2DJZA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111a mutation
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2djzA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2djzA01
1NJ2A 4XTUA 1B70A 3FB9A 5GMKe 4JUVA 4M77D 3JCMh 2ARSA 2DTHA 1M8VA 5LJ5f 1Z7NA 4YCVA 4DPGA 1B8AA 2ODRD 1WQ7A 4PJOG 4TQDA 1LJOA 4M78F 5GAN3 3GIBA 2DXTA 3PGGA 11ASA 2DTOA 2HNIA 2E10A 12ASA 5GAMj 3TUPA 3W3SA 2Q7HA 2C7IA 4OP0A 4X9CA 1E24A 2QHVA 4UP7A 2ZCEA 4HT8A 4YCUA 5F5WA 2VXFA 4C8QD 5GAN6 4XTWA 1KQ1A 4C8QG 4M7AF 4CS2A 4XU2A 3REUA 1X56A 2ZZGA 4M7AG 1B7YA 4P73C 4YP0A 4HA8A 4NL2A 4C8QF 1YB3A 4EMHA 2VC8A 5GANe 4P3NA 4BW9A 4HWRA 4M75C 2J3LA 3HFNA 1MGQA 4C92B 4K87A 4XEOA 4XU3A 5C51B 1PYSB 3P8VA 3A74A 3VQXA 4M7DC 3BW1A 4JLIA 3HY0A 4KQEA 3BFMA 4YRFA 4RQFA 4M78G 4M77E 5GAN5 4RCBA 1EVKA 5GAN7 2PMEA 4C92G 3RUXA 5GANf 1YCYA 2ZIMA 4JRIA 4M7AA 2ZT6A 5LJ5j 4YRRA 4XTVA 4M7DB 5GANd 4XTZA 2E3CA 3VQVA 5GMKi 3LC0A 3NEMA 5I21A 5C53B 3REXA 2Y90A 1B76A 1LYLA 3TEGA 3JB9I 4YRPA 4EMGA 2CJAA 3UGTA 1W66A 3E9IA 4YROA 1X2HA 4YRSA 1WYDA 4PJOD 5LJ3g 4F7UE 2ZT8A 1SESA 4RCCA 2QHUA 2AMCB 2I4LA 5GANj 3JB9F 2E41A 2ARUA 2Q7EA 4P3OA 1SERA 3M4GA 4K86A 4M7DA 4P3PA 4TVWA 3SWNC 3RACA 2ALYB 1WQWA 3VU3C 4PJOB 2DZCA 2ZGWA 4Q6GA 4EO4A 3HTZA 2I4OA 4QVDA 3V8JA 1WU7A 4M7DD 5GAMh 2DDZA 2EAYA 3A5YA 2I2LA 1JJCB 5GAOp 3RGLA 3AHUA 2Q7GA 4F7UG 1J5WA 5E3IA 5LJ3d 4CH5A 5LJ3h 4F7UF 4F7UA 3RF1A 1E1OA 3HXVA 3MF1A 4TWAA 4C8QB 1EFWA 4H2YA 3LSSA 4L87A 4C8QC 3TEHA 3JCMP 4H2SA 3TEHB 2XTIA 3M4QA 5C52B 2ZZEA 1BIAA 1I4K1 5GMKh 4EMKC 3RESA 4YRJA 4YREA 2G4CA 4BWAA 3A7UA 4M7DF 2J3MA 5K1XA 1BIBA 4P74A 1IL2A 4XQ3A 4PJOC 2CJBA 1WNLA 1JBMA 2RB6A 2DQ3A 3JCMX 5GAOq 1EIYA 3V7SA 1YFSA 3G1ZA 5GAMe 4XTYA 2Q5IA 1NNHA 3JCMb 1JRIA 1B70B 5LJ5e 4M7AB 3QHSA 1NJ1A 2EJGA 3L2ZA 4YDQA 4C92A 1D3BA 1USYC 2PMFA 3INZA 4WF2A 1BBWA 4H2XB 4M77C 2YLBA 4M7AE 2P0LA 4HWSA 5HGQA 3HSBA 4M7DE 1X54A 3IKMB 4UP9A 3HFZB 2E65A 2DZ9A 3HXXA 4EX5A 4UP8A 3JB9H 4N0AC 4A53A 3HFOA 1X2GA 2ZNIA 3UGQA 1U1SA 4M75B 3ERRA 4RQEA 1YGBA 3QO7A 4G84A 4J6WA 4M77B 1X01A 2C8MA 1USYA 2RD1A 4XU1A 2RA2A 1H641 4H2VA 2E5AA 4YPFA 1LOJA 3P8TA 3QTCA 3MEYA 1NJ5A 5LJ5g 3E9HA 4C92E 4EMKB 4M77G 1NJ6A 4YRMA 1E1TA 4P75A 1EIYB 1N9SA 3NETA 3RIRA 4Y91A 2ODRC 4YRTA 1RIQA 3LSQA 3PCOA 2CJ9A 1I8FA 5GAN2 1H4VB 4NL3A 3BDUA 4HWPA 3OD1A 3MF2A 1HK9A 1G5IA 4P71A 2FB7A 1X55A 4PJOA 3RKXA 2DVEA 3VBBA 3JCMe 4OLFA 1HC7A 1Y96A 3SB2A 3QUIA 1KMMA 2RHQA 5GAMd 1D3BB 2DQ0A 4H2XA 3SWNB 4M78A 3RKWA 5GMKm 4PJOF 2YHTA 4A54A 3A31A 4TVAB 5DY9A 2EJ9A 4M75E 5ELOA 4XU0A 1EOVA 2P5IA 1YFRA 1VQZA 4YRIA 1G51A 3HXYA 4WJ3M 1G5HA 4HWTA 5GAOl 2IY5A 3JCMV 3R07A 2ZINA 1SRYA 3IALA 4M77F 5GAN4 2XGTA 1ATIA 4KR2A 3NENA 1YFTA 4E51A 4YRQA 5LJ3f 2RHSA 3WQZA 3ICAA 3QO5A 3HXUA 4P75C 4CS3A 4XEMA 5GAOr 3HRIA 3JCMd 3CMQA 2IY5B 4H2WA 2ZR3A 2E64A 1TH7A 4ZTZB 2AKWA 1KQ2A 3RKYA 3V8LA 3KFUA 3JCMJ 4G85A 4P74C 5GAN8 3V8KA 4M75D 2I4NA 5KNNA 3HXWA 4TVAA 2QHSA 2DTIA 1I5LA 1Y96B 4WI1A 4CS4A 3PCOB 4AH6A 3RL6A 2AMCA 1ADYA 4H2TA 5CAIA 3V7RA 2DXUA 5GAOn 1Z7MA 2FYKA 3V7CA 2AKWB 4YRKA 1NYQA 4MMKA 4C92C 1ASZA 2DKGA 3HXZA 3JB9D 3BJUA 4PG3A 4M7DG 1JJCA 4P71C 3DSQA 4Q15A 4RDXA 3JB9G 4C92D 3IG2A 3QSUA 3VQWA 3RERA 2ZR2A 4PJOE 3A5ZA 1B34B 1NJ8A 3I7FA 1L0WA 4N0AA 3M4PA 1N9RA 4CH6A 4ZIBA 2ZT7A 5GAOm 2ZZFA 1KMNA 4CH3A 5LJ3e 3QO8A 4X5OA 4TTVA 3HY1A 4M7AD 1E22A 1PYSA 2E1HA 3JCMW 5GAMg 1N9WA 2QHTA 2JN0A 4LNSA 4UPAA 4F7UB 1KOGA 2ALYA 3A32A 3NELA 1NYRA 4HVCA 4H02A 2Q5HA 3BY7A 4PHCA 1I81A 4EMKA 3P8YA 4O2DA 3JB9J 2ZTGA 3L1AA 1SETA 1WPYA 4M78D 2ZIOA 3A7AA 2EWNA 3L4GB 1EQRA 4YRGA 1H4SA 1HTTA 2CIMA 2RHQB 3JCMc 3JCMQ 4RMFA 2DJZA 1BBUA 4TQFA 4H2UA 4DQ2A 1HXDA 4M78E 4QVCA 4V2SA 4M78C 2RHSB 2VXEA 5LJ5d 1FYFA 4M75A 4PNOA 4M75G 4C8QE 5LJ5h 3EFRA 3PZCA 4ZTUB 1B34A 2I4MA 3FIFA 1WLEA 4P73A 4HWOA 4HT9A 4J6YA 4C92F 1QE0A 3HRKA 3SWNA 2EJFA 2RM4A 4NOYA 3A7RA 4YCWA 4P72A 4YRNA 4CH4A 4KR3A 4YRCA 3UFGA 4M7AC 3QO3A 4NCXA 3VQYA 2ARTA 2CGHA 3QNEA 4J5YA 4YYEA 3IKLA 3EFSA 3HFZA 3UH0A 4YRLA 1H4TA 4X9DA 4M78B 5ELNA 1ADJA 4M75F 2DU5A 4XTXA 4P72C 4J6XA 1U1TA 1EVLA 4C8QA 3L4GA 1H4QA 1ASYA 3JCMg 2K57A 4K88A 4TVYA 3FJPA 5LJ3j 5GMKl 2ZT5A 3HFVA 3JCMf 4MMLA 5GAMf 2EL9A 1QF6A 5GANg 1C0AA 5K1PA 2ZXFA 2YLCA 1LNXA 4J15A 1GGMA 1M5Q1 4WJ4A 2QTXA 4JRKA 2DEQA 4M77A 2ZNJA 1B7YB 2DU7A 5GANh 5GMKj
chains in the Genus database with same CATH superfamily
1NJ2A 1B70A 5GMKe 2HQEA 4JUVA 3JCMh 3UATA 3I56Q 2ARSA 2DTHA 2CP2A 1NJIU 2DFUA 4DPGA 4DEXA 4TQDA 1WQ7A 1TSFA 4D8KA 2QGGA 2MYSA 2DETA 4IIOA 1ARKA 2ECZA 11ASA 2A8EA 1GBRA 1BB9A 1K1ZA 1YIJT 1K76A 5I2SA 4X9CA 4NS5A 4KUDK 4HT8A 2O01E 5F5WA 2DBKA 3EAEA 3CPFA 1KQ1A 4X34A 2A0FB 1Q81R 1M1KU 2E4HA 4BE1A 1VQ9Q 1VIFA 5FU7C 2C0OA 3UPUA 2ZZGA 4P73C 4C8QF 3VUBA 3CMEQ 2RHUA 1NEBA 1WLPB 3LGFA 5GJWB 1UJYA 1KK7A 1FXXA 4GBQA 3EFOB 3WXMB 2L89A 3MP6A 4C92B 1WIEA 3CC7T 4XU3A 2EBPA 5C51B 3A8HB 4ATOA 2HSPA 1YJ9T 3HY0A 4FW2A 4RQFA 3BFMA 4KH0B 4Y92A 5J39A 2PMEA 3RUXA 4FM4B 1YCYA 3C95A 3ZEHA 4E7JA 4BE0A 2ZT6A 4YRRA 5D7UA 1RI9A 1UGVA 1AD5A 4JJBA 4BD3A 3VQVA 5GMKi 3G6ET 1C1AA 4C5HA 5I21A 3LC0A 2Y90A 4FW1A 1VQ6T 4E7ZA 1B76A 1NPPA 2DL8A 2RI3A 2HL5C 3JB9I 1PSEA 2CJAA 2D1XA 3UGTA 2JNGA 1W66A 5CIUA 4YROA 4YRSA 1WYDA 1KQSP 4PJOD 4F7UE 1SESA 4CC2A 3VS5A 1Q7YU 2FRWA 1TS9A 2XHCA 2ARUA 4P3OA 2IG0A 3M4GA 3NPFA 1N8RC 3OYMA 2QG9B 3PNWC 1IHVA 1WQWA 3VU3C 4PJOB 3H0HA 1YITA 1IGQA 2HQXA 3OY9A 4Q6GA 4EO4A 1QP2A 1WU7A 2EGAA 1OULA 1M27C 5GAMh 2EAYA 2O4XA 5LL6S 3CCLT 2QQAA 2DDZA 1Y57A 2C0IA 2NUTB 2WACA 5GAOp 2K7AA 2ABLA 2Q7GA 5E3IA 3C94A 2PU9B 4TWAA 1YHQT 4C0DC 1EFWA 2M0OA 2LX9A 2OI3A 3HRUA 4YTLA 1C0MA 2LC4A 4A4KA 2XTIA 3M4QA 1Q86C 5EG2A 3CXCP 2ZZEA 2E6NA 1PRLC 4ZGEB 1JO8A 1ZLMA 2G4CA 5HK0A 3A7UA 1WGSA 1HD3A 1NLOC 3CEYA 3H6ZA 2XG8D 2MOXA 2DQ3A 2YUPA 1MMGA 1VQNA 1FMVA 2DD4A 3EHRA 3EG3A 3R6OA 3P8DA 3JCMb 1WYXA 3U23A 1MNDA 1ZBXA 5HKCA 4C5GA 3CMEA 4JZ3A 1V1CA 3E19A 1D1BA 2RK1A 3CCVA 1CKAA 2F5TX 2YLBA 3REBB 4C0GA 1R0CB 3OW2A 4HWSA 3H9NA 2K3YA 2HKQB 5KCOA 1BKBA 4UP8A 1W2BP 5A0GA 4A53A 1RL2A 1U1SA 3JAME 2CZ0B 2RJDA 4G84A 4PFOA 2VUBA 4DOVA 3HTRA 5FU6C 2E12A 2MF2A 2RA2A 1H641 4IUQA 3WVDB 1Q95G 1IREB 1M1KC 1YITT 2MWPA 2RI2A 1VQ4T 5L8RE 1QCNA 4M77G 3GF5A 1E1TA 1PNJA 3X24B 4P75A 1H3ZA 1X2KA 5J3BA 2HCKA 1I8FA 3RBBB 4L6V5 2DBMA 1XJWB 4PJLA 3M54A 4R56A 3M56A 2EYXA 1HC7A 4EPCA 3SB2A 4OLFA 3QUIA 5FLXE 3CCQQ 2COZA 5GAMd 1VQNQ 2LQ8A 2KRNA 3FJ5A 4LE9A 5GMKm 4A54A 4DBRA 3A31A 1A0NB 2EJ9A 1WFWA 4JJCA 3QYHB 1LPLA 3G71T 4FYXB 4XU0A 4B9WA 2KT8A 1YFRA 4YRIA 3OYLA 3CC4T 1ZSGA 4FYVB 3CCUT 2DL7A 5GAOl 3E9FA 2ZINA 1ACMB 3I5SA 1VQKA 4M77F 4DOWA 4KGVB 2EYZA 2YUQA 4N4HA 2M1HA 4JZ4A 1Y0MA 1N27A 2E6ZA 2RHSA 4E6RA 4CS3A 4XEMA 2XICA 2CZ6B 4QQGA 2LCCA 1YI2Q 1TXQA 1TUDA 2E64A 1TH7A 2KRSA 1QWEA 1KSWA 3ZFJA 3CD6Q 3RKYA 2DL4A 3VS6A 2EQIA 1YIJA 2CZ7B 3I5RA 4LXCA 5GAN8 1BYMA 5KNNA 2QHSA 3RR6A 1Y96B 2QA4T 3HPWA 1SSHA 2KSSA 2AMCA 4BACA 4H2TA 3VYGA 4DBHA 5CKEA 2DXUA 5GAOn 3CPWP 2VWFA 3V7CA 4MZMA 3M57A 4MMKA 2DKGA 3M0QA 2XI9A 2BZYA 1VQ8T 3UDCA 3OS5A 4RKUE 3VKIA 4M7DG 1JJCA 3HL8A 3OYJA 3OB9A 4KGZB 3IG2A 2JM9A 1UECA 3M0TA 2F2VA 2KY9A 4RTVA 1C6VX 4OB2B 3A5ZA 4ANJA 1B34B 4ZIBA 2ATCB 2CSIA 2QEXQ 3CMAA 1OZ3A 2XD0A 4KT0E 4FSSA 4UC4A 1TUGB 2DMOA 4TTVA 1F1BB 2ZZDA 4QT7A 4C0FA 1V76A 2D8HA 2KYMA 3TU4K 3E9GA 4FT2A 1UFFA 5KYWB 2QHTA 2JN0A 2L3RA 5EC7A 4UPAA 3PT9A 4JJDA 2PUOB 2L2PA 4H02A 2Q5HA 2PQWA 2V1QA 2DYBA 2BIVA 1H92A 3P8YA 3UF4A 1SETA 4M78D 3L4GB 4YRGA 2HBPA 1HTTA 3LLRA 3I55Q 2RQVA 1AOJA 3M53A 3QDFA 4J7FA 4TQFA 4QVCA 4JS4A 1YIJQ 3OW2P 2VXEA 1VYVA 1JB0E 4OMFB 3RMSA 2HL3A 4HXJA 2CYZB 5CKBA 1QVPA 2KDSA 4P73A 2I0NA 2EGEA 4WCIA 2EJFA 4NOYA 4YCWA 4P72A 4YRNA 4JLGA 3Q1JA 1OX9A 1N8RU 4M7AC 1RUWA 2DD5A 1NZ9A 3IKLA 1KHIA 4AFQC 1RLQC 1HJDA 5CCAA 1ABOA 3S6WA 4X9DA 1N6AA 4M78B 1ZHIA 2GFUA 1MHNA 2RH2A 1H4QA 1EVLA 1NYGA 3OA6A 3GNFB 1ZUUA 4C5EA 4K88A 5HY6A 5GMKl 2FPFA 2X9HA 4MMLA 2EL9A 5GANg 1C0AA 5K1PA 3CCVT 3VS3A 1ZBJA 3TSWA 1D0XA 3HRTA 4ORZA 1KC8C 1W6XA 3MEVA 1GGMA 3LW5E 3OBWA 3VS1A 2AZSA 4RUGA 2QTXA 1M30A 2DEQA 2RQTA 3QJYA 1G3YA 1B7YB 4OB0B 2JS2A 2J6KA 1RAFB 2DU7A 1U5SA 1AHJB 3OYNA 3FB9A 2LX7A 3CCSA 4M77D 2FHDA 1M8VA 5LJ5f 4AG1C 1Z7NA 3ER0A 2KE9A 2ODRD 4PJOG 2DO3A 2E3IA 2CP7A 4RMOA 3CC4Q 1BCOA 1Q7YR 2DXBA 3GIBA 3PGGA 2RK2A 2HNIA 2E10A 2L8DA 3EH2A 3TUPA 3S3OA 4C5IA 1GRIA 3ME9A 1WJRA 2CP6A 4OP0A 2QHVA 2LT1A 1CSKA 3TSZA 1JXMA 2VXFA 4XTWA 4KRTA 3MHXA 4C8QG 4M7AF 2LP5A 8ATCB 1VUBA 4HVVA 3OYFA 4YP0A 4HA8A 2HD0A 1IGUA 1QP3A 2VC8A 3MKDA 1W1FA 1CKBA 1YWPA 1UE9A 2X51A 4HCBA 5L23A 1PYSB 4E47A 3DLLA 1NBEB 4JJNK 3A74A 2JOYA 4M7DC 3QBYA 3FRNA 3BW1A 4OB3B 2FO0A 3QIIA 4PLIA 5KYXB 4II1A 1VQ4Q 1Q81C 4M78G 4M77E 5GAN5 4LVJA 3CCQT 2QQBA 1Q82C 2LQKA 4J9GA 2J7IA 4M7AA 5C6SA 4XTVA 1X6GA 2HQHA 4XTZA 5DM7R 3EG1A 3NEMA 5C53B 4Z8AA 2OX7A 3E1SA 2F69A 2V8KA 1VQ7Q 2RHIA 4Z02A 3TCJA 2D8JA 3E9IA 2MCNA 2DJQA 3OSVA 2WSFE 2MK5A 1OU9A 2CUBA 4RCCA 3L2RA 4OVAA 3LGLA 1VQ6A 3CCJQ 1K4US 1SERA 4J9FA 3RACA 1W2BA 4J9IA 3H41A 4FYWB 1M2OA 4XK8E 2DZCA 2ZGWA 3HTZA 4QVDA 2JM8A 3V8JA 4M7DD 2XIDA 2I2LA 2LRQA 1JJCB 3VS7A 1G5VA 4R0KA 3AHUA 1GCQC 1JEGA 4CH5A 5LJ3d 3HXVA 1YJNA 4C8QB 4H2YA 1RI0A 3LSSA 4C8QC 3CCLA 4JS5A 2HZYA 3TEHA 3VUZA 3JCMP 3TEHB 5IHKA 1VQPQ 4AFSC 3WVEB 1YNZA 2EKOA 1GL5A 2LCLA 1O9SA 1I4K1 1BI0A 4EMKC 4CC7A 2BUDA 4YREA 3QG1A 2KRMA 2JUFA 1K8AC 3CXCS 1SHGA 3L42A 2EIFA 4HVWA 2K2VA 1IL2A 2CJBA 5HCKA 2PZ1A 2RB6A 4LNPA 3JCMX 3OYBA 1M9SA 3CCQA 4A4GA 2JVVA 3G1ZA 1NEGA 2X3WD 1B70B 5LJ5e 4M7AB 1K9MC 1X6OA 3QHSA 4ZTFA 1UG1A 1NJ1A 1WHGA 4YDQA 4H2XB 1USYC 2PMFA 4FCYA 5ECAA 1OPLA 4M77C 1B07A 2Y4YA 2QASA 1ABQA 4O5VA 4M7DE 2BZ8A 4J7IA 1X54A 4JDSA 3IKMB 4UP9A 3HFZB 3CPWS 3I9QA 3HXXA 2EYWA 2B8AA 4N0AC 4BY6C 3G6EQ 4ME7A 3G4SA 2ZNIA 4LVMA 4RQEA 3CCMQ 2F1LA 2QQ9A 2DLPA 3OQ5A 1YGBA 4M77B 2DE0X 1K9AA 3CCET 4GLKA 1WHLA 1X01A 1PKTA 4KULA 2C8MA 1USYA 3PIOA 3P8TA 3QTCA 3MEYA 5LJ5g 2V26A 3IQLA 2J05A 3DLMA 4EMKB 2CZ1B 2GGRA 1BCMA 3QDRB 4LVIA 3FDRA 3PMIA 3X25B 1EIYB 1N9SA 1AZGB 2L3QA 4Y91A 3LSQA 3SFMA 2IVWA 1AZEA 1M4ZA 2FVUA 2AHJB 5GJVB 4ZGJB 3CCMT 2RJFA 3VYHB 3M0PA 2J6OA 9ATCB 1HK9A 3MJXA 2ED0A 3P8BB 2NUPA 1QVFP 3S3MA 2X35A 2NUPB 1UDLA 3RKXA 4E7SA 1KJWA 4AT1B 2JTMA 4IUTA 3DB4A 1OI1A 1V29B 3SWNB 3S3NA 1K73C 1S1NA 3RKWA 1T3SA 2LQNA 1IZ6A 2LDMA 4HKEA 2YHTA 1YWOA 1OYXA 4Z89A 5KYUA 1RAHB 3A8MB 2PUKB 3M0SA 3PTAA 1G51A 2WSCE 2FPEA 4O6JA 3EGUA 3JCMV 3OS0A 1Q81U 3R07A 1KQSA 4PJNA 1SRYA 4M4ZA 3IALA 2LMJA 3PFSA 4BDZA 2C06A 1X27A 1OX8A 2BZXA 1M90R 4IKFA 2B86A 3NENA 4YRQA 5LJ3f 3QYGB 2A7YA 3QO5A 4P75C 4FYYB 1VQ5A 5CR2A 1VQKT 3HRIA 4DEYA 3THKA 4BE2A 4H2WA 2DM1A 4FT4A 3CCRQ 1NJIR 2OTJA 1VQ7T 5FWBA 1NPRA 5CO7A 2AKWA 1ZUKA 3L2QA 3OMCA 3KFUA 4G85A 2YWWA 3V8KA 4M75D 2PVDB 4TVAA 4BI4A 3D7SB 1VQ8A 4CS4A 4AH6A 3RL6A 2CT4A 3QWYA 2YDLA 3CXCA 2EW3A 4J9EA 1WXBA 5D6XA 1XOVA 4X1VA 2AKWB 3G4ST 2IIMA 3NGPA 3HXZA 2RQRA 1OEBA 5CQXA 1IXDA 1MV0B 1QMCA 2AZVA 4OGCA 3MO8A 4IIMA 2XK0A 3A8OB 1JU5C 2Y4XA 1PKSA 5CKDA 2QK0A 2EQMA 3VQWA 1RAAB 3TEEA 1NG2A 1MNEA 2JMAA 1WX6A 4N0AA 5M9OA 4ZN3A 1N9RA 3LH0A 3RDVA 4CH6A 4J9CA 3X28B 3CC2T 2ZT7A 3VRYA 4MDWA 2ZZFA 4CH3A 1RLPC 2ROTA 4L59A 2K2MA 4IUVA 4LUDA 2J06A 3JSCA 1VQ9A 2NWMA 1Z9QA 5DLQE 4N4GA 4F7UB 1FWZA 1FMKA 2FEIA 3GP8A 3X26B 4FU6A 1NYRA 1QCOA 4BDYA 4PHCA 3MEUA 2QTVA 4ZN1A 2QI2A 2EYYA 2OJ2A 2NUTA 2OAWA 2LNVA 2JJ9A 2LT4A 2O4XB 1VQ8Q 2V8JA 1KHCA 1T3LA 3O8VA 2RI5A 1QVFS 1BBUA 2YSQA 5D6YA 4DQ2A 4M78E 4V2SA 4M78C 5KE2A 1QW1A 5IT9E 1HSQA 4LDYA 3CD6A 1X2QA 1YP5A 5LJ5d 3EGXB 4DA4A 1FYFA 2A28A 4OMPA 2FZCB 3EFRA 3PZCA 1B34A 2OTLT 2GBQA 4HT9A 4C92F 4CC4B 1QE0A 3BE3A 4KR3A 4CH4A 3SD4A 4YRCA 2FG0A 3UFGA 3QO3A 3CD6T 2CH4A 2JZ2A 2CGHA 3QNEA 1KD1R 4J5YA 2DRKA 2XDPA 3EFSA 2KI7A 4FL6A 1FX7A 4RTTA 3OBYA 1H4TA 3CQTA 2GCXA 2FL7A 3NTHA 4M75F 4P72C 4J6XA 1U1TA 1ASYA 1D0ZA 1PD0A 3FJPA 3M5AA 5GAMf 1RACB 1M3CA 4FSXA 1YJ9A 4MZTA 3G71A 2YLCA 3M0UA 1UB4A 1R0BG 4J15A 3PMTA 1OZ2A 2P0KA 3H0IA 4FIBA 3EG9B 1M1GA 3EG9A 1K8AU 1SKUB 5GANh 2M51A 2NUZA 3QJ6A 1YJWQ 1VQNT 3CC2A 3KUFA 1XNIA 1TTHB 1MMAA 3NFCA 2V8IA 1YFNA 1SG5A 1Q82U 5IHIA 4JPBW 1KC8R 3A8LB 4YCVA 2M9UA 1LJOA 4ELZC 2ZPFB 3TVTA 2FRYA 2JW4A 2DXTA 3M55A 2DTOA 1SEMA 5GAMj 4EDUA 2Q7HA 4HCCA 1SRLA 2C7IA 2X4JA 3G4SQ 3G6EA 1QWFA 3HP9A 3VS0A 1VQMA 2OTLA 1QVGS 4C8QD 5GAN6 3EG2A 3A5ZB 2R5AA 3HRSA 3REUA 4DBFA 3OYKA 3H0FA 5I2MA 4M7AG 2SEMA 1Q7YC 1PCXA 2H8HA 5GANe 4P3NA 2VVKA 2R5MA 4DBQA 4HWRA 4BW9A 1BI1A 2KK4A 4M75C 2QEXA 2DEUA 4K87A 1I07A 1HYOA 3P8VA 1UGQB 4Z88A 3ZL7C 2NYSA 4KQEA 2RNAA 4YRFA 2KBTA 1EVKA 5GAN7 3OS2A 4CI0C 5GANf 1I0CA 4PLLA 3T9NA 1M1FA 2BE7D 4OMOA 1KD1U 2DAQA 5GANd 4PJJA 2E3CA 2YRVA 2DL3A 4D8DA 3CCLQ 2BE9B 3REXA 4KBMB 1QLYA 4R55A 2KEAA 1YJNQ 5A2QE 1SHFA 4YRPA 1R8OB 2M0YA 2HBWA 3M9QA 5LJ3g 2ZT8A 2RMOA 1WHKA 3NMZC 2AMCB 3UA6A 1VQLA 2I4LA 2KMTA 3OSSC 2E41A 2Q7EA 1UHFA 2KXDA 2ZPIB 4KH1B 4TVWA 3SWNC 2ALYB 4OMQA 1VIEA 3CCRA 2QGFB 3MCAB 1YI2A 1VQ5Q 2SRCA 2YRDA 3NHNA 1VQ6Q 2RPNA 3L2VA 3A5YA 1NYFA 3FEOA 2P4RA 2L3PA 5A0LA 2COWA 4F7UG 1VQ7A 1X75C 3RF1A 1YI2T 3MF1A 1D0YA 2JTFA 2KYBA 5GMKh 2E70A 2GF7A 2O9VA 2PVOB 5I22A 4B6MA 4M7DF 2J3MA 5K1XA 1Y71A 2HKNA 3CCUQ 4P74A 4XQ3A 4PJOC 1PC0A 3QZ5B 1GXIE 8AT1B 1UTIA 1JJ2A 2H3JA 1JBMA 5CKFA 2MPXC 1WHJA 4BY6B 1YFSA 1JJ2S 2KVQG 1D09B 3NTKA 5GAMe 4ZNXA 2Q5IA 1LVKA 1JRIA 1XQHA 1H3HA 1KFZA 2AIRB 5AYFA 3L2ZA 2JTEA 2EGCA 1D3BA 1AEYA 5KH6A 3OYYA 3OYDA 2QA4A 4A4EA 1VQOT 4ELYC 4M7AE 5HGQA 3HSBA 5AT1B 1UHCA 2E65A 5KYNA 3JB9H 2J6FA 1EFNA 3RNJA 3UGQA 3ERRA 3EFOA 4J6WA 1WJSA 1VQMT 1TWBA 1TOVA 4PL6A 2QDLA 3I56T 1PSFA 4XU1A 4H2VA 2E5AA 2W0ZA 1LOJA 2OTJT 5HK3A 1NJ5A 4J83A 3CCRT 4C92E 2GNCA 2KR3A 3MQZA 1WHMA 5IXFA 4TVRA 4LD9K 2KT1A 2MAMA 3RIRA 2PVGB 2DXCA 1RIQA 3PCOA 2L3SA 4OF1A 3GNGA 2K9GA 2ZPHB 2CJ9A 5KYWA 1YJWA 5GAN2 3QXEB 4NL3A 3BDUA 5D6WA 1W4SA 5KYUB 3MF2A 3OD1A 4HWPA 2L5QA 5FU7B 3J80E 2QQSA 2K3BA 1K9MU 4PFPA 2G6FX 3G7ZA 4RTZA 1X55A 4PJOA 2MI6A 1WDXA 2COYA 4GY5A 3JCMe 2CUDA 4AFUC 2HEQA 2DIGA 2RHQA 3LWHA 4H2XA 2DQ0A 4M78A 4PJOF 2PNIA 2GFAA 4KUIA 3CCUA 3A98A 1SSFA 2P0PA 5DY9A 2LTOA 4M75E 3M58A 2DYIA 1U3OA 1S72A 2P5IA 4F14A 3EGXA 3HXYA 3BDLA 4IUUA 1VYTA 1G5HA 4WJ3M 4IURA 5I11A 4HWTA 4LN2A 1G3WA 1ATIA 1H8KA 5FRMA 2RQWA 4KR2A 1VYUA 1K73R 2YUNA 1Q82R 1RAGB 2KQWA 1YFTA 2DL5A 1BI2A 2LJ1A 3ICAA 2RN8A 3ULRB 1UGSB 5GAOr 1YHQQ 3NTIA 1U06A 1QKXA 1WI7A 4F17A 3L2UA 3CMQA 3GPLA 2GQIA 1JQQA 2R58A 2ZR3A 4E2FB 3CCEQ 5KYYB 4ZTZB 1OOTA 2HAXA 1KQ2A 4PFZA 2CH4W 1EZZB 3JCMJ 4P74C 1NE8A 2EQKA 3I55A 3HHTB 1ZUYA 1TU0B 1K73U 4BUGA 3PCOB 1KIKA 1ADYA 1YCSB 5CAIA 3V7RA 1QVGP 3LYIA 4F16A 1Z7MA 2E5KA 2FPDA 3C12A 3A1PA 4YRKA 2FZKB 4C92C 1NJIC 5KYYA 1ASZA 4AMCA 2K5FA 2JXBA 3C0CA 2ROLA 3CC7Q 1IB8A 3CBOA 3H8ZA 4J9HA 2X3XD 2H3EB 4P71C 1MMNA 1MUZA 3JB9G 4N4IA 2D0QB 1PRMC 2VASA 1AWJA 3QSUA 3CMET 2EQJA 3I7FA 1L0WA 2LQWA 1M8MA 1K0SA 3MP1A 3CCST 2K4YA 2ZCFB 2Z0WA 2E3HA 2IPOB 1KMNA 3QO8A 2CT3A 1G3SA 4JRQA 2V1RA 3HY1A 4M7AD 1E22A 1PYSA 3JCMW 1BBZA 1KQSS 1N9WA 3EHQA 1QQJA 4LNSA 4F04B 1KOGA 3MPUB 4AFZC 5CVIA 1PWTA 2QXFA 1VQMQ 4C0DB 3A32A 1N8RR 2EYQA 2VGNA 4LDVA 4OMNA 7AT1B 3OW2S 3BY7A 3JRZA 5KCHA 1SRMA 4O2DA 3JB9J 2ZTGA 1RABB 3L1AA 3FC3A 1WPYA 2ZIOA 3PE0A 1N5ZA 1EQRA 1H4SA 2GTOA 2CIMA 3CCJT 3JCMc 2JT4A 1IHWA 2DX1A 2XU8A 2RHSB 4QQDA 3I56A 2RQUA 1KC8U 1QVFA 2CS7A 2OTJQ 4M75A 3CCSQ 4ZTJA 4A4FA 2DK3A 5A0DA 4HT4A 2CP3A 1YHQA 1Q86R 2I4MA 4HWOA 2KAFA 4J6YA 3REAB 3SWNA 2RM4A 3A7RA 4RTWA 5KYXA 4NCXA 3VQYA 2EQUA 2ARTA 3QPHA 1K0XA 1VQOQ 2MWOA 1EX4A 1UGPB 3I55T 3AT1B 2ED1A 1ADJA 4MZPA 5FWCA 5IHNA 4C8QA 1AWWA 4BI3A 4TVYA 1T0HA 2ZAEA 2ZT5A 3HFVA 3CPWA 3JCMf 5CKHA 4E7HA 4PKCC 3EGDA 2CREA 2ZXFA 4ZGDB 3HKSA 2P4TA 1KD1C 2DILA 1ZSZA 1M5Q1 4K11A 4HVUA 3UA7A 4M77A 2ZNJA 2AT1B 3VS4A 1BI3A 4B9XA 4L5GA 1RAEB 2CP5A 2D0NA 1UJ0A 1G8XA 4XTUA 2DERA 3QZ9B 1RAIB 4Q5WA 4CRIA 1GCPA 1UGRB 4P5NA 3PVQA 2HSEB 1M90C 1B8AA 3OYGA 1E6GA 1Y7XA 5IN1A 4JRPA 2QQRA 3J7AF 4M78F 5GAN3 1ZQ1A 1VQ5T 2D6FA 3UT1A 12ASA 2RHZA 3W3SA 1YN8A 2QDYB 4RG2A 2OAUA 3CCMA 2FZGB 2RJCA 1E24A 4UP7A 1O75A 2ZCEA 4QKUA 4C0ZA 4YCUA 1GFCA 2VB6A 1M2VB 2RHYA 2VYTA 1MV3A 4CS2A 4XU2A 3CCVQ 1GCQA 1X56A 2QA4Q 4MDXA 1B7YA 5CQYA 4NL2A 3KXTA 1YB3A 3I35A 3TQ7P 4EMHA 3CMAQ 1QVGA 2J3LA 1SPKA 1ZA2B 1MGQA 3HFNA 4XEOA 3PVLA 2DRMA 2VKNA 3URGA 3VQXA 4JLIA 3MP8A 2K3XA 4GLMA 1M2VA 3SHWA 2P0QA 4E7LA 3GLXA 2CKKA 3OYIA 4RCBA 1G2BA 4C92G 3EG0A 2AKKA 4CC3A 2ZIMA 4JRIA 1JJ2P 5LJ5j 2O88A 1G83A 4M7DB 2P84A 1VQPA 1VQLT 1OU8A 1IO6A 2HMAA 3LH5A 1LYLA 3TEGA 1I1JA 3L2WA 1TG0A 5J26A 4EMGA 1Y07A 1S72T 1X2HA 5IAYA 2HDAA 2K5IA 2QHUA 2K5LA 3M4YA 5GANj 3JB9F 1YITQ 4K86A 1M3BA 2X4YA 4RTXA 4M7DA 4P3PA 4OMLA 1DJ7B 1I5OB 3G1JA 1PD1A 2I4OA 3CCJA 3X20B 3VS2A 4Y28E 4LDXA 2KNBB 3RGLA 1YJWT 3C4SA 1B7TA 2XKOC 1GFDA 1J5WA 5LJ3h 4A4HA 4F7UF 4F7UA 1E1OA 1VQKQ 4L87A 4H2SA 2LCSA 1AWXA 2CP0A 4IUPA 5C52B 1BIAA 1WJQA 2DVJA 3RESA 3SDZA 1S72Q 5IXBA 4YRJA 1IRXA 1JXOA 2QEXT 4BWAA 5FU6B 1BIBA 2BTTA 1VQ4A 1WNLA 4PJMA 2YT6A 4WTOB 5GAOq 1EIYA 3V7SA 5C0MA 1OV3A 4XTYA 1NNHA 2W10A 3FLGA 1OPKA 3M0RA 3CBPA 4A63B 2ESWA 2C0TA 2EJGA 1M1KR 1PM3A 3M59A 3P8HA 4C92A 1QKWA 2RF0A 3INZA 4WF2A 3VV0A 1BBWA 4J9DA 5FW9A 1EIFA 4LVKA 1UEBA 2P0LA 2MIOA 4QQ6A 1YJNT 2DZ9A 3LX7A 1Q86U 2OTLQ 4EX5A 2EPDA 4J8OA 4BI8B 4D6WA 2QAZA 1Z9ZA 3HFOA 1X2GA 4M75B 3QO7A 2DA9A 2KGTA 2LNHB 2A08A 1AVZC 2EFIA 2RD1A 4YPFA 1U8RA 3META 2KXCA 3CC4A 3E9HA 1WXTA 1W2BS 1NJ6A 4YRMA 2AKLA 3NETA 2ODRC 4YRTA 2AK5A 2EVRA 3KBGA 1TUCA 3SEMA 2RHXA 2ZPGB 3O5ZA 3CC2Q 4QVZA 1H4VB 1PG5B 3JV3A 3DB3A 2O2OA 3MEWA 1G5IA 4P71A 2LZ6B 4OB1B 2CDTA 2FB7A 3A8GB 2DVEA 3VBBA 1G3TA 2RO0A 3EH1A 1Y96A 6AT1B 3EGDB 1KMMA 1D3BB 2LJ0A 3G71Q 2K6DA 3GBQA 1RADB 1KG1A 2G3RA 4TVAB 5ELOA 1EOVA 2LVMA 2D9TA 4HCKA 2JS0A 1VQZA 1T0JA 1XTDA 2IY5A 2MMPA 3KFVA 3N5BB 2A36A 5GAN4 2XGTA 1AT1B 1WHHA 3TREA 5CK9A 4RTUA 1BK2A 1PHTA 1WXUA 4E51A 3WQZA 2EKHA 2YUOA 3HXUA 4LD6A 2YXYA 3JCMd 2IY5B 4QW2A 1ZA1B 2NS6A 3V8LA 2LJ3A 4BB7A 1VQLQ 2I4NA 3DKMA 3HXWA 3LWIA 2DTIA 1I5LA 4WI1A 2XDBA 1X69A 5KE3A 1X43A 1LCKA 2FYKA 2M02A 2F2WA 4E7IA 1WA7A 2JMCA 1NYQA 1VA7A 2XMFA 1M90U 4LVLA 2KROA 1X6BA 5DLOA 1BU1A 3JB9D 2M16A 2X4XA 3BJUA 4PG3A 5FROA 4Q15A 3DSQA 4RDXA 5FRNA 4C92D 4LUEA 1NLPC 3ZBDA 3RERA 2ZR2A 4PJOE 1ZX6A 1GBQA 1NJ8A 2NLUA 3OYEA 3M4PA 2DF6A 4E7KA 2CSQA 5GAOm 5LJ3e 2YRCA 4X5OA 2DIQA 4VUBA 2X4WA 3PIPA 2QYZA 2E1HA 4PK4A 2VV5A 5GAMg 3VRZA 4XAXB 3CC7A 3CMAT 1YBYA 2ZPBB 2E5QA 4KGXB 3RMQA 2ALYA 4AG2C 1M3AA 3OS1A 1E6HA 3VJPA 3NELA 4HVCA 1SF9A 2GQVA 4EIKA 1E7OA 1I81A 4EMKA 3QWXX 3A7AA 2EWNA 2VGMA 2L0AA 2RHQB 3ASKA 3JCMQ 2RJEA 3J81E 2DJZA 4RMFA 1WZOA 1J3TA 4H2UA 1HXDA 3OYCA 1OQKA 1ZSZC 2BKDN 1FMWA 3F70A 3CCEA 4PNOA 4M75G 4C8QE 5LJ5h 3CBMA 1B3QA 1QCFA 2GTJA 4ZTUB 3FIFA 2ZPEB 3OMGA 1W70A 1WLEA 4LDUA 2A3LA 3HRKA 2DNUA 1K8AR 2R57A 4YYEA 2DPPB 3HFZA 3UH0A 2K79A 4YRLA 1YJ9Q 4RG8A 1ZSZB 4HCZA 4J9BA 2O9SA 2F5KA 4RTYA 1R77A 1VQPT 5ELNA 2DU5A 4XTXA 2A37A 2F2XA 3L4GA 2XDDA 3JCMg 1K9MR 2K57A 2PTKA 5LJ3j 2O31A 3OYAA 1QF6A 1D1CA 3UWNA 1NM7A 1VQOA 4OMMA 3MEAA 1LNXA 3E2UA 1AWOA 2WSEE 5IH2A 1P92A 4WJ4A 3R6NA 1VQ9T 4JRKA 1MMDA 1FYNA 4ESRA 3OYHA 4OGEA 1VOMA 3QKJA 1D1AA 1UUEA 3GOXA 4LDWA 5GMKj 2ENMA
chains in the Genus database with same CATH topology
1NJ2A 1B70A 5GMKe 2HQEA 4JUVA 3JCMh 2ARSA 2DTHA 1NJIU 4DPGA 4TQDA 1WQ7A 11ASA 2A8EA 1YIJT 5I2SA 4X9CA 4NS5A 4KUDK 4HT8A 2O01E 5F5WA 3EAEA 3CPFA 1KQ1A 4X34A 1M1KU 4BE1A 1VIFA 5FU7C 3UPUA 2ZZGA 4P73C 4C8QF 3VUBA 2RHUA 3LGFA 1FXXA 3WXMB 2L89A 3MP6A 4C92B 3CC7T 4XU3A 5C51B 3A8HB 4ATOA 1YJ9T 3HY0A 4RQFA 3BFMA 5J39A 2PMEA 3RUXA 4FM4B 1YCYA 3C95A 3ZEHA 4E7JA 4BE0A 2ZT6A 4YRRA 4BD3A 3VQVA 5GMKi 3G6ET 4C5HA 5I21A 3LC0A 2Y90A 1VQ6T 1B76A 1NPPA 2RI3A 3JB9I 1PSEA 2CJAA 3UGTA 2JNGA 1W66A 5CIUA 4YROA 4YRSA 1WYDA 4PJOD 4F7UE 1SESA 1Q7YU 2XHCA 2ARUA 4P3OA 2IG0A 3M4GA 1N8RC 3OYMA 3PNWC 1WQWA 3VU3C 4PJOB 1YITA 2HQXA 3OY9A 4Q6GA 4EO4A 1QP2A 1WU7A 5GAMh 2DDZA 2EAYA 2O4XA 5LL6S 3CCLT 2QQAA 2WACA 5GAOp 2Q7GA 5E3IA 3C94A 2PU9B 4TWAA 1YHQT 4C0DC 1EFWA 2M0OA 2LX9A 3HRUA 4YTLA 2LC4A 4A4KA 2XTIA 3M4QA 1Q86C 5EG2A 2ZZEA 2E6NA 4ZGEB 2G4CA 5HK0A 3A7UA 1WGSA 3CEYA 3H6ZA 2XG8D 2DQ3A 1VQNA 2DD4A 3R6OA 3P8DA 3JCMb 1ZBXA 5HKCA 4C5GA 3CMEA 3E19A 2RK1A 3CCVA 2F5TX 2YLBA 4C0GA 3OW2A 4HWSA 2K3YA 5KCOA 1BKBA 4UP8A 5A0GA 4A53A 1RL2A 1U1SA 3JAME 2CZ0B 2RJDA 4G84A 2VUBA 4DOVA 5FU6C 2E12A 2MF2A 2RA2A 1H641 4IUQA 3WVDB 1M1KC 1IREB 1YITT 2MWPA 2RI2A 1VQ4T 5L8RE 4M77G 3GF5A 1E1TA 4P75A 3X24B 1H3ZA 5J3BA 1I8FA 4L6V5 3M54A 4R56A 3M56A 4OLFA 1HC7A 4EPCA 3SB2A 3QUIA 5FLXE 5GAMd 2LQ8A 5GMKm 4A54A 3A31A 2EJ9A 3QYHB 3G71T 4XU0A 4B9WA 1YFRA 4YRIA 3OYLA 3CC4T 3CCUT 5GAOl 3E9FA 2ZINA 1VQKA 4M77F 4DOWA 4N4HA 2M1HA 1N27A 2E6ZA 2RHSA 4CS3A 4XEMA 2XICA 2CZ6B 4QQGA 2LCCA 2E64A 1TH7A 3ZFJA 3RKYA 1YIJA 2CZ7B 5GAN8 1BYMA 5KNNA 2QHSA 1Y96B 2QA4T 3HPWA 2KSSA 2AMCA 4BACA 4H2TA 3VYGA 5CKEA 2DXUA 5GAOn 3V7CA 4MZMA 3M57A 4MMKA 2DKGA 2XI9A 1VQ8T 3UDCA 3OS5A 4RKUE 3VKIA 4M7DG 1JJCA 3HL8A 3OYJA 3OB9A 3IG2A 2KY9A 4OB2B 3A5ZA 1B34B 4ZIBA 3CMAA 1OZ3A 2XD0A 4KT0E 4UC4A 4TTVA 2ZZDA 4C0FA 3TU4K 3E9GA 4FT2A 2QHTA 2JN0A 2L3RA 4UPAA 3PT9A 2PUOB 4H02A 2Q5HA 2PQWA 2BIVA 3P8YA 1SETA 4M78D 3L4GB 4YRGA 2HBPA 1HTTA 3LLRA 4TQFA 3M53A 4J7FA 4QVCA 4JS4A 2VXEA 1JB0E 4OMFB 3RMSA 2CYZB 5CKBA 1QVPA 2KDSA 4P73A 2EJFA 4NOYA 4YCWA 4P72A 4YRNA 4JLGA 3Q1JA 1N8RU 4M7AC 2DD5A 1NZ9A 3IKLA 1KHIA 5CCAA 3S6WA 4X9DA 1N6AA 4M78B 1ZHIA 2GFUA 1MHNA 2RH2A 1H4QA 1EVLA 3OA6A 3GNFB 4C5EA 4K88A 5HY6A 5GMKl 4MMLA 2EL9A 5GANg 1C0AA 5K1PA 3CCVT 3HRTA 1KC8C 3MEVA 1GGMA 3LW5E 3OBWA 2QTXA 2DEQA 3QJYA 1G3YA 1B7YB 4OB0B 2DU7A 1AHJB 3OYNA 3FB9A 3CCSA 4M77D 2FHDA 1M8VA 5LJ5f 1Z7NA 3ER0A 2ODRD 4PJOG 2DO3A 4RMOA 2DXBA 3GIBA 3PGGA 2RK2A 2HNIA 2E10A 2L8DA 3TUPA 3S3OA 4C5IA 3ME9A 1WJRA 4OP0A 2QHVA 2LT1A 2VXFA 4XTWA 3MHXA 4C8QG 4M7AF 1VUBA 3OYFA 4YP0A 4HA8A 2HD0A 1QP3A 2VC8A 4HCBA 1PYSB 4E47A 3DLLA 3A74A 4JJNK 2JOYA 4M7DC 3QBYA 3FRNA 3BW1A 4OB3B 3QIIA 4PLIA 4II1A 1Q81C 4M78G 4M77E 5GAN5 4LVJA 3CCQT 2QQBA 1Q82C 2LQKA 4M7AA 5C6SA 4XTVA 5DM7R 4XTZA 3NEMA 5C53B 3E1SA 2F69A 2V8KA 2RHIA 4Z02A 3TCJA 3E9IA 3OSVA 2WSFE 4RCCA 3L2RA 4OVAA 3LGLA 1VQ6A 1SERA 3RACA 1W2BA 4XK8E 2DZCA 2ZGWA 3HTZA 4QVDA 3V8JA 4M7DD 2XIDA 2I2LA 2LRQA 1JJCB 1G5VA 3AHUA 4CH5A 5LJ3d 3HXVA 1YJNA 4C8QB 4H2YA 1RI0A 3LSSA 4C8QC 3CCLA 4JS5A 3TEHA 3VUZA 3JCMP 3TEHB 3WVEB 2EKOA 2LCLA 1O9SA 1I4K1 1BI0A 4EMKC 2BUDA 4YREA 3QG1A 2JUFA 1K8AC 3CXCS 3L42A 2EIFA 2K2VA 1IL2A 2CJBA 2RB6A 3JCMX 3OYBA 1M9SA 3CCQA 4A4GA 2JVVA 3G1ZA 1B70B 5LJ5e 4M7AB 1K9MC 1X6OA 3QHSA 4ZTFA 1NJ1A 4YDQA 4H2XB 1USYC 2PMFA 4M77C 2Y4YA 4O5VA 4M7DE 4J7IA 1X54A 4JDSA 3IKMB 4UP9A 3HFZB 3CPWS 3HXXA 2B8AA 4N0AC 4BY6C 3G4SA 4ME7A 2ZNIA 4LVMA 4RQEA 1YGBA 3OQ5A 2QQ9A 4M77B 3CCET 4GLKA 1X01A 4KULA 2C8MA 1USYA 3PIOA 3P8TA 3QTCA 3MEYA 5LJ5g 3DLMA 4EMKB 2CZ1B 3QDRB 4LVIA 3FDRA 3PMIA 3X25B 1EIYB 1N9SA 4Y91A 3LSQA 3SFMA 2IVWA 1M4ZA 2FVUA 2AHJB 4ZGJB 3CCMT 2RJFA 3VYHB 1HK9A 3P8BB 3S3MA 2X35A 3RKXA 2JTMA 4IUTA 3DB4A 1OI1A 1V29B 3SWNB 3S3NA 1K73C 3RKWA 1IZ6A 2LDMA 4HKEA 2YHTA 1OYXA 3A8MB 2PUKB 3PTAA 1G51A 2WSCE 4O6JA 3JCMV 3OS0A 1Q81U 3R07A 1KQSA 1SRYA 3IALA 3PFSA 4BDZA 2C06A 4IKFA 3NENA 4YRQA 5LJ3f 3QYGB 2A7YA 3QO5A 4P75C 1VQ5A 5CR2A 1VQKT 3HRIA 4BE2A 4H2WA 4FT4A 2OTJA 1VQ7T 1NPRA 5CO7A 2AKWA 3L2QA 3OMCA 3KFUA 4G85A 3V8KA 4M75D 2PVDB 4TVAA 4BI4A 1VQ8A 4CS4A 4AH6A 3RL6A 3CXCA 5D6XA 1XOVA 2AKWB 3G4ST 3HXZA 5CQXA 4OGCA 3MO8A 2XK0A 3A8OB 2Y4XA 5CKDA 2EQMA 3VQWA 3TEEA 4N0AA 5M9OA 4ZN3A 1N9RA 3LH0A 4CH6A 3X28B 3CC2T 2ZT7A 4MDWA 2ZZFA 4CH3A 4L59A 4IUVA 3JSCA 1VQ9A 5DLQE 4N4GA 4F7UB 1FWZA 3GP8A 3X26B 4FU6A 1NYRA 4BDYA 4PHCA 3MEUA 4ZN1A 2QI2A 2LNVA 2LT4A 2O4XB 2V8JA 1KHCA 3O8VA 2RI5A 1QVFS 1BBUA 5D6YA 4DQ2A 4M78E 4V2SA 4M78C 5KE2A 1QW1A 5IT9E 4LDYA 3CD6A 5LJ5d 4DA4A 1FYFA 3EFRA 3PZCA 1B34A 2OTLT 4HT9A 4C92F 1QE0A 4KR3A 4CH4A 3SD4A 4YRCA 3UFGA 3QO3A 3CD6T 2JZ2A 2CGHA 3QNEA 4J5YA 2XDPA 3EFSA 4FL6A 1FX7A 3OBYA 1H4TA 2GCXA 2FL7A 3NTHA 4M75F 4P72C 4J6XA 1U1TA 1ASYA 3FJPA 3M5AA 5GAMf 4FSXA 1YJ9A 4MZTA 3G71A 2YLCA 1UB4A 4J15A 3PMTA 1OZ2A 2P0KA 4FIBA 1M1GA 1K8AU 5GANh 3QJ6A 1VQNT 3CC2A 3KUFA 1XNIA 3NFCA 2V8IA 1Q82U 3A8LB 4YCVA 2M9UA 1LJOA 4ELZC 2ZPFB 2DXTA 3M55A 2DTOA 5GAMj 4EDUA 2Q7HA 4HCCA 2C7IA 2X4JA 3G6EA 3HP9A 1VQMA 2OTLA 1QVGS 4C8QD 5GAN6 3A5ZB 2R5AA 3HRSA 3REUA 3OYKA 5I2MA 4M7AG 1Q7YC 5GANe 4P3NA 2R5MA 4BW9A 4HWRA 1BI1A 2KK4A 4M75C 2QEXA 4K87A 3P8VA 1UGQB 4KQEA 4YRFA 1EVKA 5GAN7 3OS2A 4CI0C 5GANf 4PLLA 3T9NA 1M1FA 1KD1U 2DAQA 5GANd 2E3CA 2YRVA 3REXA 4KBMB 4R55A 5A2QE 4YRPA 1R8OB 5LJ3g 3M9QA 2ZT8A 2AMCB 1VQLA 2I4LA 2KMTA 3OSSC 2E41A 2Q7EA 2ZPIB 4TVWA 3SWNC 2ALYB 1VIEA 3CCRA 3MCAB 1YI2A 3A5YA 3L2VA 3FEOA 5A0LA 4F7UG 1VQ7A 1X75C 3RF1A 1YI2T 3MF1A 2JTFA 5GMKh 2E70A 2GF7A 2PVOB 4M7DF 2J3MA 5K1XA 1Y71A 4P74A 4XQ3A 4PJOC 3QZ5B 1GXIE 1JJ2A 2H3JA 1JBMA 5CKFA 4BY6B 1YFSA 1JJ2S 2KVQG 3NTKA 5GAMe 2Q5IA 1JRIA 1XQHA 5AYFA 3L2ZA 1D3BA 5KH6A 3OYYA 3OYDA 2QA4A 4A4EA 1VQOT 4ELYC 4M7AE 5HGQA 3HSBA 2E65A 3JB9H 3UGQA 3ERRA 4J6WA 1WJSA 1VQMT 4PL6A 3I56T 1PSFA 4XU1A 4H2VA 2E5AA 1LOJA 2OTJT 5HK3A 1NJ5A 4J83A 3CCRT 4C92E 3MQZA 4TVRA 4LD9K 2MAMA 3RIRA 2PVGB 2DXCA 1RIQA 3PCOA 4OF1A 3GNGA 2ZPHB 2CJ9A 1YJWA 5GAN2 3QXEB 4NL3A 3BDUA 5D6WA 1W4SA 3MF2A 3OD1A 4HWPA 2L5QA 5FU7B 3J80E 2QQSA 1K9MU 3G7ZA 1X55A 4PJOA 2MI6A 4GY5A 3JCMe 2DIGA 2RHQA 3LWHA 4H2XA 2DQ0A 4M78A 4PJOF 2GFAA 4KUIA 3CCUA 1SSFA 2P0PA 5DY9A 2LTOA 4M75E 3M58A 1S72A 2P5IA 3HXYA 3BDLA 4IUUA 1G5HA 4WJ3M 4IURA 4HWTA 1G3WA 1ATIA 5FRMA 4KR2A 2KQWA 1YFTA 1BI2A 3ICAA 1UGSB 5GAOr 3NTIA 3L2UA 3CMQA 3GPLA 2R58A 2ZR3A 4ZTZB 2HAXA 1KQ2A 3JCMJ 4P74C 1NE8A 2EQKA 3I55A 3HHTB 1K73U 4BUGA 3PCOB 1ADYA 5CAIA 3V7RA 3LYIA 1Z7MA 3C12A 4YRKA 4C92C 1NJIC 1ASZA 2K5FA 3H8ZA 3CBOA 4P71C 3JB9G 4N4IA 2D0QB 3QSUA 3CMET 2EQJA 3I7FA 1L0WA 3MP1A 3CCST 2K4YA 2ZCFB 1KMNA 3QO8A 1G3SA 4JRQA 3HY1A 4M7AD 1E22A 1PYSA 3JCMW 1KQSS 1N9WA 4LNSA 1KOGA 5CVIA 2QXFA 4C0DB 3A32A 2EYQA 2VGNA 4LDVA 3OW2S 3BY7A 3JRZA 5KCHA 4O2DA 3JB9J 2ZTGA 3FC3A 3L1AA 1WPYA 2ZIOA 1EQRA 1H4SA 2CIMA 3CCJT 3JCMc 2XU8A 2RHSB 4QQDA 3I56A 1KC8U 1QVFA 2CS7A 4M75A 4ZTJA 4A4FA 2DK3A 5A0DA 4HT4A 1YHQA 2I4MA 4HWOA 2KAFA 4J6YA 3SWNA 2RM4A 3A7RA 4NCXA 3VQYA 2EQUA 2ARTA 3QPHA 2MWOA 1UGPB 3I55T 1ADJA 4MZPA 4C8QA 4BI3A 4TVYA 2ZT5A 3HFVA 3CPWA 3JCMf 5CKHA 4E7HA 4PKCC 2ZXFA 4ZGDB 3HKSA 2P4TA 1KD1C 1M5Q1 4M77A 2ZNJA 1BI3A 4B9XA 4L5GA 4XTUA 3QZ9B 4Q5WA 4CRIA 1UGRB 4P5NA 1M90C 1B8AA 3OYGA 1Y7XA 5IN1A 4JRPA 2QQRA 3J7AF 4M78F 5GAN3 1ZQ1A 1VQ5T 2D6FA 3UT1A 12ASA 2RHZA 3W3SA 2QDYB 4RG2A 2OAUA 3CCMA 2RJCA 1E24A 4UP7A 1O75A 2ZCEA 4C0ZA 4YCUA 2RHYA 2VYTA 4CS2A 4XU2A 1X56A 4MDXA 1B7YA 5CQYA 4NL2A 3KXTA 1YB3A 4EMHA 1QVGA 2J3LA 1MGQA 3HFNA 4XEOA 3URGA 3VQXA 4JLIA 3MP8A 2K3XA 2P0QA 4E7LA 3GLXA 2CKKA 3OYIA 4RCBA 4C92G 2ZIMA 4JRIA 5LJ5j 4M7DB 1VQPA 1VQLT 1LYLA 3TEGA 3L2WA 5J26A 4EMGA 1Y07A 1S72T 1X2HA 5IAYA 2K5IA 2QHUA 2K5LA 3M4YA 5GANj 3JB9F 4K86A 4M7DA 2X4YA 4P3PA 1DJ7B 2I4OA 3CCJA 3X20B 4Y28E 4LDXA 3RGLA 1YJWT 3C4SA 2XKOC 1J5WA 5LJ3h 4A4HA 4F7UF 4F7UA 1E1OA 4L87A 4H2SA 4IUPA 5C52B 1BIAA 1WJQA 3RESA 3SDZA 4YRJA 2QEXT 4BWAA 5FU6B 1BIBA 1VQ4A 1WNLA 5GAOq 1EIYA 3V7SA 5C0MA 4XTYA 1NNHA 3FLGA 3CBPA 2EJGA 3M59A 3P8HA 4C92A 3VV0A 3INZA 4WF2A 1BBWA 1EIFA 4LVKA 1UEBA 2P0LA 4QQ6A 1YJNT 2DZ9A 3LX7A 1Q86U 4EX5A 4J8OA 4BI8B 4D6WA 3HFOA 1X2GA 4M75B 3QO7A 2EFIA 2RD1A 4YPFA 1U8RA 3META 3CC4A 3E9HA 1W2BS 1NJ6A 4YRMA 3NETA 2ODRC 4YRTA 3KBGA 2RHXA 2ZPGB 4QVZA 1H4VB 3DB3A 3MEWA 1G5IA 4P71A 4OB1B 3A8GB 2FB7A 2DVEA 3VBBA 1G3TA 2RO0A 1Y96A 1KMMA 1D3BB 1KG1A 2G3RA 4TVAB 5ELOA 1EOVA 2LVMA 2D9TA 1VQZA 1XTDA 2IY5A 2MMPA 3N5BB 5GAN4 2XGTA 5CK9A 3TREA 4E51A 3WQZA 3HXUA 4LD6A 3JCMd 2IY5B 4QW2A 2NS6A 3V8LA 4BB7A 2I4NA 3DKMA 3HXWA 3LWIA 2DTIA 1I5LA 4WI1A 2XDBA 5KE3A 2FYKA 4E7IA 1NYQA 1M90U 4LVLA 5DLOA 3JB9D 2M16A 4PG3A 2X4XA 3BJUA 5FROA 4Q15A 3DSQA 4RDXA 5FRNA 4C92D 3ZBDA 3RERA 2ZR2A 4PJOE 1NJ8A 2NLUA 3OYEA 3M4PA 4E7KA 5GAOm 5LJ3e 4X5OA 2DIQA 4VUBA 2X4WA 3PIPA 2E1HA 2VV5A 5GAMg 3CC7A 4XAXB 3CMAT 1YBYA 2ZPBB 2E5QA 3RMQA 2ALYA 3OS1A 3VJPA 3NELA 4HVCA 2GQVA 1I81A 4EMKA 3A7AA 2EWNA 2VGMA 2RHQB 3ASKA 3JCMQ 2RJEA 3J81E 2DJZA 4RMFA 4H2UA 1HXDA 3OYCA 2BKDN 3F70A 3CCEA 4PNOA 4M75G 4C8QE 5LJ5h 3CBMA 4ZTUB 3FIFA 2ZPEB 3OMGA 1WLEA 4LDUA 2A3LA 3HRKA 2R57A 4YYEA 2DPPB 3HFZA 3UH0A 4YRLA 4RG8A 4HCZA 2F5KA 5ELNA 1VQPT 2DU5A 4XTXA 3L4GA 2XDDA 3JCMg 2K57A 5LJ3j 3OYAA 1QF6A 3UWNA 1VQOA 3MEAA 1LNXA 2WSEE 1P92A 4WJ4A 1VQ9T 4JRKA 3OYHA 4OGEA 3QKJA 3GOXA 4LDWA 5GMKj
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJ2 A;  4XTU A;  1B70 A;  3FB9 A;  5GMK e;  4JUV A;  4M77 D;  3JCM h;  2ARS A;  2DTH A;  1M8V A;  5LJ5 f;  1Z7N A;  4YCV A;  4DPG A;  1B8A A;  2ODR D;  1WQ7 A;  4PJO G;  4TQD A;  1LJO A;  4M78 F;  5GAN 3;  3GIB A;  2DXT A;  3PGG A;  11AS A;  2DTO A;  2HNI A;  2E10 A;  12AS A;  5GAM j;  3TUP A;  3W3S A;  2Q7H A;  2C7I A;  4OP0 A;  4X9C A;  1E24 A;  2QHV A;  4UP7 A;  2ZCE A;  4HT8 A;  4YCU A;  5F5W A;  2VXF A;  4C8Q D;  5GAN 6;  4XTW A;  1KQ1 A;  4C8Q G;  4M7A F;  4CS2 A;  4XU2 A;  3REU A;  1X56 A;  2ZZG A;  4M7A G;  1B7Y A;  4P73 C;  4YP0 A;  4HA8 A;  4NL2 A;  4C8Q F;  1YB3 A;  4EMH A;  2VC8 A;  5GAN e;  4P3N A;  4BW9 A;  4HWR A;  4M75 C;  2J3L A;  3HFN A;  1MGQ A;  4C92 B;  4K87 A;  4XEO A;  4XU3 A;  5C51 B;  1PYS B;  3P8V A;  3A74 A;  3VQX A;  4M7D C;  3BW1 A;  4JLI A;  3HY0 A;  4KQE A;  3BFM A;  4YRF A;  4RQF A;  4M78 G;  4M77 E;  5GAN 5;  4RCB A;  1EVK A;  5GAN 7;  2PME A;  4C92 G;  3RUX A;  5GAN f;  1YCY A;  2ZIM A;  4JRI A;  4M7A A;  2ZT6 A;  5LJ5 j;  4YRR A;  4XTV A;  4M7D B;  5GAN d;  4XTZ A;  2E3C A;  3VQV A;  5GMK i;  3LC0 A;  3NEM A;  5I21 A;  5C53 B;  3REX A;  2Y90 A;  1B76 A;  1LYL A;  3TEG A;  3JB9 I;  4YRP A;  4EMG A;  2CJA A;  3UGT A;  1W66 A;  3E9I A;  4YRO A;  1X2H A;  4YRS A;  1WYD A;  4PJO D;  5LJ3 g;  4F7U E;  2ZT8 A;  1SES A;  4RCC A;  2QHU A;  2AMC B;  2I4L A;  5GAN j;  3JB9 F;  2E41 A;  2ARU A;  2Q7E A;  4P3O A;  1SER A;  3M4G A;  4K86 A;  4M7D A;  4P3P A;  4TVW A;  3SWN C;  3RAC A;  2ALY B;  1WQW A;  3VU3 C;  4PJO B;  2DZC A;  2ZGW A;  4Q6G A;  4EO4 A;  3HTZ A;  2I4O A;  4QVD A;  3V8J A;  1WU7 A;  4M7D D;  5GAM h;  2DDZ A;  2EAY A;  3A5Y A;  2I2L A;  1JJC B;  5GAO p;  3RGL A;  3AHU A;  2Q7G A;  4F7U G;  1J5W A;  5E3I A;  5LJ3 d;  4CH5 A;  5LJ3 h;  4F7U F;  4F7U A;  3RF1 A;  1E1O A;  3HXV A;  3MF1 A;  4TWA A;  4C8Q B;  1EFW A;  4H2Y A;  3LSS A;  4L87 A;  4C8Q C;  3TEH A;  3JCM P;  4H2S A;  3TEH B;  2XTI A;  3M4Q A;  5C52 B;  2ZZE A;  1BIA A;  1I4K 1;  5GMK h;  4EMK C;  3RES A;  4YRJ A;  4YRE A;  2G4C A;  4BWA A;  3A7U A;  4M7D F;  2J3M A;  5K1X A;  1BIB A;  4P74 A;  1IL2 A;  4XQ3 A;  4PJO C;  2CJB A;  1WNL A;  1JBM A;  2RB6 A;  2DQ3 A;  3JCM X;  5GAO q;  1EIY A;  3V7S A;  1YFS A;  3G1Z A;  5GAM e;  4XTY A;  2Q5I A;  1NNH A;  3JCM b;  1JRI A;  1B70 B;  5LJ5 e;  4M7A B;  3QHS A;  1NJ1 A;  2EJG A;  3L2Z A;  4YDQ A;  4C92 A;  1D3B A;  1USY C;  2PMF A;  3INZ A;  4WF2 A;  1BBW A;  4H2X B;  4M77 C;  2YLB A;  4M7A E;  2P0L A;  4HWS A;  5HGQ A;  3HSB A;  4M7D E;  1X54 A;  3IKM B;  4UP9 A;  3HFZ B;  2E65 A;  2DZ9 A;  3HXX A;  4EX5 A;  4UP8 A;  3JB9 H;  4N0A C;  4A53 A;  3HFO A;  1X2G A;  2ZNI A;  3UGQ A;  1U1S A;  4M75 B;  3ERR A;  4RQE A;  1YGB A;  3QO7 A;  4G84 A;  4J6W A;  4M77 B;  1X01 A;  2C8M A;  1USY A;  2RD1 A;  4XU1 A;  2RA2 A;  1H64 1;  4H2V A;  2E5A A;  4YPF A;  1LOJ A;  3P8T A;  3QTC A;  3MEY A;  1NJ5 A;  5LJ5 g;  3E9H A;  4C92 E;  4EMK B;  4M77 G;  1NJ6 A;  4YRM A;  1E1T A;  4P75 A;  1EIY B;  1N9S A;  3NET A;  3RIR A;  4Y91 A;  2ODR C;  4YRT A;  1RIQ A;  3LSQ A;  3PCO A;  2CJ9 A;  1I8F A;  5GAN 2;  1H4V B;  4NL3 A;  3BDU A;  4HWP A;  3OD1 A;  3MF2 A;  1HK9 A;  1G5I A;  4P71 A;  2FB7 A;  1X55 A;  4PJO A;  3RKX A;  2DVE A;  3VBB A;  3JCM e;  4OLF A;  1HC7 A;  1Y96 A;  3SB2 A;  3QUI A;  1KMM A;  2RHQ A;  5GAM d;  1D3B B;  2DQ0 A;  4H2X A;  3SWN B;  4M78 A;  3RKW A;  5GMK m;  4PJO F;  2YHT A;  4A54 A;  3A31 A;  4TVA B;  5DY9 A;  2EJ9 A;  4M75 E;  5ELO A;  4XU0 A;  1EOV A;  2P5I A;  1YFR A;  1VQZ A;  4YRI A;  1G51 A;  3HXY A;  4WJ3 M;  1G5H A;  4HWT A;  5GAO l;  2IY5 A;  3JCM V;  3R07 A;  2ZIN A;  1SRY A;  3IAL A;  4M77 F;  5GAN 4;  2XGT A;  1ATI A;  4KR2 A;  3NEN A;  1YFT A;  4E51 A;  4YRQ A;  5LJ3 f;  2RHS A;  3WQZ A;  3ICA A;  3QO5 A;  3HXU A;  4P75 C;  4CS3 A;  4XEM A;  5GAO r;  3HRI A;  3JCM d;  3CMQ A;  2IY5 B;  4H2W A;  2ZR3 A;  2E64 A;  1TH7 A;  4ZTZ B;  2AKW A;  1KQ2 A;  3RKY A;  3V8L A;  3KFU A;  3JCM J;  4G85 A;  4P74 C;  5GAN 8;  3V8K A;  4M75 D;  2I4N A;  5KNN A;  3HXW A;  4TVA A;  2QHS A;  2DTI A;  1I5L A;  1Y96 B;  4WI1 A;  4CS4 A;  3PCO B;  4AH6 A;  3RL6 A;  2AMC A;  1ADY A;  4H2T A;  5CAI A;  3V7R A;  2DXU A;  5GAO n;  1Z7M A;  2FYK A;  3V7C A;  2AKW B;  4YRK A;  1NYQ A;  4MMK A;  4C92 C;  1ASZ A;  2DKG A;  3HXZ A;  3JB9 D;  3BJU A;  4PG3 A;  4M7D G;  1JJC A;  4P71 C;  3DSQ A;  4Q15 A;  4RDX A;  3JB9 G;  4C92 D;  3IG2 A;  3QSU A;  3VQW A;  3RER A;  2ZR2 A;  4PJO E;  3A5Z A;  1B34 B;  1NJ8 A;  3I7F A;  1L0W A;  4N0A A;  3M4P A;  1N9R A;  4CH6 A;  4ZIB A;  2ZT7 A;  5GAO m;  2ZZF A;  1KMN A;  4CH3 A;  5LJ3 e;  3QO8 A;  4X5O A;  4TTV A;  3HY1 A;  4M7A D;  1E22 A;  1PYS A;  2E1H A;  3JCM W;  5GAM g;  1N9W A;  2QHT A;  2JN0 A;  4LNS A;  4UPA A;  4F7U B;  1KOG A;  2ALY A;  3A32 A;  3NEL A;  1NYR A;  4HVC A;  4H02 A;  2Q5H A;  3BY7 A;  4PHC A;  1I81 A;  4EMK A;  3P8Y A;  4O2D A;  3JB9 J;  2ZTG A;  3L1A A;  1SET A;  1WPY A;  4M78 D;  2ZIO A;  3A7A A;  2EWN A;  3L4G B;  1EQR A;  4YRG A;  1H4S A;  1HTT A;  2CIM A;  2RHQ B;  3JCM c;  3JCM Q;  4RMF A;  2DJZ A;  1BBU A;  4TQF A;  4H2U A;  4DQ2 A;  1HXD A;  4M78 E;  4QVC A;  4V2S A;  4M78 C;  2RHS B;  2VXE A;  5LJ5 d;  1FYF A;  4M75 A;  4PNO A;  4M75 G;  4C8Q E;  5LJ5 h;  3EFR A;  3PZC A;  4ZTU B;  1B34 A;  2I4M A;  3FIF A;  1WLE A;  4P73 A;  4HWO A;  4HT9 A;  4J6Y A;  4C92 F;  1QE0 A;  3HRK A;  3SWN A;  2EJF A;  2RM4 A;  4NOY A;  3A7R A;  4YCW A;  4P72 A;  4YRN A;  4CH4 A;  4KR3 A;  4YRC A;  3UFG A;  4M7A C;  3QO3 A;  4NCX A;  3VQY A;  2ART A;  2CGH A;  3QNE A;  4J5Y A;  4YYE A;  3IKL A;  3EFS A;  3HFZ A;  3UH0 A;  4YRL A;  1H4T A;  4X9D A;  4M78 B;  5ELN A;  1ADJ A;  4M75 F;  2DU5 A;  4XTX A;  4P72 C;  4J6X A;  1U1T A;  1EVL A;  4C8Q A;  3L4G A;  1H4Q A;  1ASY A;  3JCM g;  2K57 A;  4K88 A;  4TVY A;  3FJP A;  5LJ3 j;  5GMK l;  2ZT5 A;  3HFV A;  3JCM f;  4MML A;  5GAM f;  2EL9 A;  1QF6 A;  5GAN g;  1C0A A;  5K1P A;  2ZXF A;  2YLC A;  1LNX A;  4J15 A;  1GGM A;  1M5Q 1;  4WJ4 A;  2QTX A;  4JRK A;  2DEQ A;  4M77 A;  2ZNJ A;  1B7Y B;  2DU7 A;  5GAN h;  5GMK j; 
#chains in the Genus database with same CATH topology
 1NJ2 A;  1B70 A;  5GMK e;  2HQE A;  4JUV A;  3JCM h;  3UAT A;  3I56 Q;  2ARS A;  2DTH A;  2CP2 A;  1NJI U;  2DFU A;  4DPG A;  4DEX A;  4TQD A;  1WQ7 A;  1TSF A;  4D8K A;  2QGG A;  2MYS A;  2DET A;  4IIO A;  1ARK A;  2ECZ A;  11AS A;  2A8E A;  1GBR A;  1BB9 A;  1K1Z A;  1YIJ T;  1K76 A;  5I2S A;  4X9C A;  4NS5 A;  4KUD K;  4HT8 A;  2O01 E;  5F5W A;  2DBK A;  3EAE A;  3CPF A;  1KQ1 A;  4X34 A;  2A0F B;  1Q81 R;  1M1K U;  2E4H A;  4BE1 A;  1VQ9 Q;  1VIF A;  5FU7 C;  2C0O A;  3UPU A;  2ZZG A;  4P73 C;  4C8Q F;  3VUB A;  3CME Q;  2RHU A;  1NEB A;  1WLP B;  3LGF A;  5GJW B;  1UJY A;  1KK7 A;  1FXX A;  4GBQ A;  3EFO B;  3WXM B;  2L89 A;  3MP6 A;  4C92 B;  1WIE A;  3CC7 T;  4XU3 A;  2EBP A;  5C51 B;  3A8H B;  4ATO A;  2HSP A;  1YJ9 T;  3HY0 A;  4FW2 A;  4RQF A;  3BFM A;  4KH0 B;  4Y92 A;  5J39 A;  2PME A;  3RUX A;  4FM4 B;  1YCY A;  3C95 A;  3ZEH A;  4E7J A;  4BE0 A;  2ZT6 A;  4YRR A;  5D7U A;  1RI9 A;  1UGV A;  1AD5 A;  4JJB A;  4BD3 A;  3VQV A;  5GMK i;  3G6E T;  1C1A A;  4C5H A;  5I21 A;  3LC0 A;  2Y90 A;  4FW1 A;  1VQ6 T;  4E7Z A;  1B76 A;  1NPP A;  2DL8 A;  2RI3 A;  2HL5 C;  3JB9 I;  1PSE A;  2CJA A;  2D1X A;  3UGT A;  2JNG A;  1W66 A;  5CIU A;  4YRO A;  4YRS A;  1WYD A;  1KQS P;  4PJO D;  4F7U E;  1SES A;  4CC2 A;  3VS5 A;  1Q7Y U;  2FRW A;  1TS9 A;  2XHC A;  2ARU A;  4P3O A;  2IG0 A;  3M4G A;  3NPF A;  1N8R C;  3OYM A;  2QG9 B;  3PNW C;  1IHV A;  1WQW A;  3VU3 C;  4PJO B;  3H0H A;  1YIT A;  1IGQ A;  2HQX A;  3OY9 A;  4Q6G A;  4EO4 A;  1QP2 A;  1WU7 A;  2EGA A;  1OUL A;  1M27 C;  5GAM h;  2EAY A;  2O4X A;  5LL6 S;  3CCL T;  2QQA A;  2DDZ A;  1Y57 A;  2C0I A;  2NUT B;  2WAC A;  5GAO p;  2K7A A;  2ABL A;  2Q7G A;  5E3I A;  3C94 A;  2PU9 B;  4TWA A;  1YHQ T;  4C0D C;  1EFW A;  2M0O A;  2LX9 A;  2OI3 A;  3HRU A;  4YTL A;  1C0M A;  2LC4 A;  4A4K A;  2XTI A;  3M4Q A;  1Q86 C;  5EG2 A;  3CXC P;  2ZZE A;  2E6N A;  1PRL C;  4ZGE B;  1JO8 A;  1ZLM A;  2G4C A;  5HK0 A;  3A7U A;  1WGS A;  1HD3 A;  1NLO C;  3CEY A;  3H6Z A;  2XG8 D;  2MOX A;  2DQ3 A;  2YUP A;  1MMG A;  1VQN A;  1FMV A;  2DD4 A;  3EHR A;  3EG3 A;  3R6O A;  3P8D A;  3JCM b;  1WYX A;  3U23 A;  1MND A;  1ZBX A;  5HKC A;  4C5G A;  3CME A;  4JZ3 A;  1V1C A;  3E19 A;  1D1B A;  2RK1 A;  3CCV A;  1CKA A;  2F5T X;  2YLB A;  3REB B;  4C0G A;  1R0C B;  3OW2 A;  4HWS A;  3H9N A;  2K3Y A;  2HKQ B;  5KCO A;  1BKB A;  4UP8 A;  1W2B P;  5A0G A;  4A53 A;  1RL2 A;  1U1S A;  3JAM E;  2CZ0 B;  2RJD A;  4G84 A;  4PFO A;  2VUB A;  4DOV A;  3HTR A;  5FU6 C;  2E12 A;  2MF2 A;  2RA2 A;  1H64 1;  4IUQ A;  3WVD B;  1Q95 G;  1IRE B;  1M1K C;  1YIT T;  2MWP A;  2RI2 A;  1VQ4 T;  5L8R E;  1QCN A;  4M77 G;  3GF5 A;  1E1T A;  1PNJ A;  3X24 B;  4P75 A;  1H3Z A;  1X2K A;  5J3B A;  2HCK A;  1I8F A;  3RBB B;  4L6V 5;  2DBM A;  1XJW B;  4PJL A;  3M54 A;  4R56 A;  3M56 A;  2EYX A;  1HC7 A;  4EPC A;  3SB2 A;  4OLF A;  3QUI A;  5FLX E;  3CCQ Q;  2COZ A;  5GAM d;  1VQN Q;  2LQ8 A;  2KRN A;  3FJ5 A;  4LE9 A;  5GMK m;  4A54 A;  4DBR A;  3A31 A;  1A0N B;  2EJ9 A;  1WFW A;  4JJC A;  3QYH B;  1LPL A;  3G71 T;  4FYX B;  4XU0 A;  4B9W A;  2KT8 A;  1YFR A;  4YRI A;  3OYL A;  3CC4 T;  1ZSG A;  4FYV B;  3CCU T;  2DL7 A;  5GAO l;  3E9F A;  2ZIN A;  1ACM B;  3I5S A;  1VQK A;  4M77 F;  4DOW A;  4KGV B;  2EYZ A;  2YUQ A;  4N4H A;  2M1H A;  4JZ4 A;  1Y0M A;  1N27 A;  2E6Z A;  2RHS A;  4E6R A;  4CS3 A;  4XEM A;  2XIC A;  2CZ6 B;  4QQG A;  2LCC A;  1YI2 Q;  1TXQ A;  1TUD A;  2E64 A;  1TH7 A;  2KRS A;  1QWE A;  1KSW A;  3ZFJ A;  3CD6 Q;  3RKY A;  2DL4 A;  3VS6 A;  2EQI A;  1YIJ A;  2CZ7 B;  3I5R A;  4LXC A;  5GAN 8;  1BYM A;  5KNN A;  2QHS A;  3RR6 A;  1Y96 B;  2QA4 T;  3HPW A;  1SSH A;  2KSS A;  2AMC A;  4BAC A;  4H2T A;  3VYG A;  4DBH A;  5CKE A;  2DXU A;  5GAO n;  3CPW P;  2VWF A;  3V7C A;  4MZM A;  3M57 A;  4MMK A;  2DKG A;  3M0Q A;  2XI9 A;  2BZY A;  1VQ8 T;  3UDC A;  3OS5 A;  4RKU E;  3VKI A;  4M7D G;  1JJC A;  3HL8 A;  3OYJ A;  3OB9 A;  4KGZ B;  3IG2 A;  2JM9 A;  1UEC A;  3M0T A;  2F2V A;  2KY9 A;  4RTV A;  1C6V X;  4OB2 B;  3A5Z A;  4ANJ A;  1B34 B;  4ZIB A;  2ATC B;  2CSI A;  2QEX Q;  3CMA A;  1OZ3 A;  2XD0 A;  4KT0 E;  4FSS A;  4UC4 A;  1TUG B;  2DMO A;  4TTV A;  1F1B B;  2ZZD A;  4QT7 A;  4C0F A;  1V76 A;  2D8H A;  2KYM A;  3TU4 K;  3E9G A;  4FT2 A;  1UFF A;  5KYW B;  2QHT A;  2JN0 A;  2L3R A;  5EC7 A;  4UPA A;  3PT9 A;  4JJD A;  2PUO B;  2L2P A;  4H02 A;  2Q5H A;  2PQW A;  2V1Q A;  2DYB A;  2BIV A;  1H92 A;  3P8Y A;  3UF4 A;  1SET A;  4M78 D;  3L4G B;  4YRG A;  2HBP A;  1HTT A;  3LLR A;  3I55 Q;  2RQV A;  1AOJ A;  3M53 A;  3QDF A;  4J7F A;  4TQF A;  4QVC A;  4JS4 A;  1YIJ Q;  3OW2 P;  2VXE A;  1VYV A;  1JB0 E;  4OMF B;  3RMS A;  2HL3 A;  4HXJ A;  2CYZ B;  5CKB A;  1QVP A;  2KDS A;  4P73 A;  2I0N A;  2EGE A;  4WCI A;  2EJF A;  4NOY A;  4YCW A;  4P72 A;  4YRN A;  4JLG A;  3Q1J A;  1OX9 A;  1N8R U;  4M7A C;  1RUW A;  2DD5 A;  1NZ9 A;  3IKL A;  1KHI A;  4AFQ C;  1RLQ C;  1HJD A;  5CCA A;  1ABO A;  3S6W A;  4X9D A;  1N6A A;  4M78 B;  1ZHI A;  2GFU A;  1MHN A;  2RH2 A;  1H4Q A;  1EVL A;  1NYG A;  3OA6 A;  3GNF B;  1ZUU A;  4C5E A;  4K88 A;  5HY6 A;  5GMK l;  2FPF A;  2X9H A;  4MML A;  2EL9 A;  5GAN g;  1C0A A;  5K1P A;  3CCV T;  3VS3 A;  1ZBJ A;  3TSW A;  1D0X A;  3HRT A;  4ORZ A;  1KC8 C;  1W6X A;  3MEV A;  1GGM A;  3LW5 E;  3OBW A;  3VS1 A;  2AZS A;  4RUG A;  2QTX A;  1M30 A;  2DEQ A;  2RQT A;  3QJY A;  1G3Y A;  1B7Y B;  4OB0 B;  2JS2 A;  2J6K A;  1RAF B;  2DU7 A;  1U5S A;  1AHJ B;  3OYN A;  3FB9 A;  2LX7 A;  3CCS A;  4M77 D;  2FHD A;  1M8V A;  5LJ5 f;  4AG1 C;  1Z7N A;  3ER0 A;  2KE9 A;  2ODR D;  4PJO G;  2DO3 A;  2E3I A;  2CP7 A;  4RMO A;  3CC4 Q;  1BCO A;  1Q7Y R;  2DXB A;  3GIB A;  3PGG A;  2RK2 A;  2HNI A;  2E10 A;  2L8D A;  3EH2 A;  3TUP A;  3S3O A;  4C5I A;  1GRI A;  3ME9 A;  1WJR A;  2CP6 A;  4OP0 A;  2QHV A;  2LT1 A;  1CSK A;  3TSZ A;  1JXM A;  2VXF A;  4XTW A;  4KRT A;  3MHX A;  4C8Q G;  4M7A F;  2LP5 A;  8ATC B;  1VUB A;  4HVV A;  3OYF A;  4YP0 A;  4HA8 A;  2HD0 A;  1IGU A;  1QP3 A;  2VC8 A;  3MKD A;  1W1F A;  1CKB A;  1YWP A;  1UE9 A;  2X51 A;  4HCB A;  5L23 A;  1PYS B;  4E47 A;  3DLL A;  1NBE B;  4JJN K;  3A74 A;  2JOY A;  4M7D C;  3QBY A;  3FRN A;  3BW1 A;  4OB3 B;  2FO0 A;  3QII A;  4PLI A;  5KYX B;  4II1 A;  1VQ4 Q;  1Q81 C;  4M78 G;  4M77 E;  5GAN 5;  4LVJ A;  3CCQ T;  2QQB A;  1Q82 C;  2LQK A;  4J9G A;  2J7I A;  4M7A A;  5C6S A;  4XTV A;  1X6G A;  2HQH A;  4XTZ A;  5DM7 R;  3EG1 A;  3NEM A;  5C53 B;  4Z8A A;  2OX7 A;  3E1S A;  2F69 A;  2V8K A;  1VQ7 Q;  2RHI A;  4Z02 A;  3TCJ A;  2D8J A;  3E9I A;  2MCN A;  2DJQ A;  3OSV A;  2WSF E;  2MK5 A;  1OU9 A;  2CUB A;  4RCC A;  3L2R A;  4OVA A;  3LGL A;  1VQ6 A;  3CCJ Q;  1K4U S;  1SER A;  4J9F A;  3RAC A;  1W2B A;  4J9I A;  3H41 A;  4FYW B;  1M2O A;  4XK8 E;  2DZC A;  2ZGW A;  3HTZ A;  4QVD A;  2JM8 A;  3V8J A;  4M7D D;  2XID A;  2I2L A;  2LRQ A;  1JJC B;  3VS7 A;  1G5V A;  4R0K A;  3AHU A;  1GCQ C;  1JEG A;  4CH5 A;  5LJ3 d;  3HXV A;  1YJN A;  4C8Q B;  4H2Y A;  1RI0 A;  3LSS A;  4C8Q C;  3CCL A;  4JS5 A;  2HZY A;  3TEH A;  3VUZ A;  3JCM P;  3TEH B;  5IHK A;  1VQP Q;  4AFS C;  3WVE B;  1YNZ A;  2EKO A;  1GL5 A;  2LCL A;  1O9S A;  1I4K 1;  1BI0 A;  4EMK C;  4CC7 A;  2BUD A;  4YRE A;  3QG1 A;  2KRM A;  2JUF A;  1K8A C;  3CXC S;  1SHG A;  3L42 A;  2EIF A;  4HVW A;  2K2V A;  1IL2 A;  2CJB A;  5HCK A;  2PZ1 A;  2RB6 A;  4LNP A;  3JCM X;  3OYB A;  1M9S A;  3CCQ A;  4A4G A;  2JVV A;  3G1Z A;  1NEG A;  2X3W D;  1B70 B;  5LJ5 e;  4M7A B;  1K9M C;  1X6O A;  3QHS A;  4ZTF A;  1UG1 A;  1NJ1 A;  1WHG A;  4YDQ A;  4H2X B;  1USY C;  2PMF A;  4FCY A;  5ECA A;  1OPL A;  4M77 C;  1B07 A;  2Y4Y A;  2QAS A;  1ABQ A;  4O5V A;  4M7D E;  2BZ8 A;  4J7I A;  1X54 A;  4JDS A;  3IKM B;  4UP9 A;  3HFZ B;  3CPW S;  3I9Q A;  3HXX A;  2EYW A;  2B8A A;  4N0A C;  4BY6 C;  3G6E Q;  4ME7 A;  3G4S A;  2ZNI A;  4LVM A;  4RQE A;  3CCM Q;  2F1L A;  2QQ9 A;  2DLP A;  3OQ5 A;  1YGB A;  4M77 B;  2DE0 X;  1K9A A;  3CCE T;  4GLK A;  1WHL A;  1X01 A;  1PKT A;  4KUL A;  2C8M A;  1USY A;  3PIO A;  3P8T A;  3QTC A;  3MEY A;  5LJ5 g;  2V26 A;  3IQL A;  2J05 A;  3DLM A;  4EMK B;  2CZ1 B;  2GGR A;  1BCM A;  3QDR B;  4LVI A;  3FDR A;  3PMI A;  3X25 B;  1EIY B;  1N9S A;  1AZG B;  2L3Q A;  4Y91 A;  3LSQ A;  3SFM A;  2IVW A;  1AZE A;  1M4Z A;  2FVU A;  2AHJ B;  5GJV B;  4ZGJ B;  3CCM T;  2RJF A;  3VYH B;  3M0P A;  2J6O A;  9ATC B;  1HK9 A;  3MJX A;  2ED0 A;  3P8B B;  2NUP A;  1QVF P;  3S3M A;  2X35 A;  2NUP B;  1UDL A;  3RKX A;  4E7S A;  1KJW A;  4AT1 B;  2JTM A;  4IUT A;  3DB4 A;  1OI1 A;  1V29 B;  3SWN B;  3S3N A;  1K73 C;  1S1N A;  3RKW A;  1T3S A;  2LQN A;  1IZ6 A;  2LDM A;  4HKE A;  2YHT A;  1YWO A;  1OYX A;  4Z89 A;  5KYU A;  1RAH B;  3A8M B;  2PUK B;  3M0S A;  3PTA A;  1G51 A;  2WSC E;  2FPE A;  4O6J A;  3EGU A;  3JCM V;  3OS0 A;  1Q81 U;  3R07 A;  1KQS A;  4PJN A;  1SRY A;  4M4Z A;  3IAL A;  2LMJ A;  3PFS A;  4BDZ A;  2C06 A;  1X27 A;  1OX8 A;  2BZX A;  1M90 R;  4IKF A;  2B86 A;  3NEN A;  4YRQ A;  5LJ3 f;  3QYG B;  2A7Y A;  3QO5 A;  4P75 C;  4FYY B;  1VQ5 A;  5CR2 A;  1VQK T;  3HRI A;  4DEY A;  3THK A;  4BE2 A;  4H2W A;  2DM1 A;  4FT4 A;  3CCR Q;  1NJI R;  2OTJ A;  1VQ7 T;  5FWB A;  1NPR A;  5CO7 A;  2AKW A;  1ZUK A;  3L2Q A;  3OMC A;  3KFU A;  4G85 A;  2YWW A;  3V8K A;  4M75 D;  2PVD B;  4TVA A;  4BI4 A;  3D7S B;  1VQ8 A;  4CS4 A;  4AH6 A;  3RL6 A;  2CT4 A;  3QWY A;  2YDL A;  3CXC A;  2EW3 A;  4J9E A;  1WXB A;  5D6X A;  1XOV A;  4X1V A;  2AKW B;  3G4S T;  2IIM A;  3NGP A;  3HXZ A;  2RQR A;  1OEB A;  5CQX A;  1IXD A;  1MV0 B;  1QMC A;  2AZV A;  4OGC A;  3MO8 A;  4IIM A;  2XK0 A;  3A8O B;  1JU5 C;  2Y4X A;  1PKS A;  5CKD A;  2QK0 A;  2EQM A;  3VQW A;  1RAA B;  3TEE A;  1NG2 A;  1MNE A;  2JMA A;  1WX6 A;  4N0A A;  5M9O A;  4ZN3 A;  1N9R A;  3LH0 A;  3RDV A;  4CH6 A;  4J9C A;  3X28 B;  3CC2 T;  2ZT7 A;  3VRY A;  4MDW A;  2ZZF A;  4CH3 A;  1RLP C;  2ROT A;  4L59 A;  2K2M A;  4IUV A;  4LUD A;  2J06 A;  3JSC A;  1VQ9 A;  2NWM A;  1Z9Q A;  5DLQ E;  4N4G A;  4F7U B;  1FWZ A;  1FMK A;  2FEI A;  3GP8 A;  3X26 B;  4FU6 A;  1NYR A;  1QCO A;  4BDY A;  4PHC A;  3MEU A;  2QTV A;  4ZN1 A;  2QI2 A;  2EYY A;  2OJ2 A;  2NUT A;  2OAW A;  2LNV A;  2JJ9 A;  2LT4 A;  2O4X B;  1VQ8 Q;  2V8J A;  1KHC A;  1T3L A;  3O8V A;  2RI5 A;  1QVF S;  1BBU A;  2YSQ A;  5D6Y A;  4DQ2 A;  4M78 E;  4V2S A;  4M78 C;  5KE2 A;  1QW1 A;  5IT9 E;  1HSQ A;  4LDY A;  3CD6 A;  1X2Q A;  1YP5 A;  5LJ5 d;  3EGX B;  4DA4 A;  1FYF A;  2A28 A;  4OMP A;  2FZC B;  3EFR A;  3PZC A;  1B34 A;  2OTL T;  2GBQ A;  4HT9 A;  4C92 F;  4CC4 B;  1QE0 A;  3BE3 A;  4KR3 A;  4CH4 A;  3SD4 A;  4YRC A;  2FG0 A;  3UFG A;  3QO3 A;  3CD6 T;  2CH4 A;  2JZ2 A;  2CGH A;  3QNE A;  1KD1 R;  4J5Y A;  2DRK A;  2XDP A;  3EFS A;  2KI7 A;  4FL6 A;  1FX7 A;  4RTT A;  3OBY A;  1H4T A;  3CQT A;  2GCX A;  2FL7 A;  3NTH A;  4M75 F;  4P72 C;  4J6X A;  1U1T A;  1ASY A;  1D0Z A;  1PD0 A;  3FJP A;  3M5A A;  5GAM f;  1RAC B;  1M3C A;  4FSX A;  1YJ9 A;  4MZT A;  3G71 A;  2YLC A;  3M0U A;  1UB4 A;  1R0B G;  4J15 A;  3PMT A;  1OZ2 A;  2P0K A;  3H0I A;  4FIB A;  3EG9 B;  1M1G A;  3EG9 A;  1K8A U;  1SKU B;  5GAN h;  2M51 A;  2NUZ A;  3QJ6 A;  1YJW Q;  1VQN T;  3CC2 A;  3KUF A;  1XNI A;  1TTH B;  1MMA A;  3NFC A;  2V8I A;  1YFN A;  1SG5 A;  1Q82 U;  5IHI A;  4JPB W;  1KC8 R;  3A8L B;  4YCV A;  2M9U A;  1LJO A;  4ELZ C;  2ZPF B;  3TVT A;  2FRY A;  2JW4 A;  2DXT A;  3M55 A;  2DTO A;  1SEM A;  5GAM j;  4EDU A;  2Q7H A;  4HCC A;  1SRL A;  2C7I A;  2X4J A;  3G4S Q;  3G6E A;  1QWF A;  3HP9 A;  3VS0 A;  1VQM A;  2OTL A;  1QVG S;  4C8Q D;  5GAN 6;  3EG2 A;  3A5Z B;  2R5A A;  3HRS A;  3REU A;  4DBF A;  3OYK A;  3H0F A;  5I2M A;  4M7A G;  2SEM A;  1Q7Y C;  1PCX A;  2H8H A;  5GAN e;  4P3N A;  2VVK A;  2R5M A;  4DBQ A;  4HWR A;  4BW9 A;  1BI1 A;  2KK4 A;  4M75 C;  2QEX A;  2DEU A;  4K87 A;  1I07 A;  1HYO A;  3P8V A;  1UGQ B;  4Z88 A;  3ZL7 C;  2NYS A;  4KQE A;  2RNA A;  4YRF A;  2KBT A;  1EVK A;  5GAN 7;  3OS2 A;  4CI0 C;  5GAN f;  1I0C A;  4PLL A;  3T9N A;  1M1F A;  2BE7 D;  4OMO A;  1KD1 U;  2DAQ A;  5GAN d;  4PJJ A;  2E3C A;  2YRV A;  2DL3 A;  4D8D A;  3CCL Q;  2BE9 B;  3REX A;  4KBM B;  1QLY A;  4R55 A;  2KEA A;  1YJN Q;  5A2Q E;  1SHF A;  4YRP A;  1R8O B;  2M0Y A;  2HBW A;  3M9Q A;  5LJ3 g;  2ZT8 A;  2RMO A;  1WHK A;  3NMZ C;  2AMC B;  3UA6 A;  1VQL A;  2I4L A;  2KMT A;  3OSS C;  2E41 A;  2Q7E A;  1UHF A;  2KXD A;  2ZPI B;  4KH1 B;  4TVW A;  3SWN C;  2ALY B;  4OMQ A;  1VIE A;  3CCR A;  2QGF B;  3MCA B;  1YI2 A;  1VQ5 Q;  2SRC A;  2YRD A;  3NHN A;  1VQ6 Q;  2RPN A;  3L2V A;  3A5Y A;  1NYF A;  3FEO A;  2P4R A;  2L3P A;  5A0L A;  2COW A;  4F7U G;  1VQ7 A;  1X75 C;  3RF1 A;  1YI2 T;  3MF1 A;  1D0Y A;  2JTF A;  2KYB A;  5GMK h;  2E70 A;  2GF7 A;  2O9V A;  2PVO B;  5I22 A;  4B6M A;  4M7D F;  2J3M A;  5K1X A;  1Y71 A;  2HKN A;  3CCU Q;  4P74 A;  4XQ3 A;  4PJO C;  1PC0 A;  3QZ5 B;  1GXI E;  8AT1 B;  1UTI A;  1JJ2 A;  2H3J A;  1JBM A;  5CKF A;  2MPX C;  1WHJ A;  4BY6 B;  1YFS A;  1JJ2 S;  2KVQ G;  1D09 B;  3NTK A;  5GAM e;  4ZNX A;  2Q5I A;  1LVK A;  1JRI A;  1XQH A;  1H3H A;  1KFZ A;  2AIR B;  5AYF A;  3L2Z A;  2JTE A;  2EGC A;  1D3B A;  1AEY A;  5KH6 A;  3OYY A;  3OYD A;  2QA4 A;  4A4E A;  1VQO T;  4ELY C;  4M7A E;  5HGQ A;  3HSB A;  5AT1 B;  1UHC A;  2E65 A;  5KYN A;  3JB9 H;  2J6F A;  1EFN A;  3RNJ A;  3UGQ A;  3ERR A;  3EFO A;  4J6W A;  1WJS A;  1VQM T;  1TWB A;  1TOV A;  4PL6 A;  2QDL A;  3I56 T;  1PSF A;  4XU1 A;  4H2V A;  2E5A A;  2W0Z A;  1LOJ A;  2OTJ T;  5HK3 A;  1NJ5 A;  4J83 A;  3CCR T;  4C92 E;  2GNC A;  2KR3 A;  3MQZ A;  1WHM A;  5IXF A;  4TVR A;  4LD9 K;  2KT1 A;  2MAM A;  3RIR A;  2PVG B;  2DXC A;  1RIQ A;  3PCO A;  2L3S A;  4OF1 A;  3GNG A;  2K9G A;  2ZPH B;  2CJ9 A;  5KYW A;  1YJW A;  5GAN 2;  3QXE B;  4NL3 A;  3BDU A;  5D6W A;  1W4S A;  5KYU B;  3MF2 A;  3OD1 A;  4HWP A;  2L5Q A;  5FU7 B;  3J80 E;  2QQS A;  2K3B A;  1K9M U;  4PFP A;  2G6F X;  3G7Z A;  4RTZ A;  1X55 A;  4PJO A;  2MI6 A;  1WDX A;  2COY A;  4GY5 A;  3JCM e;  2CUD A;  4AFU C;  2HEQ A;  2DIG A;  2RHQ A;  3LWH A;  4H2X A;  2DQ0 A;  4M78 A;  4PJO F;  2PNI A;  2GFA A;  4KUI A;  3CCU A;  3A98 A;  1SSF A;  2P0P A;  5DY9 A;  2LTO A;  4M75 E;  3M58 A;  2DYI A;  1U3O A;  1S72 A;  2P5I A;  4F14 A;  3EGX A;  3HXY A;  3BDL A;  4IUU A;  1VYT A;  1G5H A;  4WJ3 M;  4IUR A;  5I11 A;  4HWT A;  4LN2 A;  1G3W A;  1ATI A;  1H8K A;  5FRM A;  2RQW A;  4KR2 A;  1VYU A;  1K73 R;  2YUN A;  1Q82 R;  1RAG B;  2KQW A;  1YFT A;  2DL5 A;  1BI2 A;  2LJ1 A;  3ICA A;  2RN8 A;  3ULR B;  1UGS B;  5GAO r;  1YHQ Q;  3NTI A;  1U06 A;  1QKX A;  1WI7 A;  4F17 A;  3L2U A;  3CMQ A;  3GPL A;  2GQI A;  1JQQ A;  2R58 A;  2ZR3 A;  4E2F B;  3CCE Q;  5KYY B;  4ZTZ B;  1OOT A;  2HAX A;  1KQ2 A;  4PFZ A;  2CH4 W;  1EZZ B;  3JCM J;  4P74 C;  1NE8 A;  2EQK A;  3I55 A;  3HHT B;  1ZUY A;  1TU0 B;  1K73 U;  4BUG A;  3PCO B;  1KIK A;  1ADY A;  1YCS B;  5CAI A;  3V7R A;  1QVG P;  3LYI A;  4F16 A;  1Z7M A;  2E5K A;  2FPD A;  3C12 A;  3A1P A;  4YRK A;  2FZK B;  4C92 C;  1NJI C;  5KYY A;  1ASZ A;  4AMC A;  2K5F A;  2JXB A;  3C0C A;  2ROL A;  3CC7 Q;  1IB8 A;  3CBO A;  3H8Z A;  4J9H A;  2X3X D;  2H3E B;  4P71 C;  1MMN A;  1MUZ A;  3JB9 G;  4N4I A;  2D0Q B;  1PRM C;  2VAS A;  1AWJ A;  3QSU A;  3CME T;  2EQJ A;  3I7F A;  1L0W A;  2LQW A;  1M8M A;  1K0S A;  3MP1 A;  3CCS T;  2K4Y A;  2ZCF B;  2Z0W A;  2E3H A;  2IPO B;  1KMN A;  3QO8 A;  2CT3 A;  1G3S A;  4JRQ A;  2V1R A;  3HY1 A;  4M7A D;  1E22 A;  1PYS A;  3JCM W;  1BBZ A;  1KQS S;  1N9W A;  3EHQ A;  1QQJ A;  4LNS A;  4F04 B;  1KOG A;  3MPU B;  4AFZ C;  5CVI A;  1PWT A;  2QXF A;  1VQM Q;  4C0D B;  3A32 A;  1N8R R;  2EYQ A;  2VGN A;  4LDV A;  4OMN A;  7AT1 B;  3OW2 S;  3BY7 A;  3JRZ A;  5KCH A;  1SRM A;  4O2D A;  3JB9 J;  2ZTG A;  1RAB B;  3L1A A;  3FC3 A;  1WPY A;  2ZIO A;  3PE0 A;  1N5Z A;  1EQR A;  1H4S A;  2GTO A;  2CIM A;  3CCJ T;  3JCM c;  2JT4 A;  1IHW A;  2DX1 A;  2XU8 A;  2RHS B;  4QQD A;  3I56 A;  2RQU A;  1KC8 U;  1QVF A;  2CS7 A;  2OTJ Q;  4M75 A;  3CCS Q;  4ZTJ A;  4A4F A;  2DK3 A;  5A0D A;  4HT4 A;  2CP3 A;  1YHQ A;  1Q86 R;  2I4M A;  4HWO A;  2KAF A;  4J6Y A;  3REA B;  3SWN A;  2RM4 A;  3A7R A;  4RTW A;  5KYX A;  4NCX A;  3VQY A;  2EQU A;  2ART A;  3QPH A;  1K0X A;  1VQO Q;  2MWO A;  1EX4 A;  1UGP B;  3I55 T;  3AT1 B;  2ED1 A;  1ADJ A;  4MZP A;  5FWC A;  5IHN A;  4C8Q A;  1AWW A;  4BI3 A;  4TVY A;  1T0H A;  2ZAE A;  2ZT5 A;  3HFV A;  3CPW A;  3JCM f;  5CKH A;  4E7H A;  4PKC C;  3EGD A;  2CRE A;  2ZXF A;  4ZGD B;  3HKS A;  2P4T A;  1KD1 C;  2DIL A;  1ZSZ A;  1M5Q 1;  4K11 A;  4HVU A;  3UA7 A;  4M77 A;  2ZNJ A;  2AT1 B;  3VS4 A;  1BI3 A;  4B9X A;  4L5G A;  1RAE B;  2CP5 A;  2D0N A;  1UJ0 A;  1G8X A;  4XTU A;  2DER A;  3QZ9 B;  1RAI B;  4Q5W A;  4CRI A;  1GCP A;  1UGR B;  4P5N A;  3PVQ A;  2HSE B;  1M90 C;  1B8A A;  3OYG A;  1E6G A;  1Y7X A;  5IN1 A;  4JRP A;  2QQR A;  3J7A F;  4M78 F;  5GAN 3;  1ZQ1 A;  1VQ5 T;  2D6F A;  3UT1 A;  12AS A;  2RHZ A;  3W3S A;  1YN8 A;  2QDY B;  4RG2 A;  2OAU A;  3CCM A;  2FZG B;  2RJC A;  1E24 A;  4UP7 A;  1O75 A;  2ZCE A;  4QKU A;  4C0Z A;  4YCU A;  1GFC A;  2VB6 A;  1M2V B;  2RHY A;  2VYT A;  1MV3 A;  4CS2 A;  4XU2 A;  3CCV Q;  1GCQ A;  1X56 A;  2QA4 Q;  4MDX A;  1B7Y A;  5CQY A;  4NL2 A;  3KXT A;  1YB3 A;  3I35 A;  3TQ7 P;  4EMH A;  3CMA Q;  1QVG A;  2J3L A;  1SPK A;  1ZA2 B;  1MGQ A;  3HFN A;  4XEO A;  3PVL A;  2DRM A;  2VKN A;  3URG A;  3VQX A;  4JLI A;  3MP8 A;  2K3X A;  4GLM A;  1M2V A;  3SHW A;  2P0Q A;  4E7L A;  3GLX A;  2CKK A;  3OYI A;  4RCB A;  1G2B A;  4C92 G;  3EG0 A;  2AKK A;  4CC3 A;  2ZIM A;  4JRI A;  1JJ2 P;  5LJ5 j;  2O88 A;  1G83 A;  4M7D B;  2P84 A;  1VQP A;  1VQL T;  1OU8 A;  1IO6 A;  2HMA A;  3LH5 A;  1LYL A;  3TEG A;  1I1J A;  3L2W A;  1TG0 A;  5J26 A;  4EMG A;  1Y07 A;  1S72 T;  1X2H A;  5IAY A;  2HDA A;  2K5I A;  2QHU A;  2K5L A;  3M4Y A;  5GAN j;  3JB9 F;  1YIT Q;  4K86 A;  1M3B A;  2X4Y A;  4RTX A;  4M7D A;  4P3P A;  4OML A;  1DJ7 B;  1I5O B;  3G1J A;  1PD1 A;  2I4O A;  3CCJ A;  3X20 B;  3VS2 A;  4Y28 E;  4LDX A;  2KNB B;  3RGL A;  1YJW T;  3C4S A;  1B7T A;  2XKO C;  1GFD A;  1J5W A;  5LJ3 h;  4A4H A;  4F7U F;  4F7U A;  1E1O A;  1VQK Q;  4L87 A;  4H2S A;  2LCS A;  1AWX A;  2CP0 A;  4IUP A;  5C52 B;  1BIA A;  1WJQ A;  2DVJ A;  3RES A;  3SDZ A;  1S72 Q;  5IXB A;  4YRJ A;  1IRX A;  1JXO A;  2QEX T;  4BWA A;  5FU6 B;  1BIB A;  2BTT A;  1VQ4 A;  1WNL A;  4PJM A;  2YT6 A;  4WTO B;  5GAO q;  1EIY A;  3V7S A;  5C0M A;  1OV3 A;  4XTY A;  1NNH A;  2W10 A;  3FLG A;  1OPK A;  3M0R A;  3CBP A;  4A63 B;  2ESW A;  2C0T A;  2EJG A;  1M1K R;  1PM3 A;  3M59 A;  3P8H A;  4C92 A;  1QKW A;  2RF0 A;  3INZ A;  4WF2 A;  3VV0 A;  1BBW A;  4J9D A;  5FW9 A;  1EIF A;  4LVK A;  1UEB A;  2P0L A;  2MIO A;  4QQ6 A;  1YJN T;  2DZ9 A;  3LX7 A;  1Q86 U;  2OTL Q;  4EX5 A;  2EPD A;  4J8O A;  4BI8 B;  4D6W A;  2QAZ A;  1Z9Z A;  3HFO A;  1X2G A;  4M75 B;  3QO7 A;  2DA9 A;  2KGT A;  2LNH B;  2A08 A;  1AVZ C;  2EFI A;  2RD1 A;  4YPF A;  1U8R A;  3MET A;  2KXC A;  3CC4 A;  3E9H A;  1WXT A;  1W2B S;  1NJ6 A;  4YRM A;  2AKL A;  3NET A;  2ODR C;  4YRT A;  2AK5 A;  2EVR A;  3KBG A;  1TUC A;  3SEM A;  2RHX A;  2ZPG B;  3O5Z A;  3CC2 Q;  4QVZ A;  1H4V B;  1PG5 B;  3JV3 A;  3DB3 A;  2O2O A;  3MEW A;  1G5I A;  4P71 A;  2LZ6 B;  4OB1 B;  2CDT A;  2FB7 A;  3A8G B;  2DVE A;  3VBB A;  1G3T A;  2RO0 A;  3EH1 A;  1Y96 A;  6AT1 B;  3EGD B;  1KMM A;  1D3B B;  2LJ0 A;  3G71 Q;  2K6D A;  3GBQ A;  1RAD B;  1KG1 A;  2G3R A;  4TVA B;  5ELO A;  1EOV A;  2LVM A;  2D9T A;  4HCK A;  2JS0 A;  1VQZ A;  1T0J A;  1XTD A;  2IY5 A;  2MMP A;  3KFV A;  3N5B B;  2A36 A;  5GAN 4;  2XGT A;  1AT1 B;  1WHH A;  3TRE A;  5CK9 A;  4RTU A;  1BK2 A;  1PHT A;  1WXU A;  4E51 A;  3WQZ A;  2EKH A;  2YUO A;  3HXU A;  4LD6 A;  2YXY A;  3JCM d;  2IY5 B;  4QW2 A;  1ZA1 B;  2NS6 A;  3V8L A;  2LJ3 A;  4BB7 A;  1VQL Q;  2I4N A;  3DKM A;  3HXW A;  3LWI A;  2DTI A;  1I5L A;  4WI1 A;  2XDB A;  1X69 A;  5KE3 A;  1X43 A;  1LCK A;  2FYK A;  2M02 A;  2F2W A;  4E7I A;  1WA7 A;  2JMC A;  1NYQ A;  1VA7 A;  2XMF A;  1M90 U;  4LVL A;  2KRO A;  1X6B A;  5DLO A;  1BU1 A;  3JB9 D;  2M16 A;  2X4X A;  3BJU A;  4PG3 A;  5FRO A;  4Q15 A;  3DSQ A;  4RDX A;  5FRN A;  4C92 D;  4LUE A;  1NLP C;  3ZBD A;  3RER A;  2ZR2 A;  4PJO E;  1ZX6 A;  1GBQ A;  1NJ8 A;  2NLU A;  3OYE A;  3M4P A;  2DF6 A;  4E7K A;  2CSQ A;  5GAO m;  5LJ3 e;  2YRC A;  4X5O A;  2DIQ A;  4VUB A;  2X4W A;  3PIP A;  2QYZ A;  2E1H A;  4PK4 A;  2VV5 A;  5GAM g;  3VRZ A;  4XAX B;  3CC7 A;  3CMA T;  1YBY A;  2ZPB B;  2E5Q A;  4KGX B;  3RMQ A;  2ALY A;  4AG2 C;  1M3A A;  3OS1 A;  1E6H A;  3VJP A;  3NEL A;  4HVC A;  1SF9 A;  2GQV A;  4EIK A;  1E7O A;  1I81 A;  4EMK A;  3QWX X;  3A7A A;  2EWN A;  2VGM A;  2L0A A;  2RHQ B;  3ASK A;  3JCM Q;  2RJE A;  3J81 E;  2DJZ A;  4RMF A;  1WZO A;  1J3T A;  4H2U A;  1HXD A;  3OYC A;  1OQK A;  1ZSZ C;  2BKD N;  1FMW A;  3F70 A;  3CCE A;  4PNO A;  4M75 G;  4C8Q E;  5LJ5 h;  3CBM A;  1B3Q A;  1QCF A;  2GTJ A;  4ZTU B;  3FIF A;  2ZPE B;  3OMG A;  1W70 A;  1WLE A;  4LDU A;  2A3L A;  3HRK A;  2DNU A;  1K8A R;  2R57 A;  4YYE A;  2DPP B;  3HFZ A;  3UH0 A;  2K79 A;  4YRL A;  1YJ9 Q;  4RG8 A;  1ZSZ B;  4HCZ A;  4J9B A;  2O9S A;  2F5K A;  4RTY A;  1R77 A;  1VQP T;  5ELN A;  2DU5 A;  4XTX A;  2A37 A;  2F2X A;  3L4G A;  2XDD A;  3JCM g;  1K9M R;  2K57 A;  2PTK A;  5LJ3 j;  2O31 A;  3OYA A;  1QF6 A;  1D1C A;  3UWN A;  1NM7 A;  1VQO A;  4OMM A;  3MEA A;  1LNX A;  3E2U A;  1AWO A;  2WSE E;  5IH2 A;  1P92 A;  4WJ4 A;  3R6N A;  1VQ9 T;  4JRK A;  1MMD A;  1FYN A;  4ESR A;  3OYH A;  4OGE A;  1VOM A;  3QKJ A;  1D1A A;  1UUE A;  3GOX A;  4LDW A;  5GMK j;  2ENM A; 
#chains in the Genus database with same CATH homology
 1NJ2 A;  1B70 A;  5GMK e;  2HQE A;  4JUV A;  3JCM h;  2ARS A;  2DTH A;  1NJI U;  4DPG A;  4TQD A;  1WQ7 A;  11AS A;  2A8E A;  1YIJ T;  5I2S A;  4X9C A;  4NS5 A;  4KUD K;  4HT8 A;  2O01 E;  5F5W A;  3EAE A;  3CPF A;  1KQ1 A;  4X34 A;  1M1K U;  4BE1 A;  1VIF A;  5FU7 C;  3UPU A;  2ZZG A;  4P73 C;  4C8Q F;  3VUB A;  2RHU A;  3LGF A;  1FXX A;  3WXM B;  2L89 A;  3MP6 A;  4C92 B;  3CC7 T;  4XU3 A;  5C51 B;  3A8H B;  4ATO A;  1YJ9 T;  3HY0 A;  4RQF A;  3BFM A;  5J39 A;  2PME A;  3RUX A;  4FM4 B;  1YCY A;  3C95 A;  3ZEH A;  4E7J A;  4BE0 A;  2ZT6 A;  4YRR A;  4BD3 A;  3VQV A;  5GMK i;  3G6E T;  4C5H A;  5I21 A;  3LC0 A;  2Y90 A;  1VQ6 T;  1B76 A;  1NPP A;  2RI3 A;  3JB9 I;  1PSE A;  2CJA A;  3UGT A;  2JNG A;  1W66 A;  5CIU A;  4YRO A;  4YRS A;  1WYD A;  4PJO D;  4F7U E;  1SES A;  1Q7Y U;  2XHC A;  2ARU A;  4P3O A;  2IG0 A;  3M4G A;  1N8R C;  3OYM A;  3PNW C;  1WQW A;  3VU3 C;  4PJO B;  1YIT A;  2HQX A;  3OY9 A;  4Q6G A;  4EO4 A;  1QP2 A;  1WU7 A;  5GAM h;  2DDZ A;  2EAY A;  2O4X A;  5LL6 S;  3CCL T;  2QQA A;  2WAC A;  5GAO p;  2Q7G A;  5E3I A;  3C94 A;  2PU9 B;  4TWA A;  1YHQ T;  4C0D C;  1EFW A;  2M0O A;  2LX9 A;  3HRU A;  4YTL A;  2LC4 A;  4A4K A;  2XTI A;  3M4Q A;  1Q86 C;  5EG2 A;  2ZZE A;  2E6N A;  4ZGE B;  2G4C A;  5HK0 A;  3A7U A;  1WGS A;  3CEY A;  3H6Z A;  2XG8 D;  2DQ3 A;  1VQN A;  2DD4 A;  3R6O A;  3P8D A;  3JCM b;  1ZBX A;  5HKC A;  4C5G A;  3CME A;  3E19 A;  2RK1 A;  3CCV A;  2F5T X;  2YLB A;  4C0G A;  3OW2 A;  4HWS A;  2K3Y A;  5KCO A;  1BKB A;  4UP8 A;  5A0G A;  4A53 A;  1RL2 A;  1U1S A;  3JAM E;  2CZ0 B;  2RJD A;  4G84 A;  2VUB A;  4DOV A;  5FU6 C;  2E12 A;  2MF2 A;  2RA2 A;  1H64 1;  4IUQ A;  3WVD B;  1M1K C;  1IRE B;  1YIT T;  2MWP A;  2RI2 A;  1VQ4 T;  5L8R E;  4M77 G;  3GF5 A;  1E1T A;  4P75 A;  3X24 B;  1H3Z A;  5J3B A;  1I8F A;  4L6V 5;  3M54 A;  4R56 A;  3M56 A;  4OLF A;  1HC7 A;  4EPC A;  3SB2 A;  3QUI A;  5FLX E;  5GAM d;  2LQ8 A;  5GMK m;  4A54 A;  3A31 A;  2EJ9 A;  3QYH B;  3G71 T;  4XU0 A;  4B9W A;  1YFR A;  4YRI A;  3OYL A;  3CC4 T;  3CCU T;  5GAO l;  3E9F A;  2ZIN A;  1VQK A;  4M77 F;  4DOW A;  4N4H A;  2M1H A;  1N27 A;  2E6Z A;  2RHS A;  4CS3 A;  4XEM A;  2XIC A;  2CZ6 B;  4QQG A;  2LCC A;  2E64 A;  1TH7 A;  3ZFJ A;  3RKY A;  1YIJ A;  2CZ7 B;  5GAN 8;  1BYM A;  5KNN A;  2QHS A;  1Y96 B;  2QA4 T;  3HPW A;  2KSS A;  2AMC A;  4BAC A;  4H2T A;  3VYG A;  5CKE A;  2DXU A;  5GAO n;  3V7C A;  4MZM A;  3M57 A;  4MMK A;  2DKG A;  2XI9 A;  1VQ8 T;  3UDC A;  3OS5 A;  4RKU E;  3VKI A;  4M7D G;  1JJC A;  3HL8 A;  3OYJ A;  3OB9 A;  3IG2 A;  2KY9 A;  4OB2 B;  3A5Z A;  1B34 B;  4ZIB A;  3CMA A;  1OZ3 A;  2XD0 A;  4KT0 E;  4UC4 A;  4TTV A;  2ZZD A;  4C0F A;  3TU4 K;  3E9G A;  4FT2 A;  2QHT A;  2JN0 A;  2L3R A;  4UPA A;  3PT9 A;  2PUO B;  4H02 A;  2Q5H A;  2PQW A;  2BIV A;  3P8Y A;  1SET A;  4M78 D;  3L4G B;  4YRG A;  2HBP A;  1HTT A;  3LLR A;  4TQF A;  3M53 A;  4J7F A;  4QVC A;  4JS4 A;  2VXE A;  1JB0 E;  4OMF B;  3RMS A;  2CYZ B;  5CKB A;  1QVP A;  2KDS A;  4P73 A;  2EJF A;  4NOY A;  4YCW A;  4P72 A;  4YRN A;  4JLG A;  3Q1J A;  1N8R U;  4M7A C;  2DD5 A;  1NZ9 A;  3IKL A;  1KHI A;  5CCA A;  3S6W A;  4X9D A;  1N6A A;  4M78 B;  1ZHI A;  2GFU A;  1MHN A;  2RH2 A;  1H4Q A;  1EVL A;  3OA6 A;  3GNF B;  4C5E A;  4K88 A;  5HY6 A;  5GMK l;  4MML A;  2EL9 A;  5GAN g;  1C0A A;  5K1P A;  3CCV T;  3HRT A;  1KC8 C;  3MEV A;  1GGM A;  3LW5 E;  3OBW A;  2QTX A;  2DEQ A;  3QJY A;  1G3Y A;  1B7Y B;  4OB0 B;  2DU7 A;  1AHJ B;  3OYN A;  3FB9 A;  3CCS A;  4M77 D;  2FHD A;  1M8V A;  5LJ5 f;  1Z7N A;  3ER0 A;  2ODR D;  4PJO G;  2DO3 A;  4RMO A;  2DXB A;  3GIB A;  3PGG A;  2RK2 A;  2HNI A;  2E10 A;  2L8D A;  3TUP A;  3S3O A;  4C5I A;  3ME9 A;  1WJR A;  4OP0 A;  2QHV A;  2LT1 A;  2VXF A;  4XTW A;  3MHX A;  4C8Q G;  4M7A F;  1VUB A;  3OYF A;  4YP0 A;  4HA8 A;  2HD0 A;  1QP3 A;  2VC8 A;  4HCB A;  1PYS B;  4E47 A;  3DLL A;  3A74 A;  4JJN K;  2JOY A;  4M7D C;  3QBY A;  3FRN A;  3BW1 A;  4OB3 B;  3QII A;  4PLI A;  4II1 A;  1Q81 C;  4M78 G;  4M77 E;  5GAN 5;  4LVJ A;  3CCQ T;  2QQB A;  1Q82 C;  2LQK A;  4M7A A;  5C6S A;  4XTV A;  5DM7 R;  4XTZ A;  3NEM A;  5C53 B;  3E1S A;  2F69 A;  2V8K A;  2RHI A;  4Z02 A;  3TCJ A;  3E9I A;  3OSV A;  2WSF E;  4RCC A;  3L2R A;  4OVA A;  3LGL A;  1VQ6 A;  1SER A;  3RAC A;  1W2B A;  4XK8 E;  2DZC A;  2ZGW A;  3HTZ A;  4QVD A;  3V8J A;  4M7D D;  2XID A;  2I2L A;  2LRQ A;  1JJC B;  1G5V A;  3AHU A;  4CH5 A;  5LJ3 d;  3HXV A;  1YJN A;  4C8Q B;  4H2Y A;  1RI0 A;  3LSS A;  4C8Q C;  3CCL A;  4JS5 A;  3TEH A;  3VUZ A;  3JCM P;  3TEH B;  3WVE B;  2EKO A;  2LCL A;  1O9S A;  1I4K 1;  1BI0 A;  4EMK C;  2BUD A;  4YRE A;  3QG1 A;  2JUF A;  1K8A C;  3CXC S;  3L42 A;  2EIF A;  2K2V A;  1IL2 A;  2CJB A;  2RB6 A;  3JCM X;  3OYB A;  1M9S A;  3CCQ A;  4A4G A;  2JVV A;  3G1Z A;  1B70 B;  5LJ5 e;  4M7A B;  1K9M C;  1X6O A;  3QHS A;  4ZTF A;  1NJ1 A;  4YDQ A;  4H2X B;  1USY C;  2PMF A;  4M77 C;  2Y4Y A;  4O5V A;  4M7D E;  4J7I A;  1X54 A;  4JDS A;  3IKM B;  4UP9 A;  3HFZ B;  3CPW S;  3HXX A;  2B8A A;  4N0A C;  4BY6 C;  3G4S A;  4ME7 A;  2ZNI A;  4LVM A;  4RQE A;  1YGB A;  3OQ5 A;  2QQ9 A;  4M77 B;  3CCE T;  4GLK A;  1X01 A;  4KUL A;  2C8M A;  1USY A;  3PIO A;  3P8T A;  3QTC A;  3MEY A;  5LJ5 g;  3DLM A;  4EMK B;  2CZ1 B;  3QDR B;  4LVI A;  3FDR A;  3PMI A;  3X25 B;  1EIY B;  1N9S A;  4Y91 A;  3LSQ A;  3SFM A;  2IVW A;  1M4Z A;  2FVU A;  2AHJ B;  4ZGJ B;  3CCM T;  2RJF A;  3VYH B;  1HK9 A;  3P8B B;  3S3M A;  2X35 A;  3RKX A;  2JTM A;  4IUT A;  3DB4 A;  1OI1 A;  1V29 B;  3SWN B;  3S3N A;  1K73 C;  3RKW A;  1IZ6 A;  2LDM A;  4HKE A;  2YHT A;  1OYX A;  3A8M B;  2PUK B;  3PTA A;  1G51 A;  2WSC E;  4O6J A;  3JCM V;  3OS0 A;  1Q81 U;  3R07 A;  1KQS A;  1SRY A;  3IAL A;  3PFS A;  4BDZ A;  2C06 A;  4IKF A;  3NEN A;  4YRQ A;  5LJ3 f;  3QYG B;  2A7Y A;  3QO5 A;  4P75 C;  1VQ5 A;  5CR2 A;  1VQK T;  3HRI A;  4BE2 A;  4H2W A;  4FT4 A;  2OTJ A;  1VQ7 T;  1NPR A;  5CO7 A;  2AKW A;  3L2Q A;  3OMC A;  3KFU A;  4G85 A;  3V8K A;  4M75 D;  2PVD B;  4TVA A;  4BI4 A;  1VQ8 A;  4CS4 A;  4AH6 A;  3RL6 A;  3CXC A;  5D6X A;  1XOV A;  2AKW B;  3G4S T;  3HXZ A;  5CQX A;  4OGC A;  3MO8 A;  2XK0 A;  3A8O B;  2Y4X A;  5CKD A;  2EQM A;  3VQW A;  3TEE A;  4N0A A;  5M9O A;  4ZN3 A;  1N9R A;  3LH0 A;  4CH6 A;  3X28 B;  3CC2 T;  2ZT7 A;  4MDW A;  2ZZF A;  4CH3 A;  4L59 A;  4IUV A;  3JSC A;  1VQ9 A;  5DLQ E;  4N4G A;  4F7U B;  1FWZ A;  3GP8 A;  3X26 B;  4FU6 A;  1NYR A;  4BDY A;  4PHC A;  3MEU A;  4ZN1 A;  2QI2 A;  2LNV A;  2LT4 A;  2O4X B;  2V8J A;  1KHC A;  3O8V A;  2RI5 A;  1QVF S;  1BBU A;  5D6Y A;  4DQ2 A;  4M78 E;  4V2S A;  4M78 C;  5KE2 A;  1QW1 A;  5IT9 E;  4LDY A;  3CD6 A;  5LJ5 d;  4DA4 A;  1FYF A;  3EFR A;  3PZC A;  1B34 A;  2OTL T;  4HT9 A;  4C92 F;  1QE0 A;  4KR3 A;  4CH4 A;  3SD4 A;  4YRC A;  3UFG A;  3QO3 A;  3CD6 T;  2JZ2 A;  2CGH A;  3QNE A;  4J5Y A;  2XDP A;  3EFS A;  4FL6 A;  1FX7 A;  3OBY A;  1H4T A;  2GCX A;  2FL7 A;  3NTH A;  4M75 F;  4P72 C;  4J6X A;  1U1T A;  1ASY A;  3FJP A;  3M5A A;  5GAM f;  4FSX A;  1YJ9 A;  4MZT A;  3G71 A;  2YLC A;  1UB4 A;  4J15 A;  3PMT A;  1OZ2 A;  2P0K A;  4FIB A;  1M1G A;  1K8A U;  5GAN h;  3QJ6 A;  1VQN T;  3CC2 A;  3KUF A;  1XNI A;  3NFC A;  2V8I A;  1Q82 U;  3A8L B;  4YCV A;  2M9U A;  1LJO A;  4ELZ C;  2ZPF B;  2DXT A;  3M55 A;  2DTO A;  5GAM j;  4EDU A;  2Q7H A;  4HCC A;  2C7I A;  2X4J A;  3G6E A;  3HP9 A;  1VQM A;  2OTL A;  1QVG S;  4C8Q D;  5GAN 6;  3A5Z B;  2R5A A;  3HRS A;  3REU A;  3OYK A;  5I2M A;  4M7A G;  1Q7Y C;  5GAN e;  4P3N A;  2R5M A;  4BW9 A;  4HWR A;  1BI1 A;  2KK4 A;  4M75 C;  2QEX A;  4K87 A;  3P8V A;  1UGQ B;  4KQE A;  4YRF A;  1EVK A;  5GAN 7;  3OS2 A;  4CI0 C;  5GAN f;  4PLL A;  3T9N A;  1M1F A;  1KD1 U;  2DAQ A;  5GAN d;  2E3C A;  2YRV A;  3REX A;  4KBM B;  4R55 A;  5A2Q E;  4YRP A;  1R8O B;  5LJ3 g;  3M9Q A;  2ZT8 A;  2AMC B;  1VQL A;  2I4L A;  2KMT A;  3OSS C;  2E41 A;  2Q7E A;  2ZPI B;  4TVW A;  3SWN C;  2ALY B;  1VIE A;  3CCR A;  3MCA B;  1YI2 A;  3A5Y A;  3L2V A;  3FEO A;  5A0L A;  4F7U G;  1VQ7 A;  1X75 C;  3RF1 A;  1YI2 T;  3MF1 A;  2JTF A;  5GMK h;  2E70 A;  2GF7 A;  2PVO B;  4M7D F;  2J3M A;  5K1X A;  1Y71 A;  4P74 A;  4XQ3 A;  4PJO C;  3QZ5 B;  1GXI E;  1JJ2 A;  2H3J A;  1JBM A;  5CKF A;  4BY6 B;  1YFS A;  1JJ2 S;  2KVQ G;  3NTK A;  5GAM e;  2Q5I A;  1JRI A;  1XQH A;  5AYF A;  3L2Z A;  1D3B A;  5KH6 A;  3OYY A;  3OYD A;  2QA4 A;  4A4E A;  1VQO T;  4ELY C;  4M7A E;  5HGQ A;  3HSB A;  2E65 A;  3JB9 H;  3UGQ A;  3ERR A;  4J6W A;  1WJS A;  1VQM T;  4PL6 A;  3I56 T;  1PSF A;  4XU1 A;  4H2V A;  2E5A A;  1LOJ A;  2OTJ T;  5HK3 A;  1NJ5 A;  4J83 A;  3CCR T;  4C92 E;  3MQZ A;  4TVR A;  4LD9 K;  2MAM A;  3RIR A;  2PVG B;  2DXC A;  1RIQ A;  3PCO A;  4OF1 A;  3GNG A;  2ZPH B;  2CJ9 A;  1YJW A;  5GAN 2;  3QXE B;  4NL3 A;  3BDU A;  5D6W A;  1W4S A;  3MF2 A;  3OD1 A;  4HWP A;  2L5Q A;  5FU7 B;  3J80 E;  2QQS A;  1K9M U;  3G7Z A;  1X55 A;  4PJO A;  2MI6 A;  4GY5 A;  3JCM e;  2DIG A;  2RHQ A;  3LWH A;  4H2X A;  2DQ0 A;  4M78 A;  4PJO F;  2GFA A;  4KUI A;  3CCU A;  1SSF A;  2P0P A;  5DY9 A;  2LTO A;  4M75 E;  3M58 A;  1S72 A;  2P5I A;  3HXY A;  3BDL A;  4IUU A;  1G5H A;  4WJ3 M;  4IUR A;  4HWT A;  1G3W A;  1ATI A;  5FRM A;  4KR2 A;  2KQW A;  1YFT A;  1BI2 A;  3ICA A;  1UGS B;  5GAO r;  3NTI A;  3L2U A;  3CMQ A;  3GPL A;  2R58 A;  2ZR3 A;  4ZTZ B;  2HAX A;  1KQ2 A;  3JCM J;  4P74 C;  1NE8 A;  2EQK A;  3I55 A;  3HHT B;  1K73 U;  4BUG A;  3PCO B;  1ADY A;  5CAI A;  3V7R A;  3LYI A;  1Z7M A;  3C12 A;  4YRK A;  4C92 C;  1NJI C;  1ASZ A;  2K5F A;  3H8Z A;  3CBO A;  4P71 C;  3JB9 G;  4N4I A;  2D0Q B;  3QSU A;  3CME T;  2EQJ A;  3I7F A;  1L0W A;  3MP1 A;  3CCS T;  2K4Y A;  2ZCF B;  1KMN A;  3QO8 A;  1G3S A;  4JRQ A;  3HY1 A;  4M7A D;  1E22 A;  1PYS A;  3JCM W;  1KQS S;  1N9W A;  4LNS A;  1KOG A;  5CVI A;  2QXF A;  4C0D B;  3A32 A;  2EYQ A;  2VGN A;  4LDV A;  3OW2 S;  3BY7 A;  3JRZ A;  5KCH A;  4O2D A;  3JB9 J;  2ZTG A;  3FC3 A;  3L1A A;  1WPY A;  2ZIO A;  1EQR A;  1H4S A;  2CIM A;  3CCJ T;  3JCM c;  2XU8 A;  2RHS B;  4QQD A;  3I56 A;  1KC8 U;  1QVF A;  2CS7 A;  4M75 A;  4ZTJ A;  4A4F A;  2DK3 A;  5A0D A;  4HT4 A;  1YHQ A;  2I4M A;  4HWO A;  2KAF A;  4J6Y A;  3SWN A;  2RM4 A;  3A7R A;  4NCX A;  3VQY A;  2EQU A;  2ART A;  3QPH A;  2MWO A;  1UGP B;  3I55 T;  1ADJ A;  4MZP A;  4C8Q A;  4BI3 A;  4TVY A;  2ZT5 A;  3HFV A;  3CPW A;  3JCM f;  5CKH A;  4E7H A;  4PKC C;  2ZXF A;  4ZGD B;  3HKS A;  2P4T A;  1KD1 C;  1M5Q 1;  4M77 A;  2ZNJ A;  1BI3 A;  4B9X A;  4L5G A;  4XTU A;  3QZ9 B;  4Q5W A;  4CRI A;  1UGR B;  4P5N A;  1M90 C;  1B8A A;  3OYG A;  1Y7X A;  5IN1 A;  4JRP A;  2QQR A;  3J7A F;  4M78 F;  5GAN 3;  1ZQ1 A;  1VQ5 T;  2D6F A;  3UT1 A;  12AS A;  2RHZ A;  3W3S A;  2QDY B;  4RG2 A;  2OAU A;  3CCM A;  2RJC A;  1E24 A;  4UP7 A;  1O75 A;  2ZCE A;  4C0Z A;  4YCU A;  2RHY A;  2VYT A;  4CS2 A;  4XU2 A;  1X56 A;  4MDX A;  1B7Y A;  5CQY A;  4NL2 A;  3KXT A;  1YB3 A;  4EMH A;  1QVG A;  2J3L A;  1MGQ A;  3HFN A;  4XEO A;  3URG A;  3VQX A;  4JLI A;  3MP8 A;  2K3X A;  2P0Q A;  4E7L A;  3GLX A;  2CKK A;  3OYI A;  4RCB A;  4C92 G;  2ZIM A;  4JRI A;  5LJ5 j;  4M7D B;  1VQP A;  1VQL T;  1LYL A;  3TEG A;  3L2W A;  5J26 A;  4EMG A;  1Y07 A;  1S72 T;  1X2H A;  5IAY A;  2K5I A;  2QHU A;  2K5L A;  3M4Y A;  5GAN j;  3JB9 F;  4K86 A;  4M7D A;  2X4Y A;  4P3P A;  1DJ7 B;  2I4O A;  3CCJ A;  3X20 B;  4Y28 E;  4LDX A;  3RGL A;  1YJW T;  3C4S A;  2XKO C;  1J5W A;  5LJ3 h;  4A4H A;  4F7U F;  4F7U A;  1E1O A;  4L87 A;  4H2S A;  4IUP A;  5C52 B;  1BIA A;  1WJQ A;  3RES A;  3SDZ A;  4YRJ A;  2QEX T;  4BWA A;  5FU6 B;  1BIB A;  1VQ4 A;  1WNL A;  5GAO q;  1EIY A;  3V7S A;  5C0M A;  4XTY A;  1NNH A;  3FLG A;  3CBP A;  2EJG A;  3M59 A;  3P8H A;  4C92 A;  3VV0 A;  3INZ A;  4WF2 A;  1BBW A;  1EIF A;  4LVK A;  1UEB A;  2P0L A;  4QQ6 A;  1YJN T;  2DZ9 A;  3LX7 A;  1Q86 U;  4EX5 A;  4J8O A;  4BI8 B;  4D6W A;  3HFO A;  1X2G A;  4M75 B;  3QO7 A;  2EFI A;  2RD1 A;  4YPF A;  1U8R A;  3MET A;  3CC4 A;  3E9H A;  1W2B S;  1NJ6 A;  4YRM A;  3NET A;  2ODR C;  4YRT A;  3KBG A;  2RHX A;  2ZPG B;  4QVZ A;  1H4V B;  3DB3 A;  3MEW A;  1G5I A;  4P71 A;  4OB1 B;  3A8G B;  2FB7 A;  2DVE A;  3VBB A;  1G3T A;  2RO0 A;  1Y96 A;  1KMM A;  1D3B B;  1KG1 A;  2G3R A;  4TVA B;  5ELO A;  1EOV A;  2LVM A;  2D9T A;  1VQZ A;  1XTD A;  2IY5 A;  2MMP A;  3N5B B;  5GAN 4;  2XGT A;  5CK9 A;  3TRE A;  4E51 A;  3WQZ A;  3HXU A;  4LD6 A;  3JCM d;  2IY5 B;  4QW2 A;  2NS6 A;  3V8L A;  4BB7 A;  2I4N A;  3DKM A;  3HXW A;  3LWI A;  2DTI A;  1I5L A;  4WI1 A;  2XDB A;  5KE3 A;  2FYK A;  4E7I A;  1NYQ A;  1M90 U;  4LVL A;  5DLO A;  3JB9 D;  2M16 A;  4PG3 A;  2X4X A;  3BJU A;  5FRO A;  4Q15 A;  3DSQ A;  4RDX A;  5FRN A;  4C92 D;  3ZBD A;  3RER A;  2ZR2 A;  4PJO E;  1NJ8 A;  2NLU A;  3OYE A;  3M4P A;  4E7K A;  5GAO m;  5LJ3 e;  4X5O A;  2DIQ A;  4VUB A;  2X4W A;  3PIP A;  2E1H A;  2VV5 A;  5GAM g;  3CC7 A;  4XAX B;  3CMA T;  1YBY A;  2ZPB B;  2E5Q A;  3RMQ A;  2ALY A;  3OS1 A;  3VJP A;  3NEL A;  4HVC A;  2GQV A;  1I81 A;  4EMK A;  3A7A A;  2EWN A;  2VGM A;  2RHQ B;  3ASK A;  3JCM Q;  2RJE A;  3J81 E;  2DJZ A;  4RMF A;  4H2U A;  1HXD A;  3OYC A;  2BKD N;  3F70 A;  3CCE A;  4PNO A;  4M75 G;  4C8Q E;  5LJ5 h;  3CBM A;  4ZTU B;  3FIF A;  2ZPE B;  3OMG A;  1WLE A;  4LDU A;  2A3L A;  3HRK A;  2R57 A;  4YYE A;  2DPP B;  3HFZ A;  3UH0 A;  4YRL A;  4RG8 A;  4HCZ A;  2F5K A;  5ELN A;  1VQP T;  2DU5 A;  4XTX A;  3L4G A;  2XDD A;  3JCM g;  2K57 A;  5LJ3 j;  3OYA A;  1QF6 A;  3UWN A;  1VQO A;  3MEA A;  1LNX A;  2WSE E;  1P92 A;  4WJ4 A;  1VQ9 T;  4JRK A;  3OYH A;  4OGE A;  3QKJ A;  3GOX A;  4LDW A;  5GMK j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...