2DKLA

Solution structure of the uba domain in the human trinucleotide repeat containing 6c protein (htnrc6c)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
GSSGSSGGMKTSGKQDEAWIMSRLIKQLTDMGFPREPAEEALKSNNMNLDQAMSALLEKKVDVDKRGLGVTDHNGMAAKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trinucleotide Repeat Containing 6C Protein
publication title Solution Structure of the UBA Domain in the Human Trinucleotide Repeat Containing 6C Protein (hTNRC6C)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dklA00
1HT2E 3FRHA 2DHYA 1DO0A 4DBGB 4Q7JA 3IECA 1NV9A 1Q02A 3K9PA 4F1IA 1KYIA 2EKKA 1CUKA 1V92A 2R0IA 1R4GA 2QHOB 2G3QA 2DZLA 2OOBA 2WZJA 2OOAA 1IXSA 1OQYA 2DAGA 2LVQD 1E94E 2RRUA 3E21A 2QNJA 2HAKA 4R71A 2OO9A 1VEGA 1WR1B 3GLIE 2H5XA 5JI2E 1GO5A 1OKSA 1XB2B 1AIPC 2MROB 1PGYA 4GEWA 1WHCA 2JP7A 2O25A 2K0BX 2ZTCA 3LCVB 2HWJA 3BBZA 1G41A 2L4FA 2DNAA 2JZ1A 2MGWA 1TR8A 2DAEA 1ZMVA 2LBCA 4WP2A 1BVSA 2LTUA 1P3QQ 3MMPA 1EFUB 2JUJA 2BWBA 3GLGE 1HT1E 5DFLA 2JY8A 3B89A 2DAKA 1IM2A 2KNVA 1UFZA 3LCUA 2JY5A 1ZV1A 1G4AE 3FE3A 2BWEA 2KHHA 1OTRA 2MJ5B 2QSFX 1A5TA 3GLHE 1YLAA 2DKLA 4G3OA 1VG5A 3T6PA 1IFYA 4HEOA 1NV8A 3FRIA 1HJPA 2KNZA 1VDLA 2EJSA 2B3TA 2DAIA 1WJ7A 1HQYE 1Y8GA 2JZ0A 1OAIA 2LVPC 1C7YA 2CP8A 3K9OA 2JY6B 1TTEA 2LVAA 1ZMUA 1VQ1A 1WGLA 2JNHA 1T43A 2MR9A 3F92A 1WGNA 1DV0A 1QZEA 1VEJA 1ZMWA 1WIVA 1MN3A 2L4EA 2EKFA 1VEKA 2DI0A 2L2DA 3H4JA 2ZTDA 2JY7A 1DO2A 4UN2B 2DAMA 1XXHE 1F4IA 1G3IA 3GLFE 1JR3E 3E46A 2K9DA 2KNAA 1T6OA 2LVNC 4F2LA 2DENA 2LVOC 3IHPA 2CWBA 1SG9A
chains in the Genus database with same CATH superfamily
3GO8A 2QPAA 2DHYA 3MK6A 4MGIE 3UJNA 2FS1A 3J2PB 3PNYA 4DBGB 2LHGA 4DR2M 3QAUA 3IECA 3PFIA 1NV9A 4REZA 1CUKA 1V92A 4BBAA 2XFTA 2C96A 3NBIA 2QHOB 2BJWA 2LH0A 2VQEM 2DZLA 2OQ4A 1EIJA 1EE8A 2C9OA 2WZJA 2OOAA 2CUZA 2KXEA 4LRTA 3A98B 2LVQD 2RRUA 1OAOC 4LJ7A 5A2QS 2Y0TA 2OO9A 1PJQA 1VEGA 3B7ZA 5IREB 3UMMA 5JI2E 3SAWA 1OKSA 1XB2B 4X65M 3SBJA 2Z8YM 2F5PA 1SXJB 4P16A 1NO1A 3AV0A 1WHCA 4B3MM 3DZDA 2O25A 4IBCA 4S12A 2ZTCA 1JR3D 3KSJA 1GLNA 1QUTA 3LW5F 2L4FA 3MJ5A 1IY1A 1NJFA 2DAEA 2RKOA 1K3WA 4LJ9A 2LHCA 3GRYA 5ITRA 3FUWA 1VDDA 4B3RM 1IN5A 4OW0A 3KOXE 2VQFM 4DR3M 2R6FA 3VFDA 2P5TA 4QOZC 1IN6A 1N36M 4KT0F 5DFLA 4GRIA 3B89A 4LFAM 2Y21A 2KNVA 4FW9A 5DYIA 3ZH9B 3HHZA 2MH8A 3U5ZB 4LF5M 4IBDA 3R8FA 1J7KA 5FLXS 1NVMA 2QSFX 2BNKA 4KO8A 4PDIA 3SASA 3GLHE 1YLAA 2DKLA 3I04M 1VG5A 4G3OA 4FCVA 5LMNM 3T6PA 4G4QA 2F5NA 2C5RA 1NV8A 3SHGB 2L7HA 4XK8F 4JI6M 3B7QA 2KNZA 4X64M 1L1ZA 4OX9M 1WJ7A 4IBJA 3FUXA 3HHWA 1GJSA 4GIPA 4RKUF 4L6V6 1W5SA 2H1RA 2JZ0A 2JXNA 4IBIA 4XGIA 3U5ZA 2R45A 4IJEA 1YSYA 2JY6B 3VDPA 3U60A 3SYKA 2DZOB 1ZMUA 3GRVA 3HJSA 1N34M 1KSFX 3AJIB 3GLIB 3F92A 2XSZD 2VDBB 2FFJA 3B7NA 4AI6A 1IN7A 2WSEF 2CHQA 3GLHA 3TQSA 3KP1E 2E5LM 3VKHA 2HL7A 1VEJA 1ZMWA 2RGOA 4GH9A 2C9CA 2N35A 3FTFA 4GITA 2EKFA 1I4WA 2EUCA 1GKIA 2DI0A 1XXHA 1NNUC 3IG8A 4RF0A 1JR3A 3H4JA 4G6ZA 2ZTDA 3A42A 4M9XA 4LGYA 4EIWA 5ITXE 3FYCA 2UUAM 3PNVA 1IY2A 1G3IA 5EQTA 2ZANA 3GPPA 2DWMA 4M9SA 4P17A 5EP3A 2Z3XA 1D2NA 3GRUA 4LFCM 3LQQA 3FUVA 3WHKA 3KW6A 4WURA 4JXJA 3KS4A 1L1TA 2DWLA 3IHPA 1SG9A 4MGKE 1XMQM 3J81S 2UXBM 4QNMA 3L25A 3FRHA 4LZZA 3H4MA 1NSFA 2RGHA 2WSFF 3J80S 2F5OA 4MGYE 3L27A 1T3TA 2CV1A 2UU9M 1XWIA 2JWSA 3GPYA 2F4VM 3W67A 4F1IA 2NQ8C 5F3WA 2CHVA 2C99A 3ILKA 1E32A 3A46A 1IXRC 3GQ3A 4QHTA 3J7AS 3E4RA 1PRBA 3Q8XA 3KDSE 4LJ4A 3U6CA 4NSOB 2G3QA 4QHSA 4DV1M 5E26A 4PCZA 5KPZA 2FE8A 1OQYA 1K82A 1IBKM 3GLGB 1Q39A 4FCWA 3R9XB 4D80A 3E21A 1Q3BA 2HKJA 5KPRA 1D0KA 2HAKA 4D82A 1SXJD 2X4AA 2R44A 1IY0A 4R71A 4FD2A 1N75A 3GPUA 4I81A 3RGPA 1KFVA 1IN4A 5EXPA 2XSZA 2X49A 3GQ4A 1GO5A 4PD2A 5EXSA 4JI3M 3W0LB 4LG2A 3W0FA 1MX0A 2JP7A 1DGHA 3K92A 1IN8A 2HWJA 2VF8A 3BBZA 1G41A 4JI1M 2XZUA 4L78A 2DNAA 1MU5A 2MGWA 3TWLA 3U6LA 5E6JA 3GLFB 4LY6A 3GLGA 1E9SA 4W5WA 1QYRA 4OVZB 4G4RA 1BVSA 1P3QQ 3MMPA 4ANRA 1EFUB 4DV5M 2JUJA 3HY5A 2CV0A 1R2ZA 8CATA 3M7GA 4LFBM 1GVNA 2GNOA 1HR0M 2DAKA 1ZAEA 1N77A 1QDRA 1ZV1A 2W82A 4IBFA 3ZQJA 4CGYB 2KHHA 2KZSA 2MJ5B 4K0KM 3AOEA 2F5SA 1DGBA 2I7NA 2XEPA 1V34A 3L29A 1SXJE 3J7BA 3W68A 3OTOM 2I7PA 1NY5A 1R2YA 4CJ6A 2G5GX 3SFZA 5FSWA 2DZNB 5EXTA 5IZ7D 3HU2A 1VDLA 1ZQ9A 2B3TA 2EJSA 4M0WA 1QAMA 1OIPA 4M9ZA 4XBOA 1DGGA 1PJSA 3HJ8A 4DUYM 4DV4M 1HNWM 3DOAA 4M0DA 3U6QA 2CP8A 3K9OA 4AG5A 1IXSB 2KRUA 2QQ8A 4KLNA 3CTWB 5BR8M 1R5LA 1XMOM 4LF9M 1VQ1A 4FWHA 1NJGA 5KO3A 4LJ5A 2J7OA 1OIZA 2K47A 2LNHC 4FVMA 3FTCA 1SXJA 3SC3A 1R6BX 4B7HA 1I94M 4LF8M 3AL0C 4NOOB 3LMMA 1MJGM 3TL4X 1WIVA 2DWZB 5FTNA 1L8QA 4R7GA 2M5ZA 3LVVA 3L28A 2VF7A 4LCBA 4BB9A 1TH4A 3FKEA 2JY7A 4AQYM 4UN2B 1XXHE 2XFSA 3T1YM 4TUWA 4NL4H 4JI8M 1YUBA 1JR3E 3E46A 5EP4A 3ZCBB 2BJVA 2DVWB 2KNAA 1T6OA 3U6EA 4F2LA 2CV2A 1JQJC 2LVOC 2QBYB 1PJTA 3LVWA 3THGA 2CE7A 1TH2A 1HT2E 4QNRA 1OFIA 1DO0A 3VK7A 2ZBKB 3CF6E 2FH0A 1Q02A 1TGUA 1KYIA 4B7GA 4DV0M 1QQWA 2Z4SA 3KOWE 3VDUA 4IBBA 2UXCM 2R0IA 4RNAA 2HHHM 2XGNA 2ZAMA 4L8RC 4FWGA 2J7NA 4CISA 4JI0M 1LV7A 5FTLA 3PVSA 2OOBA 4IIWA 2CFOA 3QYBA 4MGHA 2XLJA 2QBYA 4AKGA 5ITTA 1IXZA 1Z5CA 2L7IA 3TWMA 3GLIA 3FTDA 3K8ZA 3I51A 4IBKA 1GL6A 4G4OA 1OFHA 4HL4A 7CATA 3KOZE 4NSRA 5ITUA 3I4VA 4ITQA 3FYDA 2M60A 2H5XA 2VIIA 3HX3A 1AIPC 4ZPXA 1PGYA 1G59A 2KW0A 1QAQA 3L26A 2K0BX 4KHPM 2CHGA 3QYEA 1ORYB 1X37A 4YHHM 1L2DA 2F5QA 3HJQA 3K2LA 1WXQA 3HU1A 1E9RA 3MHVC 3TWKA 4GMQA 3U61B 2KRKA 3K1JA 1ZMVA 4GC5A 5C1BA 2GQFA 2Y0QA 2R18A 2KZUA 1K3XA 3A45A 2V6ZM 3AKZA 3FD9A 2OPFA 1HQCA 3GLGE 4AZFA 2V1UA 1HT1E 4GKKM 3LCUA 1NY6A 3T38A 5KQDA 2JY5A 5FTJA 3RE8A 3FE3A 3SYLA 1FNNA 1S3SA 1OTRA 3HGIA 1G71A 2AHMA 3KFUG 2C98A 5ITQA 1Z5AA 3HHYA 1A5TA 3SAVA 5DYGA 2L6OA 4L4UA 4JYAM 3V76A 3FRIA 1NHWC 2EA0A 3C3DA 2CRUA 2DAIA 2J5YA 4DV7M 1C1KA 4GC9A 1TDHA 1Y8GA 3KVWA 3M6AA 1QUSA 4Z6YA 4CIZA 1HNXM 1OAIA 3U6MA 4IBEA 1TTEA 2LWXA 2YR0A 3D8BA 3CGWA 3HZJA 4DUZM 4DV6M 4QOSA 5KQ8A 2JNHA 2MR9A 1TH3A 2KA6B 4X62M 2FNAA 4Y28F 3U6SA 1PM5A 3UZUA 4NRWA 3EIEA 1WGNA 3BOSA 1QANA 1DV0A 3JR4A 4GHAA 1FJGM 3I01M 3JR5A 4B3TM 5KPTA 1MN3A 5H37D 2DWNA 1GL7A 1Q3CA 1VEKA 2XH9A 3B9PA 4IJFA 3SARA 2L2DA 3GLFA 5EJCA 4D81A 1L2BA 2UUBM 4OVZA 3Q8GA 1D0LA 2DAMA 3FTEA 2CEAA 1NHGC 1R7RA 4NC6A 3BXWA 4MGZE 2R65A 2K9DA 2L09A 3SMSA 1V33A 3KS8A 3IG5A 4KODA 2KDLA 2QENA 2UUCM 1TF0B 1LTMA 1Z5BA 3FUUA 2D7EA 2YQZA 2YFQA 3U6OA 3T1HM 4B7FA 2R4JA 4Q7JA 3TPZA 4DR6M 2UXDM 3M0EA 2D7GA 4LRSA 3U6PA 1QAOA 3TE6A 3K9PA 3KOYE 3RFWA 1QVRA 1Z59A 2EKKA 4LJ6A 4B3SM 3RGSA 3LQRA 1R4GA 1XNRM 4I4LA 4B08A 3KSXA 4GHLA 2FOIC 2O5RA 2Y20A 1L2CA 4NXMM 1IXSA 3GPXA 3T15A 1TDZA 2DAGA 1E94E 1W5TA 3DA1A 4NXNM 2HCBA 2LXEA 2V1CA 2YNMD 2QNJA 1YE9A 4RF1A 4I5SA 3U6DA 4HLQA 1J09A 3SHFA 1IQPA 3HU3A 4MM3B 3U60B 1N78A 3UK6A 1WR1B 3J27B 3GLIE 4DR4M 4LJ8A 5BPVA 3SAUA 2KEBA 5EP1A 4LGMA 1PJJA 1G8PA 2MROB 2ZAOA 3GLHB 4GEWA 4L16A 1IBLM 4JI7M 1Z6TA 2APLA 1IBMM 3LCVB 4A3VB 4DV2M 4R3DA 3ZC7B 2JZ1A 1XXHB 1TR8A 4I8OA 5DNYA 2A5YB 3AOEC 2XF3A 4PDGA 4LF6M 3E9SA 3CF0A 2LBCA 4LZJA 1UM8A 5FTKA 4WP2A 3C9PA 5C18A 2LTUA 3NWLA 2O01F 5FTMA 5IT9S 2BWBA 4DV3M 4AG6A 1J5EM 3HHXA 2JY8A 4LJAA 1IM2A 1UFZA 3B74A 2G8LA 1N33M 4AKIA 1G4AE 4LF7M 2BWEA 4WW0A 1NNJA 5L8RF 4JV5M 3PXGA 3EIHA 3SMPA 4JI5M 3DFZA 3HWSA 1GJTA 4DR1M 4HEOA 1IFYA 1HJPA 1SXJC 4DR7M 1HQYE 3QWLA 4II7A 4FCTA 4G4NA 2QP9X 1RU3A 3VK8A 3HKPA 2LVPC 3JAMS 1C7YA 5EP2A 3KP0E 3CF2A 3GP1A 2LVAA 4JI4M 1N32M 1WGLA 2Z7JA 2R46A 1T43A 4GKJM 1GABA 1DGFA 1H6UA 4MB7A 4LF4M 2EO2A 2X8AA 1HNZM 5EXXA 3D8LA 1QZEA 1PJIA 2WSCF 3GQ5A 2R62A 3SATA 3AFHA 5IWAM 1XNQM 2L4EA 4DR5M 4FWDA 3VLFB 5ITXA 2QZ4A 1XHBA 5ITYA 1QZMA 2ZM6M 4AKHA 2D7HA 3U61A 1DGHB 5GKNA 5JI3E 1QDTA 4OU7A 2DXIA 2QCUA 2XZFA 1DO2A 2K6BA 4X66M 1AUAA 1F4IA 5LMUM 2Q2EB 3NBXX 3GLFE 1OJLA 4JN6A 3KXEC 3UGJA 4IBGA 1JB0F 3GRRA 2DHRA 4AW4A 3AOGA 2Z4RA 1XC8A 3C58A 4MH0E 2LVNC 3FUTA 4YY3M 2DENA 4PT5A 4Z8XA 2R4EA 4L15A 4NRVA 2ERCA 1D0MA 3I4YA 2CWBA 3L2AA 3WHLA 4CHTB 3C3EA 2JA2A 4JI2M 3VKGA 4BLCA
chains in the Genus database with same CATH topology
1HT2E 3FRHA 2DHYA 1DO0A 4DBGB 4Q7JA 3IECA 1NV9A 1Q02A 3K9PA 4F1IA 1KYIA 2EKKA 1CUKA 1V92A 2R0IA 1R4GA 2QHOB 2G3QA 2DZLA 2OOBA 2WZJA 2OOAA 1IXSA 1OQYA 2DAGA 2LVQD 1E94E 2RRUA 3E21A 2QNJA 2HAKA 4R71A 2OO9A 1VEGA 1WR1B 3GLIE 2H5XA 5JI2E 1GO5A 1OKSA 1XB2B 1AIPC 2MROB 1PGYA 4GEWA 1WHCA 2JP7A 2O25A 2K0BX 2ZTCA 3LCVB 2HWJA 3BBZA 1G41A 2L4FA 2DNAA 2JZ1A 2MGWA 1TR8A 2DAEA 1ZMVA 2LBCA 4WP2A 1BVSA 2LTUA 1P3QQ 3MMPA 1EFUB 2JUJA 2BWBA 3GLGE 1HT1E 5DFLA 2JY8A 3B89A 2DAKA 1IM2A 2KNVA 1UFZA 3LCUA 2JY5A 1ZV1A 1G4AE 3FE3A 2BWEA 2KHHA 1OTRA 2MJ5B 2QSFX 1A5TA 3GLHE 1YLAA 2DKLA 4G3OA 1VG5A 3T6PA 1IFYA 4HEOA 1NV8A 3FRIA 1HJPA 2KNZA 1VDLA 2EJSA 2B3TA 2DAIA 1WJ7A 1HQYE 1Y8GA 2JZ0A 1OAIA 2LVPC 1C7YA 2CP8A 3K9OA 2JY6B 1TTEA 2LVAA 1ZMUA 1VQ1A 1WGLA 2JNHA 1T43A 2MR9A 3F92A 1WGNA 1DV0A 1QZEA 1VEJA 1ZMWA 1WIVA 1MN3A 2L4EA 2EKFA 1VEKA 2DI0A 2L2DA 3H4JA 2ZTDA 2JY7A 1DO2A 4UN2B 2DAMA 1XXHE 1F4IA 1G3IA 3GLFE 1JR3E 3E46A 2K9DA 2KNAA 1T6OA 2LVNC 4F2LA 2DENA 2LVOC 3IHPA 2CWBA 1SG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HT2 E;  3FRH A;  2DHY A;  1DO0 A;  4DBG B;  4Q7J A;  3IEC A;  1NV9 A;  1Q02 A;  3K9P A;  4F1I A;  1KYI A;  2EKK A;  1CUK A;  1V92 A;  2R0I A;  1R4G A;  2QHO B;  2G3Q A;  2DZL A;  2OOB A;  2WZJ A;  2OOA A;  1IXS A;  1OQY A;  2DAG A;  2LVQ D;  1E94 E;  2RRU A;  3E21 A;  2QNJ A;  2HAK A;  4R71 A;  2OO9 A;  1VEG A;  1WR1 B;  3GLI E;  2H5X A;  5JI2 E;  1GO5 A;  1OKS A;  1XB2 B;  1AIP C;  2MRO B;  1PGY A;  4GEW A;  1WHC A;  2JP7 A;  2O25 A;  2K0B X;  2ZTC A;  3LCV B;  2HWJ A;  3BBZ A;  1G41 A;  2L4F A;  2DNA A;  2JZ1 A;  2MGW A;  1TR8 A;  2DAE A;  1ZMV A;  2LBC A;  4WP2 A;  1BVS A;  2LTU A;  1P3Q Q;  3MMP A;  1EFU B;  2JUJ A;  2BWB A;  3GLG E;  1HT1 E;  5DFL A;  2JY8 A;  3B89 A;  2DAK A;  1IM2 A;  2KNV A;  1UFZ A;  3LCU A;  2JY5 A;  1ZV1 A;  1G4A E;  3FE3 A;  2BWE A;  2KHH A;  1OTR A;  2MJ5 B;  2QSF X;  1A5T A;  3GLH E;  1YLA A;  2DKL A;  4G3O A;  1VG5 A;  3T6P A;  1IFY A;  4HEO A;  1NV8 A;  3FRI A;  1HJP A;  2KNZ A;  1VDL A;  2EJS A;  2B3T A;  2DAI A;  1WJ7 A;  1HQY E;  1Y8G A;  2JZ0 A;  1OAI A;  2LVP C;  1C7Y A;  2CP8 A;  3K9O A;  2JY6 B;  1TTE A;  2LVA A;  1ZMU A;  1VQ1 A;  1WGL A;  2JNH A;  1T43 A;  2MR9 A;  3F92 A;  1WGN A;  1DV0 A;  1QZE A;  1VEJ A;  1ZMW A;  1WIV A;  1MN3 A;  2L4E A;  2EKF A;  1VEK A;  2DI0 A;  2L2D A;  3H4J A;  2ZTD A;  2JY7 A;  1DO2 A;  4UN2 B;  2DAM A;  1XXH E;  1F4I A;  1G3I A;  3GLF E;  1JR3 E;  3E46 A;  2K9D A;  2KNA A;  1T6O A;  2LVN C;  4F2L A;  2DEN A;  2LVO C;  3IHP A;  2CWB A;  1SG9 A; 
#chains in the Genus database with same CATH topology
 3GO8 A;  2QPA A;  2DHY A;  3MK6 A;  4MGI E;  3UJN A;  2FS1 A;  3J2P B;  3PNY A;  4DBG B;  2LHG A;  4DR2 M;  3QAU A;  3IEC A;  3PFI A;  1NV9 A;  4REZ A;  1CUK A;  1V92 A;  4BBA A;  2XFT A;  2C96 A;  3NBI A;  2QHO B;  2BJW A;  2LH0 A;  2VQE M;  2DZL A;  2OQ4 A;  1EIJ A;  1EE8 A;  2C9O A;  2WZJ A;  2OOA A;  2CUZ A;  2KXE A;  4LRT A;  3A98 B;  2LVQ D;  2RRU A;  1OAO C;  4LJ7 A;  5A2Q S;  2Y0T A;  2OO9 A;  1PJQ A;  1VEG A;  3B7Z A;  5IRE B;  3UMM A;  5JI2 E;  3SAW A;  1OKS A;  1XB2 B;  4X65 M;  3SBJ A;  2Z8Y M;  2F5P A;  1SXJ B;  4P16 A;  1NO1 A;  3AV0 A;  1WHC A;  4B3M M;  3DZD A;  2O25 A;  4IBC A;  4S12 A;  2ZTC A;  1JR3 D;  3KSJ A;  1GLN A;  1QUT A;  3LW5 F;  2L4F A;  3MJ5 A;  1IY1 A;  1NJF A;  2DAE A;  2RKO A;  1K3W A;  4LJ9 A;  2LHC A;  3GRY A;  5ITR A;  3FUW A;  1VDD A;  4B3R M;  1IN5 A;  4OW0 A;  3KOX E;  2VQF M;  4DR3 M;  2R6F A;  3VFD A;  2P5T A;  4QOZ C;  1IN6 A;  1N36 M;  4KT0 F;  5DFL A;  4GRI A;  3B89 A;  4LFA M;  2Y21 A;  2KNV A;  4FW9 A;  5DYI A;  3ZH9 B;  3HHZ A;  2MH8 A;  3U5Z B;  4LF5 M;  4IBD A;  3R8F A;  1J7K A;  5FLX S;  1NVM A;  2QSF X;  2BNK A;  4KO8 A;  4PDI A;  3SAS A;  3GLH E;  1YLA A;  2DKL A;  3I04 M;  1VG5 A;  4G3O A;  4FCV A;  5LMN M;  3T6P A;  4G4Q A;  2F5N A;  2C5R A;  1NV8 A;  3SHG B;  2L7H A;  4XK8 F;  4JI6 M;  3B7Q A;  2KNZ A;  4X64 M;  1L1Z A;  4OX9 M;  1WJ7 A;  4IBJ A;  3FUX A;  3HHW A;  1GJS A;  4GIP A;  4RKU F;  4L6V 6;  1W5S A;  2H1R A;  2JZ0 A;  2JXN A;  4IBI A;  4XGI A;  3U5Z A;  2R45 A;  4IJE A;  1YSY A;  2JY6 B;  3VDP A;  3U60 A;  3SYK A;  2DZO B;  1ZMU A;  3GRV A;  3HJS A;  1N34 M;  1KSF X;  3AJI B;  3GLI B;  3F92 A;  2XSZ D;  2VDB B;  2FFJ A;  3B7N A;  4AI6 A;  1IN7 A;  2WSE F;  2CHQ A;  3GLH A;  3TQS A;  3KP1 E;  2E5L M;  3VKH A;  2HL7 A;  1VEJ A;  1ZMW A;  2RGO A;  4GH9 A;  2C9C A;  2N35 A;  3FTF A;  4GIT A;  2EKF A;  1I4W A;  2EUC A;  1GKI A;  2DI0 A;  1XXH A;  1NNU C;  3IG8 A;  4RF0 A;  1JR3 A;  3H4J A;  4G6Z A;  2ZTD A;  3A42 A;  4M9X A;  4LGY A;  4EIW A;  5ITX E;  3FYC A;  2UUA M;  3PNV A;  1IY2 A;  1G3I A;  5EQT A;  2ZAN A;  3GPP A;  2DWM A;  4M9S A;  4P17 A;  5EP3 A;  2Z3X A;  1D2N A;  3GRU A;  4LFC M;  3LQQ A;  3FUV A;  3WHK A;  3KW6 A;  4WUR A;  4JXJ A;  3KS4 A;  1L1T A;  2DWL A;  3IHP A;  1SG9 A;  4MGK E;  1XMQ M;  3J81 S;  2UXB M;  4QNM A;  3L25 A;  3FRH A;  4LZZ A;  3H4M A;  1NSF A;  2RGH A;  2WSF F;  3J80 S;  2F5O A;  4MGY E;  3L27 A;  1T3T A;  2CV1 A;  2UU9 M;  1XWI A;  2JWS A;  3GPY A;  2F4V M;  3W67 A;  4F1I A;  2NQ8 C;  5F3W A;  2CHV A;  2C99 A;  3ILK A;  1E32 A;  3A46 A;  1IXR C;  3GQ3 A;  4QHT A;  3J7A S;  3E4R A;  1PRB A;  3Q8X A;  3KDS E;  4LJ4 A;  3U6C A;  4NSO B;  2G3Q A;  4QHS A;  4DV1 M;  5E26 A;  4PCZ A;  5KPZ A;  2FE8 A;  1OQY A;  1K82 A;  1IBK M;  3GLG B;  1Q39 A;  4FCW A;  3R9X B;  4D80 A;  3E21 A;  1Q3B A;  2HKJ A;  5KPR A;  1D0K A;  2HAK A;  4D82 A;  1SXJ D;  2X4A A;  2R44 A;  1IY0 A;  4R71 A;  4FD2 A;  1N75 A;  3GPU A;  4I81 A;  3RGP A;  1KFV A;  1IN4 A;  5EXP A;  2XSZ A;  2X49 A;  3GQ4 A;  1GO5 A;  4PD2 A;  5EXS A;  4JI3 M;  3W0L B;  4LG2 A;  3W0F A;  1MX0 A;  2JP7 A;  1DGH A;  3K92 A;  1IN8 A;  2HWJ A;  2VF8 A;  3BBZ A;  1G41 A;  4JI1 M;  2XZU A;  4L78 A;  2DNA A;  1MU5 A;  2MGW A;  3TWL A;  3U6L A;  5E6J A;  3GLF B;  4LY6 A;  3GLG A;  1E9S A;  4W5W A;  1QYR A;  4OVZ B;  4G4R A;  1BVS A;  1P3Q Q;  3MMP A;  4ANR A;  1EFU B;  4DV5 M;  2JUJ A;  3HY5 A;  2CV0 A;  1R2Z A;  8CAT A;  3M7G A;  4LFB M;  1GVN A;  2GNO A;  1HR0 M;  2DAK A;  1ZAE A;  1N77 A;  1QDR A;  1ZV1 A;  2W82 A;  4IBF A;  3ZQJ A;  4CGY B;  2KHH A;  2KZS A;  2MJ5 B;  4K0K M;  3AOE A;  2F5S A;  1DGB A;  2I7N A;  2XEP A;  1V34 A;  3L29 A;  1SXJ E;  3J7B A;  3W68 A;  3OTO M;  2I7P A;  1NY5 A;  1R2Y A;  4CJ6 A;  2G5G X;  3SFZ A;  5FSW A;  2DZN B;  5EXT A;  5IZ7 D;  3HU2 A;  1VDL A;  1ZQ9 A;  2B3T A;  2EJS A;  4M0W A;  1QAM A;  1OIP A;  4M9Z A;  4XBO A;  1DGG A;  1PJS A;  3HJ8 A;  4DUY M;  4DV4 M;  1HNW M;  3DOA A;  4M0D A;  3U6Q A;  2CP8 A;  3K9O A;  4AG5 A;  1IXS B;  2KRU A;  2QQ8 A;  4KLN A;  3CTW B;  5BR8 M;  1R5L A;  1XMO M;  4LF9 M;  1VQ1 A;  4FWH A;  1NJG A;  5KO3 A;  4LJ5 A;  2J7O A;  1OIZ A;  2K47 A;  2LNH C;  4FVM A;  3FTC A;  1SXJ A;  3SC3 A;  1R6B X;  4B7H A;  1I94 M;  4LF8 M;  3AL0 C;  4NOO B;  3LMM A;  1MJG M;  3TL4 X;  1WIV A;  2DWZ B;  5FTN A;  1L8Q A;  4R7G A;  2M5Z A;  3LVV A;  3L28 A;  2VF7 A;  4LCB A;  4BB9 A;  1TH4 A;  3FKE A;  2JY7 A;  4AQY M;  4UN2 B;  1XXH E;  2XFS A;  3T1Y M;  4TUW A;  4NL4 H;  4JI8 M;  1YUB A;  1JR3 E;  3E46 A;  5EP4 A;  3ZCB B;  2BJV A;  2DVW B;  2KNA A;  1T6O A;  3U6E A;  4F2L A;  2CV2 A;  1JQJ C;  2LVO C;  2QBY B;  1PJT A;  3LVW A;  3THG A;  2CE7 A;  1TH2 A;  1HT2 E;  4QNR A;  1OFI A;  1DO0 A;  3VK7 A;  2ZBK B;  3CF6 E;  2FH0 A;  1Q02 A;  1TGU A;  1KYI A;  4B7G A;  4DV0 M;  1QQW A;  2Z4S A;  3KOW E;  3VDU A;  4IBB A;  2UXC M;  2R0I A;  4RNA A;  2HHH M;  2XGN A;  2ZAM A;  4L8R C;  4FWG A;  2J7N A;  4CIS A;  4JI0 M;  1LV7 A;  5FTL A;  3PVS A;  2OOB A;  4IIW A;  2CFO A;  3QYB A;  4MGH A;  2XLJ A;  2QBY A;  4AKG A;  5ITT A;  1IXZ A;  1Z5C A;  2L7I A;  3TWM A;  3GLI A;  3FTD A;  3K8Z A;  3I51 A;  4IBK A;  1GL6 A;  4G4O A;  1OFH A;  4HL4 A;  7CAT A;  3KOZ E;  4NSR A;  5ITU A;  3I4V A;  4ITQ A;  3FYD A;  2M60 A;  2H5X A;  2VII A;  3HX3 A;  1AIP C;  4ZPX A;  1PGY A;  1G59 A;  2KW0 A;  1QAQ A;  3L26 A;  2K0B X;  4KHP M;  2CHG A;  3QYE A;  1ORY B;  1X37 A;  4YHH M;  1L2D A;  2F5Q A;  3HJQ A;  3K2L A;  1WXQ A;  3HU1 A;  1E9R A;  3MHV C;  3TWK A;  4GMQ A;  3U61 B;  2KRK A;  3K1J A;  1ZMV A;  4GC5 A;  5C1B A;  2GQF A;  2Y0Q A;  2R18 A;  2KZU A;  1K3X A;  3A45 A;  2V6Z M;  3AKZ A;  3FD9 A;  2OPF A;  1HQC A;  3GLG E;  4AZF A;  2V1U A;  1HT1 E;  4GKK M;  3LCU A;  1NY6 A;  3T38 A;  5KQD A;  2JY5 A;  5FTJ A;  3RE8 A;  3FE3 A;  3SYL A;  1FNN A;  1S3S A;  1OTR A;  3HGI A;  1G71 A;  2AHM A;  3KFU G;  2C98 A;  5ITQ A;  1Z5A A;  3HHY A;  1A5T A;  3SAV A;  5DYG A;  2L6O A;  4L4U A;  4JYA M;  3V76 A;  3FRI A;  1NHW C;  2EA0 A;  3C3D A;  2CRU A;  2DAI A;  2J5Y A;  4DV7 M;  1C1K A;  4GC9 A;  1TDH A;  1Y8G A;  3KVW A;  3M6A A;  1QUS A;  4Z6Y A;  4CIZ A;  1HNX M;  1OAI A;  3U6M A;  4IBE A;  1TTE A;  2LWX A;  2YR0 A;  3D8B A;  3CGW A;  3HZJ A;  4DUZ M;  4DV6 M;  4QOS A;  5KQ8 A;  2JNH A;  2MR9 A;  1TH3 A;  2KA6 B;  4X62 M;  2FNA A;  4Y28 F;  3U6S A;  1PM5 A;  3UZU A;  4NRW A;  3EIE A;  1WGN A;  3BOS A;  1QAN A;  1DV0 A;  3JR4 A;  4GHA A;  1FJG M;  3I01 M;  3JR5 A;  4B3T M;  5KPT A;  1MN3 A;  5H37 D;  2DWN A;  1GL7 A;  1Q3C A;  1VEK A;  2XH9 A;  3B9P A;  4IJF A;  3SAR A;  2L2D A;  3GLF A;  5EJC A;  4D81 A;  1L2B A;  2UUB M;  4OVZ A;  3Q8G A;  1D0L A;  2DAM A;  3FTE A;  2CEA A;  1NHG C;  1R7R A;  4NC6 A;  3BXW A;  4MGZ E;  2R65 A;  2K9D A;  2L09 A;  3SMS A;  1V33 A;  3KS8 A;  3IG5 A;  4KOD A;  2KDL A;  2QEN A;  2UUC M;  1TF0 B;  1LTM A;  1Z5B A;  3FUU A;  2D7E A;  2YQZ A;  2YFQ A;  3U6O A;  3T1H M;  4B7F A;  2R4J A;  4Q7J A;  3TPZ A;  4DR6 M;  2UXD M;  3M0E A;  2D7G A;  4LRS A;  3U6P A;  1QAO A;  3TE6 A;  3K9P A;  3KOY E;  3RFW A;  1QVR A;  1Z59 A;  2EKK A;  4LJ6 A;  4B3S M;  3RGS A;  3LQR A;  1R4G A;  1XNR M;  4I4L A;  4B08 A;  3KSX A;  4GHL A;  2FOI C;  2O5R A;  2Y20 A;  1L2C A;  4NXM M;  1IXS A;  3GPX A;  3T15 A;  1TDZ A;  2DAG A;  1E94 E;  1W5T A;  3DA1 A;  4NXN M;  2HCB A;  2LXE A;  2V1C A;  2YNM D;  2QNJ A;  1YE9 A;  4RF1 A;  4I5S A;  3U6D A;  4HLQ A;  1J09 A;  3SHF A;  1IQP A;  3HU3 A;  4MM3 B;  3U60 B;  1N78 A;  3UK6 A;  1WR1 B;  3J27 B;  3GLI E;  4DR4 M;  4LJ8 A;  5BPV A;  3SAU A;  2KEB A;  5EP1 A;  4LGM A;  1PJJ A;  1G8P A;  2MRO B;  2ZAO A;  3GLH B;  4GEW A;  4L16 A;  1IBL M;  4JI7 M;  1Z6T A;  2APL A;  1IBM M;  3LCV B;  4A3V B;  4DV2 M;  4R3D A;  3ZC7 B;  2JZ1 A;  1XXH B;  1TR8 A;  4I8O A;  5DNY A;  2A5Y B;  3AOE C;  2XF3 A;  4PDG A;  4LF6 M;  3E9S A;  3CF0 A;  2LBC A;  4LZJ A;  1UM8 A;  5FTK A;  4WP2 A;  3C9P A;  5C18 A;  2LTU A;  3NWL A;  2O01 F;  5FTM A;  5IT9 S;  2BWB A;  4DV3 M;  4AG6 A;  1J5E M;  3HHX A;  2JY8 A;  4LJA A;  1IM2 A;  1UFZ A;  3B74 A;  2G8L A;  1N33 M;  4AKI A;  1G4A E;  4LF7 M;  2BWE A;  4WW0 A;  1NNJ A;  5L8R F;  4JV5 M;  3PXG A;  3EIH A;  3SMP A;  4JI5 M;  3DFZ A;  3HWS A;  1GJT A;  4DR1 M;  4HEO A;  1IFY A;  1HJP A;  1SXJ C;  4DR7 M;  1HQY E;  3QWL A;  4II7 A;  4FCT A;  4G4N A;  2QP9 X;  1RU3 A;  3VK8 A;  3HKP A;  2LVP C;  3JAM S;  1C7Y A;  5EP2 A;  3KP0 E;  3CF2 A;  3GP1 A;  2LVA A;  4JI4 M;  1N32 M;  1WGL A;  2Z7J A;  2R46 A;  1T43 A;  4GKJ M;  1GAB A;  1DGF A;  1H6U A;  4MB7 A;  4LF4 M;  2EO2 A;  2X8A A;  1HNZ M;  5EXX A;  3D8L A;  1QZE A;  1PJI A;  2WSC F;  3GQ5 A;  2R62 A;  3SAT A;  3AFH A;  5IWA M;  1XNQ M;  2L4E A;  4DR5 M;  4FWD A;  3VLF B;  5ITX A;  2QZ4 A;  1XHB A;  5ITY A;  1QZM A;  2ZM6 M;  4AKH A;  2D7H A;  3U61 A;  1DGH B;  5GKN A;  5JI3 E;  1QDT A;  4OU7 A;  2DXI A;  2QCU A;  2XZF A;  1DO2 A;  2K6B A;  4X66 M;  1AUA A;  1F4I A;  5LMU M;  2Q2E B;  3NBX X;  3GLF E;  1OJL A;  4JN6 A;  3KXE C;  3UGJ A;  4IBG A;  1JB0 F;  3GRR A;  2DHR A;  4AW4 A;  3AOG A;  2Z4R A;  1XC8 A;  3C58 A;  4MH0 E;  2LVN C;  3FUT A;  4YY3 M;  2DEN A;  4PT5 A;  4Z8X A;  2R4E A;  4L15 A;  4NRV A;  2ERC A;  1D0M A;  3I4Y A;  2CWB A;  3L2A A;  3WHL A;  4CHT B;  3C3E A;  2JA2 A;  4JI2 M;  3VKG A;  4BLC A; 
#chains in the Genus database with same CATH homology
 1HT2 E;  3FRH A;  2DHY A;  1DO0 A;  4DBG B;  4Q7J A;  3IEC A;  1NV9 A;  1Q02 A;  3K9P A;  4F1I A;  1KYI A;  2EKK A;  1CUK A;  1V92 A;  2R0I A;  1R4G A;  2QHO B;  2G3Q A;  2DZL A;  2OOB A;  2WZJ A;  2OOA A;  1IXS A;  1OQY A;  2DAG A;  2LVQ D;  1E94 E;  2RRU A;  3E21 A;  2QNJ A;  2HAK A;  4R71 A;  2OO9 A;  1VEG A;  1WR1 B;  3GLI E;  2H5X A;  5JI2 E;  1GO5 A;  1OKS A;  1XB2 B;  1AIP C;  2MRO B;  1PGY A;  4GEW A;  1WHC A;  2JP7 A;  2O25 A;  2K0B X;  2ZTC A;  3LCV B;  2HWJ A;  3BBZ A;  1G41 A;  2L4F A;  2DNA A;  2JZ1 A;  2MGW A;  1TR8 A;  2DAE A;  1ZMV A;  2LBC A;  4WP2 A;  1BVS A;  2LTU A;  1P3Q Q;  3MMP A;  1EFU B;  2JUJ A;  2BWB A;  3GLG E;  1HT1 E;  5DFL A;  2JY8 A;  3B89 A;  2DAK A;  1IM2 A;  2KNV A;  1UFZ A;  3LCU A;  2JY5 A;  1ZV1 A;  1G4A E;  3FE3 A;  2BWE A;  2KHH A;  1OTR A;  2MJ5 B;  2QSF X;  1A5T A;  3GLH E;  1YLA A;  2DKL A;  4G3O A;  1VG5 A;  3T6P A;  1IFY A;  4HEO A;  1NV8 A;  3FRI A;  1HJP A;  2KNZ A;  1VDL A;  2EJS A;  2B3T A;  2DAI A;  1WJ7 A;  1HQY E;  1Y8G A;  2JZ0 A;  1OAI A;  2LVP C;  1C7Y A;  2CP8 A;  3K9O A;  2JY6 B;  1TTE A;  2LVA A;  1ZMU A;  1VQ1 A;  1WGL A;  2JNH A;  1T43 A;  2MR9 A;  3F92 A;  1WGN A;  1DV0 A;  1QZE A;  1VEJ A;  1ZMW A;  1WIV A;  1MN3 A;  2L4E A;  2EKF A;  1VEK A;  2DI0 A;  2L2D A;  3H4J A;  2ZTD A;  2JY7 A;  1DO2 A;  4UN2 B;  2DAM A;  1XXH E;  1F4I A;  1G3I A;  3GLF E;  1JR3 E;  3E46 A;  2K9D A;  2KNA A;  1T6O A;  2LVN C;  4F2L A;  2DEN A;  2LVO C;  3IHP A;  2CWB A;  1SG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...