  2LRQ A;  1VQN T;  2E3I A;  5LJ3 d;  1W2B S;  4EMG A;  1YIT T;  2Z0W A;  1KQS A;  1IO6 A;  2DZC A;  2ARS A;  1Q7Y U;  2C0I A;  2RI2 A;  2RI3 A;  3DB3 A;  5LJ3 e;  1QW1 A;  3OYM A;  5C52 B;  1O75 A;  2KXC A;  1M90 U;  3RMS A;  3PTA A;  3X20 B;  1ZBX A;  1C6V X;  2DO3 A;  2MI6 A;  3M58 A;  2YLB A;  1ADJ A;  1AZG B;  2COY A;  2K5L A;  4DBR A;  5GAO p;  4R0K A;  1VQL T;  4HT9 A;  5FU7 C;  3QZ5 B;  2ZNI A;  2JMA A;  3S6W A;  2JXB A;  3CC7 A;  2EIF A;  4Z88 A;  1YJ9 T;  2A08 A;  4RUG A;  3I5S A;  4FYV B;  3HFZ A;  1FMV A;  2NUT A;  3JCM d;  2HSP A;  1D09 B;  1KC8 R;  4Z89 A;  1YJW Q;  3JCM X;  2KK4 A;  2MPX C;  3REA B;  1UG1 A;  3H0H A;  1IZ6 A;  2DF6 A;  2DAQ A;  5FU7 B;  5J39 A;  5E3I A;  3PVQ A;  1HC7 A;  5GAO m;  3PZC A;  4OMF B;  3JCM e;  1R8O B;  3OS5 A;  1QMC A;  4N4I A;  1E1O A;  2ARU A;  2M9U A;  4YDQ A;  1M2V A;  4EPC A;  3UGQ A;  5HCK A;  1MV0 B;  1RUW A;  3I35 A;  4WTO B;  1NNH A;  3PVL A;  3CCQ T;  2CH4 A;  5EG2 A;  2PNI A;  3G1J A;  4J9C A;  3HFV A;  3QSU A;  4M77 G;  2VC8 A;  5DM7 R;  1WGS A;  3F70 A;  1YIJ A;  2RHI A;  4DQ2 A;  2RM4 A;  1OUL A;  2X4W A;  1VQ6 A;  4H2X B;  3RDV A;  4RG8 A;  2HCK A;  4BY6 C;  1YI2 T;  2E64 A;  3QNE A;  4YYE A;  4HT4 A;  3VRZ A;  2CJ9 A;  3G4S A;  5GAN f;  4A4E A;  1H3H A;  2EFI A;  4YP0 A;  2F5K A;  2ZXF A;  2RQW A;  4KH0 B;  2A8E A;  2E10 A;  2QDY B;  3VS7 A;  1FX7 A;  3MO8 A;  3MP1 A;  4LVL A;  1Q81 U;  2RQV A;  2OTJ A;  3JRZ A;  4BY6 B;  2R5A A;  1B70 A;  4MML A;  3A32 A;  4M77 A;  3LGF A;  2GTO A;  4XAX B;  1NEG A;  3HFO A;  2K7A A;  1SG5 A;  4JS4 A;  1TU0 B;  3OYJ A;  3CPW S;  1B7T A;  3RGL A;  3OW2 A;  4OB1 B;  4XTW A;  1H92 A;  4YRT A;  4JLI A;  3HPW A;  2P4R A;  4RTW A;  5CR2 A;  1HK9 A;  2AT1 B;  4C5I A;  1VYT A;  2EQK A;  2MIO A;  3VS6 A;  2DJZ A;  2VYT A;  2DBM A;  4C0F A;  2EJG A;  3UT1 A;  4CC7 A;  5GAO q;  1N6A A;  2DRM A;  1WXT A;  3VU3 C;  3A5Z A;  1VQM T;  2NUT B;  1TSF A;  2DXB A;  3G7Z A;  1S72 T;  1ZA1 B;  2DXT A;  1C0A A;  1KQ1 A;  1JJC A;  3JCM W;  3FC3 A;  2D6F A;  2MOX A;  1KHC A;  2RNA A;  3URG A;  3P8T A;  4HWR A;  3OYD A;  2P0L A;  1N9W A;  3OS0 A;  1H4Q A;  2DNU A;  3L2Q A;  2RH2 A;  2ZT5 A;  2FPD A;  2LP5 A;  5CIU A;  2QQB A;  4OGC A;  1K8A U;  1QE0 A;  3OYL A;  3S3M A;  2F2V A;  4QQD A;  3R07 A;  2KE9 A;  3HRI A;  4F14 A;  4X9C A;  2BTT A; 
#chains in the Genus database with same CATH homology
 3OYI A;  2DDZ A;  3CXC A;  1SET A;  4BWA A;  1KHI A;  4HT8 A;  4CH4 A;  3UDC A;  5FRN A;  4PJO E;  4YRM A;  3JB9 G;  1FWZ A;  3CMQ A;  3A31 A;  4YRR A;  1TH7 A;  2EWN A;  1H4V B;  3GF5 A;  1SES A;  1B76 A;  4P3N A;  3E9G A;  3HRS A;  4CS2 A;  4HCB A;  4ZN1 A;  4M77 D;  2LDM A;  1H4T A;  4A4G A;  3L2V A;  5LJ3 h;  2XGT A;  2Y4Y A;  5LJ5 d;  4NCX A;  3G71 A;  4EX5 A;  5GAN g;  3CBO A;  2X4J A;  1LYL A;  3PNW C;  3WXM B;  4YRK A;  1N8R C;  3MF1 A;  1BI2 A;  3OYE A;  4LDW A;  2PQW A;  3WVD B;  4IUV A;  3M4Q A;  3LWH A;  3A5Z B;  3FLG A;  4BE0 A;  1FYF A;  1XNI A;  3GNF B;  3NTK A;  1D3B B;  2KAF A;  3M4Y A;  1WJR A;  3JCM h;  2EAY A;  1L0W A;  1RIQ A;  1KQ2 A;  2MF2 A;  4M7A C;  3KBG A;  1ASY A;  2CKK A;  3OYA A;  2AMC B;  3E9F A;  4J6W A;  1H3Z A;  2RHQ B;  5C6S A;  2EQJ A;  4IKF A;  2DQ3 A;  4M7A B;  1Y07 A;  4C8Q G;  5HKC A;  1N27 A;  3V7C A;  4NL3 A;  4XEO A;  5GAM f;  5CK9 A;  2XG8 D;  3HY0 A;  1B7Y A;  4M78 E;  3RUX A;  1SRY A;  2ZPI B;  2WSC E;  4J83 A;  3QHS A;  4JRQ A;  1AHJ B;  4YCV A;  4QVD A;  2ZZE A;  4TQD A;  1M1F A;  1E1T A;  2MMP A;  3LSS A;  3PCO B;  2ZZG A;  2O01 E;  1XOV A;  3JB9 D;  4C92 G;  3INZ A;  1KC8 U;  2E41 A;  4GLK A;  2QQ9 A;  3MEU A;  1U1T A;  4KR3 A;  3VUZ A;  3HHT B;  4HCZ A;  3H8Z A;  3L1A A;  4C8Q A;  4O5V A;  1WU7 A;  4H2T A;  2WSF E;  4N4G A;  1M4Z A;  4HA8 A;  4RQE A;  3M55 A;  4QQG A;  1WJQ A;  4C0Z A;  4FSX A;  2Q7H A;  3BW1 A;  5GAN 7;  4C5H A;  4C92 A;  2GCX A;  4XU0 A;  3OYG A;  4LVM A;  1EVL A;  2ART A;  3TU4 K;  3HRT A;  3JCM Q;  5HGQ A;  4RMO A;  2XK0 A;  3A74 A;  1VQZ A;  3J80 E;  4M7D G;  4P3P A;  4BW9 A;  3JCM g;  4ZTZ B;  4PJO F;  4R56 A;  3CCE A;  4EDU A;  1B34 A;  3SWN C;  1VIE A;  4YRO A;  2IY5 A;  4DOW A;  4B9X A;  3L2Z A;  4RG2 A;  4PL6 A;  3BJU A;  2ZPG B;  4P71 C;  3CC4 T;  4M77 E;  1KG1 A;  3SWN B;  1B7Y B;  1USY C;  2CJA A;  3TEH B;  5KE2 A;  1HTT A;  2VXE A;  3OYN A;  1YBY A;  4M75 C;  2Q7E A;  3I55 T;  4XU3 A;  4M7D A;  2DQ0 A;  5IN1 A;  4M75 D;  1J5W A;  5GMK m;  2KQW A;  4C8Q D;  4F7U B;  3A7U A;  3OB9 A;  2MWP A;  3REX A;  2JZ2 A;  4M75 B;  1E22 A;  3HRU A;  2L5Q A;  3CCJ T;  3CCV A;  4C8Q B;  4BE2 A;  1QVF A;  4KBM B;  3G6E A;  3UWN A;  3M54 A;  2QXF A;  4YCU A;  3SFM A;  3OSS C;  4NOY A;  1ADY A;  3QJY A;  3RKY A;  2E1H A;  3TRE A;  5A0G A;  2A7Y A;  2F69 A;  1NJ5 A;  4H02 A;  4K87 A;  1RL2 A;  3LWI A;  2RJE A;  1H4S A;  1VQ5 T;  2Y4X A;  4PG3 A;  4L6V 5;  4XK8 E;  2ODR C;  4DA4 A;  3CME A;  1KMM A;  4MZP A;  4ZTU B;  2QHS A;  5KCO A;  3CCU A;  2ODR D;  4KUL A;  2X35 A;  4M78 F;  4L87 A;  1UGQ B;  4P5N A;  3TEE A;  1JRI A;  3RMQ A;  3VBB A;  2LQ8 A;  1P92 A;  1Q7Y C;  2B8A A;  5GAO l;  4FT2 A;  1M90 C;  4HCC A;  4FU6 A;  2QHT A;  2ZNJ A;  3JCM b;  4B9W A;  5HK3 A;  3OBW A;  3SB2 A;  4E51 A;  5GAN 5;  2JNG A;  4TTV A;  2PVG B;  2C7I A;  3GPL A;  4ATO A;  5D6W A;  3MF2 A;  4NL2 A;  1X2H A;  1WJS A;  4IUP A;  2KDS A;  2P0K A;  2EYQ A;  1K73 U;  4JUV A;  4BI4 A;  3RF1 A;  1PSE A;  2ZIN A;  5GAN 8;  1ZHI A;  1XTD A;  2RB6 A;  4FT4 A;  1SER A;  4N4H A;  4BDZ A;  2ZT6 A;  2PVD B;  4BDY A;  3PMI A;  1VQP T;  4CH3 A;  1O9S A;  3KUF A;  4LDY A;  1M1G A;  3V8K A;  4XTX A;  3X24 B;  3A7R A;  2RI5 A;  2QHV A;  2ZPB B;  4M77 F;  2PUO B;  2HAX A;  2QQS A;  1GXI E;  3PMT A;  2OTL A;  2V8J A;  2I2L A;  3HTZ A;  5KCH A;  4E7I A;  3CCR A;  5C53 B;  1VQN A;  3RIR A;  1Q81 C;  2PUK B;  3JCM J;  2FYK A;  3HFN A;  1YIT A;  2FB7 A;  1VQ8 A;  2K57 A;  5CAI A;  4CH6 A;  5FU6 C;  5ELN A;  1PYS A;  3QO8 A;  2ZIM A;  2ZPH B;  5CKD A;  5LJ5 j;  2DIQ A;  1VQ6 T;  3HXU A;  4QW2 A;  3VQY A;  5GAO n;  1N9S A;  4YRI A;  4KR2 A;  2XIC A;  4TVR A;  3CCM T;  4QQ6 A;  1VQL A;  4ZGD B;  2ZCE A;  2V8I A;  4C92 E;  1WQ7 A;  2YLC A;  2DEQ A;  3H6Z A;  3HXZ A;  4WJ3 M;  3OQ5 A;  4HWT A;  2EJ9 A;  2EJF A;  4BD3 A;  2MAM A;  4A4H A;  4CS3 A;  1KOG A;  3VUB A;  1UGS B;  2LVM A;  4C0D C;  3S3O A;  1YJN T;  5HK0 A;  1XQH A;  2LTO A;  3OW2 S;  1VQK A;  1NPR A;  3VYG A;  3CCQ A;  4XU2 A;  5FRM A;  2QHU A;  3OYF A;  4M78 C;  2DXC A;  4J5Y A;  2K2V A;  4XU1 A;  3OD1 A;  3P8V A;  4RDX A;  2GFA A;  3QO5 A;  4M7D E;  1IRE B;  3QZ9 B;  1YI2 A;  3JB9 F;  4ZTJ A;  4M7A G;  2O4X B;  1X6O A;  3QO3 A;  5CO7 A;  5KH6 A;  1I81 A;  1D3B A;  4ZGJ B;  2DTH A;  3CEY A;  3HSB A;  2ZTG A;  1FXX A;  3C94 A;  4EMH A;  1PYS B;  3CXC S;  4C5G A;  1VQO T;  2VGM A;  5A0L A;  5CQX A;  2CYZ B;  4LDU A;  2AMC A;  5C51 B;  5KE3 A;  3IG2 A;  3IKL A;  4LVJ A;  2RHQ A;  3NTI A;  4BI8 B;  4M7A A;  2XDB A;  2K4Y A;  1VQ7 A;  1VQM A;  1I5L A;  2ZT7 A;  3G71 T;  4IUR A;  4O2D A;  1I8F A;  1VQ4 A;  2ZPF B;  4OB0 B;  1X55 A;  1M8V A;  3SDZ A;  4JLG A;  1EFW A;  5LJ3 f;  1WNL A;  3OS1 A;  1NJI U;  4E7J A;  1QF6 A;  3PCO A;  2IG0 A;  2L8D A;  1G3W A;  3X28 B;  4HVC A;  4X34 A;  3VQW A;  4BI3 A;  2ALY A;  4H2U A;  4P75 A;  1Q86 U;  5LJ5 e;  3M9Q A;  3MEV A;  1Y71 A;  2QI2 A;  4LVI A;  3R6O A;  4BE1 A;  4P73 C;  3E19 A;  3JCM f;  3NFC A;  3EFR A;  1KC8 C;  1YCY A;  4KUI A;  2DVE A;  3LW5 E;  1G3S A;  2HNI A;  2QQR A;  2LC4 A;  5C0M A;  3M57 A;  3BY7 A;  3LSQ A;  4C92 F;  3GNG A;  3M5A A;  5GAO r;  4M7A D;  4F7U G;  4G84 A;  5DLO A;  1KMN A;  3P8H A;  4M75 G;  1WLE A;  1X75 C;  2BUD A;  2G3R A;  3CCS T;  1IL2 A;  2ZR2 A;  2QEX T;  3X26 B;  1VQ9 T;  1YJW A;  3TEH A;  3SWN A;  1M1K U;  3HY1 A;  2ZR3 A;  4P75 C;  4Q5W A;  3PIP A;  5GMK l;  3M59 A;  4P71 A;  3P8D A;  3QDR B;  1USY A;  4F7U A;  4N0A C;  2ALY B;  4M75 A;  4TVA A;  3OYH A;  5I2S A;  3X25 B;  5LJ3 g;  2I4M A;  4M7D F;  5L8R E;  5DY9 A;  3ER0 A;  1W4S A;  4E47 A;  3M4G A;  2JTF A;  2YHT A;  3RKW A;  3HXX A;  4JRI A;  2DXU A;  2J3M A;  2DIG A;  3FIF A;  3OYC A;  3CD6 T;  1N9R A;  4RCB A;  1BYM A;  1X56 A;  1G5V A;  3QBY A;  3L2U A;  3FEO A;  3TEG A;  2R57 A;  3P8Y A;  3IKM B;  2R5M A;  4YRS A;  4VUB A;  3I56 T;  1MHN A;  4FL6 A;  5IAY A;  4Z02 A;  3WVE B;  3HXV A;  3RER A;  2E70 A;  1K9M C;  2EQM A;  3CC2 T;  4QVC A;  3QJ6 A;  4UC4 A;  5M9O A;  2JN0 A;  3OYB A;  5K1X A;  3OMC A;  1Z7N A;  3V8L A;  1G3T A;  3LX7 A;  4LD9 K;  1YFT A;  2L89 A;  4P74 C;  4TQF A;  1Z7M A;  4D6W A;  4RCC A;  3CMA T;  4XTZ A;  3A5Y A;  4OGE A;  3RKX A;  3C4S A;  1UB4 A;  1BBU A;  3MEW A;  3SD4 A;  1Q82 C;  1QVF S;  2WSE E;  2IVW A;  4Y91 A;  3UGT A;  4TVA B;  1KD1 U;  4MZT A;  1E24 A;  4KQE A;  2ZGW A;  5LJ5 h;  2DU5 A;  4PLL A;  4E7H A;  3OMG A;  3L2R A;  5D6Y A;  2E12 A;  1EIY B;  2PU9 B;  5AYF A;  3T9N A;  1YB3 A;  1YHQ A;  3CC4 A;  3ME9 A;  4OP0 A;  1I4K 1;  2XHC A;  5GMK i;  2Y90 A;  4RKU E;  2ZIO A;  2LT1 A;  1NYR A;  5FRO A;  4II1 A;  11AS A;  5GAN 2;  3WQZ A;  4OF1 A;  3MCA B;  3CCL T;  4TVY A;  3CBP A;  2YRV A;  4M7A E;  5GAN d;  5A0D A;  4PLI A;  2CZ0 B;  4PKC C;  4OB2 B;  3CPF A;  2DTI A;  4J7F A;  5GAN e;  3MHX A;  2QA4 T;  4BAC A;  1K73 C;  1DJ7 B;  4MDX A;  3KXT A;  1NZ9 A;  3FDR A;  1Y7X A;  1UGP B;  4IUT A;  2Q5H A;  1QVG A;  2J3L A;  4R55 A;  4XTV A;  3JCM c;  1OI1 A;  2XKO C;  1JJ2 A;  2AKW A;  4MMK A;  3BFM A;  3ICA A;  5GAM j;  2NS6 A;  2E65 A;  2CS7 A;  1YFR A;  2I4L A;  3DKM A;  1SSF A;  5I2M A;  3VV0 A;  3MQZ A;  2X4X A;  4RMF A;  3QG1 A;  2CZ1 B;  3NEN A;  4X9D A;  5LJ5 g;  4UP7 A;  1PSF A;  5DLQ E;  3I7F A;  2DK3 A;  2RHX A;  4M78 G;  2LCC A;  4PJO C;  4L59 A;  2KVQ G;  2XTI A;  1H64 1;  4LDX A;  2R58 A;  4CRI A;  4H2W A;  4PJO D;  3L4G A;  3GOX A;  2GQV A;  3CC7 T;  2RJD A;  4H2V A;  2OTL T;  2P0P A;  3W3S A;  3OBY A;  4PJO B;  3CCR T;  3QYH B;  3OYK A;  2K5F A;  3UH0 A;  4IUU A;  1VQ8 T;  4J7I A;  4UP9 A;  3ZBD A;  4AH6 A;  4LDV A;  4PNO A;  4LNS A;  4M78 A;  5CKH A;  2DKG A;  1W2B A;  1NJ8 A;  1BKB A;  4F7U E;  2VXF A;  1X54 A;  2O4X A;  1BI3 A;  3TUP A;  4M75 E;  2AKW B;  3PGG A;  3M4P A;  2JVV A;  4C8Q E;  3JB9 H;  1NJ6 A;  3ZEH A;  1YIJ T;  4UP8 A;  3QPH A;  2RD1 A;  3J7A F;  4P3O A;  2VUB A;  2FL7 A;  4LD6 A;  3IAL A;  4J6Y A;  4YRE A;  1VQP A;  1M5Q 1;  3QKJ A;  3L42 A;  3G4S T;  5CKF A;  5FU6 B;  1MGQ A;  4P72 C;  2DD5 A;  2OTJ T;  3DLM A;  2ZT8 A;  1VQK T;  1YFS A;  3E9I A;  1YJ9 A;  3LYI A;  3J81 E;  3JSC A;  1M9S A;  3LC0 A;  3M56 A;  3S3N A;  3QII A;  4YRL A;  5GAN 3;  2LCL A;  3HXW A;  5LL6 S;  2K3Y A;  2PMF A;  2RJC A;  4J15 A;  1K8A C;  3MEY A;  4M7A F;  3L2W A;  1OZ2 A;  3CBM A;  3L4G B;  3P8B B;  2QQA A;  4H2S A;  5GAM d;  4C0D B;  2HQE A;  1UEB A;  4A54 A;  1RI0 A;  2RHS B;  1B8A A;  3JB9 I;  2E5A A;  2A3L A;  4DPG A;  3VKI A;  3QTC A;  3A8G B;  3CCM A;  5GAM e;  4E7L A;  3ERR A;  4TWA A;  4M78 D;  5GAN h;  4WF2 A;  4CS4 A;  1X01 A;  2G4C A;  2ZZD A;  5J26 A;  3EFS A;  4M78 B;  4YRN A;  1NJ1 A;  2PVO B;  3RAC A;  5HY6 A;  2CGH A;  2RJF A;  1NJI C;  1BI0 A;  2CIM A;  1YJN A;  4FIB A;  1LJO A;  2Q7G A;  5A2Q E;  3CPW A;  4RQF A;  3NEM A;  4P73 A;  2H3J A;  2CZ6 B;  1VQ7 T;  3M53 A;  3HFZ B;  1Q86 C;  3BDU A;  3PFS A;  1VQ4 T;  2E5Q A;  4YRF A;  1U8R A;  5GMK e;  5GAN 6;  4CI0 C;  2DPP B;  2DU7 A;  2NLU A;  5CKB A;  4TVW A;  2CJB A;  2LT4 A;  3TCJ A;  4C0G A;  2RK1 A;  2HD0 A;  3KFU A;  2DTO A;  3MEA A;  4UPA A;  4OVA A;  1S72 A;  1JBM A;  2Q5I A;  1WPY A;  2EKO A;  2BKD N;  2JUF A;  2KY9 A;  3DB4 A;  4ELY C;  2DZ9 A;  4YCW A;  4YPF A;  2RA2 A;  3HXY A;  5F5W A;  4WJ4 A;  1VQO A;  4M77 C;  3ZFJ A;  2LX9 A;  1ATI A;  1WQW A;  4NS5 A;  4JRK A;  3DLL A;  3DSQ A;  1EIF A;  2XI9 A;  2XU8 A;  1LNX A;  1B70 B;  3QO7 A;  4F7U F;  4E7K A;  4N0A A;  4M77 B;  4ZTF A;  3JB9 J;  4J6X A;  4A4F A;  1M1K C;  4M75 F;  3OY9 A;  1EVK A;  2F5T X;  3HP9 A;  3HRK A;  4C8Q F;  3PIO A;  4EMK A;  3BDL A;  4KUD K;  4O6J A;  2I4N A;  2C8M A;  3GP8 A;  5CQY A;  2MWO A;  1X2G A;  2RO0 A;  1YJW T;  1JJC B;  4XTY A;  4H2Y A;  4DOV A;  1WYD A;  4C5E A;  3QXE B;  4HKE A;  3A8L B;  3C12 A;  5J3B A;  4MZM A;  2ZZF A;  2JOY A;  4YRC A;  5IT9 E;  4XEM A;  1QVP A;  2EQU A;  4OB3 B;  2L3R A;  2E3C A;  2OAU A;  2P5I A;  1QP3 A;  4X5O A;  2E6N A;  4YRQ A;  3REU A;  3A8M B;  1N8R U;  2ZCF B;  1G5I A;  4P74 A;  4PHC A;  5GAN j;  1NE8 A;  1HXD A;  3N5B B;  1OYX A;  3HKS A;  1NPP A;  5GAM h;  2I4O A;  2E6Z A;  3RL6 A;  3AHU A;  4EMK C;  1OZ3 A;  1NJ2 A;  3HL8 A;  3CCS A;  1EIY A;  3A8O B;  1BIA A;  3A7A A;  3GIB A;  2QEX A;  4QVZ A;  1VQ9 A;  3MET A;  3GLX A;  3E9H A;  1UGR B;  3UPU A;  4EMK B;  3VQV A;  3CCE T;  3O8V A;  3G1Z A;  4A53 A;  1KD1 C;  2QTX A;  4ZIB A;  2JTM A;  4JDS A;  4IUQ A;  5GMK h;  1JB0 E;  4J8O A;  3UFG A;  4FM4 B;  2XDP A;  1VIF A;  5K1P A;  4JS5 A;  4V2S A;  4Q15 A;  1Y96 A;  4ZN3 A;  2M0O A;  3CCV T;  3CD6 A;  2GF7 A;  3MP8 A;  4G85 A;  3MP6 A;  1NYQ A;  2RHY A;  5GAN 4;  3FJP A;  2KMT A;  2RK2 A;  3G6E T;  3JCM P;  4WI1 A;  1EOV A;  2FVU A;  3V7R A;  2KSS A;  4KT0 E;  1YHQ T;  3OA6 A;  4EO4 A;  5LJ5 f;  4JJN K;  3I56 A;  4CH5 A;  1V29 B;  1ZQ1 A;  5LJ3 j;  2HQX A;  3C95 A;  3CC2 A;  4C8Q C;  2FHD A;  2D9T A;  3NEL A;  4PJO G;  2GFU A;  4YRJ A;  1BI1 A;  5FLX E;  5GAM g;  5CKE A;  3LGL A;  2ZPE B;  3FB9 A;  4Y28 E;  1YGB A;  3CMA A;  4BUG A;  3CME T;  3JAM E;  3I55 A;  3CCU T;  4ME7 A;  1LOJ A;  4C92 C;  1VUB A;  12AS A;  2CZ7 B;  3OYY A;  3OSV A;  4ZGE B;  1K9M U;  2EL9 A;  4BB7 A;  4C92 D;  1GGM A;  3NTH A;  3EAE A;  4JRP A;  5I21 A;  3A8H B;  2M1H A;  3VQX A;  3CCJ A;  4PJO A;  3E1S A;  4C92 B;  1G5H A;  4A4K A;  3LLR A;  4K88 A;  2AHJ B;  1QVG S;  4ELZ C;  2P4T A;  2XID A;  1JJ2 S;  2LNV A;  2RHZ A;  1Q82 U;  4HWP A;  3VYH B;  1Y96 B;  2K5I A;  4YTL A;  2VV5 A;  1BBW A;  3FRN A;  2X4Y A;  4YRP A;  1B34 B;  1G3Y A;  2IY5 B;  3Q1J A;  3VJP A;  5D6X A;  4XTU A;  1BIB A;  4YRG A;  3CCL A;  4M7D C;  4OLF A;  1U1S A;  1VQ5 A;  2C06 A;  2RHU A;  3RES A;  4M7D D;  4MDW A;  4L5G A;  4Q6G A;  3PT9 A;  4K86 A;  4M7D B;  1G51 A;  2QA4 A;  2K3X A;  2PME A;  2P0Q A;  1W66 A;  2XDD A;  3QYG B;  1EQR A;  2M16 A;  2HBP A;  3ASK A;  2VGN A;  5CCA A;  2XD0 A;  4GY5 A;  4HWO A;  3QUI A;  2WAC A;  4P72 A;  2V8K A;  3JCM V;  1ASZ A;  3NET A;  4HWS A;  5KNN A;  1QP2 A;  2LQK A;  5ELO A;  5GMK j;  2BIV A;  4H2X A;  3OS2 A;  1KQS S;  5CVI A;  2D0Q B;  2DD4 A;  4LVK A;  3LH0 A;  3V8J A;  3V7S A;  2RHS A;  4XQ3 A;  2LRQ A;  1VQN T;  5LJ3 d;  1W2B S;  4EMG A;  1YIT T;  1KQS A;  2DZC A;  2ARS A;  1Q7Y U;  2RI2 A;  2RI3 A;  3DB3 A;  5LJ3 e;  1QW1 A;  3OYM A;  5C52 B;  1O75 A;  1M90 U;  3RMS A;  3PTA A;  3X20 B;  1ZBX A;  2MI6 A;  2DO3 A;  3M58 A;  2YLB A;  1ADJ A;  2K5L A;  5GAO p;  1VQL T;  4HT9 A;  5FU7 C;  3QZ5 B;  2ZNI A;  3S6W A;  3CC7 A;  2EIF A;  1YJ9 T;  3HFZ A;  3JCM d;  3JCM X;  2KK4 A;  1IZ6 A;  2DAQ A;  5FU7 B;  5J39 A;  5E3I A;  1HC7 A;  5GAO m;  3PZC A;  4OMF B;  3JCM e;  1R8O B;  3OS5 A;  4N4I A;  1E1O A;  2ARU A;  2M9U A;  4YDQ A;  4EPC A;  3UGQ A;  1NNH A;  3CCQ T;  5EG2 A;  3HFV A;  3QSU A;  4M77 G;  2VC8 A;  5DM7 R;  1WGS A;  3F70 A;  1YIJ A;  2RHI A;  4DQ2 A;  2RM4 A;  2X4W A;  1VQ6 A;  4H2X B;  4RG8 A;  4BY6 C;  1YI2 T;  2E64 A;  3QNE A;  4YYE A;  4HT4 A;  2CJ9 A;  3G4S A;  5GAN f;  4A4E A;  2EFI A;  4YP0 A;  2F5K A;  2ZXF A;  2A8E A;  2E10 A;  2QDY B;  1FX7 A;  3MO8 A;  3MP1 A;  4LVL A;  1Q81 U;  2OTJ A;  3JRZ A;  4BY6 B;  2R5A A;  1B70 A;  4MML A;  3A32 A;  4M77 A;  3LGF A;  4XAX B;  3HFO A;  4JS4 A;  3OYJ A;  3CPW S;  3RGL A;  3OW2 A;  4OB1 B;  4XTW A;  4YRT A;  4JLI A;  3HPW A;  5CR2 A;  1HK9 A;  4C5I A;  2EQK A;  2DJZ A;  2VYT A;  4C0F A;  2EJG A;  3UT1 A;  5GAO q;  1N6A A;  3VU3 C;  3A5Z A;  1VQM T;  2DXB A;  3G7Z A;  1S72 T;  2DXT A;  1C0A A;  1KQ1 A;  1JJC A;  3JCM W;  3FC3 A;  2D6F A;  1KHC A;  3URG A;  3P8T A;  4HWR A;  3OYD A;  2P0L A;  1N9W A;  3OS0 A;  1H4Q A;  3L2Q A;  2RH2 A;  2ZT5 A;  5CIU A;  2QQB A;  4OGC A;  1K8A U;  1QE0 A;  3OYL A;  3S3M A;  4QQD A;  3R07 A;  3HRI A;  4X9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...