2DK7A

Solution structure of ww domain in transcription elongation regulator 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGKAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of WW domain in transcription elongation regulator 1
rcsb
molecule keywords Transcription elongation regulator 1
molecule tags Transcription
source organism Homo sapiens
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2dk7A00
3M85A 3KAHA 3L4HA 1I5HW 1WMVA 2XP4A 4E5RA 3CNGA 5CQ2A 3KAFA 1EG4A 2JMFA 2XPBA 1ZCNA 3TCZA 2YSIA 2LAJA 4QIBA 3KAGA 1NMVA 2ZR5A 2XP6A 3TC5A 3ODKA 3KAIA 1PINA 2XPAA 2ZR6A 2DK1A 2ITKA 2YSGA 3OOBA 3LE4A 3KCEA 2EZ5W 2DJYA 2ZQSA 2BA1A 2M8JA 1JMQA 2ZR4A 2YSHA 2JV4A 2ZQVA 3TDBA 2JXWA 3KABA 4U84A 2KXQA 1F8AB 4REXA 2ZQTA 2DWVA 2E45A 2YSFA 2M3OW 4U85A 3NTPA 2YSBA 2DK7A 1WR7A 1EG3A 1TK7A 2MDIA 2XP9A 1K9QA 2L4JA 2XP8A 1O6WA 3KADA 1YW5A 2XP7A 5AHTA 2ZAJA 2ZQUA 1K9RA 2RE3A 2DMVA 3WH0A 2F21A 2M8IA 2JX8A 4U86A 2XP5A 2XP3A 2Q5AA 3M7NA
chains in the Genus database with same CATH superfamily
3M85A 3KAHA 3L4HA 1I5HW 1WMVA 3FSCA 4A0UA 2XP4A 4E5RA 3CNGA 5CQ2A 5E65A 3KAFA 1EG4A 3PQHA 2JMFA 2XPBA 3MCBB 1ZCNA 2OWOA 3MCBA 2WADA 3TCZA 2YSIA 2LAJA 4QIBA 3KAGA 1NMVA 2ZR5A 2XP6A 5E64A 2Y8NB 3TC5A 3ODKA 3KAIA 1PINA 2XPAA 2ZR6A 4GLXA 2DK1A 2ITKA 2YSGA 3OOBA 3FS8A 3LE4A 3LKXB 3LKXA 4A0TA 3KCEA 2EZ5W 2DJYA 2ZQSA 2BA1A 2M8JA 1JMQA 2ZR4A 5E66A 2YSHA 2JV4A 2ZQVA 3TDBA 2JXWA 3KABA 4U84A 5U47A 2YAJB 2KXQA 1F8AB 3FSBA 4REXA 2ZQTA 2DWVA 2E45A 2YSFA 2M3OW 4U85A 3NTPA 3MQHA 5E62A 2YSBA 1FLCA 2DK7A 1WR7A 1EG3A 1TK7A 2MDIA 2XP9A 1K9QA 2L4JA 2XP8A 1O6WA 3KADA 1YW5A 2QRVA 2XP7A 5AHTA 2ZAJA 2ZQUA 1TR8A 1K9RA 2RE3A 2DMVA 3WH0A 2F21A 2M8IA 2JX8A 5E5WA 4U86A 2WAEA 2XP5A 1RP5A 2XP3A 3MQGA 2Q5AA 3M7NA
chains in the Genus database with same CATH topology
3M85A 3KAHA 3L4HA 1I5HW 1WMVA 3FSCA 4A0UA 2XP4A 4E5RA 3CNGA 5CQ2A 5E65A 3KAFA 1EG4A 3PQHA 2JMFA 2XPBA 3MCBB 1ZCNA 2OWOA 3MCBA 2WADA 3TCZA 2YSIA 2LAJA 4QIBA 3KAGA 1NMVA 2ZR5A 2XP6A 5E64A 2Y8NB 3TC5A 3ODKA 3KAIA 1PINA 2XPAA 2ZR6A 4GLXA 2DK1A 2ITKA 2YSGA 3OOBA 3FS8A 3LE4A 3LKXB 3LKXA 4A0TA 3KCEA 2EZ5W 2DJYA 2ZQSA 2BA1A 2M8JA 1JMQA 2ZR4A 5E66A 2YSHA 2JV4A 2ZQVA 3TDBA 2JXWA 3KABA 4U84A 5U47A 2YAJB 2KXQA 1F8AB 3FSBA 4REXA 2ZQTA 2DWVA 2E45A 2YSFA 2M3OW 4U85A 3NTPA 3MQHA 5E62A 2YSBA 1FLCA 2DK7A 1WR7A 1EG3A 1TK7A 2MDIA 2XP9A 1K9QA 2L4JA 2XP8A 1O6WA 3KADA 1YW5A 2QRVA 2XP7A 5AHTA 2ZAJA 2ZQUA 1TR8A 1K9RA 2RE3A 2DMVA 3WH0A 2F21A 2M8IA 2JX8A 5E5WA 4U86A 2WAEA 2XP5A 1RP5A 2XP3A 3MQGA 2Q5AA 3M7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M85 A;  3KAH A;  3L4H A;  1I5H W;  1WMV A;  2XP4 A;  4E5R A;  3CNG A;  5CQ2 A;  3KAF A;  1EG4 A;  2JMF A;  2XPB A;  1ZCN A;  3TCZ A;  2YSI A;  2LAJ A;  4QIB A;  3KAG A;  1NMV A;  2ZR5 A;  2XP6 A;  3TC5 A;  3ODK A;  3KAI A;  1PIN A;  2XPA A;  2ZR6 A;  2DK1 A;  2ITK A;  2YSG A;  3OOB A;  3LE4 A;  3KCE A;  2EZ5 W;  2DJY A;  2ZQS A;  2BA1 A;  2M8J A;  1JMQ A;  2ZR4 A;  2YSH A;  2JV4 A;  2ZQV A;  3TDB A;  2JXW A;  3KAB A;  4U84 A;  2KXQ A;  1F8A B;  4REX A;  2ZQT A;  2DWV A;  2E45 A;  2YSF A;  2M3O W;  4U85 A;  3NTP A;  2YSB A;  2DK7 A;  1WR7 A;  1EG3 A;  1TK7 A;  2MDI A;  2XP9 A;  1K9Q A;  2L4J A;  2XP8 A;  1O6W A;  3KAD A;  1YW5 A;  2XP7 A;  5AHT A;  2ZAJ A;  2ZQU A;  1K9R A;  2RE3 A;  2DMV A;  3WH0 A;  2F21 A;  2M8I A;  2JX8 A;  4U86 A;  2XP5 A;  2XP3 A;  2Q5A A;  3M7N A; 
#chains in the Genus database with same CATH topology
 3M85 A;  3KAH A;  3L4H A;  1I5H W;  1WMV A;  3FSC A;  4A0U A;  2XP4 A;  4E5R A;  3CNG A;  5CQ2 A;  5E65 A;  3KAF A;  1EG4 A;  3PQH A;  2JMF A;  2XPB A;  3MCB B;  1ZCN A;  2OWO A;  3MCB A;  2WAD A;  3TCZ A;  2YSI A;  2LAJ A;  4QIB A;  3KAG A;  1NMV A;  2ZR5 A;  2XP6 A;  5E64 A;  2Y8N B;  3TC5 A;  3ODK A;  3KAI A;  1PIN A;  2XPA A;  2ZR6 A;  4GLX A;  2DK1 A;  2ITK A;  2YSG A;  3OOB A;  3FS8 A;  3LE4 A;  3LKX B;  3LKX A;  4A0T A;  3KCE A;  2EZ5 W;  2DJY A;  2ZQS A;  2BA1 A;  2M8J A;  1JMQ A;  2ZR4 A;  5E66 A;  2YSH A;  2JV4 A;  2ZQV A;  3TDB A;  2JXW A;  3KAB A;  4U84 A;  5U47 A;  2YAJ B;  2KXQ A;  1F8A B;  3FSB A;  4REX A;  2ZQT A;  2DWV A;  2E45 A;  2YSF A;  2M3O W;  4U85 A;  3NTP A;  3MQH A;  5E62 A;  2YSB A;  1FLC A;  2DK7 A;  1WR7 A;  1EG3 A;  1TK7 A;  2MDI A;  2XP9 A;  1K9Q A;  2L4J A;  2XP8 A;  1O6W A;  3KAD A;  1YW5 A;  2QRV A;  2XP7 A;  5AHT A;  2ZAJ A;  2ZQU A;  1TR8 A;  1K9R A;  2RE3 A;  2DMV A;  3WH0 A;  2F21 A;  2M8I A;  2JX8 A;  5E5W A;  4U86 A;  2WAE A;  2XP5 A;  1RP5 A;  2XP3 A;  3MQG A;  2Q5A A;  3M7N A; 
#chains in the Genus database with same CATH homology
 3M85 A;  3KAH A;  3L4H A;  1I5H W;  1WMV A;  3FSC A;  4A0U A;  2XP4 A;  4E5R A;  3CNG A;  5CQ2 A;  5E65 A;  3KAF A;  1EG4 A;  3PQH A;  2JMF A;  2XPB A;  3MCB B;  1ZCN A;  2OWO A;  3MCB A;  2WAD A;  3TCZ A;  2YSI A;  2LAJ A;  4QIB A;  3KAG A;  1NMV A;  2ZR5 A;  2XP6 A;  5E64 A;  2Y8N B;  3TC5 A;  3ODK A;  3KAI A;  1PIN A;  2XPA A;  2ZR6 A;  4GLX A;  2DK1 A;  2ITK A;  2YSG A;  3OOB A;  3FS8 A;  3LE4 A;  3LKX B;  3LKX A;  4A0T A;  3KCE A;  2EZ5 W;  2DJY A;  2ZQS A;  2BA1 A;  2M8J A;  1JMQ A;  2ZR4 A;  5E66 A;  2YSH A;  2JV4 A;  2ZQV A;  3TDB A;  2JXW A;  3KAB A;  4U84 A;  5U47 A;  2YAJ B;  2KXQ A;  1F8A B;  3FSB A;  4REX A;  2ZQT A;  2DWV A;  2E45 A;  2YSF A;  2M3O W;  4U85 A;  3NTP A;  3MQH A;  5E62 A;  2YSB A;  1FLC A;  2DK7 A;  1WR7 A;  1EG3 A;  1TK7 A;  2MDI A;  2XP9 A;  1K9Q A;  2L4J A;  2XP8 A;  1O6W A;  3KAD A;  1YW5 A;  2QRV A;  2XP7 A;  5AHT A;  2ZAJ A;  2ZQU A;  1TR8 A;  1K9R A;  2RE3 A;  2DMV A;  3WH0 A;  2F21 A;  2M8I A;  2JX8 A;  5E5W A;  4U86 A;  2WAE A;  2XP5 A;  1RP5 A;  2XP3 A;  3MQG A;  2Q5A A;  3M7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...