2DKLA

Solution structure of the uba domain in the human trinucleotide repeat containing 6c protein (htnrc6c)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
GSSGSSGGMKTSGKQDEAWIMSRLIKQLTDMGFPREPAEEALKSNNMNLDQAMSALLEKKVDVDKRGLGVTDHNGMAAKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the UBA Domain in the Human Trinucleotide Repeat Containing 6C Protein (hTNRC6C)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Trinucleotide Repeat Containing 6C Protein
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dklA00
2KNZA 3LCUA 2JP7A 1TR8A 2KNAA 2K9DA 2RRUA 3B89A 2BWEA 2DAIA 5DFLA 1JR3E 2CP8A 2ZTDA 5JI2E 2JY5A 1G3IA 2DENA 3LCVB 2OOAA 1C7YA 1HT2E 3FRHA 2MGWA 1ZMUA 4DBGB 1VEKA 3GLFE 2DAGA 1NV8A 1IFYA 2JZ1A 2O25A 3IHPA 2OO9A 3IECA 1YLAA 1ZV1A 1DO0A 2KNVA 3FE3A 2LBCA 3F92A 1WR1B 2JY8A 2K0BX 2L4EA 2DHYA 1OAIA 2KHHA 2MROB 2BWBA 2DZLA 1XB2B 3K9PA 2CWBA 2HAKA 2DAMA 2EKKA 4G3OA 1WHCA 1XXHE 3H4JA 2EKFA 2R0IA 4WP2A 4F2LA 3T6PA 2L2DA 2LVAA 3E21A 1SG9A 1IM2A 2LVNC 2LVOC 2JUJA 1QZEA 3BBZA 3GLGE 1ZMWA 1CUKA 1T43A 1VDLA 4R71A 1MN3A 2LVPC 1VG5A 2MJ5B 2JY6B 1VEGA 2LTUA 2WZJA 1PGYA 1F4IA 1ZMVA 1AIPC 2QSFX 1WIVA 3GLIE 1WGLA 1DV0A 2G3QA 2JNHA 4Q7JA 2JZ0A 2JY7A 1GO5A 2DNAA 1Q02A 3FRIA 2ZTCA 1OQYA 1TTEA 1OTRA 2DKLA 4UN2B 2HWJA 4HEOA 1VEJA 4GEWA 2DAEA 1V92A 1A5TA 3GLHE 1WGNA 3MMPA 4F1IA 2LVQD 1P3QQ 2DAKA 1BVSA 2L4FA 1T6OA 1DO2A 1HT1E 1R4GA 1NV9A 2QHOB 1HJPA 2DI0A 1IXSA 2EJSA 3E46A 1E94E 1Y8GA 1VQ1A 1OKSA 2QNJA 2MR9A 1G41A 3K9OA 1WJ7A 2OOBA 1EFUB 1G4AE 1HQYE 1UFZA 2H5XA 2B3TA 1KYIA
chains in the Genus database with same CATH superfamily
1GJTA 3W67A 3TPZA 1NNJA 3PFIA 4PDIA 3U5ZB 2JP7A 1TR8A 1UM8A 4LZZA 5EXXA 1E9SA 2KNAA 5ITXA 2BWEA 1XWIA 3HHZA 3GPUA 4OVZA 2KXEA 3LCVB 3GLGA 2OOAA 1HT2E 3A45A 2DWLA 1NNUC 3LW5F 4KHPM 3Q8GA 3SMSA 4P17A 4MGKE 4RKUF 2D7GA 4DBGB 2HKJA 1EE8A 4RNAA 3GLFE 1OFHA 1QAQA 3I4VA 1IFYA 3GRVA 3UK6A 2UXDM 2O25A 3GLIB 4L4UA 4AZFA 5IZ7D 3SC3A 3M7GA 1JQJC 1TH2A 3AOEA 3IG8A 1YLAA 2KW0A 3C58A 3I51A 4MH0E 3FYCA 2KZSA 3AL0C 4NC6A 1ZV1A 4RF1A 3NBXX 7CATA 2LBCA 4FWHA 3LVVA 1DGHA 1SXJA 2KHHA 2BWBA 3K9PA 1XB2B 4DV4M 3TL4X 2HAKA 4NSRA 2BJVA 5KPZA 1D2NA 3GLFB 3DZDA 2EKKA 3MJ5A 5H37D 5LMUM 5EP3A 1K82A 4JI6M 4GMQA 4JV5M 2JA2A 1XXHE 2CHQA 2WSCF 4QHTA 4WP2A 4DV2M 1QAMA 1QDRA 3U6SA 1XMQM 1FNNA 4FWGA 3GP1A 1R2YA 4FCVA 3HKPA 3U6PA 1XMOM 4NOOB 3V76A 2QP9X 1J09A 1T3TA 4FD2A 1AUAA 1VDDA 4IBGA 1NJFA 2KEBA 3TQSA 2LVOC 1QZEA 2LHGA 4G4OA 2GQFA 3RGPA 4GKJM 1HNWM 1VDLA 2DWMA 1YUBA 2Z8YM 1PJTA 1TH3A 3BOSA 4R71A 2V1UA 1TGUA 2CRUA 4LFBM 1XC8A 5KQDA 3LVWA 2YR0A 3MK6A 1W5TA 4PT5A 4M0WA 1VG5A 2XZFA 1L2DA 4L6V6 3UGJA 2Z7JA 2JY6B 2DHRA 4IBCA 4L16A 1ZMVA 1LTMA 2WSFF 3HHXA 1Z59A 5ITXE 3SYLA 2OQ4A 4JI1M 4I5SA 5KO3A 3SMPA 3HU3A 2G3QA 3VKGA 2JZ0A 1GABA 3SYKA 3QYBA 5ITRA 3U61A 3LQRA 3HJSA 5JI3E 2KRUA 4CGYB 4LFAM 1IXZA 1IN5A 4D81A 3J81S 4UN2B 3OTOM 3GLHB 3E4RA 1VEJA 2Y0TA 4GEWA 5BR8M 2DAEA 2HL7A 1V92A 3MHVC 1HQCA 1JB0F 2N35A 3GLHE 3HHYA 4IIWA 4LY6A 3T38A 3HHWA 5IT9S 4JI0M 3VFDA 2XGNA 1P3QQ 3L26A 5ITUA 3LMMA 4GITA 1QQWA 2C99A 3U6MA 1DO2A 1GVNA 2UXCM 1PJIA 4JI3M 2QHOB 1FJGM 4AG5A 2XLJA 1JR3D 2DI0A 3A46A 4AQYM 1VQ1A 3AJIB 1G41A 2DXIA 3W68A 1NJGA 3D8BA 4AKHA 4DR5M 1HQYE 1UFZA 1C1KA 4R7GA 5IWAM 2QBYB 4DV6M 1N75A 4FWDA 3GRYA 3U6EA 1IQPA 1KYIA 4KODA 3R8FA 1SXJC 4ITQA 3K8ZA 2WSEF 1YE9A 2KNZA 5L8RF 2YQZA 3GLGB 3FTDA 4MGZE 1IBMM 2L6OA 3FTFA 2K9DA 2XSZA 4PD2A 4G4RA 1NHGC 1XXHA 2XFSA 4FCWA 2F4VM 2YNMD 3QAUA 3I04M 3U60A 2ZTDA 2LXEA 3KW6A 4KT0F 3UZUA 4K0KM 2JY5A 5FSWA 1G3IA 1C7YA 3GQ3A 4LJ8A 4B3SM 2C98A 2R18A 3DA1A 3KXEC 1ZMUA 4I81A 3NWLA 4MGIE 4MGHA 5FTLA 3HJ8A 2QBYA 1VEKA 3FYDA 3KS4A 2JWSA 2DAGA 1NV8A 5EJCA 2LWXA 4LGYA 4NRVA 4DR3M 3RFWA 1R6BX 2CEAA 4A3VB 2CV1A 4GH9A 1K3WA 2XSZD 2QCUA 3FKEA 2K47A 2KNVA 3NBIA 4G4NA 2W82A 2JY8A 4L78A 4DV5M 3KOZE 4XGIA 2UUBM 3SARA 1N33M 2RKOA 1GL6A 2GNOA 3K92A 5FLXS 3HX3A 1N77A 3SHGB 1PJQA 2DWZB 2CE7A 2DAMA 2DZNB 3TWKA 2XH9A 2CFOA 4JI4M 1G8PA 2R62A 1QANA 2R0IA 2R4JA 4NXMM 2FS1A 1X37A 3WHLA 1ZAEA 1OAOC 3W0FA 4DUZM 2QQ8A 1DGFA 4LGMA 4MGYE 3K2LA 3C3EA 3A98B 3GLIA 3BBZA 3GO8A 4AW4A 4CISA 3FUTA 2XZUA 3CGWA 4NXNM 3B7ZA 1IXSB 1MN3A 2LVPC 2QPAA 5ITYA 1HNZM 1KFVA 1VEGA 2LTUA 2WZJA 4AI6A 1L1ZA 4IJFA 4YY3M 4LJ4A 4QNMA 1L1TA 5EQTA 4NL4H 1XNRM 1WIVA 3SHFA 4GHLA 3GQ4A 1TH4A 3D8LA 1J5EM 4LF9M 2X8AA 3T15A 2FNAA 2JNHA 4Q7JA 5ITQA 1DV0A 2JY7A 1J7KA 3CF6E 5IREB 2YFQA 3THGA 1NSFA 3AOGA 3AFHA 1Q02A 2ZTCA 2L09A 4B7HA 1OQYA 1OTRA 1IN6A 5FTNA 3AKZA 1MJGM 2R65A 4HEOA 3ZCBB 2R45A 3TWMA 1A5TA 1GKIA 4MB7A 1WGNA 4X65M 3K1JA 3J80S 1EIJA 4B7FA 3CF0A 5BPVA 2DAKA 3B7NA 3I01M 4BBAA 1HT1E 2XF3A 1NV9A 2XEPA 3U60B 4AKIA 1E94E 4AG6A 4PCZA 1Y8GA 2F5NA 1HR0M 4LF7M 3SAWA 3KSXA 2MR9A 2J7OA 1E32A 2VQFM 2Z3XA 1N34M 4IBDA 2D7HA 2HHHM 1L2BA 2ZAOA 1EFUB 2VQEM 2F5SA 5EXTA 2H5XA 2B3TA 2O01F 1YSYA 2R6FA 4D80A 4B3MM 1DGBA 3FTEA 4BB9A 2O5RA 5LMNM 4DV0M 1IBLM 2P5TA 1ZQ9A 3LCUA 5A2QS 3H4MA 2L7HA 3Q8XA 4OVZB 1Z5BA 4WURA 3L25A 1LV7A 3B9PA 2CHVA 2EUCA 1JR3E 3B7QA 4NSOB 2DZOB 3RGSA 2UUCM 3HWSA 4DR1M 4I4LA 1WXQA 3FRHA 4B3TM 2MGWA 2APLA 1D0LA 2Y20A 3GPXA 1L2CA 4DR4M 3PNYA 3SATA 1SXJE 1R7RA 2VF7A 4JYAM 2F5PA 2JZ1A 2JXNA 3FUVA 4DV3M 5KPTA 3JR5A 1TDHA 5E6JA 1I4WA 1QUSA 4LRTA 2UXBM 1QVRA 1IY1A 3VDUA 4LF4M 2FE8A 3KDSE 1DO0A 3KVWA 4JN6A 1WR1B 1N36M 2M60A 3GRUA 2L4EA 4B7GA 2DHYA 3GLFA 1RU3A 2V1CA 1OAIA 3UJNA 2DZLA 4LCBA 4LG2A 5FTJA 1SXJB 2V6ZM 1IXRC 2ZM6M 3HU1A 2R46A 4W5WA 4X64M 1WHCA 4LJ5A 3KOWE 3KOXE 3H4JA 2EKFA 2H1RA 4F2LA 3VDPA 5FTKA 3E9SA 3FUWA 4DUYM 1N78A 1Z5CA 3AOEC 4DR7M 4OW0A 1IN4A 2LVNC 4YHHM 1OIPA 4KO8A 2UUAM 1CUKA 1Z5AA 1T43A 4CJ6A 2NQ8C 4LF6M 3J7AS 4LJ7A 1L8QA 4TUWA 3CF2A 1PM5A 2J7NA 1GLNA 4M0DA 1PGYA 2XFTA 3J27B 5DYGA 1XXHB 3L29A 4M9XA 1F4IA 1AIPC 2QSFX 1DGHB 5EP1A 4M9SA 2ERCA 3KP1E 1WGLA 2CV0A 4G6ZA 3ZH9B 4B08A 2QZ4A 1NY6A 2F5QA 4LF8M 1OJLA 3T1HM 4FVMA 1IBKM 1GO5A 2DVWB 1JR3A 2G8LA 3FRIA 4QOZC 3HU2A 2BJWA 1TTEA 3FUXA 3KP0E 5EXSA 1PJJA 3CTWB 3U6OA 2HWJA 3HJQA 4QHSA 5EP2A 2F5OA 1NO1A 1DGGA 1ORYB 3DFZA 3B74A 3PVSA 3MMPA 4F1IA 3TE6A 3VLFB 2J5YA 2FFJA 2LNHC 2LVQD 2D7EA 5GKNA 4CIZA 3U6LA 1I94M 2L4FA 1TF0B 3HZJA 4LJ6A 4BLCA 5FTMA 2C9CA 1E9RA 1K3XA 4DR6M 3HY5A 3SFZA 1XNQM 3E46A 4LRSA 4WW0A 4XK8F 2QNJA 4JI8M 3GLHA 3K9OA 4HL4A 3LQQA 4JI7M 1OFIA 3C9PA 3DOAA 3RE8A 3A42A 3QWLA 4LJAA 1HNXM 4GKKM 3I4YA 3TWLA 3ILKA 4OU7A 1S3SA 2RGOA 2VF8A 2ZBKB 4XBOA 4GC9A 4M9ZA 2FOIC 2RRUA 3B89A 2DAIA 5DFLA 1V33A 4LZJA 2CP8A 3L27A 2LH0A 1QZMA 2C9OA 4ZPXA 5JI2E 2DENA 1PRBA 3L2AA 3EIHA 3U6QA 1QDTA 3M0EA 2FH0A 3QYEA 2ZAMA 4IBFA 4X66M 2LHCA 2VDBB 3U61B 4Y28F 2CHGA 4AKGA 4DR2M 3W0LB 2RGHA 3IHPA 4JXJA 4Z6YA 4X62M 4S12A 1XHBA 2AHMA 2L7IA 2OO9A 3IECA 1W5SA 3U5ZA 3GRRA 4REZA 2A5YB 2Y21A 4JI5M 3KFUG 1N32M 2Z4RA 4GIPA 1IN8A 3FE3A 3F92A 4L8RC 1GL7A 4L15A 3JAMS 3BXWA 2K0BX 1D0KA 2MH8A 4MM3B 2MROB 8CATA 1MX0A 2CWBA 5ITTA 1QYRA 2M5ZA 4B3RM 4RF0A 4II7A 3C3DA 4QOSA 4G3OA 4ANRA 2DWNA 3SASA 1Z6TA 3UMMA 4P16A 4GHAA 2KRKA 3FUUA 3WHKA 4Z8XA 3VK7A 3KOYE 4KLNA 2Y0QA 3T6PA 2C5RA 1NY5A 4OX9M 2L2DA 2LVAA 2E5LM 3SAUA 1IN7A 3KS8A 5DYIA 3E21A 3M6AA 1SG9A 1IM2A 1NHWC 1SXJD 2Z4SA 1TDZA 2JUJA 2ZANA 1Q39A 1GJSA 3GLGE 1ZMWA 2EA0A 4PDGA 1R2ZA 4NRWA 3SAVA 1IY0A 5C1BA 4FW9A 1PJSA 2MJ5B 3T1YM 4GC5A 2QENA 3ZC7B 3L28A 3J7BA 3IG5A 3EIEA 2R44A 3VK8A 4LF5M 5E26A 3GLIE 1QUTA 3PXGA 3HGIA 4IBKA 1H6UA 4HLQA 5C18A 2I7NA 2OPFA 2DNAA 4LFCM 1Q3CA 4LJ9A 5EXPA 2VIIA 3U6DA 3FTCA 1OIZA 5KQ8A 4JI2M 2DKLA 2X49A 1QAOA 2G5GX 1G71A 4CHTB 2CV2A 1D0MA 4R3DA 4G4QA 1V34A 2KDLA 2EO2A 1MU5A 3AV0A 1NVMA 3JR4A 5KPRA 3FD9A 2K6BA 4QNRA 5DNYA 4IJEA 1BVSA 4DV1M 2Q2EB 4D82A 1R5LA 1IY2A 1R4GA 1T6OA 3SBJA 3R9XB 1HJPA 4GRIA 5F3WA 1IXSA 2EJSA 3PNVA 4IBBA 2HCBA 4IBIA 2R4EA 1KSFX 1OKSA 3VKHA 1WJ7A 2BNKA 1Q3BA 4FCTA 3GPPA 2C96A 2KA6B 2KZUA 2OOBA 2CUZA 2X4AA 1G4AE 3KSJA 4IBJA 4EIWA 3ZQJA 3U6CA 1G59A 2UU9M 3GPYA 4I8OA 4DV7M 5EP4A 2I7PA 4IBEA 3J2PB 3GQ5A
chains in the Genus database with same CATH topology
2KNZA 3LCUA 2JP7A 1TR8A 2KNAA 2K9DA 2RRUA 3B89A 2BWEA 2DAIA 5DFLA 1JR3E 2CP8A 2ZTDA 5JI2E 2JY5A 1G3IA 2DENA 3LCVB 2OOAA 1C7YA 1HT2E 3FRHA 2MGWA 1ZMUA 4DBGB 1VEKA 3GLFE 2DAGA 1NV8A 1IFYA 2JZ1A 2O25A 3IHPA 2OO9A 3IECA 1YLAA 1ZV1A 1DO0A 2KNVA 3FE3A 2LBCA 3F92A 1WR1B 2JY8A 2K0BX 2L4EA 2DHYA 1OAIA 2KHHA 2MROB 2BWBA 2DZLA 1XB2B 3K9PA 2CWBA 2HAKA 2DAMA 2EKKA 4G3OA 1WHCA 1XXHE 3H4JA 2EKFA 2R0IA 4WP2A 4F2LA 3T6PA 2L2DA 2LVAA 3E21A 1SG9A 1IM2A 2LVNC 2LVOC 2JUJA 1QZEA 3BBZA 3GLGE 1ZMWA 1CUKA 1T43A 1VDLA 4R71A 1MN3A 2LVPC 1VG5A 2MJ5B 2JY6B 1VEGA 2LTUA 2WZJA 1PGYA 1F4IA 1ZMVA 1AIPC 2QSFX 1WIVA 3GLIE 1WGLA 1DV0A 2G3QA 2JNHA 4Q7JA 2JZ0A 2JY7A 1GO5A 2DNAA 1Q02A 3FRIA 2ZTCA 1OQYA 1TTEA 1OTRA 2DKLA 4UN2B 2HWJA 4HEOA 1VEJA 4GEWA 2DAEA 1V92A 1A5TA 3GLHE 1WGNA 3MMPA 4F1IA 2LVQD 1P3QQ 2DAKA 1BVSA 2L4FA 1T6OA 1DO2A 1HT1E 1R4GA 1NV9A 2QHOB 1HJPA 2DI0A 1IXSA 2EJSA 3E46A 1E94E 1Y8GA 1VQ1A 1OKSA 2QNJA 2MR9A 1G41A 3K9OA 1WJ7A 2OOBA 1EFUB 1G4AE 1HQYE 1UFZA 2H5XA 2B3TA 1KYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNZ A;  3LCU A;  2JP7 A;  1TR8 A;  2KNA A;  2K9D A;  2RRU A;  3B89 A;  2BWE A;  2DAI A;  5DFL A;  1JR3 E;  2CP8 A;  2ZTD A;  5JI2 E;  2JY5 A;  1G3I A;  2DEN A;  3LCV B;  2OOA A;  1C7Y A;  1HT2 E;  3FRH A;  2MGW A;  1ZMU A;  4DBG B;  1VEK A;  3GLF E;  2DAG A;  1NV8 A;  1IFY A;  2JZ1 A;  2O25 A;  3IHP A;  2OO9 A;  3IEC A;  1YLA A;  1ZV1 A;  1DO0 A;  2KNV A;  3FE3 A;  2LBC A;  3F92 A;  1WR1 B;  2JY8 A;  2K0B X;  2L4E A;  2DHY A;  1OAI A;  2KHH A;  2MRO B;  2BWB A;  2DZL A;  1XB2 B;  3K9P A;  2CWB A;  2HAK A;  2DAM A;  2EKK A;  4G3O A;  1WHC A;  1XXH E;  3H4J A;  2EKF A;  2R0I A;  4WP2 A;  4F2L A;  3T6P A;  2L2D A;  2LVA A;  3E21 A;  1SG9 A;  1IM2 A;  2LVN C;  2LVO C;  2JUJ A;  1QZE A;  3BBZ A;  3GLG E;  1ZMW A;  1CUK A;  1T43 A;  1VDL A;  4R71 A;  1MN3 A;  2LVP C;  1VG5 A;  2MJ5 B;  2JY6 B;  1VEG A;  2LTU A;  2WZJ A;  1PGY A;  1F4I A;  1ZMV A;  1AIP C;  2QSF X;  1WIV A;  3GLI E;  1WGL A;  1DV0 A;  2G3Q A;  2JNH A;  4Q7J A;  2JZ0 A;  2JY7 A;  1GO5 A;  2DNA A;  1Q02 A;  3FRI A;  2ZTC A;  1OQY A;  1TTE A;  1OTR A;  2DKL A;  4UN2 B;  2HWJ A;  4HEO A;  1VEJ A;  4GEW A;  2DAE A;  1V92 A;  1A5T A;  3GLH E;  1WGN A;  3MMP A;  4F1I A;  2LVQ D;  1P3Q Q;  2DAK A;  1BVS A;  2L4F A;  1T6O A;  1DO2 A;  1HT1 E;  1R4G A;  1NV9 A;  2QHO B;  1HJP A;  2DI0 A;  1IXS A;  2EJS A;  3E46 A;  1E94 E;  1Y8G A;  1VQ1 A;  1OKS A;  2QNJ A;  2MR9 A;  1G41 A;  3K9O A;  1WJ7 A;  2OOB A;  1EFU B;  1G4A E;  1HQY E;  1UFZ A;  2H5X A;  2B3T A;  1KYI A; 
#chains in the Genus database with same CATH topology
 1GJT A;  3W67 A;  3TPZ A;  1NNJ A;  3PFI A;  4PDI A;  3U5Z B;  2JP7 A;  1TR8 A;  1UM8 A;  4LZZ A;  5EXX A;  1E9S A;  2KNA A;  5ITX A;  2BWE A;  1XWI A;  3HHZ A;  3GPU A;  4OVZ A;  2KXE A;  3LCV B;  3GLG A;  2OOA A;  1HT2 E;  3A45 A;  2DWL A;  1NNU C;  3LW5 F;  4KHP M;  3Q8G A;  3SMS A;  4P17 A;  4MGK E;  4RKU F;  2D7G A;  4DBG B;  2HKJ A;  1EE8 A;  4RNA A;  3GLF E;  1OFH A;  1QAQ A;  3I4V A;  1IFY A;  3GRV A;  3UK6 A;  2UXD M;  2O25 A;  3GLI B;  4L4U A;  4AZF A;  5IZ7 D;  3SC3 A;  3M7G A;  1JQJ C;  1TH2 A;  3AOE A;  3IG8 A;  1YLA A;  2KW0 A;  3C58 A;  3I51 A;  4MH0 E;  3FYC A;  2KZS A;  3AL0 C;  4NC6 A;  1ZV1 A;  4RF1 A;  3NBX X;  7CAT A;  2LBC A;  4FWH A;  3LVV A;  1DGH A;  1SXJ A;  2KHH A;  2BWB A;  3K9P A;  1XB2 B;  4DV4 M;  3TL4 X;  2HAK A;  4NSR A;  2BJV A;  5KPZ A;  1D2N A;  3GLF B;  3DZD A;  2EKK A;  3MJ5 A;  5H37 D;  5LMU M;  5EP3 A;  1K82 A;  4JI6 M;  4GMQ A;  4JV5 M;  2JA2 A;  1XXH E;  2CHQ A;  2WSC F;  4QHT A;  4WP2 A;  4DV2 M;  1QAM A;  1QDR A;  3U6S A;  1XMQ M;  1FNN A;  4FWG A;  3GP1 A;  1R2Y A;  4FCV A;  3HKP A;  3U6P A;  1XMO M;  4NOO B;  3V76 A;  2QP9 X;  1J09 A;  1T3T A;  4FD2 A;  1AUA A;  1VDD A;  4IBG A;  1NJF A;  2KEB A;  3TQS A;  2LVO C;  1QZE A;  2LHG A;  4G4O A;  2GQF A;  3RGP A;  4GKJ M;  1HNW M;  1VDL A;  2DWM A;  1YUB A;  2Z8Y M;  1PJT A;  1TH3 A;  3BOS A;  4R71 A;  2V1U A;  1TGU A;  2CRU A;  4LFB M;  1XC8 A;  5KQD A;  3LVW A;  2YR0 A;  3MK6 A;  1W5T A;  4PT5 A;  4M0W A;  1VG5 A;  2XZF A;  1L2D A;  4L6V 6;  3UGJ A;  2Z7J A;  2JY6 B;  2DHR A;  4IBC A;  4L16 A;  1ZMV A;  1LTM A;  2WSF F;  3HHX A;  1Z59 A;  5ITX E;  3SYL A;  2OQ4 A;  4JI1 M;  4I5S A;  5KO3 A;  3SMP A;  3HU3 A;  2G3Q A;  3VKG A;  2JZ0 A;  1GAB A;  3SYK A;  3QYB A;  5ITR A;  3U61 A;  3LQR A;  3HJS A;  5JI3 E;  2KRU A;  4CGY B;  4LFA M;  1IXZ A;  1IN5 A;  4D81 A;  3J81 S;  4UN2 B;  3OTO M;  3GLH B;  3E4R A;  1VEJ A;  2Y0T A;  4GEW A;  5BR8 M;  2DAE A;  2HL7 A;  1V92 A;  3MHV C;  1HQC A;  1JB0 F;  2N35 A;  3GLH E;  3HHY A;  4IIW A;  4LY6 A;  3T38 A;  3HHW A;  5IT9 S;  4JI0 M;  3VFD A;  2XGN A;  1P3Q Q;  3L26 A;  5ITU A;  3LMM A;  4GIT A;  1QQW A;  2C99 A;  3U6M A;  1DO2 A;  1GVN A;  2UXC M;  1PJI A;  4JI3 M;  2QHO B;  1FJG M;  4AG5 A;  2XLJ A;  1JR3 D;  2DI0 A;  3A46 A;  4AQY M;  1VQ1 A;  3AJI B;  1G41 A;  2DXI A;  3W68 A;  1NJG A;  3D8B A;  4AKH A;  4DR5 M;  1HQY E;  1UFZ A;  1C1K A;  4R7G A;  5IWA M;  2QBY B;  4DV6 M;  1N75 A;  4FWD A;  3GRY A;  3U6E A;  1IQP A;  1KYI A;  4KOD A;  3R8F A;  1SXJ C;  4ITQ A;  3K8Z A;  2WSE F;  1YE9 A;  2KNZ A;  5L8R F;  2YQZ A;  3GLG B;  3FTD A;  4MGZ E;  1IBM M;  2L6O A;  3FTF A;  2K9D A;  2XSZ A;  4PD2 A;  4G4R A;  1NHG C;  1XXH A;  2XFS A;  4FCW A;  2F4V M;  2YNM D;  3QAU A;  3I04 M;  3U60 A;  2ZTD A;  2LXE A;  3KW6 A;  4KT0 F;  3UZU A;  4K0K M;  2JY5 A;  5FSW A;  1G3I A;  1C7Y A;  3GQ3 A;  4LJ8 A;  4B3S M;  2C98 A;  2R18 A;  3DA1 A;  3KXE C;  1ZMU A;  4I81 A;  3NWL A;  4MGI E;  4MGH A;  5FTL A;  3HJ8 A;  2QBY A;  1VEK A;  3FYD A;  3KS4 A;  2JWS A;  2DAG A;  1NV8 A;  5EJC A;  2LWX A;  4LGY A;  4NRV A;  4DR3 M;  3RFW A;  1R6B X;  2CEA A;  4A3V B;  2CV1 A;  4GH9 A;  1K3W A;  2XSZ D;  2QCU A;  3FKE A;  2K47 A;  2KNV A;  3NBI A;  4G4N A;  2W82 A;  2JY8 A;  4L78 A;  4DV5 M;  3KOZ E;  4XGI A;  2UUB M;  3SAR A;  1N33 M;  2RKO A;  1GL6 A;  2GNO A;  3K92 A;  5FLX S;  3HX3 A;  1N77 A;  3SHG B;  1PJQ A;  2DWZ B;  2CE7 A;  2DAM A;  2DZN B;  3TWK A;  2XH9 A;  2CFO A;  4JI4 M;  1G8P A;  2R62 A;  1QAN A;  2R0I A;  2R4J A;  4NXM M;  2FS1 A;  1X37 A;  3WHL A;  1ZAE A;  1OAO C;  3W0F A;  4DUZ M;  2QQ8 A;  1DGF A;  4LGM A;  4MGY E;  3K2L A;  3C3E A;  3A98 B;  3GLI A;  3BBZ A;  3GO8 A;  4AW4 A;  4CIS A;  3FUT A;  2XZU A;  3CGW A;  4NXN M;  3B7Z A;  1IXS B;  1MN3 A;  2LVP C;  2QPA A;  5ITY A;  1HNZ M;  1KFV A;  1VEG A;  2LTU A;  2WZJ A;  4AI6 A;  1L1Z A;  4IJF A;  4YY3 M;  4LJ4 A;  4QNM A;  1L1T A;  5EQT A;  4NL4 H;  1XNR M;  1WIV A;  3SHF A;  4GHL A;  3GQ4 A;  1TH4 A;  3D8L A;  1J5E M;  4LF9 M;  2X8A A;  3T15 A;  2FNA A;  2JNH A;  4Q7J A;  5ITQ A;  1DV0 A;  2JY7 A;  1J7K A;  3CF6 E;  5IRE B;  2YFQ A;  3THG A;  1NSF A;  3AOG A;  3AFH A;  1Q02 A;  2ZTC A;  2L09 A;  4B7H A;  1OQY A;  1OTR A;  1IN6 A;  5FTN A;  3AKZ A;  1MJG M;  2R65 A;  4HEO A;  3ZCB B;  2R45 A;  3TWM A;  1A5T A;  1GKI A;  4MB7 A;  1WGN A;  4X65 M;  3K1J A;  3J80 S;  1EIJ A;  4B7F A;  3CF0 A;  5BPV A;  2DAK A;  3B7N A;  3I01 M;  4BBA A;  1HT1 E;  2XF3 A;  1NV9 A;  2XEP A;  3U60 B;  4AKI A;  1E94 E;  4AG6 A;  4PCZ A;  1Y8G A;  2F5N A;  1HR0 M;  4LF7 M;  3SAW A;  3KSX A;  2MR9 A;  2J7O A;  1E32 A;  2VQF M;  2Z3X A;  1N34 M;  4IBD A;  2D7H A;  2HHH M;  1L2B A;  2ZAO A;  1EFU B;  2VQE M;  2F5S A;  5EXT A;  2H5X A;  2B3T A;  2O01 F;  1YSY A;  2R6F A;  4D80 A;  4B3M M;  1DGB A;  3FTE A;  4BB9 A;  2O5R A;  5LMN M;  4DV0 M;  1IBL M;  2P5T A;  1ZQ9 A;  3LCU A;  5A2Q S;  3H4M A;  2L7H A;  3Q8X A;  4OVZ B;  1Z5B A;  4WUR A;  3L25 A;  1LV7 A;  3B9P A;  2CHV A;  2EUC A;  1JR3 E;  3B7Q A;  4NSO B;  2DZO B;  3RGS A;  2UUC M;  3HWS A;  4DR1 M;  4I4L A;  1WXQ A;  3FRH A;  4B3T M;  2MGW A;  2APL A;  1D0L A;  2Y20 A;  3GPX A;  1L2C A;  4DR4 M;  3PNY A;  3SAT A;  1SXJ E;  1R7R A;  2VF7 A;  4JYA M;  2F5P A;  2JZ1 A;  2JXN A;  3FUV A;  4DV3 M;  5KPT A;  3JR5 A;  1TDH A;  5E6J A;  1I4W A;  1QUS A;  4LRT A;  2UXB M;  1QVR A;  1IY1 A;  3VDU A;  4LF4 M;  2FE8 A;  3KDS E;  1DO0 A;  3KVW A;  4JN6 A;  1WR1 B;  1N36 M;  2M60 A;  3GRU A;  2L4E A;  4B7G A;  2DHY A;  3GLF A;  1RU3 A;  2V1C A;  1OAI A;  3UJN A;  2DZL A;  4LCB A;  4LG2 A;  5FTJ A;  1SXJ B;  2V6Z M;  1IXR C;  2ZM6 M;  3HU1 A;  2R46 A;  4W5W A;  4X64 M;  1WHC A;  4LJ5 A;  3KOW E;  3KOX E;  3H4J A;  2EKF A;  2H1R A;  4F2L A;  3VDP A;  5FTK A;  3E9S A;  3FUW A;  4DUY M;  1N78 A;  1Z5C A;  3AOE C;  4DR7 M;  4OW0 A;  1IN4 A;  2LVN C;  4YHH M;  1OIP A;  4KO8 A;  2UUA M;  1CUK A;  1Z5A A;  1T43 A;  4CJ6 A;  2NQ8 C;  4LF6 M;  3J7A S;  4LJ7 A;  1L8Q A;  4TUW A;  3CF2 A;  1PM5 A;  2J7N A;  1GLN A;  4M0D A;  1PGY A;  2XFT A;  3J27 B;  5DYG A;  1XXH B;  3L29 A;  4M9X A;  1F4I A;  1AIP C;  2QSF X;  1DGH B;  5EP1 A;  4M9S A;  2ERC A;  3KP1 E;  1WGL A;  2CV0 A;  4G6Z A;  3ZH9 B;  4B08 A;  2QZ4 A;  1NY6 A;  2F5Q A;  4LF8 M;  1OJL A;  3T1H M;  4FVM A;  1IBK M;  1GO5 A;  2DVW B;  1JR3 A;  2G8L A;  3FRI A;  4QOZ C;  3HU2 A;  2BJW A;  1TTE A;  3FUX A;  3KP0 E;  5EXS A;  1PJJ A;  3CTW B;  3U6O A;  2HWJ A;  3HJQ A;  4QHS A;  5EP2 A;  2F5O A;  1NO1 A;  1DGG A;  1ORY B;  3DFZ A;  3B74 A;  3PVS A;  3MMP A;  4F1I A;  3TE6 A;  3VLF B;  2J5Y A;  2FFJ A;  2LNH C;  2LVQ D;  2D7E A;  5GKN A;  4CIZ A;  3U6L A;  1I94 M;  2L4F A;  1TF0 B;  3HZJ A;  4LJ6 A;  4BLC A;  5FTM A;  2C9C A;  1E9R A;  1K3X A;  4DR6 M;  3HY5 A;  3SFZ A;  1XNQ M;  3E46 A;  4LRS A;  4WW0 A;  4XK8 F;  2QNJ A;  4JI8 M;  3GLH A;  3K9O A;  4HL4 A;  3LQQ A;  4JI7 M;  1OFI A;  3C9P A;  3DOA A;  3RE8 A;  3A42 A;  3QWL A;  4LJA A;  1HNX M;  4GKK M;  3I4Y A;  3TWL A;  3ILK A;  4OU7 A;  1S3S A;  2RGO A;  2VF8 A;  2ZBK B;  4XBO A;  4GC9 A;  4M9Z A;  2FOI C;  2RRU A;  3B89 A;  2DAI A;  5DFL A;  1V33 A;  4LZJ A;  2CP8 A;  3L27 A;  2LH0 A;  1QZM A;  2C9O A;  4ZPX A;  5JI2 E;  2DEN A;  1PRB A;  3L2A A;  3EIH A;  3U6Q A;  1QDT A;  3M0E A;  2FH0 A;  3QYE A;  2ZAM A;  4IBF A;  4X66 M;  2LHC A;  2VDB B;  3U61 B;  4Y28 F;  2CHG A;  4AKG A;  4DR2 M;  3W0L B;  2RGH A;  3IHP A;  4JXJ A;  4Z6Y A;  4X62 M;  4S12 A;  1XHB A;  2AHM A;  2L7I A;  2OO9 A;  3IEC A;  1W5S A;  3U5Z A;  3GRR A;  4REZ A;  2A5Y B;  2Y21 A;  4JI5 M;  3KFU G;  1N32 M;  2Z4R A;  4GIP A;  1IN8 A;  3FE3 A;  3F92 A;  4L8R C;  1GL7 A;  4L15 A;  3JAM S;  3BXW A;  2K0B X;  1D0K A;  2MH8 A;  4MM3 B;  2MRO B;  8CAT A;  1MX0 A;  2CWB A;  5ITT A;  1QYR A;  2M5Z A;  4B3R M;  4RF0 A;  4II7 A;  3C3D A;  4QOS A;  4G3O A;  4ANR A;  2DWN A;  3SAS A;  1Z6T A;  3UMM A;  4P16 A;  4GHA A;  2KRK A;  3FUU A;  3WHK A;  4Z8X A;  3VK7 A;  3KOY E;  4KLN A;  2Y0Q A;  3T6P A;  2C5R A;  1NY5 A;  4OX9 M;  2L2D A;  2LVA A;  2E5L M;  3SAU A;  1IN7 A;  3KS8 A;  5DYI A;  3E21 A;  3M6A A;  1SG9 A;  1IM2 A;  1NHW C;  1SXJ D;  2Z4S A;  1TDZ A;  2JUJ A;  2ZAN A;  1Q39 A;  1GJS A;  3GLG E;  1ZMW A;  2EA0 A;  4PDG A;  1R2Z A;  4NRW A;  3SAV A;  1IY0 A;  5C1B A;  4FW9 A;  1PJS A;  2MJ5 B;  3T1Y M;  4GC5 A;  2QEN A;  3ZC7 B;  3L28 A;  3J7B A;  3IG5 A;  3EIE A;  2R44 A;  3VK8 A;  4LF5 M;  5E26 A;  3GLI E;  1QUT A;  3PXG A;  3HGI A;  4IBK A;  1H6U A;  4HLQ A;  5C18 A;  2I7N A;  2OPF A;  2DNA A;  4LFC M;  1Q3C A;  4LJ9 A;  5EXP A;  2VII A;  3U6D A;  3FTC A;  1OIZ A;  5KQ8 A;  4JI2 M;  2DKL A;  2X49 A;  1QAO A;  2G5G X;  1G71 A;  4CHT B;  2CV2 A;  1D0M A;  4R3D A;  4G4Q A;  1V34 A;  2KDL A;  2EO2 A;  1MU5 A;  3AV0 A;  1NVM A;  3JR4 A;  5KPR A;  3FD9 A;  2K6B A;  4QNR A;  5DNY A;  4IJE A;  1BVS A;  4DV1 M;  2Q2E B;  4D82 A;  1R5L A;  1IY2 A;  1R4G A;  1T6O A;  3SBJ A;  3R9X B;  1HJP A;  4GRI A;  5F3W A;  1IXS A;  2EJS A;  3PNV A;  4IBB A;  2HCB A;  4IBI A;  2R4E A;  1KSF X;  1OKS A;  3VKH A;  1WJ7 A;  2BNK A;  1Q3B A;  4FCT A;  3GPP A;  2C96 A;  2KA6 B;  2KZU A;  2OOB A;  2CUZ A;  2X4A A;  1G4A E;  3KSJ A;  4IBJ A;  4EIW A;  3ZQJ A;  3U6C A;  1G59 A;  2UU9 M;  3GPY A;  4I8O A;  4DV7 M;  5EP4 A;  2I7P A;  4IBE A;  3J2P B;  3GQ5 A; 
#chains in the Genus database with same CATH homology
 2KNZ A;  3LCU A;  2JP7 A;  1TR8 A;  2KNA A;  2K9D A;  2RRU A;  3B89 A;  2BWE A;  2DAI A;  5DFL A;  1JR3 E;  2CP8 A;  2ZTD A;  5JI2 E;  2JY5 A;  1G3I A;  2DEN A;  3LCV B;  2OOA A;  1C7Y A;  1HT2 E;  3FRH A;  2MGW A;  1ZMU A;  4DBG B;  1VEK A;  3GLF E;  2DAG A;  1NV8 A;  1IFY A;  2JZ1 A;  2O25 A;  3IHP A;  2OO9 A;  3IEC A;  1YLA A;  1ZV1 A;  1DO0 A;  2KNV A;  3FE3 A;  2LBC A;  3F92 A;  1WR1 B;  2JY8 A;  2K0B X;  2L4E A;  2DHY A;  1OAI A;  2KHH A;  2MRO B;  2BWB A;  2DZL A;  1XB2 B;  3K9P A;  2CWB A;  2HAK A;  2DAM A;  2EKK A;  4G3O A;  1WHC A;  1XXH E;  3H4J A;  2EKF A;  2R0I A;  4WP2 A;  4F2L A;  3T6P A;  2L2D A;  2LVA A;  3E21 A;  1SG9 A;  1IM2 A;  2LVN C;  2LVO C;  2JUJ A;  1QZE A;  3BBZ A;  3GLG E;  1ZMW A;  1CUK A;  1T43 A;  1VDL A;  4R71 A;  1MN3 A;  2LVP C;  1VG5 A;  2MJ5 B;  2JY6 B;  1VEG A;  2LTU A;  2WZJ A;  1PGY A;  1F4I A;  1ZMV A;  1AIP C;  2QSF X;  1WIV A;  3GLI E;  1WGL A;  1DV0 A;  2G3Q A;  2JNH A;  4Q7J A;  2JZ0 A;  2JY7 A;  1GO5 A;  2DNA A;  1Q02 A;  3FRI A;  2ZTC A;  1OQY A;  1TTE A;  1OTR A;  2DKL A;  4UN2 B;  2HWJ A;  4HEO A;  1VEJ A;  4GEW A;  2DAE A;  1V92 A;  1A5T A;  3GLH E;  1WGN A;  3MMP A;  4F1I A;  2LVQ D;  1P3Q Q;  2DAK A;  1BVS A;  2L4F A;  1T6O A;  1DO2 A;  1HT1 E;  1R4G A;  1NV9 A;  2QHO B;  1HJP A;  2DI0 A;  1IXS A;  2EJS A;  3E46 A;  1E94 E;  1Y8G A;  1VQ1 A;  1OKS A;  2QNJ A;  2MR9 A;  1G41 A;  3K9O A;  1WJ7 A;  2OOB A;  1EFU B;  1G4A E;  1HQY E;  1UFZ A;  2H5X A;  2B3T A;  1KYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...