2DJZA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111a mutation
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2djzA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2djzA01
3TEGA 2AMCB 3SWNB 4TVYA 1VQZA 4YRMA 4ZIBA 1U1TA 3HSBA 3RGLA 3RL6A 3VQXA 2CIMA 4WJ4A 2FYKA 5GMKi 1I81A 2I4LA 4C92E 4KQEA 4EMKA 2DEQA 3L4GA 1HXDA 2QHVA 1C0AA 5E3IA 4RCCA 3HXWA 1B34B 4XU3A 4P71A 4TVAA 3VQVA 3BDUA 1LYLA 3RKXA 4G85A 1Y96B 2DXTA 4XTXA 2YLCA 2DZCA 2J3LA 4OLFA 3HXXA 3HRIA 5CAIA 3IKLA 2ZT8A 4M78C 4A53A 1SRYA 1FYFA 2E5AA 1H4TA 1X2GA 4M7AF 2Q5IA 3NEMA 4RMFA 4CS3A 4C92B 2AMCA 2ZIOA 3SWNA 4H2XB 5GAOp 2Q7HA 2ALYB 1H4QA 3VQWA 1YFRA 1EOVA 3LSSA 3QHSA 4K86A 1YFTA 2EJ9A 2QHSA 5GANj 4YRTA 1WPYA 3PCOB 3VBBA 3JCMe 4HWRA 4UP8A 2ZR3A 4RDXA 4NL2A 4M77C 1BIBA 5GMKl 4QVCA 3HXZA 5GAMh 3W3SA 1X01A 1Y96A 4YRIA 4XEMA 2DU5A 1G51A 4XU2A 3RIRA 3V7RA 1HK9A 4M7DC 2Q5HA 1IL2A 2C8MA 4C92A 1B7YB 4YRCA 4H2WA 2ZR2A 4H2XA 4XTUA 2ALYA 4C8QC 5GAMd 2DU7A 2RHSB 3PCOA 4J5YA 1N9RA 3V7SA 3RF1A 4P72C 3JCMh 2ZZGA 3JCMX 2VXFA 1SERA 1L0WA 1E24A 2ODRC 3RKYA 4P75A 4V2SA 4C92D 5F5WA 4HT8A 1H641 4J6WA 3JCMP 5GAN8 3HXYA 5GAN7 3L1AA 5GANh 4HWPA 4UPAA 3QTCA 1B7YA 4PJOC 5LJ5j 4C92G 3IKMB 4EMHA 3JCMd 2ZGWA 2RHSA 4NCXA 1E1OA 4M78B 4CH5A 4M7AC 4P74C 2DJZA 5LJ5e 1WQ7A 3QO5A 4P3PA 4M75B 3BFMA 3UGQA 1KQ1A 4XEOA 2K57A 5GANd 4MMKA 3RKWA 3JCMb 5LJ3g 4HVCA 4KR2A 3A31A 4L87A 4XU1A 3P8TA 3V8JA 4DQ2A 3HFOA 4MMLA 4N0AC 5GAN5 1YFSA 2AKWA 3KFUA 5C53B 2ARUA 3A32A 3P8VA 2E64A 2ZT7A 1BBUA 1JBMA 5LJ3f 3ERRA 1ADYA 4A54A 4M78A 2DTHA 5GAN6 3IALA 3TEHB 4CS2A 3LC0A 1YB3A 4M75A 3NETA 4RQEA 3RERA 2E65A 4H2TA 4C92F 3RUXA 2ZNJA 3UFGA 3JCMW 1X2HA 3JCMV 1ASYA 3REUA 4C8QB 1GGMA 2QTXA 1I8FA 3IG2A 4O2DA 3HY0A 1NYRA 3L2ZA 3V8LA 4H2SA 1B70B 3A7AA 1W66A 1N9WA 1X54A 4G84A 5GAOn 4BWAA 3BW1A 3MF1A 2RM4A 4EX5A 1QF6A 1Z7MA 1NJ8A 3HXUA 1I4K1 5GMKe 2EJFA 2I2LA 2YHTA 4M75D 2ARTA 1USYC 5LJ5d 1B76A 2EAYA 3TEHA 4JLIA 2P5IA 1B34A 3HFVA 1KOGA 1U1SA 4CH6A 3VQYA 5KNNA 1RIQA 4PJOB 2IY5B 4P71C 3HFNA 3BJUA 4C8QA 4YRKA 3UH0A 1WYDA 1G5IA 1WQWA 5DY9A 2QHTA 4AH6A 1B70A 4OP0A 3JCMQ 1ASZA 4H2YA 4M7AB 1BBWA 4P72A 5GAMg 4Q15A 4Q6GA 5HGQA 4H2UA 2I4NA 5GAN4 4YRSA 5GAN3 4X9CA 1LNXA 2E41A 2DVEA 5GAOq 1NJ1A 3P8YA 4YRJA 2EWNA 4C8QD 3TUPA 2E3CA 2DQ0A 4PJOA 5GAMf 2IY5A 4LNSA 5GAOm 3INZA 4M78E 4YRQA 4HT9A 5LJ3e 1E22A 2DQ3A 3REXA 3PGGA 4WI1A 4NL3A 4M75E 1LJOA 4M78F 3JCMg 4P74A 2Y90A 2CJ9A 3M4QA 1EQRA 3LSQA 2DTOA 4M75F 4C92C 2ZTGA 2VC8A 2DXUA 1NJ6A 3E9IA 1NNHA 4F7UB 3E9HA 4K88A 4YYEA 3A74A 2CJAA 4H02A 3HRKA 4M77E 5GANg 4YP0A 2JN0A 4J15A 4XTZA 4N0AA 4CH3A 4XTYA 3JCMf 3JB9H 1WU7A 4EO4A 1HC7A 1LOJA 2E1HA 5I21A 11ASA 4XQ3A 3A7RA 1TH7A 2ZZEA 4YCUA 4P75C 4P73C 5GANf 4WJ3M 2I4OA 3JB9I 5GAOr 3JB9D 4M77B 3MF2A 1JRIA 4XTVA 2RA2A 4X9DA 4C8QE 1KQ2A 4P3NA 4F7UA 5GMKm 1JJCB 1Z7NA 1D3BB 3JB9G 3RACA 4C8QF 2DKGA 4M7DB 3FJPA 1H4VB 1WNLA 2DZ9A 3HTZA 2RHQB 3HY1A 3EFSA 5LJ5h 3G1ZA 3MEYA 1PYSB 5GMKj 4Y91A 2YLBA 4TTVA 4XU0A 4XTWA 1USYA 3QUIA 4PJOE 1ATIA 4YREA 4HWTA 4M77A 4TWAA 4YRNA 4M78D 5LJ5g 4CH4A 5GAMe 5ELNA 4PJOF 4F7UG 1JJCA 3R07A 2Q7GA 1M5Q1 1D3BA 2XTIA 1EIYB 1QE0A 2CJBA 4YRRA 1BIAA 1B8AA 1G5HA 4M78G 4M7AE 2P0LA 3NENA 4YRPA 4DPGA 4M7DA 4EMGA 2RHQA 3QO8A 2PMEA 4EMKC 3RESA 4M75G 2ZNIA 1YGBA 3JCMc 1H4SA 5LJ5f 4M75C 1PYSA 4M77D 4YCWA 2Q7EA 4BW9A 3HXVA 1SESA 2C7IA 2ZCEA 2PMFA 4YROA 3JB9F 4J6XA 2EL9A 3FB9A 1EVLA 4M77G 5C52B 4RQFA 3AHUA 4YRGA 2RD1A 4P3OA 4M7DD 4PNOA 3HFZB 4H2VA 3QNEA 4QVDA 3BY7A 3SWNC 1EIYA 5LJ3j 4YPFA 1KMNA 2FB7A 4YDQA 5GMKh 2RB6A 5GAN2 2ZIMA 4M7DG 3PZCA 5GANe 12ASA 3I7FA 4J6YA 1NYQA 4F7UE 2J3MA 1YCYA 3JCMJ 4CS4A 1N9SA 4YRLA 3QO7A 2G4CA 1I5LA 4C8QG 4F7UF 4RCBA 2ZT6A 2DTIA 4E51A 2ODRD 1EVKA 3VU3C 4M7AA 3OD1A 4TQFA 1HTTA 3M4PA 1NJ2A 3V8KA 3HFZA 3SB2A 5K1PA 4YRFA 2ZINA 4PJOD 4YCVA 4HWOA 4NOYA 1NJ5A 2ZZFA 4P73A 3UGTA 2EJGA 3A5ZA 3V7CA 2DDZA 3A7UA 2I4MA 2XGTA 1EFWA 3NELA 4UP7A 4PJOG 3A5YA 4M77F 2AKWB 2QHUA 2E10A 4M7AD 3CMQA 3DSQA 4JRKA 4ZTZB 4M7DE 4HA8A 4K87A 3FIFA 4PHCA 4X5OA 5LJ3h 3QSUA 3ICAA 3WQZA 1M8VA 2VXEA 1X55A 4M7AG 4M7DF 1X56A 1ADJA 4EMKB 4JUVA 3M4GA 3L4GB 1E1TA 2ARSA 3GIBA 2ZXFA 4TQDA 4TVWA 4TVAB 3QO3A 3JB9J 2ZT5A 2CGHA 4HWSA 3EFRA 4ZTUB 1J5WA 5K1XA 4KR3A 4JRIA 1KMMA 1MGQA 1SETA 5C51B 4WF2A 4UP9A 5LJ3d 5GAOl 5ELOA 2HNIA 5GAMj 4PG3A 1WLEA
chains in the Genus database with same CATH superfamily
2EYQA 3TEGA 2YXYA 2IVWA 1D09B 2ZPEB 4N4HA 1CSKA 4TVYA 4YRMA 2ED0A 1JXMA 2RQWA 4ZIBA 1RLQC 2DJQA 2NYSA 3TQ7P 3RL6A 3ZFJA 2PU9B 4WJ4A 2H8HA 1JO8A 1PHTA 2ZPBB 3QJ6A 4C92E 4HVVA 4XU3A 3VQVA 3FJ5A 3CXCP 1UEBA 3BDUA 1NYGA 1XNIA 1Y96B 1IXDA 3VYHB 3MQZA 2E12A 1QQJA 5CO7A 2R58A 1H4TA 1X2GA 1UHFA 3H0HA 1I1JA 4M7AF 3NEMA 4CS3A 2AMCA 4C5GA 2DLPA 3SWNA 4H2XB 5GAOp 1VQ5T 2O9VA 4EIKA 1YJWQ 3VQWA 4KH1B 3QHSA 1X6GA 3VBBA 2RHUA 3JCMe 2A8EA 1IRXA 2ZR3A 1NPRA 2R5AA 4M77C 1BIBA 5CK9A 3W3SA 3LW5E 1X01A 3RDVA 4XEMA 1G51A 1TUDA 3CCUA 3V7RA 4M7DC 1HK9A 2Q5HA 1U3OA 2EGAA 4YRCA 1A0NB 4H2WA 1KFZA 1EZZB 2EGEA 1ABQA 1GXIE 3OYBA 1OX8A 3VUZA 1VQOQ 1UTIA 1N8RR 3QBYA 1VQ6Q 1XTDA 2DU7A 3CBOA 3PCOA 3M4YA 1BI0A 3LWHA 2OAUA 4OMFB 4EDUA 1L0WA 3P8DA 1YJWT 1VA7A 5CR2A 1T0HA 1TUGB 3CCRQ 4V2SA 2DVJA 1GCQC 4E6RA 5IAYA 5GAN7 2NUZA 4RTYA 2EYZA 5LL6S 3UF4A 1D1CA 3G6EQ 4PJOC 3EGXB 1OYXA 2V8IA 3DKMA 3S6WA 1M30A 3OA6A 3TREA 2HDAA 3A8LB 4PKCC 1VYUA 2ATCB 2ZGWA 1BI1A 4IIOA 3TU4K 2RHSA 5IXFA 3NTHA 1E1OA 4M78B 1YCSB 2J6OA 3OYEA 3P8BB 5LJ5e 3G4SQ 1AZEA 2CP3A 3BFMA 4M75B 1KQ1A 2HAXA 3UGQA 4MMKA 2M0OA 3UWNA 1VQOT 2XKOC 2FZCB 2IG0A 5KE3A 1VQ6T 1WGSA 3V8JA 2J6KA 5FWBA 2D6FA 2HEQA 5FROA 4EPCA 1D0ZA 2AKWA 3CMAA 1E7OA 3KFUA 2MF2A 4LVIA 1M2OA 1XOVA 5FU7C 5M9OA 3CCRT 4ZTFA 1QKWA 4AG2C 3C94A 4J9HA 3RR6A 3S3OA 1D0YA 1R77A 2E6ZA 2EBPA 2LT1A 2QQRA 4FW2A 4AMCA 2DTHA 4IURA 3G6ET 2KRSA 2K5IA 1NE8A 4OF1A 4H2TA 4Z89A 1SHGA 5DLOA 1X2HA 4N4GA 3REUA 1I8FA 3I5RA 2RF0A 2AIRB 4H2SA 3A7AA 4OMLA 1W66A 3GLXA 1X54A 3G4ST 1V29B 4Y92A 5GAOn 1QMCA 3CCET 1YJ9Q 4BWAA 3CC7Q 2IPOB 1QF6A 5C6SA 5J3BA 3HXUA 1I4K1 2EJFA 4PJMA 5IT9E 2L0AA 1T3SA 2DD5A 2RO0A 3I55A 4DEXA 1U1SA 4HCKA 1QLYA 4R55A 1HYOA 4LDVA 1NPPA 3HFNA 3I9QA 4AFUC 1MV3A 1X75C 1G5IA 1WQWA 2DL5A 2FVUA 2QHTA 2KGTA 3DB3A 3JCMQ 1VQNQ 1S72Q 3PVQA 4P72A 1YFNA 1K9MC 4Q15A 4BI8B 2GF7A 5GAN4 4E7IA 1QVFS 3FRNA 4X9CA 1WDXA 2DVEA 3FDRA 1BI2A 1YJ9T 5A2QE 2E3CA 1C1AA 4RTWA 3CC7T 2DQ0A 1K9MR 3QDRB 5GAMf 1AHJB 3INZA 2YT6A 2DXBA 4YRQA 4DBHA 3REXA 2XHCA 3PGGA 3OBYA 5CIUA 1LJOA 2P4TA 3JCMg 1YJNQ 3OB9A 2RPNA 2IIMA 3M4QA 3LSQA 2DTOA 1K73C 2VC8A 2CP7A 2DXUA 4MZPA 4YYEA 2ED1A 4J7IA 1RAAB 2LNVA 4M77E 1OQKA 2F2VA 1VQNT 3HTRA 1S72T 3JB9H 3JAME 1B7TA 5I21A 5KE2A 1K73R 11ASA 3ZBDA 1MMGA 2EQMA 2BE9B 1G8XA 1WHGA 4PJLA 2ZZEA 4P75C 2BZYA 3CCSQ 5GANf 4ZGJB 1D1AA 2I4OA 4KGVB 3EGXA 3HRTA 5GAOr 1W6XA 1X6OA 3U23A 1XQHA 2CZ7B 3M53A 4P3NA 2FZKB 2AZSA 2QASA 2XD0A 1Z7NA 2HKNA 1UGPB 4WCIA 2DKGA 1N27A 3HTZA 3HY1A 1TS9A 2AHJB 5A0DA 2RI3A 2VGMA 2YLBA 1IZ6A 1OPLA 3CC2A 3TVTA 4FSXA 2DEUA 4QQ6A 1IB8A 4PJOE 1UB4A 4L5GA 2CP5A 4YRNA 2K5FA 5LJ5g 4CH4A 2X4JA 1SEMA 5GAMe 5ELNA 3R07A 4JLGA 3EG9B 2K6DA 3CCST 1M5Q1 2V8JA 1D3BA 1QE0A 2CJBA 4YRRA 1RADB 1BIAA 2O2OA 5KYWB 4YRPA 4PFZA 2P0LA 4DPGA 2NUPB 1QVFP 3OYNA 2YSQA 3RESA 2ZNIA 4IUQA 2JMAA 3M54A 4M75C 3EAEA 4YCWA 3EG3A 1MMDA 1VQ8Q 1K0XA 2ZCEA 2W10A 3JB9F 2QK0A 3OW2S 1EVLA 2PUOB 2L2PA 2KEAA 3AHUA 2O9SA 3M0TA 2KT8A 2MMPA 1P92A 4RG8A 4QVDA 1WXTA 4YDQA 2GBQA 4C0GA 1YITA 5GAN2 1KQSP 1IGUA 2ZIMA 3PZCA 2RHIA 4IIMA 5GANe 2O31A 2L5QA 3JCMJ 1Q81U 4CS4A 2M9UA 3LWIA 4C8QG 5KYYA 4RCBA 3RNJA 2J7IA 5AYFA 1EVKA 2MAMA 1O9SA 1ZSGA 2KR3A 3OD1A 4FCYA 1H3ZA 2KYBA 4AFZC 3SB2A 4DOWA 4JS5A 2CREA 3PMIA 3LX7A 1TUCA 4C0DB 3CCMQ 2DILA 1VQ8T 4HWOA 2ZZFA 4P73A 1YN8A 3R6OA 3OYAA 2BUDA 2W0ZA 2I4MA 1UHCA 2CKKA 2RJFA 2A37A 1VOMA 1NM7A 2MYSA 4PL6A 2XDDA 5IHKA 1ZSZB 3M55A 4RMOA 2CZ0B 2DXCA 2ZPGB 4ZTZB 3MCAB 4FYXB 1AEYA 4K87A 4P5NA 5CKBA 2RNAA 2VXEA 4M7AG 2V26A 2COWA 1K8AC 1X56A 1YIJA 2QEXQ 4E47A 4N4IA 3H9NA 1SSHA 3ME9A 3GIBA 1E1TA 2ARSA 1VQMA 4HWSA 3EFRA 3A1PA 1J5WA 5K1XA 1MGQA 8AT1B 2Y4XA 4WF2A 1G3TA 2HNIA 5GAMj 1KD1U 4PG3A 4ZN1A 2AMCB 2C0IA 2P84A 4BI4A 1PM3A 3SWNB 1W2BP 3T9NA 3ZL7C 4J83A 3NHNA 2FYKA 2LZ6B 3QKJA 4JJNK 2I4LA 2FRWA 2OAWA 5KCHA 5E3IA 1QCFA 1Y71A 4E7JA 1WHHA 3RKXA 4G85A 2DXTA 3LGFA 1VUBA 4J7FA 1IREB 1OZ3A 2O4XA 5CAIA 3IKLA 1SRYA 2QEXT 5C0MA 3HPWA 1OX9A 2ZIOA 3G1JA 3S3MA 3C0CA 3VS4A 2CS7A 1H4QA 1PD1A 1YFRA 2KDSA 4K86A 2AKLA 5GANj 4HVUA 2QI2A 1K8AU 3PCOB 4HWRA 2KNBB 1WJRA 2OTLA 4RDXA 1M1KU 4OMOA 4FW1A 2GFUA 2P0KA 2XI9A 4QVZA 4F04B 4YRIA 2HSPA 2DYIA 1AT1B 2NUPA 1M2VB 3EHQA 1G5VA 2PVGB 3RIRA 2EVRA 1NEGA 5IN1A 1M90U 2ALYA 2G3RA 4PFPA 2EYWA 2GQIA 3CPFA 1KG1A 2ROLA 4C8QC 2ZPIB 3AT1B 2YUOA 5HK0A 5GAMd 1G83A 2RHSB 4IUPA 3NFCA 1RI0A 3A98A 3JCMh 2ZZGA 2VXFA 4FU6A 3CBMA 1SERA 4A4KA 2ODRC 3RKYA 4C92D 2NLUA 3JCMP 1F1BB 2VYTA 1QVGS 5I2SA 1VQ4Q 3L1AA 2OJ2A 5CKFA 2GTOA 3KFVA 1Q86R 3BDLA 3IKMB 3QWXX 4Z88A 4C0FA 4KUDK 3OSSC 5DLQE 1C6VX 2OTJQ 4OB1B 3MEVA 4NCXA 1NEBA 3KUFA 4RTVA 4M7AC 4P74C 1RL2A 1WQ7A 4B9WA 1KIKA 1ZQ1A 2HBPA 2DBMA 5GANd 2HMAA 2A0FB 1BCMA 3JCMb 1PSFA 2J06A 4KR2A 4XU1A 2XK0A 4A63B 4MMLA 2OX7A 2P0PA 2D8HA 2QYZA 1NZ9A 3A32A 4JJDA 3HP9A 2ZT7A 5LJ3f 1BCOA 2F2XA 4CC2A 2BKDN 1VQ4T 4ZN3A 1MUZA 1V76A 4QQDA 5GAN6 3GP8A 3WVDB 4QKUA 2L3SA 2LT4A 2E65A 5FRNA 1WHMA 2EYXA 3GOXA 1YWOA 1JU5C 2QTXA 3IG2A 4LDWA 2OTJT 1D1BA 3L2ZA 3VS3A 3BW1A 3MF1A 4EX5A 3MEUA 1K4US 4LD6A 1G3WA 2JTMA 4LVLA 1EX4A 4OVAA 3CD6Q 3DLMA 2MWPA 2ARTA 4F17A 1D0XA 4BE2A 2ENMA 2LQNA 1AZGB 2EAYA 2JW4A 4JLIA 2P5IA 2DA9A 1VQ7A 1RIQA 3MP6A 3REBB 9ATCB 2QA4A 2C0TA 3DB4A 1NLOC 2KI7A 4L6V5 2AT1B 2PNIA 4YRKA 3QPHA 4ORZA 4AH6A 1N8RC 1KC8R 1B70A 2DE0X 2DMOA 4J9IA 1BBZA 1QVGP 4Q6GA 5HGQA 3EH2A 4RG2A 2I4NA 2D9TA 1Q95G 2E41A 3H8ZA 5GAOq 3I56Q 2MIOA 3G71A 4C8QD 2XU8A 1QCNA 4JRPA 2EIFA 1X27A 4PJOA 2EYYA 1M1FA 2BIVA 3D7SB 3CD6T 2DFUA 1M2VA 2KK4A 5LJ3e 4HT9A 2DQ3A 2K9GA 1Y07A 3EFOB 1YI2Q 3PT9A 4RTXA 1WXBA 2E6NA 1EQRA 3GF5A 3M0UA 4O6JA 2ZTGA 3E9HA 1NNHA 2VV5A 3A74A 4H02A 4YP0A 3H0IA 1Y57A 1NG2A 2K79A 1ARKA 4EO4A 1GFDA 3L2QA 4KGZB 1HC7A 2E1HA 2E5KA 1WHLA 4OB0B 3QJYA 2YRVA 2B86A 3CBPA 4LDXA 1N8RU 2F69A 3I56T 4IUUA 4WJ3M 2ZZDA 4JJBA 1T0JA 3MF2A 4XTVA 4C8QE 1VQ5A 2NUTA 2PVDB 3M59A 1PCXA 4PLLA 5GMKm 4F14A 2ECZA 4ZTJA 1D3BB 3JB9G 1QVFA 1TG0A 1X6BA 1RAGB 3RACA 2DF6A 1CKBA 4ESRA 1YI2T 1VQPQ 3FJPA 2SEMA 1H4VB 1WHKA 5CKDA 1VQKQ 3EFSA 3JRZA 1WFWA 2L8DA 3PE0A 3ZEHA 4DOVA 1PKSA 4XU0A 3O5ZA 2NS6A 2E70A 3CPWP 4XTWA 1TU0B 1VQLQ 2JTEA 3QUIA 2GQVA 3M0QA 5I11A 1X69A 4TWAA 3VJPA 1QVPA 1WLPB 2ESWA 3G7ZA 4J9DA 3X28B 4PJOF 2EQJA 5D6XA 4OGEA 2Q7GA 3CEYA 2CP6A 5IHNA 1B8AA 1G5HA 4M78G 2B8AA 4M7AE 1UUEA 4LDUA 4LDYA 3NPFA 3M56A 4EMKC 1KHCA 4M75G 4QT7A 3EHRA 3QIIA 1YJWA 2KY9A 1AD5A 1PYSA 4M77D 1PNJA 2AKKA 3HXVA 5KYYB 2KXDA 1VQPT 3VRYA 4YROA 2KT1A 4J6XA 1VQ9Q 2EL9A 3LLRA 4C5EA 4Z02A 1VQKT 4A4HA 4RQFA 4PFOA 2RD1A 2F2WA 4PNOA 4M7DD 4H2VA 1RACB 4DEYA 1EIYA 8ATCB 4L59A 5LJ3j 7AT1B 1KMNA 4YPFA 3BE3A 5GMKh 4BDYA 2RB6A 1VQLT 1WZOA 2K5LA 12ASA 2PTKA 4F7UE 3EGDA 3MP1A 1FMVA 2DIGA 2A08A 2KBTA 5L8RE 3OS5A 1ZBXA 1N9SA 1VQOA 3QO7A 1UGSB 1M3AA 1PWTA 4YRLA 3CCQQ 3OSVA 3S3NA 3CC4Q 1TXQA 1SSFA 1X2QA 1NJIC 1OZ2A 4D8KA 1NJ2A 1SPKA 4WTOB 4NS5A 3HFZA 1KQSS 3CCRA 1UG1A 3UDCA 2ZINA 2F5KA 2FPFA 4XK8E 3RBBB 4PJOD 2RMOA 5KCOA 3A5ZA 1NJIR 3WXMB 5FWCA 1VQ9T 4GY5A 4DBFA 3G6EA 2XGTA 4PJNA 2C0OA 1ZA2B 2FG0A 4B9XA 4Y28E 1YHQQ 2RH2A 2QHUA 2DERA 4JRQA 1IHWA 3DSQA 3EFOA 3OMCA 4M7DE 1S1NA 2PUKB 3WQZA 3G4SA 3CCEA 3MEAA 2LVMA 3L2UA 3C4SA 3OW2A 1K9MU 3VS1A 5D6YA 4JUVA 3M4GA 2KMTA 4E2FB 1JQQA 1AWOA 1PC0A 3CCQT 3JB9J 3TEEA 3CC4T 3MKDA 1OU9A 3OYCA 4JRIA 2O4XB 2YDLA 1YJNT 2YWWA 3QZ5B 1SETA 4E7LA 5D6WA 5C51B 2JVVA 4HVWA 2LQ8A 5LJ3d 2VKNA 3L42A 5ELOA 5HKCA 5KYUA 3NTKA 4FIBA 1JB0E 4PJJA 1U1TA 1NJIU 2CIMA 2COYA 2H3EB 2MOXA 4ATOA 1I81A 5CCAA 1FYNA 2KRMA 1YHQT 4KQEA 4KULA 1HXDA 1W70A 2D0QB 1C0AA 1K73U 1B34B 2RQVA 4P71A 4AT1B 4TVAA 4C0ZA 1O75A 4XTXA 2YLCA 1YJ9A 4GLKA 4M78C 3QZ9B 1BK2A 2RJEA 2G6FX 1FYFA 2E5AA 2VASA 1UJYA 2HCKA 1W2BS 2FRYA 2K2VA 2LJ1A 4FM4B 3EG0A 2KE9A 2ALYB 1KJWA 1EOVA 3CCLQ 2HQEA 2HL5C 1YFTA 2EJ9A 4AG1C 2QHSA 5AT1B 2K3XA 4PLIA 4NL2A 1U06A 3HXZA 1OV3A 2I0NA 4YTLA 2E3IA 4BY6B 4LVJA 2A36A 2DU5A 1VQNA 1S72A 2K3BA 3E2UA 2DO3A 1IL2A 2XDPA 2CSQA 2C8MA 4C92A 4J9CA 4XTUA 4OGCA 2ZCFB 3M0PA 4D8DA 1B07A 2E4HA 1LCKA 3OBWA 1Q82C 4J5YA 1N9RA 2JMCA 4JZ4A 1VYTA 3GNFB 4BD3A 4CC3A 3JCMX 1E24A 3VYGA 3MJXA 3QYHB 3CCLT 4HCCA 2JM8A 1Q82R 2H3JA 5GAN8 3CCJQ 2X3WD 3MO8A 4RUGA 3QTCA 4UPAA 4KUIA 1WX6A 4PK4A 3A8GB 1B7YA 4ELYC 3ULRB 1ZLMA 5FU6B 1VIFA 4EMHA 4LVMA 4ZNXA 3UATA 3OS0A 1M8MA 1MNEA 4J8OA 3CXCA 2RQTA 3GBQA 4BE1A 2DJZA 3QO5A 3META 3CQTA 2K57A 1VIEA 3RKWA 4BB7A 4VUBA 3A31A 4GBQA 5CVIA 4L87A 3I35A 5FRMA 4DQ2A 1MMAA 1TWBA 4N0AC 1YFSA 2PQWA 5C53B 3CMEQ 2ARUA 3P8VA 3CCMT 4FSSA 4ANJA 4KRTA 3CCVQ 4HKEA 4A54A 3X25B 3CCJT 3IALA 3HRUA 1OU8A 2XIDA 3LC0A 3NETA 2CZ1B 2SRCA 2DM1A 4C92F 3RUXA 5CQYA 2ZNJA 4QW2A 3UFGA 3JCMV 2GGRA 4O2DA 1MMNA 1NYRA 2CYZB 3SDZA 1B70B 3VS2A 4F16A 4J9BA 3OY9A 2RM4A 3E9GA 2MI6A 1NJ8A 2LX9A 2RJDA 1JJ2S 2F1LA 4M75D 3OYIA 1USYC 2NWMA 1K9AA 2XICA 3TEHA 2JTFA 2RN8A 1YBYA 5KYXA 3F70A 1B34A 3CMET 2ZPFB 3RMQA 5KNNA 4PJOB 3CCVT 1OOTA 2CUBA 2VVKA 4C8QA 1WYDA 1Q7YC 4A4GA 2QA4Q 4D6WA 1I0CA 1PRLC 4OP0A 2QAZA 1JEGA 4J9FA 1ASZA 1ZHIA 3RMSA 1BBWA 1ABOA 5GAMg 3OYHA 3CCUQ 1BYMA 3HKSA 3M58A 4H2UA 3J7AF 1X2KA 1OULA 1Q7YR 4YRSA 2X4XA 1LNXA 2QQ9A 2K7AA 2QTVA 1V1CA 2QG9B 4RTZA 3ER0A 1UDLA 1M3BA 2RQUA 4O5VA 1Q86C 2IY5A 5GAOm 5FU7B 4ZGEB 4M78E 1E22A 3H0FA 4NL3A 3HL8A 3QWYA 2LCSA 1SRMA 1FX7A 3LYIA 4M75E 1IGQA 4P74A 3Q1JA 2CJ9A 2ZAEA 4LNPA 2NUTB 1UFFA 4R0KA 3E9IA 3LH5A 3E19A 1WA7A 2QGGA 3HRKA 1VYVA 5GANg 2LTOA 2JN0A 4CH3A 1KHIA 2JS2A 2YUNA 3I5SA 1WU7A 3JCMf 4OMNA 3CCUT 1LOJA 2JUFA 2PZ1A 4OB2B 3A7RA 2DL8A 5IH2A 4HCZA 3FLGA 1Z9QA 1WYXA 4MDXA 1ZX6A 6AT1B 3OYMA 2QEXA 2GTJA 2HSEB 1JRIA 2RA2A 4X9DA 1N5ZA 1KQ2A 4F7UA 3CMAQ 2BZ8A 4M4ZA 2DRKA 4RKUE 2DETA 3UA7A 4C8QF 2K3YA 2YRCA 1GRIA 3NTIA 3KBGA 2LX7A 1JJ2P 1WNLA 1WIEA 2DZ9A 1Q86U 5LJ5h 1R0BG 3G1ZA 3PMTA 2HD0A 4C0DC 1PYSB 4Y91A 2XDBA 1LVKA 1YP5A 1N6AA 4LXCA 4HWTA 4M77A 3A8OB 3VKIA 4E7SA 2K2MA 1ZSZC 2JJ9A 3UPUA 3QYGB 5FU6C 3REAB 2QDYB 1W4SA 1JJCA 2LCLA 1E6HA 1EIYB 1AWJA 1OPKA 1M4ZA 2BZXA 4LVKA 2D0NA 1KC8C 4CC7A 4M7DA 2FHDA 4MZMA 4MDWA 4EMGA 2RHQA 2DAQA 1WI7A 3JCMc 3EGDB 5LJ5f 3I55Q 3CPWS 2L89A 3CMAT 4R56A 1FMWA 3THKA 3HHTB 1QW1A 2J6FA 4BW9A 1SESA 2C7IA 4E7ZA 2F5TX 4GLMA 2D8JA 4RTUA 4JDSA 4J9EA 4OMQA 5C52B 3GPLA 4YRGA 3UA6A 3HFZB 1QCOA 4X34A 2DL4A 3QDFA 3QNEA 3SWNC 4X1VA 3M9QA 4CRIA 1GCQA 2FB7A 3A5ZB 1QP2A 3I7FA 4J6YA 3OYFA 1R0CB 1YCYA 4A4FA 2KQWA 4HXJA 2G4CA 4F7UF 2ZT6A 2DTIA 2LRQA 4E51A 4DBRA 2ODRD 2QGFB 3VU3C 3M4PA 4BE0A 3I55T 3P8HA 1Y0MA 5K1PA 4YRFA 1ZUKA 1PKTA 2RHYA 1VQ4A 1GCPA 3V7CA 1KC8U 4IUTA 2DDZA 3A7UA 2EW3A 2WSEE 3NELA 2X35A 1I07A 1U5SA 4M77F 2L3PA 4AFSC 5KYUB 2E10A 4OB3B 4M7AD 4KT0E 2JS0A 2OTJA 1FWZA 4BACA 3QSUA 3ICAA 4OMMA 5J39A 1M8VA 1X55A 2FZGB 4M7DF 5I2MA 2HBWA 2O88A 2V8KA 3CCEQ 1NYFA 2ZXFA 4TQDA 5IHIA 4TVAB 2X51A 3QO3A 2JOYA 2CGHA 1RAHB 2KRNA 2R57A 3MPUB 5HK3A 4ZTUB 5EC7A 4LE9A 1GL5A 1YNZA 2ZPHB 1XJWB 4DA4A 2EPDA 3SFMA 3C12A 4FYWB 4UP9A 1UGVA 1YWPA 2JXBA 1WLEA 2YRDA 5CKEA 2HKQB 1VQZA 2LQKA 1X43A 2LP5A 3HSBA 3H41A 3RGLA 3VQXA 4FYVB 3CC2Q 5GMKi 3WVEB 2OI3A 2RHZA 1C0MA 1PD0A 1PSEA 2X4WA 1ZUYA 2PVOB 4EMKA 2DEQA 4BI3A 3L4GA 3VS6A 2QHVA 5KYNA 2DPPB 4RCCA 3HXWA 4DBQA 1KQSA 3MEWA 3QG1A 1LYLA 1FXXA 2L3QA 3A8MB 1GBRA 2DD4A 1TTHB 4Q5WA 2DZCA 2J3LA 2LMJA 4OLFA 1W1FA 3OYYA 3HRIA 3HXXA 2LCCA 2ZT8A 5FLXE 4A53A 1H3HA 4C5HA 1ACMB 3CD6A 2Q5IA 4RMFA 1BI3A 1BKBA 1GFCA 4C92B 2JZ2A 2Q7HA 4BDZA 4FYYB 2VGNA 3TCJA 3LSSA 1IHVA 3MHXA 1G3SA 3X24B 2KROA 1SG5A 1K0SA 2D1XA 4YRTA 1WPYA 3O8VA 4FT2A 4UP8A 2LJ3A 1IO6A 5GMKl 1H92A 4QVCA 4ME7A 5GAMh 4LN2A 1Y96A 1WJQA 4ELZC 3CC2T 3OMGA 4XU2A 3VS5A 2AZVA 1YITQ 4KBMB 3M0SA 4IUVA 1B7YB 2ZR2A 4H2XA 1VQ6A 3H6ZA 2EFIA 2A7YA 3X20B 3JSCA 3I56A 1ZBJA 1U8RA 2M1HA 2YUQA 3V7SA 3RF1A 1B3QA 2GFAA 5EG2A 4P72C 1QKXA 1K1ZA 2MCNA 4P75A 2VWFA 1SHFA 1YI2A 1HD3A 4Z8AA 2FL7A 4BUGA 5F5WA 2A3LA 4HT8A 1H641 2LQWA 4J6WA 2EQIA 2QQBA 3HXYA 5GANh 4HWPA 4UC4A 3SHWA 1W2BA 5LJ5j 4C92G 3JV3A 3OYGA 2DBKA 1TSFA 2DL3A 1M9SA 1AOJA 3JCMd 2QQSA 1G2BA 2KVQG 1YITT 2J05A 3A8HB 2EGCA 4CH5A 1J3TA 3VRZA 4LUDA 1OI1A 4P3PA 4XEOA 1YIJQ 1HSQA 1KK7A 3LGLA 5LJ3g 4HVCA 3PFSA 3VS0A 2HQHA 2CDTA 3M0RA 1VQMQ 4LD9K 4JS4A 3P8TA 3HFOA 2R5MA 2LJ0A 4C5IA 5GAN5 2E64A 3NMZC 2EKOA 3VV0A 4OMPA 3R6NA 1BBUA 1VQPA 1JBMA 1RI9A 3ERRA 1ADYA 1AVZC 4M78A 1VQKA 2RI2A 3X26B 3TEHB 4CS2A 5L23A 5KYXB 1YB3A 4M75A 4RQEA 3VUBA 3RERA 3EH1A 3J81E 1Q81C 3E9FA 1QP3A 2X9HA 3JCMW 1VQLA 4B6MA 1ASYA 2FEIA 1KSWA 4C8QB 1GGMA 3DLLA 1BB9A 3HY0A 3PIPA 3SD4A 3CC7A 1M1GA 3V8LA 2CUDA 1WXUA 1N9WA 4G84A 3C95A 4HCBA 1GBQA 3PVLA 1Q81R 1YIJT 3OS2A 1Z7MA 3FEOA 3J80E 1JXOA 3L2VA 5GMKe 1MHNA 2I2LA 2M16A 2YHTA 1VQMT 3FC3A 5LJ5d 1B76A 4KGXB 1RAIB 3HFVA 1KOGA 1OEBA 4CH6A 3VQYA 3NGPA 2MWOA 2HQXA 2IY5B 4P71C 2OTLQ 2FPDA 1CKAA 3BJUA 3EG1A 1VQ9A 3UH0A 5DY9A 1SRLA 2RK1A 4H2YA 4M7AB 2QXFA 1T3LA 5GAN3 2C06A 1NJ1A 3P8YA 2CH4W 4YRJA 2EWNA 4FL6A 4JZ3A 4E7KA 3UT1A 3TUPA 2DNUA 2DK3A 1ZUUA 3CCQA 4LNSA 3CC4A 2EQUA 1KD1C 1BU1A 1YJNA 1G3YA 4WI1A 1MV0B 1M27C 4M78F 2MK5A 5CQXA 2LDMA 2V1RA 2Y90A 2OTLT 1KD1R 4M75F 4C92C 1HJDA 1NJ6A 4K88A 4F7UB 3OQ5A 1JJ2A 2CJAA 1WHJA 2CT4A 3M57A 5A0GA 2CH4A 1YHQA 1DJ7B 4JJCA 4ZGDB 5IXBA 4J15A 1EIFA 4XTZA 4N0AA 4XTYA 2RQRA 2O01E 1WJSA 2ROTA 3ASKA 4QQGA 3CCSA 4XQ3A 1FMKA 3GNGA 1TH7A 2M0YA 2K4YA 4E7HA 2VB6A 3MP8A 4YCUA 4P73C 3TSWA 1LPLA 2Z0WA 2FO0A 2CP0A 2EQKA 3JB9I 2BTTA 4RTTA 3JB9D 4M77B 1SF9A 2KAFA 1M1KC 2LC4A 5GJWB 1JJCB 2HZYA 2QQAA 1M3CA 2AK5A 2V1QA 1Q82U 4M7DB 2COZA 1K8AR 1UJ0A 2RHQB 4IKFA 3E1SA 1MNDA 1M1KR 1TOVA 3HRSA 3MEYA 5HCKA 2QDLA 2CSIA 5GMKj 1M90C 4TTVA 1PRMC 4AFQC 1USYA 1ZA1B 3N5BB 4KH0B 3OS1A 5KH6A 1QVGA 1ATIA 1NBEB 4YREA 5HY6A 2FPEA 3VS7A 4M78D 2CP2A 1UECA 1NLPC 1M90R 2YUPA 3IQLA 4F7UG 4MZTA 3OW2P 3M5AA 2XTIA 2JT4A 2DL7A 3NENA 2KSSA 4FT4A 2XG8D 2KXCA 2LNHB 3QO8A 2PMEA 3OYLA 5D7UA 1RLPC 1YGBA 2E3HA 1H4SA 1VQ8A 1QWEA 3CCLA 2Q7EA 1VQ7Q 2Y4YA 1SKUB 2PMFA 2JM9A 4JPBW 1K76A 4HT4A 5DM7R 3FB9A 3CXCS 4M77G 3TSZA 3PNWC 4P3OA 4XAXB 2L3RA 3BY7A 3EG9A 2CZ6B 5GJVB 2RHXA 3OYJA 5KYWA 3KXTA 1PG5B 1Z9ZA 4K11A 4M7DG 1NYQA 2RJCA 1EFNA 2X4YA 2JNGA 1AWWA 2ABLA 2J3MA 2KYMA 2X3XD 2MPXC 3G71Q 3OYDA 5ECAA 5FW9A 1I5LA 2HL3A 1R8OB 4TVRA 2WSCE 3PTAA 3PIOA 4M7AA 4TQFA 1HTTA 2BE7D 3SEMA 3CCMA 1QWFA 3V8KA 4A4EA 4J9GA 3QXEB 1VQ7T 2GCXA 2E5QA 4YCVA 1E6GA 4NOYA 2QA4T 1RABB 3CCJA 1NJ5A 3UGTA 2EJGA 2EKHA 2DX1A 3L2RA 2WSFE 1EFWA 3LH0A 1RAFB 4UP7A 4LUEA 4PJOG 3A5YA 2AKWB 3CPWA 2M02A 3OYKA 5I22A 3CMQA 4BY6C 1UGQB 2P4RA 4JRKA 3L2WA 2DRMA 1Q7YU 1I5OB 4HA8A 3FIFA 4PHCA 4X5OA 2RI5A 5LJ3h 2DIQA 5J26A 3G71T 1ADJA 4EMKB 1UGRB 3L4GB 4CI0C 4TVWA 2DYBA 1RAEB 2ZT5A 1RUWA 5CKHA 1VQ5Q 1H8KA 1UE9A 1AWXA 4KR3A 2RK2A 2M51A 1KMMA 2P0QA 3CMEA 4II1A 2VUBA 3EGUA 3URGA 1Y7XA 2A28A 2XMFA 5A0LA 3EG2A 2GNCA 2WACA 1ZSZA 2CT3A 5GAOl 3CCVA 4CC4B
chains in the Genus database with same CATH topology
2EYQA 3TEGA 2IVWA 2ZPEB 4TVYA 4N4HA 4YRMA 4ZIBA 3RL6A 3ZFJA 2PU9B 4WJ4A 2ZPBB 3QJ6A 4C92E 4XU3A 3VQVA 1UEBA 3BDUA 1XNIA 1Y96B 3VYHB 3MQZA 2E12A 5CO7A 2R58A 1H4TA 1X2GA 4M7AF 3NEMA 4CS3A 2AMCA 4C5GA 3SWNA 4H2XB 5GAOp 1VQ5T 3VQWA 3QHSA 3VBBA 2RHUA 3JCMe 2A8EA 2ZR3A 1NPRA 2R5AA 4M77C 1BIBA 5CK9A 3W3SA 3LW5E 1X01A 4XEMA 1G51A 3CCUA 3V7RA 4M7DC 1HK9A 2Q5HA 4YRCA 4H2WA 1GXIE 3OYBA 3VUZA 3QBYA 1XTDA 2DU7A 3CBOA 3PCOA 3M4YA 1BI0A 3LWHA 2OAUA 4OMFB 4EDUA 1L0WA 3P8DA 1YJWT 5CR2A 4V2SA 5IAYA 5GAN7 5LL6S 4PJOC 3S6WA 1OYXA 2V8IA 3DKMA 3OA6A 3TREA 3A8LB 4PKCC 2ZGWA 1BI1A 3TU4K 2RHSA 3NTHA 1E1OA 4M78B 3OYEA 3P8BB 5LJ5e 4M75B 3BFMA 3UGQA 1KQ1A 2HAXA 4MMKA 2M0OA 3UWNA 1VQOT 2XKOC 2IG0A 5KE3A 1VQ6T 1WGSA 3V8JA 2D6FA 5FROA 4EPCA 2AKWA 3CMAA 3KFUA 2MF2A 4LVIA 1XOVA 5FU7C 5M9OA 3CCRT 4ZTFA 3C94A 3S3OA 2QQRA 2E6ZA 2LT1A 2DTHA 4IURA 3G6ET 2K5IA 1NE8A 4OF1A 4H2TA 5DLOA 1X2HA 4N4GA 3REUA 1I8FA 4H2SA 3A7AA 1W66A 3GLXA 1X54A 3G4ST 1V29B 5GAOn 3CCET 4BWAA 1QF6A 5C6SA 5J3BA 3HXUA 1I4K1 2EJFA 5IT9E 2DD5A 2RO0A 3I55A 1U1SA 4R55A 4LDVA 1NPPA 3HFNA 1X75C 1G5IA 1WQWA 2FVUA 2QHTA 3DB3A 3JCMQ 4P72A 1K9MC 4Q15A 4BI8B 2GF7A 5GAN4 4E7IA 1QVFS 3FRNA 4X9CA 2DVEA 3FDRA 1BI2A 1YJ9T 5A2QE 2E3CA 3CC7T 2DQ0A 3QDRB 5GAMf 1AHJB 3INZA 2DXBA 4YRQA 3REXA 2XHCA 3PGGA 3OBYA 5CIUA 1LJOA 2P4TA 3JCMg 3OB9A 3M4QA 3LSQA 2DTOA 1K73C 2VC8A 2DXUA 4MZPA 4YYEA 4J7IA 2LNVA 4M77E 1VQNT 1S72T 3JB9H 3JAME 5I21A 5KE2A 11ASA 3ZBDA 2EQMA 2ZZEA 4P75C 5GANf 4ZGJB 2I4OA 3HRTA 5GAOr 1X6OA 1XQHA 2CZ7B 3M53A 4P3NA 2XD0A 1Z7NA 1UGPB 2DKGA 1N27A 3HTZA 3HY1A 2AHJB 5A0DA 2RI3A 2VGMA 2YLBA 1IZ6A 3CC2A 4FSXA 4QQ6A 4PJOE 1UB4A 4L5GA 4YRNA 2K5FA 5LJ5g 4CH4A 2X4JA 5GAMe 5ELNA 3R07A 4JLGA 3CCST 1M5Q1 1D3BA 2V8JA 1QE0A 2CJBA 4YRRA 1BIAA 4YRPA 2P0LA 4DPGA 3OYNA 3RESA 2ZNIA 4IUQA 3M54A 4M75C 3EAEA 4YCWA 2ZCEA 3JB9F 3OW2S 1EVLA 2PUOB 3AHUA 2MMPA 1P92A 4RG8A 4QVDA 4YDQA 4C0GA 1YITA 5GAN2 2ZIMA 3PZCA 2RHIA 5GANe 2L5QA 3JCMJ 1Q81U 4CS4A 2M9UA 3LWIA 4C8QG 4RCBA 5AYFA 1EVKA 2MAMA 1O9SA 3OD1A 1H3ZA 3SB2A 4DOWA 4JS5A 3PMIA 3LX7A 4C0DB 1VQ8T 4HWOA 2ZZFA 4P73A 3R6OA 3OYAA 2BUDA 2I4MA 2CKKA 2RJFA 4PL6A 2XDDA 3M55A 4RMOA 2CZ0B 2DXCA 2ZPGB 4ZTZB 3MCAB 4K87A 4P5NA 5CKBA 2VXEA 4M7AG 1K8AC 1X56A 1YIJA 4E47A 4N4IA 3ME9A 1E1TA 3GIBA 2ARSA 1VQMA 4HWSA 3EFRA 1J5WA 5K1XA 1MGQA 2Y4XA 4WF2A 1G3TA 2HNIA 5GAMj 1KD1U 4PG3A 4ZN1A 2AMCB 4BI4A 3SWNB 3T9NA 4J83A 2FYKA 3QKJA 4JJNK 2I4LA 5KCHA 5E3IA 1Y71A 4E7JA 3RKXA 4G85A 2DXTA 3LGFA 1VUBA 4J7FA 1IREB 1OZ3A 2O4XA 5CAIA 3IKLA 1SRYA 2QEXT 5C0MA 3HPWA 2ZIOA 3S3MA 2CS7A 1H4QA 1YFRA 2KDSA 4K86A 5GANj 2QI2A 1K8AU 3PCOB 4HWRA 1WJRA 2OTLA 4RDXA 1M1KU 2GFUA 2P0KA 2XI9A 4QVZA 4YRIA 1G5VA 2PVGB 3RIRA 5IN1A 1M90U 2ALYA 2G3RA 3CPFA 1KG1A 4C8QC 2ZPIB 5HK0A 5GAMd 2RHSB 4IUPA 3NFCA 1RI0A 3JCMh 2ZZGA 2VXFA 4FU6A 3CBMA 1SERA 4A4KA 2ODRC 3RKYA 4C92D 2NLUA 3JCMP 2VYTA 1QVGS 5I2SA 3L1AA 5CKFA 3IKMB 3BDLA 4C0FA 4KUDK 3OSSC 5DLQE 4OB1B 3MEVA 4NCXA 3KUFA 4M7AC 4P74C 1RL2A 1WQ7A 4B9WA 1ZQ1A 2HBPA 5GANd 3JCMb 1PSFA 4KR2A 4XU1A 2XK0A 4MMLA 2P0PA 1NZ9A 3A32A 3HP9A 2ZT7A 5LJ3f 2BKDN 1VQ4T 4ZN3A 4QQDA 5GAN6 3GP8A 3WVDB 2LT4A 2E65A 5FRNA 3GOXA 2QTXA 3IG2A 4LDWA 2OTJT 3L2ZA 3BW1A 3MF1A 4EX5A 3MEUA 4LD6A 1G3WA 2JTMA 4LVLA 4OVAA 3DLMA 2MWPA 2ARTA 4BE2A 2EAYA 4JLIA 2P5IA 1VQ7A 1RIQA 3MP6A 2QA4A 3DB4A 4L6V5 4YRKA 3QPHA 4AH6A 1N8RC 1B70A 4Q6GA 5HGQA 4RG2A 2I4NA 2D9TA 3H8ZA 2E41A 5GAOq 3G71A 4C8QD 2XU8A 4JRPA 2EIFA 4PJOA 1M1FA 2BIVA 3CD6T 2KK4A 5LJ3e 4HT9A 2DQ3A 1Y07A 3PT9A 2E6NA 1EQRA 3GF5A 4O6JA 2ZTGA 3E9HA 1NNHA 2VV5A 3A74A 4H02A 4YP0A 4EO4A 1HC7A 3L2QA 2E1HA 4OB0B 3QJYA 2YRVA 3CBPA 4LDXA 1N8RU 2F69A 3I56T 4IUUA 4WJ3M 2ZZDA 3MF2A 4XTVA 4C8QE 1VQ5A 2PVDB 3M59A 4PLLA 5GMKm 4ZTJA 1D3BB 3JB9G 1QVFA 3RACA 1YI2T 3FJPA 1H4VB 5CKDA 3EFSA 3JRZA 2L8DA 3ZEHA 4DOVA 4XU0A 2NS6A 2E70A 4XTWA 3QUIA 2GQVA 4TWAA 3VJPA 1QVPA 3G7ZA 3X28B 4PJOF 2EQJA 5D6XA 4OGEA 2Q7GA 3CEYA 1B8AA 1G5HA 4M78G 2B8AA 4M7AE 4LDUA 4LDYA 3M56A 4EMKC 1KHCA 4M75G 3QIIA 1YJWA 2KY9A 1PYSA 4M77D 3HXVA 1VQPT 4YROA 4J6XA 2EL9A 3LLRA 4C5EA 4Z02A 1VQKT 4A4HA 4RQFA 2RD1A 4M7DD 4PNOA 4H2VA 1EIYA 4L59A 5LJ3j 1KMNA 4YPFA 5GMKh 4BDYA 2RB6A 1VQLT 2K5LA 12ASA 4F7UE 3MP1A 2DIGA 5L8RE 3OS5A 1ZBXA 1N9SA 1VQOA 3QO7A 1UGSB 4YRLA 3OSVA 3S3NA 1SSFA 1NJIC 1OZ2A 1NJ2A 3HFZA 4NS5A 1KQSS 3CCRA 3UDCA 2ZINA 2F5KA 4XK8E 4PJOD 5KCOA 3A5ZA 3WXMB 1VQ9T 4GY5A 3G6EA 2XGTA 4B9XA 4Y28E 2RH2A 2QHUA 4JRQA 3DSQA 3OMCA 4M7DE 2PUKB 3WQZA 3G4SA 3CCEA 3MEAA 2LVMA 3L2UA 3C4SA 3OW2A 1K9MU 5D6YA 4JUVA 3M4GA 2KMTA 3CCQT 3JB9J 3TEEA 3CC4T 3OYCA 4JRIA 2O4XB 1YJNT 1SETA 3QZ5B 4E7LA 5D6WA 5C51B 2JVVA 2LQ8A 5LJ3d 3L42A 5ELOA 5HKCA 3NTKA 4FIBA 1JB0E 1U1TA 1NJIU 2CIMA 4ATOA 1I81A 5CCAA 1YHQT 4KQEA 4KULA 1HXDA 1C0AA 2D0QB 1K73U 1B34B 4P71A 4TVAA 4C0ZA 1O75A 4XTXA 2YLCA 1YJ9A 4GLKA 4M78C 3QZ9B 2RJEA 1FYFA 2E5AA 1W2BS 2K2VA 4FM4B 2ALYB 1EOVA 2HQEA 1YFTA 2EJ9A 2QHSA 2K3XA 4PLIA 4NL2A 3HXZA 4YTLA 4BY6B 4LVJA 2DU5A 1VQNA 1S72A 2DO3A 1IL2A 2XDPA 2C8MA 4C92A 4XTUA 4OGCA 2ZCFB 3OBWA 1Q82C 4J5YA 1N9RA 3GNFB 4BD3A 3JCMX 1E24A 3VYGA 3QYHB 3CCLT 4HCCA 2H3JA 5GAN8 3MO8A 4UPAA 3QTCA 4KUIA 3A8GB 1B7YA 4ELYC 5FU6B 1VIFA 4EMHA 4LVMA 3OS0A 4J8OA 3CXCA 4BE1A 2DJZA 3QO5A 3META 2K57A 1VIEA 3RKWA 4BB7A 4VUBA 3A31A 5CVIA 4L87A 5FRMA 4DQ2A 4N0AC 1YFSA 2PQWA 5C53B 2ARUA 3P8VA 3CCMT 4HKEA 4A54A 3X25B 3CCJT 3IALA 3HRUA 2XIDA 3LC0A 3NETA 2CZ1B 4C92F 3RUXA 5CQYA 2ZNJA 4QW2A 3UFGA 3JCMV 4O2DA 1NYRA 2CYZB 3SDZA 1B70B 3OY9A 2RM4A 3E9GA 2MI6A 1NJ8A 2LX9A 2RJDA 1JJ2S 4M75D 3OYIA 1USYC 2XICA 3TEHA 2JTFA 1YBYA 3F70A 1B34A 3CMET 2ZPFB 3RMQA 5KNNA 4PJOB 3CCVT 4C8QA 1WYDA 1Q7YC 4A4GA 4D6WA 4OP0A 1ASZA 1ZHIA 3RMSA 1BBWA 5GAMg 3OYHA 1BYMA 3HKSA 3M58A 4H2UA 3J7AF 4YRSA 2X4XA 1LNXA 2QQ9A 3ER0A 4O5VA 1Q86C 2IY5A 5GAOm 5FU7B 4ZGEB 4M78E 1E22A 4NL3A 3HL8A 1FX7A 3LYIA 4M75E 4P74A 3Q1JA 2CJ9A 3E9IA 3E19A 3HRKA 5GANg 2LTOA 2JN0A 4CH3A 1KHIA 1WU7A 3JCMf 3CCUT 1LOJA 2JUFA 4OB2B 3A7RA 4HCZA 3FLGA 4MDXA 3OYMA 2QEXA 1JRIA 2RA2A 4X9DA 1KQ2A 4F7UA 4RKUE 4C8QF 2K3YA 3NTIA 3KBGA 1WNLA 2DZ9A 1Q86U 5LJ5h 3G1ZA 3PMTA 2HD0A 4C0DC 1PYSB 4Y91A 2XDBA 1N6AA 4HWTA 4M77A 3A8OB 3VKIA 3UPUA 3QYGB 5FU6C 1JJCA 2QDYB 1W4SA 2LCLA 1EIYB 1M4ZA 4LVKA 1KC8C 4M7DA 2FHDA 4MZMA 4MDWA 4EMGA 2RHQA 2DAQA 3JCMc 5LJ5f 3CPWS 2L89A 3CMAT 4R56A 3HHTB 1QW1A 4BW9A 1SESA 2C7IA 2F5TX 4JDSA 5C52B 3GPLA 4YRGA 3HFZB 4X34A 3QNEA 3SWNC 3M9QA 4CRIA 2FB7A 3A5ZB 1QP2A 3I7FA 4J6YA 3OYFA 1YCYA 4A4FA 2KQWA 2G4CA 4F7UF 2ZT6A 2DTIA 2LRQA 4E51A 2ODRD 3VU3C 3M4PA 4BE0A 3I55T 3P8HA 5K1PA 4YRFA 2RHYA 1VQ4A 3V7CA 1KC8U 4IUTA 2DDZA 3A7UA 2WSEE 3NELA 2X35A 4M77F 4M7AD 2E10A 4OB3B 4KT0E 2OTJA 1FWZA 4BACA 3QSUA 3ICAA 5J39A 1M8VA 1X55A 4M7DF 5I2MA 2V8KA 2ZXFA 4TQDA 4TVAB 3QO3A 2JOYA 2CGHA 2R57A 5HK3A 4ZTUB 2ZPHB 4DA4A 3SFMA 3C12A 4UP9A 1WLEA 5CKEA 1VQZA 2LQKA 3HSBA 3RGLA 3VQXA 5GMKi 3WVEB 2RHZA 2X4WA 1PSEA 2PVOB 4EMKA 2DEQA 4BI3A 3L4GA 2QHVA 2DPPB 4RCCA 3HXWA 1KQSA 3MEWA 3QG1A 1LYLA 1FXXA 3A8MB 2DD4A 4Q5WA 2DZCA 2J3LA 4OLFA 3HXXA 3OYYA 3HRIA 2LCCA 2ZT8A 5FLXE 4A53A 4C5HA 3CD6A 2Q5IA 4RMFA 1BKBA 1BI3A 4C92B 2JZ2A 2Q7HA 4BDZA 2VGNA 3TCJA 3LSSA 3MHXA 1G3SA 3X24B 4YRTA 1WPYA 3O8VA 4FT2A 4UP8A 5GMKl 4QVCA 4ME7A 5GAMh 1Y96A 1WJQA 4ELZC 3CC2T 3OMGA 4XU2A 4KBMB 4IUVA 1B7YB 2ZR2A 4H2XA 1VQ6A 3H6ZA 2EFIA 2A7YA 3X20B 3JSCA 3I56A 1U8RA 2M1HA 3V7SA 3RF1A 2GFAA 5EG2A 4P72C 4P75A 1YI2A 4BUGA 2FL7A 5F5WA 2A3LA 4HT8A 1H641 4J6WA 2QQBA 3HXYA 5GANh 4HWPA 4UC4A 1W2BA 5LJ5j 4C92G 3OYGA 1M9SA 3JCMd 2QQSA 2KVQG 1YITT 3A8HB 4CH5A 1OI1A 4P3PA 4XEOA 3LGLA 5LJ3g 4HVCA 3PFSA 4LD9K 4JS4A 3P8TA 3HFOA 2R5MA 4C5IA 5GAN5 2E64A 2EKOA 3VV0A 1BBUA 1VQPA 1JBMA 3ERRA 1ADYA 4M78A 1VQKA 2RI2A 3X26B 3TEHB 4CS2A 1YB3A 4M75A 4RQEA 3VUBA 3RERA 3J81E 1Q81C 3E9FA 1QP3A 3JCMW 1VQLA 1ASYA 4C8QB 1GGMA 3DLLA 3HY0A 3PIPA 3SD4A 3CC7A 1M1GA 3V8LA 1N9WA 4G84A 3C95A 4HCBA 1YIJT 3OS2A 1Z7MA 3FEOA 3J80E 3L2VA 5GMKe 1MHNA 2I2LA 2M16A 2YHTA 1VQMT 3FC3A 5LJ5d 1B76A 3HFVA 1KOGA 4CH6A 3VQYA 2MWOA 2HQXA 2IY5B 4P71C 3BJUA 1VQ9A 3UH0A 5DY9A 2RK1A 4H2YA 4M7AB 2QXFA 5GAN3 2C06A 1NJ1A 3P8YA 4YRJA 2EWNA 4FL6A 4E7KA 3UT1A 3TUPA 2DK3A 3CCQA 4LNSA 3CC4A 2EQUA 1KD1C 1YJNA 1G3YA 4WI1A 4M78F 5CQXA 2LDMA 2Y90A 2OTLT 4M75F 4C92C 1NJ6A 4K88A 4F7UB 3OQ5A 1JJ2A 2CJAA 3M57A 5A0GA 1YHQA 1DJ7B 4ZGDB 4J15A 1EIFA 4XTZA 4N0AA 4XTYA 2O01E 1WJSA 3ASKA 4QQGA 3CCSA 4XQ3A 3GNGA 1TH7A 2K4YA 4E7HA 3MP8A 4YCUA 4P73C 2EQKA 3JB9I 3JB9D 4M77B 2KAFA 1M1KC 2LC4A 1JJCB 2QQAA 1Q82U 4M7DB 2RHQB 4IKFA 3E1SA 3HRSA 3MEYA 5GMKj 1M90C 4TTVA 1USYA 3N5BB 3OS1A 5KH6A 1QVGA 1ATIA 4YREA 5HY6A 4M78D 4F7UG 4MZTA 3M5AA 2XTIA 3NENA 2KSSA 4FT4A 2XG8D 3QO8A 2PMEA 3OYLA 1YGBA 1H4SA 1VQ8A 3CCLA 2Q7EA 2Y4YA 2PMFA 4HT4A 5DM7R 3FB9A 3CXCS 4M77G 3PNWC 4P3OA 4XAXB 2L3RA 3BY7A 2CZ6B 2RHXA 3OYJA 3KXTA 4M7DG 1NYQA 2RJCA 2X4YA 2JNGA 2J3MA 3OYDA 1I5LA 1R8OB 4TVRA 2WSCE 3PTAA 3PIOA 4M7AA 4TQFA 1HTTA 3CCMA 3V8KA 4A4EA 3QXEB 1VQ7T 2GCXA 2E5QA 4YCVA 4NOYA 2QA4T 1NJ5A 3CCJA 3UGTA 2EJGA 3L2RA 2WSFE 1EFWA 3LH0A 4UP7A 4PJOG 3A5YA 2AKWB 3CPWA 3OYKA 3CMQA 4BY6C 1UGQB 4JRKA 3L2WA 1Q7YU 4HA8A 3FIFA 4PHCA 4X5OA 2RI5A 5LJ3h 2DIQA 5J26A 3G71T 1ADJA 4EMKB 1UGRB 3L4GB 4CI0C 4TVWA 2ZT5A 5CKHA 4KR3A 2RK2A 1KMMA 2P0QA 3CMEA 4II1A 2VUBA 3URGA 1Y7XA 5A0LA 2WACA 5GAOl 3CCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TEG A;  2AMC B;  3SWN B;  4TVY A;  1VQZ A;  4YRM A;  4ZIB A;  1U1T A;  3HSB A;  3RGL A;  3RL6 A;  3VQX A;  2CIM A;  4WJ4 A;  2FYK A;  5GMK i;  1I81 A;  2I4L A;  4C92 E;  4KQE A;  4EMK A;  2DEQ A;  3L4G A;  1HXD A;  2QHV A;  1C0A A;  5E3I A;  4RCC A;  3HXW A;  1B34 B;  4XU3 A;  4P71 A;  4TVA A;  3VQV A;  3BDU A;  1LYL A;  3RKX A;  4G85 A;  1Y96 B;  2DXT A;  4XTX A;  2YLC A;  2DZC A;  2J3L A;  4OLF A;  3HXX A;  3HRI A;  5CAI A;  3IKL A;  2ZT8 A;  4M78 C;  4A53 A;  1SRY A;  1FYF A;  2E5A A;  1H4T A;  1X2G A;  4M7A F;  2Q5I A;  3NEM A;  4RMF A;  4CS3 A;  4C92 B;  2AMC A;  2ZIO A;  3SWN A;  4H2X B;  5GAO p;  2Q7H A;  2ALY B;  1H4Q A;  3VQW A;  1YFR A;  1EOV A;  3LSS A;  3QHS A;  4K86 A;  1YFT A;  2EJ9 A;  2QHS A;  5GAN j;  4YRT A;  1WPY A;  3PCO B;  3VBB A;  3JCM e;  4HWR A;  4UP8 A;  2ZR3 A;  4RDX A;  4NL2 A;  4M77 C;  1BIB A;  5GMK l;  4QVC A;  3HXZ A;  5GAM h;  3W3S A;  1X01 A;  1Y96 A;  4YRI A;  4XEM A;  2DU5 A;  1G51 A;  4XU2 A;  3RIR A;  3V7R A;  1HK9 A;  4M7D C;  2Q5H A;  1IL2 A;  2C8M A;  4C92 A;  1B7Y B;  4YRC A;  4H2W A;  2ZR2 A;  4H2X A;  4XTU A;  2ALY A;  4C8Q C;  5GAM d;  2DU7 A;  2RHS B;  3PCO A;  4J5Y A;  1N9R A;  3V7S A;  3RF1 A;  4P72 C;  3JCM h;  2ZZG A;  3JCM X;  2VXF A;  1SER A;  1L0W A;  1E24 A;  2ODR C;  3RKY A;  4P75 A;  4V2S A;  4C92 D;  5F5W A;  4HT8 A;  1H64 1;  4J6W A;  3JCM P;  5GAN 8;  3HXY A;  5GAN 7;  3L1A A;  5GAN h;  4HWP A;  4UPA A;  3QTC A;  1B7Y A;  4PJO C;  5LJ5 j;  4C92 G;  3IKM B;  4EMH A;  3JCM d;  2ZGW A;  2RHS A;  4NCX A;  1E1O A;  4M78 B;  4CH5 A;  4M7A C;  4P74 C;  2DJZ A;  5LJ5 e;  1WQ7 A;  3QO5 A;  4P3P A;  4M75 B;  3BFM A;  3UGQ A;  1KQ1 A;  4XEO A;  2K57 A;  5GAN d;  4MMK A;  3RKW A;  3JCM b;  5LJ3 g;  4HVC A;  4KR2 A;  3A31 A;  4L87 A;  4XU1 A;  3P8T A;  3V8J A;  4DQ2 A;  3HFO A;  4MML A;  4N0A C;  5GAN 5;  1YFS A;  2AKW A;  3KFU A;  5C53 B;  2ARU A;  3A32 A;  3P8V A;  2E64 A;  2ZT7 A;  1BBU A;  1JBM A;  5LJ3 f;  3ERR A;  1ADY A;  4A54 A;  4M78 A;  2DTH A;  5GAN 6;  3IAL A;  3TEH B;  4CS2 A;  3LC0 A;  1YB3 A;  4M75 A;  3NET A;  4RQE A;  3RER A;  2E65 A;  4H2T A;  4C92 F;  3RUX A;  2ZNJ A;  3UFG A;  3JCM W;  1X2H A;  3JCM V;  1ASY A;  3REU A;  4C8Q B;  1GGM A;  2QTX A;  1I8F A;  3IG2 A;  4O2D A;  3HY0 A;  1NYR A;  3L2Z A;  3V8L A;  4H2S A;  1B70 B;  3A7A A;  1W66 A;  1N9W A;  1X54 A;  4G84 A;  5GAO n;  4BWA A;  3BW1 A;  3MF1 A;  2RM4 A;  4EX5 A;  1QF6 A;  1Z7M A;  1NJ8 A;  3HXU A;  1I4K 1;  5GMK e;  2EJF A;  2I2L A;  2YHT A;  4M75 D;  2ART A;  1USY C;  5LJ5 d;  1B76 A;  2EAY A;  3TEH A;  4JLI A;  2P5I A;  1B34 A;  3HFV A;  1KOG A;  1U1S A;  4CH6 A;  3VQY A;  5KNN A;  1RIQ A;  4PJO B;  2IY5 B;  4P71 C;  3HFN A;  3BJU A;  4C8Q A;  4YRK A;  3UH0 A;  1WYD A;  1G5I A;  1WQW A;  5DY9 A;  2QHT A;  4AH6 A;  1B70 A;  4OP0 A;  3JCM Q;  1ASZ A;  4H2Y A;  4M7A B;  1BBW A;  4P72 A;  5GAM g;  4Q15 A;  4Q6G A;  5HGQ A;  4H2U A;  2I4N A;  5GAN 4;  4YRS A;  5GAN 3;  4X9C A;  1LNX A;  2E41 A;  2DVE A;  5GAO q;  1NJ1 A;  3P8Y A;  4YRJ A;  2EWN A;  4C8Q D;  3TUP A;  2E3C A;  2DQ0 A;  4PJO A;  5GAM f;  2IY5 A;  4LNS A;  5GAO m;  3INZ A;  4M78 E;  4YRQ A;  4HT9 A;  5LJ3 e;  1E22 A;  2DQ3 A;  3REX A;  3PGG A;  4WI1 A;  4NL3 A;  4M75 E;  1LJO A;  4M78 F;  3JCM g;  4P74 A;  2Y90 A;  2CJ9 A;  3M4Q A;  1EQR A;  3LSQ A;  2DTO A;  4M75 F;  4C92 C;  2ZTG A;  2VC8 A;  2DXU A;  1NJ6 A;  3E9I A;  1NNH A;  4F7U B;  3E9H A;  4K88 A;  4YYE A;  3A74 A;  2CJA A;  4H02 A;  3HRK A;  4M77 E;  5GAN g;  4YP0 A;  2JN0 A;  4J15 A;  4XTZ A;  4N0A A;  4CH3 A;  4XTY A;  3JCM f;  3JB9 H;  1WU7 A;  4EO4 A;  1HC7 A;  1LOJ A;  2E1H A;  5I21 A;  11AS A;  4XQ3 A;  3A7R A;  1TH7 A;  2ZZE A;  4YCU A;  4P75 C;  4P73 C;  5GAN f;  4WJ3 M;  2I4O A;  3JB9 I;  5GAO r;  3JB9 D;  4M77 B;  3MF2 A;  1JRI A;  4XTV A;  2RA2 A;  4X9D A;  4C8Q E;  1KQ2 A;  4P3N A;  4F7U A;  5GMK m;  1JJC B;  1Z7N A;  1D3B B;  3JB9 G;  3RAC A;  4C8Q F;  2DKG A;  4M7D B;  3FJP A;  1H4V B;  1WNL A;  2DZ9 A;  3HTZ A;  2RHQ B;  3HY1 A;  3EFS A;  5LJ5 h;  3G1Z A;  3MEY A;  1PYS B;  5GMK j;  4Y91 A;  2YLB A;  4TTV A;  4XU0 A;  4XTW A;  1USY A;  3QUI A;  4PJO E;  1ATI A;  4YRE A;  4HWT A;  4M77 A;  4TWA A;  4YRN A;  4M78 D;  5LJ5 g;  4CH4 A;  5GAM e;  5ELN A;  4PJO F;  4F7U G;  1JJC A;  3R07 A;  2Q7G A;  1M5Q 1;  1D3B A;  2XTI A;  1EIY B;  1QE0 A;  2CJB A;  4YRR A;  1BIA A;  1B8A A;  1G5H A;  4M78 G;  4M7A E;  2P0L A;  3NEN A;  4YRP A;  4DPG A;  4M7D A;  4EMG A;  2RHQ A;  3QO8 A;  2PME A;  4EMK C;  3RES A;  4M75 G;  2ZNI A;  1YGB A;  3JCM c;  1H4S A;  5LJ5 f;  4M75 C;  1PYS A;  4M77 D;  4YCW A;  2Q7E A;  4BW9 A;  3HXV A;  1SES A;  2C7I A;  2ZCE A;  2PMF A;  4YRO A;  3JB9 F;  4J6X A;  2EL9 A;  3FB9 A;  1EVL A;  4M77 G;  5C52 B;  4RQF A;  3AHU A;  4YRG A;  2RD1 A;  4P3O A;  4M7D D;  4PNO A;  3HFZ B;  4H2V A;  3QNE A;  4QVD A;  3BY7 A;  3SWN C;  1EIY A;  5LJ3 j;  4YPF A;  1KMN A;  2FB7 A;  4YDQ A;  5GMK h;  2RB6 A;  5GAN 2;  2ZIM A;  4M7D G;  3PZC A;  5GAN e;  12AS A;  3I7F A;  4J6Y A;  1NYQ A;  4F7U E;  2J3M A;  1YCY A;  3JCM J;  4CS4 A;  1N9S A;  4YRL A;  3QO7 A;  2G4C A;  1I5L A;  4C8Q G;  4F7U F;  4RCB A;  2ZT6 A;  2DTI A;  4E51 A;  2ODR D;  1EVK A;  3VU3 C;  4M7A A;  3OD1 A;  4TQF A;  1HTT A;  3M4P A;  1NJ2 A;  3V8K A;  3HFZ A;  3SB2 A;  5K1P A;  4YRF A;  2ZIN A;  4PJO D;  4YCV A;  4HWO A;  4NOY A;  1NJ5 A;  2ZZF A;  4P73 A;  3UGT A;  2EJG A;  3A5Z A;  3V7C A;  2DDZ A;  3A7U A;  2I4M A;  2XGT A;  1EFW A;  3NEL A;  4UP7 A;  4PJO G;  3A5Y A;  4M77 F;  2AKW B;  2QHU A;  2E10 A;  4M7A D;  3CMQ A;  3DSQ A;  4JRK A;  4ZTZ B;  4M7D E;  4HA8 A;  4K87 A;  3FIF A;  4PHC A;  4X5O A;  5LJ3 h;  3QSU A;  3ICA A;  3WQZ A;  1M8V A;  2VXE A;  1X55 A;  4M7A G;  4M7D F;  1X56 A;  1ADJ A;  4EMK B;  4JUV A;  3M4G A;  3L4G B;  1E1T A;  2ARS A;  3GIB A;  2ZXF A;  4TQD A;  4TVW A;  4TVA B;  3QO3 A;  3JB9 J;  2ZT5 A;  2CGH A;  4HWS A;  3EFR A;  4ZTU B;  1J5W A;  5K1X A;  4KR3 A;  4JRI A;  1KMM A;  1MGQ A;  1SET A;  5C51 B;  4WF2 A;  4UP9 A;  5LJ3 d;  5GAO l;  5ELO A;  2HNI A;  5GAM j;  4PG3 A;  1WLE A; 
#chains in the Genus database with same CATH topology
 2EYQ A;  3TEG A;  2YXY A;  2IVW A;  1D09 B;  2ZPE B;  4N4H A;  1CSK A;  4TVY A;  4YRM A;  2ED0 A;  1JXM A;  2RQW A;  4ZIB A;  1RLQ C;  2DJQ A;  2NYS A;  3TQ7 P;  3RL6 A;  3ZFJ A;  2PU9 B;  4WJ4 A;  2H8H A;  1JO8 A;  1PHT A;  2ZPB B;  3QJ6 A;  4C92 E;  4HVV A;  4XU3 A;  3VQV A;  3FJ5 A;  3CXC P;  1UEB A;  3BDU A;  1NYG A;  1XNI A;  1Y96 B;  1IXD A;  3VYH B;  3MQZ A;  2E12 A;  1QQJ A;  5CO7 A;  2R58 A;  1H4T A;  1X2G A;  1UHF A;  3H0H A;  1I1J A;  4M7A F;  3NEM A;  4CS3 A;  2AMC A;  4C5G A;  2DLP A;  3SWN A;  4H2X B;  5GAO p;  1VQ5 T;  2O9V A;  4EIK A;  1YJW Q;  3VQW A;  4KH1 B;  3QHS A;  1X6G A;  3VBB A;  2RHU A;  3JCM e;  2A8E A;  1IRX A;  2ZR3 A;  1NPR A;  2R5A A;  4M77 C;  1BIB A;  5CK9 A;  3W3S A;  3LW5 E;  1X01 A;  3RDV A;  4XEM A;  1G51 A;  1TUD A;  3CCU A;  3V7R A;  4M7D C;  1HK9 A;  2Q5H A;  1U3O A;  2EGA A;  4YRC A;  1A0N B;  4H2W A;  1KFZ A;  1EZZ B;  2EGE A;  1ABQ A;  1GXI E;  3OYB A;  1OX8 A;  3VUZ A;  1VQO Q;  1UTI A;  1N8R R;  3QBY A;  1VQ6 Q;  1XTD A;  2DU7 A;  3CBO A;  3PCO A;  3M4Y A;  1BI0 A;  3LWH A;  2OAU A;  4OMF B;  4EDU A;  1L0W A;  3P8D A;  1YJW T;  1VA7 A;  5CR2 A;  1T0H A;  1TUG B;  3CCR Q;  4V2S A;  2DVJ A;  1GCQ C;  4E6R A;  5IAY A;  5GAN 7;  2NUZ A;  4RTY A;  2EYZ A;  5LL6 S;  3UF4 A;  1D1C A;  3G6E Q;  4PJO C;  3EGX B;  1OYX A;  2V8I A;  3DKM A;  3S6W A;  1M30 A;  3OA6 A;  3TRE A;  2HDA A;  3A8L B;  4PKC C;  1VYU A;  2ATC B;  2ZGW A;  1BI1 A;  4IIO A;  3TU4 K;  2RHS A;  5IXF A;  3NTH A;  1E1O A;  4M78 B;  1YCS B;  2J6O A;  3OYE A;  3P8B B;  5LJ5 e;  3G4S Q;  1AZE A;  2CP3 A;  3BFM A;  4M75 B;  1KQ1 A;  2HAX A;  3UGQ A;  4MMK A;  2M0O A;  3UWN A;  1VQO T;  2XKO C;  2FZC B;  2IG0 A;  5KE3 A;  1VQ6 T;  1WGS A;  3V8J A;  2J6K A;  5FWB A;  2D6F A;  2HEQ A;  5FRO A;  4EPC A;  1D0Z A;  2AKW A;  3CMA A;  1E7O A;  3KFU A;  2MF2 A;  4LVI A;  1M2O A;  1XOV A;  5FU7 C;  5M9O A;  3CCR T;  4ZTF A;  1QKW A;  4AG2 C;  3C94 A;  4J9H A;  3RR6 A;  3S3O A;  1D0Y A;  1R77 A;  2E6Z A;  2EBP A;  2LT1 A;  2QQR A;  4FW2 A;  4AMC A;  2DTH A;  4IUR A;  3G6E T;  2KRS A;  2K5I A;  1NE8 A;  4OF1 A;  4H2T A;  4Z89 A;  1SHG A;  5DLO A;  1X2H A;  4N4G A;  3REU A;  1I8F A;  3I5R A;  2RF0 A;  2AIR B;  4H2S A;  3A7A A;  4OML A;  1W66 A;  3GLX A;  1X54 A;  3G4S T;  1V29 B;  4Y92 A;  5GAO n;  1QMC A;  3CCE T;  1YJ9 Q;  4BWA A;  3CC7 Q;  2IPO B;  1QF6 A;  5C6S A;  5J3B A;  3HXU A;  1I4K 1;  2EJF A;  4PJM A;  5IT9 E;  2L0A A;  1T3S A;  2DD5 A;  2RO0 A;  3I55 A;  4DEX A;  1U1S A;  4HCK A;  1QLY A;  4R55 A;  1HYO A;  4LDV A;  1NPP A;  3HFN A;  3I9Q A;  4AFU C;  1MV3 A;  1X75 C;  1G5I A;  1WQW A;  2DL5 A;  2FVU A;  2QHT A;  2KGT A;  3DB3 A;  3JCM Q;  1VQN Q;  1S72 Q;  3PVQ A;  4P72 A;  1YFN A;  1K9M C;  4Q15 A;  4BI8 B;  2GF7 A;  5GAN 4;  4E7I A;  1QVF S;  3FRN A;  4X9C A;  1WDX A;  2DVE A;  3FDR A;  1BI2 A;  1YJ9 T;  5A2Q E;  2E3C A;  1C1A A;  4RTW A;  3CC7 T;  2DQ0 A;  1K9M R;  3QDR B;  5GAM f;  1AHJ B;  3INZ A;  2YT6 A;  2DXB A;  4YRQ A;  4DBH A;  3REX A;  2XHC A;  3PGG A;  3OBY A;  5CIU A;  1LJO A;  2P4T A;  3JCM g;  1YJN Q;  3OB9 A;  2RPN A;  2IIM A;  3M4Q A;  3LSQ A;  2DTO A;  1K73 C;  2VC8 A;  2CP7 A;  2DXU A;  4MZP A;  4YYE A;  2ED1 A;  4J7I A;  1RAA B;  2LNV A;  4M77 E;  1OQK A;  2F2V A;  1VQN T;  3HTR A;  1S72 T;  3JB9 H;  3JAM E;  1B7T A;  5I21 A;  5KE2 A;  1K73 R;  11AS A;  3ZBD A;  1MMG A;  2EQM A;  2BE9 B;  1G8X A;  1WHG A;  4PJL A;  2ZZE A;  4P75 C;  2BZY A;  3CCS Q;  5GAN f;  4ZGJ B;  1D1A A;  2I4O A;  4KGV B;  3EGX A;  3HRT A;  5GAO r;  1W6X A;  1X6O A;  3U23 A;  1XQH A;  2CZ7 B;  3M53 A;  4P3N A;  2FZK B;  2AZS A;  2QAS A;  2XD0 A;  1Z7N A;  2HKN A;  1UGP B;  4WCI A;  2DKG A;  1N27 A;  3HTZ A;  3HY1 A;  1TS9 A;  2AHJ B;  5A0D A;  2RI3 A;  2VGM A;  2YLB A;  1IZ6 A;  1OPL A;  3CC2 A;  3TVT A;  4FSX A;  2DEU A;  4QQ6 A;  1IB8 A;  4PJO E;  1UB4 A;  4L5G A;  2CP5 A;  4YRN A;  2K5F A;  5LJ5 g;  4CH4 A;  2X4J A;  1SEM A;  5GAM e;  5ELN A;  3R07 A;  4JLG A;  3EG9 B;  2K6D A;  3CCS T;  1M5Q 1;  2V8J A;  1D3B A;  1QE0 A;  2CJB A;  4YRR A;  1RAD B;  1BIA A;  2O2O A;  5KYW B;  4YRP A;  4PFZ A;  2P0L A;  4DPG A;  2NUP B;  1QVF P;  3OYN A;  2YSQ A;  3RES A;  2ZNI A;  4IUQ A;  2JMA A;  3M54 A;  4M75 C;  3EAE A;  4YCW A;  3EG3 A;  1MMD A;  1VQ8 Q;  1K0X A;  2ZCE A;  2W10 A;  3JB9 F;  2QK0 A;  3OW2 S;  1EVL A;  2PUO B;  2L2P A;  2KEA A;  3AHU A;  2O9S A;  3M0T A;  2KT8 A;  2MMP A;  1P92 A;  4RG8 A;  4QVD A;  1WXT A;  4YDQ A;  2GBQ A;  4C0G A;  1YIT A;  5GAN 2;  1KQS P;  1IGU A;  2ZIM A;  3PZC A;  2RHI A;  4IIM A;  5GAN e;  2O31 A;  2L5Q A;  3JCM J;  1Q81 U;  4CS4 A;  2M9U A;  3LWI A;  4C8Q G;  5KYY A;  4RCB A;  3RNJ A;  2J7I A;  5AYF A;  1EVK A;  2MAM A;  1O9S A;  1ZSG A;  2KR3 A;  3OD1 A;  4FCY A;  1H3Z A;  2KYB A;  4AFZ C;  3SB2 A;  4DOW A;  4JS5 A;  2CRE A;  3PMI A;  3LX7 A;  1TUC A;  4C0D B;  3CCM Q;  2DIL A;  1VQ8 T;  4HWO A;  2ZZF A;  4P73 A;  1YN8 A;  3R6O A;  3OYA A;  2BUD A;  2W0Z A;  2I4M A;  1UHC A;  2CKK A;  2RJF A;  2A37 A;  1VOM A;  1NM7 A;  2MYS A;  4PL6 A;  2XDD A;  5IHK A;  1ZSZ B;  3M55 A;  4RMO A;  2CZ0 B;  2DXC A;  2ZPG B;  4ZTZ B;  3MCA B;  4FYX B;  1AEY A;  4K87 A;  4P5N A;  5CKB A;  2RNA A;  2VXE A;  4M7A G;  2V26 A;  2COW A;  1K8A C;  1X56 A;  1YIJ A;  2QEX Q;  4E47 A;  4N4I A;  3H9N A;  1SSH A;  3ME9 A;  3GIB A;  1E1T A;  2ARS A;  1VQM A;  4HWS A;  3EFR A;  3A1P A;  1J5W A;  5K1X A;  1MGQ A;  8AT1 B;  2Y4X A;  4WF2 A;  1G3T A;  2HNI A;  5GAM j;  1KD1 U;  4PG3 A;  4ZN1 A;  2AMC B;  2C0I A;  2P84 A;  4BI4 A;  1PM3 A;  3SWN B;  1W2B P;  3T9N A;  3ZL7 C;  4J83 A;  3NHN A;  2FYK A;  2LZ6 B;  3QKJ A;  4JJN K;  2I4L A;  2FRW A;  2OAW A;  5KCH A;  5E3I A;  1QCF A;  1Y71 A;  4E7J A;  1WHH A;  3RKX A;  4G85 A;  2DXT A;  3LGF A;  1VUB A;  4J7F A;  1IRE B;  1OZ3 A;  2O4X A;  5CAI A;  3IKL A;  1SRY A;  2QEX T;  5C0M A;  3HPW A;  1OX9 A;  2ZIO A;  3G1J A;  3S3M A;  3C0C A;  3VS4 A;  2CS7 A;  1H4Q A;  1PD1 A;  1YFR A;  2KDS A;  4K86 A;  2AKL A;  5GAN j;  4HVU A;  2QI2 A;  1K8A U;  3PCO B;  4HWR A;  2KNB B;  1WJR A;  2OTL A;  4RDX A;  1M1K U;  4OMO A;  4FW1 A;  2GFU A;  2P0K A;  2XI9 A;  4QVZ A;  4F04 B;  4YRI A;  2HSP A;  2DYI A;  1AT1 B;  2NUP A;  1M2V B;  3EHQ A;  1G5V A;  2PVG B;  3RIR A;  2EVR A;  1NEG A;  5IN1 A;  1M90 U;  2ALY A;  2G3R A;  4PFP A;  2EYW A;  2GQI A;  3CPF A;  1KG1 A;  2ROL A;  4C8Q C;  2ZPI B;  3AT1 B;  2YUO A;  5HK0 A;  5GAM d;  1G83 A;  2RHS B;  4IUP A;  3NFC A;  1RI0 A;  3A98 A;  3JCM h;  2ZZG A;  2VXF A;  4FU6 A;  3CBM A;  1SER A;  4A4K A;  2ODR C;  3RKY A;  4C92 D;  2NLU A;  3JCM P;  1F1B B;  2VYT A;  1QVG S;  5I2S A;  1VQ4 Q;  3L1A A;  2OJ2 A;  5CKF A;  2GTO A;  3KFV A;  1Q86 R;  3BDL A;  3IKM B;  3QWX X;  4Z88 A;  4C0F A;  4KUD K;  3OSS C;  5DLQ E;  1C6V X;  2OTJ Q;  4OB1 B;  3MEV A;  4NCX A;  1NEB A;  3KUF A;  4RTV A;  4M7A C;  4P74 C;  1RL2 A;  1WQ7 A;  4B9W A;  1KIK A;  1ZQ1 A;  2HBP A;  2DBM A;  5GAN d;  2HMA A;  2A0F B;  1BCM A;  3JCM b;  1PSF A;  2J06 A;  4KR2 A;  4XU1 A;  2XK0 A;  4A63 B;  4MML A;  2OX7 A;  2P0P A;  2D8H A;  2QYZ A;  1NZ9 A;  3A32 A;  4JJD A;  3HP9 A;  2ZT7 A;  5LJ3 f;  1BCO A;  2F2X A;  4CC2 A;  2BKD N;  1VQ4 T;  4ZN3 A;  1MUZ A;  1V76 A;  4QQD A;  5GAN 6;  3GP8 A;  3WVD B;  4QKU A;  2L3S A;  2LT4 A;  2E65 A;  5FRN A;  1WHM A;  2EYX A;  3GOX A;  1YWO A;  1JU5 C;  2QTX A;  3IG2 A;  4LDW A;  2OTJ T;  1D1B A;  3L2Z A;  3VS3 A;  3BW1 A;  3MF1 A;  4EX5 A;  3MEU A;  1K4U S;  4LD6 A;  1G3W A;  2JTM A;  4LVL A;  1EX4 A;  4OVA A;  3CD6 Q;  3DLM A;  2MWP A;  2ART A;  4F17 A;  1D0X A;  4BE2 A;  2ENM A;  2LQN A;  1AZG B;  2EAY A;  2JW4 A;  4JLI A;  2P5I A;  2DA9 A;  1VQ7 A;  1RIQ A;  3MP6 A;  3REB B;  9ATC B;  2QA4 A;  2C0T A;  3DB4 A;  1NLO C;  2KI7 A;  4L6V 5;  2AT1 B;  2PNI A;  4YRK A;  3QPH A;  4ORZ A;  4AH6 A;  1N8R C;  1KC8 R;  1B70 A;  2DE0 X;  2DMO A;  4J9I A;  1BBZ A;  1QVG P;  4Q6G A;  5HGQ A;  3EH2 A;  4RG2 A;  2I4N A;  2D9T A;  1Q95 G;  2E41 A;  3H8Z A;  5GAO q;  3I56 Q;  2MIO A;  3G71 A;  4C8Q D;  2XU8 A;  1QCN A;  4JRP A;  2EIF A;  1X27 A;  4PJO A;  2EYY A;  1M1F A;  2BIV A;  3D7S B;  3CD6 T;  2DFU A;  1M2V A;  2KK4 A;  5LJ3 e;  4HT9 A;  2DQ3 A;  2K9G A;  1Y07 A;  3EFO B;  1YI2 Q;  3PT9 A;  4RTX A;  1WXB A;  2E6N A;  1EQR A;  3GF5 A;  3M0U A;  4O6J A;  2ZTG A;  3E9H A;  1NNH A;  2VV5 A;  3A74 A;  4H02 A;  4YP0 A;  3H0I A;  1Y57 A;  1NG2 A;  2K79 A;  1ARK A;  4EO4 A;  1GFD A;  3L2Q A;  4KGZ B;  1HC7 A;  2E1H A;  2E5K A;  1WHL A;  4OB0 B;  3QJY A;  2YRV A;  2B86 A;  3CBP A;  4LDX A;  1N8R U;  2F69 A;  3I56 T;  4IUU A;  4WJ3 M;  2ZZD A;  4JJB A;  1T0J A;  3MF2 A;  4XTV A;  4C8Q E;  1VQ5 A;  2NUT A;  2PVD B;  3M59 A;  1PCX A;  4PLL A;  5GMK m;  4F14 A;  2ECZ A;  4ZTJ A;  1D3B B;  3JB9 G;  1QVF A;  1TG0 A;  1X6B A;  1RAG B;  3RAC A;  2DF6 A;  1CKB A;  4ESR A;  1YI2 T;  1VQP Q;  3FJP A;  2SEM A;  1H4V B;  1WHK A;  5CKD A;  1VQK Q;  3EFS A;  3JRZ A;  1WFW A;  2L8D A;  3PE0 A;  3ZEH A;  4DOV A;  1PKS A;  4XU0 A;  3O5Z A;  2NS6 A;  2E70 A;  3CPW P;  4XTW A;  1TU0 B;  1VQL Q;  2JTE A;  3QUI A;  2GQV A;  3M0Q A;  5I11 A;  1X69 A;  4TWA A;  3VJP A;  1QVP A;  1WLP B;  2ESW A;  3G7Z A;  4J9D A;  3X28 B;  4PJO F;  2EQJ A;  5D6X A;  4OGE A;  2Q7G A;  3CEY A;  2CP6 A;  5IHN A;  1B8A A;  1G5H A;  4M78 G;  2B8A A;  4M7A E;  1UUE A;  4LDU A;  4LDY A;  3NPF A;  3M56 A;  4EMK C;  1KHC A;  4M75 G;  4QT7 A;  3EHR A;  3QII A;  1YJW A;  2KY9 A;  1AD5 A;  1PYS A;  4M77 D;  1PNJ A;  2AKK A;  3HXV A;  5KYY B;  2KXD A;  1VQP T;  3VRY A;  4YRO A;  2KT1 A;  4J6X A;  1VQ9 Q;  2EL9 A;  3LLR A;  4C5E A;  4Z02 A;  1VQK T;  4A4H A;  4RQF A;  4PFO A;  2RD1 A;  2F2W A;  4PNO A;  4M7D D;  4H2V A;  1RAC B;  4DEY A;  1EIY A;  8ATC B;  4L59 A;  5LJ3 j;  7AT1 B;  1KMN A;  4YPF A;  3BE3 A;  5GMK h;  4BDY A;  2RB6 A;  1VQL T;  1WZO A;  2K5L A;  12AS A;  2PTK A;  4F7U E;  3EGD A;  3MP1 A;  1FMV A;  2DIG A;  2A08 A;  2KBT A;  5L8R E;  3OS5 A;  1ZBX A;  1N9S A;  1VQO A;  3QO7 A;  1UGS B;  1M3A A;  1PWT A;  4YRL A;  3CCQ Q;  3OSV A;  3S3N A;  3CC4 Q;  1TXQ A;  1SSF A;  1X2Q A;  1NJI C;  1OZ2 A;  4D8K A;  1NJ2 A;  1SPK A;  4WTO B;  4NS5 A;  3HFZ A;  1KQS S;  3CCR A;  1UG1 A;  3UDC A;  2ZIN A;  2F5K A;  2FPF A;  4XK8 E;  3RBB B;  4PJO D;  2RMO A;  5KCO A;  3A5Z A;  1NJI R;  3WXM B;  5FWC A;  1VQ9 T;  4GY5 A;  4DBF A;  3G6E A;  2XGT A;  4PJN A;  2C0O A;  1ZA2 B;  2FG0 A;  4B9X A;  4Y28 E;  1YHQ Q;  2RH2 A;  2QHU A;  2DER A;  4JRQ A;  1IHW A;  3DSQ A;  3EFO A;  3OMC A;  4M7D E;  1S1N A;  2PUK B;  3WQZ A;  3G4S A;  3CCE A;  3MEA A;  2LVM A;  3L2U A;  3C4S A;  3OW2 A;  1K9M U;  3VS1 A;  5D6Y A;  4JUV A;  3M4G A;  2KMT A;  4E2F B;  1JQQ A;  1AWO A;  1PC0 A;  3CCQ T;  3JB9 J;  3TEE A;  3CC4 T;  3MKD A;  1OU9 A;  3OYC A;  4JRI A;  2O4X B;  2YDL A;  1YJN T;  2YWW A;  3QZ5 B;  1SET A;  4E7L A;  5D6W A;  5C51 B;  2JVV A;  4HVW A;  2LQ8 A;  5LJ3 d;  2VKN A;  3L42 A;  5ELO A;  5HKC A;  5KYU A;  3NTK A;  4FIB A;  1JB0 E;  4PJJ A;  1U1T A;  1NJI U;  2CIM A;  2COY A;  2H3E B;  2MOX A;  4ATO A;  1I81 A;  5CCA A;  1FYN A;  2KRM A;  1YHQ T;  4KQE A;  4KUL A;  1HXD A;  1W70 A;  2D0Q B;  1C0A A;  1K73 U;  1B34 B;  2RQV A;  4P71 A;  4AT1 B;  4TVA A;  4C0Z A;  1O75 A;  4XTX A;  2YLC A;  1YJ9 A;  4GLK A;  4M78 C;  3QZ9 B;  1BK2 A;  2RJE A;  2G6F X;  1FYF A;  2E5A A;  2VAS A;  1UJY A;  2HCK A;  1W2B S;  2FRY A;  2K2V A;  2LJ1 A;  4FM4 B;  3EG0 A;  2KE9 A;  2ALY B;  1KJW A;  1EOV A;  3CCL Q;  2HQE A;  2HL5 C;  1YFT A;  2EJ9 A;  4AG1 C;  2QHS A;  5AT1 B;  2K3X A;  4PLI A;  4NL2 A;  1U06 A;  3HXZ A;  1OV3 A;  2I0N A;  4YTL A;  2E3I A;  4BY6 B;  4LVJ A;  2A36 A;  2DU5 A;  1VQN A;  1S72 A;  2K3B A;  3E2U A;  2DO3 A;  1IL2 A;  2XDP A;  2CSQ A;  2C8M A;  4C92 A;  4J9C A;  4XTU A;  4OGC A;  2ZCF B;  3M0P A;  4D8D A;  1B07 A;  2E4H A;  1LCK A;  3OBW A;  1Q82 C;  4J5Y A;  1N9R A;  2JMC A;  4JZ4 A;  1VYT A;  3GNF B;  4BD3 A;  4CC3 A;  3JCM X;  1E24 A;  3VYG A;  3MJX A;  3QYH B;  3CCL T;  4HCC A;  2JM8 A;  1Q82 R;  2H3J A;  5GAN 8;  3CCJ Q;  2X3W D;  3MO8 A;  4RUG A;  3QTC A;  4UPA A;  4KUI A;  1WX6 A;  4PK4 A;  3A8G B;  1B7Y A;  4ELY C;  3ULR B;  1ZLM A;  5FU6 B;  1VIF A;  4EMH A;  4LVM A;  4ZNX A;  3UAT A;  3OS0 A;  1M8M A;  1MNE A;  4J8O A;  3CXC A;  2RQT A;  3GBQ A;  4BE1 A;  2DJZ A;  3QO5 A;  3MET A;  3CQT A;  2K57 A;  1VIE A;  3RKW A;  4BB7 A;  4VUB A;  3A31 A;  4GBQ A;  5CVI A;  4L87 A;  3I35 A;  5FRM A;  4DQ2 A;  1MMA A;  1TWB A;  4N0A C;  1YFS A;  2PQW A;  5C53 B;  3CME Q;  2ARU A;  3P8V A;  3CCM T;  4FSS A;  4ANJ A;  4KRT A;  3CCV Q;  4HKE A;  4A54 A;  3X25 B;  3CCJ T;  3IAL A;  3HRU A;  1OU8 A;  2XID A;  3LC0 A;  3NET A;  2CZ1 B;  2SRC A;  2DM1 A;  4C92 F;  3RUX A;  5CQY A;  2ZNJ A;  4QW2 A;  3UFG A;  3JCM V;  2GGR A;  4O2D A;  1MMN A;  1NYR A;  2CYZ B;  3SDZ A;  1B70 B;  3VS2 A;  4F16 A;  4J9B A;  3OY9 A;  2RM4 A;  3E9G A;  2MI6 A;  1NJ8 A;  2LX9 A;  2RJD A;  1JJ2 S;  2F1L A;  4M75 D;  3OYI A;  1USY C;  2NWM A;  1K9A A;  2XIC A;  3TEH A;  2JTF A;  2RN8 A;  1YBY A;  5KYX A;  3F70 A;  1B34 A;  3CME T;  2ZPF B;  3RMQ A;  5KNN A;  4PJO B;  3CCV T;  1OOT A;  2CUB A;  2VVK A;  4C8Q A;  1WYD A;  1Q7Y C;  4A4G A;  2QA4 Q;  4D6W A;  1I0C A;  1PRL C;  4OP0 A;  2QAZ A;  1JEG A;  4J9F A;  1ASZ A;  1ZHI A;  3RMS A;  1BBW A;  1ABO A;  5GAM g;  3OYH A;  3CCU Q;  1BYM A;  3HKS A;  3M58 A;  4H2U A;  3J7A F;  1X2K A;  1OUL A;  1Q7Y R;  4YRS A;  2X4X A;  1LNX A;  2QQ9 A;  2K7A A;  2QTV A;  1V1C A;  2QG9 B;  4RTZ A;  3ER0 A;  1UDL A;  1M3B A;  2RQU A;  4O5V A;  1Q86 C;  2IY5 A;  5GAO m;  5FU7 B;  4ZGE B;  4M78 E;  1E22 A;  3H0F A;  4NL3 A;  3HL8 A;  3QWY A;  2LCS A;  1SRM A;  1FX7 A;  3LYI A;  4M75 E;  1IGQ A;  4P74 A;  3Q1J A;  2CJ9 A;  2ZAE A;  4LNP A;  2NUT B;  1UFF A;  4R0K A;  3E9I A;  3LH5 A;  3E19 A;  1WA7 A;  2QGG A;  3HRK A;  1VYV A;  5GAN g;  2LTO A;  2JN0 A;  4CH3 A;  1KHI A;  2JS2 A;  2YUN A;  3I5S A;  1WU7 A;  3JCM f;  4OMN A;  3CCU T;  1LOJ A;  2JUF A;  2PZ1 A;  4OB2 B;  3A7R A;  2DL8 A;  5IH2 A;  4HCZ A;  3FLG A;  1Z9Q A;  1WYX A;  4MDX A;  1ZX6 A;  6AT1 B;  3OYM A;  2QEX A;  2GTJ A;  2HSE B;  1JRI A;  2RA2 A;  4X9D A;  1N5Z A;  1KQ2 A;  4F7U A;  3CMA Q;  2BZ8 A;  4M4Z A;  2DRK A;  4RKU E;  2DET A;  3UA7 A;  4C8Q F;  2K3Y A;  2YRC A;  1GRI A;  3NTI A;  3KBG A;  2LX7 A;  1JJ2 P;  1WNL A;  1WIE A;  2DZ9 A;  1Q86 U;  5LJ5 h;  1R0B G;  3G1Z A;  3PMT A;  2HD0 A;  4C0D C;  1PYS B;  4Y91 A;  2XDB A;  1LVK A;  1YP5 A;  1N6A A;  4LXC A;  4HWT A;  4M77 A;  3A8O B;  3VKI A;  4E7S A;  2K2M A;  1ZSZ C;  2JJ9 A;  3UPU A;  3QYG B;  5FU6 C;  3REA B;  2QDY B;  1W4S A;  1JJC A;  2LCL A;  1E6H A;  1EIY B;  1AWJ A;  1OPK A;  1M4Z A;  2BZX A;  4LVK A;  2D0N A;  1KC8 C;  4CC7 A;  4M7D A;  2FHD A;  4MZM A;  4MDW A;  4EMG A;  2RHQ A;  2DAQ A;  1WI7 A;  3JCM c;  3EGD B;  5LJ5 f;  3I55 Q;  3CPW S;  2L89 A;  3CMA T;  4R56 A;  1FMW A;  3THK A;  3HHT B;  1QW1 A;  2J6F A;  4BW9 A;  1SES A;  2C7I A;  4E7Z A;  2F5T X;  4GLM A;  2D8J A;  4RTU A;  4JDS A;  4J9E A;  4OMQ A;  5C52 B;  3GPL A;  4YRG A;  3UA6 A;  3HFZ B;  1QCO A;  4X34 A;  2DL4 A;  3QDF A;  3QNE A;  3SWN C;  4X1V A;  3M9Q A;  4CRI A;  1GCQ A;  2FB7 A;  3A5Z B;  1QP2 A;  3I7F A;  4J6Y A;  3OYF A;  1R0C B;  1YCY A;  4A4F A;  2KQW A;  4HXJ A;  2G4C A;  4F7U F;  2ZT6 A;  2DTI A;  2LRQ A;  4E51 A;  4DBR A;  2ODR D;  2QGF B;  3VU3 C;  3M4P A;  4BE0 A;  3I55 T;  3P8H A;  1Y0M A;  5K1P A;  4YRF A;  1ZUK A;  1PKT A;  2RHY A;  1VQ4 A;  1GCP A;  3V7C A;  1KC8 U;  4IUT A;  2DDZ A;  3A7U A;  2EW3 A;  2WSE E;  3NEL A;  2X35 A;  1I07 A;  1U5S A;  4M77 F;  2L3P A;  4AFS C;  5KYU B;  2E10 A;  4OB3 B;  4M7A D;  4KT0 E;  2JS0 A;  2OTJ A;  1FWZ A;  4BAC A;  3QSU A;  3ICA A;  4OMM A;  5J39 A;  1M8V A;  1X55 A;  2FZG B;  4M7D F;  5I2M A;  2HBW A;  2O88 A;  2V8K A;  3CCE Q;  1NYF A;  2ZXF A;  4TQD A;  5IHI A;  4TVA B;  2X51 A;  3QO3 A;  2JOY A;  2CGH A;  1RAH B;  2KRN A;  2R57 A;  3MPU B;  5HK3 A;  4ZTU B;  5EC7 A;  4LE9 A;  1GL5 A;  1YNZ A;  2ZPH B;  1XJW B;  4DA4 A;  2EPD A;  3SFM A;  3C12 A;  4FYW B;  4UP9 A;  1UGV A;  1YWP A;  2JXB A;  1WLE A;  2YRD A;  5CKE A;  2HKQ B;  1VQZ A;  2LQK A;  1X43 A;  2LP5 A;  3HSB A;  3H41 A;  3RGL A;  3VQX A;  4FYV B;  3CC2 Q;  5GMK i;  3WVE B;  2OI3 A;  2RHZ A;  1C0M A;  1PD0 A;  1PSE A;  2X4W A;  1ZUY A;  2PVO B;  4EMK A;  2DEQ A;  4BI3 A;  3L4G A;  3VS6 A;  2QHV A;  5KYN A;  2DPP B;  4RCC A;  3HXW A;  4DBQ A;  1KQS A;  3MEW A;  3QG1 A;  1LYL A;  1FXX A;  2L3Q A;  3A8M B;  1GBR A;  2DD4 A;  1TTH B;  4Q5W A;  2DZC A;  2J3L A;  2LMJ A;  4OLF A;  1W1F A;  3OYY A;  3HRI A;  3HXX A;  2LCC A;  2ZT8 A;  5FLX E;  4A53 A;  1H3H A;  4C5H A;  1ACM B;  3CD6 A;  2Q5I A;  4RMF A;  1BI3 A;  1BKB A;  1GFC A;  4C92 B;  2JZ2 A;  2Q7H A;  4BDZ A;  4FYY B;  2VGN A;  3TCJ A;  3LSS A;  1IHV A;  3MHX A;  1G3S A;  3X24 B;  2KRO A;  1SG5 A;  1K0S A;  2D1X A;  4YRT A;  1WPY A;  3O8V A;  4FT2 A;  4UP8 A;  2LJ3 A;  1IO6 A;  5GMK l;  1H92 A;  4QVC A;  4ME7 A;  5GAM h;  4LN2 A;  1Y96 A;  1WJQ A;  4ELZ C;  3CC2 T;  3OMG A;  4XU2 A;  3VS5 A;  2AZV A;  1YIT Q;  4KBM B;  3M0S A;  4IUV A;  1B7Y B;  2ZR2 A;  4H2X A;  1VQ6 A;  3H6Z A;  2EFI A;  2A7Y A;  3X20 B;  3JSC A;  3I56 A;  1ZBJ A;  1U8R A;  2M1H A;  2YUQ A;  3V7S A;  3RF1 A;  1B3Q A;  2GFA A;  5EG2 A;  4P72 C;  1QKX A;  1K1Z A;  2MCN A;  4P75 A;  2VWF A;  1SHF A;  1YI2 A;  1HD3 A;  4Z8A A;  2FL7 A;  4BUG A;  5F5W A;  2A3L A;  4HT8 A;  1H64 1;  2LQW A;  4J6W A;  2EQI A;  2QQB A;  3HXY A;  5GAN h;  4HWP A;  4UC4 A;  3SHW A;  1W2B A;  5LJ5 j;  4C92 G;  3JV3 A;  3OYG A;  2DBK A;  1TSF A;  2DL3 A;  1M9S A;  1AOJ A;  3JCM d;  2QQS A;  1G2B A;  2KVQ G;  1YIT T;  2J05 A;  3A8H B;  2EGC A;  4CH5 A;  1J3T A;  3VRZ A;  4LUD A;  1OI1 A;  4P3P A;  4XEO A;  1YIJ Q;  1HSQ A;  1KK7 A;  3LGL A;  5LJ3 g;  4HVC A;  3PFS A;  3VS0 A;  2HQH A;  2CDT A;  3M0R A;  1VQM Q;  4LD9 K;  4JS4 A;  3P8T A;  3HFO A;  2R5M A;  2LJ0 A;  4C5I A;  5GAN 5;  2E64 A;  3NMZ C;  2EKO A;  3VV0 A;  4OMP A;  3R6N A;  1BBU A;  1VQP A;  1JBM A;  1RI9 A;  3ERR A;  1ADY A;  1AVZ C;  4M78 A;  1VQK A;  2RI2 A;  3X26 B;  3TEH B;  4CS2 A;  5L23 A;  5KYX B;  1YB3 A;  4M75 A;  4RQE A;  3VUB A;  3RER A;  3EH1 A;  3J81 E;  1Q81 C;  3E9F A;  1QP3 A;  2X9H A;  3JCM W;  1VQL A;  4B6M A;  1ASY A;  2FEI A;  1KSW A;  4C8Q B;  1GGM A;  3DLL A;  1BB9 A;  3HY0 A;  3PIP A;  3SD4 A;  3CC7 A;  1M1G A;  3V8L A;  2CUD A;  1WXU A;  1N9W A;  4G84 A;  3C95 A;  4HCB A;  1GBQ A;  3PVL A;  1Q81 R;  1YIJ T;  3OS2 A;  1Z7M A;  3FEO A;  3J80 E;  1JXO A;  3L2V A;  5GMK e;  1MHN A;  2I2L A;  2M16 A;  2YHT A;  1VQM T;  3FC3 A;  5LJ5 d;  1B76 A;  4KGX B;  1RAI B;  3HFV A;  1KOG A;  1OEB A;  4CH6 A;  3VQY A;  3NGP A;  2MWO A;  2HQX A;  2IY5 B;  4P71 C;  2OTL Q;  2FPD A;  1CKA A;  3BJU A;  3EG1 A;  1VQ9 A;  3UH0 A;  5DY9 A;  1SRL A;  2RK1 A;  4H2Y A;  4M7A B;  2QXF A;  1T3L A;  5GAN 3;  2C06 A;  1NJ1 A;  3P8Y A;  2CH4 W;  4YRJ A;  2EWN A;  4FL6 A;  4JZ3 A;  4E7K A;  3UT1 A;  3TUP A;  2DNU A;  2DK3 A;  1ZUU A;  3CCQ A;  4LNS A;  3CC4 A;  2EQU A;  1KD1 C;  1BU1 A;  1YJN A;  1G3Y A;  4WI1 A;  1MV0 B;  1M27 C;  4M78 F;  2MK5 A;  5CQX A;  2LDM A;  2V1R A;  2Y90 A;  2OTL T;  1KD1 R;  4M75 F;  4C92 C;  1HJD A;  1NJ6 A;  4K88 A;  4F7U B;  3OQ5 A;  1JJ2 A;  2CJA A;  1WHJ A;  2CT4 A;  3M57 A;  5A0G A;  2CH4 A;  1YHQ A;  1DJ7 B;  4JJC A;  4ZGD B;  5IXB A;  4J15 A;  1EIF A;  4XTZ A;  4N0A A;  4XTY A;  2RQR A;  2O01 E;  1WJS A;  2ROT A;  3ASK A;  4QQG A;  3CCS A;  4XQ3 A;  1FMK A;  3GNG A;  1TH7 A;  2M0Y A;  2K4Y A;  4E7H A;  2VB6 A;  3MP8 A;  4YCU A;  4P73 C;  3TSW A;  1LPL A;  2Z0W A;  2FO0 A;  2CP0 A;  2EQK A;  3JB9 I;  2BTT A;  4RTT A;  3JB9 D;  4M77 B;  1SF9 A;  2KAF A;  1M1K C;  2LC4 A;  5GJW B;  1JJC B;  2HZY A;  2QQA A;  1M3C A;  2AK5 A;  2V1Q A;  1Q82 U;  4M7D B;  2COZ A;  1K8A R;  1UJ0 A;  2RHQ B;  4IKF A;  3E1S A;  1MND A;  1M1K R;  1TOV A;  3HRS A;  3MEY A;  5HCK A;  2QDL A;  2CSI A;  5GMK j;  1M90 C;  4TTV A;  1PRM C;  4AFQ C;  1USY A;  1ZA1 B;  3N5B B;  4KH0 B;  3OS1 A;  5KH6 A;  1QVG A;  1ATI A;  1NBE B;  4YRE A;  5HY6 A;  2FPE A;  3VS7 A;  4M78 D;  2CP2 A;  1UEC A;  1NLP C;  1M90 R;  2YUP A;  3IQL A;  4F7U G;  4MZT A;  3OW2 P;  3M5A A;  2XTI A;  2JT4 A;  2DL7 A;  3NEN A;  2KSS A;  4FT4 A;  2XG8 D;  2KXC A;  2LNH B;  3QO8 A;  2PME A;  3OYL A;  5D7U A;  1RLP C;  1YGB A;  2E3H A;  1H4S A;  1VQ8 A;  1QWE A;  3CCL A;  2Q7E A;  1VQ7 Q;  2Y4Y A;  1SKU B;  2PMF A;  2JM9 A;  4JPB W;  1K76 A;  4HT4 A;  5DM7 R;  3FB9 A;  3CXC S;  4M77 G;  3TSZ A;  3PNW C;  4P3O A;  4XAX B;  2L3R A;  3BY7 A;  3EG9 A;  2CZ6 B;  5GJV B;  2RHX A;  3OYJ A;  5KYW A;  3KXT A;  1PG5 B;  1Z9Z A;  4K11 A;  4M7D G;  1NYQ A;  2RJC A;  1EFN A;  2X4Y A;  2JNG A;  1AWW A;  2ABL A;  2J3M A;  2KYM A;  2X3X D;  2MPX C;  3G71 Q;  3OYD A;  5ECA A;  5FW9 A;  1I5L A;  2HL3 A;  1R8O B;  4TVR A;  2WSC E;  3PTA A;  3PIO A;  4M7A A;  4TQF A;  1HTT A;  2BE7 D;  3SEM A;  3CCM A;  1QWF A;  3V8K A;  4A4E A;  4J9G A;  3QXE B;  1VQ7 T;  2GCX A;  2E5Q A;  4YCV A;  1E6G A;  4NOY A;  2QA4 T;  1RAB B;  3CCJ A;  1NJ5 A;  3UGT A;  2EJG A;  2EKH A;  2DX1 A;  3L2R A;  2WSF E;  1EFW A;  3LH0 A;  1RAF B;  4UP7 A;  4LUE A;  4PJO G;  3A5Y A;  2AKW B;  3CPW A;  2M02 A;  3OYK A;  5I22 A;  3CMQ A;  4BY6 C;  1UGQ B;  2P4R A;  4JRK A;  3L2W A;  2DRM A;  1Q7Y U;  1I5O B;  4HA8 A;  3FIF A;  4PHC A;  4X5O A;  2RI5 A;  5LJ3 h;  2DIQ A;  5J26 A;  3G71 T;  1ADJ A;  4EMK B;  1UGR B;  3L4G B;  4CI0 C;  4TVW A;  2DYB A;  1RAE B;  2ZT5 A;  1RUW A;  5CKH A;  1VQ5 Q;  1H8K A;  1UE9 A;  1AWX A;  4KR3 A;  2RK2 A;  2M51 A;  1KMM A;  2P0Q A;  3CME A;  4II1 A;  2VUB A;  3EGU A;  3URG A;  1Y7X A;  2A28 A;  2XMF A;  5A0L A;  3EG2 A;  2GNC A;  2WAC A;  1ZSZ A;  2CT3 A;  5GAO l;  3CCV A;  4CC4 B; 
#chains in the Genus database with same CATH homology
 2EYQ A;  3TEG A;  2IVW A;  2ZPE B;  4TVY A;  4N4H A;  4YRM A;  4ZIB A;  3RL6 A;  3ZFJ A;  2PU9 B;  4WJ4 A;  2ZPB B;  3QJ6 A;  4C92 E;  4XU3 A;  3VQV A;  1UEB A;  3BDU A;  1XNI A;  1Y96 B;  3VYH B;  3MQZ A;  2E12 A;  5CO7 A;  2R58 A;  1H4T A;  1X2G A;  4M7A F;  3NEM A;  4CS3 A;  2AMC A;  4C5G A;  3SWN A;  4H2X B;  5GAO p;  1VQ5 T;  3VQW A;  3QHS A;  3VBB A;  2RHU A;  3JCM e;  2A8E A;  2ZR3 A;  1NPR A;  2R5A A;  4M77 C;  1BIB A;  5CK9 A;  3W3S A;  3LW5 E;  1X01 A;  4XEM A;  1G51 A;  3CCU A;  3V7R A;  4M7D C;  1HK9 A;  2Q5H A;  4YRC A;  4H2W A;  1GXI E;  3OYB A;  3VUZ A;  3QBY A;  1XTD A;  2DU7 A;  3CBO A;  3PCO A;  3M4Y A;  1BI0 A;  3LWH A;  2OAU A;  4OMF B;  4EDU A;  1L0W A;  3P8D A;  1YJW T;  5CR2 A;  4V2S A;  5IAY A;  5GAN 7;  5LL6 S;  4PJO C;  3S6W A;  1OYX A;  2V8I A;  3DKM A;  3OA6 A;  3TRE A;  3A8L B;  4PKC C;  2ZGW A;  1BI1 A;  3TU4 K;  2RHS A;  3NTH A;  1E1O A;  4M78 B;  3OYE A;  3P8B B;  5LJ5 e;  4M75 B;  3BFM A;  3UGQ A;  1KQ1 A;  2HAX A;  4MMK A;  2M0O A;  3UWN A;  1VQO T;  2XKO C;  2IG0 A;  5KE3 A;  1VQ6 T;  1WGS A;  3V8J A;  2D6F A;  5FRO A;  4EPC A;  2AKW A;  3CMA A;  3KFU A;  2MF2 A;  4LVI A;  1XOV A;  5FU7 C;  5M9O A;  3CCR T;  4ZTF A;  3C94 A;  3S3O A;  2QQR A;  2E6Z A;  2LT1 A;  2DTH A;  4IUR A;  3G6E T;  2K5I A;  1NE8 A;  4OF1 A;  4H2T A;  5DLO A;  1X2H A;  4N4G A;  3REU A;  1I8F A;  4H2S A;  3A7A A;  1W66 A;  3GLX A;  1X54 A;  3G4S T;  1V29 B;  5GAO n;  3CCE T;  4BWA A;  1QF6 A;  5C6S A;  5J3B A;  3HXU A;  1I4K 1;  2EJF A;  5IT9 E;  2DD5 A;  2RO0 A;  3I55 A;  1U1S A;  4R55 A;  4LDV A;  1NPP A;  3HFN A;  1X75 C;  1G5I A;  1WQW A;  2FVU A;  2QHT A;  3DB3 A;  3JCM Q;  4P72 A;  1K9M C;  4Q15 A;  4BI8 B;  2GF7 A;  5GAN 4;  4E7I A;  1QVF S;  3FRN A;  4X9C A;  2DVE A;  3FDR A;  1BI2 A;  1YJ9 T;  5A2Q E;  2E3C A;  3CC7 T;  2DQ0 A;  3QDR B;  5GAM f;  1AHJ B;  3INZ A;  2DXB A;  4YRQ A;  3REX A;  2XHC A;  3PGG A;  3OBY A;  5CIU A;  1LJO A;  2P4T A;  3JCM g;  3OB9 A;  3M4Q A;  3LSQ A;  2DTO A;  1K73 C;  2VC8 A;  2DXU A;  4MZP A;  4YYE A;  4J7I A;  2LNV A;  4M77 E;  1VQN T;  1S72 T;  3JB9 H;  3JAM E;  5I21 A;  5KE2 A;  11AS A;  3ZBD A;  2EQM A;  2ZZE A;  4P75 C;  5GAN f;  4ZGJ B;  2I4O A;  3HRT A;  5GAO r;  1X6O A;  1XQH A;  2CZ7 B;  3M53 A;  4P3N A;  2XD0 A;  1Z7N A;  1UGP B;  2DKG A;  1N27 A;  3HTZ A;  3HY1 A;  2AHJ B;  5A0D A;  2RI3 A;  2VGM A;  2YLB A;  1IZ6 A;  3CC2 A;  4FSX A;  4QQ6 A;  4PJO E;  1UB4 A;  4L5G A;  4YRN A;  2K5F A;  5LJ5 g;  4CH4 A;  2X4J A;  5GAM e;  5ELN A;  3R07 A;  4JLG A;  3CCS T;  1M5Q 1;  1D3B A;  2V8J A;  1QE0 A;  2CJB A;  4YRR A;  1BIA A;  4YRP A;  2P0L A;  4DPG A;  3OYN A;  3RES A;  2ZNI A;  4IUQ A;  3M54 A;  4M75 C;  3EAE A;  4YCW A;  2ZCE A;  3JB9 F;  3OW2 S;  1EVL A;  2PUO B;  3AHU A;  2MMP A;  1P92 A;  4RG8 A;  4QVD A;  4YDQ A;  4C0G A;  1YIT A;  5GAN 2;  2ZIM A;  3PZC A;  2RHI A;  5GAN e;  2L5Q A;  3JCM J;  1Q81 U;  4CS4 A;  2M9U A;  3LWI A;  4C8Q G;  4RCB A;  5AYF A;  1EVK A;  2MAM A;  1O9S A;  3OD1 A;  1H3Z A;  3SB2 A;  4DOW A;  4JS5 A;  3PMI A;  3LX7 A;  4C0D B;  1VQ8 T;  4HWO A;  2ZZF A;  4P73 A;  3R6O A;  3OYA A;  2BUD A;  2I4M A;  2CKK A;  2RJF A;  4PL6 A;  2XDD A;  3M55 A;  4RMO A;  2CZ0 B;  2DXC A;  2ZPG B;  4ZTZ B;  3MCA B;  4K87 A;  4P5N A;  5CKB A;  2VXE A;  4M7A G;  1K8A C;  1X56 A;  1YIJ A;  4E47 A;  4N4I A;  3ME9 A;  1E1T A;  3GIB A;  2ARS A;  1VQM A;  4HWS A;  3EFR A;  1J5W A;  5K1X A;  1MGQ A;  2Y4X A;  4WF2 A;  1G3T A;  2HNI A;  5GAM j;  1KD1 U;  4PG3 A;  4ZN1 A;  2AMC B;  4BI4 A;  3SWN B;  3T9N A;  4J83 A;  2FYK A;  3QKJ A;  4JJN K;  2I4L A;  5KCH A;  5E3I A;  1Y71 A;  4E7J A;  3RKX A;  4G85 A;  2DXT A;  3LGF A;  1VUB A;  4J7F A;  1IRE B;  1OZ3 A;  2O4X A;  5CAI A;  3IKL A;  1SRY A;  2QEX T;  5C0M A;  3HPW A;  2ZIO A;  3S3M A;  2CS7 A;  1H4Q A;  1YFR A;  2KDS A;  4K86 A;  5GAN j;  2QI2 A;  1K8A U;  3PCO B;  4HWR A;  1WJR A;  2OTL A;  4RDX A;  1M1K U;  2GFU A;  2P0K A;  2XI9 A;  4QVZ A;  4YRI A;  1G5V A;  2PVG B;  3RIR A;  5IN1 A;  1M90 U;  2ALY A;  2G3R A;  3CPF A;  1KG1 A;  4C8Q C;  2ZPI B;  5HK0 A;  5GAM d;  2RHS B;  4IUP A;  3NFC A;  1RI0 A;  3JCM h;  2ZZG A;  2VXF A;  4FU6 A;  3CBM A;  1SER A;  4A4K A;  2ODR C;  3RKY A;  4C92 D;  2NLU A;  3JCM P;  2VYT A;  1QVG S;  5I2S A;  3L1A A;  5CKF A;  3IKM B;  3BDL A;  4C0F A;  4KUD K;  3OSS C;  5DLQ E;  4OB1 B;  3MEV A;  4NCX A;  3KUF A;  4M7A C;  4P74 C;  1RL2 A;  1WQ7 A;  4B9W A;  1ZQ1 A;  2HBP A;  5GAN d;  3JCM b;  1PSF A;  4KR2 A;  4XU1 A;  2XK0 A;  4MML A;  2P0P A;  1NZ9 A;  3A32 A;  3HP9 A;  2ZT7 A;  5LJ3 f;  2BKD N;  1VQ4 T;  4ZN3 A;  4QQD A;  5GAN 6;  3GP8 A;  3WVD B;  2LT4 A;  2E65 A;  5FRN A;  3GOX A;  2QTX A;  3IG2 A;  4LDW A;  2OTJ T;  3L2Z A;  3BW1 A;  3MF1 A;  4EX5 A;  3MEU A;  4LD6 A;  1G3W A;  2JTM A;  4LVL A;  4OVA A;  3DLM A;  2MWP A;  2ART A;  4BE2 A;  2EAY A;  4JLI A;  2P5I A;  1VQ7 A;  1RIQ A;  3MP6 A;  2QA4 A;  3DB4 A;  4L6V 5;  4YRK A;  3QPH A;  4AH6 A;  1N8R C;  1B70 A;  4Q6G A;  5HGQ A;  4RG2 A;  2I4N A;  2D9T A;  3H8Z A;  2E41 A;  5GAO q;  3G71 A;  4C8Q D;  2XU8 A;  4JRP A;  2EIF A;  4PJO A;  1M1F A;  2BIV A;  3CD6 T;  2KK4 A;  5LJ3 e;  4HT9 A;  2DQ3 A;  1Y07 A;  3PT9 A;  2E6N A;  1EQR A;  3GF5 A;  4O6J A;  2ZTG A;  3E9H A;  1NNH A;  2VV5 A;  3A74 A;  4H02 A;  4YP0 A;  4EO4 A;  1HC7 A;  3L2Q A;  2E1H A;  4OB0 B;  3QJY A;  2YRV A;  3CBP A;  4LDX A;  1N8R U;  2F69 A;  3I56 T;  4IUU A;  4WJ3 M;  2ZZD A;  3MF2 A;  4XTV A;  4C8Q E;  1VQ5 A;  2PVD B;  3M59 A;  4PLL A;  5GMK m;  4ZTJ A;  1D3B B;  3JB9 G;  1QVF A;  3RAC A;  1YI2 T;  3FJP A;  1H4V B;  5CKD A;  3EFS A;  3JRZ A;  2L8D A;  3ZEH A;  4DOV A;  4XU0 A;  2NS6 A;  2E70 A;  4XTW A;  3QUI A;  2GQV A;  4TWA A;  3VJP A;  1QVP A;  3G7Z A;  3X28 B;  4PJO F;  2EQJ A;  5D6X A;  4OGE A;  2Q7G A;  3CEY A;  1B8A A;  1G5H A;  4M78 G;  2B8A A;  4M7A E;  4LDU A;  4LDY A;  3M56 A;  4EMK C;  1KHC A;  4M75 G;  3QII A;  1YJW A;  2KY9 A;  1PYS A;  4M77 D;  3HXV A;  1VQP T;  4YRO A;  4J6X A;  2EL9 A;  3LLR A;  4C5E A;  4Z02 A;  1VQK T;  4A4H A;  4RQF A;  2RD1 A;  4M7D D;  4PNO A;  4H2V A;  1EIY A;  4L59 A;  5LJ3 j;  1KMN A;  4YPF A;  5GMK h;  4BDY A;  2RB6 A;  1VQL T;  2K5L A;  12AS A;  4F7U E;  3MP1 A;  2DIG A;  5L8R E;  3OS5 A;  1ZBX A;  1N9S A;  1VQO A;  3QO7 A;  1UGS B;  4YRL A;  3OSV A;  3S3N A;  1SSF A;  1NJI C;  1OZ2 A;  1NJ2 A;  3HFZ A;  4NS5 A;  1KQS S;  3CCR A;  3UDC A;  2ZIN A;  2F5K A;  4XK8 E;  4PJO D;  5KCO A;  3A5Z A;  3WXM B;  1VQ9 T;  4GY5 A;  3G6E A;  2XGT A;  4B9X A;  4Y28 E;  2RH2 A;  2QHU A;  4JRQ A;  3DSQ A;  3OMC A;  4M7D E;  2PUK B;  3WQZ A;  3G4S A;  3CCE A;  3MEA A;  2LVM A;  3L2U A;  3C4S A;  3OW2 A;  1K9M U;  5D6Y A;  4JUV A;  3M4G A;  2KMT A;  3CCQ T;  3JB9 J;  3TEE A;  3CC4 T;  3OYC A;  4JRI A;  2O4X B;  1YJN T;  1SET A;  3QZ5 B;  4E7L A;  5D6W A;  5C51 B;  2JVV A;  2LQ8 A;  5LJ3 d;  3L42 A;  5ELO A;  5HKC A;  3NTK A;  4FIB A;  1JB0 E;  1U1T A;  1NJI U;  2CIM A;  4ATO A;  1I81 A;  5CCA A;  1YHQ T;  4KQE A;  4KUL A;  1HXD A;  1C0A A;  2D0Q B;  1K73 U;  1B34 B;  4P71 A;  4TVA A;  4C0Z A;  1O75 A;  4XTX A;  2YLC A;  1YJ9 A;  4GLK A;  4M78 C;  3QZ9 B;  2RJE A;  1FYF A;  2E5A A;  1W2B S;  2K2V A;  4FM4 B;  2ALY B;  1EOV A;  2HQE A;  1YFT A;  2EJ9 A;  2QHS A;  2K3X A;  4PLI A;  4NL2 A;  3HXZ A;  4YTL A;  4BY6 B;  4LVJ A;  2DU5 A;  1VQN A;  1S72 A;  2DO3 A;  1IL2 A;  2XDP A;  2C8M A;  4C92 A;  4XTU A;  4OGC A;  2ZCF B;  3OBW A;  1Q82 C;  4J5Y A;  1N9R A;  3GNF B;  4BD3 A;  3JCM X;  1E24 A;  3VYG A;  3QYH B;  3CCL T;  4HCC A;  2H3J A;  5GAN 8;  3MO8 A;  4UPA A;  3QTC A;  4KUI A;  3A8G B;  1B7Y A;  4ELY C;  5FU6 B;  1VIF A;  4EMH A;  4LVM A;  3OS0 A;  4J8O A;  3CXC A;  4BE1 A;  2DJZ A;  3QO5 A;  3MET A;  2K57 A;  1VIE A;  3RKW A;  4BB7 A;  4VUB A;  3A31 A;  5CVI A;  4L87 A;  5FRM A;  4DQ2 A;  4N0A C;  1YFS A;  2PQW A;  5C53 B;  2ARU A;  3P8V A;  3CCM T;  4HKE A;  4A54 A;  3X25 B;  3CCJ T;  3IAL A;  3HRU A;  2XID A;  3LC0 A;  3NET A;  2CZ1 B;  4C92 F;  3RUX A;  5CQY A;  2ZNJ A;  4QW2 A;  3UFG A;  3JCM V;  4O2D A;  1NYR A;  2CYZ B;  3SDZ A;  1B70 B;  3OY9 A;  2RM4 A;  3E9G A;  2MI6 A;  1NJ8 A;  2LX9 A;  2RJD A;  1JJ2 S;  4M75 D;  3OYI A;  1USY C;  2XIC A;  3TEH A;  2JTF A;  1YBY A;  3F70 A;  1B34 A;  3CME T;  2ZPF B;  3RMQ A;  5KNN A;  4PJO B;  3CCV T;  4C8Q A;  1WYD A;  1Q7Y C;  4A4G A;  4D6W A;  4OP0 A;  1ASZ A;  1ZHI A;  3RMS A;  1BBW A;  5GAM g;  3OYH A;  1BYM A;  3HKS A;  3M58 A;  4H2U A;  3J7A F;  4YRS A;  2X4X A;  1LNX A;  2QQ9 A;  3ER0 A;  4O5V A;  1Q86 C;  2IY5 A;  5GAO m;  5FU7 B;  4ZGE B;  4M78 E;  1E22 A;  4NL3 A;  3HL8 A;  1FX7 A;  3LYI A;  4M75 E;  4P74 A;  3Q1J A;  2CJ9 A;  3E9I A;  3E19 A;  3HRK A;  5GAN g;  2LTO A;  2JN0 A;  4CH3 A;  1KHI A;  1WU7 A;  3JCM f;  3CCU T;  1LOJ A;  2JUF A;  4OB2 B;  3A7R A;  4HCZ A;  3FLG A;  4MDX A;  3OYM A;  2QEX A;  1JRI A;  2RA2 A;  4X9D A;  1KQ2 A;  4F7U A;  4RKU E;  4C8Q F;  2K3Y A;  3NTI A;  3KBG A;  1WNL A;  2DZ9 A;  1Q86 U;  5LJ5 h;  3G1Z A;  3PMT A;  2HD0 A;  4C0D C;  1PYS B;  4Y91 A;  2XDB A;  1N6A A;  4HWT A;  4M77 A;  3A8O B;  3VKI A;  3UPU A;  3QYG B;  5FU6 C;  1JJC A;  2QDY B;  1W4S A;  2LCL A;  1EIY B;  1M4Z A;  4LVK A;  1KC8 C;  4M7D A;  2FHD A;  4MZM A;  4MDW A;  4EMG A;  2RHQ A;  2DAQ A;  3JCM c;  5LJ5 f;  3CPW S;  2L89 A;  3CMA T;  4R56 A;  3HHT B;  1QW1 A;  4BW9 A;  1SES A;  2C7I A;  2F5T X;  4JDS A;  5C52 B;  3GPL A;  4YRG A;  3HFZ B;  4X34 A;  3QNE A;  3SWN C;  3M9Q A;  4CRI A;  2FB7 A;  3A5Z B;  1QP2 A;  3I7F A;  4J6Y A;  3OYF A;  1YCY A;  4A4F A;  2KQW A;  2G4C A;  4F7U F;  2ZT6 A;  2DTI A;  2LRQ A;  4E51 A;  2ODR D;  3VU3 C;  3M4P A;  4BE0 A;  3I55 T;  3P8H A;  5K1P A;  4YRF A;  2RHY A;  1VQ4 A;  3V7C A;  1KC8 U;  4IUT A;  2DDZ A;  3A7U A;  2WSE E;  3NEL A;  2X35 A;  4M77 F;  4M7A D;  2E10 A;  4OB3 B;  4KT0 E;  2OTJ A;  1FWZ A;  4BAC A;  3QSU A;  3ICA A;  5J39 A;  1M8V A;  1X55 A;  4M7D F;  5I2M A;  2V8K A;  2ZXF A;  4TQD A;  4TVA B;  3QO3 A;  2JOY A;  2CGH A;  2R57 A;  5HK3 A;  4ZTU B;  2ZPH B;  4DA4 A;  3SFM A;  3C12 A;  4UP9 A;  1WLE A;  5CKE A;  1VQZ A;  2LQK A;  3HSB A;  3RGL A;  3VQX A;  5GMK i;  3WVE B;  2RHZ A;  2X4W A;  1PSE A;  2PVO B;  4EMK A;  2DEQ A;  4BI3 A;  3L4G A;  2QHV A;  2DPP B;  4RCC A;  3HXW A;  1KQS A;  3MEW A;  3QG1 A;  1LYL A;  1FXX A;  3A8M B;  2DD4 A;  4Q5W A;  2DZC A;  2J3L A;  4OLF A;  3HXX A;  3OYY A;  3HRI A;  2LCC A;  2ZT8 A;  5FLX E;  4A53 A;  4C5H A;  3CD6 A;  2Q5I A;  4RMF A;  1BKB A;  1BI3 A;  4C92 B;  2JZ2 A;  2Q7H A;  4BDZ A;  2VGN A;  3TCJ A;  3LSS A;  3MHX A;  1G3S A;  3X24 B;  4YRT A;  1WPY A;  3O8V A;  4FT2 A;  4UP8 A;  5GMK l;  4QVC A;  4ME7 A;  5GAM h;  1Y96 A;  1WJQ A;  4ELZ C;  3CC2 T;  3OMG A;  4XU2 A;  4KBM B;  4IUV A;  1B7Y B;  2ZR2 A;  4H2X A;  1VQ6 A;  3H6Z A;  2EFI A;  2A7Y A;  3X20 B;  3JSC A;  3I56 A;  1U8R A;  2M1H A;  3V7S A;  3RF1 A;  2GFA A;  5EG2 A;  4P72 C;  4P75 A;  1YI2 A;  4BUG A;  2FL7 A;  5F5W A;  2A3L A;  4HT8 A;  1H64 1;  4J6W A;  2QQB A;  3HXY A;  5GAN h;  4HWP A;  4UC4 A;  1W2B A;  5LJ5 j;  4C92 G;  3OYG A;  1M9S A;  3JCM d;  2QQS A;  2KVQ G;  1YIT T;  3A8H B;  4CH5 A;  1OI1 A;  4P3P A;  4XEO A;  3LGL A;  5LJ3 g;  4HVC A;  3PFS A;  4LD9 K;  4JS4 A;  3P8T A;  3HFO A;  2R5M A;  4C5I A;  5GAN 5;  2E64 A;  2EKO A;  3VV0 A;  1BBU A;  1VQP A;  1JBM A;  3ERR A;  1ADY A;  4M78 A;  1VQK A;  2RI2 A;  3X26 B;  3TEH B;  4CS2 A;  1YB3 A;  4M75 A;  4RQE A;  3VUB A;  3RER A;  3J81 E;  1Q81 C;  3E9F A;  1QP3 A;  3JCM W;  1VQL A;  1ASY A;  4C8Q B;  1GGM A;  3DLL A;  3HY0 A;  3PIP A;  3SD4 A;  3CC7 A;  1M1G A;  3V8L A;  1N9W A;  4G84 A;  3C95 A;  4HCB A;  1YIJ T;  3OS2 A;  1Z7M A;  3FEO A;  3J80 E;  3L2V A;  5GMK e;  1MHN A;  2I2L A;  2M16 A;  2YHT A;  1VQM T;  3FC3 A;  5LJ5 d;  1B76 A;  3HFV A;  1KOG A;  4CH6 A;  3VQY A;  2MWO A;  2HQX A;  2IY5 B;  4P71 C;  3BJU A;  1VQ9 A;  3UH0 A;  5DY9 A;  2RK1 A;  4H2Y A;  4M7A B;  2QXF A;  5GAN 3;  2C06 A;  1NJ1 A;  3P8Y A;  4YRJ A;  2EWN A;  4FL6 A;  4E7K A;  3UT1 A;  3TUP A;  2DK3 A;  3CCQ A;  4LNS A;  3CC4 A;  2EQU A;  1KD1 C;  1YJN A;  1G3Y A;  4WI1 A;  4M78 F;  5CQX A;  2LDM A;  2Y90 A;  2OTL T;  4M75 F;  4C92 C;  1NJ6 A;  4K88 A;  4F7U B;  3OQ5 A;  1JJ2 A;  2CJA A;  3M57 A;  5A0G A;  1YHQ A;  1DJ7 B;  4ZGD B;  4J15 A;  1EIF A;  4XTZ A;  4N0A A;  4XTY A;  2O01 E;  1WJS A;  3ASK A;  4QQG A;  3CCS A;  4XQ3 A;  3GNG A;  1TH7 A;  2K4Y A;  4E7H A;  3MP8 A;  4YCU A;  4P73 C;  2EQK A;  3JB9 I;  3JB9 D;  4M77 B;  2KAF A;  1M1K C;  2LC4 A;  1JJC B;  2QQA A;  1Q82 U;  4M7D B;  2RHQ B;  4IKF A;  3E1S A;  3HRS A;  3MEY A;  5GMK j;  1M90 C;  4TTV A;  1USY A;  3N5B B;  3OS1 A;  5KH6 A;  1QVG A;  1ATI A;  4YRE A;  5HY6 A;  4M78 D;  4F7U G;  4MZT A;  3M5A A;  2XTI A;  3NEN A;  2KSS A;  4FT4 A;  2XG8 D;  3QO8 A;  2PME A;  3OYL A;  1YGB A;  1H4S A;  1VQ8 A;  3CCL A;  2Q7E A;  2Y4Y A;  2PMF A;  4HT4 A;  5DM7 R;  3FB9 A;  3CXC S;  4M77 G;  3PNW C;  4P3O A;  4XAX B;  2L3R A;  3BY7 A;  2CZ6 B;  2RHX A;  3OYJ A;  3KXT A;  4M7D G;  1NYQ A;  2RJC A;  2X4Y A;  2JNG A;  2J3M A;  3OYD A;  1I5L A;  1R8O B;  4TVR A;  2WSC E;  3PTA A;  3PIO A;  4M7A A;  4TQF A;  1HTT A;  3CCM A;  3V8K A;  4A4E A;  3QXE B;  1VQ7 T;  2GCX A;  2E5Q A;  4YCV A;  4NOY A;  2QA4 T;  1NJ5 A;  3CCJ A;  3UGT A;  2EJG A;  3L2R A;  2WSF E;  1EFW A;  3LH0 A;  4UP7 A;  4PJO G;  3A5Y A;  2AKW B;  3CPW A;  3OYK A;  3CMQ A;  4BY6 C;  1UGQ B;  4JRK A;  3L2W A;  1Q7Y U;  4HA8 A;  3FIF A;  4PHC A;  4X5O A;  2RI5 A;  5LJ3 h;  2DIQ A;  5J26 A;  3G71 T;  1ADJ A;  4EMK B;  1UGR B;  3L4G B;  4CI0 C;  4TVW A;  2ZT5 A;  5CKH A;  4KR3 A;  2RK2 A;  1KMM A;  2P0Q A;  3CME A;  4II1 A;  2VUB A;  3URG A;  1Y7X A;  5A0L A;  2WAC A;  5GAO l;  3CCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...