2DJZA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111a mutation
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2djzA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2djzA01
4F7UE 4JLIA 1L0WA 1USYA 4YRFA 1I4K1 4K86A 1N9RA 3PZCA 4KR3A 3IKLA 2C7IA 1QF6A 3A7AA 4F7UA 3PGGA 3G1ZA 4XTVA 4CH3A 1NNHA 1KQ1A 5GAN8 4H2UA 4P71A 5GAMe 4YP0A 2DQ3A 1N9SA 1EOVA 4XU1A 1BBWA 3HTZA 1WU7A 4K88A 3QO7A 1QE0A 2ZTGA 3JB9D 4H02A 3VQXA 1IL2A 4EMKC 5GAOm 4O2DA 12ASA 1EVKA 1X01A 5GAMh 1E1OA 5LJ3d 4AH6A 2ZT5A 3KFUA 1SRYA 5GANg 4P3OA 3JCMc 4J5YA 5C52B 4E51A 1WPYA 2Q5IA 5GMKj 4M7AG 3SB2A 4WF2A 1I81A 2E41A 3JB9I 5LJ3j 3IG2A 2ODRD 4EMGA 4UP7A 3TEHB 4PJOB 5LJ5g 4C92E 1ADYA 3M4GA 5ELOA 3A5ZA 4PJOE 2I4NA 1EIYA 1U1SA 4J6WA 1SETA 4EO4A 3V7RA 2ZZGA 4YCVA 3RF1A 4JRIA 3RUXA 4C92A 3QO5A 3CMQA 3HY0A 3M4QA 3RKYA 4P73A 4BW9A 3TEHA 4PJOA 3JCMh 3PCOB 4NL3A 3NENA 11ASA 3UGTA 4J15A 4M77D 1U1TA 1WQWA 1EQRA 4X9CA 2EWNA 5CAIA 3DSQA 1YB3A 3GIBA 4P72A 2CJAA 4PNOA 4P75C 3JB9G 5GMKe 1BBUA 3QO8A 3VQWA 2RM4A 1M5Q1 4JRKA 3A31A 4YYEA 3SWNA 5C51B 2C8MA 5LJ3e 2PMEA 1B34B 4WJ4A 2ZINA 4M7AF 1Y96A 4RMFA 4YRMA 3P8VA 2DDZA 5GANf 1GGMA 4N0AC 4M78B 5GMKh 1KQ2A 2XTIA 1LOJA 2Y90A 1E22A 3UH0A 3BFMA 5LJ3h 4M78E 5GAMd 2QHTA 3RGLA 4EX5A 5GAOr 4C8QD 5GAMg 4CH5A 4M78G 3LSSA 5LJ5f 2AMCB 2QTXA 1LYLA 3JCMb 4YROA 1USYC 4YDQA 1WQ7A 4YRLA 2Q7EA 3E9IA 3MF2A 4MMLA 2VXFA 1JJCB 2ARUA 3I7FA 1KMMA 3MEYA 2QHVA 4HWRA 4P74A 2ZCEA 4P71C 4XU0A 3HXXA 4M77G 1PYSB 1H4QA 2ZNIA 4LNSA 3WQZA 5K1XA 3VQYA 3JB9F 3RESA 2CIMA 3NEMA 4WJ3M 4M75D 3JCMd 2FB7A 2CGHA 1G5IA 3TUPA 2G4CA 3V7SA 3JCMX 1I5LA 5GAOl 1B70A 4C8QB 4M75C 3FB9A 1PYSA 3V7CA 1ADJA 2DTOA 2RHQB 4RCCA 4XEOA 2YHTA 1M8VA 4M78F 1KOGA 4C8QG 4HWPA 4HWTA 4XTUA 2DZCA 3BJUA 3HRIA 3VBBA 2DTHA 3L2ZA 3A5YA 2ZNJA 4M7AB 5HGQA 2QHSA 4PG3A 3HXVA 4YRKA 4C92C 4PHCA 3A7RA 2EJFA 1SERA 4CS3A 4M7AE 5LJ3g 3HFVA 4P73C 4MMKA 2RHQA 4BWAA 4YCWA 4PJOC 3HY1A 2EAYA 1X55A 3QHSA 4M77F 2EJGA 2Q7GA 4YRQA 4RQFA 3FIFA 5GAN5 4M7AA 3E9HA 5GMKl 4NOYA 1HTTA 2CJ9A 4YRTA 4M75G 2PMFA 1YFSA 3JCMe 3R07A 3SWNC 3P8TA 2DVEA 3AHUA 1C0AA 5GAN2 2E1HA 4QVDA 1I8FA 3IKMB 1NJ1A 1G5HA 4YRRA 1X54A 1RIQA 2I2LA 2EJ9A 2DJZA 2VXEA 5GANj 1SESA 3HXYA 1BIAA 1WLEA 4M7DD 1ASZA 2I4OA 3NELA 5GAOq 4C8QF 5GAN3 4XTXA 3V8LA 4JUVA 4UPAA 2ZXFA 4M7DC 4V2SA 1H4VB 2YLCA 3L1AA 1HC7A 3P8YA 3L4GB 2I4LA 4YRGA 3PCOA 2AKWB 4L87A 5ELNA 3RKXA 4J6YA 4HVCA 2RD1A 4P74C 5LJ3f 4UP8A 5K1PA 3REUA 3A32A 4HWSA 2ZIOA 4TWAA 4A54A 1YFRA 1Z7NA 1VQZA 1LJOA 2ZIMA 3LC0A 1WNLA 4TVYA 2ZT6A 1B7YB 4XU3A 4M75F 4NL2A 3L4GA 4H2SA 5I21A 5GANe 3RIRA 1W66A 1H4TA 1B34A 2E5AA 4YRIA 2E3CA 3UFGA 3JB9H 4XU2A 1J5WA 1JRIA 4M78A 1E1TA 2DQ0A 2XGTA 4HA8A 4HWOA 3UGQA 4M77B 4Q15A 2E10A 5GANh 4XTZA 4M7DG 3QTCA 2RB6A 2DTIA 1B7YA 4M77E 4KR2A 3BDUA 4XTYA 5C53B 2AMCA 2ZT7A 1JBMA 3BY7A 2QHUA 1LNXA 1KMNA 2FYKA 1EFWA 4CS4A 1JJCA 4M77A 2E65A 2Q7HA 4CH4A 3JCMg 3QNEA 3TEGA 3HXWA 4YRSA 1BIBA 1H641 5GAN6 4KQEA 2YLBA 3HFOA 4DQ2A 4F7UB 4RDXA 4C8QE 4TVAB 5GAN7 1TH7A 1G51A 4X9DA 4A53A 4C92D 4RCBA 1NYRA 3EFRA 4HT9A 3HXUA 4EMHA 3HRKA 4F7UG 3MF1A 4CH6A 4P3NA 5GAMf 4PJOD 4YCUA 1H4SA 2E64A 5DY9A 4C8QA 1X2GA 3ICAA 3EFSA 2ZZEA 3JCMP 4TVAA 4K87A 3JCMW 1YGBA 2ARSA 4OP0A 4M7DF 4Q6GA 3HXZA 1D3BB 4G85A 4YRJA 3JCMQ 1WYDA 4XQ3A 4M75B 3OD1A 2JN0A 4RQEA 4P72C 3RKWA 2CJBA 4M75E 4TQDA 2EL9A 4P3PA 3QUIA 3RL6A 1EVLA 5GANd 4ZTUB 1EIYB 1D3BA 1YCYA 3V8JA 3JCMJ 4EMKB 4H2YA 3JCMf 4M75A 5GAN4 2IY5B 4C92B 4WI1A 2J3MA 4X5OA 5LJ5d 3REXA 1HXDA 2ZR3A 2RHSB 4CS2A 4XTWA 4TVWA 2DKGA 3W3SA 4Y91A 4QVCA 4M78D 4C92G 5GAOn 1Z7MA 2DU5A 4F7UF 5GAOp 2ODRC 5LJ5j 4PJOG 4EMKA 4J6XA 2K57A 3A74A 2DU7A 2IY5A 3JCMV 3BW1A 4HT8A 4M78C 1B8AA 2ZR2A 1NJ5A 2RHSA 3SWNB 4G84A 1X2HA 2ARTA 1Y96B 5GMKm 2DEQA 3A7UA 3HFZB 5KNNA 2ZGWA 2Q5HA 3RERA 5GMKi 1NJ6A 4OLFA 1B76A 4TTVA 4TQFA 2ZT8A 2ZZFA 3JB9J 1YFTA 4M77C 4YRCA 3LSQA 2AKWA 3QSUA 2DZ9A 3NETA 4M7DB 4YREA 2ALYB 1ATIA 3QO3A 3HFZA 4H2VA 4M7DE 5LJ5e 2DXUA 2VC8A 4YRNA 4H2XB 4ZIBA 2HNIA 4C92F 1NJ2A 4ZTZB 4NCXA 5E3IA 3HSBA 1HK9A 2RA2A 4PJOF 4M7DA 1X56A 3M4PA 3INZA 4P75A 1E24A 2ALYA 1NYQA 5GAMj 5LJ5h 1MGQA 2J3LA 3VQVA 4C8QC 4H2WA 3IALA 4UP9A 3V8KA 2I4MA 4XEMA 5F5WA 2P0LA 4H2TA 4H2XA 1ASYA 4YPFA 3VU3C 4M7AD 3HFNA 3ERRA 4N0AA 4DPGA 2DXTA 1N9WA 1B70B 1FYFA 3FJPA 1NJ8A 2P5IA 4M7AC 3RACA 4YRPA
chains in the Genus database with same CATH superfamily
4F7UE 4JLIA 2EKHA 3N5BB 2V1QA 2BZ8A 8ATCB 3CMAA 3EHQA 1QF6A 1QVFS 4FU6A 1T0JA 4F7UA 3A7AA 1VQMQ 4L5GA 2CZ7B 4XTVA 4RTUA 3VV0A 5GAMe 2VB6A 2KRSA 2DQ3A 1N9SA 2EGCA 2BZXA 1AD5A 1UFFA 2FPEA 2CREA 3A8HB 1AWOA 1M30A 3QO7A 1QE0A 2ZTGA 1SSFA 1M1KC 5DM7R 5KYWA 1A0NB 3A5ZB 2DRMA 2O88A 4P3OA 3WXMB 4FIBA 1FMKA 4J5YA 3ZEHA 1WPYA 1JQQA 4E7LA 2GFAA 2L3SA 4OMNA 1UGVA 2J6OA 1JB0E 1PKSA 3FJ5A 3IG2A 4EMGA 3MP6A 4UP7A 2LCCA 2XDBA 1M3AA 2KXCA 5LJ5g 2XICA 4M4ZA 4PJOB 1ADYA 2J05A 2DYIA 2MPXC 3HKSA 4C5EA 4ELZC 1WA7A 3PVQA 4QQ6A 3CPFA 4JZ3A 1I5OB 3H0HA 1YI2Q 3VYGA 1UJYA 3O5ZA 3RKYA 5CKFA 2P84A 4FM4B 5CKBA 3J7AF 2F2VA 4J15A 3C95A 1WQWA 2NUPB 2MF2A 1Q95G 2E6ZA 4LDUA 2CJAA 2BKDN 2EGEA 2RI3A 1BBUA 2DO3A 3QO8A 2IIMA 3G7ZA 2DRKA 2RM4A 4JRKA 5C51B 2YUPA 1R8OB 1TUDA 4ZN3A 4M7AF 1Y96A 2ECZA 1QP2A 1OI1A 2M1HA 2RQWA 4F17A 2XTIA 2CT3A 3LGLA 2K7AA 5GAMd 5GAMg 1GCQA 2DJQA 3LSSA 2Y4XA 2AMCB 1NPPA 1K73C 1USYC 2EYZA 2HMAA 3R6OA 1W6XA 4YDQA 1KFZA 3ZBDA 1VQ5Q 3E9IA 1X43A 3MF2A 4LVKA 4D6WA 2ARUA 3I7FA 5L8RE 4HWRA 1S72A 2VV5A 4P74A 2ZCEA 1SG5A 1KD1U 3OY9A 3EAEA 1VQ6A 2E3HA 1S1NA 3LWIA 1BYMA 1RAHB 1VQ4T 3QKJA 3EH2A 4M75D 2K3YA 2KI7A 2R57A 2VGMA 5C6SA 2OI3A 3V7SA 1TU0B 1I5LA 2JVVA 4JLGA 5GAOl 1B70A 4M75C 2CS7A 3CCRA 2JUFA 2K5FA 3CPWA 1OQKA 4LDYA 1N8RU 2YHTA 4C8QG 2R5AA 4HWTA 2OX7A 1MUZA 3A5YA 1XJWB 5HGQA 2KSSA 2XDPA 2CZ0B 3A7RA 2EQIA 4CS3A 3SDZA 4P73C 1VQPA 3CCEA 2RHQA 4YCWA 2DL8A 3OYKA 3KXTA 1NJIU 5I2SA 1QCNA 1PC0A 3M9QA 3OS2A 1OPKA 1BU1A 4KBMB 3MQZA 3FIFA 2LQ8A 5GAN5 1M2OA 1X27A 5IHIA 1KJWA 1R77A 2YUNA 4NOYA 2XG8D 3CMEQ 1HTTA 2CJ9A 3VS5A 1S72T 4VUBA 3SWNC 3P8TA 3AHUA 2AIRB 1VQ6T 4KH0B 1Q86U 1NJ1A 2MMPA 1X6GA 2I2LA 2VXEA 3UPUA 2L8DA 2CZ6B 1SESA 4ANJA 1WLEA 4LDXA 2I4OA 1MV3A 3CEYA 2C0IA 1I07A 4C0GA 5C0MA 3V8LA 4JUVA 3VS6A 1JEGA 3TEEA 4LVMA 3CCRT 1Z9QA 2QDYB 1D0XA 1SPKA 2JJ9A 4YRGA 4L87A 3I55A 1FXXA 3I35A 2LCSA 5ELNA 2ED1A 4J6YA 2RD1A 1QVFP 2FZGB 2NUPA 3I9QA 3LWHA 3A32A 2ED0A 2KAFA 4TWAA 1VQZA 1BI0A 2DA9A 1VQPT 3CCET 2LNHB 2ZT6A 2X9HA 2DBMA 5I21A 2KYMA 1IZ6A 3CCVT 1H4TA 4OB0B 2ZCFB 3G71Q 3M0SA 2KNBB 3JB9H 1J5WA 1YNZA 2XHCA 4HWOA 2AZVA 3EFOB 4M77B 5FWCA 3LH0A 1E6HA 5CK9A 3CC4Q 3QTCA 1B7YA 5C53B 1UDLA 2RI2A 1SSHA 4E7ZA 2AMCA 4X34A 4PJJA 1LNXA 3OYYA 4OMQA 2FYKA 3TU4K 1MMDA 2VGNA 1FMWA 3PE0A 3CMAQ 4XK8E 3CCUQ 4A63B 2QQSA 4LE9A 4KH1B 2M02A 3QIIA 1AZEA 1VQOA 3OYJA 2RHXA 1K73R 3I56T 1IGUA 3QYHB 4NS5A 2KGTA 2X4JA 1AVZC 1WXBA 3G4SQ 1RL2A 2J6FA 3JSCA 3HXUA 4HT9A 2J6KA 1GFCA 4CH6A 2A08A 5GAMf 1IHWA 4YCUA 1H4SA 1DJ7B 4B9XA 1VQNQ 5DY9A 2DXBA 5KYUB 3JRZA 4AT1B 3CCQA 3JCMP 1Y71A 1PRLC 4Q6GA 4M7DF 1ZUUA 3HXZA 1D3BB 3JCMQ 2YRCA 2JS0A 2MIOA 3MO8A 4XQ3A 1TS9A 1WHHA 1D0YA 3R6NA 4P72C 3RKWA 2CJBA 4M75E 4E47A 4TQDA 4P3PA 1EVLA 1VQ8A 4ZTUB 2O4XA 1EIYB 1MMGA 2RHYA 2FRYA 3JAME 3OS0A 4M75A 4J9DA 3PMIA 1AWXA 3REXA 1HXDA 1KD1C 2ZR3A 4TVWA 2D8JA 2QGGA 2E12A 4C92G 2PZ1A 3VS7A 5GAOn 2LQNA 5GAOp 2ABLA 3PTAA 2LC4A 4A4KA 1WYXA 4PJOG 2K57A 3GBQA 1YBYA 3A74A 2DU7A 2IY5A 1QKWA 2W10A 3BW1A 2FG0A 2E5KA 2AK5A 3M57A 2EQMA 1XTDA 2I0NA 1X2HA 1BBZA 5GMKm 1N8RC 2LRQA 2ZGWA 2G6FX 1NPRA 2JTEA 5GMKi 2FHDA 5J39A 3OS5A 3C12A 2SRCA 2KY9A 3META 1V1CA 2ZZFA 2L3RA 1YFTA 1RABB 3QSUA 3QZ5B 5GJWB 3NETA 1VIEA 1W2BS 1ATIA 4BDZA 3OYAA 1WGSA 4GBQA 1NJIC 1M4ZA 1JU5C 1S72Q 3UA6A 1AT1B 1IRXA 2CYZB 4H2XB 4YRNA 2HEQA 4O6JA 1GCPA 4IURA 5FRNA 4NCXA 2EBPA 3OW2S 2AKLA 1VQLA 3VQVA 4C8QC 1Q86C 2FRWA 1R0CB 3EFOA 4J7FA 2I4MA 2YUOA 2K2VA 2P4RA 1VQ5A 2P0LA 2JNGA 4M7AD 2RQRA 3GLXA 2YXYA 2LX7A 3FJPA 2A3LA 5HK3A 1VQ7Q 2DAQA 1NJ8A 4M7AC 5CKEA 1H3ZA 2KBTA 4J8OA 4E6RA 3VUZA 1U3OA 5D6WA 4BI4A 2R58A 4YRFA 2LVMA 4K86A 1N9RA 1UG1A 2D8HA 2PUOB 3IKLA 1RI9A 1PHTA 2BIVA 5KYWB 3OYNA 2ZPIB 2YDLA 1E6GA 5GAN8 4HCBA 1KC8U 4QQGA 5CO7A 1VQKA 3HTZA 3OSSC 1QWFA 1K4US 4PLLA 5EG2A 5L23A 4H02A 3VQXA 5KYUA 4EMKC 5GAOm 12ASA 1P92A 1EVKA 1OX8A 1OPLA 3OYFA 1FWZA 2ZT5A 2A36A 2P0PA 4E51A 2V1RA 3ULRB 3OYGA 5LJ3j 4KUIA 1WHLA 1VQ5T 4LDWA 3HPWA 1HJDA 2O31A 3S3MA 3NPFA 1EIYA 2D0NA 1SETA 5IN1A 4J9CA 1YHQQ 4EO4A 3MP8A 2OAWA 2ZZGA 4YCVA 1PD1A 3C94A 3SFMA 4KRTA 1B7TA 2JTFA 3HY0A 1C1AA 3I55Q 1M1GA 1U06A 2FO0A 3DLMA 4IUQA 5KYXB 3UF4A 2K6DA 4NL3A 3NENA 3CBOA 2HDAA 2XIDA 3VS1A 2X35A 1YJNA 3ASKA 1BI2A 4WCIA 4P72A 3M56A 3OB9A 3JB9G 1J3TA 3ER0A 5GMKe 3VQWA 2QXFA 1KD1R 3VRYA 2EYWA 5KCHA 1PRMC 1B34B 1IHVA 2ZINA 4RTZA 4WJ4A 1Q81R 2G3RA 4YRMA 4N4IA 1GGMA 4N0AC 5LJ3h 4PFZA 1QVFA 4M78G 2L5QA 3H9NA 3L2QA 1BCMA 4KULA 3JCMb 1N8RR 4BI8B 1WQ7A 2Q7EA 3E1SA 2EPDA 1GFDA 1XOVA 3G71A 2NLUA 4MMLA 4K11A 4QW2A 2RJFA 4KUDK 1JJCB 1K8AR 1BI3A 2CUBA 1VQOQ 2EQUA 1KMMA 1Y0MA 2QI2A 3CMET 4P71C 2CP6A 2K3XA 3CC4A 4RTTA 3HXXA 4M77G 2HKQB 4LNSA 2KRMA 4MZPA 4ELYC 5K1XA 3WQZA 1JXOA 1YITA 2M0YA 3MEUA 1IB8A 3JCMd 2J7IA 1YP5A 2FB7A 2WSEE 2CGHA 1G5IA 3TUPA 2RH2A 1X69A 3CCQQ 3CCUA 3OYMA 1NLPC 2OAUA 3FB9A 1PYSA 1KQSS 3C4SA 4IKFA 1ADJA 2HL3A 5IHNA 2DTOA 3A8MB 9ATCB 3CD6A 4JS4A 2RHQB 1ZSZC 2GCXA 4RCCA 3NTIA 1KOGA 4MZTA 3G4SA 2KT1A 3M0QA 3HRIA 1VQ8Q 2YRDA 1R0BG 3RDVA 1BB9A 1MMAA 4C92C 1VQNA 2EJFA 4M7AE 3QJ6A 3HFVA 2LJ3A 4PJOC 1W2BP 1Z9ZA 5FU7C 3X20B 4HCCA 1TOVA 1AWJA 2FL7A 1X55A 2EJGA 3G71T 1GBRA 4RQFA 1WJRA 2MWPA 4M7AA 4X1VA 1BCOA 1CKBA 2CT4A 5GMKl 5A0LA 2O2OA 3LGFA 3OW2P 3CC4T 3M0RA 2D6FA 1C0AA 2E1HA 2EYYA 5KE3A 1X54A 2B8AA 1RIQA 1I1JA 2NUTA 2EJ9A 4FT4A 3MKDA 1UB4A 3O8VA 4IUTA 2F5KA 4M7DD 2QGFB 1ASZA 4OGEA 2AHJB 3NELA 1SHGA 4C8QF 5GAOq 4LVLA 3S6WA 3FRNA 3WVDB 3CMAT 1WHKA 3CCUT 4UPAA 3AT1B 2ZXFA 4FSSA 1Q82U 4M7DC 1H4VB 4B9WA 4ZTFA 2YLCA 4RTXA 4OMPA 3P8YA 5KYXA 3UATA 2QTVA 2I4LA 1W70A 3G4ST 2JW4A 2PVGB 4HVCA 3REUA 2KRNA 2M16A 4HWSA 1ZHIA 3OYHA 3PT9A 4FYXB 3M0TA 1KC8C 1YFRA 2ZIOA 1VQNT 4TVYA 1RAEB 2LQKA 2LT1A 1OU8A 1ZLMA 1RLQC 3MEAA 4PJMA 4XU3A 4CC3A 1B7YB 1YJ9Q 5GANe 4D8DA 1B34A 1VQLQ 2E3CA 3VUBA 3RNJA 3UGQA 2LJ0A 2XGTA 1M90U 3TREA 1UJ0A 4FT2A 2K5IA 5D6YA 4Q15A 3LLRA 2A28A 4OF1A 3EHRA 3M5AA 4XTYA 4HVWA 3DKMA 2KK4A 5FU6C 2JTMA 4LUDA 3CXCS 4MZMA 3BY7A 5CQXA 2D0QB 2K3BA 3QBYA 1KMNA 2D1XA 2GFUA 4FYWB 1EFWA 1JJCA 2MYSA 1K9MU 3GNGA 1X75C 3QNEA 3REBB 3VJPA 1RAGB 3TVTA 4YRSA 4P5NA 1GL5A 4HXJA 5GAN6 3HHTB 1CKAA 4BUGA 1UGRB 2FZCB 2YLBA 3HFOA 3HRTA 4RDXA 2B86A 3RMQA 2K79A 4CC4B 1G3SA 1QP3A 2F5TX 4X9DA 4A53A 3G6EQ 1VQ7A 1VQKQ 4RCBA 1NYRA 3VYHB 4EMHA 4F7UG 2RPNA 3ZFJA 2H3JA 2E64A 2ZPGB 2WSCE 1X2GA 1H92A 3CCMQ 2P4TA 1QLYA 3NHNA 3OYCA 2O4XB 4TVAA 4K87A 3JCMW 2VYTA 1YGBA 2KYBA 3M58A 2ARSA 1UGQB 4YRJA 4F14A 4PL6A 2FVUA 3M4YA 1GBQA 4M75B 2HD0A 2JN0A 2GQIA 2E70A 4RQEA 2WSFE 4PFOA 2JXBA 2KXDA 2RI5A 2EL9A 1QMCA 1QQJA 3NTKA 2L0AA 1ZA1B 2RJCA 5GANd 2YSQA 4HVVA 4A4FA 4AFZC 2KQWA 1YCYA 2EIFA 2XI9A 1TUGB 4H2YA 3JCMf 5GAN4 2IY5B 3URGA 2DD4A 2J3MA 4X5OA 1M1KR 1OOTA 1ZSZA 4KT0E 5I2MA 2DKGA 2HSPA 4Z88A 2KE9A 1O75A 4Y91A 4QVCA 2MOXA 1YJNQ 4M78D 4E7KA 1NEBA 1Z7MA 4L59A 2ODRC 5LJ5j 2YWWA 3CPWS 1T3LA 1YHQA 3EG3A 4HT8A 4M78C 2PQWA 3HRSA 1B8AA 1NJ5A 1VQ7T 5HY6A 3SWNB 4DOVA 4N4GA 4RTYA 1TSFA 3H6ZA 3QZ9B 1KQSP 2QK0A 2XKOC 3A7UA 1NBEB 3RERA 5IHKA 4LD6A 2RQUA 2IG0A 1UHFA 2L3QA 2JT4A 4TQFA 3JB9J 4M77C 2RHIA 3L2RA 4CC7A 3HFZA 1SRLA 4DBHA 4LNPA 4WTOB 3TSWA 4M7DE 1RLPC 1VYVA 2DX1A 1ACMB 1FX7A 1ZUKA 4ZTJA 1M3BA 2VC8A 4OVAA 2HNIA 4MDXA 4C92F 1NJ2A 2KVQG 3EG9A 3E9FA 3HSBA 1YITQ 2RA2A 3PNWC 4PJOF 4C5IA 4M7DA 3M4PA 3X26B 3H0FA 4E7HA 5GAMj 5LJ5h 1HYOA 2ROLA 1KC8R 1XQHA 4FW2A 3V8KA 1ZUYA 2JMAA 4H2TA 1KHCA 1TXQA 4LUEA 3HFNA 3T9NA 2P0QA 2K2MA 3CD6Q 1YHQT 2CDTA 1YWPA 1VQ9Q 2O9VA 2P5IA 2VKNA 2PNIA 1Q82C 3MCAB 4YRPA 3I55T 2MK5A 4C0DC 2HQHA 2COYA 2RQVA 1USYA 1QCOA 3MP1A 2V8IA 4RUGA 5GJVB 4KR3A 4ME7A 4MDWA 2DF6A 3G1ZA 2LDMA 3PGGA 2D9TA 3A1PA 2E4HA 2QG9B 5IT9E 4CH3A 1NNHA 1PSFA 2HCKA 4YP0A 4OMFB 4ZGJB 4BB7A 2GQVA 1KK7A 2LQWA 3UDCA 4AFQC 1IL2A 1GRIA 5GAMh 5LJ3d 4AH6A 3KFUA 1SRYA 3TCJA 1M90C 3JCMc 1VA7A 5C52B 2FPDA 4B6MA 4ATOA 1IGQA 4OB1B 4PKCC 1W2BA 5IH2A 3M4GA 1PSEA 4E2FB 3CCJA 3CXCP 1OX9A 5ELOA 3OMGA 2I4NA 4FW1A 1VQOT 2HBWA 3V7RA 4CC2A 3LX7A 1K9MC 4JRIA 3VS4A 4A4HA 3RUXA 3QO5A 3CMQA 1M9SA 1VUBA 1YIJA 3M4QA 1WXUA 2AZSA 4R0KA 3OW2A 4P73A 4BW9A 3QXEB 4HCZA 3TEHA 2JM8A 1I0CA 2DM1A 1OU9A 4JDSA 4BE1A 1C6VX 2ATCB 2PU9B 5CR2A 4KGXB 1U1TA 3HL8A 4J9FA 1EQRA 3QJYA 4X9CA 3Q1JA 3DSQA 3CCQT 4PNOA 4J83A 4P75C 4JJDA 4YYEA 1U5SA 3SWNA 4TVRA 2DK3A 2V8JA 4RMFA 1T3SA 2RNAA 4OMLA 3P8VA 2DDZA 3QG1A 5GANf 1K1ZA 3OSVA 3H0IA 2HAXA 2BUDA 1KQ2A 1JJ2S 1LOJA 1E22A 1VQ8T 2M0OA 4M78E 2QHTA 3RGLA 1H8KA 1NYGA 4C8QD 3EGUA 5AYFA 3H41A 1LYLA 1YJ9A 4FYYB 3E2UA 4EIKA 1W1FA 3DB3A 4A4EA 2VXFA 3CCJT 3WVEB 4DEXA 3MEYA 2CP2A 4BE2A 2JS2A 1WX6A 1MMNA 2GGRA 4XU0A 3M59A 1PYSB 4II1A 3JB9F 4ZGDB 2CIMA 4D8KA 3UT1A 1JXMA 4WJ3M 2A7YA 2KDSA 2CH4A 4E7IA 3JCMX 3VS0A 5EC7A 1YFNA 5J3BA 4C8QB 2RQTA 3UWNA 3ZL7C 5HCKA 4XEOA 1M8VA 4M78F 4HWPA 4XTUA 3G6EA 3BJUA 1RAIB 1G3TA 3L2ZA 2VVKA 2QEXQ 2ZNJA 4M7AB 5KYYB 2XD0A 4PG3A 4YRKA 4PHCA 3GPLA 3CCMA 1YJWA 3GOXA 3L2WA 3QDRB 1G3WA 1ABQA 1YJ9T 2EAYA 1VQLT 4M77F 2NUTB 2Q7GA 2RF0A 1MHNA 4DOWA 3CBMA 4DBQA 4YRTA 4LVIA 4M75G 2PMFA 3JCMe 3R07A 2DVEA 1W4SA 4C0FA 3IKMB 4YRRA 5CVIA 1G5HA 3DB4A 2GTJA 4Y92A 2XU8A 4J9IA 3CCSQ 2A8EA 4QQDA 3CQTA 3JV3A 1WJSA 3HRUA 2JZ2A 2W0ZA 3RR6A 1OEBA 1BKBA 5KCOA 1UTIA 4IIMA 4V2SA 2VASA 2X4YA 3L1AA 3OBYA 4JJCA 3M0UA 3OYEA 2CP0A 2RJEA 3G6ET 1VQKT 2AKWB 3RKXA 2H3EB 3GF5A 4P74C 4UP8A 5LJ3f 1K9MR 3VKIA 1KHIA 3LC0A 1WNLA 3CCMT 1YJWT 1QVGS 2DNUA 2EW3A 3VS3A 1KQSA 4H2SA 3L4GA 3I5SA 4BY6B 4DEYA 1G83A 5KE2A 1W66A 1MV0B 3RIRA 4OMOA 1WJQA 1RAFB 3NMZC 4XU2A 2DQ0A 4HA8A 5IXFA 2E10A 2NS6A 1PG5B 4XTZA 4OB3B 1UEBA 2DTIA 2RB6A 1WLPB 4JS5A 3BDUA 3QDFA 2LJ1A 2QA4Q 1ZA2B 2ZT7A 2JOYA 1Q7YU 2EYQA 4AFSC 2CH4W 2E3IA 3EG2A 2L3PA 1NJIR 1VYUA 3QWYA 2RJDA 2X51A 3JCMg 1YJNT 2BTTA 4YTLA 3HXWA 1U8RA 2XMFA 1BIBA 1H641 4FSXA 4DQ2A 1Q86R 3M53A 4C8QE 4TVAB 2YT6A 1G8XA 4PJNA 1TH7A 4N4HA 1VQ9A 4C92D 2COWA 1Y7XA 1TWBA 3OBWA 2X4WA 4P3NA 4PLIA 5CQYA 4F04B 4PJOD 3MEWA 2QQAA 2FPFA 4PJLA 2FZKB 4C8QA 3ICAA 1YN8A 5CCAA 2XDDA 3FLGA 1OZ3A 3EFSA 2ZZEA 3MHXA 1SKUB 1D1BA 2DXCA 4OP0A 4Z89A 3FEOA 1M2VB 3EGDB 2IPOB 3E19A 1WYDA 1JJ2P 3OD1A 2CP5A 2ESWA 3CCJQ 5KYYA 2DPPB 1V76A 1ZSZB 3OA6A 3PMTA 2QDLA 3UA7A 4DBFA 1TG0A 3SHWA 3V8JA 1YIJQ 5KH6A 2HQXA 4C92B 1YITT 2CSQA 2DIGA 4WI1A 2L2PA 5LJ5d 4XAXB 4CS2A 1VYTA 4GLKA 5FLXE 4JJNK 4RMOA 3W3SA 4BD3A 1ZX6A 5FU7B 2DU5A 4F7UF 1WXTA 4QT7A 2X3XD 4OB2B 3I5RA 2NYSA 3GP8A 4EMKA 2WACA 2OJ2A 3CD6T 3JCMV 3CXCA 1PD0A 2R5MA 2ZR2A 4JRPA 1VQ9T 2RHSA 1VQ4A 2BE9B 2QAZA 2IVWA 2DVJA 8AT1B 3HFZB 1WFWA 2A0FB 2MCNA 2Q5HA 1NJ6A 1V29B 1B76A 2FEIA 4TTVA 2MAMA 3NGPA 2ZT8A 1FYNA 2DL4A 4YRCA 1LPLA 3EG9B 2AKWA 3LSQA 2JM9A 3EG1A 2X3WD 2DMOA 1OV3A 3L2VA 2DETA 3RBBB 7AT1B 4M7DB 4IUVA 1NZ9A 1N5ZA 1ZQ1A 3HTRA 1HD3A 4E7SA 4OGCA 2HQEA 3BDLA 2AT1B 3FDRA 4ZIBA 4BE0A 3BE3A 4ZTZB 2PVDB 1NYFA 3J81E 1RUWA 1E24A 2ALYA 2HZYA 1NYQA 3OYBA 2J3LA 4H2WA 4UP9A 4XEMA 2KMTA 3J80E 2K4YA 5F5WA 1ASYA 2CUDA 4YPFA 5J26A 4BI3A 4BDYA 2C0TA 4N0AA 4DPGA 2DXTA 3CC2T 1N9WA 1LVKA 1D0ZA 2CZ1B 2K9GA 2VUBA 5LL6S 4EDUA 1FYFA 4Z8AA 2OTLA 5CIUA 2DLPA 1KG1A 4L6V5 2RO0A 1Q81U 1PNJA 1EIFA 5FU6B 1L0WA 5I11A 1I4K1 3VS2A 3PZCA 3FC3A 1OZ2A 2C7IA 3PIOA 1YJWQ 4J9EA 4JPBW 4C5GA 1KQ1A 4ZN1A 4H2UA 4P71A 4FCYA 2V8KA 4XU1A 1EOVA 1BBWA 1SRMA 1WHMA 1WU7A 4K88A 1K8AU 1QVGP 2OTJQ 1RADB 3JB9D 4O2DA 2QEXA 1X01A 2RHZA 1E1OA 1B3QA 4EPCA 5GANg 1M2VA 3EGDA 2GF7A 2Q5IA 1X2KA 5GMKj 1BI1A 1TUCA 2DE0X 4M7AG 3SB2A 4WF2A 1I81A 2E41A 4O5VA 3CCVA 2LNVA 3JB9I 3CC7Q 2QQBA 2ODRD 3TEHB 4C92E 1QVPA 1FMVA 1Q7YC 4C0ZA 3F70A 3A5ZA 1ZBJA 4PJOE 1U1SA 4J6WA 4DA4A 3LW5E 2OTLT 3RF1A 1M3CA 2M9UA 3P8DA 5IAYA 4C92A 4Z02A 3CC2Q 2EVRA 4PJOA 3JCMh 3PCOB 3CCSA 11ASA 2DL3A 3UGTA 2ZZDA 2GTOA 4M77D 2AKKA 3X25B 1ABOA 2DL7A 2EWNA 5CAIA 1YB3A 3GIBA 2PUKB 3A8OB 4CRIA 3I56A 3A31A 1M5Q1 4JRQA 2C8MA 4FL6A 5LJ3e 3DLLA 2PMEA 4RTVA 1QWEA 1YCSB 4QKUA 5DLQE 1NLOC 4M78B 2CKKA 5GMKh 2EQKA 2Y90A 2QEXT 3UH0A 1VIFA 1SF9A 3BFMA 1C0MA 2RMOA 2LCLA 4EX5A 5GAOr 4CH5A 3CCLA 1PCXA 3SD4A 5LJ5f 1WDXA 2QTXA 3PIPA 2HL5C 4YROA 3HP9A 5ECAA 4YRLA 1OYXA 3NTHA 2ROTA 3EG0A 3E9GA 4A4GA 2RK2A 2YUQA 1G3YA 2QHVA 2ZPFB 5CKHA 4AMCA 1CSKA 3H8ZA 4HT4A 2DIQA 1M1FA 1H4QA 2EFIA 3X24B 5I22A 2ZNIA 2QA4A 3VQYA 2MWOA 2J06A 4JJBA 3RESA 1UE9A 3NEMA 1G5VA 3CCST 2A37A 3KFVA 4BACA 1UHCA 2G4CA 4KGZB 5HKCA 3P8BB 4ZNXA 1D09B 1GXIE 3V7CA 2DERA 2X4XA 5FWBA 4Y28E 3EH1A 2DZCA 3VBBA 2DTHA 1NM7A 2QHSA 3HXVA 3LYIA 2JMCA 1WZOA 2F1LA 4C0DB 1SERA 3CCLT 5LJ3g 4MMKA 4BWAA 1Y07A 1VQMA 2L89A 2E6NA 2SEMA 1QCFA 2ZPBB 3HY1A 3RMSA 4RG8A 1RACB 3QHSA 4LD9K 3A98A 2EYXA 4KGVB 5A0GA 4YRQA 1AWWA 3E9HA 2DD5A 2V26A 1WI7A 4LVJA 1JJ2A 5AT1B 1YFSA 1D1AA 2COZA 5GAN2 4QVDA 1AHJB 1I8FA 1N6AA 2KROA 5FRMA 2QA4T 2Z0WA 1VQ4Q 2QQ9A 2P0KA 2DJZA 5GANj 3HXYA 1BIAA 3U23A 3LH5A 4CI0C 4ESRA 2CSIA 5GAN3 2BZYA 4XTXA 4HKEA 1BK2A 1Q81C 2ZPEB 1X6BA 5A0DA 1UUEA 1HC7A 3EGXB 2K5LA 4AG1C 1YI2A 3L4GB 2HBPA 3S3OA 1EZZB 4QVZA 4DBRA 1Q7YR 3PCOA 2F2WA 3A8LB 1M8MA 2PTKA 5K1PA 1E7OA 5FW9A 2Y4YA 4A54A 1Z7NA 2EGAA 1LJOA 2KEAA 2ZIMA 1ZBXA 1MNEA 1K8AC 4M75F 3PVLA 4NL2A 1VQMT 4OMMA 2E5AA 1AEYA 4YRIA 1M1KU 2NWMA 2RN8A 1IREB 3UFGA 1JRIA 4M78A 1E1TA 4C5HA 3OYLA 3VRZA 1H3HA 3MEVA 2DBKA 1SEMA 1PKTA 3P8HA 1OULA 1T0HA 5GANh 4M7DG 4RG2A 4M77E 1VQ6Q 2E5QA 2DL5A 1RI0A 2CP3A 2OTLQ 4KR2A 4Q5WA 2DEUA 3L42A 2DYBA 1JBMA 1YIJT 5A2QE 1AZGB 2QHUA 4RKUE 2GNCA 2VWFA 1IO6A 1NEGA 2KT8A 3OYDA 4CS4A 4M77A 2E65A 2Q7HA 4CH4A 3SEMA 1X6OA 4F16A 1EFNA 5IXBA 3CPWP 3TEGA 2DILA 3CCRQ 2ZPHB 2LMJA 3L2UA 1IXDA 1RAAB 4JZ4A 1LCKA 2HSEB 3KUFA 4KQEA 4F7UB 1YI2T 3M54A 3X28B 5GAN7 1G51A 4E7JA 4PFPA 3EFRA 2QQRA 1ARKA 3HRKA 3MF1A 1D1CA 3ME9A 1NG2A 1EX4A 2O9SA 4J9GA 1K0XA 3D7SB 2BE7D 1VQPQ 3CCEQ 3MPUB 3MJXA 2LT4A 4J9HA 1Q82R 3S3NA 3CCVQ 4HVUA 3NFCA 4G85A 4HCKA 2XK0A 3TQ7P 2PVOB 3QWXX 4IUUA 5DLOA 5D7UA 1ZSGA 5M9OA 3OQ5A 5FROA 4LXCA 2ENMA 2DFUA 4J7IA 2LTOA 1K9AA 3QUIA 2OTJA 3RL6A 1K73U 4J9BA 1O9SA 1QVGA 1D3BA 1JO8A 1MNDA 3JCMJ 4EMKB 2HKNA 1PM3A 3OYIA 1AOJA 3G1JA 1UGPB 2RHSB 1WIEA 3CC7A 1X2QA 4XTWA 1N27A 3C0CA 1M90R 1GCQC 4R55A 1SHFA 3CMEA 1UECA 5KYNA 3I56Q 1XNIA 2F69A 4J6XA 3TSZA 3M0PA 5D6XA 2YRVA 2EKOA 3IQLA 1M27C 1K0SA 4ZGEB 2LZ6B 1Y57A 3CC2A 4G84A 3KBGA 2H8HA 3A8GB 4IIOA 3PFSA 4RTWA 4R56A 1TTHB 2ARTA 1Y96B 1K76A 2DEQA 4BY6C 5KNNA 1QW1A 3QPHA 2EQJA 2QYZA 1B07A 2LX9A 4LN2A 3M55A 3CCLQ 3OS1A 4OLFA 1UGSB 3EGXA 1G2BA 2NUZA 2KR3A 4PK4A 6AT1B 1VOMA 2RHUA 1KIKA 1WHJA 2C0OA 1KSWA 2DZ9A 2O01E 4YREA 2MI6A 2ALYB 3QO3A 2F2XA 3GNFB 4AFUC 2ZAEA 4H2VA 1YWOA 2C06A 2OTJT 2M51A 2QASA 4IUPA 5HK0A 5LJ5e 2DXUA 4GY5A 1NE8A 3CBPA 4GLMA 4UC4A 5E3IA 1HK9A 1X56A 2RK1A 4P75A 3INZA 4ORZA 1MGQA 4LDVA 3CC7T 3QYGB 2LP5A 3REAB 3IALA 1F1BB 2CP7A 1PWTA 4AG2C 4H2XA 1HSQA 3VU3C 3ERRA 1QKXA 3THKA 1B70B 4FYVB 1WHGA 3RACA 2GBQA 5CKDA 3OMCA
chains in the Genus database with same CATH topology
4F7UE 4JLIA 3N5BB 3CMAA 1QF6A 1QVFS 4FU6A 3A7AA 4F7UA 4L5GA 2CZ7B 4XTVA 3VV0A 5GAMe 2DQ3A 1N9SA 3A8HB 3QO7A 1QE0A 2ZTGA 1SSFA 1M1KC 5DM7R 3A5ZB 4P3OA 3WXMB 4FIBA 4J5YA 3ZEHA 1WPYA 4E7LA 2GFAA 1JB0E 3IG2A 4EMGA 3MP6A 4UP7A 2LCCA 2XDBA 4PJOB 5LJ5g 2XICA 1ADYA 3HKSA 4C5EA 4ELZC 4QQ6A 3CPFA 3VYGA 3RKYA 5CKFA 4FM4B 5CKBA 3J7AF 4J15A 3C95A 1WQWA 2MF2A 2E6ZA 4LDUA 2CJAA 2BKDN 2RI3A 1BBUA 2DO3A 3QO8A 3G7ZA 2RM4A 4JRKA 5C51B 1R8OB 4ZN3A 4M7AF 1Y96A 1QP2A 1OI1A 2M1HA 2XTIA 3LGLA 5GAMd 5GAMg 3LSSA 2Y4XA 2AMCB 1NPPA 1K73C 1USYC 4YDQA 3R6OA 3ZBDA 3E9IA 3MF2A 4LVKA 4D6WA 2ARUA 3I7FA 5L8RE 4HWRA 1S72A 2VV5A 4P74A 2ZCEA 1KD1U 3OY9A 3EAEA 1VQ6A 3LWIA 1BYMA 1VQ4T 3QKJA 4M75D 2K3YA 2R57A 2VGMA 5C6SA 3V7SA 1I5LA 2JVVA 4JLGA 5GAOl 1B70A 4M75C 2CS7A 3CCRA 2JUFA 2K5FA 3CPWA 4LDYA 1N8RU 2YHTA 4C8QG 2R5AA 4HWTA 3A5YA 5HGQA 2KSSA 2XDPA 2CZ0B 3A7RA 4CS3A 3SDZA 4P73C 1VQPA 3CCEA 2RHQA 4YCWA 3OYKA 3KXTA 1NJIU 5I2SA 3M9QA 3OS2A 4KBMB 3MQZA 3FIFA 2LQ8A 5GAN5 4NOYA 2XG8D 1HTTA 2CJ9A 1S72T 4VUBA 3SWNC 3P8TA 3AHUA 1VQ6T 1Q86U 1NJ1A 2MMPA 2I2LA 2VXEA 3UPUA 2L8DA 2CZ6B 1SESA 1WLEA 4LDXA 2I4OA 3CEYA 4C0GA 5C0MA 3V8LA 4JUVA 3TEEA 4LVMA 3CCRT 2QDYB 4YRGA 4L87A 3I55A 1FXXA 5ELNA 4J6YA 2RD1A 3LWHA 3A32A 2KAFA 4TWAA 1VQZA 1BI0A 1VQPT 3CCET 2ZT6A 5I21A 1IZ6A 3CCVT 1H4TA 4OB0B 2ZCFB 3JB9H 1J5WA 2XHCA 4HWOA 4M77B 3LH0A 5CK9A 3QTCA 1B7YA 5C53B 2RI2A 2AMCA 4X34A 1LNXA 3OYYA 2FYKA 3TU4K 2VGNA 4XK8E 2QQSA 3QIIA 1VQOA 3OYJA 2RHXA 3I56T 3QYHB 4NS5A 2X4JA 1RL2A 3JSCA 3HXUA 4HT9A 4CH6A 5GAMf 4YCUA 1H4SA 1DJ7B 4B9XA 5DY9A 2DXBA 3JRZA 3CCQA 3JCMP 1Y71A 4Q6GA 4M7DF 3HXZA 1D3BB 3JCMQ 3MO8A 4XQ3A 4P72C 3RKWA 2CJBA 4M75E 4E47A 4TQDA 4P3PA 1EVLA 1VQ8A 4ZTUB 2O4XA 1EIYB 2RHYA 3JAME 3OS0A 4M75A 3PMIA 3REXA 1HXDA 1KD1C 2ZR3A 4TVWA 2E12A 4C92G 5GAOn 5GAOp 3PTAA 2LC4A 4A4KA 4PJOG 2K57A 3A74A 1YBYA 2DU7A 2IY5A 3BW1A 3M57A 2EQMA 1XTDA 1X2HA 5GMKm 1N8RC 2LRQA 2ZGWA 1NPRA 5GMKi 2FHDA 5J39A 3OS5A 3C12A 2KY9A 3META 2ZZFA 2L3RA 1YFTA 3QSUA 3QZ5B 3NETA 1VIEA 1W2BS 1ATIA 4BDZA 3OYAA 1WGSA 1NJIC 1M4ZA 2CYZB 4H2XB 4YRNA 4O6JA 4IURA 5FRNA 4NCXA 3OW2S 1VQLA 3VQVA 4C8QC 1Q86C 4J7FA 2I4MA 2K2VA 1VQ5A 2P0LA 2JNGA 4M7AD 3GLXA 3FJPA 2A3LA 5HK3A 2DAQA 1NJ8A 4M7AC 5CKEA 1H3ZA 4J8OA 3VUZA 5D6WA 4BI4A 2R58A 4YRFA 2LVMA 4K86A 1N9RA 2PUOB 3IKLA 2BIVA 3OYNA 2ZPIB 5GAN8 4HCBA 1KC8U 4QQGA 5CO7A 1VQKA 3HTZA 3OSSC 4PLLA 5EG2A 4H02A 3VQXA 4EMKC 5GAOm 12ASA 1P92A 1EVKA 3OYFA 1FWZA 2ZT5A 2P0PA 4E51A 3OYGA 5LJ3j 4KUIA 1VQ5T 4LDWA 3HPWA 3S3MA 1EIYA 1SETA 5IN1A 4EO4A 3MP8A 2ZZGA 4YCVA 3C94A 3SFMA 2JTFA 3HY0A 1M1GA 3DLMA 4IUQA 4NL3A 3NENA 3CBOA 2XIDA 2X35A 1YJNA 3ASKA 1BI2A 4P72A 3M56A 3OB9A 3JB9G 3ER0A 5GMKe 3VQWA 2QXFA 5KCHA 1B34B 4WJ4A 2ZINA 2G3RA 4YRMA 4N4IA 1GGMA 4N0AC 5LJ3h 1QVFA 4M78G 2L5QA 3L2QA 4KULA 3JCMb 4BI8B 1WQ7A 2Q7EA 3E1SA 1XOVA 3G71A 2NLUA 4MMLA 4QW2A 4KUDK 2RJFA 1JJCB 1BI3A 2EQUA 1KMMA 2QI2A 3CMET 4P71C 2K3XA 3CC4A 3HXXA 4M77G 4LNSA 4ELYC 4MZPA 5K1XA 3WQZA 1YITA 3MEUA 3JCMd 2FB7A 2WSEE 2CGHA 1G5IA 3TUPA 2RH2A 3CCUA 3OYMA 2OAUA 3FB9A 1PYSA 1KQSS 3C4SA 4IKFA 1ADJA 2DTOA 3A8MB 3CD6A 4JS4A 2RHQB 2GCXA 4RCCA 3NTIA 1KOGA 4MZTA 3G4SA 3HRIA 4C92C 1VQNA 2EJFA 4M7AE 3QJ6A 3HFVA 4PJOC 5FU7C 3X20B 4HCCA 2FL7A 1X55A 2EJGA 3G71T 4RQFA 1WJRA 2MWPA 4M7AA 5GMKl 5A0LA 3LGFA 3CC4T 2D6FA 1C0AA 2E1HA 5KE3A 1X54A 2B8AA 1RIQA 2EJ9A 4FT4A 1UB4A 3O8VA 4IUTA 2F5KA 4M7DD 1ASZA 4OGEA 2AHJB 3NELA 5GAOq 4C8QF 4LVLA 3S6WA 3FRNA 3WVDB 3CMAT 3CCUT 4UPAA 2ZXFA 1Q82U 4M7DC 1H4VB 4B9WA 4ZTFA 2YLCA 3P8YA 2I4LA 3G4ST 2PVGB 4HVCA 3REUA 2M16A 4HWSA 1ZHIA 3OYHA 3PT9A 2ZIOA 1KC8C 1YFRA 1VQNT 4TVYA 2LQKA 2LT1A 1B7YB 3MEAA 4XU3A 5GANe 1B34A 2E3CA 3VUBA 3UGQA 2XGTA 1M90U 3TREA 4FT2A 2K5IA 5D6YA 4Q15A 3LLRA 4OF1A 3M5AA 4XTYA 3DKMA 2KK4A 5FU6C 2JTMA 3CXCS 4MZMA 3BY7A 5CQXA 2D0QB 3QBYA 1KMNA 2GFUA 1EFWA 1JJCA 1K9MU 3GNGA 1X75C 3QNEA 3VJPA 4YRSA 4P5NA 5GAN6 3HHTB 4BUGA 1UGRB 2YLBA 3HFOA 3HRTA 4RDXA 3RMQA 1G3SA 1QP3A 2F5TX 4X9DA 4A53A 1VQ7A 4RCBA 1NYRA 3VYHB 4EMHA 4F7UG 3ZFJA 2H3JA 2E64A 2ZPGB 2WSCE 1X2GA 2P4TA 3OYCA 2O4XB 4TVAA 4K87A 3JCMW 2VYTA 1YGBA 2ARSA 3M58A 1UGQB 4YRJA 4PL6A 2FVUA 3M4YA 4M75B 2HD0A 2JN0A 2E70A 4RQEA 2WSFE 2RI5A 2EL9A 3NTKA 2RJCA 5GANd 4A4FA 2KQWA 1YCYA 2EIFA 2XI9A 4H2YA 3JCMf 5GAN4 2IY5B 3URGA 2DD4A 2J3MA 4X5OA 4KT0E 5I2MA 2DKGA 1O75A 4Y91A 4QVCA 4M78D 4E7KA 1Z7MA 4L59A 2ODRC 5LJ5j 3CPWS 1YHQA 4HT8A 4M78C 2PQWA 3HRSA 1B8AA 1NJ5A 1VQ7T 5HY6A 3SWNB 4DOVA 4N4GA 3H6ZA 3QZ9B 2XKOC 3A7UA 3RERA 4LD6A 2IG0A 4TQFA 3JB9J 4M77C 2RHIA 3L2RA 3HFZA 4M7DE 1FX7A 4ZTJA 2VC8A 4OVAA 2HNIA 4MDXA 4C92F 1NJ2A 2KVQG 3E9FA 3HSBA 2RA2A 3PNWC 4PJOF 4C5IA 4M7DA 3M4PA 3X26B 4E7HA 5GAMj 5LJ5h 1XQHA 3V8KA 4H2TA 1KHCA 3HFNA 3T9NA 2P0QA 1YHQT 2P5IA 1Q82C 3MCAB 4YRPA 3I55T 4C0DC 1USYA 3MP1A 2V8IA 4KR3A 4ME7A 4MDWA 3G1ZA 2LDMA 3PGGA 2D9TA 5IT9E 4CH3A 1NNHA 1PSFA 4YP0A 4OMFB 4ZGJB 4BB7A 2GQVA 3UDCA 1IL2A 5GAMh 5LJ3d 4AH6A 3KFUA 1SRYA 3TCJA 1M90C 3JCMc 5C52B 4ATOA 4OB1B 4PKCC 1W2BA 3M4GA 1PSEA 3CCJA 5ELOA 3OMGA 2I4NA 1VQOT 3V7RA 3LX7A 1K9MC 4JRIA 4A4HA 3RUXA 3QO5A 3CMQA 1M9SA 1VUBA 1YIJA 3M4QA 3OW2A 4P73A 4BW9A 3QXEB 4HCZA 3TEHA 4JDSA 4BE1A 2PU9B 5CR2A 1EQRA 1U1TA 3HL8A 3QJYA 4X9CA 3Q1JA 3DSQA 3CCQT 4PNOA 4J83A 4P75C 4YYEA 3SWNA 4TVRA 2DK3A 2V8JA 4RMFA 3P8VA 2DDZA 3QG1A 5GANf 3OSVA 2HAXA 2BUDA 1KQ2A 1JJ2S 1LOJA 1E22A 1VQ8T 2M0OA 4M78E 2QHTA 3RGLA 4C8QD 5AYFA 1LYLA 1YJ9A 3DB3A 4A4EA 2VXFA 3CCJT 3WVEB 3MEYA 4BE2A 4XU0A 3M59A 1PYSB 4II1A 3JB9F 4ZGDB 2CIMA 3UT1A 4WJ3M 2A7YA 2KDSA 4E7IA 3JCMX 5J3BA 4C8QB 3UWNA 4XEOA 1M8VA 4M78F 4HWPA 4XTUA 3G6EA 3BJUA 1G3TA 3L2ZA 2ZNJA 4M7AB 2XD0A 4PG3A 4YRKA 4PHCA 3GPLA 3CCMA 1YJWA 3GOXA 3L2WA 3QDRB 1G3WA 1YJ9T 2EAYA 1VQLT 4M77F 2Q7GA 1MHNA 4DOWA 3CBMA 4YRTA 4LVIA 4M75G 2PMFA 3JCMe 3R07A 2DVEA 1W4SA 4C0FA 3IKMB 4YRRA 5CVIA 1G5HA 3DB4A 2XU8A 2A8EA 4QQDA 1WJSA 3HRUA 2JZ2A 1BKBA 5KCOA 4V2SA 2X4YA 3L1AA 3OBYA 3OYEA 2RJEA 3G6ET 1VQKT 2AKWB 3RKXA 3GF5A 4P74C 4UP8A 5LJ3f 3VKIA 1KHIA 3LC0A 1WNLA 3CCMT 1YJWT 1QVGS 1KQSA 4H2SA 3L4GA 4BY6B 5KE2A 1W66A 3RIRA 1WJQA 4XU2A 2DQ0A 4HA8A 2E10A 2NS6A 4XTZA 4OB3B 1UEBA 2DTIA 2RB6A 4JS5A 3BDUA 2ZT7A 2JOYA 1Q7YU 2EYQA 2RJDA 3JCMg 1YJNT 4YTLA 3HXWA 1U8RA 1BIBA 1H641 4FSXA 4DQ2A 3M53A 4C8QE 4TVAB 1TH7A 4N4HA 1VQ9A 4C92D 1Y7XA 3OBWA 2X4WA 4P3NA 4PLIA 5CQYA 4PJOD 3MEWA 2QQAA 4C8QA 3ICAA 5CCAA 2XDDA 3FLGA 1OZ3A 3EFSA 2ZZEA 3MHXA 4OP0A 2DXCA 3FEOA 3E19A 1WYDA 3OD1A 2DPPB 3OA6A 3PMTA 3V8JA 5KH6A 2HQXA 4C92B 1YITT 2DIGA 4WI1A 5LJ5d 4XAXB 4CS2A 4GLKA 5FLXE 4JJNK 4RMOA 3W3SA 4BD3A 5FU7B 2DU5A 4F7UF 4OB2B 3GP8A 4EMKA 2WACA 3CD6T 3JCMV 3CXCA 2R5MA 2ZR2A 4JRPA 1VQ9T 2RHSA 1VQ4A 2IVWA 3HFZB 2Q5HA 1NJ6A 1V29B 1B76A 4TTVA 2MAMA 2ZT8A 4YRCA 3LSQA 2AKWA 3L2VA 4M7DB 4IUVA 1NZ9A 1ZQ1A 4OGCA 2HQEA 3BDLA 3FDRA 4ZIBA 4BE0A 4ZTZB 2PVDB 3J81E 1E24A 2ALYA 1NYQA 3OYBA 2J3LA 4H2WA 4UP9A 4XEMA 2KMTA 3J80E 2K4YA 5F5WA 1ASYA 4YPFA 5J26A 4BI3A 4BDYA 4N0AA 4DPGA 2DXTA 1N9WA 4EDUA 2CZ1B 2VUBA 5LL6S 1FYFA 2OTLA 5CIUA 1KG1A 4L6V5 2RO0A 1Q81U 1EIFA 5FU6B 1L0WA 1I4K1 3PZCA 3FC3A 1OZ2A 2C7IA 3PIOA 4C5GA 1KQ1A 4ZN1A 4H2UA 4P71A 2V8KA 4XU1A 1EOVA 1BBWA 1WU7A 4K88A 1K8AU 3JB9D 4O2DA 2QEXA 1X01A 2RHZA 1E1OA 4EPCA 5GANg 2GF7A 2Q5IA 5GMKj 1BI1A 4M7AG 3SB2A 4WF2A 1I81A 2E41A 4O5VA 3CCVA 2LNVA 3JB9I 2QQBA 2ODRD 3TEHB 4C92E 1QVPA 1Q7YC 4C0ZA 3F70A 3A5ZA 4PJOE 1U1SA 4J6WA 4DA4A 3LW5E 2OTLT 3RF1A 5IAYA 2M9UA 3P8DA 4C92A 4Z02A 4PJOA 3JCMh 3PCOB 3CCSA 11ASA 3UGTA 2ZZDA 4M77D 3X25B 2EWNA 5CAIA 1YB3A 3GIBA 2PUKB 3A8OB 4CRIA 3I56A 3A31A 1M5Q1 4JRQA 2C8MA 4FL6A 5LJ3e 3DLLA 2PMEA 5DLQE 4M78B 2CKKA 5GMKh 2EQKA 2Y90A 2QEXT 3UH0A 1VIFA 3BFMA 2LCLA 4EX5A 5GAOr 4CH5A 3CCLA 3SD4A 5LJ5f 2QTXA 3PIPA 4YROA 3HP9A 4YRLA 1OYXA 3NTHA 3E9GA 4A4GA 2RK2A 1G3YA 2QHVA 2ZPFB 5CKHA 3H8ZA 4HT4A 2DIQA 1M1FA 1H4QA 2EFIA 3X24B 2ZNIA 2QA4A 3VQYA 2MWOA 3RESA 3NEMA 1G5VA 3CCST 4BACA 2G4CA 5HKCA 3P8BB 1GXIE 3V7CA 2X4XA 4Y28E 2DZCA 3VBBA 2DTHA 2QHSA 3HXVA 3LYIA 4C0DB 1SERA 3CCLT 5LJ3g 4MMKA 4BWAA 1Y07A 1VQMA 2L89A 2E6NA 2ZPBB 3HY1A 3RMSA 4RG8A 3QHSA 4LD9K 4YRQA 5A0GA 3E9HA 2DD5A 4LVJA 1JJ2A 1YFSA 5GAN2 4QVDA 1AHJB 1I8FA 1N6AA 5FRMA 2QA4T 2QQ9A 2P0KA 2DJZA 5GANj 3HXYA 1BIAA 4CI0C 5GAN3 4XTXA 4HKEA 1Q81C 2ZPEB 5A0DA 1HC7A 2K5LA 1YI2A 3L4GB 2HBPA 3S3OA 4QVZA 3PCOA 3A8LB 5K1PA 2Y4YA 4A54A 1Z7NA 1LJOA 2ZIMA 1ZBXA 1K8AC 4M75F 4NL2A 1VQMT 2E5AA 4YRIA 1M1KU 1IREB 3UFGA 1JRIA 4M78A 1E1TA 4C5HA 3OYLA 3MEVA 3P8HA 5GANh 4M7DG 4RG2A 4M77E 4KR2A 2E5QA 1RI0A 4Q5WA 3L42A 1JBMA 1YIJT 5A2QE 2QHUA 4RKUE 3OYDA 4CS4A 4M77A 2E65A 2Q7HA 4CH4A 1X6OA 3TEGA 2ZPHB 3L2UA 3KUFA 4KQEA 4F7UB 1YI2T 3M54A 3X28B 5GAN7 1G51A 4E7JA 3EFRA 2QQRA 3HRKA 3MF1A 3ME9A 2LT4A 3S3NA 3NFCA 4G85A 2XK0A 2PVOB 4IUUA 5DLOA 5M9OA 3OQ5A 5FROA 4J7IA 2LTOA 3QUIA 2OTJA 3RL6A 1K73U 1O9SA 1QVGA 1D3BA 3JCMJ 4EMKB 3OYIA 1UGPB 2RHSB 3CC7A 4XTWA 1N27A 4R55A 3CMEA 1XNIA 2F69A 4J6XA 5D6XA 2YRVA 2EKOA 4ZGEB 3CC2A 4G84A 3KBGA 3A8GB 3PFSA 4R56A 2ARTA 1Y96B 4BY6C 2DEQA 5KNNA 1QW1A 3QPHA 2EQJA 2LX9A 4OLFA 3M55A 3OS1A 1UGSB 2RHUA 2DZ9A 2O01E 4YREA 2MI6A 2ALYB 3QO3A 3GNFB 4H2VA 2C06A 2OTJT 4IUPA 5HK0A 5LJ5e 2DXUA 4GY5A 1NE8A 3CBPA 4UC4A 5E3IA 1HK9A 1X56A 2RK1A 4P75A 3INZA 1MGQA 4LDVA 3CC7T 3QYGB 3IALA 4H2XA 3VU3C 3ERRA 1B70B 3RACA 3CC2T 5CKDA 3OMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U E;  4JLI A;  1L0W A;  1USY A;  4YRF A;  1I4K 1;  4K86 A;  1N9R A;  3PZC A;  4KR3 A;  3IKL A;  2C7I A;  1QF6 A;  3A7A A;  4F7U A;  3PGG A;  3G1Z A;  4XTV A;  4CH3 A;  1NNH A;  1KQ1 A;  5GAN 8;  4H2U A;  4P71 A;  5GAM e;  4YP0 A;  2DQ3 A;  1N9S A;  1EOV A;  4XU1 A;  1BBW A;  3HTZ A;  1WU7 A;  4K88 A;  3QO7 A;  1QE0 A;  2ZTG A;  3JB9 D;  4H02 A;  3VQX A;  1IL2 A;  4EMK C;  5GAO m;  4O2D A;  12AS A;  1EVK A;  1X01 A;  5GAM h;  1E1O A;  5LJ3 d;  4AH6 A;  2ZT5 A;  3KFU A;  1SRY A;  5GAN g;  4P3O A;  3JCM c;  4J5Y A;  5C52 B;  4E51 A;  1WPY A;  2Q5I A;  5GMK j;  4M7A G;  3SB2 A;  4WF2 A;  1I81 A;  2E41 A;  3JB9 I;  5LJ3 j;  3IG2 A;  2ODR D;  4EMG A;  4UP7 A;  3TEH B;  4PJO B;  5LJ5 g;  4C92 E;  1ADY A;  3M4G A;  5ELO A;  3A5Z A;  4PJO E;  2I4N A;  1EIY A;  1U1S A;  4J6W A;  1SET A;  4EO4 A;  3V7R A;  2ZZG A;  4YCV A;  3RF1 A;  4JRI A;  3RUX A;  4C92 A;  3QO5 A;  3CMQ A;  3HY0 A;  3M4Q A;  3RKY A;  4P73 A;  4BW9 A;  3TEH A;  4PJO A;  3JCM h;  3PCO B;  4NL3 A;  3NEN A;  11AS A;  3UGT A;  4J15 A;  4M77 D;  1U1T A;  1WQW A;  1EQR A;  4X9C A;  2EWN A;  5CAI A;  3DSQ A;  1YB3 A;  3GIB A;  4P72 A;  2CJA A;  4PNO A;  4P75 C;  3JB9 G;  5GMK e;  1BBU A;  3QO8 A;  3VQW A;  2RM4 A;  1M5Q 1;  4JRK A;  3A31 A;  4YYE A;  3SWN A;  5C51 B;  2C8M A;  5LJ3 e;  2PME A;  1B34 B;  4WJ4 A;  2ZIN A;  4M7A F;  1Y96 A;  4RMF A;  4YRM A;  3P8V A;  2DDZ A;  5GAN f;  1GGM A;  4N0A C;  4M78 B;  5GMK h;  1KQ2 A;  2XTI A;  1LOJ A;  2Y90 A;  1E22 A;  3UH0 A;  3BFM A;  5LJ3 h;  4M78 E;  5GAM d;  2QHT A;  3RGL A;  4EX5 A;  5GAO r;  4C8Q D;  5GAM g;  4CH5 A;  4M78 G;  3LSS A;  5LJ5 f;  2AMC B;  2QTX A;  1LYL A;  3JCM b;  4YRO A;  1USY C;  4YDQ A;  1WQ7 A;  4YRL A;  2Q7E A;  3E9I A;  3MF2 A;  4MML A;  2VXF A;  1JJC B;  2ARU A;  3I7F A;  1KMM A;  3MEY A;  2QHV A;  4HWR A;  4P74 A;  2ZCE A;  4P71 C;  4XU0 A;  3HXX A;  4M77 G;  1PYS B;  1H4Q A;  2ZNI A;  4LNS A;  3WQZ A;  5K1X A;  3VQY A;  3JB9 F;  3RES A;  2CIM A;  3NEM A;  4WJ3 M;  4M75 D;  3JCM d;  2FB7 A;  2CGH A;  1G5I A;  3TUP A;  2G4C A;  3V7S A;  3JCM X;  1I5L A;  5GAO l;  1B70 A;  4C8Q B;  4M75 C;  3FB9 A;  1PYS A;  3V7C A;  1ADJ A;  2DTO A;  2RHQ B;  4RCC A;  4XEO A;  2YHT A;  1M8V A;  4M78 F;  1KOG A;  4C8Q G;  4HWP A;  4HWT A;  4XTU A;  2DZC A;  3BJU A;  3HRI A;  3VBB A;  2DTH A;  3L2Z A;  3A5Y A;  2ZNJ A;  4M7A B;  5HGQ A;  2QHS A;  4PG3 A;  3HXV A;  4YRK A;  4C92 C;  4PHC A;  3A7R A;  2EJF A;  1SER A;  4CS3 A;  4M7A E;  5LJ3 g;  3HFV A;  4P73 C;  4MMK A;  2RHQ A;  4BWA A;  4YCW A;  4PJO C;  3HY1 A;  2EAY A;  1X55 A;  3QHS A;  4M77 F;  2EJG A;  2Q7G A;  4YRQ A;  4RQF A;  3FIF A;  5GAN 5;  4M7A A;  3E9H A;  5GMK l;  4NOY A;  1HTT A;  2CJ9 A;  4YRT A;  4M75 G;  2PMF A;  1YFS A;  3JCM e;  3R07 A;  3SWN C;  3P8T A;  2DVE A;  3AHU A;  1C0A A;  5GAN 2;  2E1H A;  4QVD A;  1I8F A;  3IKM B;  1NJ1 A;  1G5H A;  4YRR A;  1X54 A;  1RIQ A;  2I2L A;  2EJ9 A;  2DJZ A;  2VXE A;  5GAN j;  1SES A;  3HXY A;  1BIA A;  1WLE A;  4M7D D;  1ASZ A;  2I4O A;  3NEL A;  5GAO q;  4C8Q F;  5GAN 3;  4XTX A;  3V8L A;  4JUV A;  4UPA A;  2ZXF A;  4M7D C;  4V2S A;  1H4V B;  2YLC A;  3L1A A;  1HC7 A;  3P8Y A;  3L4G B;  2I4L A;  4YRG A;  3PCO A;  2AKW B;  4L87 A;  5ELN A;  3RKX A;  4J6Y A;  4HVC A;  2RD1 A;  4P74 C;  5LJ3 f;  4UP8 A;  5K1P A;  3REU A;  3A32 A;  4HWS A;  2ZIO A;  4TWA A;  4A54 A;  1YFR A;  1Z7N A;  1VQZ A;  1LJO A;  2ZIM A;  3LC0 A;  1WNL A;  4TVY A;  2ZT6 A;  1B7Y B;  4XU3 A;  4M75 F;  4NL2 A;  3L4G A;  4H2S A;  5I21 A;  5GAN e;  3RIR A;  1W66 A;  1H4T A;  1B34 A;  2E5A A;  4YRI A;  2E3C A;  3UFG A;  3JB9 H;  4XU2 A;  1J5W A;  1JRI A;  4M78 A;  1E1T A;  2DQ0 A;  2XGT A;  4HA8 A;  4HWO A;  3UGQ A;  4M77 B;  4Q15 A;  2E10 A;  5GAN h;  4XTZ A;  4M7D G;  3QTC A;  2RB6 A;  2DTI A;  1B7Y A;  4M77 E;  4KR2 A;  3BDU A;  4XTY A;  5C53 B;  2AMC A;  2ZT7 A;  1JBM A;  3BY7 A;  2QHU A;  1LNX A;  1KMN A;  2FYK A;  1EFW A;  4CS4 A;  1JJC A;  4M77 A;  2E65 A;  2Q7H A;  4CH4 A;  3JCM g;  3QNE A;  3TEG A;  3HXW A;  4YRS A;  1BIB A;  1H64 1;  5GAN 6;  4KQE A;  2YLB A;  3HFO A;  4DQ2 A;  4F7U B;  4RDX A;  4C8Q E;  4TVA B;  5GAN 7;  1TH7 A;  1G51 A;  4X9D A;  4A53 A;  4C92 D;  4RCB A;  1NYR A;  3EFR A;  4HT9 A;  3HXU A;  4EMH A;  3HRK A;  4F7U G;  3MF1 A;  4CH6 A;  4P3N A;  5GAM f;  4PJO D;  4YCU A;  1H4S A;  2E64 A;  5DY9 A;  4C8Q A;  1X2G A;  3ICA A;  3EFS A;  2ZZE A;  3JCM P;  4TVA A;  4K87 A;  3JCM W;  1YGB A;  2ARS A;  4OP0 A;  4M7D F;  4Q6G A;  3HXZ A;  1D3B B;  4G85 A;  4YRJ A;  3JCM Q;  1WYD A;  4XQ3 A;  4M75 B;  3OD1 A;  2JN0 A;  4RQE A;  4P72 C;  3RKW A;  2CJB A;  4M75 E;  4TQD A;  2EL9 A;  4P3P A;  3QUI A;  3RL6 A;  1EVL A;  5GAN d;  4ZTU B;  1EIY B;  1D3B A;  1YCY A;  3V8J A;  3JCM J;  4EMK B;  4H2Y A;  3JCM f;  4M75 A;  5GAN 4;  2IY5 B;  4C92 B;  4WI1 A;  2J3M A;  4X5O A;  5LJ5 d;  3REX A;  1HXD A;  2ZR3 A;  2RHS B;  4CS2 A;  4XTW A;  4TVW A;  2DKG A;  3W3S A;  4Y91 A;  4QVC A;  4M78 D;  4C92 G;  5GAO n;  1Z7M A;  2DU5 A;  4F7U F;  5GAO p;  2ODR C;  5LJ5 j;  4PJO G;  4EMK A;  4J6X A;  2K57 A;  3A74 A;  2DU7 A;  2IY5 A;  3JCM V;  3BW1 A;  4HT8 A;  4M78 C;  1B8A A;  2ZR2 A;  1NJ5 A;  2RHS A;  3SWN B;  4G84 A;  1X2H A;  2ART A;  1Y96 B;  5GMK m;  2DEQ A;  3A7U A;  3HFZ B;  5KNN A;  2ZGW A;  2Q5H A;  3RER A;  5GMK i;  1NJ6 A;  4OLF A;  1B76 A;  4TTV A;  4TQF A;  2ZT8 A;  2ZZF A;  3JB9 J;  1YFT A;  4M77 C;  4YRC A;  3LSQ A;  2AKW A;  3QSU A;  2DZ9 A;  3NET A;  4M7D B;  4YRE A;  2ALY B;  1ATI A;  3QO3 A;  3HFZ A;  4H2V A;  4M7D E;  5LJ5 e;  2DXU A;  2VC8 A;  4YRN A;  4H2X B;  4ZIB A;  2HNI A;  4C92 F;  1NJ2 A;  4ZTZ B;  4NCX A;  5E3I A;  3HSB A;  1HK9 A;  2RA2 A;  4PJO F;  4M7D A;  1X56 A;  3M4P A;  3INZ A;  4P75 A;  1E24 A;  2ALY A;  1NYQ A;  5GAM j;  5LJ5 h;  1MGQ A;  2J3L A;  3VQV A;  4C8Q C;  4H2W A;  3IAL A;  4UP9 A;  3V8K A;  2I4M A;  4XEM A;  5F5W A;  2P0L A;  4H2T A;  4H2X A;  1ASY A;  4YPF A;  3VU3 C;  4M7A D;  3HFN A;  3ERR A;  4N0A A;  4DPG A;  2DXT A;  1N9W A;  1B70 B;  1FYF A;  3FJP A;  1NJ8 A;  2P5I A;  4M7A C;  3RAC A;  4YRP A; 
#chains in the Genus database with same CATH topology
 4F7U E;  4JLI A;  2EKH A;  3N5B B;  2V1Q A;  2BZ8 A;  8ATC B;  3CMA A;  3EHQ A;  1QF6 A;  1QVF S;  4FU6 A;  1T0J A;  4F7U A;  3A7A A;  1VQM Q;  4L5G A;  2CZ7 B;  4XTV A;  4RTU A;  3VV0 A;  5GAM e;  2VB6 A;  2KRS A;  2DQ3 A;  1N9S A;  2EGC A;  2BZX A;  1AD5 A;  1UFF A;  2FPE A;  2CRE A;  3A8H B;  1AWO A;  1M30 A;  3QO7 A;  1QE0 A;  2ZTG A;  1SSF A;  1M1K C;  5DM7 R;  5KYW A;  1A0N B;  3A5Z B;  2DRM A;  2O88 A;  4P3O A;  3WXM B;  4FIB A;  1FMK A;  4J5Y A;  3ZEH A;  1WPY A;  1JQQ A;  4E7L A;  2GFA A;  2L3S A;  4OMN A;  1UGV A;  2J6O A;  1JB0 E;  1PKS A;  3FJ5 A;  3IG2 A;  4EMG A;  3MP6 A;  4UP7 A;  2LCC A;  2XDB A;  1M3A A;  2KXC A;  5LJ5 g;  2XIC A;  4M4Z A;  4PJO B;  1ADY A;  2J05 A;  2DYI A;  2MPX C;  3HKS A;  4C5E A;  4ELZ C;  1WA7 A;  3PVQ A;  4QQ6 A;  3CPF A;  4JZ3 A;  1I5O B;  3H0H A;  1YI2 Q;  3VYG A;  1UJY A;  3O5Z A;  3RKY A;  5CKF A;  2P84 A;  4FM4 B;  5CKB A;  3J7A F;  2F2V A;  4J15 A;  3C95 A;  1WQW A;  2NUP B;  2MF2 A;  1Q95 G;  2E6Z A;  4LDU A;  2CJA A;  2BKD N;  2EGE A;  2RI3 A;  1BBU A;  2DO3 A;  3QO8 A;  2IIM A;  3G7Z A;  2DRK A;  2RM4 A;  4JRK A;  5C51 B;  2YUP A;  1R8O B;  1TUD A;  4ZN3 A;  4M7A F;  1Y96 A;  2ECZ A;  1QP2 A;  1OI1 A;  2M1H A;  2RQW A;  4F17 A;  2XTI A;  2CT3 A;  3LGL A;  2K7A A;  5GAM d;  5GAM g;  1GCQ A;  2DJQ A;  3LSS A;  2Y4X A;  2AMC B;  1NPP A;  1K73 C;  1USY C;  2EYZ A;  2HMA A;  3R6O A;  1W6X A;  4YDQ A;  1KFZ A;  3ZBD A;  1VQ5 Q;  3E9I A;  1X43 A;  3MF2 A;  4LVK A;  4D6W A;  2ARU A;  3I7F A;  5L8R E;  4HWR A;  1S72 A;  2VV5 A;  4P74 A;  2ZCE A;  1SG5 A;  1KD1 U;  3OY9 A;  3EAE A;  1VQ6 A;  2E3H A;  1S1N A;  3LWI A;  1BYM A;  1RAH B;  1VQ4 T;  3QKJ A;  3EH2 A;  4M75 D;  2K3Y A;  2KI7 A;  2R57 A;  2VGM A;  5C6S A;  2OI3 A;  3V7S A;  1TU0 B;  1I5L A;  2JVV A;  4JLG A;  5GAO l;  1B70 A;  4M75 C;  2CS7 A;  3CCR A;  2JUF A;  2K5F A;  3CPW A;  1OQK A;  4LDY A;  1N8R U;  2YHT A;  4C8Q G;  2R5A A;  4HWT A;  2OX7 A;  1MUZ A;  3A5Y A;  1XJW B;  5HGQ A;  2KSS A;  2XDP A;  2CZ0 B;  3A7R A;  2EQI A;  4CS3 A;  3SDZ A;  4P73 C;  1VQP A;  3CCE A;  2RHQ A;  4YCW A;  2DL8 A;  3OYK A;  3KXT A;  1NJI U;  5I2S A;  1QCN A;  1PC0 A;  3M9Q A;  3OS2 A;  1OPK A;  1BU1 A;  4KBM B;  3MQZ A;  3FIF A;  2LQ8 A;  5GAN 5;  1M2O A;  1X27 A;  5IHI A;  1KJW A;  1R77 A;  2YUN A;  4NOY A;  2XG8 D;  3CME Q;  1HTT A;  2CJ9 A;  3VS5 A;  1S72 T;  4VUB A;  3SWN C;  3P8T A;  3AHU A;  2AIR B;  1VQ6 T;  4KH0 B;  1Q86 U;  1NJ1 A;  2MMP A;  1X6G A;  2I2L A;  2VXE A;  3UPU A;  2L8D A;  2CZ6 B;  1SES A;  4ANJ A;  1WLE A;  4LDX A;  2I4O A;  1MV3 A;  3CEY A;  2C0I A;  1I07 A;  4C0G A;  5C0M A;  3V8L A;  4JUV A;  3VS6 A;  1JEG A;  3TEE A;  4LVM A;  3CCR T;  1Z9Q A;  2QDY B;  1D0X A;  1SPK A;  2JJ9 A;  4YRG A;  4L87 A;  3I55 A;  1FXX A;  3I35 A;  2LCS A;  5ELN A;  2ED1 A;  4J6Y A;  2RD1 A;  1QVF P;  2FZG B;  2NUP A;  3I9Q A;  3LWH A;  3A32 A;  2ED0 A;  2KAF A;  4TWA A;  1VQZ A;  1BI0 A;  2DA9 A;  1VQP T;  3CCE T;  2LNH B;  2ZT6 A;  2X9H A;  2DBM A;  5I21 A;  2KYM A;  1IZ6 A;  3CCV T;  1H4T A;  4OB0 B;  2ZCF B;  3G71 Q;  3M0S A;  2KNB B;  3JB9 H;  1J5W A;  1YNZ A;  2XHC A;  4HWO A;  2AZV A;  3EFO B;  4M77 B;  5FWC A;  3LH0 A;  1E6H A;  5CK9 A;  3CC4 Q;  3QTC A;  1B7Y A;  5C53 B;  1UDL A;  2RI2 A;  1SSH A;  4E7Z A;  2AMC A;  4X34 A;  4PJJ A;  1LNX A;  3OYY A;  4OMQ A;  2FYK A;  3TU4 K;  1MMD A;  2VGN A;  1FMW A;  3PE0 A;  3CMA Q;  4XK8 E;  3CCU Q;  4A63 B;  2QQS A;  4LE9 A;  4KH1 B;  2M02 A;  3QII A;  1AZE A;  1VQO A;  3OYJ A;  2RHX A;  1K73 R;  3I56 T;  1IGU A;  3QYH B;  4NS5 A;  2KGT A;  2X4J A;  1AVZ C;  1WXB A;  3G4S Q;  1RL2 A;  2J6F A;  3JSC A;  3HXU A;  4HT9 A;  2J6K A;  1GFC A;  4CH6 A;  2A08 A;  5GAM f;  1IHW A;  4YCU A;  1H4S A;  1DJ7 B;  4B9X A;  1VQN Q;  5DY9 A;  2DXB A;  5KYU B;  3JRZ A;  4AT1 B;  3CCQ A;  3JCM P;  1Y71 A;  1PRL C;  4Q6G A;  4M7D F;  1ZUU A;  3HXZ A;  1D3B B;  3JCM Q;  2YRC A;  2JS0 A;  2MIO A;  3MO8 A;  4XQ3 A;  1TS9 A;  1WHH A;  1D0Y A;  3R6N A;  4P72 C;  3RKW A;  2CJB A;  4M75 E;  4E47 A;  4TQD A;  4P3P A;  1EVL A;  1VQ8 A;  4ZTU B;  2O4X A;  1EIY B;  1MMG A;  2RHY A;  2FRY A;  3JAM E;  3OS0 A;  4M75 A;  4J9D A;  3PMI A;  1AWX A;  3REX A;  1HXD A;  1KD1 C;  2ZR3 A;  4TVW A;  2D8J A;  2QGG A;  2E12 A;  4C92 G;  2PZ1 A;  3VS7 A;  5GAO n;  2LQN A;  5GAO p;  2ABL A;  3PTA A;  2LC4 A;  4A4K A;  1WYX A;  4PJO G;  2K57 A;  3GBQ A;  1YBY A;  3A74 A;  2DU7 A;  2IY5 A;  1QKW A;  2W10 A;  3BW1 A;  2FG0 A;  2E5K A;  2AK5 A;  3M57 A;  2EQM A;  1XTD A;  2I0N A;  1X2H A;  1BBZ A;  5GMK m;  1N8R C;  2LRQ A;  2ZGW A;  2G6F X;  1NPR A;  2JTE A;  5GMK i;  2FHD A;  5J39 A;  3OS5 A;  3C12 A;  2SRC A;  2KY9 A;  3MET A;  1V1C A;  2ZZF A;  2L3R A;  1YFT A;  1RAB B;  3QSU A;  3QZ5 B;  5GJW B;  3NET A;  1VIE A;  1W2B S;  1ATI A;  4BDZ A;  3OYA A;  1WGS A;  4GBQ A;  1NJI C;  1M4Z A;  1JU5 C;  1S72 Q;  3UA6 A;  1AT1 B;  1IRX A;  2CYZ B;  4H2X B;  4YRN A;  2HEQ A;  4O6J A;  1GCP A;  4IUR A;  5FRN A;  4NCX A;  2EBP A;  3OW2 S;  2AKL A;  1VQL A;  3VQV A;  4C8Q C;  1Q86 C;  2FRW A;  1R0C B;  3EFO A;  4J7F A;  2I4M A;  2YUO A;  2K2V A;  2P4R A;  1VQ5 A;  2P0L A;  2JNG A;  4M7A D;  2RQR A;  3GLX A;  2YXY A;  2LX7 A;  3FJP A;  2A3L A;  5HK3 A;  1VQ7 Q;  2DAQ A;  1NJ8 A;  4M7A C;  5CKE A;  1H3Z A;  2KBT A;  4J8O A;  4E6R A;  3VUZ A;  1U3O A;  5D6W A;  4BI4 A;  2R58 A;  4YRF A;  2LVM A;  4K86 A;  1N9R A;  1UG1 A;  2D8H A;  2PUO B;  3IKL A;  1RI9 A;  1PHT A;  2BIV A;  5KYW B;  3OYN A;  2ZPI B;  2YDL A;  1E6G A;  5GAN 8;  4HCB A;  1KC8 U;  4QQG A;  5CO7 A;  1VQK A;  3HTZ A;  3OSS C;  1QWF A;  1K4U S;  4PLL A;  5EG2 A;  5L23 A;  4H02 A;  3VQX A;  5KYU A;  4EMK C;  5GAO m;  12AS A;  1P92 A;  1EVK A;  1OX8 A;  1OPL A;  3OYF A;  1FWZ A;  2ZT5 A;  2A36 A;  2P0P A;  4E51 A;  2V1R A;  3ULR B;  3OYG A;  5LJ3 j;  4KUI A;  1WHL A;  1VQ5 T;  4LDW A;  3HPW A;  1HJD A;  2O31 A;  3S3M A;  3NPF A;  1EIY A;  2D0N A;  1SET A;  5IN1 A;  4J9C A;  1YHQ Q;  4EO4 A;  3MP8 A;  2OAW A;  2ZZG A;  4YCV A;  1PD1 A;  3C94 A;  3SFM A;  4KRT A;  1B7T A;  2JTF A;  3HY0 A;  1C1A A;  3I55 Q;  1M1G A;  1U06 A;  2FO0 A;  3DLM A;  4IUQ A;  5KYX B;  3UF4 A;  2K6D A;  4NL3 A;  3NEN A;  3CBO A;  2HDA A;  2XID A;  3VS1 A;  2X35 A;  1YJN A;  3ASK A;  1BI2 A;  4WCI A;  4P72 A;  3M56 A;  3OB9 A;  3JB9 G;  1J3T A;  3ER0 A;  5GMK e;  3VQW A;  2QXF A;  1KD1 R;  3VRY A;  2EYW A;  5KCH A;  1PRM C;  1B34 B;  1IHV A;  2ZIN A;  4RTZ A;  4WJ4 A;  1Q81 R;  2G3R A;  4YRM A;  4N4I A;  1GGM A;  4N0A C;  5LJ3 h;  4PFZ A;  1QVF A;  4M78 G;  2L5Q A;  3H9N A;  3L2Q A;  1BCM A;  4KUL A;  3JCM b;  1N8R R;  4BI8 B;  1WQ7 A;  2Q7E A;  3E1S A;  2EPD A;  1GFD A;  1XOV A;  3G71 A;  2NLU A;  4MML A;  4K11 A;  4QW2 A;  2RJF A;  4KUD K;  1JJC B;  1K8A R;  1BI3 A;  2CUB A;  1VQO Q;  2EQU A;  1KMM A;  1Y0M A;  2QI2 A;  3CME T;  4P71 C;  2CP6 A;  2K3X A;  3CC4 A;  4RTT A;  3HXX A;  4M77 G;  2HKQ B;  4LNS A;  2KRM A;  4MZP A;  4ELY C;  5K1X A;  3WQZ A;  1JXO A;  1YIT A;  2M0Y A;  3MEU A;  1IB8 A;  3JCM d;  2J7I A;  1YP5 A;  2FB7 A;  2WSE E;  2CGH A;  1G5I A;  3TUP A;  2RH2 A;  1X69 A;  3CCQ Q;  3CCU A;  3OYM A;  1NLP C;  2OAU A;  3FB9 A;  1PYS A;  1KQS S;  3C4S A;  4IKF A;  1ADJ A;  2HL3 A;  5IHN A;  2DTO A;  3A8M B;  9ATC B;  3CD6 A;  4JS4 A;  2RHQ B;  1ZSZ C;  2GCX A;  4RCC A;  3NTI A;  1KOG A;  4MZT A;  3G4S A;  2KT1 A;  3M0Q A;  3HRI A;  1VQ8 Q;  2YRD A;  1R0B G;  3RDV A;  1BB9 A;  1MMA A;  4C92 C;  1VQN A;  2EJF A;  4M7A E;  3QJ6 A;  3HFV A;  2LJ3 A;  4PJO C;  1W2B P;  1Z9Z A;  5FU7 C;  3X20 B;  4HCC A;  1TOV A;  1AWJ A;  2FL7 A;  1X55 A;  2EJG A;  3G71 T;  1GBR A;  4RQF A;  1WJR A;  2MWP A;  4M7A A;  4X1V A;  1BCO A;  1CKB A;  2CT4 A;  5GMK l;  5A0L A;  2O2O A;  3LGF A;  3OW2 P;  3CC4 T;  3M0R A;  2D6F A;  1C0A A;  2E1H A;  2EYY A;  5KE3 A;  1X54 A;  2B8A A;  1RIQ A;  1I1J A;  2NUT A;  2EJ9 A;  4FT4 A;  3MKD A;  1UB4 A;  3O8V A;  4IUT A;  2F5K A;  4M7D D;  2QGF B;  1ASZ A;  4OGE A;  2AHJ B;  3NEL A;  1SHG A;  4C8Q F;  5GAO q;  4LVL A;  3S6W A;  3FRN A;  3WVD B;  3CMA T;  1WHK A;  3CCU T;  4UPA A;  3AT1 B;  2ZXF A;  4FSS A;  1Q82 U;  4M7D C;  1H4V B;  4B9W A;  4ZTF A;  2YLC A;  4RTX A;  4OMP A;  3P8Y A;  5KYX A;  3UAT A;  2QTV A;  2I4L A;  1W70 A;  3G4S T;  2JW4 A;  2PVG B;  4HVC A;  3REU A;  2KRN A;  2M16 A;  4HWS A;  1ZHI A;  3OYH A;  3PT9 A;  4FYX B;  3M0T A;  1KC8 C;  1YFR A;  2ZIO A;  1VQN T;  4TVY A;  1RAE B;  2LQK A;  2LT1 A;  1OU8 A;  1ZLM A;  1RLQ C;  3MEA A;  4PJM A;  4XU3 A;  4CC3 A;  1B7Y B;  1YJ9 Q;  5GAN e;  4D8D A;  1B34 A;  1VQL Q;  2E3C A;  3VUB A;  3RNJ A;  3UGQ A;  2LJ0 A;  2XGT A;  1M90 U;  3TRE A;  1UJ0 A;  4FT2 A;  2K5I A;  5D6Y A;  4Q15 A;  3LLR A;  2A28 A;  4OF1 A;  3EHR A;  3M5A A;  4XTY A;  4HVW A;  3DKM A;  2KK4 A;  5FU6 C;  2JTM A;  4LUD A;  3CXC S;  4MZM A;  3BY7 A;  5CQX A;  2D0Q B;  2K3B A;  3QBY A;  1KMN A;  2D1X A;  2GFU A;  4FYW B;  1EFW A;  1JJC A;  2MYS A;  1K9M U;  3GNG A;  1X75 C;  3QNE A;  3REB B;  3VJP A;  1RAG B;  3TVT A;  4YRS A;  4P5N A;  1GL5 A;  4HXJ A;  5GAN 6;  3HHT B;  1CKA A;  4BUG A;  1UGR B;  2FZC B;  2YLB A;  3HFO A;  3HRT A;  4RDX A;  2B86 A;  3RMQ A;  2K79 A;  4CC4 B;  1G3S A;  1QP3 A;  2F5T X;  4X9D A;  4A53 A;  3G6E Q;  1VQ7 A;  1VQK Q;  4RCB A;  1NYR A;  3VYH B;  4EMH A;  4F7U G;  2RPN A;  3ZFJ A;  2H3J A;  2E64 A;  2ZPG B;  2WSC E;  1X2G A;  1H92 A;  3CCM Q;  2P4T A;  1QLY A;  3NHN A;  3OYC A;  2O4X B;  4TVA A;  4K87 A;  3JCM W;  2VYT A;  1YGB A;  2KYB A;  3M58 A;  2ARS A;  1UGQ B;  4YRJ A;  4F14 A;  4PL6 A;  2FVU A;  3M4Y A;  1GBQ A;  4M75 B;  2HD0 A;  2JN0 A;  2GQI A;  2E70 A;  4RQE A;  2WSF E;  4PFO A;  2JXB A;  2KXD A;  2RI5 A;  2EL9 A;  1QMC A;  1QQJ A;  3NTK A;  2L0A A;  1ZA1 B;  2RJC A;  5GAN d;  2YSQ A;  4HVV A;  4A4F A;  4AFZ C;  2KQW A;  1YCY A;  2EIF A;  2XI9 A;  1TUG B;  4H2Y A;  3JCM f;  5GAN 4;  2IY5 B;  3URG A;  2DD4 A;  2J3M A;  4X5O A;  1M1K R;  1OOT A;  1ZSZ A;  4KT0 E;  5I2M A;  2DKG A;  2HSP A;  4Z88 A;  2KE9 A;  1O75 A;  4Y91 A;  4QVC A;  2MOX A;  1YJN Q;  4M78 D;  4E7K A;  1NEB A;  1Z7M A;  4L59 A;  2ODR C;  5LJ5 j;  2YWW A;  3CPW S;  1T3L A;  1YHQ A;  3EG3 A;  4HT8 A;  4M78 C;  2PQW A;  3HRS A;  1B8A A;  1NJ5 A;  1VQ7 T;  5HY6 A;  3SWN B;  4DOV A;  4N4G A;  4RTY A;  1TSF A;  3H6Z A;  3QZ9 B;  1KQS P;  2QK0 A;  2XKO C;  3A7U A;  1NBE B;  3RER A;  5IHK A;  4LD6 A;  2RQU A;  2IG0 A;  1UHF A;  2L3Q A;  2JT4 A;  4TQF A;  3JB9 J;  4M77 C;  2RHI A;  3L2R A;  4CC7 A;  3HFZ A;  1SRL A;  4DBH A;  4LNP A;  4WTO B;  3TSW A;  4M7D E;  1RLP C;  1VYV A;  2DX1 A;  1ACM B;  1FX7 A;  1ZUK A;  4ZTJ A;  1M3B A;  2VC8 A;  4OVA A;  2HNI A;  4MDX A;  4C92 F;  1NJ2 A;  2KVQ G;  3EG9 A;  3E9F A;  3HSB A;  1YIT Q;  2RA2 A;  3PNW C;  4PJO F;  4C5I A;  4M7D A;  3M4P A;  3X26 B;  3H0F A;  4E7H A;  5GAM j;  5LJ5 h;  1HYO A;  2ROL A;  1KC8 R;  1XQH A;  4FW2 A;  3V8K A;  1ZUY A;  2JMA A;  4H2T A;  1KHC A;  1TXQ A;  4LUE A;  3HFN A;  3T9N A;  2P0Q A;  2K2M A;  3CD6 Q;  1YHQ T;  2CDT A;  1YWP A;  1VQ9 Q;  2O9V A;  2P5I A;  2VKN A;  2PNI A;  1Q82 C;  3MCA B;  4YRP A;  3I55 T;  2MK5 A;  4C0D C;  2HQH A;  2COY A;  2RQV A;  1USY A;  1QCO A;  3MP1 A;  2V8I A;  4RUG A;  5GJV B;  4KR3 A;  4ME7 A;  4MDW A;  2DF6 A;  3G1Z A;  2LDM A;  3PGG A;  2D9T A;  3A1P A;  2E4H A;  2QG9 B;  5IT9 E;  4CH3 A;  1NNH A;  1PSF A;  2HCK A;  4YP0 A;  4OMF B;  4ZGJ B;  4BB7 A;  2GQV A;  1KK7 A;  2LQW A;  3UDC A;  4AFQ C;  1IL2 A;  1GRI A;  5GAM h;  5LJ3 d;  4AH6 A;  3KFU A;  1SRY A;  3TCJ A;  1M90 C;  3JCM c;  1VA7 A;  5C52 B;  2FPD A;  4B6M A;  4ATO A;  1IGQ A;  4OB1 B;  4PKC C;  1W2B A;  5IH2 A;  3M4G A;  1PSE A;  4E2F B;  3CCJ A;  3CXC P;  1OX9 A;  5ELO A;  3OMG A;  2I4N A;  4FW1 A;  1VQO T;  2HBW A;  3V7R A;  4CC2 A;  3LX7 A;  1K9M C;  4JRI A;  3VS4 A;  4A4H A;  3RUX A;  3QO5 A;  3CMQ A;  1M9S A;  1VUB A;  1YIJ A;  3M4Q A;  1WXU A;  2AZS A;  4R0K A;  3OW2 A;  4P73 A;  4BW9 A;  3QXE B;  4HCZ A;  3TEH A;  2JM8 A;  1I0C A;  2DM1 A;  1OU9 A;  4JDS A;  4BE1 A;  1C6V X;  2ATC B;  2PU9 B;  5CR2 A;  4KGX B;  1U1T A;  3HL8 A;  4J9F A;  1EQR A;  3QJY A;  4X9C A;  3Q1J A;  3DSQ A;  3CCQ T;  4PNO A;  4J83 A;  4P75 C;  4JJD A;  4YYE A;  1U5S A;  3SWN A;  4TVR A;  2DK3 A;  2V8J A;  4RMF A;  1T3S A;  2RNA A;  4OML A;  3P8V A;  2DDZ A;  3QG1 A;  5GAN f;  1K1Z A;  3OSV A;  3H0I A;  2HAX A;  2BUD A;  1KQ2 A;  1JJ2 S;  1LOJ A;  1E22 A;  1VQ8 T;  2M0O A;  4M78 E;  2QHT A;  3RGL A;  1H8K A;  1NYG A;  4C8Q D;  3EGU A;  5AYF A;  3H41 A;  1LYL A;  1YJ9 A;  4FYY B;  3E2U A;  4EIK A;  1W1F A;  3DB3 A;  4A4E A;  2VXF A;  3CCJ T;  3WVE B;  4DEX A;  3MEY A;  2CP2 A;  4BE2 A;  2JS2 A;  1WX6 A;  1MMN A;  2GGR A;  4XU0 A;  3M59 A;  1PYS B;  4II1 A;  3JB9 F;  4ZGD B;  2CIM A;  4D8K A;  3UT1 A;  1JXM A;  4WJ3 M;  2A7Y A;  2KDS A;  2CH4 A;  4E7I A;  3JCM X;  3VS0 A;  5EC7 A;  1YFN A;  5J3B A;  4C8Q B;  2RQT A;  3UWN A;  3ZL7 C;  5HCK A;  4XEO A;  1M8V A;  4M78 F;  4HWP A;  4XTU A;  3G6E A;  3BJU A;  1RAI B;  1G3T A;  3L2Z A;  2VVK A;  2QEX Q;  2ZNJ A;  4M7A B;  5KYY B;  2XD0 A;  4PG3 A;  4YRK A;  4PHC A;  3GPL A;  3CCM A;  1YJW A;  3GOX A;  3L2W A;  3QDR B;  1G3W A;  1ABQ A;  1YJ9 T;  2EAY A;  1VQL T;  4M77 F;  2NUT B;  2Q7G A;  2RF0 A;  1MHN A;  4DOW A;  3CBM A;  4DBQ A;  4YRT A;  4LVI A;  4M75 G;  2PMF A;  3JCM e;  3R07 A;  2DVE A;  1W4S A;  4C0F A;  3IKM B;  4YRR A;  5CVI A;  1G5H A;  3DB4 A;  2GTJ A;  4Y92 A;  2XU8 A;  4J9I A;  3CCS Q;  2A8E A;  4QQD A;  3CQT A;  3JV3 A;  1WJS A;  3HRU A;  2JZ2 A;  2W0Z A;  3RR6 A;  1OEB A;  1BKB A;  5KCO A;  1UTI A;  4IIM A;  4V2S A;  2VAS A;  2X4Y A;  3L1A A;  3OBY A;  4JJC A;  3M0U A;  3OYE A;  2CP0 A;  2RJE A;  3G6E T;  1VQK T;  2AKW B;  3RKX A;  2H3E B;  3GF5 A;  4P74 C;  4UP8 A;  5LJ3 f;  1K9M R;  3VKI A;  1KHI A;  3LC0 A;  1WNL A;  3CCM T;  1YJW T;  1QVG S;  2DNU A;  2EW3 A;  3VS3 A;  1KQS A;  4H2S A;  3L4G A;  3I5S A;  4BY6 B;  4DEY A;  1G83 A;  5KE2 A;  1W66 A;  1MV0 B;  3RIR A;  4OMO A;  1WJQ A;  1RAF B;  3NMZ C;  4XU2 A;  2DQ0 A;  4HA8 A;  5IXF A;  2E10 A;  2NS6 A;  1PG5 B;  4XTZ A;  4OB3 B;  1UEB A;  2DTI A;  2RB6 A;  1WLP B;  4JS5 A;  3BDU A;  3QDF A;  2LJ1 A;  2QA4 Q;  1ZA2 B;  2ZT7 A;  2JOY A;  1Q7Y U;  2EYQ A;  4AFS C;  2CH4 W;  2E3I A;  3EG2 A;  2L3P A;  1NJI R;  1VYU A;  3QWY A;  2RJD A;  2X51 A;  3JCM g;  1YJN T;  2BTT A;  4YTL A;  3HXW A;  1U8R A;  2XMF A;  1BIB A;  1H64 1;  4FSX A;  4DQ2 A;  1Q86 R;  3M53 A;  4C8Q E;  4TVA B;  2YT6 A;  1G8X A;  4PJN A;  1TH7 A;  4N4H A;  1VQ9 A;  4C92 D;  2COW A;  1Y7X A;  1TWB A;  3OBW A;  2X4W A;  4P3N A;  4PLI A;  5CQY A;  4F04 B;  4PJO D;  3MEW A;  2QQA A;  2FPF A;  4PJL A;  2FZK B;  4C8Q A;  3ICA A;  1YN8 A;  5CCA A;  2XDD A;  3FLG A;  1OZ3 A;  3EFS A;  2ZZE A;  3MHX A;  1SKU B;  1D1B A;  2DXC A;  4OP0 A;  4Z89 A;  3FEO A;  1M2V B;  3EGD B;  2IPO B;  3E19 A;  1WYD A;  1JJ2 P;  3OD1 A;  2CP5 A;  2ESW A;  3CCJ Q;  5KYY A;  2DPP B;  1V76 A;  1ZSZ B;  3OA6 A;  3PMT A;  2QDL A;  3UA7 A;  4DBF A;  1TG0 A;  3SHW A;  3V8J A;  1YIJ Q;  5KH6 A;  2HQX A;  4C92 B;  1YIT T;  2CSQ A;  2DIG A;  4WI1 A;  2L2P A;  5LJ5 d;  4XAX B;  4CS2 A;  1VYT A;  4GLK A;  5FLX E;  4JJN K;  4RMO A;  3W3S A;  4BD3 A;  1ZX6 A;  5FU7 B;  2DU5 A;  4F7U F;  1WXT A;  4QT7 A;  2X3X D;  4OB2 B;  3I5R A;  2NYS A;  3GP8 A;  4EMK A;  2WAC A;  2OJ2 A;  3CD6 T;  3JCM V;  3CXC A;  1PD0 A;  2R5M A;  2ZR2 A;  4JRP A;  1VQ9 T;  2RHS A;  1VQ4 A;  2BE9 B;  2QAZ A;  2IVW A;  2DVJ A;  8AT1 B;  3HFZ B;  1WFW A;  2A0F B;  2MCN A;  2Q5H A;  1NJ6 A;  1V29 B;  1B76 A;  2FEI A;  4TTV A;  2MAM A;  3NGP A;  2ZT8 A;  1FYN A;  2DL4 A;  4YRC A;  1LPL A;  3EG9 B;  2AKW A;  3LSQ A;  2JM9 A;  3EG1 A;  2X3W D;  2DMO A;  1OV3 A;  3L2V A;  2DET A;  3RBB B;  7AT1 B;  4M7D B;  4IUV A;  1NZ9 A;  1N5Z A;  1ZQ1 A;  3HTR A;  1HD3 A;  4E7S A;  4OGC A;  2HQE A;  3BDL A;  2AT1 B;  3FDR A;  4ZIB A;  4BE0 A;  3BE3 A;  4ZTZ B;  2PVD B;  1NYF A;  3J81 E;  1RUW A;  1E24 A;  2ALY A;  2HZY A;  1NYQ A;  3OYB A;  2J3L A;  4H2W A;  4UP9 A;  4XEM A;  2KMT A;  3J80 E;  2K4Y A;  5F5W A;  1ASY A;  2CUD A;  4YPF A;  5J26 A;  4BI3 A;  4BDY A;  2C0T A;  4N0A A;  4DPG A;  2DXT A;  3CC2 T;  1N9W A;  1LVK A;  1D0Z A;  2CZ1 B;  2K9G A;  2VUB A;  5LL6 S;  4EDU A;  1FYF A;  4Z8A A;  2OTL A;  5CIU A;  2DLP A;  1KG1 A;  4L6V 5;  2RO0 A;  1Q81 U;  1PNJ A;  1EIF A;  5FU6 B;  1L0W A;  5I11 A;  1I4K 1;  3VS2 A;  3PZC A;  3FC3 A;  1OZ2 A;  2C7I A;  3PIO A;  1YJW Q;  4J9E A;  4JPB W;  4C5G A;  1KQ1 A;  4ZN1 A;  4H2U A;  4P71 A;  4FCY A;  2V8K A;  4XU1 A;  1EOV A;  1BBW A;  1SRM A;  1WHM A;  1WU7 A;  4K88 A;  1K8A U;  1QVG P;  2OTJ Q;  1RAD B;  3JB9 D;  4O2D A;  2QEX A;  1X01 A;  2RHZ A;  1E1O A;  1B3Q A;  4EPC A;  5GAN g;  1M2V A;  3EGD A;  2GF7 A;  2Q5I A;  1X2K A;  5GMK j;  1BI1 A;  1TUC A;  2DE0 X;  4M7A G;  3SB2 A;  4WF2 A;  1I81 A;  2E41 A;  4O5V A;  3CCV A;  2LNV A;  3JB9 I;  3CC7 Q;  2QQB A;  2ODR D;  3TEH B;  4C92 E;  1QVP A;  1FMV A;  1Q7Y C;  4C0Z A;  3F70 A;  3A5Z A;  1ZBJ A;  4PJO E;  1U1S A;  4J6W A;  4DA4 A;  3LW5 E;  2OTL T;  3RF1 A;  1M3C A;  2M9U A;  3P8D A;  5IAY A;  4C92 A;  4Z02 A;  3CC2 Q;  2EVR A;  4PJO A;  3JCM h;  3PCO B;  3CCS A;  11AS A;  2DL3 A;  3UGT A;  2ZZD A;  2GTO A;  4M77 D;  2AKK A;  3X25 B;  1ABO A;  2DL7 A;  2EWN A;  5CAI A;  1YB3 A;  3GIB A;  2PUK B;  3A8O B;  4CRI A;  3I56 A;  3A31 A;  1M5Q 1;  4JRQ A;  2C8M A;  4FL6 A;  5LJ3 e;  3DLL A;  2PME A;  4RTV A;  1QWE A;  1YCS B;  4QKU A;  5DLQ E;  1NLO C;  4M78 B;  2CKK A;  5GMK h;  2EQK A;  2Y90 A;  2QEX T;  3UH0 A;  1VIF A;  1SF9 A;  3BFM A;  1C0M A;  2RMO A;  2LCL A;  4EX5 A;  5GAO r;  4CH5 A;  3CCL A;  1PCX A;  3SD4 A;  5LJ5 f;  1WDX A;  2QTX A;  3PIP A;  2HL5 C;  4YRO A;  3HP9 A;  5ECA A;  4YRL A;  1OYX A;  3NTH A;  2ROT A;  3EG0 A;  3E9G A;  4A4G A;  2RK2 A;  2YUQ A;  1G3Y A;  2QHV A;  2ZPF B;  5CKH A;  4AMC A;  1CSK A;  3H8Z A;  4HT4 A;  2DIQ A;  1M1F A;  1H4Q A;  2EFI A;  3X24 B;  5I22 A;  2ZNI A;  2QA4 A;  3VQY A;  2MWO A;  2J06 A;  4JJB A;  3RES A;  1UE9 A;  3NEM A;  1G5V A;  3CCS T;  2A37 A;  3KFV A;  4BAC A;  1UHC A;  2G4C A;  4KGZ B;  5HKC A;  3P8B B;  4ZNX A;  1D09 B;  1GXI E;  3V7C A;  2DER A;  2X4X A;  5FWB A;  4Y28 E;  3EH1 A;  2DZC A;  3VBB A;  2DTH A;  1NM7 A;  2QHS A;  3HXV A;  3LYI A;  2JMC A;  1WZO A;  2F1L A;  4C0D B;  1SER A;  3CCL T;  5LJ3 g;  4MMK A;  4BWA A;  1Y07 A;  1VQM A;  2L89 A;  2E6N A;  2SEM A;  1QCF A;  2ZPB B;  3HY1 A;  3RMS A;  4RG8 A;  1RAC B;  3QHS A;  4LD9 K;  3A98 A;  2EYX A;  4KGV B;  5A0G A;  4YRQ A;  1AWW A;  3E9H A;  2DD5 A;  2V26 A;  1WI7 A;  4LVJ A;  1JJ2 A;  5AT1 B;  1YFS A;  1D1A A;  2COZ A;  5GAN 2;  4QVD A;  1AHJ B;  1I8F A;  1N6A A;  2KRO A;  5FRM A;  2QA4 T;  2Z0W A;  1VQ4 Q;  2QQ9 A;  2P0K A;  2DJZ A;  5GAN j;  3HXY A;  1BIA A;  3U23 A;  3LH5 A;  4CI0 C;  4ESR A;  2CSI A;  5GAN 3;  2BZY A;  4XTX A;  4HKE A;  1BK2 A;  1Q81 C;  2ZPE B;  1X6B A;  5A0D A;  1UUE A;  1HC7 A;  3EGX B;  2K5L A;  4AG1 C;  1YI2 A;  3L4G B;  2HBP A;  3S3O A;  1EZZ B;  4QVZ A;  4DBR A;  1Q7Y R;  3PCO A;  2F2W A;  3A8L B;  1M8M A;  2PTK A;  5K1P A;  1E7O A;  5FW9 A;  2Y4Y A;  4A54 A;  1Z7N A;  2EGA A;  1LJO A;  2KEA A;  2ZIM A;  1ZBX A;  1MNE A;  1K8A C;  4M75 F;  3PVL A;  4NL2 A;  1VQM T;  4OMM A;  2E5A A;  1AEY A;  4YRI A;  1M1K U;  2NWM A;  2RN8 A;  1IRE B;  3UFG A;  1JRI A;  4M78 A;  1E1T A;  4C5H A;  3OYL A;  3VRZ A;  1H3H A;  3MEV A;  2DBK A;  1SEM A;  1PKT A;  3P8H A;  1OUL A;  1T0H A;  5GAN h;  4M7D G;  4RG2 A;  4M77 E;  1VQ6 Q;  2E5Q A;  2DL5 A;  1RI0 A;  2CP3 A;  2OTL Q;  4KR2 A;  4Q5W A;  2DEU A;  3L42 A;  2DYB A;  1JBM A;  1YIJ T;  5A2Q E;  1AZG B;  2QHU A;  4RKU E;  2GNC A;  2VWF A;  1IO6 A;  1NEG A;  2KT8 A;  3OYD A;  4CS4 A;  4M77 A;  2E65 A;  2Q7H A;  4CH4 A;  3SEM A;  1X6O A;  4F16 A;  1EFN A;  5IXB A;  3CPW P;  3TEG A;  2DIL A;  3CCR Q;  2ZPH B;  2LMJ A;  3L2U A;  1IXD A;  1RAA B;  4JZ4 A;  1LCK A;  2HSE B;  3KUF A;  4KQE A;  4F7U B;  1YI2 T;  3M54 A;  3X28 B;  5GAN 7;  1G51 A;  4E7J A;  4PFP A;  3EFR A;  2QQR A;  1ARK A;  3HRK A;  3MF1 A;  1D1C A;  3ME9 A;  1NG2 A;  1EX4 A;  2O9S A;  4J9G A;  1K0X A;  3D7S B;  2BE7 D;  1VQP Q;  3CCE Q;  3MPU B;  3MJX A;  2LT4 A;  4J9H A;  1Q82 R;  3S3N A;  3CCV Q;  4HVU A;  3NFC A;  4G85 A;  4HCK A;  2XK0 A;  3TQ7 P;  2PVO B;  3QWX X;  4IUU A;  5DLO A;  5D7U A;  1ZSG A;  5M9O A;  3OQ5 A;  5FRO A;  4LXC A;  2ENM A;  2DFU A;  4J7I A;  2LTO A;  1K9A A;  3QUI A;  2OTJ A;  3RL6 A;  1K73 U;  4J9B A;  1O9S A;  1QVG A;  1D3B A;  1JO8 A;  1MND A;  3JCM J;  4EMK B;  2HKN A;  1PM3 A;  3OYI A;  1AOJ A;  3G1J A;  1UGP B;  2RHS B;  1WIE A;  3CC7 A;  1X2Q A;  4XTW A;  1N27 A;  3C0C A;  1M90 R;  1GCQ C;  4R55 A;  1SHF A;  3CME A;  1UEC A;  5KYN A;  3I56 Q;  1XNI A;  2F69 A;  4J6X A;  3TSZ A;  3M0P A;  5D6X A;  2YRV A;  2EKO A;  3IQL A;  1M27 C;  1K0S A;  4ZGE B;  2LZ6 B;  1Y57 A;  3CC2 A;  4G84 A;  3KBG A;  2H8H A;  3A8G B;  4IIO A;  3PFS A;  4RTW A;  4R56 A;  1TTH B;  2ART A;  1Y96 B;  1K76 A;  2DEQ A;  4BY6 C;  5KNN A;  1QW1 A;  3QPH A;  2EQJ A;  2QYZ A;  1B07 A;  2LX9 A;  4LN2 A;  3M55 A;  3CCL Q;  3OS1 A;  4OLF A;  1UGS B;  3EGX A;  1G2B A;  2NUZ A;  2KR3 A;  4PK4 A;  6AT1 B;  1VOM A;  2RHU A;  1KIK A;  1WHJ A;  2C0O A;  1KSW A;  2DZ9 A;  2O01 E;  4YRE A;  2MI6 A;  2ALY B;  3QO3 A;  2F2X A;  3GNF B;  4AFU C;  2ZAE A;  4H2V A;  1YWO A;  2C06 A;  2OTJ T;  2M51 A;  2QAS A;  4IUP A;  5HK0 A;  5LJ5 e;  2DXU A;  4GY5 A;  1NE8 A;  3CBP A;  4GLM A;  4UC4 A;  5E3I A;  1HK9 A;  1X56 A;  2RK1 A;  4P75 A;  3INZ A;  4ORZ A;  1MGQ A;  4LDV A;  3CC7 T;  3QYG B;  2LP5 A;  3REA B;  3IAL A;  1F1B B;  2CP7 A;  1PWT A;  4AG2 C;  4H2X A;  1HSQ A;  3VU3 C;  3ERR A;  1QKX A;  3THK A;  1B70 B;  4FYV B;  1WHG A;  3RAC A;  2GBQ A;  5CKD A;  3OMC A; 
#chains in the Genus database with same CATH homology
 4F7U E;  4JLI A;  3N5B B;  3CMA A;  1QF6 A;  1QVF S;  4FU6 A;  3A7A A;  4F7U A;  4L5G A;  2CZ7 B;  4XTV A;  3VV0 A;  5GAM e;  2DQ3 A;  1N9S A;  3A8H B;  3QO7 A;  1QE0 A;  2ZTG A;  1SSF A;  1M1K C;  5DM7 R;  3A5Z B;  4P3O A;  3WXM B;  4FIB A;  4J5Y A;  3ZEH A;  1WPY A;  4E7L A;  2GFA A;  1JB0 E;  3IG2 A;  4EMG A;  3MP6 A;  4UP7 A;  2LCC A;  2XDB A;  4PJO B;  5LJ5 g;  2XIC A;  1ADY A;  3HKS A;  4C5E A;  4ELZ C;  4QQ6 A;  3CPF A;  3VYG A;  3RKY A;  5CKF A;  4FM4 B;  5CKB A;  3J7A F;  4J15 A;  3C95 A;  1WQW A;  2MF2 A;  2E6Z A;  4LDU A;  2CJA A;  2BKD N;  2RI3 A;  1BBU A;  2DO3 A;  3QO8 A;  3G7Z A;  2RM4 A;  4JRK A;  5C51 B;  1R8O B;  4ZN3 A;  4M7A F;  1Y96 A;  1QP2 A;  1OI1 A;  2M1H A;  2XTI A;  3LGL A;  5GAM d;  5GAM g;  3LSS A;  2Y4X A;  2AMC B;  1NPP A;  1K73 C;  1USY C;  4YDQ A;  3R6O A;  3ZBD A;  3E9I A;  3MF2 A;  4LVK A;  4D6W A;  2ARU A;  3I7F A;  5L8R E;  4HWR A;  1S72 A;  2VV5 A;  4P74 A;  2ZCE A;  1KD1 U;  3OY9 A;  3EAE A;  1VQ6 A;  3LWI A;  1BYM A;  1VQ4 T;  3QKJ A;  4M75 D;  2K3Y A;  2R57 A;  2VGM A;  5C6S A;  3V7S A;  1I5L A;  2JVV A;  4JLG A;  5GAO l;  1B70 A;  4M75 C;  2CS7 A;  3CCR A;  2JUF A;  2K5F A;  3CPW A;  4LDY A;  1N8R U;  2YHT A;  4C8Q G;  2R5A A;  4HWT A;  3A5Y A;  5HGQ A;  2KSS A;  2XDP A;  2CZ0 B;  3A7R A;  4CS3 A;  3SDZ A;  4P73 C;  1VQP A;  3CCE A;  2RHQ A;  4YCW A;  3OYK A;  3KXT A;  1NJI U;  5I2S A;  3M9Q A;  3OS2 A;  4KBM B;  3MQZ A;  3FIF A;  2LQ8 A;  5GAN 5;  4NOY A;  2XG8 D;  1HTT A;  2CJ9 A;  1S72 T;  4VUB A;  3SWN C;  3P8T A;  3AHU A;  1VQ6 T;  1Q86 U;  1NJ1 A;  2MMP A;  2I2L A;  2VXE A;  3UPU A;  2L8D A;  2CZ6 B;  1SES A;  1WLE A;  4LDX A;  2I4O A;  3CEY A;  4C0G A;  5C0M A;  3V8L A;  4JUV A;  3TEE A;  4LVM A;  3CCR T;  2QDY B;  4YRG A;  4L87 A;  3I55 A;  1FXX A;  5ELN A;  4J6Y A;  2RD1 A;  3LWH A;  3A32 A;  2KAF A;  4TWA A;  1VQZ A;  1BI0 A;  1VQP T;  3CCE T;  2ZT6 A;  5I21 A;  1IZ6 A;  3CCV T;  1H4T A;  4OB0 B;  2ZCF B;  3JB9 H;  1J5W A;  2XHC A;  4HWO A;  4M77 B;  3LH0 A;  5CK9 A;  3QTC A;  1B7Y A;  5C53 B;  2RI2 A;  2AMC A;  4X34 A;  1LNX A;  3OYY A;  2FYK A;  3TU4 K;  2VGN A;  4XK8 E;  2QQS A;  3QII A;  1VQO A;  3OYJ A;  2RHX A;  3I56 T;  3QYH B;  4NS5 A;  2X4J A;  1RL2 A;  3JSC A;  3HXU A;  4HT9 A;  4CH6 A;  5GAM f;  4YCU A;  1H4S A;  1DJ7 B;  4B9X A;  5DY9 A;  2DXB A;  3JRZ A;  3CCQ A;  3JCM P;  1Y71 A;  4Q6G A;  4M7D F;  3HXZ A;  1D3B B;  3JCM Q;  3MO8 A;  4XQ3 A;  4P72 C;  3RKW A;  2CJB A;  4M75 E;  4E47 A;  4TQD A;  4P3P A;  1EVL A;  1VQ8 A;  4ZTU B;  2O4X A;  1EIY B;  2RHY A;  3JAM E;  3OS0 A;  4M75 A;  3PMI A;  3REX A;  1HXD A;  1KD1 C;  2ZR3 A;  4TVW A;  2E12 A;  4C92 G;  5GAO n;  5GAO p;  3PTA A;  2LC4 A;  4A4K A;  4PJO G;  2K57 A;  3A74 A;  1YBY A;  2DU7 A;  2IY5 A;  3BW1 A;  3M57 A;  2EQM A;  1XTD A;  1X2H A;  5GMK m;  1N8R C;  2LRQ A;  2ZGW A;  1NPR A;  5GMK i;  2FHD A;  5J39 A;  3OS5 A;  3C12 A;  2KY9 A;  3MET A;  2ZZF A;  2L3R A;  1YFT A;  3QSU A;  3QZ5 B;  3NET A;  1VIE A;  1W2B S;  1ATI A;  4BDZ A;  3OYA A;  1WGS A;  1NJI C;  1M4Z A;  2CYZ B;  4H2X B;  4YRN A;  4O6J A;  4IUR A;  5FRN A;  4NCX A;  3OW2 S;  1VQL A;  3VQV A;  4C8Q C;  1Q86 C;  4J7F A;  2I4M A;  2K2V A;  1VQ5 A;  2P0L A;  2JNG A;  4M7A D;  3GLX A;  3FJP A;  2A3L A;  5HK3 A;  2DAQ A;  1NJ8 A;  4M7A C;  5CKE A;  1H3Z A;  4J8O A;  3VUZ A;  5D6W A;  4BI4 A;  2R58 A;  4YRF A;  2LVM A;  4K86 A;  1N9R A;  2PUO B;  3IKL A;  2BIV A;  3OYN A;  2ZPI B;  5GAN 8;  4HCB A;  1KC8 U;  4QQG A;  5CO7 A;  1VQK A;  3HTZ A;  3OSS C;  4PLL A;  5EG2 A;  4H02 A;  3VQX A;  4EMK C;  5GAO m;  12AS A;  1P92 A;  1EVK A;  3OYF A;  1FWZ A;  2ZT5 A;  2P0P A;  4E51 A;  3OYG A;  5LJ3 j;  4KUI A;  1VQ5 T;  4LDW A;  3HPW A;  3S3M A;  1EIY A;  1SET A;  5IN1 A;  4EO4 A;  3MP8 A;  2ZZG A;  4YCV A;  3C94 A;  3SFM A;  2JTF A;  3HY0 A;  1M1G A;  3DLM A;  4IUQ A;  4NL3 A;  3NEN A;  3CBO A;  2XID A;  2X35 A;  1YJN A;  3ASK A;  1BI2 A;  4P72 A;  3M56 A;  3OB9 A;  3JB9 G;  3ER0 A;  5GMK e;  3VQW A;  2QXF A;  5KCH A;  1B34 B;  4WJ4 A;  2ZIN A;  2G3R A;  4YRM A;  4N4I A;  1GGM A;  4N0A C;  5LJ3 h;  1QVF A;  4M78 G;  2L5Q A;  3L2Q A;  4KUL A;  3JCM b;  4BI8 B;  1WQ7 A;  2Q7E A;  3E1S A;  1XOV A;  3G71 A;  2NLU A;  4MML A;  4QW2 A;  4KUD K;  2RJF A;  1JJC B;  1BI3 A;  2EQU A;  1KMM A;  2QI2 A;  3CME T;  4P71 C;  2K3X A;  3CC4 A;  3HXX A;  4M77 G;  4LNS A;  4ELY C;  4MZP A;  5K1X A;  3WQZ A;  1YIT A;  3MEU A;  3JCM d;  2FB7 A;  2WSE E;  2CGH A;  1G5I A;  3TUP A;  2RH2 A;  3CCU A;  3OYM A;  2OAU A;  3FB9 A;  1PYS A;  1KQS S;  3C4S A;  4IKF A;  1ADJ A;  2DTO A;  3A8M B;  3CD6 A;  4JS4 A;  2RHQ B;  2GCX A;  4RCC A;  3NTI A;  1KOG A;  4MZT A;  3G4S A;  3HRI A;  4C92 C;  1VQN A;  2EJF A;  4M7A E;  3QJ6 A;  3HFV A;  4PJO C;  5FU7 C;  3X20 B;  4HCC A;  2FL7 A;  1X55 A;  2EJG A;  3G71 T;  4RQF A;  1WJR A;  2MWP A;  4M7A A;  5GMK l;  5A0L A;  3LGF A;  3CC4 T;  2D6F A;  1C0A A;  2E1H A;  5KE3 A;  1X54 A;  2B8A A;  1RIQ A;  2EJ9 A;  4FT4 A;  1UB4 A;  3O8V A;  4IUT A;  2F5K A;  4M7D D;  1ASZ A;  4OGE A;  2AHJ B;  3NEL A;  5GAO q;  4C8Q F;  4LVL A;  3S6W A;  3FRN A;  3WVD B;  3CMA T;  3CCU T;  4UPA A;  2ZXF A;  1Q82 U;  4M7D C;  1H4V B;  4B9W A;  4ZTF A;  2YLC A;  3P8Y A;  2I4L A;  3G4S T;  2PVG B;  4HVC A;  3REU A;  2M16 A;  4HWS A;  1ZHI A;  3OYH A;  3PT9 A;  2ZIO A;  1KC8 C;  1YFR A;  1VQN T;  4TVY A;  2LQK A;  2LT1 A;  1B7Y B;  3MEA A;  4XU3 A;  5GAN e;  1B34 A;  2E3C A;  3VUB A;  3UGQ A;  2XGT A;  1M90 U;  3TRE A;  4FT2 A;  2K5I A;  5D6Y A;  4Q15 A;  3LLR A;  4OF1 A;  3M5A A;  4XTY A;  3DKM A;  2KK4 A;  5FU6 C;  2JTM A;  3CXC S;  4MZM A;  3BY7 A;  5CQX A;  2D0Q B;  3QBY A;  1KMN A;  2GFU A;  1EFW A;  1JJC A;  1K9M U;  3GNG A;  1X75 C;  3QNE A;  3VJP A;  4YRS A;  4P5N A;  5GAN 6;  3HHT B;  4BUG A;  1UGR B;  2YLB A;  3HFO A;  3HRT A;  4RDX A;  3RMQ A;  1G3S A;  1QP3 A;  2F5T X;  4X9D A;  4A53 A;  1VQ7 A;  4RCB A;  1NYR A;  3VYH B;  4EMH A;  4F7U G;  3ZFJ A;  2H3J A;  2E64 A;  2ZPG B;  2WSC E;  1X2G A;  2P4T A;  3OYC A;  2O4X B;  4TVA A;  4K87 A;  3JCM W;  2VYT A;  1YGB A;  2ARS A;  3M58 A;  1UGQ B;  4YRJ A;  4PL6 A;  2FVU A;  3M4Y A;  4M75 B;  2HD0 A;  2JN0 A;  2E70 A;  4RQE A;  2WSF E;  2RI5 A;  2EL9 A;  3NTK A;  2RJC A;  5GAN d;  4A4F A;  2KQW A;  1YCY A;  2EIF A;  2XI9 A;  4H2Y A;  3JCM f;  5GAN 4;  2IY5 B;  3URG A;  2DD4 A;  2J3M A;  4X5O A;  4KT0 E;  5I2M A;  2DKG A;  1O75 A;  4Y91 A;  4QVC A;  4M78 D;  4E7K A;  1Z7M A;  4L59 A;  2ODR C;  5LJ5 j;  3CPW S;  1YHQ A;  4HT8 A;  4M78 C;  2PQW A;  3HRS A;  1B8A A;  1NJ5 A;  1VQ7 T;  5HY6 A;  3SWN B;  4DOV A;  4N4G A;  3H6Z A;  3QZ9 B;  2XKO C;  3A7U A;  3RER A;  4LD6 A;  2IG0 A;  4TQF A;  3JB9 J;  4M77 C;  2RHI A;  3L2R A;  3HFZ A;  4M7D E;  1FX7 A;  4ZTJ A;  2VC8 A;  4OVA A;  2HNI A;  4MDX A;  4C92 F;  1NJ2 A;  2KVQ G;  3E9F A;  3HSB A;  2RA2 A;  3PNW C;  4PJO F;  4C5I A;  4M7D A;  3M4P A;  3X26 B;  4E7H A;  5GAM j;  5LJ5 h;  1XQH A;  3V8K A;  4H2T A;  1KHC A;  3HFN A;  3T9N A;  2P0Q A;  1YHQ T;  2P5I A;  1Q82 C;  3MCA B;  4YRP A;  3I55 T;  4C0D C;  1USY A;  3MP1 A;  2V8I A;  4KR3 A;  4ME7 A;  4MDW A;  3G1Z A;  2LDM A;  3PGG A;  2D9T A;  5IT9 E;  4CH3 A;  1NNH A;  1PSF A;  4YP0 A;  4OMF B;  4ZGJ B;  4BB7 A;  2GQV A;  3UDC A;  1IL2 A;  5GAM h;  5LJ3 d;  4AH6 A;  3KFU A;  1SRY A;  3TCJ A;  1M90 C;  3JCM c;  5C52 B;  4ATO A;  4OB1 B;  4PKC C;  1W2B A;  3M4G A;  1PSE A;  3CCJ A;  5ELO A;  3OMG A;  2I4N A;  1VQO T;  3V7R A;  3LX7 A;  1K9M C;  4JRI A;  4A4H A;  3RUX A;  3QO5 A;  3CMQ A;  1M9S A;  1VUB A;  1YIJ A;  3M4Q A;  3OW2 A;  4P73 A;  4BW9 A;  3QXE B;  4HCZ A;  3TEH A;  4JDS A;  4BE1 A;  2PU9 B;  5CR2 A;  1EQR A;  1U1T A;  3HL8 A;  3QJY A;  4X9C A;  3Q1J A;  3DSQ A;  3CCQ T;  4PNO A;  4J83 A;  4P75 C;  4YYE A;  3SWN A;  4TVR A;  2DK3 A;  2V8J A;  4RMF A;  3P8V A;  2DDZ A;  3QG1 A;  5GAN f;  3OSV A;  2HAX A;  2BUD A;  1KQ2 A;  1JJ2 S;  1LOJ A;  1E22 A;  1VQ8 T;  2M0O A;  4M78 E;  2QHT A;  3RGL A;  4C8Q D;  5AYF A;  1LYL A;  1YJ9 A;  3DB3 A;  4A4E A;  2VXF A;  3CCJ T;  3WVE B;  3MEY A;  4BE2 A;  4XU0 A;  3M59 A;  1PYS B;  4II1 A;  3JB9 F;  4ZGD B;  2CIM A;  3UT1 A;  4WJ3 M;  2A7Y A;  2KDS A;  4E7I A;  3JCM X;  5J3B A;  4C8Q B;  3UWN A;  4XEO A;  1M8V A;  4M78 F;  4HWP A;  4XTU A;  3G6E A;  3BJU A;  1G3T A;  3L2Z A;  2ZNJ A;  4M7A B;  2XD0 A;  4PG3 A;  4YRK A;  4PHC A;  3GPL A;  3CCM A;  1YJW A;  3GOX A;  3L2W A;  3QDR B;  1G3W A;  1YJ9 T;  2EAY A;  1VQL T;  4M77 F;  2Q7G A;  1MHN A;  4DOW A;  3CBM A;  4YRT A;  4LVI A;  4M75 G;  2PMF A;  3JCM e;  3R07 A;  2DVE A;  1W4S A;  4C0F A;  3IKM B;  4YRR A;  5CVI A;  1G5H A;  3DB4 A;  2XU8 A;  2A8E A;  4QQD A;  1WJS A;  3HRU A;  2JZ2 A;  1BKB A;  5KCO A;  4V2S A;  2X4Y A;  3L1A A;  3OBY A;  3OYE A;  2RJE A;  3G6E T;  1VQK T;  2AKW B;  3RKX A;  3GF5 A;  4P74 C;  4UP8 A;  5LJ3 f;  3VKI A;  1KHI A;  3LC0 A;  1WNL A;  3CCM T;  1YJW T;  1QVG S;  1KQS A;  4H2S A;  3L4G A;  4BY6 B;  5KE2 A;  1W66 A;  3RIR A;  1WJQ A;  4XU2 A;  2DQ0 A;  4HA8 A;  2E10 A;  2NS6 A;  4XTZ A;  4OB3 B;  1UEB A;  2DTI A;  2RB6 A;  4JS5 A;  3BDU A;  2ZT7 A;  2JOY A;  1Q7Y U;  2EYQ A;  2RJD A;  3JCM g;  1YJN T;  4YTL A;  3HXW A;  1U8R A;  1BIB A;  1H64 1;  4FSX A;  4DQ2 A;  3M53 A;  4C8Q E;  4TVA B;  1TH7 A;  4N4H A;  1VQ9 A;  4C92 D;  1Y7X A;  3OBW A;  2X4W A;  4P3N A;  4PLI A;  5CQY A;  4PJO D;  3MEW A;  2QQA A;  4C8Q A;  3ICA A;  5CCA A;  2XDD A;  3FLG A;  1OZ3 A;  3EFS A;  2ZZE A;  3MHX A;  4OP0 A;  2DXC A;  3FEO A;  3E19 A;  1WYD A;  3OD1 A;  2DPP B;  3OA6 A;  3PMT A;  3V8J A;  5KH6 A;  2HQX A;  4C92 B;  1YIT T;  2DIG A;  4WI1 A;  5LJ5 d;  4XAX B;  4CS2 A;  4GLK A;  5FLX E;  4JJN K;  4RMO A;  3W3S A;  4BD3 A;  5FU7 B;  2DU5 A;  4F7U F;  4OB2 B;  3GP8 A;  4EMK A;  2WAC A;  3CD6 T;  3JCM V;  3CXC A;  2R5M A;  2ZR2 A;  4JRP A;  1VQ9 T;  2RHS A;  1VQ4 A;  2IVW A;  3HFZ B;  2Q5H A;  1NJ6 A;  1V29 B;  1B76 A;  4TTV A;  2MAM A;  2ZT8 A;  4YRC A;  3LSQ A;  2AKW A;  3L2V A;  4M7D B;  4IUV A;  1NZ9 A;  1ZQ1 A;  4OGC A;  2HQE A;  3BDL A;  3FDR A;  4ZIB A;  4BE0 A;  4ZTZ B;  2PVD B;  3J81 E;  1E24 A;  2ALY A;  1NYQ A;  3OYB A;  2J3L A;  4H2W A;  4UP9 A;  4XEM A;  2KMT A;  3J80 E;  2K4Y A;  5F5W A;  1ASY A;  4YPF A;  5J26 A;  4BI3 A;  4BDY A;  4N0A A;  4DPG A;  2DXT A;  1N9W A;  4EDU A;  2CZ1 B;  2VUB A;  5LL6 S;  1FYF A;  2OTL A;  5CIU A;  1KG1 A;  4L6V 5;  2RO0 A;  1Q81 U;  1EIF A;  5FU6 B;  1L0W A;  1I4K 1;  3PZC A;  3FC3 A;  1OZ2 A;  2C7I A;  3PIO A;  4C5G A;  1KQ1 A;  4ZN1 A;  4H2U A;  4P71 A;  2V8K A;  4XU1 A;  1EOV A;  1BBW A;  1WU7 A;  4K88 A;  1K8A U;  3JB9 D;  4O2D A;  2QEX A;  1X01 A;  2RHZ A;  1E1O A;  4EPC A;  5GAN g;  2GF7 A;  2Q5I A;  5GMK j;  1BI1 A;  4M7A G;  3SB2 A;  4WF2 A;  1I81 A;  2E41 A;  4O5V A;  3CCV A;  2LNV A;  3JB9 I;  2QQB A;  2ODR D;  3TEH B;  4C92 E;  1QVP A;  1Q7Y C;  4C0Z A;  3F70 A;  3A5Z A;  4PJO E;  1U1S A;  4J6W A;  4DA4 A;  3LW5 E;  2OTL T;  3RF1 A;  5IAY A;  2M9U A;  3P8D A;  4C92 A;  4Z02 A;  4PJO A;  3JCM h;  3PCO B;  3CCS A;  11AS A;  3UGT A;  2ZZD A;  4M77 D;  3X25 B;  2EWN A;  5CAI A;  1YB3 A;  3GIB A;  2PUK B;  3A8O B;  4CRI A;  3I56 A;  3A31 A;  1M5Q 1;  4JRQ A;  2C8M A;  4FL6 A;  5LJ3 e;  3DLL A;  2PME A;  5DLQ E;  4M78 B;  2CKK A;  5GMK h;  2EQK A;  2Y90 A;  2QEX T;  3UH0 A;  1VIF A;  3BFM A;  2LCL A;  4EX5 A;  5GAO r;  4CH5 A;  3CCL A;  3SD4 A;  5LJ5 f;  2QTX A;  3PIP A;  4YRO A;  3HP9 A;  4YRL A;  1OYX A;  3NTH A;  3E9G A;  4A4G A;  2RK2 A;  1G3Y A;  2QHV A;  2ZPF B;  5CKH A;  3H8Z A;  4HT4 A;  2DIQ A;  1M1F A;  1H4Q A;  2EFI A;  3X24 B;  2ZNI A;  2QA4 A;  3VQY A;  2MWO A;  3RES A;  3NEM A;  1G5V A;  3CCS T;  4BAC A;  2G4C A;  5HKC A;  3P8B B;  1GXI E;  3V7C A;  2X4X A;  4Y28 E;  2DZC A;  3VBB A;  2DTH A;  2QHS A;  3HXV A;  3LYI A;  4C0D B;  1SER A;  3CCL T;  5LJ3 g;  4MMK A;  4BWA A;  1Y07 A;  1VQM A;  2L89 A;  2E6N A;  2ZPB B;  3HY1 A;  3RMS A;  4RG8 A;  3QHS A;  4LD9 K;  4YRQ A;  5A0G A;  3E9H A;  2DD5 A;  4LVJ A;  1JJ2 A;  1YFS A;  5GAN 2;  4QVD A;  1AHJ B;  1I8F A;  1N6A A;  5FRM A;  2QA4 T;  2QQ9 A;  2P0K A;  2DJZ A;  5GAN j;  3HXY A;  1BIA A;  4CI0 C;  5GAN 3;  4XTX A;  4HKE A;  1Q81 C;  2ZPE B;  5A0D A;  1HC7 A;  2K5L A;  1YI2 A;  3L4G B;  2HBP A;  3S3O A;  4QVZ A;  3PCO A;  3A8L B;  5K1P A;  2Y4Y A;  4A54 A;  1Z7N A;  1LJO A;  2ZIM A;  1ZBX A;  1K8A C;  4M75 F;  4NL2 A;  1VQM T;  2E5A A;  4YRI A;  1M1K U;  1IRE B;  3UFG A;  1JRI A;  4M78 A;  1E1T A;  4C5H A;  3OYL A;  3MEV A;  3P8H A;  5GAN h;  4M7D G;  4RG2 A;  4M77 E;  4KR2 A;  2E5Q A;  1RI0 A;  4Q5W A;  3L42 A;  1JBM A;  1YIJ T;  5A2Q E;  2QHU A;  4RKU E;  3OYD A;  4CS4 A;  4M77 A;  2E65 A;  2Q7H A;  4CH4 A;  1X6O A;  3TEG A;  2ZPH B;  3L2U A;  3KUF A;  4KQE A;  4F7U B;  1YI2 T;  3M54 A;  3X28 B;  5GAN 7;  1G51 A;  4E7J A;  3EFR A;  2QQR A;  3HRK A;  3MF1 A;  3ME9 A;  2LT4 A;  3S3N A;  3NFC A;  4G85 A;  2XK0 A;  2PVO B;  4IUU A;  5DLO A;  5M9O A;  3OQ5 A;  5FRO A;  4J7I A;  2LTO A;  3QUI A;  2OTJ A;  3RL6 A;  1K73 U;  1O9S A;  1QVG A;  1D3B A;  3JCM J;  4EMK B;  3OYI A;  1UGP B;  2RHS B;  3CC7 A;  4XTW A;  1N27 A;  4R55 A;  3CME A;  1XNI A;  2F69 A;  4J6X A;  5D6X A;  2YRV A;  2EKO A;  4ZGE B;  3CC2 A;  4G84 A;  3KBG A;  3A8G B;  3PFS A;  4R56 A;  2ART A;  1Y96 B;  4BY6 C;  2DEQ A;  5KNN A;  1QW1 A;  3QPH A;  2EQJ A;  2LX9 A;  4OLF A;  3M55 A;  3OS1 A;  1UGS B;  2RHU A;  2DZ9 A;  2O01 E;  4YRE A;  2MI6 A;  2ALY B;  3QO3 A;  3GNF B;  4H2V A;  2C06 A;  2OTJ T;  4IUP A;  5HK0 A;  5LJ5 e;  2DXU A;  4GY5 A;  1NE8 A;  3CBP A;  4UC4 A;  5E3I A;  1HK9 A;  1X56 A;  2RK1 A;  4P75 A;  3INZ A;  1MGQ A;  4LDV A;  3CC7 T;  3QYG B;  3IAL A;  4H2X A;  3VU3 C;  3ERR A;  1B70 B;  3RAC A;  3CC2 T;  5CKD A;  3OMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...