2DKLA

Solution structure of the uba domain in the human trinucleotide repeat containing 6c protein (htnrc6c)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
GSSGSSGGMKTSGKQDEAWIMSRLIKQLTDMGFPREPAEEALKSNNMNLDQAMSALLEKKVDVDKRGLGVTDHNGMAAKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the UBA Domain in the Human Trinucleotide Repeat Containing 6C Protein (hTNRC6C)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Trinucleotide Repeat Containing 6C Protein
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dklA00
2JZ1A 3FE3A 4F1IA 2DHYA 2CP8A 1IXSA 1OAIA 1OQYA 1KYIA 2ZTDA 1HT2E 2EKKA 2HWJA 2JY7A 2RRUA 1T6OA 1IFYA 1VEJA 1VQ1A 1ZMWA 2DNAA 1TR8A 1NV8A 2H5XA 2DENA 4WP2A 1G3IA 1HQYE 4DBGB 2EJSA 2LVOC 2MGWA 2JY6B 2BWBA 2R0IA 2O25A 3LCUA 2MR9A 3GLHE 2DAEA 1JR3E 2LTUA 4HEOA 1F4IA 1SG9A 2B3TA 2JZ0A 1T43A 2L4EA 3GLGE 3IECA 1WGLA 3K9OA 2OOAA 1R4GA 1VDLA 1A5TA 1DV0A 5JI2E 2MROB 1VG5A 2QNJA 3T6PA 1EFUB 2KNZA 1GO5A 2K0BX 1P3QQ 3BBZA 1G41A 1VEKA 2QHOB 3F92A 2OO9A 1WHCA 3B89A 1E94E 2HAKA 4GEWA 2JY8A 4Q7JA 1Q02A 2JY5A 2WZJA 1HJPA 4G3OA 1MN3A 2ZTCA 2EKFA 3MMPA 2OOBA 1XXHE 3FRHA 1DO2A 2L2DA 1BVSA 2LVNC 2MJ5B 1UFZA 1ZMUA 3IHPA 1TTEA 2KNVA 4F2LA 1C7YA 2JNHA 3GLIE 1VEGA 5DFLA 1OTRA 2L4FA 1WJ7A 2LVPC 3E46A 1Y8GA 2CWBA 1AIPC 1WGNA 1WR1B 3FRIA 2KNAA 4UN2B 1NV9A 2DAGA 4R71A 2K9DA 2DAMA 2DI0A 1ZMVA 1PGYA 1HT1E 1YLAA 2LBCA 2DAIA 2JP7A 1OKSA 2G3QA 2LVQD 1DO0A 1CUKA 2KHHA 2BWEA 2DKLA 1WIVA 2QSFX 1XB2B 2LVAA 3LCVB 3K9PA 3GLFE 1IM2A 1ZV1A 1G4AE 1V92A 2JUJA 1QZEA 3H4JA 3E21A 2DZLA 2DAKA
chains in the Genus database with same CATH superfamily
2VF7A 3FE3A 1DGBA 1QANA 1S3SA 1TF0B 2KZUA 4I81A 3HHWA 5FTLA 4GKJM 3JAMS 1OQYA 1PJQA 2R4JA 2ZAOA 4LJ7A 3AKZA 1HT2E 2EKKA 4QHTA 5FTKA 1T6OA 4IJEA 2XLJA 1IFYA 1VEJA 1XC8A 1TR8A 1G3IA 3A98B 1PJJA 1HQYE 3LQRA 4LG2A 2LWXA 3AOEA 3UMMA 5IWAM 3GO8A 2Z3XA 3SASA 4P17A 2C9OA 4A3VB 2F5SA 2B3TA 1SXJA 2C99A 3DFZA 3DOAA 2OOAA 4ITQA 1R4GA 2FS1A 1J5EM 1A5TA 3I04M 4JI1M 5KQ8A 4DR4M 2E5LM 4MGZE 4LF7M 3KSXA 3FYDA 5ITXA 3T15A 1XNQM 3AJIB 1EFUB 1XHBA 2Z8YM 1GO5A 4JI4M 3TWKA 3BBZA 4JI3M 3GPPA 1L1ZA 1VEKA 3AOEC 1NO1A 2UU9M 2DZOB 2ZBKB 4GH9A 4LRTA 3U6SA 1IY1A 1GLNA 2YR0A 4PD2A 1Q3BA 3WHLA 1NNJA 3OTOM 2JY5A 2VDBB 2XSZA 2CUZA 3UK6A 3W68A 4CHTB 3SAVA 4II7A 4X65M 4IBKA 1T3TA 3C9PA 2UUBM 3M0EA 3VLFB 1IBMM 4LJ8A 1XXHE 1DO2A 2R44A 2V1CA 3FUVA 3U61A 2MJ5B 3HZJA 3KXEC 4EIWA 3KS4A 4B3RM 1HNWM 1D0MA 4FD2A 4OX9M 4NXMM 5EP2A 3EIEA 2J7OA 1VEGA 4LF8M 3BXWA 5DYGA 2XF3A 2V6ZM 4DV4M 2XH9A 2F5NA 2LVPC 2N35A 2CHQA 1HQCA 1Y8GA 5BPVA 3KS8A 1AUAA 2R45A 2F4VM 3FTCA 5EXPA 4QOSA 1AIPC 1WR1B 4IBIA 3TPZA 4L8RC 1N75A 5A2QS 3KOWE 2DAGA 2DWZB 3U61B 3B7NA 2K9DA 2DAMA 4WW0A 4PDIA 2Q2EB 4B08A 3PNVA 2XZUA 3CTWB 4GMQA 1ZMVA 4LF5M 3K1JA 1HT1E 4B3TM 2X8AA 4IBGA 1N78A 1QQWA 2LHCA 3J27B 3GQ3A 3U5ZA 3RFWA 2DAIA 1QUTA 1OKSA 1MX0A 5FTJA 4DV1M 1TGUA 3SARA 3KSJA 1XMOM 1D0KA 2M5ZA 4DR7M 2DKLA 4DV7M 2QSFX 2BJWA 3LCVB 3KOXE 1L2DA 3U60B 3GPYA 2YFQA 3VKGA 3VFDA 3FUWA 1G4AE 1C1KA 3SAWA 2JUJA 2D7EA 4IBEA 4G4OA 3E21A 4NRWA 4AKHA 3FD9A 1Z6TA 2DAKA 4IBCA 2UUCM 3CF6E 2DWNA 4B7FA 2G8LA 4AG6A 2G5GX 4F1IA 1TH3A 3HKPA 2HCBA 4LY6A 3D8LA 3GLIB 3FUXA 2CE7A 2VQFM 3PFIA 1TH4A 2HWJA 2RRUA 5DYIA 2JY7A 3J2PB 4WURA 4G4NA 1ZMWA 2O01F 2DNAA 5ITTA 1R7RA 3T1HM 3HHZA 4CIZA 1ORYB 2DENA 2R4EA 2KA6B 4DBGB 2CEAA 2LVOC 2AHMA 1PJSA 2QENA 5KQDA 3R8FA 5EXXA 3UGJA 5DNYA 4DR6M 1D2NA 2LTUA 4HEOA 1F4IA 1FJGM 1L1TA 2V1UA 4CJ6A 2JZ0A 2OPFA 4Z6YA 1XNRM 3J81S 2HL7A 3GPXA 1WGLA 3K9OA 4MB7A 4JI7M 3HJQA 3HWSA 3AL0C 2JA2A 4AZFA 4FWHA 2CV1A 1VDLA 4JI8M 4CISA 5JI2E 3K2LA 3KDSE 3V76A 3T6PA 1NSFA 2K0BX 3WHKA 3VKHA 2ZANA 2FNAA 3FYCA 5IZ7D 3RGPA 3JR5A 2QHOB 3GLFB 1HNZM 1GJTA 3L25A 3GRVA 1X37A 1V33A 3CF2A 5FLXS 1WHCA 3UJNA 4JI2M 1R5LA 2HAKA 2VQEM 3IG5A 4MM3B 1Q02A 3HHXA 4L6V6 4PT5A 3I01M 2DWMA 4DR2M 4FWDA 1IN7A 2KRKA 2ZTCA 3MMPA 3FTFA 1DGFA 2OOBA 1OFHA 5ITQA 2EA0A 3L27A 1XWIA 3B7ZA 1J7KA 5EP4A 2LHGA 3PXGA 3ZH9B 3SAUA 4GHLA 1Q39A 1Z5CA 1JB0F 3SBJA 2KNVA 2YQZA 2O5RA 4B3SM 2HHHM 1C7YA 1JR3D 4DV5M 5DFLA 2XFTA 1PJTA 3VDUA 1WJ7A 3M6AA 4YY3M 3E46A 3Q8GA 2UXBM 2CWBA 2Z7JA 2JWSA 2Y0TA 1SXJD 5LMUM 1GL7A 2X49A 3GRUA 3R9XB 1ZQ9A 3FTDA 1NHGC 4BLCA 4UN2B 2KW0A 1QYRA 2XFSA 3A45A 3T1YM 1I94M 4JI0M 3H4MA 4NC6A 1IY0A 1W5TA 1GL6A 4FCVA 4OU7A 3AFHA 1GKIA 4LZJA 2Y20A 2LBCA 3U5ZB 3SATA 2UXDM 4IJFA 2X4AA 3U6MA 1DO0A 5H37D 4DV6M 1R2ZA 4JI5M 3J80S 1Z59A 4KO8A 3UZUA 3GQ4A 5EP1A 2BWEA 4X62M 3KW6A 4AG5A 3KVWA 4NSRA 4ZPXA 3K9PA 2FFJA 3I4YA 3QWLA 3RGSA 5ITYA 3TQSA 1ZV1A 4GC5A 4M0WA 1DGHB 1NVMA 1NY6A 4D81A 1QZEA 2DVWB 3TWMA 4LJAA 4DUZM 1IY2A 4HL4A 3W0LB 5L8RF 3GLHA 4KHPM 2JZ1A 1SXJB 3DA1A 3JR4A 5E26A 5KPZA 2DHYA 4HLQA 1NJFA 2CP8A 4KLNA 2QZ4A 4KT0F 3VK8A 1IXSA 1IQPA 1OAIA 3B9PA 1KYIA 1SXJE 2ZTDA 1QDTA 1Z5AA 3HU2A 4JXJA 2BNKA 1QAOA 3U6LA 2UUAM 4K0KM 4M9XA 1VQ1A 1N33M 2KRUA 4LJ6A 3U6EA 1K3XA 3RE8A 4FCTA 1NV8A 2H5XA 5EXSA 4WP2A 4LZZA 1YUBA 3E4RA 3W0FA 2EJSA 2H1RA 2BWBA 2K47A 3C3EA 2O25A 3LCUA 2MR9A 2GNOA 3GLHE 3LQQA 4IIWA 2Z4SA 2M60A 4LJ4A 4AW4A 4LGMA 4RF0A 4B7HA 4LF9M 3ZQJA 3A46A 4S12A 1UM8A 1SG9A 1IN4A 1T43A 4LF6M 5KPRA 3CGWA 3K8ZA 3HJ8A 4FW9A 2APLA 4FCWA 1W5SA 4I5SA 1DV0A 2R6FA 4NOOB 3U6PA 1KSFX 3NBXX 2MROB 3VDPA 7CATA 2C5RA 2QNJA 2WSFF 3AV0A 2Y0QA 1P3QQ 1OIZA 4BBAA 1PJIA 2CFOA 1L8QA 3LW5F 3F92A 2KEBA 2OO9A 1IXSB 1OFIA 3I4VA 2YNMD 3TE6A 3GPUA 8CATA 2DHRA 4GEWA 4DUYM 1EIJA 2JY8A 2WSCF 2R46A 1IBLM 4R7GA 2WZJA 1HJPA 1J09A 3FKEA 4G3OA 1MN3A 2RGOA 1OJLA 3HHYA 4AI6A 4GIPA 2ERCA 2VF8A 3L2AA 2L09A 4XGIA 3SC3A 4AKIA 3NWLA 1R6BX 4MGKE 2VIIA 2L2DA 1N77A 5EXTA 1BVSA 3Q8XA 3U60A 2D7HA 3D8BA 4GKKM 4I8OA 4GC9A 3J7AS 2LH0A 3HU3A 3LMMA 2DZNB 3EIHA 3SHGB 4FVMA 2EUCA 4GHAA 1FNNA 5FTNA 3DZDA 2EO2A 2JNHA 2QCUA 2R18A 3C3DA 4M9ZA 4I4LA 4GRIA 3C58A 3VK7A 5C18A 1VDDA 1LV7A 4OVZB 4TUWA 1QVRA 2CHVA 1QAMA 2QP9X 4M0DA 4MGIE 3FRIA 1WGNA 4B3MM 2Y21A 2QBYB 2XZFA 4JYAM 2RGHA 2KNAA 4QOZC 3GRYA 4Y28F 2J5YA 2NQ8C 1NNUC 2R65A 1L2CA 4R71A 3L29A 1G59A 4AQYM 4JN6A 5EP3A 4PCZA 2DI0A 2XGNA 3TL4X 2L6OA 3QYEA 4MH0E 3SFZA 3GLIA 1L2BA 1GJSA 4CGYB 4IBBA 2F5QA 3FUTA 3GQ5A 3MHVC 3J7BA 1YLAA 1LTMA 4DR1M 1KFVA 4NL4H 1XMQM 2I7NA 2L7IA 2ZAMA 1JQJC 3B74A 4YHHM 1WXQA 4OVZA 2KHHA 2KZSA 2FH0A 3GLHB 2GQFA 1EE8A 1N32M 2MH8A 4LRSA 4RKUF 4LGYA 1XB2B 4P16A 4RF1A 4XK8F 2QBYA 1V92A 1XXHB 3H4JA 2BJVA 2JXNA 2D7GA 2RKOA 1YSYA 3PVSA 1I4WA 1QZMA 4G6ZA 3ZC7B 2I7PA 5C1BA 2XSZD 2F5PA 4DR3M 4X66M 4QNRA 1SXJC 4IBJA 1K82A 3MJ5A 1RU3A 4ANRA 2CHGA 1IN8A 2LNHC 4LCBA 3LVVA 2C9CA 3AOGA 2LXEA 4AKGA 2DXIA 2FOIC 4R3DA 4MGHA 3SYLA 4G4RA 4W5WA 1IN5A 4Z8XA 2R62A 4L78A 5EJCA 4DV3M 3KOYE 1N36M 1JR3A 2MGWA 2JY6B 2R0IA 4QNMA 1PRBA 4LFBM 4LJ5A 2DWLA 3GLGB 4IBDA 2DAEA 4OW0A 1JR3E 1GVNA 2QQ8A 4L16A 2XEPA 3GRRA 3FTEA 2L4EA 3FUUA 3GLGE 1TDHA 4DR5M 3IECA 1NJGA 3HY5A 2OQ4A 4B7GA 3PNYA 4DV0M 3U6QA 1V34A 1NY5A 1XXHA 4KODA 1TH2A 3CF0A 2FE8A 3NBIA 3U6OA 1VG5A 3T38A 1H6UA 2KNZA 3U6DA 1IXRC 3ILKA 3QYBA 1G41A 5IREB 2WSEF 4IBFA 2F5OA 4JV5M 1MJGM 3A42A 2CV0A 1OAOC 3B89A 1E94E 3W67A 4FWGA 3QAUA 2A5YB 4XBOA 1HNXM 3GLGA 4Q7JA 4REZA 1QUSA 1QDRA 1PM5A 2EKFA 5BR8M 3B7QA 4L15A 4NRVA 3GP1A 4DV2M 1E9SA 3FRHA 3M7GA 5KPTA 1K3WA 2LVNC 5ITXE 3E9SA 1UFZA 4BB9A 4LJ9A 1ZMUA 4M9SA 1DGHA 1TTEA 3IHPA 1IXZA 1G8PA 2CRUA 3IG8A 2J7NA 3KOZE 5FTMA 4F2LA 5LMNM 3L26A 3GLIE 4L4UA 1OTRA 3L28A 5ITUA 4JI6M 1DGGA 1E9RA 3MK6A 2L4FA 3BOSA 3TWLA 1IN6A 1IBKM 4X64M 1YE9A 1E32A 3THGA 3HGIA 1R2YA 2KXEA 3K92A 1TDZA 4PDGA 1GABA 2QPAA 3U6CA 4LF4M 2P5TA 4QHSA 1NV9A 5GKNA 4LFAM 1MU5A 2L7HA 2C98A 3SYKA 4D82A 5IT9S 2K6BA 3I51A 1NHWC 4G4QA 3KFUG 5FSWA 2Z4RA 1PGYA 4GITA 4MGYE 2CV2A 2UXCM 3SMSA 1N34M 4RNAA 1D0LA 3SMPA 2JP7A 3LVWA 2G3QA 2LVQD 5ITRA 3HJSA 1CUKA 3KP0E 2ZM6M 3HX3A 1G71A 3SHFA 1Z5BA 3GLFA 4LFCM 4NSOB 5JI3E 4D80A 1WIVA 2LVAA 5EQTA 3KP1E 4NXNM 2C96A 1ZAEA 1OIPA 1IM2A 2KDLA 3GLFE 5KO3A 2W82A 3ZCBB 1Q3CA 2HKJA 3HU1A 1HR0M 5F3WA 5E6JA 2DZLA 1QAQA
chains in the Genus database with same CATH topology
2JZ1A 3FE3A 4F1IA 2DHYA 2CP8A 1IXSA 1OAIA 1OQYA 1KYIA 2ZTDA 1HT2E 2EKKA 2HWJA 2JY7A 2RRUA 1T6OA 1IFYA 1VEJA 1VQ1A 1ZMWA 2DNAA 1TR8A 1NV8A 2H5XA 2DENA 4WP2A 1G3IA 1HQYE 4DBGB 2EJSA 2LVOC 2MGWA 2JY6B 2BWBA 2R0IA 2O25A 3LCUA 2MR9A 3GLHE 2DAEA 1JR3E 2LTUA 4HEOA 1F4IA 1SG9A 2B3TA 2JZ0A 1T43A 2L4EA 3GLGE 3IECA 1WGLA 3K9OA 2OOAA 1R4GA 1VDLA 1A5TA 1DV0A 5JI2E 2MROB 1VG5A 2QNJA 3T6PA 1EFUB 2KNZA 1GO5A 2K0BX 1P3QQ 3BBZA 1G41A 1VEKA 2QHOB 3F92A 2OO9A 1WHCA 3B89A 1E94E 2HAKA 4GEWA 2JY8A 4Q7JA 1Q02A 2JY5A 2WZJA 1HJPA 4G3OA 1MN3A 2ZTCA 2EKFA 3MMPA 2OOBA 1XXHE 3FRHA 1DO2A 2L2DA 1BVSA 2LVNC 2MJ5B 1UFZA 1ZMUA 3IHPA 1TTEA 2KNVA 4F2LA 1C7YA 2JNHA 3GLIE 1VEGA 5DFLA 1OTRA 2L4FA 1WJ7A 2LVPC 3E46A 1Y8GA 2CWBA 1AIPC 1WGNA 1WR1B 3FRIA 2KNAA 4UN2B 1NV9A 2DAGA 4R71A 2K9DA 2DAMA 2DI0A 1ZMVA 1PGYA 1HT1E 1YLAA 2LBCA 2DAIA 2JP7A 1OKSA 2G3QA 2LVQD 1DO0A 1CUKA 2KHHA 2BWEA 2DKLA 1WIVA 2QSFX 1XB2B 2LVAA 3LCVB 3K9PA 3GLFE 1IM2A 1ZV1A 1G4AE 1V92A 2JUJA 1QZEA 3H4JA 3E21A 2DZLA 2DAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZ1 A;  3FE3 A;  4F1I A;  2DHY A;  2CP8 A;  1IXS A;  1OAI A;  1OQY A;  1KYI A;  2ZTD A;  1HT2 E;  2EKK A;  2HWJ A;  2JY7 A;  2RRU A;  1T6O A;  1IFY A;  1VEJ A;  1VQ1 A;  1ZMW A;  2DNA A;  1TR8 A;  1NV8 A;  2H5X A;  2DEN A;  4WP2 A;  1G3I A;  1HQY E;  4DBG B;  2EJS A;  2LVO C;  2MGW A;  2JY6 B;  2BWB A;  2R0I A;  2O25 A;  3LCU A;  2MR9 A;  3GLH E;  2DAE A;  1JR3 E;  2LTU A;  4HEO A;  1F4I A;  1SG9 A;  2B3T A;  2JZ0 A;  1T43 A;  2L4E A;  3GLG E;  3IEC A;  1WGL A;  3K9O A;  2OOA A;  1R4G A;  1VDL A;  1A5T A;  1DV0 A;  5JI2 E;  2MRO B;  1VG5 A;  2QNJ A;  3T6P A;  1EFU B;  2KNZ A;  1GO5 A;  2K0B X;  1P3Q Q;  3BBZ A;  1G41 A;  1VEK A;  2QHO B;  3F92 A;  2OO9 A;  1WHC A;  3B89 A;  1E94 E;  2HAK A;  4GEW A;  2JY8 A;  4Q7J A;  1Q02 A;  2JY5 A;  2WZJ A;  1HJP A;  4G3O A;  1MN3 A;  2ZTC A;  2EKF A;  3MMP A;  2OOB A;  1XXH E;  3FRH A;  1DO2 A;  2L2D A;  1BVS A;  2LVN C;  2MJ5 B;  1UFZ A;  1ZMU A;  3IHP A;  1TTE A;  2KNV A;  4F2L A;  1C7Y A;  2JNH A;  3GLI E;  1VEG A;  5DFL A;  1OTR A;  2L4F A;  1WJ7 A;  2LVP C;  3E46 A;  1Y8G A;  2CWB A;  1AIP C;  1WGN A;  1WR1 B;  3FRI A;  2KNA A;  4UN2 B;  1NV9 A;  2DAG A;  4R71 A;  2K9D A;  2DAM A;  2DI0 A;  1ZMV A;  1PGY A;  1HT1 E;  1YLA A;  2LBC A;  2DAI A;  2JP7 A;  1OKS A;  2G3Q A;  2LVQ D;  1DO0 A;  1CUK A;  2KHH A;  2BWE A;  2DKL A;  1WIV A;  2QSF X;  1XB2 B;  2LVA A;  3LCV B;  3K9P A;  3GLF E;  1IM2 A;  1ZV1 A;  1G4A E;  1V92 A;  2JUJ A;  1QZE A;  3H4J A;  3E21 A;  2DZL A;  2DAK A; 
#chains in the Genus database with same CATH topology
 2VF7 A;  3FE3 A;  1DGB A;  1QAN A;  1S3S A;  1TF0 B;  2KZU A;  4I81 A;  3HHW A;  5FTL A;  4GKJ M;  3JAM S;  1OQY A;  1PJQ A;  2R4J A;  2ZAO A;  4LJ7 A;  3AKZ A;  1HT2 E;  2EKK A;  4QHT A;  5FTK A;  1T6O A;  4IJE A;  2XLJ A;  1IFY A;  1VEJ A;  1XC8 A;  1TR8 A;  1G3I A;  3A98 B;  1PJJ A;  1HQY E;  3LQR A;  4LG2 A;  2LWX A;  3AOE A;  3UMM A;  5IWA M;  3GO8 A;  2Z3X A;  3SAS A;  4P17 A;  2C9O A;  4A3V B;  2F5S A;  2B3T A;  1SXJ A;  2C99 A;  3DFZ A;  3DOA A;  2OOA A;  4ITQ A;  1R4G A;  2FS1 A;  1J5E M;  1A5T A;  3I04 M;  4JI1 M;  5KQ8 A;  4DR4 M;  2E5L M;  4MGZ E;  4LF7 M;  3KSX A;  3FYD A;  5ITX A;  3T15 A;  1XNQ M;  3AJI B;  1EFU B;  1XHB A;  2Z8Y M;  1GO5 A;  4JI4 M;  3TWK A;  3BBZ A;  4JI3 M;  3GPP A;  1L1Z A;  1VEK A;  3AOE C;  1NO1 A;  2UU9 M;  2DZO B;  2ZBK B;  4GH9 A;  4LRT A;  3U6S A;  1IY1 A;  1GLN A;  2YR0 A;  4PD2 A;  1Q3B A;  3WHL A;  1NNJ A;  3OTO M;  2JY5 A;  2VDB B;  2XSZ A;  2CUZ A;  3UK6 A;  3W68 A;  4CHT B;  3SAV A;  4II7 A;  4X65 M;  4IBK A;  1T3T A;  3C9P A;  2UUB M;  3M0E A;  3VLF B;  1IBM M;  4LJ8 A;  1XXH E;  1DO2 A;  2R44 A;  2V1C A;  3FUV A;  3U61 A;  2MJ5 B;  3HZJ A;  3KXE C;  4EIW A;  3KS4 A;  4B3R M;  1HNW M;  1D0M A;  4FD2 A;  4OX9 M;  4NXM M;  5EP2 A;  3EIE A;  2J7O A;  1VEG A;  4LF8 M;  3BXW A;  5DYG A;  2XF3 A;  2V6Z M;  4DV4 M;  2XH9 A;  2F5N A;  2LVP C;  2N35 A;  2CHQ A;  1HQC A;  1Y8G A;  5BPV A;  3KS8 A;  1AUA A;  2R45 A;  2F4V M;  3FTC A;  5EXP A;  4QOS A;  1AIP C;  1WR1 B;  4IBI A;  3TPZ A;  4L8R C;  1N75 A;  5A2Q S;  3KOW E;  2DAG A;  2DWZ B;  3U61 B;  3B7N A;  2K9D A;  2DAM A;  4WW0 A;  4PDI A;  2Q2E B;  4B08 A;  3PNV A;  2XZU A;  3CTW B;  4GMQ A;  1ZMV A;  4LF5 M;  3K1J A;  1HT1 E;  4B3T M;  2X8A A;  4IBG A;  1N78 A;  1QQW A;  2LHC A;  3J27 B;  3GQ3 A;  3U5Z A;  3RFW A;  2DAI A;  1QUT A;  1OKS A;  1MX0 A;  5FTJ A;  4DV1 M;  1TGU A;  3SAR A;  3KSJ A;  1XMO M;  1D0K A;  2M5Z A;  4DR7 M;  2DKL A;  4DV7 M;  2QSF X;  2BJW A;  3LCV B;  3KOX E;  1L2D A;  3U60 B;  3GPY A;  2YFQ A;  3VKG A;  3VFD A;  3FUW A;  1G4A E;  1C1K A;  3SAW A;  2JUJ A;  2D7E A;  4IBE A;  4G4O A;  3E21 A;  4NRW A;  4AKH A;  3FD9 A;  1Z6T A;  2DAK A;  4IBC A;  2UUC M;  3CF6 E;  2DWN A;  4B7F A;  2G8L A;  4AG6 A;  2G5G X;  4F1I A;  1TH3 A;  3HKP A;  2HCB A;  4LY6 A;  3D8L A;  3GLI B;  3FUX A;  2CE7 A;  2VQF M;  3PFI A;  1TH4 A;  2HWJ A;  2RRU A;  5DYI A;  2JY7 A;  3J2P B;  4WUR A;  4G4N A;  1ZMW A;  2O01 F;  2DNA A;  5ITT A;  1R7R A;  3T1H M;  3HHZ A;  4CIZ A;  1ORY B;  2DEN A;  2R4E A;  2KA6 B;  4DBG B;  2CEA A;  2LVO C;  2AHM A;  1PJS A;  2QEN A;  5KQD A;  3R8F A;  5EXX A;  3UGJ A;  5DNY A;  4DR6 M;  1D2N A;  2LTU A;  4HEO A;  1F4I A;  1FJG M;  1L1T A;  2V1U A;  4CJ6 A;  2JZ0 A;  2OPF A;  4Z6Y A;  1XNR M;  3J81 S;  2HL7 A;  3GPX A;  1WGL A;  3K9O A;  4MB7 A;  4JI7 M;  3HJQ A;  3HWS A;  3AL0 C;  2JA2 A;  4AZF A;  4FWH A;  2CV1 A;  1VDL A;  4JI8 M;  4CIS A;  5JI2 E;  3K2L A;  3KDS E;  3V76 A;  3T6P A;  1NSF A;  2K0B X;  3WHK A;  3VKH A;  2ZAN A;  2FNA A;  3FYC A;  5IZ7 D;  3RGP A;  3JR5 A;  2QHO B;  3GLF B;  1HNZ M;  1GJT A;  3L25 A;  3GRV A;  1X37 A;  1V33 A;  3CF2 A;  5FLX S;  1WHC A;  3UJN A;  4JI2 M;  1R5L A;  2HAK A;  2VQE M;  3IG5 A;  4MM3 B;  1Q02 A;  3HHX A;  4L6V 6;  4PT5 A;  3I01 M;  2DWM A;  4DR2 M;  4FWD A;  1IN7 A;  2KRK A;  2ZTC A;  3MMP A;  3FTF A;  1DGF A;  2OOB A;  1OFH A;  5ITQ A;  2EA0 A;  3L27 A;  1XWI A;  3B7Z A;  1J7K A;  5EP4 A;  2LHG A;  3PXG A;  3ZH9 B;  3SAU A;  4GHL A;  1Q39 A;  1Z5C A;  1JB0 F;  3SBJ A;  2KNV A;  2YQZ A;  2O5R A;  4B3S M;  2HHH M;  1C7Y A;  1JR3 D;  4DV5 M;  5DFL A;  2XFT A;  1PJT A;  3VDU A;  1WJ7 A;  3M6A A;  4YY3 M;  3E46 A;  3Q8G A;  2UXB M;  2CWB A;  2Z7J A;  2JWS A;  2Y0T A;  1SXJ D;  5LMU M;  1GL7 A;  2X49 A;  3GRU A;  3R9X B;  1ZQ9 A;  3FTD A;  1NHG C;  4BLC A;  4UN2 B;  2KW0 A;  1QYR A;  2XFS A;  3A45 A;  3T1Y M;  1I94 M;  4JI0 M;  3H4M A;  4NC6 A;  1IY0 A;  1W5T A;  1GL6 A;  4FCV A;  4OU7 A;  3AFH A;  1GKI A;  4LZJ A;  2Y20 A;  2LBC A;  3U5Z B;  3SAT A;  2UXD M;  4IJF A;  2X4A A;  3U6M A;  1DO0 A;  5H37 D;  4DV6 M;  1R2Z A;  4JI5 M;  3J80 S;  1Z59 A;  4KO8 A;  3UZU A;  3GQ4 A;  5EP1 A;  2BWE A;  4X62 M;  3KW6 A;  4AG5 A;  3KVW A;  4NSR A;  4ZPX A;  3K9P A;  2FFJ A;  3I4Y A;  3QWL A;  3RGS A;  5ITY A;  3TQS A;  1ZV1 A;  4GC5 A;  4M0W A;  1DGH B;  1NVM A;  1NY6 A;  4D81 A;  1QZE A;  2DVW B;  3TWM A;  4LJA A;  4DUZ M;  1IY2 A;  4HL4 A;  3W0L B;  5L8R F;  3GLH A;  4KHP M;  2JZ1 A;  1SXJ B;  3DA1 A;  3JR4 A;  5E26 A;  5KPZ A;  2DHY A;  4HLQ A;  1NJF A;  2CP8 A;  4KLN A;  2QZ4 A;  4KT0 F;  3VK8 A;  1IXS A;  1IQP A;  1OAI A;  3B9P A;  1KYI A;  1SXJ E;  2ZTD A;  1QDT A;  1Z5A A;  3HU2 A;  4JXJ A;  2BNK A;  1QAO A;  3U6L A;  2UUA M;  4K0K M;  4M9X A;  1VQ1 A;  1N33 M;  2KRU A;  4LJ6 A;  3U6E A;  1K3X A;  3RE8 A;  4FCT A;  1NV8 A;  2H5X A;  5EXS A;  4WP2 A;  4LZZ A;  1YUB A;  3E4R A;  3W0F A;  2EJS A;  2H1R A;  2BWB A;  2K47 A;  3C3E A;  2O25 A;  3LCU A;  2MR9 A;  2GNO A;  3GLH E;  3LQQ A;  4IIW A;  2Z4S A;  2M60 A;  4LJ4 A;  4AW4 A;  4LGM A;  4RF0 A;  4B7H A;  4LF9 M;  3ZQJ A;  3A46 A;  4S12 A;  1UM8 A;  1SG9 A;  1IN4 A;  1T43 A;  4LF6 M;  5KPR A;  3CGW A;  3K8Z A;  3HJ8 A;  4FW9 A;  2APL A;  4FCW A;  1W5S A;  4I5S A;  1DV0 A;  2R6F A;  4NOO B;  3U6P A;  1KSF X;  3NBX X;  2MRO B;  3VDP A;  7CAT A;  2C5R A;  2QNJ A;  2WSF F;  3AV0 A;  2Y0Q A;  1P3Q Q;  1OIZ A;  4BBA A;  1PJI A;  2CFO A;  1L8Q A;  3LW5 F;  3F92 A;  2KEB A;  2OO9 A;  1IXS B;  1OFI A;  3I4V A;  2YNM D;  3TE6 A;  3GPU A;  8CAT A;  2DHR A;  4GEW A;  4DUY M;  1EIJ A;  2JY8 A;  2WSC F;  2R46 A;  1IBL M;  4R7G A;  2WZJ A;  1HJP A;  1J09 A;  3FKE A;  4G3O A;  1MN3 A;  2RGO A;  1OJL A;  3HHY A;  4AI6 A;  4GIP A;  2ERC A;  2VF8 A;  3L2A A;  2L09 A;  4XGI A;  3SC3 A;  4AKI A;  3NWL A;  1R6B X;  4MGK E;  2VII A;  2L2D A;  1N77 A;  5EXT A;  1BVS A;  3Q8X A;  3U60 A;  2D7H A;  3D8B A;  4GKK M;  4I8O A;  4GC9 A;  3J7A S;  2LH0 A;  3HU3 A;  3LMM A;  2DZN B;  3EIH A;  3SHG B;  4FVM A;  2EUC A;  4GHA A;  1FNN A;  5FTN A;  3DZD A;  2EO2 A;  2JNH A;  2QCU A;  2R18 A;  3C3D A;  4M9Z A;  4I4L A;  4GRI A;  3C58 A;  3VK7 A;  5C18 A;  1VDD A;  1LV7 A;  4OVZ B;  4TUW A;  1QVR A;  2CHV A;  1QAM A;  2QP9 X;  4M0D A;  4MGI E;  3FRI A;  1WGN A;  4B3M M;  2Y21 A;  2QBY B;  2XZF A;  4JYA M;  2RGH A;  2KNA A;  4QOZ C;  3GRY A;  4Y28 F;  2J5Y A;  2NQ8 C;  1NNU C;  2R65 A;  1L2C A;  4R71 A;  3L29 A;  1G59 A;  4AQY M;  4JN6 A;  5EP3 A;  4PCZ A;  2DI0 A;  2XGN A;  3TL4 X;  2L6O A;  3QYE A;  4MH0 E;  3SFZ A;  3GLI A;  1L2B A;  1GJS A;  4CGY B;  4IBB A;  2F5Q A;  3FUT A;  3GQ5 A;  3MHV C;  3J7B A;  1YLA A;  1LTM A;  4DR1 M;  1KFV A;  4NL4 H;  1XMQ M;  2I7N A;  2L7I A;  2ZAM A;  1JQJ C;  3B74 A;  4YHH M;  1WXQ A;  4OVZ A;  2KHH A;  2KZS A;  2FH0 A;  3GLH B;  2GQF A;  1EE8 A;  1N32 M;  2MH8 A;  4LRS A;  4RKU F;  4LGY A;  1XB2 B;  4P16 A;  4RF1 A;  4XK8 F;  2QBY A;  1V92 A;  1XXH B;  3H4J A;  2BJV A;  2JXN A;  2D7G A;  2RKO A;  1YSY A;  3PVS A;  1I4W A;  1QZM A;  4G6Z A;  3ZC7 B;  2I7P A;  5C1B A;  2XSZ D;  2F5P A;  4DR3 M;  4X66 M;  4QNR A;  1SXJ C;  4IBJ A;  1K82 A;  3MJ5 A;  1RU3 A;  4ANR A;  2CHG A;  1IN8 A;  2LNH C;  4LCB A;  3LVV A;  2C9C A;  3AOG A;  2LXE A;  4AKG A;  2DXI A;  2FOI C;  4R3D A;  4MGH A;  3SYL A;  4G4R A;  4W5W A;  1IN5 A;  4Z8X A;  2R62 A;  4L78 A;  5EJC A;  4DV3 M;  3KOY E;  1N36 M;  1JR3 A;  2MGW A;  2JY6 B;  2R0I A;  4QNM A;  1PRB A;  4LFB M;  4LJ5 A;  2DWL A;  3GLG B;  4IBD A;  2DAE A;  4OW0 A;  1JR3 E;  1GVN A;  2QQ8 A;  4L16 A;  2XEP A;  3GRR A;  3FTE A;  2L4E A;  3FUU A;  3GLG E;  1TDH A;  4DR5 M;  3IEC A;  1NJG A;  3HY5 A;  2OQ4 A;  4B7G A;  3PNY A;  4DV0 M;  3U6Q A;  1V34 A;  1NY5 A;  1XXH A;  4KOD A;  1TH2 A;  3CF0 A;  2FE8 A;  3NBI A;  3U6O A;  1VG5 A;  3T38 A;  1H6U A;  2KNZ A;  3U6D A;  1IXR C;  3ILK A;  3QYB A;  1G41 A;  5IRE B;  2WSE F;  4IBF A;  2F5O A;  4JV5 M;  1MJG M;  3A42 A;  2CV0 A;  1OAO C;  3B89 A;  1E94 E;  3W67 A;  4FWG A;  3QAU A;  2A5Y B;  4XBO A;  1HNX M;  3GLG A;  4Q7J A;  4REZ A;  1QUS A;  1QDR A;  1PM5 A;  2EKF A;  5BR8 M;  3B7Q A;  4L15 A;  4NRV A;  3GP1 A;  4DV2 M;  1E9S A;  3FRH A;  3M7G A;  5KPT A;  1K3W A;  2LVN C;  5ITX E;  3E9S A;  1UFZ A;  4BB9 A;  4LJ9 A;  1ZMU A;  4M9S A;  1DGH A;  1TTE A;  3IHP A;  1IXZ A;  1G8P A;  2CRU A;  3IG8 A;  2J7N A;  3KOZ E;  5FTM A;  4F2L A;  5LMN M;  3L26 A;  3GLI E;  4L4U A;  1OTR A;  3L28 A;  5ITU A;  4JI6 M;  1DGG A;  1E9R A;  3MK6 A;  2L4F A;  3BOS A;  3TWL A;  1IN6 A;  1IBK M;  4X64 M;  1YE9 A;  1E32 A;  3THG A;  3HGI A;  1R2Y A;  2KXE A;  3K92 A;  1TDZ A;  4PDG A;  1GAB A;  2QPA A;  3U6C A;  4LF4 M;  2P5T A;  4QHS A;  1NV9 A;  5GKN A;  4LFA M;  1MU5 A;  2L7H A;  2C98 A;  3SYK A;  4D82 A;  5IT9 S;  2K6B A;  3I51 A;  1NHW C;  4G4Q A;  3KFU G;  5FSW A;  2Z4R A;  1PGY A;  4GIT A;  4MGY E;  2CV2 A;  2UXC M;  3SMS A;  1N34 M;  4RNA A;  1D0L A;  3SMP A;  2JP7 A;  3LVW A;  2G3Q A;  2LVQ D;  5ITR A;  3HJS A;  1CUK A;  3KP0 E;  2ZM6 M;  3HX3 A;  1G71 A;  3SHF A;  1Z5B A;  3GLF A;  4LFC M;  4NSO B;  5JI3 E;  4D80 A;  1WIV A;  2LVA A;  5EQT A;  3KP1 E;  4NXN M;  2C96 A;  1ZAE A;  1OIP A;  1IM2 A;  2KDL A;  3GLF E;  5KO3 A;  2W82 A;  3ZCB B;  1Q3C A;  2HKJ A;  3HU1 A;  1HR0 M;  5F3W A;  5E6J A;  2DZL A;  1QAQ A; 
#chains in the Genus database with same CATH homology
 2JZ1 A;  3FE3 A;  4F1I A;  2DHY A;  2CP8 A;  1IXS A;  1OAI A;  1OQY A;  1KYI A;  2ZTD A;  1HT2 E;  2EKK A;  2HWJ A;  2JY7 A;  2RRU A;  1T6O A;  1IFY A;  1VEJ A;  1VQ1 A;  1ZMW A;  2DNA A;  1TR8 A;  1NV8 A;  2H5X A;  2DEN A;  4WP2 A;  1G3I A;  1HQY E;  4DBG B;  2EJS A;  2LVO C;  2MGW A;  2JY6 B;  2BWB A;  2R0I A;  2O25 A;  3LCU A;  2MR9 A;  3GLH E;  2DAE A;  1JR3 E;  2LTU A;  4HEO A;  1F4I A;  1SG9 A;  2B3T A;  2JZ0 A;  1T43 A;  2L4E A;  3GLG E;  3IEC A;  1WGL A;  3K9O A;  2OOA A;  1R4G A;  1VDL A;  1A5T A;  1DV0 A;  5JI2 E;  2MRO B;  1VG5 A;  2QNJ A;  3T6P A;  1EFU B;  2KNZ A;  1GO5 A;  2K0B X;  1P3Q Q;  3BBZ A;  1G41 A;  1VEK A;  2QHO B;  3F92 A;  2OO9 A;  1WHC A;  3B89 A;  1E94 E;  2HAK A;  4GEW A;  2JY8 A;  4Q7J A;  1Q02 A;  2JY5 A;  2WZJ A;  1HJP A;  4G3O A;  1MN3 A;  2ZTC A;  2EKF A;  3MMP A;  2OOB A;  1XXH E;  3FRH A;  1DO2 A;  2L2D A;  1BVS A;  2LVN C;  2MJ5 B;  1UFZ A;  1ZMU A;  3IHP A;  1TTE A;  2KNV A;  4F2L A;  1C7Y A;  2JNH A;  3GLI E;  1VEG A;  5DFL A;  1OTR A;  2L4F A;  1WJ7 A;  2LVP C;  3E46 A;  1Y8G A;  2CWB A;  1AIP C;  1WGN A;  1WR1 B;  3FRI A;  2KNA A;  4UN2 B;  1NV9 A;  2DAG A;  4R71 A;  2K9D A;  2DAM A;  2DI0 A;  1ZMV A;  1PGY A;  1HT1 E;  1YLA A;  2LBC A;  2DAI A;  2JP7 A;  1OKS A;  2G3Q A;  2LVQ D;  1DO0 A;  1CUK A;  2KHH A;  2BWE A;  2DKL A;  1WIV A;  2QSF X;  1XB2 B;  2LVA A;  3LCV B;  3K9P A;  3GLF E;  1IM2 A;  1ZV1 A;  1G4A E;  1V92 A;  2JUJ A;  1QZE A;  3H4J A;  3E21 A;  2DZL A;  2DAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...