2DJZA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111a mutation
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2djzA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2djzA01
4NCXA 5LJ3j 1I5LA 4CS2A 1E24A 3IKMB 4CS4A 1WNLA 4C8QC 1B70B 4YCWA 1YGBA 1X2HA 2ZNJA 4UP7A 2RHSA 4YYEA 2J3LA 2E65A 3MF1A 4JRKA 3JCMb 3E9IA 1ADJA 4YP0A 3MF2A 2DU7A 1MGQA 4M75C 2CIMA 2ARUA 3L1AA 5GAN4 4M7DA 3HTZA 3VBBA 3JCMW 2EL9A 5ELOA 3V8JA 1E22A 5GAMd 4WJ4A 1X2GA 3WQZA 1N9SA 1NJ8A 3A7AA 2XGTA 4OLFA 2K57A 2EAYA 3QO7A 2ZR3A 2FB7A 5GAN8 4YREA 4TVAA 1N9WA 1HC7A 3NELA 3MEYA 1G5IA 5GANe 4YPFA 4M75B 4P71A 2P0LA 3INZA 5GANj 1WQ7A 3V7SA 4XTYA 4P75A 4M78G 3BW1A 1I81A 2ALYA 4JRIA 4NOYA 4P3PA 5GMKi 4CH6A 4P74C 3LSSA 4M75G 2ZT8A 1BBWA 4PG3A 5GAOq 4M78B 1X01A 1YCYA 2I4OA 2RHQB 4RDXA 2RD1A 4C8QD 3JB9D 2VC8A 3V8KA 2EJFA 5LJ3g 3UH0A 3VQWA 1Y96A 3HFZA 4F7UE 4P3NA 4M77D 4WJ3M 4M78D 4YDQA 1B7YB 5GAOm 4QVCA 4HWSA 4C92F 3TUPA 1NJ2A 1EQRA 3QUIA 1D3BB 1EVKA 4P73C 4M7DG 1IL2A 4BW9A 1H4SA 2DJZA 2VXFA 3RERA 2G4CA 5GANh 4C8QA 2Q7HA 4M78F 3R07A 2JN0A 4YRRA 2Q7EA 4YRQA 2AMCB 3HY0A 3QHSA 2I2LA 4M77C 1VQZA 5GAN5 3I7FA 3JCMh 1USYA 5HGQA 4UPAA 2ZR2A 5E3IA 4H2VA 2J3MA 4C92B 1RIQA 2ODRD 4H02A 2E1HA 4Q6GA 3TEHB 2YHTA 3QNEA 4EMHA 5GMKe 1ASYA 3JCMX 5GAN7 3KFUA 3V7CA 4PJOE 4J6WA 3VQYA 1WQWA 2DTHA 4XTZA 5GAMg 2C7IA 4A53A 1LJOA 4UP9A 1NJ6A 1Z7NA 3IG2A 4J15A 4CH3A 1X54A 4XQ3A 4TVYA 3AHUA 3HSBA 3TEHA 2EJGA 1I8FA 4EMKB 3QTCA 4XU3A 4M7AG 5GANd 2FYKA 4EX5A 3REUA 3UGQA 1U1TA 4YRNA 1TH7A 3A5YA 4CH5A 5CAIA 1NNHA 1HTTA 4PNOA 4TQFA 4C92C 4PJOC 4EMGA 1YB3A 2AMCA 1YFRA 2Q5IA 3UFGA 1B76A 3M4GA 4RCBA 3RIRA 4C8QB 4X5OA 1EOVA 2YLCA 4DPGA 1D3BA 4M7AA 4RQEA 2I4MA 5LJ5d 1QE0A 2DXUA 3QSUA 4P72C 4H2XA 2EJ9A 1B7YA 4M7AC 5GMKh 3A74A 3EFRA 3RKXA 4YRLA 1LOJA 2E3CA 1Y96B 2Q5HA 5LJ3d 1YFTA 5GMKj 3JCMe 5GMKl 5GAMe 4C92G 3GIBA 4Y91A 4M78A 2E41A 3JB9I 4M7AD 2CGHA 1YFSA 3L2ZA 5LJ5g 1WYDA 4HT8A 3A5ZA 2QHUA 4G84A 1SESA 2ARSA 3HXZA 5ELNA 1JBMA 4M77F 3HXYA 3P8VA 12ASA 4TQDA 2ALYB 4H2XB 4YRCA 1KQ1A 3RL6A 4ZTUB 3JCMg 3HXUA 3REXA 4X9DA 4M7AB 3SB2A 2ZIOA 5GAOp 5C52B 1BBUA 2RM4A 3PGGA 3BJUA 4XTWA 4N0AA 4XTVA 3G1ZA 4M7AF 2CJAA 4TVAB 4XU0A 4TWAA 4YRPA 3FJPA 3A7RA 2PMFA 4YRFA 4PHCA 3HXWA 2ZGWA 4C92D 5KNNA 4EMKA 2I4NA 5GAMf 1ADYA 1E1OA 1M8VA 2ZZGA 4YCUA 2DEQA 3HXXA 4M75E 2QHTA 11ASA 3A32A 1J5WA 4DQ2A 3DSQA 1H4TA 3ERRA 5C51B 5DY9A 3HFVA 5LJ5h 4UP8A 1ATIA 1NJ1A 3JCMV 3V7RA 3JCMc 1C0AA 4C92A 4XEMA 3JCMd 4J6YA 4TTVA 3RESA 2ZT7A 4HA8A 3VQXA 3A7UA 3QO8A 2DZ9A 3FB9A 1BIBA 4J6XA 4N0AC 4KQEA 5K1PA 2Y90A 4YRJA 4Q15A 5LJ5j 1G5HA 2ZTGA 4V2SA 1HK9A 2EWNA 4C8QF 3JB9F 3JCMJ 1G51A 2AKWA 2DQ3A 4K86A 4ZTZB 3M4PA 4YRKA 2VXEA 4EO4A 4M7DE 4YRMA 5GAN3 4CS3A 3HFZB 5GAOn 3HRKA 3LSQA 1PYSA 1SETA 4YRIA 2RHQA 4PJOG 2ZT6A 1L0WA 4LNSA 5GAMh 3V8LA 4WI1A 3RKWA 3JCMQ 4X9CA 2QHVA 1NJ5A 2DTIA 3IALA 2DU5A 1LYLA 1USYC 1H641 4YRGA 1Z7MA 2P5IA 4NL3A 4P75C 2ODRC 3FIFA 1E1TA 4PJOB 2ZZEA 3JB9J 3BFMA 1HXDA 5F5WA 4M75A 4H2TA 1H4VB 1QF6A 2DDZA 2I4LA 4M75F 4XTXA 2ZINA 1X56A 3HFOA 4EMKC 4XEOA 2E64A 5C53B 4MMKA 3L4GA 2DXTA 4CH4A 1LNXA 1WLEA 3VQVA 3RGLA 4M75D 1KMNA 4HT9A 4M7DB 2CJBA 1KQ2A 4P71C 4BWAA 4RCCA 1KMMA 2IY5B 4M7DF 3SWNC 2DZCA 3A31A 4YROA 3SWNA 3JCMP 2RHSB 2ZT5A 3LC0A 5K1XA 1JRIA 2RB6A 4E51A 1B70A 4P74A 3QO3A 2DQ0A 4F7UG 1NYQA 4HWPA 3QO5A 4RQFA 3RACA 4HWRA 3NETA 5LJ3f 1NYRA 4MMLA 4M78E 3HXVA 4K88A 1B34A 1JJCA 2QHSA 3RUXA 3W3SA 3SWNB 4M7DD 3NENA 3TEGA 5GAN6 4M7AE 4F7UB 1WU7A 3P8TA 4YCVA 4H2SA 4HVCA 1EFWA 1W66A 1EIYB 4NL2A 5LJ5e 3IKLA 4P73A 1B8AA 3ICAA 4WF2A 2IY5A 1SRYA 4F7UF 3BDUA 3M4QA 4XU1A 3VU3C 4J5YA 3HRIA 2YLBA 4TVWA 3PCOA 5LJ3h 4P3OA 2XTIA 2ZNIA 4JUVA 5GAOr 4HWTA 1BIAA 3HY1A 1M5Q1 4M77B 5GAOl 5I21A 4K87A 3UGTA 1KOGA 2DTOA 4PJOD 3L4GB 4QVDA 2DVEA 1U1SA 2QTXA 4JLIA 4L87A 4H2UA 2DKGA 4P72A 1SERA 4OP0A 3P8YA 4C92E 3EFSA 5GAMj 3HFNA 4AH6A 5LJ3e 4XU2A 2ZCEA 4PJOF 3JB9H 1X55A 3RKYA 2ZIMA 1H4QA 5GANf 4KR3A 2E10A 2ZXFA 4YRTA 2RA2A 4RMFA 5GMKm 4PJOA 3RF1A 1EVLA 1WPYA 4HWOA 2CJ9A 3PZCA 2ZZFA 1I4K1 4C8QG 3JB9G 3BY7A 2C8MA 4M77A 2Q7GA 4XTUA 2HNIA 3JCMf 3NEMA 1N9RA 3PCOB 5LJ5f 1PYSB 4O2DA 5GANg 4H2WA 4M7DC 3CMQA 4C8QE 4A54A 1EIYA 3E9HA 4ZIBA 4F7UA 2AKWB 4M77E 4G85A 1GGMA 4KR2A 2ARTA 1ASZA 4M77G 4H2YA 5GAN2 4YRSA 1B34B 1JJCB 2E5AA 1FYFA 2PMEA 3OD1A 4M78C
chains in the Genus database with same CATH superfamily
3A8HB 2FEIA 4ANJA 4KUIA 1WNLA 3EG9A 1N27A 1XNIA 2CP6A 4E2FB 2YSQA 5EC7A 4VUBA 2PU9B 3LGLA 1VQ8T 2ZNJA 3G1JA 2RHSA 2DMOA 4FW1A 4JRKA 5KE2A 2FHDA 3CCMA 4HCBA 9ATCB 1MNEA 3VS4A 2DU7A 4M75C 2JS2A 1AT1B 1T0JA 2RK1A 2DBMA 4AMCA 3VBBA 2EL9A 3RDVA 4J7IA 4DOWA 5ELOA 1Q81R 5GAMd 3WQZA 1N9SA 1IGQA 1ZQ1A 2XGTA 1WJQA 2F5TX 3PVQA 1R0BG 3CXCS 3PNWC 1N9WA 3NFCA 3CCVA 4L59A 5HKCA 3M53A 2P0LA 1ZBJA 5IN1A 2Y4XA 3VS5A 2JJ9A 1I81A 1IREB 3LGFA 2ALYA 4E6RA 4JRIA 1ZSZB 3OY9A 4FL6A 4NOYA 1JXOA 1UGVA 3CXCA 3H8ZA 3G6EA 1KC8C 2PVGB 1K73R 2ZT8A 4ZN3A 4E7JA 1Q82R 1X6OA 2RHQB 4C8QD 5LJ3g 3SFMA 1VQOQ 4QVZA 3X25B 2KBTA 4M78D 5IH2A 1H8KA 3JSCA 4HWSA 3G6EQ 1S72Q 4ORZA 3QUIA 4P73C 5I22A 1ZUUA 4LDUA 2DJZA 2XKOC 4D8DA 1NG2A 1K8AC 3MQZA 4YRQA 5EG2A 3HY0A 1VQNQ 1VQZA 3VJPA 1YP5A 3MKDA 3CCJA 3LX7A 3QG1A 2GCXA 3S3OA 5E3IA 3CMEQ 3P8HA 2FL7A 4OMFB 2E1HA 3QNEA 5GMKe 2KXDA 3EAEA 4ZGDB 1UDLA 4KH1B 2HKQB 1WQWA 3CCVT 5KYYA 4UP9A 1M3AA 1VQ9Q 3ULRB 2KVQG 1ACMB 3AHUA 3HSBA 1GCQC 2F2VA 2EJGA 1I8FA 4EMKB 3ER0A 2NUZA 2FYKA 5C6SA 3LW5E 1U1TA 1C0MA 3A8OB 1YWOA 2YWWA 3VYHB 5HCKA 1HTTA 2EBPA 1K9AA 1K1ZA 1OU9A 3M54A 1NJIU 2AKLA 4JZ3A 1TU0B 2ABLA 2CP3A 4CI0C 3LYIA 4OB0B 1M90C 4C0ZA 4P72C 2X4WA 2XG8D 3A74A 3EFRA 2NUTA 4YRLA 3H6ZA 4B9WA 3MEUA 4BD3A 2E3CA 1VQ5A 2YUOA 1Y96B 2KY9A 3CCEQ 5GMKj 2DD4A 2XDPA 2O31A 3GIBA 3L2UA 4DA4A 5FRMA 2DO3A 1WHLA 1PM3A 2CGHA 4F17A 3EH1A 1T3SA 2J6FA 1WYDA 3QYGB 5ELNA 2NUTB 3CCET 3P8VA 2O9VA 12ASA 4E7KA 2ALYB 1VQPT 5IT9E 1PSEA 5HK0A 3KXTA 4C5HA 2L3SA 4X9DA 3ZFJA 1R0CB 1GRIA 4M7AB 5CIUA 3RNJA 2DILA 3PE0A 2P0QA 4Y28E 2KAFA 4A4EA 3A7RA 2FRWA 2DVJA 1QMCA 2ZGWA 4C92D 5KNNA 1WHGA 4YTLA 4EMKA 5GAMf 1E1OA 4GLKA 2ZZGA 3HL8A 3VS7A 5KYYB 11ASA 1AOJA 3J80E 4P5NA 1KQSP 1NEBA 1H4TA 3M0TA 4PJNA 5LJ5h 1VQPQ 1YFNA 2OTLA 1C0AA 1NLPC 3O8VA 4XEMA 4CC3A 3JCMd 1ZUYA 2W0ZA 3VQXA 4FW2A 1CKBA 2QA4T 5DM7R 5CO7A 4BACA 3NPFA 3CXCP 2K3YA 4OMNA 4OMLA 2X35A 1X75C 3OYKA 4KQEA 4ZN1A 3IQLA 2AHJB 2CH4W 2Y90A 1UUEA 4Q15A 2BKDN 5LJ5j 2KYMA 2ZTGA 3HHTB 2BZ8A 2DQ3A 4K86A 5IXFA 3M4PA 1P92A 5D6XA 2RQWA 2PNIA 2LTOA 1UECA 3PMTA 4ATOA 1PNJA 2MMPA 3S3MA 3LSQA 1PYSA 2CZ0B 3AT1B 4YRIA 2RHQA 2RQVA 4HVWA 5GAMh 3JCMQ 2A08A 1JO8A 1RLQC 2DPPB 1VQ5Q 4YRGA 1Z7MA 2P5IA 1SPKA 3EFOA 4NL3A 4Q5WA 1AZEA 3R6OA 3JB9J 2MF2A 5KH6A 2A37A 1UHCA 4RKUE 2ED1A 1E6GA 1K8AU 1YITA 2D6FA 5CQYA 2I4LA 2QEXT 2WSCE 3CCJQ 2ZINA 2QDLA 2XICA 3CCST 1YIJA 1X56A 2VWFA 3HFOA 4EMKC 4XEOA 2E64A 1N8RR 1C6VX 2LQWA 3VQVA 4AFQC 1AVZC 3ME9A 2GTOA 1A0NB 1X2KA 2E5KA 3QDRB 2EKHA 1KQ2A 1Z9QA 2OTJA 1VIFA 4P71C 4BWAA 4RCCA 2O01E 4RTYA 2IY5B 2FVUA 2DJQA 3UPUA 2J6OA 2RHSB 2J6KA 3LC0A 5K1XA 1JRIA 1OOTA 1AD5A 4P74A 2FG0A 3EG9B 2ROTA 2RJEA 1JU5C 3CPWA 1Q86U 3VS2A 4HWPA 3ASKA 5LJ3f 1NYRA 5D6WA 2QAZA 2H3EB 4MMLA 1JJCA 2RN8A 3W3SA 3SWNB 4M7DD 3NENA 4M7AE 2OX7A 4YCVA 1EFWA 4H2SA 1W66A 1QVFA 3IKLA 2OI3A 4WF2A 2BZYA 4O6JA 3VU3C 4CC2A 1BI0A 1TUCA 4J9DA 2YXYA 2YLBA 4TVWA 3MEVA 2EYYA 3OA6A 1Q86C 1BIAA 4PFPA 1M5Q1 4K87A 5I21A 1UTIA 4J9BA 4XAXB 2DTOA 2HQHA 1M1KR 3L4GB 4QVDA 3OYHA 4MZTA 3DLLA 4IUVA 3VS6A 3REAB 4EIKA 4L87A 2D8JA 4OP0A 1UJ0A 1D1CA 1YJWT 3P8YA 1FWZA 3HFNA 3MP6A 4FYYB 2OTLT 1OPLA 3OS0A 4XU2A 1W6XA 4PJOF 2ZPHB 2EFIA 2ZIMA 1LPLA 2ZXFA 5GMKm 2VUBA 3R6NA 3I56T 3H9NA 4HWOA 3M9QA 1YJWQ 1IB8A 1VQ5T 1KQSS 1I4K1 1GCPA 1J3TA 1VQ7T 1WHMA 2RJFA 2C8MA 1VQ6A 3DB3A 2KEAA 1U06A 4J9GA 3NEMA 1PG5B 3OSSC 1K9MR 1Q7YC 2G6FX 4BI3A 4M7DC 2XK0A 1QQJA 1FXXA 3SEMA 2YDLA 3C94A 3OBYA 4KGVB 1VQPA 3E9HA 3FC3A 4E7IA 1M27C 2AKWB 2RK2A 1QW1A 3HPWA 2EW3A 3EG1A 5GAN2 4GLMA 1JJCB 4OMPA 1WLPB 2HQXA 4BDZA 3OD1A 2RHYA 4NCXA 4OMQA 4CS2A 3OYYA 2L5QA 1VQLA 2SRCA 1Q81C 4CS4A 5CKHA 1GBQA 1LCKA 4YCWA 1NLOC 1YGBA 2KMTA 1QVGS 4LDWA 3I56Q 2LP5A 2J3LA 2RO0A 1CKAA 3MF1A 3JCMb 1ADJA 3CQTA 1JXMA 4LN2A 1M9SA 4A4GA 2R5AA 3QWYA 4LD9K 1MGQA 2K5IA 4O5VA 1RAHB 4QQDA 3P8DA 2ARUA 3L1AA 3ZL7C 2QGGA 3J81E 4M7DA 3EGXA 1RAGB 2JT4A 1B07A 3KBGA 4WJ4A 1X2GA 3OYDA 2DETA 1KK7A 3CC7Q 3A7AA 1EZZB 1TUDA 5I2MA 2PTKA 5FWBA 2EAYA 2ZR3A 2FB7A 5GAN8 4GBQA 2MCNA 1YJNT 2D9TA 3NELA 1QP2A 1G5IA 5GANe 3GOXA 3OYAA 1ZX6A 2A36A 2CP2A 2FZCB 4P75A 1VQKA 4HXJA 2O4XB 2FPFA 1H3ZA 4P3PA 3L42A 1N8RC 3EFOB 4CH6A 1W2BS 2VVKA 3M0PA 3UA6A 1D0ZA 2MWPA 3A5ZB 5J3BA 4QQGA 4NS5A 2PQWA 1VQMT 3LSSA 2DIQA 1BBWA 4PG3A 4JJNK 1Y7XA 3META 4FSSA 3THKA 4OMOA 3CC2T 3V8KA 2EJFA 1EX4A 1YJ9T 4P3NA 3G4SQ 3TQ7P 3HKSA 3HRUA 4JS4A 2KQWA 2RHZA 4J7FA 4JJBA 2QG9B 1EVKA 3PIOA 2HSEB 4M7DG 4BW9A 1H4SA 3RERA 1IL2A 4PKCC 4FSXA 1RABB 5GANh 4X1VA 4C8QA 3R07A 2JN0A 2AMCB 4XK8E 2I2LA 2YUNA 4A4FA 2DXBA 2C0IA 2LJ1A 3JCMh 4JRQA 1USYA 5HGQA 1RL2A 2RNAA 4RTUA 4UPAA 1D0XA 2ZPBB 5CKDA 4H2VA 4DBFA 3GPLA 2GTJA 1IXDA 2ECZA 4Q6GA 2IPOB 2YHTA 3MHXA 3NMZC 1ASYA 3JCMX 2OTJT 4PFOA 2FZGB 1BK2A 3V7CA 4PJOE 2CSQA 2HDAA 2C7IA 1ZLMA 2LDMA 1LJOA 4A53A 1YJ9Q 4AT1B 4MDXA 4DEXA 3IG2A 4J15A 3G4ST 1X54A 1UEBA 3TEHA 1VQKT 2DK3A 4XU3A 3REUA 3UGQA 1TH7A 2ZPIB 5L8RE 1ZA1B 4TQFA 2DFUA 4EMGA 2CSIA 3LH0A 1YB3A 2AZSA 3M4GA 1MMGA 3EG2A 3RIRA 5FWCA 2EPDA 2YLCA 1D3BA 5CK9A 4M7AA 4RQEA 3EGDA 5LJ5d 2DXUA 2B8AA 5CCAA 3QSUA 1B7YA 1SRLA 1Y07A 3RKXA 5KYUB 1VQOT 3CCLQ 5FU7C 2DE0X 3JCMe 4C92G 1M30A 2RQRA 3KUFA 5GJWB 3UDCA 1GCQA 3MPUB 1YI2Q 3HXZA 4M77F 4PJMA 2K79A 4TQDA 4KRTA 4FT2A 3RL6A 1RAEB 1X2QA 1OZ3A 3I5RA 3JCMg 3REXA 2F1LA 3QXEB 1RADB 3D7SB 5GAOp 1QVFP 2PUOB 2ZPEB 3PGGA 1YI2T 4N0AA 4XTVA 3HTRA 4TVAB 3I56A 4ELZC 2YRCA 4FYXB 1VQLQ 1QKWA 2LNHB 3CC2Q 4FU6A 2GFAA 2XU8A 1PWTA 1WJRA 2A0FB 2DERA 1QCNA 1YJNA 3P8BB 1AWWA 2JZ2A 2XD0A 2KSSA 2KNBB 3CCRT 3OYJA 3HXXA 1OEBA 2KI7A 1G83A 2RH2A 1SHGA 4ZNXA 2L3PA 3M59A 4DQ2A 1K9MU 3DSQA 3X24B 2E12A 1SG5A 3GLXA 1PD0A 3WXMB 3A8GB 2SEMA 3JCMV 2RQUA 4C0GA 4Z02A 3CC4T 3DLMA 1VQLT 1M1FA 1SSHA 4N0AC 2QQBA 3WVEB 2CP0A 2MWOA 1MV0B 4R0KA 5A0GA 4OB1B 1ABOA 4D6WA 3EHQA 1G5HA 1HK9A 2AZVA 4C8QF 2DRMA 2J05A 3M5AA 3MEAA 1OX8A 5GAN3 1Y71A 3HFZB 3CCUA 4BY6C 2CH4A 1L0WA 1NZ9A 3M57A 4R55A 1YJWA 3J7AF 3GNFB 1SHFA 3CMEA 1I07A 2NLUA 3RKWA 2KXCA 2DBKA 2QHVA 1NJ5A 2E6NA 1S1NA 1AWJA 1H641 1B7TA 1ZSZA 2HCKA 2VV5A 4PJOB 1X43A 2ZZEA 3BFMA 1M90U 4RTWA 1OU8A 2JNGA 1VQ7A 2E3HA 1HSQA 2CYZB 4H2TA 1H4VB 1QF6A 2DNUA 2P0PA 2DDZA 2JM9A 3EG3A 3L2WA 2BZXA 4J9CA 1Q86R 3TVTA 2E70A 1K0XA 5J26A 2CT4A 2DXTA 4CH4A 1RAIB 1QCOA 3CC4Q 1LNXA 1WLEA 1K76A 3CCLA 3N5BB 2O9SA 7AT1B 1VQ4T 2RF0A 1KMNA 1MMAA 1M2VA 4FYWB 4GY5A 2KRSA 1M1KC 2E4HA 1BBZA 4M7DF 3OYGA 3SWNC 1VQOA 2H3JA 2HQEA 2OTJQ 2DL7A 2C0OA 1NJIR 2DZCA 3CCEA 1XTDA 3A31A 5IHNA 1U8RA 1ZSZC 2ZT5A 1X6BA 2FO0A 2JUFA 3M0SA 1TG0A 2RB6A 4E51A 1KFZA 3QO3A 2OJ2A 2DQ0A 1AWOA 2K6DA 3CCQQ 2HL3A 2GQVA 4QW2A 5J39A 1VQ8A 3O5ZA 4K88A 4M78E 3HXVA 3GBQA 4FT4A 1B34A 2J7IA 2D8HA 3QZ9B 3RUXA 1JJ2P 2GQIA 4QKUA 2QEXQ 3CMAQ 3TEGA 5GAN6 1YHQT 4F7UB 1WU7A 3P8TA 1JQQA 2F69A 3MCAB 5LJ5e 2MI6A 4P73A 3LH5A 4WTOB 3M4QA 1KD1C 4KUDK 2ED0A 2RPNA 4C0DB 2PVOB 3OYCA 5IHKA 3G71T 3PCOA 1G2BA 1G3TA 4PJLA 2XTIA 4JUVA 3A98A 4M77B 3CCRA 3NTHA 1B3QA 1WZOA 2D1XA 3URGA 2AK5A 4PJOD 2E5QA 3U23A 5HY6A 4JLIA 1QLYA 1FMWA 4H2UA 3GP8A 2WSEE 3EFSA 2QA4A 4AH6A 1NPRA 2HAXA 1VQ6T 2ZCEA 2MOXA 1X55A 1YJNQ 1H4QA 2ESWA 1ZBXA 4FYVB 4KGXB 2BUDA 4OB3B 2QTVA 2PVDB 3QDFA 3PZCA 2KROA 3BY7A 2QA4Q 2D0QB 2Q7GA 4Y92A 3VUBA 1N9RA 2YUQA 3M58A 4IUQA 2RJCA 1YNZA 2KDSA 1VQKQ 3BE3A 2Y4YA 4H2WA 3QPHA 2K5LA 3PT9A 3EG0A 2LZ6B 4PL6A 4J8OA 3CMQA 4C8QE 1NPPA 4A54A 3CCUT 1EIYA 4LVLA 1BI2A 2AIRB 2QDYB 4G85A 3PVLA 1GGMA 1ASZA 2QYZA 4H2YA 1PCXA 1W4SA 2G3RA 2M0YA 2E5AA 4JDSA 1LVKA 3VRZA 1Z9ZA 1AHJB 1PRLC 1X6GA 2A7YA 1I5LA 3QJYA 4Z89A 2JW4A 5ECAA 1MNDA 2EQUA 4C8QC 2A3LA 1B70B 3E9FA 1QVPA 1R77A 1JEGA 1QKXA 1X2HA 4HVUA 3C95A 4YYEA 2E65A 4IURA 2RI3A 3MF2A 2EKOA 3RBBB 2O2OA 1HYOA 4A4KA 1ABQA 2XDBA 3CBPA 4RTVA 4HCKA 2CIMA 2O88A 5GAN4 2V1QA 1HJDA 3HTZA 3JCMW 1BU1A 4J9EA 4E7LA 2OAUA 1NJ8A 2HBWA 1IRXA 1M3BA 1TXQA 4YREA 1VQNT 2CS7A 1HC7A 3L2QA 4YPFA 5GANj 1WQ7A 4XTYA 2LCSA 3VRYA 3BW1A 1G5VA 1V76A 4LE9A 4J83A 2PUKB 2JS0A 2EQJA 2YUPA 1IO6A 1TSFA 2LCCA 3UT1A 3JRZA 3QYHB 2MYSA 1QWFA 4M75G 1UG1A 4ESRA 1XOVA 3FRNA 5FU6C 4B6MA 4M78B 5GAOq 1X01A 1YCYA 4RDXA 2VC8A 1VYVA 5KYUA 2EIFA 4F7UE 3OYLA 4WJ3M 4QQ6A 4AFSC 4YDQA 1B7YB 3ZEHA 2CZ7B 5GAOm 4QVCA 4C92F 3TUPA 3BDLA 4F16A 1D3BB 2HMAA 2G4CA 1IGUA 2BE9B 2Q7EA 1O75A 3QWXX 4M77C 2CZ6B 3TSWA 2P4RA 2EYWA 5GAN5 5GJVB 1YIJQ 3I7FA 4MZMA 1NE8A 4E7HA 3CCLT 2ZR2A 2X4XA 1NEGA 4PFZA 2J3MA 3X28B 2P0KA 1RIQA 4H02A 4LVMA 2NYSA 4EMHA 3A8MB 4DEYA 5GAN7 1BCOA 3VQYA 2CDTA 1NJIC 2OTLQ 1Z7NA 4XQ3A 3CCQA 2M9UA 2DIGA 3QTCA 4M7AG 5KYXB 4HT4A 1QCFA 4EX5A 2EQIA 2X4JA 3KFVA 1ZUKA 1OZ2A 3H41A 1VQ4Q 4YRNA 2PZ1A 3EH2A 3OQ5A 4PNOA 4C92C 1UGRB 4PJOC 2AMCA 1PKSA 3UFGA 4X5OA 4RCBA 4C8QB 4IIOA 1FX7A 2BIVA 2XIDA 1WXUA 4DPGA 3OBWA 2H8HA 5DLOA 2IVWA 1QE0A 4H2XA 1K4US 4M7AC 5GMKh 1VOMA 1WYXA 4IIMA 4Z88A 2JVVA 1T0HA 2JM8A 3CCMQ 2ZAEA 4PJJA 1WHHA 3X20B 2Q5HA 2DL3A 2V8IA 2KT1A 1YFTA 3E2UA 1KHIA 4DBQA 5GAMe 5GMKl 4Y91A 4RG2A 4M78A 2E41A 3JB9I 4DBHA 1YFSA 1YI2A 3A5ZA 2QHUA 4F14A 1QWEA 4OVAA 1SESA 2ARSA 4G84A 2ZCFB 1JBMA 3HXYA 4AFZC 2QGFB 4C5EA 1H3HA 3CEYA 2O4XA 5CKFA 1OV3A 1KQ1A 1QVGP 2DYBA 2COZA 4LD6A 3CMAT 5C52B 2QQSA 1H92A 3BJUA 4XTWA 3CCSA 3G1ZA 4M7AF 2CJAA 2LJ3A 1VQ4A 4K11A 4TWAA 3OMGA 2DX1A 3OS2A 1QVFS 4OMMA 3UF4A 2P4TA 4YRFA 2FPDA 3HXWA 5KYXA 3I55Q 3VS1A 4MZPA 1ADYA 3OYBA 3G71Q 1E7OA 1HD3A 2LQKA 2DEQA 4ME7A 4HCCA 2GGRA 4L6V5 1WHKA 1YBYA 2X9HA 2DF6A 2RMOA 3A32A 4KGZB 4EPCA 1EIFA 3ERRA 5C51B 1UGQB 4UP8A 1ATIA 4C0DC 2V26A 2DL4A 1Q7YU 1NJ1A 3V7RA 4PK4A 1F1BB 3JCMc 4C92A 4BUGA 4J6YA 3RESA 2ZT7A 3NGPA 3OB9A 4HA8A 4RG8A 3FJ5A 3QO8A 1VQ9A 1YIJT 1YHQA 3FB9A 3JV3A 1BIBA 2COYA 3UA7A 2Z0WA 1Q7YR 2CT3A 3CCSQ 1M4ZA 5K1PA 3DB4A 2L8DA 3VS3A 4V2SA 3MP8A 2EWNA 3JB9F 1W70A 1G51A 2P84A 4ZTZB 2VXEA 2DL5A 3CPFA 4EO4A 5CQXA 4M7DE 1K8AR 4YRMA 1D1AA 4B9XA 4CS3A 4PJOG 4C5IA 4LNSA 3MEWA 2LQNA 3UWNA 3V8LA 4X9CA 2OAWA 1WJSA 2C06A 3I35A 1V29B 2DU5A 1LYLA 4FCYA 3OW2A 3PIPA 4KH0B 3QKJA 2K3BA 2ODRC 2JXBA 3FIFA 4R56A 1RAAB 1E1TA 1VQNA 3SD4A 1X27A 3G7ZA 5F5WA 4M75A 1XQHA 1IHVA 3I9QA 1KD1R 4M75F 3A1PA 4XTXA 1VQ8Q 1M8MA 4FM4B 1ZHIA 4HKEA 1UB4A 4MMKA 1BI1A 5FU7B 2RHXA 3HRSA 2MAMA 2ZPGB 2CJBA 1GBRA 2L3RA 3CPWS 1I1JA 2QK0A 3CCVQ 2LJ0A 3SWNA 2MK5A 2K3XA 1VIEA 2R58A 1WDXA 2V8KA 3OYFA 4F7UG 4LDYA 3H0HA 1NYQA 3CC7T 3OMCA 3RACA 1IZ6A 3I5SA 2CUBA 2DD5A 1WFWA 4FIBA 2CZ1B 1YITQ 2CP7A 1U5SA 1W2BA 1S72T 4IUUA 2J06A 2MPXC 4HCZA 1N6AA 2QEXA 5HK3A 4J9IA 1EIYB 4BI8B 4NL2A 2ROLA 2LQ8A 1B8AA 3G6ET 1UGPB 1SRYA 3BDUA 1KSWA 4XU1A 4J5YA 1EFNA 4N4HA 1ARKA 1OI1A 1JJ2A 1VA7A 5LJ3h 3CCQT 4P3OA 3GF5A 2ZNIA 1W1FA 5GAOr 3HY1A 4AG1C 1G3WA 1GXIE 2KK4A 1KOGA 3OYNA 1TWBA 2K2VA 1QP3A 4Z8AA 4LNPA 2DVEA 3TEEA 1BYMA 2DKGA 4P72A 1SERA 1JJ2S 3CC4A 2R57A 4C92E 5GAMj 5LJ3e 2VASA 2EVRA 3JB9H 5GANf 2CREA 1PKTA 1KIKA 4YRTA 2EGAA 2QQRA 4PJOA 1YITT 1EVLA 1WPYA 2LVMA 2VB6A 1NM7A 1NYGA 1WGSA 4C8QG 2F5KA 2MIOA 1VYTA 1U3OA 2EQMA 4M77A 2A8EA 2QQAA 3PCOB 2JMAA 3FDRA 3CC7A 2K4YA 5LJ5f 1PYSB 4O2DA 5GANg 2LNVA 2QI2A 5M9OA 3REBB 2W10A 3TU4K 4A4HA 4ZIBA 4BB7A 4F7UA 4M77E 3OW2S 3LWIA 3EHRA 3MO8A 3L2RA 1FMKA 5FLXE 1FYFA 5DLQE 3X26B 5LJ3j 2VGNA 5L23A 4OB2B 1E24A 2L0AA 5A2QE 4JJDA 3IKMB 2LCLA 3M0RA 5CR2A 3M0UA 4E7SA 1VQMA 2HEQA 2HZYA 4C5GA 4UP7A 4D8KA 1UJYA 2DAQA 2JMCA 4J9HA 3E9IA 4YP0A 1YJ9A 1GFDA 2E3IA 1TTHB 2X4YA 1MUZA 1W2BP 3DKMA 1M2VB 3T9NA 4IUPA 2DXCA 3VUZA 4LVIA 2IIMA 5IXBA 3V8JA 4DOVA 1E22A 2FPEA 2EYQA 3QZ5B 3E1SA 5FU6B 1E6HA 4OLFA 2K57A 1IHWA 1Q82U 3QO7A 1K73U 3C12A 3WVDB 4TVAA 1G3SA 4PLLA 3MP1A 1OULA 3MEYA 4BI4A 3H0FA 4M75B 4P71A 2K7AA 4LUDA 3INZA 3V7SA 2EGEA 3CBOA 4M78G 3M4YA 5GMKi 4C0FA 3TCJA 3JAME 2FRYA 4P74C 1BI3A 4LUEA 2I4OA 1Q82C 3CMAA 2RD1A 3JB9D 3VQWA 3CPWP 3UH0A 1Y96A 3HFZA 3S6WA 1GFCA 5KE3A 2QASA 3UATA 4M77D 4A63B 4M4ZA 4EDUA 3CD6T 1N8RU 1MMDA 2JOYA 4KULA 1NJ2A 3EGDB 1EQRA 3OS1A 2VXFA 2Q7HA 4M78F 4YRRA 4F04B 1OPKA 3QHSA 1K0SA 2CKKA 2D0NA 4OGEA 2EYZA 2ZZDA 4C92B 2HBPA 2LC4A 2ODRD 2LX9A 3QBYA 3OS5A 3TEHB 2M02A 2DEUA 4AG2C 1T3LA 3KFUA 4J6WA 1RAFB 4JZ4A 1N5ZA 2DTHA 4XTZA 5GAMg 1NJ6A 3F70A 4J9FA 1UFFA 1X69A 5IAYA 1WA7A 2KT8A 3PFSA 4LDXA 2M0OA 3CD6Q 4TVYA 4CH3A 1NYFA 1C1AA 4IUTA 1VYUA 5A0LA 2ENMA 3C4SA 2XMFA 5GANd 2KRNA 4ZTFA 1KJWA 3HRTA 3A5YA 4CH5A 5CAIA 1NNHA 1PHTA 2EQKA 2ZPFB 1YWPA 4BDYA 1KC8U 1YFRA 2Q5IA 4AFUC 3OYIA 1B76A 3CBMA 1EOVA 2HD0A 4N4IA 1WI7A 3QIIA 1Y0MA 2I4MA 2I0NA 2RI5A 2EJ9A 2DM1A 2YT6A 5AT1B 3CCUQ 1RACB 1YHQQ 5C0MA 1LOJA 8AT1B 5LJ3d 2LMJA 3PTAA 2K2MA 1TS9A 3CMET 4TVRA 1PSFA 5CKBA 6AT1B 4M7AD 2KR3A 3L2ZA 5LJ5g 1M1KU 4HT8A 4HVVA 5LL6S 1ZA2B 1V1CA 2DRKA 3CC2A 1AWXA 4LVJA 1UHFA 4H2XB 5AYFA 1M90R 4YRCA 4ZTUB 5FROA 3G4SA 3HXUA 1D0YA 2YRVA 2GBQA 3SB2A 4BY6B 3RMQA 1WIEA 2ZIOA 3VKIA 1BBUA 2RM4A 1VQ6Q 5D6YA 4BE0A 2LT1A 4XU0A 2GF7A 4II1A 1WXTA 3RMSA 4YRPA 1G3YA 5CKEA 1VQMQ 3FJPA 2NWMA 5KCHA 2PMFA 4PLIA 4PHCA 2M51A 3SHWA 2I4NA 4CC7A 5D7UA 1M8VA 4YCUA 1AEYA 1D09B 1SSFA 3GNGA 4X34A 4M75E 2QHTA 2XI9A 1VQ9T 3CCMT 1TOVA 1J5WA 2M1HA 1Q95G 2LX7A 2RJDA 5DY9A 3QJ6A 3LLRA 2XDDA 3HFVA 1RUWA 2K9GA 2K5FA 3NTIA 2QQ9A 3CCRQ 5FW9A 1OX9A 3TREA 1M1GA 5IHIA 2KGTA 4TTVA 3A7UA 4JS5A 1I0CA 2DZ9A 4IKFA 4J6XA 2IG0A 1K9MC 2RQTA 2KYBA 2E6ZA 2V8JA 2F2WA 2V1RA 2NUPB 5I2SA 4YRJA 1KG1A 4JPBW 1BCMA 3M0QA 2XHCA 1PRMC 3JCMJ 2AKWA 1DJ7B 4ZTJA 3S3NA 4JRPA 4YRKA 4KBMB 3VS0A 3RR6A 2A28A 1GL5A 2M16A 2BTTA 5GAOn 1M3CA 3HRKA 3FLGA 1SETA 3I55T 2ZT6A 1WX6A 2ATCB 4MDWA 3L2VA 4WI1A 4N4GA 4LXCA 3M56A 2DTIA 3IALA 2L3QA 1USYC 4P75C 2B86A 4WCIA 3LWHA 1AZGB 2AT1B 4JLGA 2VGMA 1HXDA 3OYMA 4OGCA 5I11A 1SKUB 1MHNA 1O9SA 2FZKB 3NHNA 4E47A 2KE9A 1NBEB 1I5OB 2HSPA 4RTXA 1BB9A 1RI0A 2BE7D 4QT7A 5C53B 4RUGA 5KYWA 3L4GA 5KCOA 1SRMA 3OW2P 3RGLA 3PMIA 4M75D 4DBRA 1VQ7Q 1KHCA 1RI9A 1JB0E 3EGXB 4HT9A 2JTFA 4M7DB 5KYNA 1SF9A 5A0DA 4BE1A 1Y57A 1KQSA 2AKKA 3HP9A 1PD1A 1KMMA 2DLPA 1G8XA 3CD6A 2F2XA 2GNCA 2CUDA 4YROA 3JCMP 1PC0A 1RLPC 3OYEA 1S72A 2C0TA 8ATCB 2WACA 1B70A 2L2PA 3ZBDA 4JJCA 2KRMA 1KD1U 3QO5A 4RQFA 3I55A 4HWRA 3NETA 2CP5A 4L5GA 2LT4A 2RHUA 2QHSA 1WHJA 1Q81U 2R5MA 3Q1JA 4HVCA 2RI2A 3ICAA 2IY5A 4F7UF 4KT0E 3HRIA 1QVGA 2VKNA 3VYGA 2JTEA 2GFUA 3VV0A 4CC4B 1TUGB 4HWTA 1ZSGA 3UGTA 1D1BA 5GAOl 2JTMA 4RMOA 3MJXA 2HKNA 2VYTA 5CVIA 5KYWB 2QXFA 1U1SA 2QTXA 3A8LB 4ZGJB 1MMNA 2DYIA 3CCJT 4OF1A 1BKBA 3OSVA 1R8OB 4ELYC 2X3WD 1MV3A 2NS6A 2COWA 1YCSB 1M2OA 4ZGEB 3EGUA 3RKYA 2DA9A 4KR3A 2WSFE 2EGCA 2E10A 4RTZA 3TSZA 2RA2A 4RMFA 2LRQA 2RHIA 3RF1A 2X51A 4LVKA 2CJ9A 1OYXA 1YN8A 1UGSB 3E9GA 1SEMA 3C0CA 2ZZFA 2DL8A 3JB9G 3FEOA 3SDZA 1K73C 2EYXA 1KC8R 1FMVA 3H0IA 1FYNA 4XTUA 2HNIA 3JCMf 3E19A 1WXBA 1XJWB 1VUBA 1UE9A 4BE2A 2L89A 1OQKA 3M55A 2YRDA 4CRIA 3G71A 1CSKA 3NTKA 4UC4A 4E7ZA 4KR2A 5FRNA 2ARTA 4M77G 2X3XD 4YRSA 1B34B 2NUPA 2HL5C 2PMEA 4RTTA 4LDVA 4M78C
chains in the Genus database with same CATH topology
3A8HB 4KUIA 1WNLA 1N27A 1XNIA 4VUBA 2PU9B 3LGLA 1VQ8T 2ZNJA 2RHSA 4JRKA 5KE2A 2FHDA 3CCMA 4HCBA 2DU7A 4M75C 2RK1A 3VBBA 2EL9A 5ELOA 4J7IA 4DOWA 5GAMd 3WQZA 1N9SA 1ZQ1A 2XGTA 1WJQA 2F5TX 3CXCS 3PNWC 1N9WA 3NFCA 3CCVA 4L59A 5HKCA 3M53A 2P0LA 5IN1A 2Y4XA 1I81A 1IREB 3LGFA 2ALYA 4JRIA 3OY9A 4FL6A 4NOYA 3CXCA 3H8ZA 3G6EA 1KC8C 2PVGB 2ZT8A 4ZN3A 4E7JA 1X6OA 2RHQB 4C8QD 5LJ3g 3SFMA 4QVZA 3X25B 4M78D 3JSCA 4HWSA 3QUIA 4P73C 4LDUA 2DJZA 2XKOC 1K8AC 3MQZA 4YRQA 5EG2A 3HY0A 1VQZA 3VJPA 3CCJA 3LX7A 3QG1A 2GCXA 3S3OA 5E3IA 3P8HA 2FL7A 4OMFB 2E1HA 3QNEA 5GMKe 3EAEA 4ZGDB 1WQWA 3CCVT 4UP9A 2KVQG 3AHUA 3HSBA 2EJGA 1I8FA 4EMKB 3ER0A 2FYKA 5C6SA 1U1TA 3LW5E 3A8OB 3VYHB 1HTTA 3M54A 1NJIU 4CI0C 3LYIA 4OB0B 1M90C 4C0ZA 4P72C 2X4WA 2XG8D 3A74A 3EFRA 4YRLA 3H6ZA 4B9WA 3MEUA 4BD3A 2E3CA 1VQ5A 1Y96B 2KY9A 5GMKj 2DD4A 3GIBA 2XDPA 3L2UA 4DA4A 5FRMA 2DO3A 2CGHA 1WYDA 3QYGB 5ELNA 3CCET 3P8VA 12ASA 4E7KA 2ALYB 1VQPT 5IT9E 1PSEA 5HK0A 3KXTA 4C5HA 4X9DA 3ZFJA 4M7AB 5CIUA 2P0QA 4Y28E 2KAFA 4A4EA 3A7RA 2ZGWA 4C92D 5KNNA 4YTLA 4EMKA 5GAMf 1E1OA 4GLKA 2ZZGA 3HL8A 11ASA 3J80E 4P5NA 1H4TA 5LJ5h 2OTLA 1C0AA 3O8VA 4XEMA 3JCMd 3VQXA 2QA4T 5DM7R 5CO7A 4BACA 2K3YA 2X35A 1X75C 3OYKA 4KQEA 4ZN1A 2AHJB 2Y90A 4Q15A 2BKDN 5LJ5j 2ZTGA 3HHTB 2DQ3A 4K86A 3M4PA 1P92A 5D6XA 2LTOA 3PMTA 4ATOA 2MMPA 3S3MA 3LSQA 1PYSA 2CZ0B 4YRIA 2RHQA 5GAMh 3JCMQ 2DPPB 4YRGA 1Z7MA 2P5IA 4NL3A 4Q5WA 3R6OA 3JB9J 2MF2A 5KH6A 4RKUE 1K8AU 1YITA 2D6FA 5CQYA 2I4LA 2QEXT 2WSCE 2ZINA 1X56A 2XICA 3CCST 1YIJA 3HFOA 4EMKC 4XEOA 2E64A 3VQVA 3ME9A 3QDRB 1KQ2A 2OTJA 1VIFA 4P71C 4BWAA 4RCCA 2O01E 2IY5B 2FVUA 3UPUA 2RHSB 3LC0A 5K1XA 1JRIA 4P74A 1Q86U 2RJEA 3CPWA 4HWPA 3ASKA 5LJ3f 1NYRA 5D6WA 4MMLA 1JJCA 3W3SA 3SWNB 4M7DD 3NENA 4M7AE 4YCVA 1EFWA 4H2SA 1W66A 1QVFA 3IKLA 4WF2A 4O6JA 3VU3C 1BI0A 2YLBA 4TVWA 3MEVA 3OA6A 1Q86C 1BIAA 4K87A 1M5Q1 5I21A 4XAXB 2DTOA 3L4GB 4QVDA 3OYHA 4MZTA 3DLLA 4IUVA 4L87A 4OP0A 3P8YA 1YJWT 1FWZA 3HFNA 3MP6A 2OTLT 3OS0A 4XU2A 4PJOF 2ZPHB 2EFIA 2ZIMA 2ZXFA 5GMKm 2VUBA 3I56T 4HWOA 3M9QA 1VQ5T 1KQSS 1I4K1 1VQ7T 2C8MA 2RJFA 1VQ6A 3DB3A 3NEMA 3OSSC 1Q7YC 4BI3A 4M7DC 2XK0A 1FXXA 3C94A 3OBYA 1VQPA 3E9HA 3FC3A 4E7IA 2AKWB 2RK2A 1QW1A 3HPWA 5GAN2 1JJCB 2HQXA 4BDZA 3OD1A 2RHYA 4NCXA 4CS2A 3OYYA 2L5QA 1VQLA 1Q81C 4CS4A 5CKHA 4YCWA 1YGBA 2KMTA 1QVGS 4LDWA 2J3LA 2RO0A 3MF1A 3JCMb 1ADJA 1M9SA 4A4GA 2R5AA 4LD9K 1MGQA 2K5IA 4O5VA 4QQDA 3P8DA 2ARUA 3L1AA 3J81E 4M7DA 3KBGA 4WJ4A 1X2GA 3OYDA 3A7AA 5I2MA 2EAYA 2ZR3A 2FB7A 5GAN8 1YJNT 2D9TA 3NELA 1QP2A 1G5IA 5GANe 3GOXA 3OYAA 4P75A 1VQKA 2O4XB 1H3ZA 4P3PA 3L42A 1N8RC 4CH6A 1W2BS 2MWPA 3A5ZB 5J3BA 4QQGA 4NS5A 2PQWA 1VQMT 3LSSA 2DIQA 1BBWA 4PG3A 4JJNK 1Y7XA 3META 3CC2T 3V8KA 2EJFA 1YJ9T 4P3NA 3HKSA 3HRUA 4JS4A 2KQWA 2RHZA 4J7FA 1EVKA 3PIOA 4M7DG 4BW9A 1IL2A 1H4SA 3RERA 4PKCC 4FSXA 5GANh 4C8QA 3R07A 2JN0A 2AMCB 4XK8E 2I2LA 4A4FA 2DXBA 3JCMh 4JRQA 1USYA 5HGQA 1RL2A 4UPAA 2ZPBB 5CKDA 4H2VA 3GPLA 4Q6GA 2YHTA 3MHXA 1ASYA 3JCMX 2OTJT 3V7CA 4PJOE 2C7IA 2LDMA 1LJOA 4A53A 4MDXA 3IG2A 4J15A 3G4ST 1X54A 1UEBA 3TEHA 1VQKT 2DK3A 4XU3A 3REUA 3UGQA 1TH7A 2ZPIB 5L8RE 4TQFA 4EMGA 3LH0A 1YB3A 3M4GA 3RIRA 2YLCA 1D3BA 5CK9A 4M7AA 4RQEA 5LJ5d 2DXUA 2B8AA 5CCAA 3QSUA 1B7YA 1Y07A 3RKXA 1VQOT 5FU7C 3JCMe 4C92G 3KUFA 3UDCA 3HXZA 4M77F 4TQDA 4FT2A 3RL6A 1OZ3A 3JCMg 3REXA 3QXEB 5GAOp 2PUOB 2ZPEB 3PGGA 1YI2T 4N0AA 4XTVA 4TVAB 3I56A 4ELZC 4FU6A 2GFAA 2XU8A 1WJRA 1YJNA 3P8BB 2JZ2A 2XD0A 2KSSA 3CCRT 3OYJA 3HXXA 2RH2A 3M59A 4DQ2A 1K9MU 3DSQA 3X24B 2E12A 3GLXA 3WXMB 3A8GB 3JCMV 4C0GA 4Z02A 3CC4T 3DLMA 1VQLT 1M1FA 4N0AC 2QQBA 3WVEB 2MWOA 5A0GA 4OB1B 4D6WA 1G5HA 1HK9A 4C8QF 3M5AA 3MEAA 5GAN3 1Y71A 3HFZB 3CCUA 4BY6C 1L0WA 1NZ9A 3M57A 4R55A 1YJWA 3J7AF 3GNFB 3CMEA 2NLUA 3RKWA 2QHVA 1NJ5A 2E6NA 1H641 2VV5A 4PJOB 2ZZEA 3BFMA 1M90U 2JNGA 1VQ7A 2CYZB 4H2TA 1H4VB 1QF6A 2P0PA 2DDZA 3L2WA 2E70A 5J26A 2DXTA 4CH4A 1LNXA 1WLEA 3CCLA 3N5BB 1VQ4T 1KMNA 4GY5A 1M1KC 4M7DF 3OYGA 3SWNC 1VQOA 2H3JA 2HQEA 2DZCA 3CCEA 1XTDA 3A31A 1U8RA 2ZT5A 2JUFA 2RB6A 4E51A 3QO3A 2DQ0A 2GQVA 4QW2A 5J39A 1VQ8A 4K88A 4M78E 3HXVA 4FT4A 1B34A 3QZ9B 3RUXA 3TEGA 5GAN6 1YHQT 4F7UB 1WU7A 3P8TA 2F69A 3MCAB 5LJ5e 2MI6A 4P73A 3M4QA 1KD1C 4KUDK 4C0DB 2PVOB 3OYCA 3G71T 3PCOA 1G3TA 2XTIA 4JUVA 4M77B 3CCRA 3NTHA 3URGA 4PJOD 2E5QA 5HY6A 4JLIA 4H2UA 3GP8A 2WSEE 3EFSA 2QA4A 4AH6A 1NPRA 2HAXA 1VQ6T 2ZCEA 1X55A 1H4QA 1ZBXA 2BUDA 4OB3B 2PVDB 3PZCA 3BY7A 2D0QB 2Q7GA 3VUBA 1N9RA 3M58A 4IUQA 2RJCA 2KDSA 2Y4YA 4H2WA 3QPHA 2K5LA 3PT9A 4PL6A 4J8OA 3CMQA 4C8QE 1NPPA 4A54A 3CCUT 1EIYA 4LVLA 1BI2A 2QDYB 4G85A 1GGMA 1ASZA 4H2YA 1W4SA 2G3RA 2E5AA 4JDSA 1AHJB 2A7YA 1I5LA 3QJYA 2EQUA 4C8QC 2A3LA 1B70B 3E9FA 1QVPA 1X2HA 3C95A 4YYEA 2E65A 4IURA 2RI3A 3MF2A 2EKOA 4A4KA 2XDBA 3CBPA 2CIMA 5GAN4 3HTZA 3JCMW 4E7LA 2OAUA 1NJ8A 4YREA 1VQNT 2CS7A 1HC7A 3L2QA 4YPFA 5GANj 1WQ7A 4XTYA 3BW1A 1G5VA 4J83A 2PUKB 2EQJA 2LCCA 3UT1A 3JRZA 3QYHB 4M75G 1XOVA 3FRNA 5FU6C 5GAOq 4M78B 1X01A 1YCYA 4RDXA 2VC8A 2EIFA 4F7UE 3OYLA 4WJ3M 4QQ6A 4YDQA 1B7YB 3ZEHA 2CZ7B 5GAOm 4QVCA 4C92F 3TUPA 3BDLA 1D3BB 2G4CA 2Q7EA 1O75A 4M77C 2CZ6B 5GAN5 3I7FA 4MZMA 1NE8A 4E7HA 3CCLT 2ZR2A 2X4XA 2J3MA 3X28B 2P0KA 1RIQA 4H02A 4LVMA 4EMHA 3A8MB 5GAN7 3VQYA 1NJIC 1Z7NA 4XQ3A 3CCQA 2M9UA 2DIGA 3QTCA 4M7AG 4HT4A 4EX5A 2X4JA 1OZ2A 4YRNA 3OQ5A 4PNOA 4C92C 1UGRB 4PJOC 2AMCA 3UFGA 4X5OA 4RCBA 4C8QB 1FX7A 2BIVA 2XIDA 4DPGA 3OBWA 5DLOA 2IVWA 1QE0A 4H2XA 4M7AC 5GMKh 2JVVA 3X20B 2Q5HA 1YFTA 2V8IA 1KHIA 5GMKl 5GAMe 4Y91A 4RG2A 4M78A 2E41A 3JB9I 1YFSA 1YI2A 3A5ZA 2QHUA 4OVAA 4G84A 1SESA 2ARSA 2ZCFB 1JBMA 3HXYA 4C5EA 3CEYA 2O4XA 5CKFA 1KQ1A 4LD6A 3CMAT 5C52B 2QQSA 3BJUA 4XTWA 3CCSA 3G1ZA 4M7AF 2CJAA 1VQ4A 4TWAA 3OMGA 3OS2A 1QVFS 2P4TA 4YRFA 3HXWA 4MZPA 1ADYA 3OYBA 2LQKA 2DEQA 4ME7A 4HCCA 4L6V5 1YBYA 3A32A 4EPCA 1EIFA 3ERRA 5C51B 1UGQB 4UP8A 1ATIA 4C0DC 1Q7YU 1NJ1A 3V7RA 3JCMc 4C92A 4BUGA 4J6YA 3RESA 2ZT7A 3OB9A 4HA8A 4RG8A 3QO8A 1VQ9A 1YIJT 1YHQA 3FB9A 1BIBA 1M4ZA 5K1PA 3DB4A 2L8DA 4V2SA 3MP8A 2EWNA 3JB9F 1G51A 4ZTZB 2VXEA 3CPFA 4EO4A 5CQXA 4M7DE 4YRMA 4B9XA 4CS3A 4PJOG 4C5IA 4LNSA 3MEWA 3UWNA 3V8LA 4X9CA 1WJSA 2C06A 1V29B 2DU5A 1LYLA 3OW2A 3PIPA 3QKJA 2ODRC 3FIFA 4R56A 1E1TA 1VQNA 3SD4A 3G7ZA 5F5WA 4M75A 1XQHA 4M75F 4XTXA 4FM4B 1ZHIA 4HKEA 1UB4A 4MMKA 1BI1A 5FU7B 2RHXA 3HRSA 2MAMA 2ZPGB 2CJBA 2L3RA 3CPWS 3SWNA 2K3XA 1VIEA 2R58A 2V8KA 3OYFA 4F7UG 4LDYA 1NYQA 3CC7T 3OMCA 3RACA 1IZ6A 2DD5A 4FIBA 2CZ1B 1W2BA 1S72T 4IUUA 4HCZA 1N6AA 2QEXA 5HK3A 1EIYB 4BI8B 4NL2A 2LQ8A 1B8AA 3G6ET 1UGPB 1SRYA 3BDUA 4XU1A 4J5YA 4N4HA 1OI1A 1JJ2A 5LJ3h 3CCQT 4P3OA 3GF5A 2ZNIA 5GAOr 3HY1A 1G3WA 1GXIE 2KK4A 1KOGA 3OYNA 2K2VA 1QP3A 2DVEA 3TEEA 1BYMA 2DKGA 4P72A 1SERA 1JJ2S 3CC4A 2R57A 4C92E 5GAMj 5LJ3e 3JB9H 5GANf 4YRTA 2QQRA 4PJOA 1YITT 1EVLA 1WPYA 2LVMA 1WGSA 4C8QG 2F5KA 2EQMA 4M77A 2A8EA 2QQAA 3PCOB 3CC7A 3FDRA 2K4YA 5LJ5f 1PYSB 4O2DA 5GANg 2LNVA 2QI2A 5M9OA 3TU4K 4A4HA 4ZIBA 4BB7A 4F7UA 4M77E 3OW2S 3LWIA 3MO8A 3L2RA 5FLXE 1FYFA 5DLQE 3X26B 5LJ3j 2VGNA 4OB2B 1E24A 5A2QE 3IKMB 2LCLA 5CR2A 1VQMA 4C5GA 4UP7A 2DAQA 3E9IA 4YP0A 1YJ9A 2X4YA 3DKMA 3T9NA 4IUPA 2DXCA 3VUZA 4LVIA 3V8JA 4DOVA 1E22A 2EYQA 3QZ5B 3E1SA 5FU6B 4OLFA 2K57A 3QO7A 1Q82U 1K73U 3C12A 3WVDB 4TVAA 1G3SA 4PLLA 3MP1A 3MEYA 4BI4A 4M75B 4P71A 3INZA 3V7SA 3CBOA 4M78G 3M4YA 5GMKi 4C0FA 3TCJA 3JAME 4P74C 1BI3A 2I4OA 1Q82C 3CMAA 2RD1A 3JB9D 3VQWA 3UH0A 1Y96A 3HFZA 3S6WA 5KE3A 4M77D 4EDUA 3CD6T 1N8RU 2JOYA 4KULA 1NJ2A 1EQRA 3OS1A 2VXFA 2Q7HA 4M78F 4YRRA 3QHSA 2CKKA 4OGEA 2ZZDA 4C92B 2HBPA 2LC4A 2ODRD 2LX9A 3QBYA 3OS5A 3TEHB 3KFUA 4J6WA 2DTHA 5GAMg 4XTZA 1NJ6A 3F70A 5IAYA 4CH3A 3PFSA 4LDXA 2M0OA 4TVYA 4IUTA 5A0LA 3C4SA 5GANd 4ZTFA 3HRTA 3A5YA 4CH5A 5CAIA 1NNHA 2EQKA 2ZPFB 4BDYA 1KC8U 1YFRA 2Q5IA 3OYIA 1B76A 3CBMA 1EOVA 2HD0A 4N4IA 3QIIA 2I4MA 2RI5A 2EJ9A 5C0MA 1LOJA 5LJ3d 3PTAA 3CMET 4TVRA 1PSFA 5CKBA 4M7AD 3L2ZA 5LJ5g 1M1KU 4HT8A 5LL6S 3CC2A 4LVJA 4H2XB 5AYFA 4YRCA 4ZTUB 5FROA 3G4SA 3HXUA 2YRVA 3SB2A 4BY6B 3RMQA 2ZIOA 3VKIA 1BBUA 2RM4A 5D6YA 4BE0A 2LT1A 4XU0A 2GF7A 4II1A 3RMSA 4YRPA 1G3YA 5CKEA 3FJPA 5KCHA 2PMFA 4PLIA 4PHCA 2I4NA 1M8VA 4YCUA 1SSFA 3GNGA 4M75E 4X34A 2QHTA 2XI9A 1VQ9T 3CCMT 1J5WA 2M1HA 2RJDA 5DY9A 3QJ6A 3LLRA 2XDDA 3HFVA 2K5FA 3NTIA 2QQ9A 3TREA 1M1GA 4TTVA 3A7UA 4JS5A 2DZ9A 4IKFA 4J6XA 2IG0A 1K9MC 2E6ZA 2V8JA 4YRJA 5I2SA 1KG1A 2XHCA 3JCMJ 2AKWA 1DJ7B 4ZTJA 3S3NA 4JRPA 4YRKA 4KBMB 2M16A 5GAOn 3HRKA 3FLGA 1SETA 3I55T 2ZT6A 4MDWA 3L2VA 4WI1A 4N4GA 3M56A 2DTIA 3IALA 1USYC 4P75C 3LWHA 4JLGA 2VGMA 1HXDA 3OYMA 4OGCA 1MHNA 1O9SA 4E47A 1RI0A 5C53B 3L4GA 5KCOA 3RGLA 3PMIA 4M75D 1KHCA 1JB0E 4HT9A 2JTFA 4M7DB 5A0DA 4BE1A 1KQSA 3HP9A 1KMMA 3CD6A 4YROA 3JCMP 3OYEA 1S72A 2WACA 1B70A 3ZBDA 1KD1U 3QO5A 4RQFA 3I55A 4HWRA 3NETA 4L5GA 2LT4A 2RHUA 2QHSA 1Q81U 2R5MA 3Q1JA 4HVCA 2RI2A 3ICAA 2IY5A 4F7UF 4KT0E 3HRIA 1QVGA 3VYGA 2GFUA 3VV0A 4HWTA 3UGTA 5GAOl 2JTMA 4RMOA 2VYTA 5CVIA 2QXFA 1U1SA 2QTXA 3A8LB 4ZGJB 3CCJT 4OF1A 1BKBA 3OSVA 1R8OB 4ELYC 2NS6A 4ZGEB 3RKYA 4KR3A 2WSFE 2E10A 2RA2A 4RMFA 2LRQA 2RHIA 3RF1A 4LVKA 2CJ9A 1OYXA 1UGSB 3E9GA 2ZZFA 3JB9G 3FEOA 3SDZA 1K73C 4XTUA 2HNIA 3JCMf 3E19A 1VUBA 4BE2A 2L89A 3M55A 4CRIA 3G71A 3NTKA 4UC4A 4KR2A 5FRNA 2ARTA 4M77G 4YRSA 1B34B 2PMEA 4LDVA 4M78C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCX A;  5LJ3 j;  1I5L A;  4CS2 A;  1E24 A;  3IKM B;  4CS4 A;  1WNL A;  4C8Q C;  1B70 B;  4YCW A;  1YGB A;  1X2H A;  2ZNJ A;  4UP7 A;  2RHS A;  4YYE A;  2J3L A;  2E65 A;  3MF1 A;  4JRK A;  3JCM b;  3E9I A;  1ADJ A;  4YP0 A;  3MF2 A;  2DU7 A;  1MGQ A;  4M75 C;  2CIM A;  2ARU A;  3L1A A;  5GAN 4;  4M7D A;  3HTZ A;  3VBB A;  3JCM W;  2EL9 A;  5ELO A;  3V8J A;  1E22 A;  5GAM d;  4WJ4 A;  1X2G A;  3WQZ A;  1N9S A;  1NJ8 A;  3A7A A;  2XGT A;  4OLF A;  2K57 A;  2EAY A;  3QO7 A;  2ZR3 A;  2FB7 A;  5GAN 8;  4YRE A;  4TVA A;  1N9W A;  1HC7 A;  3NEL A;  3MEY A;  1G5I A;  5GAN e;  4YPF A;  4M75 B;  4P71 A;  2P0L A;  3INZ A;  5GAN j;  1WQ7 A;  3V7S A;  4XTY A;  4P75 A;  4M78 G;  3BW1 A;  1I81 A;  2ALY A;  4JRI A;  4NOY A;  4P3P A;  5GMK i;  4CH6 A;  4P74 C;  3LSS A;  4M75 G;  2ZT8 A;  1BBW A;  4PG3 A;  5GAO q;  4M78 B;  1X01 A;  1YCY A;  2I4O A;  2RHQ B;  4RDX A;  2RD1 A;  4C8Q D;  3JB9 D;  2VC8 A;  3V8K A;  2EJF A;  5LJ3 g;  3UH0 A;  3VQW A;  1Y96 A;  3HFZ A;  4F7U E;  4P3N A;  4M77 D;  4WJ3 M;  4M78 D;  4YDQ A;  1B7Y B;  5GAO m;  4QVC A;  4HWS A;  4C92 F;  3TUP A;  1NJ2 A;  1EQR A;  3QUI A;  1D3B B;  1EVK A;  4P73 C;  4M7D G;  1IL2 A;  4BW9 A;  1H4S A;  2DJZ A;  2VXF A;  3RER A;  2G4C A;  5GAN h;  4C8Q A;  2Q7H A;  4M78 F;  3R07 A;  2JN0 A;  4YRR A;  2Q7E A;  4YRQ A;  2AMC B;  3HY0 A;  3QHS A;  2I2L A;  4M77 C;  1VQZ A;  5GAN 5;  3I7F A;  3JCM h;  1USY A;  5HGQ A;  4UPA A;  2ZR2 A;  5E3I A;  4H2V A;  2J3M A;  4C92 B;  1RIQ A;  2ODR D;  4H02 A;  2E1H A;  4Q6G A;  3TEH B;  2YHT A;  3QNE A;  4EMH A;  5GMK e;  1ASY A;  3JCM X;  5GAN 7;  3KFU A;  3V7C A;  4PJO E;  4J6W A;  3VQY A;  1WQW A;  2DTH A;  4XTZ A;  5GAM g;  2C7I A;  4A53 A;  1LJO A;  4UP9 A;  1NJ6 A;  1Z7N A;  3IG2 A;  4J15 A;  4CH3 A;  1X54 A;  4XQ3 A;  4TVY A;  3AHU A;  3HSB A;  3TEH A;  2EJG A;  1I8F A;  4EMK B;  3QTC A;  4XU3 A;  4M7A G;  5GAN d;  2FYK A;  4EX5 A;  3REU A;  3UGQ A;  1U1T A;  4YRN A;  1TH7 A;  3A5Y A;  4CH5 A;  5CAI A;  1NNH A;  1HTT A;  4PNO A;  4TQF A;  4C92 C;  4PJO C;  4EMG A;  1YB3 A;  2AMC A;  1YFR A;  2Q5I A;  3UFG A;  1B76 A;  3M4G A;  4RCB A;  3RIR A;  4C8Q B;  4X5O A;  1EOV A;  2YLC A;  4DPG A;  1D3B A;  4M7A A;  4RQE A;  2I4M A;  5LJ5 d;  1QE0 A;  2DXU A;  3QSU A;  4P72 C;  4H2X A;  2EJ9 A;  1B7Y A;  4M7A C;  5GMK h;  3A74 A;  3EFR A;  3RKX A;  4YRL A;  1LOJ A;  2E3C A;  1Y96 B;  2Q5H A;  5LJ3 d;  1YFT A;  5GMK j;  3JCM e;  5GMK l;  5GAM e;  4C92 G;  3GIB A;  4Y91 A;  4M78 A;  2E41 A;  3JB9 I;  4M7A D;  2CGH A;  1YFS A;  3L2Z A;  5LJ5 g;  1WYD A;  4HT8 A;  3A5Z A;  2QHU A;  4G84 A;  1SES A;  2ARS A;  3HXZ A;  5ELN A;  1JBM A;  4M77 F;  3HXY A;  3P8V A;  12AS A;  4TQD A;  2ALY B;  4H2X B;  4YRC A;  1KQ1 A;  3RL6 A;  4ZTU B;  3JCM g;  3HXU A;  3REX A;  4X9D A;  4M7A B;  3SB2 A;  2ZIO A;  5GAO p;  5C52 B;  1BBU A;  2RM4 A;  3PGG A;  3BJU A;  4XTW A;  4N0A A;  4XTV A;  3G1Z A;  4M7A F;  2CJA A;  4TVA B;  4XU0 A;  4TWA A;  4YRP A;  3FJP A;  3A7R A;  2PMF A;  4YRF A;  4PHC A;  3HXW A;  2ZGW A;  4C92 D;  5KNN A;  4EMK A;  2I4N A;  5GAM f;  1ADY A;  1E1O A;  1M8V A;  2ZZG A;  4YCU A;  2DEQ A;  3HXX A;  4M75 E;  2QHT A;  11AS A;  3A32 A;  1J5W A;  4DQ2 A;  3DSQ A;  1H4T A;  3ERR A;  5C51 B;  5DY9 A;  3HFV A;  5LJ5 h;  4UP8 A;  1ATI A;  1NJ1 A;  3JCM V;  3V7R A;  3JCM c;  1C0A A;  4C92 A;  4XEM A;  3JCM d;  4J6Y A;  4TTV A;  3RES A;  2ZT7 A;  4HA8 A;  3VQX A;  3A7U A;  3QO8 A;  2DZ9 A;  3FB9 A;  1BIB A;  4J6X A;  4N0A C;  4KQE A;  5K1P A;  2Y90 A;  4YRJ A;  4Q15 A;  5LJ5 j;  1G5H A;  2ZTG A;  4V2S A;  1HK9 A;  2EWN A;  4C8Q F;  3JB9 F;  3JCM J;  1G51 A;  2AKW A;  2DQ3 A;  4K86 A;  4ZTZ B;  3M4P A;  4YRK A;  2VXE A;  4EO4 A;  4M7D E;  4YRM A;  5GAN 3;  4CS3 A;  3HFZ B;  5GAO n;  3HRK A;  3LSQ A;  1PYS A;  1SET A;  4YRI A;  2RHQ A;  4PJO G;  2ZT6 A;  1L0W A;  4LNS A;  5GAM h;  3V8L A;  4WI1 A;  3RKW A;  3JCM Q;  4X9C A;  2QHV A;  1NJ5 A;  2DTI A;  3IAL A;  2DU5 A;  1LYL A;  1USY C;  1H64 1;  4YRG A;  1Z7M A;  2P5I A;  4NL3 A;  4P75 C;  2ODR C;  3FIF A;  1E1T A;  4PJO B;  2ZZE A;  3JB9 J;  3BFM A;  1HXD A;  5F5W A;  4M75 A;  4H2T A;  1H4V B;  1QF6 A;  2DDZ A;  2I4L A;  4M75 F;  4XTX A;  2ZIN A;  1X56 A;  3HFO A;  4EMK C;  4XEO A;  2E64 A;  5C53 B;  4MMK A;  3L4G A;  2DXT A;  4CH4 A;  1LNX A;  1WLE A;  3VQV A;  3RGL A;  4M75 D;  1KMN A;  4HT9 A;  4M7D B;  2CJB A;  1KQ2 A;  4P71 C;  4BWA A;  4RCC A;  1KMM A;  2IY5 B;  4M7D F;  3SWN C;  2DZC A;  3A31 A;  4YRO A;  3SWN A;  3JCM P;  2RHS B;  2ZT5 A;  3LC0 A;  5K1X A;  1JRI A;  2RB6 A;  4E51 A;  1B70 A;  4P74 A;  3QO3 A;  2DQ0 A;  4F7U G;  1NYQ A;  4HWP A;  3QO5 A;  4RQF A;  3RAC A;  4HWR A;  3NET A;  5LJ3 f;  1NYR A;  4MML A;  4M78 E;  3HXV A;  4K88 A;  1B34 A;  1JJC A;  2QHS A;  3RUX A;  3W3S A;  3SWN B;  4M7D D;  3NEN A;  3TEG A;  5GAN 6;  4M7A E;  4F7U B;  1WU7 A;  3P8T A;  4YCV A;  4H2S A;  4HVC A;  1EFW A;  1W66 A;  1EIY B;  4NL2 A;  5LJ5 e;  3IKL A;  4P73 A;  1B8A A;  3ICA A;  4WF2 A;  2IY5 A;  1SRY A;  4F7U F;  3BDU A;  3M4Q A;  4XU1 A;  3VU3 C;  4J5Y A;  3HRI A;  2YLB A;  4TVW A;  3PCO A;  5LJ3 h;  4P3O A;  2XTI A;  2ZNI A;  4JUV A;  5GAO r;  4HWT A;  1BIA A;  3HY1 A;  1M5Q 1;  4M77 B;  5GAO l;  5I21 A;  4K87 A;  3UGT A;  1KOG A;  2DTO A;  4PJO D;  3L4G B;  4QVD A;  2DVE A;  1U1S A;  2QTX A;  4JLI A;  4L87 A;  4H2U A;  2DKG A;  4P72 A;  1SER A;  4OP0 A;  3P8Y A;  4C92 E;  3EFS A;  5GAM j;  3HFN A;  4AH6 A;  5LJ3 e;  4XU2 A;  2ZCE A;  4PJO F;  3JB9 H;  1X55 A;  3RKY A;  2ZIM A;  1H4Q A;  5GAN f;  4KR3 A;  2E10 A;  2ZXF A;  4YRT A;  2RA2 A;  4RMF A;  5GMK m;  4PJO A;  3RF1 A;  1EVL A;  1WPY A;  4HWO A;  2CJ9 A;  3PZC A;  2ZZF A;  1I4K 1;  4C8Q G;  3JB9 G;  3BY7 A;  2C8M A;  4M77 A;  2Q7G A;  4XTU A;  2HNI A;  3JCM f;  3NEM A;  1N9R A;  3PCO B;  5LJ5 f;  1PYS B;  4O2D A;  5GAN g;  4H2W A;  4M7D C;  3CMQ A;  4C8Q E;  4A54 A;  1EIY A;  3E9H A;  4ZIB A;  4F7U A;  2AKW B;  4M77 E;  4G85 A;  1GGM A;  4KR2 A;  2ART A;  1ASZ A;  4M77 G;  4H2Y A;  5GAN 2;  4YRS A;  1B34 B;  1JJC B;  2E5A A;  1FYF A;  2PME A;  3OD1 A;  4M78 C; 
#chains in the Genus database with same CATH topology
 3A8H B;  2FEI A;  4ANJ A;  4KUI A;  1WNL A;  3EG9 A;  1N27 A;  1XNI A;  2CP6 A;  4E2F B;  2YSQ A;  5EC7 A;  4VUB A;  2PU9 B;  3LGL A;  1VQ8 T;  2ZNJ A;  3G1J A;  2RHS A;  2DMO A;  4FW1 A;  4JRK A;  5KE2 A;  2FHD A;  3CCM A;  4HCB A;  9ATC B;  1MNE A;  3VS4 A;  2DU7 A;  4M75 C;  2JS2 A;  1AT1 B;  1T0J A;  2RK1 A;  2DBM A;  4AMC A;  3VBB A;  2EL9 A;  3RDV A;  4J7I A;  4DOW A;  5ELO A;  1Q81 R;  5GAM d;  3WQZ A;  1N9S A;  1IGQ A;  1ZQ1 A;  2XGT A;  1WJQ A;  2F5T X;  3PVQ A;  1R0B G;  3CXC S;  3PNW C;  1N9W A;  3NFC A;  3CCV A;  4L59 A;  5HKC A;  3M53 A;  2P0L A;  1ZBJ A;  5IN1 A;  2Y4X A;  3VS5 A;  2JJ9 A;  1I81 A;  1IRE B;  3LGF A;  2ALY A;  4E6R A;  4JRI A;  1ZSZ B;  3OY9 A;  4FL6 A;  4NOY A;  1JXO A;  1UGV A;  3CXC A;  3H8Z A;  3G6E A;  1KC8 C;  2PVG B;  1K73 R;  2ZT8 A;  4ZN3 A;  4E7J A;  1Q82 R;  1X6O A;  2RHQ B;  4C8Q D;  5LJ3 g;  3SFM A;  1VQO Q;  4QVZ A;  3X25 B;  2KBT A;  4M78 D;  5IH2 A;  1H8K A;  3JSC A;  4HWS A;  3G6E Q;  1S72 Q;  4ORZ A;  3QUI A;  4P73 C;  5I22 A;  1ZUU A;  4LDU A;  2DJZ A;  2XKO C;  4D8D A;  1NG2 A;  1K8A C;  3MQZ A;  4YRQ A;  5EG2 A;  3HY0 A;  1VQN Q;  1VQZ A;  3VJP A;  1YP5 A;  3MKD A;  3CCJ A;  3LX7 A;  3QG1 A;  2GCX A;  3S3O A;  5E3I A;  3CME Q;  3P8H A;  2FL7 A;  4OMF B;  2E1H A;  3QNE A;  5GMK e;  2KXD A;  3EAE A;  4ZGD B;  1UDL A;  4KH1 B;  2HKQ B;  1WQW A;  3CCV T;  5KYY A;  4UP9 A;  1M3A A;  1VQ9 Q;  3ULR B;  2KVQ G;  1ACM B;  3AHU A;  3HSB A;  1GCQ C;  2F2V A;  2EJG A;  1I8F A;  4EMK B;  3ER0 A;  2NUZ A;  2FYK A;  5C6S A;  3LW5 E;  1U1T A;  1C0M A;  3A8O B;  1YWO A;  2YWW A;  3VYH B;  5HCK A;  1HTT A;  2EBP A;  1K9A A;  1K1Z A;  1OU9 A;  3M54 A;  1NJI U;  2AKL A;  4JZ3 A;  1TU0 B;  2ABL A;  2CP3 A;  4CI0 C;  3LYI A;  4OB0 B;  1M90 C;  4C0Z A;  4P72 C;  2X4W A;  2XG8 D;  3A74 A;  3EFR A;  2NUT A;  4YRL A;  3H6Z A;  4B9W A;  3MEU A;  4BD3 A;  2E3C A;  1VQ5 A;  2YUO A;  1Y96 B;  2KY9 A;  3CCE Q;  5GMK j;  2DD4 A;  2XDP A;  2O31 A;  3GIB A;  3L2U A;  4DA4 A;  5FRM A;  2DO3 A;  1WHL A;  1PM3 A;  2CGH A;  4F17 A;  3EH1 A;  1T3S A;  2J6F A;  1WYD A;  3QYG B;  5ELN A;  2NUT B;  3CCE T;  3P8V A;  2O9V A;  12AS A;  4E7K A;  2ALY B;  1VQP T;  5IT9 E;  1PSE A;  5HK0 A;  3KXT A;  4C5H A;  2L3S A;  4X9D A;  3ZFJ A;  1R0C B;  1GRI A;  4M7A B;  5CIU A;  3RNJ A;  2DIL A;  3PE0 A;  2P0Q A;  4Y28 E;  2KAF A;  4A4E A;  3A7R A;  2FRW A;  2DVJ A;  1QMC A;  2ZGW A;  4C92 D;  5KNN A;  1WHG A;  4YTL A;  4EMK A;  5GAM f;  1E1O A;  4GLK A;  2ZZG A;  3HL8 A;  3VS7 A;  5KYY B;  11AS A;  1AOJ A;  3J80 E;  4P5N A;  1KQS P;  1NEB A;  1H4T A;  3M0T A;  4PJN A;  5LJ5 h;  1VQP Q;  1YFN A;  2OTL A;  1C0A A;  1NLP C;  3O8V A;  4XEM A;  4CC3 A;  3JCM d;  1ZUY A;  2W0Z A;  3VQX A;  4FW2 A;  1CKB A;  2QA4 T;  5DM7 R;  5CO7 A;  4BAC A;  3NPF A;  3CXC P;  2K3Y A;  4OMN A;  4OML A;  2X35 A;  1X75 C;  3OYK A;  4KQE A;  4ZN1 A;  3IQL A;  2AHJ B;  2CH4 W;  2Y90 A;  1UUE A;  4Q15 A;  2BKD N;  5LJ5 j;  2KYM A;  2ZTG A;  3HHT B;  2BZ8 A;  2DQ3 A;  4K86 A;  5IXF A;  3M4P A;  1P92 A;  5D6X A;  2RQW A;  2PNI A;  2LTO A;  1UEC A;  3PMT A;  4ATO A;  1PNJ A;  2MMP A;  3S3M A;  3LSQ A;  1PYS A;  2CZ0 B;  3AT1 B;  4YRI A;  2RHQ A;  2RQV A;  4HVW A;  5GAM h;  3JCM Q;  2A08 A;  1JO8 A;  1RLQ C;  2DPP B;  1VQ5 Q;  4YRG A;  1Z7M A;  2P5I A;  1SPK A;  3EFO A;  4NL3 A;  4Q5W A;  1AZE A;  3R6O A;  3JB9 J;  2MF2 A;  5KH6 A;  2A37 A;  1UHC A;  4RKU E;  2ED1 A;  1E6G A;  1K8A U;  1YIT A;  2D6F A;  5CQY A;  2I4L A;  2QEX T;  2WSC E;  3CCJ Q;  2ZIN A;  2QDL A;  2XIC A;  3CCS T;  1YIJ A;  1X56 A;  2VWF A;  3HFO A;  4EMK C;  4XEO A;  2E64 A;  1N8R R;  1C6V X;  2LQW A;  3VQV A;  4AFQ C;  1AVZ C;  3ME9 A;  2GTO A;  1A0N B;  1X2K A;  2E5K A;  3QDR B;  2EKH A;  1KQ2 A;  1Z9Q A;  2OTJ A;  1VIF A;  4P71 C;  4BWA A;  4RCC A;  2O01 E;  4RTY A;  2IY5 B;  2FVU A;  2DJQ A;  3UPU A;  2J6O A;  2RHS B;  2J6K A;  3LC0 A;  5K1X A;  1JRI A;  1OOT A;  1AD5 A;  4P74 A;  2FG0 A;  3EG9 B;  2ROT A;  2RJE A;  1JU5 C;  3CPW A;  1Q86 U;  3VS2 A;  4HWP A;  3ASK A;  5LJ3 f;  1NYR A;  5D6W A;  2QAZ A;  2H3E B;  4MML A;  1JJC A;  2RN8 A;  3W3S A;  3SWN B;  4M7D D;  3NEN A;  4M7A E;  2OX7 A;  4YCV A;  1EFW A;  4H2S A;  1W66 A;  1QVF A;  3IKL A;  2OI3 A;  4WF2 A;  2BZY A;  4O6J A;  3VU3 C;  4CC2 A;  1BI0 A;  1TUC A;  4J9D A;  2YXY A;  2YLB A;  4TVW A;  3MEV A;  2EYY A;  3OA6 A;  1Q86 C;  1BIA A;  4PFP A;  1M5Q 1;  4K87 A;  5I21 A;  1UTI A;  4J9B A;  4XAX B;  2DTO A;  2HQH A;  1M1K R;  3L4G B;  4QVD A;  3OYH A;  4MZT A;  3DLL A;  4IUV A;  3VS6 A;  3REA B;  4EIK A;  4L87 A;  2D8J A;  4OP0 A;  1UJ0 A;  1D1C A;  1YJW T;  3P8Y A;  1FWZ A;  3HFN A;  3MP6 A;  4FYY B;  2OTL T;  1OPL A;  3OS0 A;  4XU2 A;  1W6X A;  4PJO F;  2ZPH B;  2EFI A;  2ZIM A;  1LPL A;  2ZXF A;  5GMK m;  2VUB A;  3R6N A;  3I56 T;  3H9N A;  4HWO A;  3M9Q A;  1YJW Q;  1IB8 A;  1VQ5 T;  1KQS S;  1I4K 1;  1GCP A;  1J3T A;  1VQ7 T;  1WHM A;  2RJF A;  2C8M A;  1VQ6 A;  3DB3 A;  2KEA A;  1U06 A;  4J9G A;  3NEM A;  1PG5 B;  3OSS C;  1K9M R;  1Q7Y C;  2G6F X;  4BI3 A;  4M7D C;  2XK0 A;  1QQJ A;  1FXX A;  3SEM A;  2YDL A;  3C94 A;  3OBY A;  4KGV B;  1VQP A;  3E9H A;  3FC3 A;  4E7I A;  1M27 C;  2AKW B;  2RK2 A;  1QW1 A;  3HPW A;  2EW3 A;  3EG1 A;  5GAN 2;  4GLM A;  1JJC B;  4OMP A;  1WLP B;  2HQX A;  4BDZ A;  3OD1 A;  2RHY A;  4NCX A;  4OMQ A;  4CS2 A;  3OYY A;  2L5Q A;  1VQL A;  2SRC A;  1Q81 C;  4CS4 A;  5CKH A;  1GBQ A;  1LCK A;  4YCW A;  1NLO C;  1YGB A;  2KMT A;  1QVG S;  4LDW A;  3I56 Q;  2LP5 A;  2J3L A;  2RO0 A;  1CKA A;  3MF1 A;  3JCM b;  1ADJ A;  3CQT A;  1JXM A;  4LN2 A;  1M9S A;  4A4G A;  2R5A A;  3QWY A;  4LD9 K;  1MGQ A;  2K5I A;  4O5V A;  1RAH B;  4QQD A;  3P8D A;  2ARU A;  3L1A A;  3ZL7 C;  2QGG A;  3J81 E;  4M7D A;  3EGX A;  1RAG B;  2JT4 A;  1B07 A;  3KBG A;  4WJ4 A;  1X2G A;  3OYD A;  2DET A;  1KK7 A;  3CC7 Q;  3A7A A;  1EZZ B;  1TUD A;  5I2M A;  2PTK A;  5FWB A;  2EAY A;  2ZR3 A;  2FB7 A;  5GAN 8;  4GBQ A;  2MCN A;  1YJN T;  2D9T A;  3NEL A;  1QP2 A;  1G5I A;  5GAN e;  3GOX A;  3OYA A;  1ZX6 A;  2A36 A;  2CP2 A;  2FZC B;  4P75 A;  1VQK A;  4HXJ A;  2O4X B;  2FPF A;  1H3Z A;  4P3P A;  3L42 A;  1N8R C;  3EFO B;  4CH6 A;  1W2B S;  2VVK A;  3M0P A;  3UA6 A;  1D0Z A;  2MWP A;  3A5Z B;  5J3B A;  4QQG A;  4NS5 A;  2PQW A;  1VQM T;  3LSS A;  2DIQ A;  1BBW A;  4PG3 A;  4JJN K;  1Y7X A;  3MET A;  4FSS A;  3THK A;  4OMO A;  3CC2 T;  3V8K A;  2EJF A;  1EX4 A;  1YJ9 T;  4P3N A;  3G4S Q;  3TQ7 P;  3HKS A;  3HRU A;  4JS4 A;  2KQW A;  2RHZ A;  4J7F A;  4JJB A;  2QG9 B;  1EVK A;  3PIO A;  2HSE B;  4M7D G;  4BW9 A;  1H4S A;  3RER A;  1IL2 A;  4PKC C;  4FSX A;  1RAB B;  5GAN h;  4X1V A;  4C8Q A;  3R07 A;  2JN0 A;  2AMC B;  4XK8 E;  2I2L A;  2YUN A;  4A4F A;  2DXB A;  2C0I A;  2LJ1 A;  3JCM h;  4JRQ A;  1USY A;  5HGQ A;  1RL2 A;  2RNA A;  4RTU A;  4UPA A;  1D0X A;  2ZPB B;  5CKD A;  4H2V A;  4DBF A;  3GPL A;  2GTJ A;  1IXD A;  2ECZ A;  4Q6G A;  2IPO B;  2YHT A;  3MHX A;  3NMZ C;  1ASY A;  3JCM X;  2OTJ T;  4PFO A;  2FZG B;  1BK2 A;  3V7C A;  4PJO E;  2CSQ A;  2HDA A;  2C7I A;  1ZLM A;  2LDM A;  1LJO A;  4A53 A;  1YJ9 Q;  4AT1 B;  4MDX A;  4DEX A;  3IG2 A;  4J15 A;  3G4S T;  1X54 A;  1UEB A;  3TEH A;  1VQK T;  2DK3 A;  4XU3 A;  3REU A;  3UGQ A;  1TH7 A;  2ZPI B;  5L8R E;  1ZA1 B;  4TQF A;  2DFU A;  4EMG A;  2CSI A;  3LH0 A;  1YB3 A;  2AZS A;  3M4G A;  1MMG A;  3EG2 A;  3RIR A;  5FWC A;  2EPD A;  2YLC A;  1D3B A;  5CK9 A;  4M7A A;  4RQE A;  3EGD A;  5LJ5 d;  2DXU A;  2B8A A;  5CCA A;  3QSU A;  1B7Y A;  1SRL A;  1Y07 A;  3RKX A;  5KYU B;  1VQO T;  3CCL Q;  5FU7 C;  2DE0 X;  3JCM e;  4C92 G;  1M30 A;  2RQR A;  3KUF A;  5GJW B;  3UDC A;  1GCQ A;  3MPU B;  1YI2 Q;  3HXZ A;  4M77 F;  4PJM A;  2K79 A;  4TQD A;  4KRT A;  4FT2 A;  3RL6 A;  1RAE B;  1X2Q A;  1OZ3 A;  3I5R A;  3JCM g;  3REX A;  2F1L A;  3QXE B;  1RAD B;  3D7S B;  5GAO p;  1QVF P;  2PUO B;  2ZPE B;  3PGG A;  1YI2 T;  4N0A A;  4XTV A;  3HTR A;  4TVA B;  3I56 A;  4ELZ C;  2YRC A;  4FYX B;  1VQL Q;  1QKW A;  2LNH B;  3CC2 Q;  4FU6 A;  2GFA A;  2XU8 A;  1PWT A;  1WJR A;  2A0F B;  2DER A;  1QCN A;  1YJN A;  3P8B B;  1AWW A;  2JZ2 A;  2XD0 A;  2KSS A;  2KNB B;  3CCR T;  3OYJ A;  3HXX A;  1OEB A;  2KI7 A;  1G83 A;  2RH2 A;  1SHG A;  4ZNX A;  2L3P A;  3M59 A;  4DQ2 A;  1K9M U;  3DSQ A;  3X24 B;  2E12 A;  1SG5 A;  3GLX A;  1PD0 A;  3WXM B;  3A8G B;  2SEM A;  3JCM V;  2RQU A;  4C0G A;  4Z02 A;  3CC4 T;  3DLM A;  1VQL T;  1M1F A;  1SSH A;  4N0A C;  2QQB A;  3WVE B;  2CP0 A;  2MWO A;  1MV0 B;  4R0K A;  5A0G A;  4OB1 B;  1ABO A;  4D6W A;  3EHQ A;  1G5H A;  1HK9 A;  2AZV A;  4C8Q F;  2DRM A;  2J05 A;  3M5A A;  3MEA A;  1OX8 A;  5GAN 3;  1Y71 A;  3HFZ B;  3CCU A;  4BY6 C;  2CH4 A;  1L0W A;  1NZ9 A;  3M57 A;  4R55 A;  1YJW A;  3J7A F;  3GNF B;  1SHF A;  3CME A;  1I07 A;  2NLU A;  3RKW A;  2KXC A;  2DBK A;  2QHV A;  1NJ5 A;  2E6N A;  1S1N A;  1AWJ A;  1H64 1;  1B7T A;  1ZSZ A;  2HCK A;  2VV5 A;  4PJO B;  1X43 A;  2ZZE A;  3BFM A;  1M90 U;  4RTW A;  1OU8 A;  2JNG A;  1VQ7 A;  2E3H A;  1HSQ A;  2CYZ B;  4H2T A;  1H4V B;  1QF6 A;  2DNU A;  2P0P A;  2DDZ A;  2JM9 A;  3EG3 A;  3L2W A;  2BZX A;  4J9C A;  1Q86 R;  3TVT A;  2E70 A;  1K0X A;  5J26 A;  2CT4 A;  2DXT A;  4CH4 A;  1RAI B;  1QCO A;  3CC4 Q;  1LNX A;  1WLE A;  1K76 A;  3CCL A;  3N5B B;  2O9S A;  7AT1 B;  1VQ4 T;  2RF0 A;  1KMN A;  1MMA A;  1M2V A;  4FYW B;  4GY5 A;  2KRS A;  1M1K C;  2E4H A;  1BBZ A;  4M7D F;  3OYG A;  3SWN C;  1VQO A;  2H3J A;  2HQE A;  2OTJ Q;  2DL7 A;  2C0O A;  1NJI R;  2DZC A;  3CCE A;  1XTD A;  3A31 A;  5IHN A;  1U8R A;  1ZSZ C;  2ZT5 A;  1X6B A;  2FO0 A;  2JUF A;  3M0S A;  1TG0 A;  2RB6 A;  4E51 A;  1KFZ A;  3QO3 A;  2OJ2 A;  2DQ0 A;  1AWO A;  2K6D A;  3CCQ Q;  2HL3 A;  2GQV A;  4QW2 A;  5J39 A;  1VQ8 A;  3O5Z A;  4K88 A;  4M78 E;  3HXV A;  3GBQ A;  4FT4 A;  1B34 A;  2J7I A;  2D8H A;  3QZ9 B;  3RUX A;  1JJ2 P;  2GQI A;  4QKU A;  2QEX Q;  3CMA Q;  3TEG A;  5GAN 6;  1YHQ T;  4F7U B;  1WU7 A;  3P8T A;  1JQQ A;  2F69 A;  3MCA B;  5LJ5 e;  2MI6 A;  4P73 A;  3LH5 A;  4WTO B;  3M4Q A;  1KD1 C;  4KUD K;  2ED0 A;  2RPN A;  4C0D B;  2PVO B;  3OYC A;  5IHK A;  3G71 T;  3PCO A;  1G2B A;  1G3T A;  4PJL A;  2XTI A;  4JUV A;  3A98 A;  4M77 B;  3CCR A;  3NTH A;  1B3Q A;  1WZO A;  2D1X A;  3URG A;  2AK5 A;  4PJO D;  2E5Q A;  3U23 A;  5HY6 A;  4JLI A;  1QLY A;  1FMW A;  4H2U A;  3GP8 A;  2WSE E;  3EFS A;  2QA4 A;  4AH6 A;  1NPR A;  2HAX A;  1VQ6 T;  2ZCE A;  2MOX A;  1X55 A;  1YJN Q;  1H4Q A;  2ESW A;  1ZBX A;  4FYV B;  4KGX B;  2BUD A;  4OB3 B;  2QTV A;  2PVD B;  3QDF A;  3PZC A;  2KRO A;  3BY7 A;  2QA4 Q;  2D0Q B;  2Q7G A;  4Y92 A;  3VUB A;  1N9R A;  2YUQ A;  3M58 A;  4IUQ A;  2RJC A;  1YNZ A;  2KDS A;  1VQK Q;  3BE3 A;  2Y4Y A;  4H2W A;  3QPH A;  2K5L A;  3PT9 A;  3EG0 A;  2LZ6 B;  4PL6 A;  4J8O A;  3CMQ A;  4C8Q E;  1NPP A;  4A54 A;  3CCU T;  1EIY A;  4LVL A;  1BI2 A;  2AIR B;  2QDY B;  4G85 A;  3PVL A;  1GGM A;  1ASZ A;  2QYZ A;  4H2Y A;  1PCX A;  1W4S A;  2G3R A;  2M0Y A;  2E5A A;  4JDS A;  1LVK A;  3VRZ A;  1Z9Z A;  1AHJ B;  1PRL C;  1X6G A;  2A7Y A;  1I5L A;  3QJY A;  4Z89 A;  2JW4 A;  5ECA A;  1MND A;  2EQU A;  4C8Q C;  2A3L A;  1B70 B;  3E9F A;  1QVP A;  1R77 A;  1JEG A;  1QKX A;  1X2H A;  4HVU A;  3C95 A;  4YYE A;  2E65 A;  4IUR A;  2RI3 A;  3MF2 A;  2EKO A;  3RBB B;  2O2O A;  1HYO A;  4A4K A;  1ABQ A;  2XDB A;  3CBP A;  4RTV A;  4HCK A;  2CIM A;  2O88 A;  5GAN 4;  2V1Q A;  1HJD A;  3HTZ A;  3JCM W;  1BU1 A;  4J9E A;  4E7L A;  2OAU A;  1NJ8 A;  2HBW A;  1IRX A;  1M3B A;  1TXQ A;  4YRE A;  1VQN T;  2CS7 A;  1HC7 A;  3L2Q A;  4YPF A;  5GAN j;  1WQ7 A;  4XTY A;  2LCS A;  3VRY A;  3BW1 A;  1G5V A;  1V76 A;  4LE9 A;  4J83 A;  2PUK B;  2JS0 A;  2EQJ A;  2YUP A;  1IO6 A;  1TSF A;  2LCC A;  3UT1 A;  3JRZ A;  3QYH B;  2MYS A;  1QWF A;  4M75 G;  1UG1 A;  4ESR A;  1XOV A;  3FRN A;  5FU6 C;  4B6M A;  4M78 B;  5GAO q;  1X01 A;  1YCY A;  4RDX A;  2VC8 A;  1VYV A;  5KYU A;  2EIF A;  4F7U E;  3OYL A;  4WJ3 M;  4QQ6 A;  4AFS C;  4YDQ A;  1B7Y B;  3ZEH A;  2CZ7 B;  5GAO m;  4QVC A;  4C92 F;  3TUP A;  3BDL A;  4F16 A;  1D3B B;  2HMA A;  2G4C A;  1IGU A;  2BE9 B;  2Q7E A;  1O75 A;  3QWX X;  4M77 C;  2CZ6 B;  3TSW A;  2P4R A;  2EYW A;  5GAN 5;  5GJV B;  1YIJ Q;  3I7F A;  4MZM A;  1NE8 A;  4E7H A;  3CCL T;  2ZR2 A;  2X4X A;  1NEG A;  4PFZ A;  2J3M A;  3X28 B;  2P0K A;  1RIQ A;  4H02 A;  4LVM A;  2NYS A;  4EMH A;  3A8M B;  4DEY A;  5GAN 7;  1BCO A;  3VQY A;  2CDT A;  1NJI C;  2OTL Q;  1Z7N A;  4XQ3 A;  3CCQ A;  2M9U A;  2DIG A;  3QTC A;  4M7A G;  5KYX B;  4HT4 A;  1QCF A;  4EX5 A;  2EQI A;  2X4J A;  3KFV A;  1ZUK A;  1OZ2 A;  3H41 A;  1VQ4 Q;  4YRN A;  2PZ1 A;  3EH2 A;  3OQ5 A;  4PNO A;  4C92 C;  1UGR B;  4PJO C;  2AMC A;  1PKS A;  3UFG A;  4X5O A;  4RCB A;  4C8Q B;  4IIO A;  1FX7 A;  2BIV A;  2XID A;  1WXU A;  4DPG A;  3OBW A;  2H8H A;  5DLO A;  2IVW A;  1QE0 A;  4H2X A;  1K4U S;  4M7A C;  5GMK h;  1VOM A;  1WYX A;  4IIM A;  4Z88 A;  2JVV A;  1T0H A;  2JM8 A;  3CCM Q;  2ZAE A;  4PJJ A;  1WHH A;  3X20 B;  2Q5H A;  2DL3 A;  2V8I A;  2KT1 A;  1YFT A;  3E2U A;  1KHI A;  4DBQ A;  5GAM e;  5GMK l;  4Y91 A;  4RG2 A;  4M78 A;  2E41 A;  3JB9 I;  4DBH A;  1YFS A;  1YI2 A;  3A5Z A;  2QHU A;  4F14 A;  1QWE A;  4OVA A;  1SES A;  2ARS A;  4G84 A;  2ZCF B;  1JBM A;  3HXY A;  4AFZ C;  2QGF B;  4C5E A;  1H3H A;  3CEY A;  2O4X A;  5CKF A;  1OV3 A;  1KQ1 A;  1QVG P;  2DYB A;  2COZ A;  4LD6 A;  3CMA T;  5C52 B;  2QQS A;  1H92 A;  3BJU A;  4XTW A;  3CCS A;  3G1Z A;  4M7A F;  2CJA A;  2LJ3 A;  1VQ4 A;  4K11 A;  4TWA A;  3OMG A;  2DX1 A;  3OS2 A;  1QVF S;  4OMM A;  3UF4 A;  2P4T A;  4YRF A;  2FPD A;  3HXW A;  5KYX A;  3I55 Q;  3VS1 A;  4MZP A;  1ADY A;  3OYB A;  3G71 Q;  1E7O A;  1HD3 A;  2LQK A;  2DEQ A;  4ME7 A;  4HCC A;  2GGR A;  4L6V 5;  1WHK A;  1YBY A;  2X9H A;  2DF6 A;  2RMO A;  3A32 A;  4KGZ B;  4EPC A;  1EIF A;  3ERR A;  5C51 B;  1UGQ B;  4UP8 A;  1ATI A;  4C0D C;  2V26 A;  2DL4 A;  1Q7Y U;  1NJ1 A;  3V7R A;  4PK4 A;  1F1B B;  3JCM c;  4C92 A;  4BUG A;  4J6Y A;  3RES A;  2ZT7 A;  3NGP A;  3OB9 A;  4HA8 A;  4RG8 A;  3FJ5 A;  3QO8 A;  1VQ9 A;  1YIJ T;  1YHQ A;  3FB9 A;  3JV3 A;  1BIB A;  2COY A;  3UA7 A;  2Z0W A;  1Q7Y R;  2CT3 A;  3CCS Q;  1M4Z A;  5K1P A;  3DB4 A;  2L8D A;  3VS3 A;  4V2S A;  3MP8 A;  2EWN A;  3JB9 F;  1W70 A;  1G51 A;  2P84 A;  4ZTZ B;  2VXE A;  2DL5 A;  3CPF A;  4EO4 A;  5CQX A;  4M7D E;  1K8A R;  4YRM A;  1D1A A;  4B9X A;  4CS3 A;  4PJO G;  4C5I A;  4LNS A;  3MEW A;  2LQN A;  3UWN A;  3V8L A;  4X9C A;  2OAW A;  1WJS A;  2C06 A;  3I35 A;  1V29 B;  2DU5 A;  1LYL A;  4FCY A;  3OW2 A;  3PIP A;  4KH0 B;  3QKJ A;  2K3B A;  2ODR C;  2JXB A;  3FIF A;  4R56 A;  1RAA B;  1E1T A;  1VQN A;  3SD4 A;  1X27 A;  3G7Z A;  5F5W A;  4M75 A;  1XQH A;  1IHV A;  3I9Q A;  1KD1 R;  4M75 F;  3A1P A;  4XTX A;  1VQ8 Q;  1M8M A;  4FM4 B;  1ZHI A;  4HKE A;  1UB4 A;  4MMK A;  1BI1 A;  5FU7 B;  2RHX A;  3HRS A;  2MAM A;  2ZPG B;  2CJB A;  1GBR A;  2L3R A;  3CPW S;  1I1J A;  2QK0 A;  3CCV Q;  2LJ0 A;  3SWN A;  2MK5 A;  2K3X A;  1VIE A;  2R58 A;  1WDX A;  2V8K A;  3OYF A;  4F7U G;  4LDY A;  3H0H A;  1NYQ A;  3CC7 T;  3OMC A;  3RAC A;  1IZ6 A;  3I5S A;  2CUB A;  2DD5 A;  1WFW A;  4FIB A;  2CZ1 B;  1YIT Q;  2CP7 A;  1U5S A;  1W2B A;  1S72 T;  4IUU A;  2J06 A;  2MPX C;  4HCZ A;  1N6A A;  2QEX A;  5HK3 A;  4J9I A;  1EIY B;  4BI8 B;  4NL2 A;  2ROL A;  2LQ8 A;  1B8A A;  3G6E T;  1UGP B;  1SRY A;  3BDU A;  1KSW A;  4XU1 A;  4J5Y A;  1EFN A;  4N4H A;  1ARK A;  1OI1 A;  1JJ2 A;  1VA7 A;  5LJ3 h;  3CCQ T;  4P3O A;  3GF5 A;  2ZNI A;  1W1F A;  5GAO r;  3HY1 A;  4AG1 C;  1G3W A;  1GXI E;  2KK4 A;  1KOG A;  3OYN A;  1TWB A;  2K2V A;  1QP3 A;  4Z8A A;  4LNP A;  2DVE A;  3TEE A;  1BYM A;  2DKG A;  4P72 A;  1SER A;  1JJ2 S;  3CC4 A;  2R57 A;  4C92 E;  5GAM j;  5LJ3 e;  2VAS A;  2EVR A;  3JB9 H;  5GAN f;  2CRE A;  1PKT A;  1KIK A;  4YRT A;  2EGA A;  2QQR A;  4PJO A;  1YIT T;  1EVL A;  1WPY A;  2LVM A;  2VB6 A;  1NM7 A;  1NYG A;  1WGS A;  4C8Q G;  2F5K A;  2MIO A;  1VYT A;  1U3O A;  2EQM A;  4M77 A;  2A8E A;  2QQA A;  3PCO B;  2JMA A;  3FDR A;  3CC7 A;  2K4Y A;  5LJ5 f;  1PYS B;  4O2D A;  5GAN g;  2LNV A;  2QI2 A;  5M9O A;  3REB B;  2W10 A;  3TU4 K;  4A4H A;  4ZIB A;  4BB7 A;  4F7U A;  4M77 E;  3OW2 S;  3LWI A;  3EHR A;  3MO8 A;  3L2R A;  1FMK A;  5FLX E;  1FYF A;  5DLQ E;  3X26 B;  5LJ3 j;  2VGN A;  5L23 A;  4OB2 B;  1E24 A;  2L0A A;  5A2Q E;  4JJD A;  3IKM B;  2LCL A;  3M0R A;  5CR2 A;  3M0U A;  4E7S A;  1VQM A;  2HEQ A;  2HZY A;  4C5G A;  4UP7 A;  4D8K A;  1UJY A;  2DAQ A;  2JMC A;  4J9H A;  3E9I A;  4YP0 A;  1YJ9 A;  1GFD A;  2E3I A;  1TTH B;  2X4Y A;  1MUZ A;  1W2B P;  3DKM A;  1M2V B;  3T9N A;  4IUP A;  2DXC A;  3VUZ A;  4LVI A;  2IIM A;  5IXB A;  3V8J A;  4DOV A;  1E22 A;  2FPE A;  2EYQ A;  3QZ5 B;  3E1S A;  5FU6 B;  1E6H A;  4OLF A;  2K57 A;  1IHW A;  1Q82 U;  3QO7 A;  1K73 U;  3C12 A;  3WVD B;  4TVA A;  1G3S A;  4PLL A;  3MP1 A;  1OUL A;  3MEY A;  4BI4 A;  3H0F A;  4M75 B;  4P71 A;  2K7A A;  4LUD A;  3INZ A;  3V7S A;  2EGE A;  3CBO A;  4M78 G;  3M4Y A;  5GMK i;  4C0F A;  3TCJ A;  3JAM E;  2FRY A;  4P74 C;  1BI3 A;  4LUE A;  2I4O A;  1Q82 C;  3CMA A;  2RD1 A;  3JB9 D;  3VQW A;  3CPW P;  3UH0 A;  1Y96 A;  3HFZ A;  3S6W A;  1GFC A;  5KE3 A;  2QAS A;  3UAT A;  4M77 D;  4A63 B;  4M4Z A;  4EDU A;  3CD6 T;  1N8R U;  1MMD A;  2JOY A;  4KUL A;  1NJ2 A;  3EGD B;  1EQR A;  3OS1 A;  2VXF A;  2Q7H A;  4M78 F;  4YRR A;  4F04 B;  1OPK A;  3QHS A;  1K0S A;  2CKK A;  2D0N A;  4OGE A;  2EYZ A;  2ZZD A;  4C92 B;  2HBP A;  2LC4 A;  2ODR D;  2LX9 A;  3QBY A;  3OS5 A;  3TEH B;  2M02 A;  2DEU A;  4AG2 C;  1T3L A;  3KFU A;  4J6W A;  1RAF B;  4JZ4 A;  1N5Z A;  2DTH A;  4XTZ A;  5GAM g;  1NJ6 A;  3F70 A;  4J9F A;  1UFF A;  1X69 A;  5IAY A;  1WA7 A;  2KT8 A;  3PFS A;  4LDX A;  2M0O A;  3CD6 Q;  4TVY A;  4CH3 A;  1NYF A;  1C1A A;  4IUT A;  1VYU A;  5A0L A;  2ENM A;  3C4S A;  2XMF A;  5GAN d;  2KRN A;  4ZTF A;  1KJW A;  3HRT A;  3A5Y A;  4CH5 A;  5CAI A;  1NNH A;  1PHT A;  2EQK A;  2ZPF B;  1YWP A;  4BDY A;  1KC8 U;  1YFR A;  2Q5I A;  4AFU C;  3OYI A;  1B76 A;  3CBM A;  1EOV A;  2HD0 A;  4N4I A;  1WI7 A;  3QII A;  1Y0M A;  2I4M A;  2I0N A;  2RI5 A;  2EJ9 A;  2DM1 A;  2YT6 A;  5AT1 B;  3CCU Q;  1RAC B;  1YHQ Q;  5C0M A;  1LOJ A;  8AT1 B;  5LJ3 d;  2LMJ A;  3PTA A;  2K2M A;  1TS9 A;  3CME T;  4TVR A;  1PSF A;  5CKB A;  6AT1 B;  4M7A D;  2KR3 A;  3L2Z A;  5LJ5 g;  1M1K U;  4HT8 A;  4HVV A;  5LL6 S;  1ZA2 B;  1V1C A;  2DRK A;  3CC2 A;  1AWX A;  4LVJ A;  1UHF A;  4H2X B;  5AYF A;  1M90 R;  4YRC A;  4ZTU B;  5FRO A;  3G4S A;  3HXU A;  1D0Y A;  2YRV A;  2GBQ A;  3SB2 A;  4BY6 B;  3RMQ A;  1WIE A;  2ZIO A;  3VKI A;  1BBU A;  2RM4 A;  1VQ6 Q;  5D6Y A;  4BE0 A;  2LT1 A;  4XU0 A;  2GF7 A;  4II1 A;  1WXT A;  3RMS A;  4YRP A;  1G3Y A;  5CKE A;  1VQM Q;  3FJP A;  2NWM A;  5KCH A;  2PMF A;  4PLI A;  4PHC A;  2M51 A;  3SHW A;  2I4N A;  4CC7 A;  5D7U A;  1M8V A;  4YCU A;  1AEY A;  1D09 B;  1SSF A;  3GNG A;  4X34 A;  4M75 E;  2QHT A;  2XI9 A;  1VQ9 T;  3CCM T;  1TOV A;  1J5W A;  2M1H A;  1Q95 G;  2LX7 A;  2RJD A;  5DY9 A;  3QJ6 A;  3LLR A;  2XDD A;  3HFV A;  1RUW A;  2K9G A;  2K5F A;  3NTI A;  2QQ9 A;  3CCR Q;  5FW9 A;  1OX9 A;  3TRE A;  1M1G A;  5IHI A;  2KGT A;  4TTV A;  3A7U A;  4JS5 A;  1I0C A;  2DZ9 A;  4IKF A;  4J6X A;  2IG0 A;  1K9M C;  2RQT A;  2KYB A;  2E6Z A;  2V8J A;  2F2W A;  2V1R A;  2NUP B;  5I2S A;  4YRJ A;  1KG1 A;  4JPB W;  1BCM A;  3M0Q A;  2XHC A;  1PRM C;  3JCM J;  2AKW A;  1DJ7 B;  4ZTJ A;  3S3N A;  4JRP A;  4YRK A;  4KBM B;  3VS0 A;  3RR6 A;  2A28 A;  1GL5 A;  2M16 A;  2BTT A;  5GAO n;  1M3C A;  3HRK A;  3FLG A;  1SET A;  3I55 T;  2ZT6 A;  1WX6 A;  2ATC B;  4MDW A;  3L2V A;  4WI1 A;  4N4G A;  4LXC A;  3M56 A;  2DTI A;  3IAL A;  2L3Q A;  1USY C;  4P75 C;  2B86 A;  4WCI A;  3LWH A;  1AZG B;  2AT1 B;  4JLG A;  2VGM A;  1HXD A;  3OYM A;  4OGC A;  5I11 A;  1SKU B;  1MHN A;  1O9S A;  2FZK B;  3NHN A;  4E47 A;  2KE9 A;  1NBE B;  1I5O B;  2HSP A;  4RTX A;  1BB9 A;  1RI0 A;  2BE7 D;  4QT7 A;  5C53 B;  4RUG A;  5KYW A;  3L4G A;  5KCO A;  1SRM A;  3OW2 P;  3RGL A;  3PMI A;  4M75 D;  4DBR A;  1VQ7 Q;  1KHC A;  1RI9 A;  1JB0 E;  3EGX B;  4HT9 A;  2JTF A;  4M7D B;  5KYN A;  1SF9 A;  5A0D A;  4BE1 A;  1Y57 A;  1KQS A;  2AKK A;  3HP9 A;  1PD1 A;  1KMM A;  2DLP A;  1G8X A;  3CD6 A;  2F2X A;  2GNC A;  2CUD A;  4YRO A;  3JCM P;  1PC0 A;  1RLP C;  3OYE A;  1S72 A;  2C0T A;  8ATC B;  2WAC A;  1B70 A;  2L2P A;  3ZBD A;  4JJC A;  2KRM A;  1KD1 U;  3QO5 A;  4RQF A;  3I55 A;  4HWR A;  3NET A;  2CP5 A;  4L5G A;  2LT4 A;  2RHU A;  2QHS A;  1WHJ A;  1Q81 U;  2R5M A;  3Q1J A;  4HVC A;  2RI2 A;  3ICA A;  2IY5 A;  4F7U F;  4KT0 E;  3HRI A;  1QVG A;  2VKN A;  3VYG A;  2JTE A;  2GFU A;  3VV0 A;  4CC4 B;  1TUG B;  4HWT A;  1ZSG A;  3UGT A;  1D1B A;  5GAO l;  2JTM A;  4RMO A;  3MJX A;  2HKN A;  2VYT A;  5CVI A;  5KYW B;  2QXF A;  1U1S A;  2QTX A;  3A8L B;  4ZGJ B;  1MMN A;  2DYI A;  3CCJ T;  4OF1 A;  1BKB A;  3OSV A;  1R8O B;  4ELY C;  2X3W D;  1MV3 A;  2NS6 A;  2COW A;  1YCS B;  1M2O A;  4ZGE B;  3EGU A;  3RKY A;  2DA9 A;  4KR3 A;  2WSF E;  2EGC A;  2E10 A;  4RTZ A;  3TSZ A;  2RA2 A;  4RMF A;  2LRQ A;  2RHI A;  3RF1 A;  2X51 A;  4LVK A;  2CJ9 A;  1OYX A;  1YN8 A;  1UGS B;  3E9G A;  1SEM A;  3C0C A;  2ZZF A;  2DL8 A;  3JB9 G;  3FEO A;  3SDZ A;  1K73 C;  2EYX A;  1KC8 R;  1FMV A;  3H0I A;  1FYN A;  4XTU A;  2HNI A;  3JCM f;  3E19 A;  1WXB A;  1XJW B;  1VUB A;  1UE9 A;  4BE2 A;  2L89 A;  1OQK A;  3M55 A;  2YRD A;  4CRI A;  3G71 A;  1CSK A;  3NTK A;  4UC4 A;  4E7Z A;  4KR2 A;  5FRN A;  2ART A;  4M77 G;  2X3X D;  4YRS A;  1B34 B;  2NUP A;  2HL5 C;  2PME A;  4RTT A;  4LDV A;  4M78 C; 
#chains in the Genus database with same CATH homology
 3A8H B;  4KUI A;  1WNL A;  1N27 A;  1XNI A;  4VUB A;  2PU9 B;  3LGL A;  1VQ8 T;  2ZNJ A;  2RHS A;  4JRK A;  5KE2 A;  2FHD A;  3CCM A;  4HCB A;  2DU7 A;  4M75 C;  2RK1 A;  3VBB A;  2EL9 A;  5ELO A;  4J7I A;  4DOW A;  5GAM d;  3WQZ A;  1N9S A;  1ZQ1 A;  2XGT A;  1WJQ A;  2F5T X;  3CXC S;  3PNW C;  1N9W A;  3NFC A;  3CCV A;  4L59 A;  5HKC A;  3M53 A;  2P0L A;  5IN1 A;  2Y4X A;  1I81 A;  1IRE B;  3LGF A;  2ALY A;  4JRI A;  3OY9 A;  4FL6 A;  4NOY A;  3CXC A;  3H8Z A;  3G6E A;  1KC8 C;  2PVG B;  2ZT8 A;  4ZN3 A;  4E7J A;  1X6O A;  2RHQ B;  4C8Q D;  5LJ3 g;  3SFM A;  4QVZ A;  3X25 B;  4M78 D;  3JSC A;  4HWS A;  3QUI A;  4P73 C;  4LDU A;  2DJZ A;  2XKO C;  1K8A C;  3MQZ A;  4YRQ A;  5EG2 A;  3HY0 A;  1VQZ A;  3VJP A;  3CCJ A;  3LX7 A;  3QG1 A;  2GCX A;  3S3O A;  5E3I A;  3P8H A;  2FL7 A;  4OMF B;  2E1H A;  3QNE A;  5GMK e;  3EAE A;  4ZGD B;  1WQW A;  3CCV T;  4UP9 A;  2KVQ G;  3AHU A;  3HSB A;  2EJG A;  1I8F A;  4EMK B;  3ER0 A;  2FYK A;  5C6S A;  1U1T A;  3LW5 E;  3A8O B;  3VYH B;  1HTT A;  3M54 A;  1NJI U;  4CI0 C;  3LYI A;  4OB0 B;  1M90 C;  4C0Z A;  4P72 C;  2X4W A;  2XG8 D;  3A74 A;  3EFR A;  4YRL A;  3H6Z A;  4B9W A;  3MEU A;  4BD3 A;  2E3C A;  1VQ5 A;  1Y96 B;  2KY9 A;  5GMK j;  2DD4 A;  3GIB A;  2XDP A;  3L2U A;  4DA4 A;  5FRM A;  2DO3 A;  2CGH A;  1WYD A;  3QYG B;  5ELN A;  3CCE T;  3P8V A;  12AS A;  4E7K A;  2ALY B;  1VQP T;  5IT9 E;  1PSE A;  5HK0 A;  3KXT A;  4C5H A;  4X9D A;  3ZFJ A;  4M7A B;  5CIU A;  2P0Q A;  4Y28 E;  2KAF A;  4A4E A;  3A7R A;  2ZGW A;  4C92 D;  5KNN A;  4YTL A;  4EMK A;  5GAM f;  1E1O A;  4GLK A;  2ZZG A;  3HL8 A;  11AS A;  3J80 E;  4P5N A;  1H4T A;  5LJ5 h;  2OTL A;  1C0A A;  3O8V A;  4XEM A;  3JCM d;  3VQX A;  2QA4 T;  5DM7 R;  5CO7 A;  4BAC A;  2K3Y A;  2X35 A;  1X75 C;  3OYK A;  4KQE A;  4ZN1 A;  2AHJ B;  2Y90 A;  4Q15 A;  2BKD N;  5LJ5 j;  2ZTG A;  3HHT B;  2DQ3 A;  4K86 A;  3M4P A;  1P92 A;  5D6X A;  2LTO A;  3PMT A;  4ATO A;  2MMP A;  3S3M A;  3LSQ A;  1PYS A;  2CZ0 B;  4YRI A;  2RHQ A;  5GAM h;  3JCM Q;  2DPP B;  4YRG A;  1Z7M A;  2P5I A;  4NL3 A;  4Q5W A;  3R6O A;  3JB9 J;  2MF2 A;  5KH6 A;  4RKU E;  1K8A U;  1YIT A;  2D6F A;  5CQY A;  2I4L A;  2QEX T;  2WSC E;  2ZIN A;  1X56 A;  2XIC A;  3CCS T;  1YIJ A;  3HFO A;  4EMK C;  4XEO A;  2E64 A;  3VQV A;  3ME9 A;  3QDR B;  1KQ2 A;  2OTJ A;  1VIF A;  4P71 C;  4BWA A;  4RCC A;  2O01 E;  2IY5 B;  2FVU A;  3UPU A;  2RHS B;  3LC0 A;  5K1X A;  1JRI A;  4P74 A;  1Q86 U;  2RJE A;  3CPW A;  4HWP A;  3ASK A;  5LJ3 f;  1NYR A;  5D6W A;  4MML A;  1JJC A;  3W3S A;  3SWN B;  4M7D D;  3NEN A;  4M7A E;  4YCV A;  1EFW A;  4H2S A;  1W66 A;  1QVF A;  3IKL A;  4WF2 A;  4O6J A;  3VU3 C;  1BI0 A;  2YLB A;  4TVW A;  3MEV A;  3OA6 A;  1Q86 C;  1BIA A;  4K87 A;  1M5Q 1;  5I21 A;  4XAX B;  2DTO A;  3L4G B;  4QVD A;  3OYH A;  4MZT A;  3DLL A;  4IUV A;  4L87 A;  4OP0 A;  3P8Y A;  1YJW T;  1FWZ A;  3HFN A;  3MP6 A;  2OTL T;  3OS0 A;  4XU2 A;  4PJO F;  2ZPH B;  2EFI A;  2ZIM A;  2ZXF A;  5GMK m;  2VUB A;  3I56 T;  4HWO A;  3M9Q A;  1VQ5 T;  1KQS S;  1I4K 1;  1VQ7 T;  2C8M A;  2RJF A;  1VQ6 A;  3DB3 A;  3NEM A;  3OSS C;  1Q7Y C;  4BI3 A;  4M7D C;  2XK0 A;  1FXX A;  3C94 A;  3OBY A;  1VQP A;  3E9H A;  3FC3 A;  4E7I A;  2AKW B;  2RK2 A;  1QW1 A;  3HPW A;  5GAN 2;  1JJC B;  2HQX A;  4BDZ A;  3OD1 A;  2RHY A;  4NCX A;  4CS2 A;  3OYY A;  2L5Q A;  1VQL A;  1Q81 C;  4CS4 A;  5CKH A;  4YCW A;  1YGB A;  2KMT A;  1QVG S;  4LDW A;  2J3L A;  2RO0 A;  3MF1 A;  3JCM b;  1ADJ A;  1M9S A;  4A4G A;  2R5A A;  4LD9 K;  1MGQ A;  2K5I A;  4O5V A;  4QQD A;  3P8D A;  2ARU A;  3L1A A;  3J81 E;  4M7D A;  3KBG A;  4WJ4 A;  1X2G A;  3OYD A;  3A7A A;  5I2M A;  2EAY A;  2ZR3 A;  2FB7 A;  5GAN 8;  1YJN T;  2D9T A;  3NEL A;  1QP2 A;  1G5I A;  5GAN e;  3GOX A;  3OYA A;  4P75 A;  1VQK A;  2O4X B;  1H3Z A;  4P3P A;  3L42 A;  1N8R C;  4CH6 A;  1W2B S;  2MWP A;  3A5Z B;  5J3B A;  4QQG A;  4NS5 A;  2PQW A;  1VQM T;  3LSS A;  2DIQ A;  1BBW A;  4PG3 A;  4JJN K;  1Y7X A;  3MET A;  3CC2 T;  3V8K A;  2EJF A;  1YJ9 T;  4P3N A;  3HKS A;  3HRU A;  4JS4 A;  2KQW A;  2RHZ A;  4J7F A;  1EVK A;  3PIO A;  4M7D G;  4BW9 A;  1IL2 A;  1H4S A;  3RER A;  4PKC C;  4FSX A;  5GAN h;  4C8Q A;  3R07 A;  2JN0 A;  2AMC B;  4XK8 E;  2I2L A;  4A4F A;  2DXB A;  3JCM h;  4JRQ A;  1USY A;  5HGQ A;  1RL2 A;  4UPA A;  2ZPB B;  5CKD A;  4H2V A;  3GPL A;  4Q6G A;  2YHT A;  3MHX A;  1ASY A;  3JCM X;  2OTJ T;  3V7C A;  4PJO E;  2C7I A;  2LDM A;  1LJO A;  4A53 A;  4MDX A;  3IG2 A;  4J15 A;  3G4S T;  1X54 A;  1UEB A;  3TEH A;  1VQK T;  2DK3 A;  4XU3 A;  3REU A;  3UGQ A;  1TH7 A;  2ZPI B;  5L8R E;  4TQF A;  4EMG A;  3LH0 A;  1YB3 A;  3M4G A;  3RIR A;  2YLC A;  1D3B A;  5CK9 A;  4M7A A;  4RQE A;  5LJ5 d;  2DXU A;  2B8A A;  5CCA A;  3QSU A;  1B7Y A;  1Y07 A;  3RKX A;  1VQO T;  5FU7 C;  3JCM e;  4C92 G;  3KUF A;  3UDC A;  3HXZ A;  4M77 F;  4TQD A;  4FT2 A;  3RL6 A;  1OZ3 A;  3JCM g;  3REX A;  3QXE B;  5GAO p;  2PUO B;  2ZPE B;  3PGG A;  1YI2 T;  4N0A A;  4XTV A;  4TVA B;  3I56 A;  4ELZ C;  4FU6 A;  2GFA A;  2XU8 A;  1WJR A;  1YJN A;  3P8B B;  2JZ2 A;  2XD0 A;  2KSS A;  3CCR T;  3OYJ A;  3HXX A;  2RH2 A;  3M59 A;  4DQ2 A;  1K9M U;  3DSQ A;  3X24 B;  2E12 A;  3GLX A;  3WXM B;  3A8G B;  3JCM V;  4C0G A;  4Z02 A;  3CC4 T;  3DLM A;  1VQL T;  1M1F A;  4N0A C;  2QQB A;  3WVE B;  2MWO A;  5A0G A;  4OB1 B;  4D6W A;  1G5H A;  1HK9 A;  4C8Q F;  3M5A A;  3MEA A;  5GAN 3;  1Y71 A;  3HFZ B;  3CCU A;  4BY6 C;  1L0W A;  1NZ9 A;  3M57 A;  4R55 A;  1YJW A;  3J7A F;  3GNF B;  3CME A;  2NLU A;  3RKW A;  2QHV A;  1NJ5 A;  2E6N A;  1H64 1;  2VV5 A;  4PJO B;  2ZZE A;  3BFM A;  1M90 U;  2JNG A;  1VQ7 A;  2CYZ B;  4H2T A;  1H4V B;  1QF6 A;  2P0P A;  2DDZ A;  3L2W A;  2E70 A;  5J26 A;  2DXT A;  4CH4 A;  1LNX A;  1WLE A;  3CCL A;  3N5B B;  1VQ4 T;  1KMN A;  4GY5 A;  1M1K C;  4M7D F;  3OYG A;  3SWN C;  1VQO A;  2H3J A;  2HQE A;  2DZC A;  3CCE A;  1XTD A;  3A31 A;  1U8R A;  2ZT5 A;  2JUF A;  2RB6 A;  4E51 A;  3QO3 A;  2DQ0 A;  2GQV A;  4QW2 A;  5J39 A;  1VQ8 A;  4K88 A;  4M78 E;  3HXV A;  4FT4 A;  1B34 A;  3QZ9 B;  3RUX A;  3TEG A;  5GAN 6;  1YHQ T;  4F7U B;  1WU7 A;  3P8T A;  2F69 A;  3MCA B;  5LJ5 e;  2MI6 A;  4P73 A;  3M4Q A;  1KD1 C;  4KUD K;  4C0D B;  2PVO B;  3OYC A;  3G71 T;  3PCO A;  1G3T A;  2XTI A;  4JUV A;  4M77 B;  3CCR A;  3NTH A;  3URG A;  4PJO D;  2E5Q A;  5HY6 A;  4JLI A;  4H2U A;  3GP8 A;  2WSE E;  3EFS A;  2QA4 A;  4AH6 A;  1NPR A;  2HAX A;  1VQ6 T;  2ZCE A;  1X55 A;  1H4Q A;  1ZBX A;  2BUD A;  4OB3 B;  2PVD B;  3PZC A;  3BY7 A;  2D0Q B;  2Q7G A;  3VUB A;  1N9R A;  3M58 A;  4IUQ A;  2RJC A;  2KDS A;  2Y4Y A;  4H2W A;  3QPH A;  2K5L A;  3PT9 A;  4PL6 A;  4J8O A;  3CMQ A;  4C8Q E;  1NPP A;  4A54 A;  3CCU T;  1EIY A;  4LVL A;  1BI2 A;  2QDY B;  4G85 A;  1GGM A;  1ASZ A;  4H2Y A;  1W4S A;  2G3R A;  2E5A A;  4JDS A;  1AHJ B;  2A7Y A;  1I5L A;  3QJY A;  2EQU A;  4C8Q C;  2A3L A;  1B70 B;  3E9F A;  1QVP A;  1X2H A;  3C95 A;  4YYE A;  2E65 A;  4IUR A;  2RI3 A;  3MF2 A;  2EKO A;  4A4K A;  2XDB A;  3CBP A;  2CIM A;  5GAN 4;  3HTZ A;  3JCM W;  4E7L A;  2OAU A;  1NJ8 A;  4YRE A;  1VQN T;  2CS7 A;  1HC7 A;  3L2Q A;  4YPF A;  5GAN j;  1WQ7 A;  4XTY A;  3BW1 A;  1G5V A;  4J83 A;  2PUK B;  2EQJ A;  2LCC A;  3UT1 A;  3JRZ A;  3QYH B;  4M75 G;  1XOV A;  3FRN A;  5FU6 C;  5GAO q;  4M78 B;  1X01 A;  1YCY A;  4RDX A;  2VC8 A;  2EIF A;  4F7U E;  3OYL A;  4WJ3 M;  4QQ6 A;  4YDQ A;  1B7Y B;  3ZEH A;  2CZ7 B;  5GAO m;  4QVC A;  4C92 F;  3TUP A;  3BDL A;  1D3B B;  2G4C A;  2Q7E A;  1O75 A;  4M77 C;  2CZ6 B;  5GAN 5;  3I7F A;  4MZM A;  1NE8 A;  4E7H A;  3CCL T;  2ZR2 A;  2X4X A;  2J3M A;  3X28 B;  2P0K A;  1RIQ A;  4H02 A;  4LVM A;  4EMH A;  3A8M B;  5GAN 7;  3VQY A;  1NJI C;  1Z7N A;  4XQ3 A;  3CCQ A;  2M9U A;  2DIG A;  3QTC A;  4M7A G;  4HT4 A;  4EX5 A;  2X4J A;  1OZ2 A;  4YRN A;  3OQ5 A;  4PNO A;  4C92 C;  1UGR B;  4PJO C;  2AMC A;  3UFG A;  4X5O A;  4RCB A;  4C8Q B;  1FX7 A;  2BIV A;  2XID A;  4DPG A;  3OBW A;  5DLO A;  2IVW A;  1QE0 A;  4H2X A;  4M7A C;  5GMK h;  2JVV A;  3X20 B;  2Q5H A;  1YFT A;  2V8I A;  1KHI A;  5GMK l;  5GAM e;  4Y91 A;  4RG2 A;  4M78 A;  2E41 A;  3JB9 I;  1YFS A;  1YI2 A;  3A5Z A;  2QHU A;  4OVA A;  4G84 A;  1SES A;  2ARS A;  2ZCF B;  1JBM A;  3HXY A;  4C5E A;  3CEY A;  2O4X A;  5CKF A;  1KQ1 A;  4LD6 A;  3CMA T;  5C52 B;  2QQS A;  3BJU A;  4XTW A;  3CCS A;  3G1Z A;  4M7A F;  2CJA A;  1VQ4 A;  4TWA A;  3OMG A;  3OS2 A;  1QVF S;  2P4T A;  4YRF A;  3HXW A;  4MZP A;  1ADY A;  3OYB A;  2LQK A;  2DEQ A;  4ME7 A;  4HCC A;  4L6V 5;  1YBY A;  3A32 A;  4EPC A;  1EIF A;  3ERR A;  5C51 B;  1UGQ B;  4UP8 A;  1ATI A;  4C0D C;  1Q7Y U;  1NJ1 A;  3V7R A;  3JCM c;  4C92 A;  4BUG A;  4J6Y A;  3RES A;  2ZT7 A;  3OB9 A;  4HA8 A;  4RG8 A;  3QO8 A;  1VQ9 A;  1YIJ T;  1YHQ A;  3FB9 A;  1BIB A;  1M4Z A;  5K1P A;  3DB4 A;  2L8D A;  4V2S A;  3MP8 A;  2EWN A;  3JB9 F;  1G51 A;  4ZTZ B;  2VXE A;  3CPF A;  4EO4 A;  5CQX A;  4M7D E;  4YRM A;  4B9X A;  4CS3 A;  4PJO G;  4C5I A;  4LNS A;  3MEW A;  3UWN A;  3V8L A;  4X9C A;  1WJS A;  2C06 A;  1V29 B;  2DU5 A;  1LYL A;  3OW2 A;  3PIP A;  3QKJ A;  2ODR C;  3FIF A;  4R56 A;  1E1T A;  1VQN A;  3SD4 A;  3G7Z A;  5F5W A;  4M75 A;  1XQH A;  4M75 F;  4XTX A;  4FM4 B;  1ZHI A;  4HKE A;  1UB4 A;  4MMK A;  1BI1 A;  5FU7 B;  2RHX A;  3HRS A;  2MAM A;  2ZPG B;  2CJB A;  2L3R A;  3CPW S;  3SWN A;  2K3X A;  1VIE A;  2R58 A;  2V8K A;  3OYF A;  4F7U G;  4LDY A;  1NYQ A;  3CC7 T;  3OMC A;  3RAC A;  1IZ6 A;  2DD5 A;  4FIB A;  2CZ1 B;  1W2B A;  1S72 T;  4IUU A;  4HCZ A;  1N6A A;  2QEX A;  5HK3 A;  1EIY B;  4BI8 B;  4NL2 A;  2LQ8 A;  1B8A A;  3G6E T;  1UGP B;  1SRY A;  3BDU A;  4XU1 A;  4J5Y A;  4N4H A;  1OI1 A;  1JJ2 A;  5LJ3 h;  3CCQ T;  4P3O A;  3GF5 A;  2ZNI A;  5GAO r;  3HY1 A;  1G3W A;  1GXI E;  2KK4 A;  1KOG A;  3OYN A;  2K2V A;  1QP3 A;  2DVE A;  3TEE A;  1BYM A;  2DKG A;  4P72 A;  1SER A;  1JJ2 S;  3CC4 A;  2R57 A;  4C92 E;  5GAM j;  5LJ3 e;  3JB9 H;  5GAN f;  4YRT A;  2QQR A;  4PJO A;  1YIT T;  1EVL A;  1WPY A;  2LVM A;  1WGS A;  4C8Q G;  2F5K A;  2EQM A;  4M77 A;  2A8E A;  2QQA A;  3PCO B;  3CC7 A;  3FDR A;  2K4Y A;  5LJ5 f;  1PYS B;  4O2D A;  5GAN g;  2LNV A;  2QI2 A;  5M9O A;  3TU4 K;  4A4H A;  4ZIB A;  4BB7 A;  4F7U A;  4M77 E;  3OW2 S;  3LWI A;  3MO8 A;  3L2R A;  5FLX E;  1FYF A;  5DLQ E;  3X26 B;  5LJ3 j;  2VGN A;  4OB2 B;  1E24 A;  5A2Q E;  3IKM B;  2LCL A;  5CR2 A;  1VQM A;  4C5G A;  4UP7 A;  2DAQ A;  3E9I A;  4YP0 A;  1YJ9 A;  2X4Y A;  3DKM A;  3T9N A;  4IUP A;  2DXC A;  3VUZ A;  4LVI A;  3V8J A;  4DOV A;  1E22 A;  2EYQ A;  3QZ5 B;  3E1S A;  5FU6 B;  4OLF A;  2K57 A;  3QO7 A;  1Q82 U;  1K73 U;  3C12 A;  3WVD B;  4TVA A;  1G3S A;  4PLL A;  3MP1 A;  3MEY A;  4BI4 A;  4M75 B;  4P71 A;  3INZ A;  3V7S A;  3CBO A;  4M78 G;  3M4Y A;  5GMK i;  4C0F A;  3TCJ A;  3JAM E;  4P74 C;  1BI3 A;  2I4O A;  1Q82 C;  3CMA A;  2RD1 A;  3JB9 D;  3VQW A;  3UH0 A;  1Y96 A;  3HFZ A;  3S6W A;  5KE3 A;  4M77 D;  4EDU A;  3CD6 T;  1N8R U;  2JOY A;  4KUL A;  1NJ2 A;  1EQR A;  3OS1 A;  2VXF A;  2Q7H A;  4M78 F;  4YRR A;  3QHS A;  2CKK A;  4OGE A;  2ZZD A;  4C92 B;  2HBP A;  2LC4 A;  2ODR D;  2LX9 A;  3QBY A;  3OS5 A;  3TEH B;  3KFU A;  4J6W A;  2DTH A;  5GAM g;  4XTZ A;  1NJ6 A;  3F70 A;  5IAY A;  4CH3 A;  3PFS A;  4LDX A;  2M0O A;  4TVY A;  4IUT A;  5A0L A;  3C4S A;  5GAN d;  4ZTF A;  3HRT A;  3A5Y A;  4CH5 A;  5CAI A;  1NNH A;  2EQK A;  2ZPF B;  4BDY A;  1KC8 U;  1YFR A;  2Q5I A;  3OYI A;  1B76 A;  3CBM A;  1EOV A;  2HD0 A;  4N4I A;  3QII A;  2I4M A;  2RI5 A;  2EJ9 A;  5C0M A;  1LOJ A;  5LJ3 d;  3PTA A;  3CME T;  4TVR A;  1PSF A;  5CKB A;  4M7A D;  3L2Z A;  5LJ5 g;  1M1K U;  4HT8 A;  5LL6 S;  3CC2 A;  4LVJ A;  4H2X B;  5AYF A;  4YRC A;  4ZTU B;  5FRO A;  3G4S A;  3HXU A;  2YRV A;  3SB2 A;  4BY6 B;  3RMQ A;  2ZIO A;  3VKI A;  1BBU A;  2RM4 A;  5D6Y A;  4BE0 A;  2LT1 A;  4XU0 A;  2GF7 A;  4II1 A;  3RMS A;  4YRP A;  1G3Y A;  5CKE A;  3FJP A;  5KCH A;  2PMF A;  4PLI A;  4PHC A;  2I4N A;  1M8V A;  4YCU A;  1SSF A;  3GNG A;  4M75 E;  4X34 A;  2QHT A;  2XI9 A;  1VQ9 T;  3CCM T;  1J5W A;  2M1H A;  2RJD A;  5DY9 A;  3QJ6 A;  3LLR A;  2XDD A;  3HFV A;  2K5F A;  3NTI A;  2QQ9 A;  3TRE A;  1M1G A;  4TTV A;  3A7U A;  4JS5 A;  2DZ9 A;  4IKF A;  4J6X A;  2IG0 A;  1K9M C;  2E6Z A;  2V8J A;  4YRJ A;  5I2S A;  1KG1 A;  2XHC A;  3JCM J;  2AKW A;  1DJ7 B;  4ZTJ A;  3S3N A;  4JRP A;  4YRK A;  4KBM B;  2M16 A;  5GAO n;  3HRK A;  3FLG A;  1SET A;  3I55 T;  2ZT6 A;  4MDW A;  3L2V A;  4WI1 A;  4N4G A;  3M56 A;  2DTI A;  3IAL A;  1USY C;  4P75 C;  3LWH A;  4JLG A;  2VGM A;  1HXD A;  3OYM A;  4OGC A;  1MHN A;  1O9S A;  4E47 A;  1RI0 A;  5C53 B;  3L4G A;  5KCO A;  3RGL A;  3PMI A;  4M75 D;  1KHC A;  1JB0 E;  4HT9 A;  2JTF A;  4M7D B;  5A0D A;  4BE1 A;  1KQS A;  3HP9 A;  1KMM A;  3CD6 A;  4YRO A;  3JCM P;  3OYE A;  1S72 A;  2WAC A;  1B70 A;  3ZBD A;  1KD1 U;  3QO5 A;  4RQF A;  3I55 A;  4HWR A;  3NET A;  4L5G A;  2LT4 A;  2RHU A;  2QHS A;  1Q81 U;  2R5M A;  3Q1J A;  4HVC A;  2RI2 A;  3ICA A;  2IY5 A;  4F7U F;  4KT0 E;  3HRI A;  1QVG A;  3VYG A;  2GFU A;  3VV0 A;  4HWT A;  3UGT A;  5GAO l;  2JTM A;  4RMO A;  2VYT A;  5CVI A;  2QXF A;  1U1S A;  2QTX A;  3A8L B;  4ZGJ B;  3CCJ T;  4OF1 A;  1BKB A;  3OSV A;  1R8O B;  4ELY C;  2NS6 A;  4ZGE B;  3RKY A;  4KR3 A;  2WSF E;  2E10 A;  2RA2 A;  4RMF A;  2LRQ A;  2RHI A;  3RF1 A;  4LVK A;  2CJ9 A;  1OYX A;  1UGS B;  3E9G A;  2ZZF A;  3JB9 G;  3FEO A;  3SDZ A;  1K73 C;  4XTU A;  2HNI A;  3JCM f;  3E19 A;  1VUB A;  4BE2 A;  2L89 A;  3M55 A;  4CRI A;  3G71 A;  3NTK A;  4UC4 A;  4KR2 A;  5FRN A;  2ART A;  4M77 G;  4YRS A;  1B34 B;  2PME A;  4LDV A;  4M78 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...