2DKZA

Solution structure of the sam_pnt-domain of the hypothetical protein loc64762
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
b'GSSGSSGPWQPPADLSGLSIEEVSKSLRFIGLSEDVISFFVTEKIDGNLLVQLTEEILSEDFKLSKLQVKKIMQFINGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SAM_PNT-domain of the hypothetical protein LOC64762
rcsb
molecule keywords hypothetical protein LOC64762
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2dkzA01
2KSOA 2F8KA 1SV0A 4PZOA 1B4FA 1KW4A 2KG5A 1Z1VA 3TACB 2YTUA 2DKXA 1UQVA 1DXSA 1F0MA 3BS5A 3BQ7A 2F44A 3H8MA 4IS7A 2QARA 1SV4A 1UCVA 3SEIA 2E8MA 2B6GA 1X9XA 2EAOA 1X66A 3BS7A 1V38A 2L5YA 1B0XA 2K4PA 2D3DA 4RQNA 2KIVA 2LMRA 4RQMA 4NJ8A 1OXJA 2E8NA 3TADC 2F3NA 2D8CA 1OW5A 2KSOB 3TADA 2K60A 1V85A 5JTIA 1LKYA 1PK1A 4NL9C 4NL9A 5J8YC 5KNIA 2KE7A 5J8YA 1PK3A 2DKZA 2EAMA 2EAPA 2QB0B 3HILA 2ES6A 2QARB 2ESEA 2DL0A 2FE9A 2QB1A 3KKAC 2E8PA 2QKQA 3KKAA 3SENA 1SXEA 1COKA 2KMDA 2Y9UA 3IDWA 5JU5A 2GLEA 4PZNA 1WWUA 3BS5B 1RG6A 4MHVA 1WWVA 1LKYB 1PK1B 5JRTA 1X40A 1SXDA 2E8OA 2QB0A 2Y9TA 2JV3A 2LPEA 5L1MA 1JI7A 2EANA 1SGGA 3K1RB 5F3XB 1SV0C
chains in the Genus database with same CATH superfamily
5AICA 9ICKA 4Y2VA 1B4FA 4U7CA 4Q8FA 8ICFA 1IV8A 3G6XA 3HX0A 1DRGA 5ALMA 4DQSA 2Y0SC 3ZDDA 4JB3A 3HRDD 3NVZA 4DOBA 4NLZA 5EE3A 2J6SA 5AI4A 2W8LA 3SEIA 1ZQOA 4MF8A 4F5PA 5J0YA 4UAYA 2HHVA 4USAA 4R65A 1KFTA 3SAGA 4B6JA 1Z00B 2MSNA 5AK6A 4X5VA 3LDAA 3Q8QB 4F5OA 3UXNA 1OXJA 4ECSA 1ZD4A 3DV9A 4DS5A 2G06A 4R64A 4M04A 4QZCA 1ZQEA 5KFWA 4IRCA 4PGXA 4XA5A 5ALKA 4IC9A 2KJ9A 7ICGA 1S0MA 4EBDA 1GO3F 4RPYA 1X9WA 4GFJA 1AROP 2BCSA 3RF9A 2VJ4A 1T7PA 2HHTA 4CNQA 5DBAA 3WKAA 2P66A 5AK5A 2DL0A 7ICEA 5KT6A 1Z4NA 5ALSA 3F5AA 3KKAC 3BZCA 1TK0A 5KL1B 3IG8A 4FO6A 3PW2A 2LYHA 3T79A 2BPGA 2KMDA 5DGAA 1P7DA 5KFIA 3FDSA 2M9NA 3E2EA 2LM4A 4GC6A 4UB8U 1SL0A 8ICPA 5JRTA 4XQ8A 1KBUA 1FO4A 1NKEA 1S97A 5J0QA 2XICA 1RPLA 1TVAA 2FI1A 4UB3A 8ICCA 1B22A 5DQIA 3WKDA 5KT2A 2XCAA 2LYAA 5DLFA 2YTUA 1X6JA 4PJ0U 2HHQA 2OM6A 4KLFA 3H40A 4LZGA 4MFFA 4DSEA 1JMSA 9ICSA 4OCZA 3H8MA 2K4HA 5CHGA 4QWDA 3OSPA 4CDGA 4J03A 4I2JA 2F1IA 4O3NA 4R8UB 1NK7A 5IIOA 2A1JA 3SAFA 4NXZA 1Q3VA 3KHRA 4RQNA 2W9CA 1SIJA 9ICEA 1ZRMA 2WF8A 2W04A 4P2HA 5D46A 1HIWA 3C1ZA 2BQ3A 3SZ2A 4QWAA 1MQ3A 1KFSA 1Y88A 1BPEA 2W8KA 3AM9A 2PFQA 4I2EA 1NJXA 5ALUA 4CF5A 4ED1A 2XCPA 3C29A 1NK5A 2JEFA 1S9FA 2H3QA 3QU4A 3PW7A 1QH9A 4ECZA 1KLNA 3NGDA 4OJPA 2KNJA 5AIBA 2V4RA 5AKGA 4J9NA 4DFPA 1IM4A 2LKYA 4DFKA 2JZBA 5KFYA 5DB6A 1XWLA 1ZQXA 4GXJA 2JXJA 1WWVA 4RNOA 3MFHA 2QB0A 4ECRA 3C5FA 3F2CA 1JI7A 5A0LA 4UB4A 3JPPA 1H38A 2HW3A 3QU2A 1SB3C 4EX7A 1IG6A 1TV9A 5KFUA 1Z1VA 5DBCA 2P6UA 2C2RA 1ZQ1C 1QQ7A 4KLTA 2IA6A 3F53A 4RQ4A 8ICSA 1ZQFA 4C80A 3BS5A 2ZXIA 2ZJ5A 5DDYA 1UHUA 4US8A 4C8KA 4OJ6A 2ZJAA 2FMPA 5DDMA 3ZD9A 1RXWA 2B6GA 2QLTA 1X9XA 2OCEA 7ICNA 2HBLA 1D9DA 2DGZA 4Y2TA 4I2BA 2KVSA 3ORYA 5KG7A 7ICIA 4DWIA 4EX6A 2AGPA 4DFJA 4EZ6A 5HMLA 3U26A 4GXIA 2KOBA 3V72A 4FE3A 4ECVA 5DQGA 4P0PB 5J0TA 2F77X 1ZQAA 3I1YA 2G09A 3QU7A 2KJ8A 5J8YC 2BCVA 1L7NA 4PHEA 4DQRA 3WK5A 4NLNA 2DKZA 2YMQA 3K75D 5HR6A 2EZYA 2PFPA 1VLBA 4ED6A 1JALA 2BHNA 2WAQC 4DOAA 4C8OA 4K4GA 3PMNA 5DKWA 2BZFA 4EBCA 2QB1A 3QEAZ 4AYBF 1DGSA 1ZQGA 2Y9UA 2RDJA 3E58A 1U45A 3QEBZ 1RQLA 2LYBA 4XUSA 4DL5A 7ICQA 3EUB2 2KV2A 4M9NA 2W43A 5KL8B 5KFKA 1NZBA 4OJLA 4PL2A 4ED0A 1SV0C 4UARA 4Z6FA 4BX9C 2W9CB 3GFKB 2RLTA 5KFNA 2E1FA 2ZIXA 2KVCA 3UMCA 4TQRA 1V97A 4UAWA 3AU6A 2F44A 4DQPA 2PI4A 4BWJA 4IS7A 4YXJA 2UVUA 9ICUA 2ZIWA 4M9JA 1F44A 1D9FA 4CGZA 2K4PA 4YVZA 5J2AA 2ZTEA 3OTQA 5J0XA 5IIMA 8ICAA 1JIHA 1ZQZA 5CWRA 1LVHA 1PUZA 3TADA 2K60A 5KFVA 2H3IA 2JR5A 4PHAA 5KAFU 4PL1A 5AKJA 1L8LA 1HJPA 4GIBA 5KFPA 4M9HA 4KLDA 4QWBA 5KFOA 4IL6U 2K4EA 4NLGA 5EWFA 5L1KA 1TK5A 3RJHA 4UB1A 2F1HA 2QB0B 5ALNA 4TQSA 2ZTDA 5KG3A 2VKQA 1N63A 2R8IA 3KBBA 2PFOA 2F8LA 2AQ4A 1NJZA 1BNPA 3BS5B 2R8JA 8ICRA 5J2IA 1L3SA 2KKPA 3NTUA 2FLLA 5KFTA 2BQUA 1KFDA 5DB9A 5CB1A 3B9JA 3DEEA 2G08A 2E8OA 5KG1A 4YG2A 4YMOA 5KFEA 8ICVA 3JPQA 4KLQA 1Z1BA 4ELVA 4DOCA 5ALTA 2W9BB 4IQTA 5AHXA 3Q8MA 3QYPA 4YMMA 2IOFA 2G5HB 5KFSA 3ZD8A 3R9KA 4DCCA 5GTHU 5ALJA 4NLKA 2H3FA 1XSLA 4F50A 1X6IA 4QWEA 2BGWA 1ZRNA 4QIWC 3M8SA 4I2AA 4B9VA 4DS4A 4PH5A 1X66A 1ZQSA 4OJOA 5KFHA 5F9LA 4KITB 3UXPA 2FPKA 2G0AA 1XU4A 2FPLA 2AH5A 2CN1A 5EOZA 9ICPA 2DF4B 2KFZA 5KFMA 2MA1A 3OJUA 3BZKA 4M47A 4NL9C 4J9PA 3KFUF 8ICUA 4R63A 3RR8A 3SV3A 3RBEA 3TQ1A 4WJ3B 2N1RA 3B0XA 3L4PA 4YCXA 4O5CA 5TISU 2I9GA 4QZIA 1XS9D 2ZIVA 4F4XA 3BQ0A 4ZOHC 4CRXA 3WK7A 1S0NA 1WG8A 2LM1A 3RH5A 1NK4A 4UATA 1RM6C 3QX7A 3NVWA 3T5KA 2PXIA 2JGAA 3IDWA 4YD1A 4I29A 5G5HA 4Y2SA 3ZDAA 2Q4TA 1MC8A 3KZIU 3PR4A 4Z6CA 4DL7A 3LYSA 3OPXA 4P4OA 4R8UA 8ICXA 2HI0A 1LKYB 4NY8A 2PI5A 3NS1A 5D4BA 3BQTA 3HKZF 2LPEA 5AKYA 2YQEA 4QZEA 1Q8KA 1D8LA 3KHHA 4DL2A 4UW9A 4Y2JA 4C4RA 3PR5B 5J0OA 1CUKA 9ICTA 4PGQA 7ICPA 2GO7A 3N28A 3PW4A 3NASA 1S10A 3T5LA 5AK4A 2HSZA 3RH4A 4TUQA 5AI5A 1SV4A 8ICMA 1A77A 2H3VA 4BJQA 3K4GA 1BPYA 4UB6U 5KT7A 3QU9A 5KFCA 3D6JA 4RZRA 2R18A 4HYKA 5TZVA 4ACOA 3O0FA 4ED8A 1NNLA 1C7YA 5AM0A 2K8BB 1L6NA 3NRZA 4FBUA 1SL2A 1SZHA 4RUAA 3NVYA 1PVPA 8ICLA 3ISCA 3UXOA 1YZ6A 3Q8KA 3RAQA 2DWQA 2XY7A 2EAMA 5AKHA 8ICIA 3RJEA 3WKEA 4I2IA 3GIJA 2QARB 4YN4A 3IN5A 9ICBA 4UAVA 4Y2UA 3IHQB 3AQFA 3GIKA 3D2QA 1ZQIA 3SQIA 2IMWP 3PW5A 4RUCA 2ODGA 3RAXA 4AP9A 1NKCA 2ZUDA 1COKA 4Q45A 2AHOB 2HBKA 2GLEA 4ECUA 5L9XA 4C8MA 1RDFA 1JXLA 1ZQDA 4MHVA 2KHQA 4KLIA 3GU3A 1FFUA 3F2BA 4UB5A 4Y2YA 8ICEA 4F92B 5J2EA 5D49A 3ISDA 2RHFA 5F9NA 1BGXT 3VC8A 1L5UA 3QXGA 4JWNA 4F2RA 4P0PA 1Z4OA 5KFRA 3ZDBA 8ICJA 1TE2A 3ZDEA 4BDPA 2BCUA 1KN5A 3ZI4A 4F4YA 3CRXA 2J6UA 2B0CA 5AKZA 2JRZA 2CRXA 4I27A 4KX5A 3AL0B 5KFBA 4KLUA 3ED5A 4KLLA 2ZIVB 2G5IB 4GXKA 4RQMA 3RFAA 2KZZA 4RQ5A 9ICRA 2PMZC 1ZQNA 3OJSA 2D8CA 3M7DA 2DPJA 2HOIA 4KX3A 1UPHA 3ALRA 9ICQA 2VANA 3FAHA 3H4BA 5AKKA 4BUGA 1S8OA 1K1SA 2BKEA 5AM5A 3HILA 4J9OA 1NK9A 2ES6A 1A76A 3SD7A 1X42A 3IV6A 2F2AB 1XNSA 1NOMA 4E0DA 7ICTA 4US9A 4RQ1A 2ZJ8A 2OHFA 1SXEA 9ICLA 4ELUA 2HVIA 2M0NA 3FM9A 4DSLA 1J2NA 2OEHA 4KLHA 2XGPA 2DQNB 1KKXA 5EWEA 2YMPA 2GWSA 1N61A 2KZ3A 3K1RB 3HW8A 2JEJA 5KG2A 4GLXA 4Y2XA 4I2HA 3ETLA 3MGHA 4F8RA 4O3PA 5B5EU 1X2IA 2ISOA 4BWMA 2JH1A 4YMNA 4YXMA 4QZGA 4F4WA 1CRXA 1S0VA 2KFNA 4C7YA 3BQ7A 1RYSA 5T14A 3TFRA 5AKLA 3M8RA 7ICHA 2E8MA 3NRWA 1ZOLA 2AQ0A 2BPCA 4Y2PA 3GV8B 2ISPA 4KN7A 1TAUA 5CRXA 9ICMA 2HOQA 4O3SA 2RDIA 2D3DA 4B9TA 2PFNA 4NJ8A 3PW0A 1U47A 1LB2B 3RB6A 5G5GA 1Z19A 1OW5A 3T5JA 2ATLA 3EPIA 1T3NA 4NV0A 4Q44A 1NK0A 3NUQA 3C2LA 3ETRA 2NYVA 4HAIA 4Z6EA 1N2XA 3M6KA 2JH7A 5L1LA 2W9BA 1HUZA 4IRKA 3KOOA 2XVTA 4KMUA 1DK2A 2K8AA 4RPZA 4JV0A 3UPQA 1LV5A 4KLJA 3H4DA 4QW8A 3WU2U 1ZQYA 4M9GA 4YR3A 2ASDA 3FYHA 1XSNA 4XRHA 4DL6A 3JPSA 1VJ5A 3C2MA 2NRWA 3RB3A 4PZNA 1L8OA 3M9MB 1ZD2P 2UVVA 4LJXA 5J2FA 3IP4B 3UM9A 3RH6A 9ICWA 2WB1F 1RQNA 5AM4A 5L1IA 1S5LU 4DLGA 5IIIA 5B66U 2D6FC 5ALHA 4QZ9A 5F3XB 2E1EA 1L7MA 3EW9A 2KG5A 1NKBA 5E79U 2UVWA 3V6HA 4FS2A 2O6KA 1KDHA 3ISBA 5DG7A 1X9MA 4QIWF 3ONNA 1FFVA 3BJYA 1N62A 4CF4A 3B0YA 3H8SA 3AUOA 5ALDA 5BPCA 4F2SA 4B9NA 4B9SA 4RQ2A 2KIVA 5KFQA 3PV8A 4DO9A 3KD3A 2W3RA 7ICFA 1UA1A 4ED7A 3OGUA 3SR6A 2K89A 4DSFA 1LKYA 1BPXA 3BDPA 3H7IA 1O03A 4KMOB 4QZAA 2KE7A 1PK3A 2P35A 4P4PA 3PO4A 1L3VA 4C7ZA 2EAPA 2G07A 1L3TA 3IM1A 1SWWA 1RYUA 2ESEA 4ECQA 4DL4A 3PX4A 3QUQA 3TANA 3FC4A 4FFDA 2H3ZA 3SMVA 1MA7A 2FE9A 3AQEA 3LWMA 1WCNA 4IR1A 4KLSA 1S76D 1SL1A 3Q8PB 4Y2RA 5J2BA 5KFFA 5CEHA 2OXOA 5J2DA 3RB4A 3OSNA 4ECTA 2JMGA 3BQ1A 2KICA 4O0IA 3SAHA 5DLGA 4YD2A 4M2YA 2BDUA 4DQIA 3H0LB 5AKXA 2FJ6A 2WF5A 4ED3A 2W9AA 1N56A 5IIKA 2KZMA 2A19A 2WF9A 1NK6A 3QU5A 3AN1A 3CW2C 2RQ5A 3CNHA 4CF3A 3RRHA 4I2FA 2VJ5A 3TARA 1SKWA 1BVSA 4KLOA 1WCLA 2KN7A 3KZXA 5ALZA 2J6TA 1XC9A 2QARA 3M6ZA 4QZ8A 3WK6A 2HOFA 2DUYA 5AM2A 5J29A 5ALLA 3HJEA 4CE6A 1T8EA 3QZ7A 4EENA 1XSPA 2LHTA 2FMSA 4O3QA 1ZD3A 2Y0SF 1N5XA 3TADC 4C4SA 4DLEA 4PHPA 1XO1A 2KKVA 5KG4A 3M9NB 4M6WB 1BPZA 4GC7A 1UT8A 4R66A 3HT3A 3JPNA 4QZHA 4BXOB 2VA2A 3CYMA 3T3FA 4IQWA 4MF2A 8ICKA 2IOFK 1HUOA 5KAIU 5ALYA 1ZD5A 4EYIB 3TKAA 1CI4A 5JUMA 2R8GA 2YX8A 1N5WA 4EELA 5IIJA 2BQRA 3TFSA 4CCHA 4UAUA 4DFDA 1A0PA 1JN3A 4KLEA 5KFJA 3MBYA 3BQ2A 1SXDA 1TAMA 2CXYA 4UB2A 2ZUCA 5AM3A 4NM1A 4PGYA 8ICYA 1IXRA 4JV2A 3HPOA 3EYZA 3N4MB 1QTMA 1U9LA 2F1JA 3PSPA 4JV1A 1EXNA 3AMZA 5AM1A 3M9OB 1QLNA 1J2MA 2DKXA 2E5SA 5KG6A 5J2HA 5AIAA 4F91B 2LI6A 4Y2QA 2EZXA 4C8NA 1Q3UA 5AI0A 1OUQA 4JUZA 1UT5A 5AI8A 2I1QA 4OJ5A 4LZDA 2AGOA 4I2CA 4KN4A 4ELTA 9ICAA 3SV4A 4NM2A 2LMRA 2W7PA 4DSKA 2RP5A 2IBKA 2HBJA 2W11A 4F71A 1K1QA 2ZXHA 8ICZA 2PKEA 3JPOA 3D2NA 1F5SA 3QE9Y 2NRXA 4F4ZA 7ICVA 2NRZA 3RJJA 4K4IA 2E3TA 4ZH4A 1ZQCA 1MQ2A 2WFAA 1KQQA 3PSTA 2MAXA 1ZQLA 3QZ8A 3SI8A 5IINA 3MGIA 1CEZA 4C8LA 3G6YA 3KKAA 5KT5A 3LK9A 1NJWA 3MFIA 9ICHA 1ZQMA 8ICGA 1ZQUA 4F5RA 4ECWA 2YB4A 1S77D 5J0SA 2ZIUB 1ZQQA 2MUTA 1PK1B 1KRPA 2YMLA 5DG9A 9ICVA 3GILA 2ZTCA 1XO0A 5HNKA 1U4BA 4YR2A 1KW4A 4RQ3A 2BDPA 4F72A 5AI6A 3PO5A 9ICNA 3N7PD 2NRVA 4FBTA 7ICSA 3D2SA 2AJQA 4J9SA 3ZDCA 1ZJMA 3H8WA 4DSIA 4QNLA 1V38A 4O3OA 4UBCA 4KLGA 4TUSA 5KFAA 5DGBA 4U6PA 2W7OA 2KHVA 2HHUA 9ICJA 5DBBA 2K4IA 2NO5A 2F3NA 1QSSA 2KSOB 8ICOA 1K5OA 2H5XA 5JTIA 1DOQA 4J9MA 5ALWA 4ECYA 2VA8A 1M6YA 2HVHA 2W54A 5ALXA 4I2DA 1COOA 1TK8A 2FDRA 3QUBA 4IQUA 1O08A 3H0RB 1FIQA 1ECWA 5J2JA 3GQCA 2F76X 1J97A 3HKZC 3QUTA 3G6VA 2HDOA 5ALPA 4PHDA 2ASJA 2EZZA 4YFKA 3SENA 1UA0A 3DDHA 1N48A 4DF4A 5DQHA 1ZQPA 2IOHA 4F93B 5AKEA 1KTQA 5KFLA 3RJGA 2EH9A 2Z7JA 2WAQF 1AQ6A 1FEZA 2JV3A 4KLMA 3K1ZA 4O3MA 4UQGA 4FZMA 2FLNA 1ED1A 5J0PA 3JPRA 4NLBA 4M9LA 5ALQA 5J0RA 4QW9A 5J2KA 1RXVA 2WF7A 2C28A 9ICCA 1TAQA 4P0QA 1BPBA 2EAOA 1JXEA 5ALEA 7ICLA 4DQQA 2Y1JA 5KT4A 2W9MA 4RQ7A 2I5HA 2FLPA 4ED2A 3V7KA 2IHMA 4K4HA 3AU2A 5K4LA 3C2KA 1ZQHA 4F5NA 4Q8EA 3TI0A 5KG5A 1V85A 3C21A 4EYHB 2KJ5A 4I2GA 3JPTA 2AU0A 1HEKA 1NI3A 3PY8A 3PVXA 5J8YA 3WK8A 2BPFA 7ICJA 2MUTB 3GV5B 2C2DA 5HHIA 5KTQA 3OHAA 2UVRA 3I76A 2HHWA 3T5HA 2YB1A 1ZQBA 4NLCA 4UASA 5CR0A 3V6JA 1VDVA 4A8EA 3KTQA 2V4QA 2JHDA 3A0BU 4QZFA 8ICHA 3S6JA 2W55A 1WWUA 1ZYQA 4F3OA 4RQ0A 1Z3EB 1C20A 2ALZA 9ICGA 4QWCA 3C5GA 2EQYA 2RRDA 5DB8A 2ZG6A 2Y9TA 4MFCA 5EWGA 8ICNA 5L1MA 4JK1A 2A1AA 5KT3A 4Z6DA 2XC9A 4B9LA 1SGGA 2MU2A 3F5EA 5FP0A 4RPXA 3Q8RB 4DSJA 1B43A 1SV0A 4PZOA 5HR7A 4RQ8A 3PMLA 3MGVA 4J9LA 3E0FA 4M6WA 4FZLA 3UMBA 3PZPA 4DEZA 1NZPA 2HCFA 1SWVA 4UBBA 1ZQJA 1QSYA 4Q43A 5EE9A 2KD1A 4O5EA 4BXOA 1YT3A 3KHGA 2C22A 2K8CB 4PPXA 4RT2A 4FS1A 3VCBA 3GDXA 1B0XA 2W3SA 3V7JA 2NV3A 3GIIA 2GH1A 3WKBA 1JROA 5KFGA 1T94A 3NVVA 5KFXA 2B21A 3LVVA 3MR3A 8ICBA 3MDAA 2HHXA 3MR6A 3TAPA 3C28A 1ZQRA 4RQ6A 3GZFA 3H8JA 2DBYA 2MRLA 1MN8A 1QQ5A 1RYRA 2Q0ZX 2KIWA 1ZQTA 2Y1IA 5KFZA 3MDCA 5AK3A 3C23A 4J9RA 2A1JB 2YN4A 4JMUA 2KK0A 3PSIA 1N60A 3HWTA 3H0MB 3UQ0A 2NO4A 2WHEA 4TURA 4OD0A 3V7LA 2W03A 3RJFA 2DFLA 4YP3A 1RZTA 4QJFB 3ICXA 2XIDA 2DPIA 5CP2A 1A6SA 4J9QA 2KTQA 4P0QB 7ICOA 4QZBA 3GV7B 3A0HU 5IILA 5AI9A 5ALGA 3I28A 4RNNA 5EE0A 4M0AA 5L1JA 1QCKA 4C4TA 4JWMA 2XY6A 4B9UA 5EE1A 2C2EA 2BR0A 2F8KA 7ICUA 5ALIA 2CPRA 2YY6A 4O9MA 8ICTA 4DFMA 2AXTU 3MR5A 3TACB 5ALRA 1V9PA 7ICKA 2V9WA 4ICAA 1S0OA 1KSPA 1TFRA 5C0YA 2YMMA 2FMQA 4O3RA 1T3QA 1BPDA 5ALVA 1SZPA 4MFAA 3BS7A 2JZBB 3Q8SB 3RR7A 1X9SA 1ZJNA 5C5JA 4F5QA 3L3FX 3OHBA 1PVQA 8ICQA 5ALOA 5J2GA 4EEYA 1NK8A 2XGQA 2ASLA 4UAZA 2ZIUA 9ICOA 1U48A 8ICWA 2BCRA 9ICIA 1PK1A 4ECXA 4P4MA 7ICMA 4NL9A 3PNCA 1QSLA 3SYZA 1DK3A 4IRDA 3THVA 3WK9A 3AEVA 4EZ9A 1L7OA 2KEYA 2WB1C 4RU9A 3GIMA 1Z00A 3Q8LA 5J2CA 2FPMA 3UMGA 1KL9A 4AYBC 1YZ7A 4QZDA 2E8PA 3WK4A 3PX0A 1JUDA 2A3VA 2R8KA 3RJKA 5JU5A 3RJIA 4MEYA 4O5KA 4C0ZA 2GOLA 2JEIA 2HMXA 3CP8A 5HMMA 1ZQWA 3M1YA 1D8BA 4IR9A 4EEKA 2XI9A 3EPGA 3WKCA 4FZNA 2OH2A 3RBDA 5ALFA 1Q46A 4OO1J 2KSOA 1DGJA 3RB0A 3N7RC 1MSWD 3IG5A 7ICRA 3UQ2A 2HHSA 2NRTA 2WF6A 4TUPA 4YQWA 3EWAA 1UQVA 1DXSA 4IQVA 1F0MA 4RNMA 1ZQVA 3RTVA 5CJ7A 4MEXA 5GTIU 1T4GA 2EDUA 3QNMA 2VIXA 2AGQA 1UCVA 1WYGA 3LWLA 9ICXA 5J0WA 2XY5A 3RRGA 4RT3A 2JEGA 2OYYA 4G9BA 3PX6A 1PVRA 2L5YA 5BOLA 2R8HA 1WUDA 1JX4A 5BOMA 5DG8A 2ZUBA 4I28A 2HBMA 4F4KA 2VA3A 2E8NA 4DL3A 4NWIA 4DF8A 1TKDA 2BCQA 1L7PA 2ZIXB 2KP7A 1PZNA 1ZQKA 3MC1A 5KFDA 3F2DA 2I6XA 3MABA 5KNIA 5DB7A 3L5KA 3C1YA 4G3IA 3MR2A 4LVSA 2IHNA 9ICFA 5H2FU 4YR0A 1KEJA 4KTQA 3IRUA 1IIPA 2PMZF 3KHLA 3LVWA 3N7SC 1SKSA 1SKRA 2ZIWB 3J81j 2WTFA 2QKQA 3HP6A 1D8YA 3V6KA 5J0UA 5KG0A 2XO7A 2OWOA 4B9MA 1BNOA 1L3UA 2LBOA 4EBEA 5HHHA 1QQ6A 1RG6A 3QUCA 4J9KA 5CA7A 3EZ5A 1ZETA 4BGDA 1X40A 3PSFA 1JRPA 1URJA 1U49A 5HP4A 5AKIA 1NJYA 2EANA 3TAQA 3N97B 2P6RA 1ZXIA
chains in the Genus database with same CATH topology
2KSOA 2F8KA 1SV0A 4PZOA 1B4FA 1KW4A 2KG5A 1Z1VA 3TACB 2YTUA 2DKXA 1UQVA 1DXSA 1F0MA 3BS5A 3BQ7A 2F44A 3H8MA 4IS7A 2QARA 1SV4A 1UCVA 3SEIA 2E8MA 2B6GA 1X9XA 2EAOA 1X66A 3BS7A 1V38A 2L5YA 1B0XA 2K4PA 2D3DA 4RQNA 2KIVA 2LMRA 4RQMA 4NJ8A 1OXJA 2E8NA 3TADC 2F3NA 2D8CA 1OW5A 2KSOB 3TADA 2K60A 1V85A 5JTIA 1LKYA 1PK1A 4NL9C 4NL9A 5J8YC 5KNIA 2KE7A 5J8YA 1PK3A 2DKZA 2EAMA 2EAPA 2QB0B 3HILA 2ES6A 2QARB 2ESEA 2DL0A 2FE9A 2QB1A 3KKAC 2E8PA 2QKQA 3KKAA 3SENA 1SXEA 1COKA 2KMDA 2Y9UA 3IDWA 5JU5A 2GLEA 4PZNA 1WWUA 3BS5B 1RG6A 4MHVA 1WWVA 1LKYB 1PK1B 5JRTA 1X40A 1SXDA 2E8OA 2QB0A 2Y9TA 2JV3A 2LPEA 5L1MA 1JI7A 2EANA 1SGGA 3K1RB 5F3XB 1SV0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSO A;  2F8K A;  1SV0 A;  4PZO A;  1B4F A;  1KW4 A;  2KG5 A;  1Z1V A;  3TAC B;  2YTU A;  2DKX A;  1UQV A;  1DXS A;  1F0M A;  3BS5 A;  3BQ7 A;  2F44 A;  3H8M A;  4IS7 A;  2QAR A;  1SV4 A;  1UCV A;  3SEI A;  2E8M A;  2B6G A;  1X9X A;  2EAO A;  1X66 A;  3BS7 A;  1V38 A;  2L5Y A;  1B0X A;  2K4P A;  2D3D A;  4RQN A;  2KIV A;  2LMR A;  4RQM A;  4NJ8 A;  1OXJ A;  2E8N A;  3TAD C;  2F3N A;  2D8C A;  1OW5 A;  2KSO B;  3TAD A;  2K60 A;  1V85 A;  5JTI A;  1LKY A;  1PK1 A;  4NL9 C;  4NL9 A;  5J8Y C;  5KNI A;  2KE7 A;  5J8Y A;  1PK3 A;  2DKZ A;  2EAM A;  2EAP A;  2QB0 B;  3HIL A;  2ES6 A;  2QAR B;  2ESE A;  2DL0 A;  2FE9 A;  2QB1 A;  3KKA C;  2E8P A;  2QKQ A;  3KKA A;  3SEN A;  1SXE A;  1COK A;  2KMD A;  2Y9U A;  3IDW A;  5JU5 A;  2GLE A;  4PZN A;  1WWU A;  3BS5 B;  1RG6 A;  4MHV A;  1WWV A;  1LKY B;  1PK1 B;  5JRT A;  1X40 A;  1SXD A;  2E8O A;  2QB0 A;  2Y9T A;  2JV3 A;  2LPE A;  5L1M A;  1JI7 A;  2EAN A;  1SGG A;  3K1R B;  5F3X B;  1SV0 C; 
#chains in the Genus database with same CATH topology
 5AIC A;  9ICK A;  4Y2V A;  1B4F A;  4U7C A;  4Q8F A;  8ICF A;  1IV8 A;  3G6X A;  3HX0 A;  1DRG A;  5ALM A;  4DQS A;  2Y0S C;  3ZDD A;  4JB3 A;  3HRD D;  3NVZ A;  4DOB A;  4NLZ A;  5EE3 A;  2J6S A;  5AI4 A;  2W8L A;  3SEI A;  1ZQO A;  4MF8 A;  4F5P A;  5J0Y A;  4UAY A;  2HHV A;  4USA A;  4R65 A;  1KFT A;  3SAG A;  4B6J A;  1Z00 B;  2MSN A;  5AK6 A;  4X5V A;  3LDA A;  3Q8Q B;  4F5O A;  3UXN A;  1OXJ A;  4ECS A;  1ZD4 A;  3DV9 A;  4DS5 A;  2G06 A;  4R64 A;  4M04 A;  4QZC A;  1ZQE A;  5KFW A;  4IRC A;  4PGX A;  4XA5 A;  5ALK A;  4IC9 A;  2KJ9 A;  7ICG A;  1S0M A;  4EBD A;  1GO3 F;  4RPY A;  1X9W A;  4GFJ A;  1ARO P;  2BCS A;  3RF9 A;  2VJ4 A;  1T7P A;  2HHT A;  4CNQ A;  5DBA A;  3WKA A;  2P66 A;  5AK5 A;  2DL0 A;  7ICE A;  5KT6 A;  1Z4N A;  5ALS A;  3F5A A;  3KKA C;  3BZC A;  1TK0 A;  5KL1 B;  3IG8 A;  4FO6 A;  3PW2 A;  2LYH A;  3T79 A;  2BPG A;  2KMD A;  5DGA A;  1P7D A;  5KFI A;  3FDS A;  2M9N A;  3E2E A;  2LM4 A;  4GC6 A;  4UB8 U;  1SL0 A;  8ICP A;  5JRT A;  4XQ8 A;  1KBU A;  1FO4 A;  1NKE A;  1S97 A;  5J0Q A;  2XIC A;  1RPL A;  1TVA A;  2FI1 A;  4UB3 A;  8ICC A;  1B22 A;  5DQI A;  3WKD A;  5KT2 A;  2XCA A;  2LYA A;  5DLF A;  2YTU A;  1X6J A;  4PJ0 U;  2HHQ A;  2OM6 A;  4KLF A;  3H40 A;  4LZG A;  4MFF A;  4DSE A;  1JMS A;  9ICS A;  4OCZ A;  3H8M A;  2K4H A;  5CHG A;  4QWD A;  3OSP A;  4CDG A;  4J03 A;  4I2J A;  2F1I A;  4O3N A;  4R8U B;  1NK7 A;  5IIO A;  2A1J A;  3SAF A;  4NXZ A;  1Q3V A;  3KHR A;  4RQN A;  2W9C A;  1SIJ A;  9ICE A;  1ZRM A;  2WF8 A;  2W04 A;  4P2H A;  5D46 A;  1HIW A;  3C1Z A;  2BQ3 A;  3SZ2 A;  4QWA A;  1MQ3 A;  1KFS A;  1Y88 A;  1BPE A;  2W8K A;  3AM9 A;  2PFQ A;  4I2E A;  1NJX A;  5ALU A;  4CF5 A;  4ED1 A;  2XCP A;  3C29 A;  1NK5 A;  2JEF A;  1S9F A;  2H3Q A;  3QU4 A;  3PW7 A;  1QH9 A;  4ECZ A;  1KLN A;  3NGD A;  4OJP A;  2KNJ A;  5AIB A;  2V4R A;  5AKG A;  4J9N A;  4DFP A;  1IM4 A;  2LKY A;  4DFK A;  2JZB A;  5KFY A;  5DB6 A;  1XWL A;  1ZQX A;  4GXJ A;  2JXJ A;  1WWV A;  4RNO A;  3MFH A;  2QB0 A;  4ECR A;  3C5F A;  3F2C A;  1JI7 A;  5A0L A;  4UB4 A;  3JPP A;  1H38 A;  2HW3 A;  3QU2 A;  1SB3 C;  4EX7 A;  1IG6 A;  1TV9 A;  5KFU A;  1Z1V A;  5DBC A;  2P6U A;  2C2R A;  1ZQ1 C;  1QQ7 A;  4KLT A;  2IA6 A;  3F53 A;  4RQ4 A;  8ICS A;  1ZQF A;  4C80 A;  3BS5 A;  2ZXI A;  2ZJ5 A;  5DDY A;  1UHU A;  4US8 A;  4C8K A;  4OJ6 A;  2ZJA A;  2FMP A;  5DDM A;  3ZD9 A;  1RXW A;  2B6G A;  2QLT A;  1X9X A;  2OCE A;  7ICN A;  2HBL A;  1D9D A;  2DGZ A;  4Y2T A;  4I2B A;  2KVS A;  3ORY A;  5KG7 A;  7ICI A;  4DWI A;  4EX6 A;  2AGP A;  4DFJ A;  4EZ6 A;  5HML A;  3U26 A;  4GXI A;  2KOB A;  3V72 A;  4FE3 A;  4ECV A;  5DQG A;  4P0P B;  5J0T A;  2F77 X;  1ZQA A;  3I1Y A;  2G09 A;  3QU7 A;  2KJ8 A;  5J8Y C;  2BCV A;  1L7N A;  4PHE A;  4DQR A;  3WK5 A;  4NLN A;  2DKZ A;  2YMQ A;  3K75 D;  5HR6 A;  2EZY A;  2PFP A;  1VLB A;  4ED6 A;  1JAL A;  2BHN A;  2WAQ C;  4DOA A;  4C8O A;  4K4G A;  3PMN A;  5DKW A;  2BZF A;  4EBC A;  2QB1 A;  3QEA Z;  4AYB F;  1DGS A;  1ZQG A;  2Y9U A;  2RDJ A;  3E58 A;  1U45 A;  3QEB Z;  1RQL A;  2LYB A;  4XUS A;  4DL5 A;  7ICQ A;  3EUB 2;  2KV2 A;  4M9N A;  2W43 A;  5KL8 B;  5KFK A;  1NZB A;  4OJL A;  4PL2 A;  4ED0 A;  1SV0 C;  4UAR A;  4Z6F A;  4BX9 C;  2W9C B;  3GFK B;  2RLT A;  5KFN A;  2E1F A;  2ZIX A;  2KVC A;  3UMC A;  4TQR A;  1V97 A;  4UAW A;  3AU6 A;  2F44 A;  4DQP A;  2PI4 A;  4BWJ A;  4IS7 A;  4YXJ A;  2UVU A;  9ICU A;  2ZIW A;  4M9J A;  1F44 A;  1D9F A;  4CGZ A;  2K4P A;  4YVZ A;  5J2A A;  2ZTE A;  3OTQ A;  5J0X A;  5IIM A;  8ICA A;  1JIH A;  1ZQZ A;  5CWR A;  1LVH A;  1PUZ A;  3TAD A;  2K60 A;  5KFV A;  2H3I A;  2JR5 A;  4PHA A;  5KAF U;  4PL1 A;  5AKJ A;  1L8L A;  1HJP A;  4GIB A;  5KFP A;  4M9H A;  4KLD A;  4QWB A;  5KFO A;  4IL6 U;  2K4E A;  4NLG A;  5EWF A;  5L1K A;  1TK5 A;  3RJH A;  4UB1 A;  2F1H A;  2QB0 B;  5ALN A;  4TQS A;  2ZTD A;  5KG3 A;  2VKQ A;  1N63 A;  2R8I A;  3KBB A;  2PFO A;  2F8L A;  2AQ4 A;  1NJZ A;  1BNP A;  3BS5 B;  2R8J A;  8ICR A;  5J2I A;  1L3S A;  2KKP A;  3NTU A;  2FLL A;  5KFT A;  2BQU A;  1KFD A;  5DB9 A;  5CB1 A;  3B9J A;  3DEE A;  2G08 A;  2E8O A;  5KG1 A;  4YG2 A;  4YMO A;  5KFE A;  8ICV A;  3JPQ A;  4KLQ A;  1Z1B A;  4ELV A;  4DOC A;  5ALT A;  2W9B B;  4IQT A;  5AHX A;  3Q8M A;  3QYP A;  4YMM A;  2IOF A;  2G5H B;  5KFS A;  3ZD8 A;  3R9K A;  4DCC A;  5GTH U;  5ALJ A;  4NLK A;  2H3F A;  1XSL A;  4F50 A;  1X6I A;  4QWE A;  2BGW A;  1ZRN A;  4QIW C;  3M8S A;  4I2A A;  4B9V A;  4DS4 A;  4PH5 A;  1X66 A;  1ZQS A;  4OJO A;  5KFH A;  5F9L A;  4KIT B;  3UXP A;  2FPK A;  2G0A A;  1XU4 A;  2FPL A;  2AH5 A;  2CN1 A;  5EOZ A;  9ICP A;  2DF4 B;  2KFZ A;  5KFM A;  2MA1 A;  3OJU A;  3BZK A;  4M47 A;  4NL9 C;  4J9P A;  3KFU F;  8ICU A;  4R63 A;  3RR8 A;  3SV3 A;  3RBE A;  3TQ1 A;  4WJ3 B;  2N1R A;  3B0X A;  3L4P A;  4YCX A;  4O5C A;  5TIS U;  2I9G A;  4QZI A;  1XS9 D;  2ZIV A;  4F4X A;  3BQ0 A;  4ZOH C;  4CRX A;  3WK7 A;  1S0N A;  1WG8 A;  2LM1 A;  3RH5 A;  1NK4 A;  4UAT A;  1RM6 C;  3QX7 A;  3NVW A;  3T5K A;  2PXI A;  2JGA A;  3IDW A;  4YD1 A;  4I29 A;  5G5H A;  4Y2S A;  3ZDA A;  2Q4T A;  1MC8 A;  3KZI U;  3PR4 A;  4Z6C A;  4DL7 A;  3LYS A;  3OPX A;  4P4O A;  4R8U A;  8ICX A;  2HI0 A;  1LKY B;  4NY8 A;  2PI5 A;  3NS1 A;  5D4B A;  3BQT A;  3HKZ F;  2LPE A;  5AKY A;  2YQE A;  4QZE A;  1Q8K A;  1D8L A;  3KHH A;  4DL2 A;  4UW9 A;  4Y2J A;  4C4R A;  3PR5 B;  5J0O A;  1CUK A;  9ICT A;  4PGQ A;  7ICP A;  2GO7 A;  3N28 A;  3PW4 A;  3NAS A;  1S10 A;  3T5L A;  5AK4 A;  2HSZ A;  3RH4 A;  4TUQ A;  5AI5 A;  1SV4 A;  8ICM A;  1A77 A;  2H3V A;  4BJQ A;  3K4G A;  1BPY A;  4UB6 U;  5KT7 A;  3QU9 A;  5KFC A;  3D6J A;  4RZR A;  2R18 A;  4HYK A;  5TZV A;  4ACO A;  3O0F A;  4ED8 A;  1NNL A;  1C7Y A;  5AM0 A;  2K8B B;  1L6N A;  3NRZ A;  4FBU A;  1SL2 A;  1SZH A;  4RUA A;  3NVY A;  1PVP A;  8ICL A;  3ISC A;  3UXO A;  1YZ6 A;  3Q8K A;  3RAQ A;  2DWQ A;  2XY7 A;  2EAM A;  5AKH A;  8ICI A;  3RJE A;  3WKE A;  4I2I A;  3GIJ A;  2QAR B;  4YN4 A;  3IN5 A;  9ICB A;  4UAV A;  4Y2U A;  3IHQ B;  3AQF A;  3GIK A;  3D2Q A;  1ZQI A;  3SQI A;  2IMW P;  3PW5 A;  4RUC A;  2ODG A;  3RAX A;  4AP9 A;  1NKC A;  2ZUD A;  1COK A;  4Q45 A;  2AHO B;  2HBK A;  2GLE A;  4ECU A;  5L9X A;  4C8M A;  1RDF A;  1JXL A;  1ZQD A;  4MHV A;  2KHQ A;  4KLI A;  3GU3 A;  1FFU A;  3F2B A;  4UB5 A;  4Y2Y A;  8ICE A;  4F92 B;  5J2E A;  5D49 A;  3ISD A;  2RHF A;  5F9N A;  1BGX T;  3VC8 A;  1L5U A;  3QXG A;  4JWN A;  4F2R A;  4P0P A;  1Z4O A;  5KFR A;  3ZDB A;  8ICJ A;  1TE2 A;  3ZDE A;  4BDP A;  2BCU A;  1KN5 A;  3ZI4 A;  4F4Y A;  3CRX A;  2J6U A;  2B0C A;  5AKZ A;  2JRZ A;  2CRX A;  4I27 A;  4KX5 A;  3AL0 B;  5KFB A;  4KLU A;  3ED5 A;  4KLL A;  2ZIV B;  2G5I B;  4GXK A;  4RQM A;  3RFA A;  2KZZ A;  4RQ5 A;  9ICR A;  2PMZ C;  1ZQN A;  3OJS A;  2D8C A;  3M7D A;  2DPJ A;  2HOI A;  4KX3 A;  1UPH A;  3ALR A;  9ICQ A;  2VAN A;  3FAH A;  3H4B A;  5AKK A;  4BUG A;  1S8O A;  1K1S A;  2BKE A;  5AM5 A;  3HIL A;  4J9O A;  1NK9 A;  2ES6 A;  1A76 A;  3SD7 A;  1X42 A;  3IV6 A;  2F2A B;  1XNS A;  1NOM A;  4E0D A;  7ICT A;  4US9 A;  4RQ1 A;  2ZJ8 A;  2OHF A;  1SXE A;  9ICL A;  4ELU A;  2HVI A;  2M0N A;  3FM9 A;  4DSL A;  1J2N A;  2OEH A;  4KLH A;  2XGP A;  2DQN B;  1KKX A;  5EWE A;  2YMP A;  2GWS A;  1N61 A;  2KZ3 A;  3K1R B;  3HW8 A;  2JEJ A;  5KG2 A;  4GLX A;  4Y2X A;  4I2H A;  3ETL A;  3MGH A;  4F8R A;  4O3P A;  5B5E U;  1X2I A;  2ISO A;  4BWM A;  2JH1 A;  4YMN A;  4YXM A;  4QZG A;  4F4W A;  1CRX A;  1S0V A;  2KFN A;  4C7Y A;  3BQ7 A;  1RYS A;  5T14 A;  3TFR A;  5AKL A;  3M8R A;  7ICH A;  2E8M A;  3NRW A;  1ZOL A;  2AQ0 A;  2BPC A;  4Y2P A;  3GV8 B;  2ISP A;  4KN7 A;  1TAU A;  5CRX A;  9ICM A;  2HOQ A;  4O3S A;  2RDI A;  2D3D A;  4B9T A;  2PFN A;  4NJ8 A;  3PW0 A;  1U47 A;  1LB2 B;  3RB6 A;  5G5G A;  1Z19 A;  1OW5 A;  3T5J A;  2ATL A;  3EPI A;  1T3N A;  4NV0 A;  4Q44 A;  1NK0 A;  3NUQ A;  3C2L A;  3ETR A;  2NYV A;  4HAI A;  4Z6E A;  1N2X A;  3M6K A;  2JH7 A;  5L1L A;  2W9B A;  1HUZ A;  4IRK A;  3KOO A;  2XVT A;  4KMU A;  1DK2 A;  2K8A A;  4RPZ A;  4JV0 A;  3UPQ A;  1LV5 A;  4KLJ A;  3H4D A;  4QW8 A;  3WU2 U;  1ZQY A;  4M9G A;  4YR3 A;  2ASD A;  3FYH A;  1XSN A;  4XRH A;  4DL6 A;  3JPS A;  1VJ5 A;  3C2M A;  2NRW A;  3RB3 A;  4PZN A;  1L8O A;  3M9M B;  1ZD2 P;  2UVV A;  4LJX A;  5J2F A;  3IP4 B;  3UM9 A;  3RH6 A;  9ICW A;  2WB1 F;  1RQN A;  5AM4 A;  5L1I A;  1S5L U;  4DLG A;  5III A;  5B66 U;  2D6F C;  5ALH A;  4QZ9 A;  5F3X B;  2E1E A;  1L7M A;  3EW9 A;  2KG5 A;  1NKB A;  5E79 U;  2UVW A;  3V6H A;  4FS2 A;  2O6K A;  1KDH A;  3ISB A;  5DG7 A;  1X9M A;  4QIW F;  3ONN A;  1FFV A;  3BJY A;  1N62 A;  4CF4 A;  3B0Y A;  3H8S A;  3AUO A;  5ALD A;  5BPC A;  4F2S A;  4B9N A;  4B9S A;  4RQ2 A;  2KIV A;  5KFQ A;  3PV8 A;  4DO9 A;  3KD3 A;  2W3R A;  7ICF A;  1UA1 A;  4ED7 A;  3OGU A;  3SR6 A;  2K89 A;  4DSF A;  1LKY A;  1BPX A;  3BDP A;  3H7I A;  1O03 A;  4KMO B;  4QZA A;  2KE7 A;  1PK3 A;  2P35 A;  4P4P A;  3PO4 A;  1L3V A;  4C7Z A;  2EAP A;  2G07 A;  1L3T A;  3IM1 A;  1SWW A;  1RYU A;  2ESE A;  4ECQ A;  4DL4 A;  3PX4 A;  3QUQ A;  3TAN A;  3FC4 A;  4FFD A;  2H3Z A;  3SMV A;  1MA7 A;  2FE9 A;  3AQE A;  3LWM A;  1WCN A;  4IR1 A;  4KLS A;  1S76 D;  1SL1 A;  3Q8P B;  4Y2R A;  5J2B A;  5KFF A;  5CEH A;  2OXO A;  5J2D A;  3RB4 A;  3OSN A;  4ECT A;  2JMG A;  3BQ1 A;  2KIC A;  4O0I A;  3SAH A;  5DLG A;  4YD2 A;  4M2Y A;  2BDU A;  4DQI A;  3H0L B;  5AKX A;  2FJ6 A;  2WF5 A;  4ED3 A;  2W9A A;  1N56 A;  5IIK A;  2KZM A;  2A19 A;  2WF9 A;  1NK6 A;  3QU5 A;  3AN1 A;  3CW2 C;  2RQ5 A;  3CNH A;  4CF3 A;  3RRH A;  4I2F A;  2VJ5 A;  3TAR A;  1SKW A;  1BVS A;  4KLO A;  1WCL A;  2KN7 A;  3KZX A;  5ALZ A;  2J6T A;  1XC9 A;  2QAR A;  3M6Z A;  4QZ8 A;  3WK6 A;  2HOF A;  2DUY A;  5AM2 A;  5J29 A;  5ALL A;  3HJE A;  4CE6 A;  1T8E A;  3QZ7 A;  4EEN A;  1XSP A;  2LHT A;  2FMS A;  4O3Q A;  1ZD3 A;  2Y0S F;  1N5X A;  3TAD C;  4C4S A;  4DLE A;  4PHP A;  1XO1 A;  2KKV A;  5KG4 A;  3M9N B;  4M6W B;  1BPZ A;  4GC7 A;  1UT8 A;  4R66 A;  3HT3 A;  3JPN A;  4QZH A;  4BXO B;  2VA2 A;  3CYM A;  3T3F A;  4IQW A;  4MF2 A;  8ICK A;  2IOF K;  1HUO A;  5KAI U;  5ALY A;  1ZD5 A;  4EYI B;  3TKA A;  1CI4 A;  5JUM A;  2R8G A;  2YX8 A;  1N5W A;  4EEL A;  5IIJ A;  2BQR A;  3TFS A;  4CCH A;  4UAU A;  4DFD A;  1A0P A;  1JN3 A;  4KLE A;  5KFJ A;  3MBY A;  3BQ2 A;  1SXD A;  1TAM A;  2CXY A;  4UB2 A;  2ZUC A;  5AM3 A;  4NM1 A;  4PGY A;  8ICY A;  1IXR A;  4JV2 A;  3HPO A;  3EYZ A;  3N4M B;  1QTM A;  1U9L A;  2F1J A;  3PSP A;  4JV1 A;  1EXN A;  3AMZ A;  5AM1 A;  3M9O B;  1QLN A;  1J2M A;  2DKX A;  2E5S A;  5KG6 A;  5J2H A;  5AIA A;  4F91 B;  2LI6 A;  4Y2Q A;  2EZX A;  4C8N A;  1Q3U A;  5AI0 A;  1OUQ A;  4JUZ A;  1UT5 A;  5AI8 A;  2I1Q A;  4OJ5 A;  4LZD A;  2AGO A;  4I2C A;  4KN4 A;  4ELT A;  9ICA A;  3SV4 A;  4NM2 A;  2LMR A;  2W7P A;  4DSK A;  2RP5 A;  2IBK A;  2HBJ A;  2W11 A;  4F71 A;  1K1Q A;  2ZXH A;  8ICZ A;  2PKE A;  3JPO A;  3D2N A;  1F5S A;  3QE9 Y;  2NRX A;  4F4Z A;  7ICV A;  2NRZ A;  3RJJ A;  4K4I A;  2E3T A;  4ZH4 A;  1ZQC A;  1MQ2 A;  2WFA A;  1KQQ A;  3PST A;  2MAX A;  1ZQL A;  3QZ8 A;  3SI8 A;  5IIN A;  3MGI A;  1CEZ A;  4C8L A;  3G6Y A;  3KKA A;  5KT5 A;  3LK9 A;  1NJW A;  3MFI A;  9ICH A;  1ZQM A;  8ICG A;  1ZQU A;  4F5R A;  4ECW A;  2YB4 A;  1S77 D;  5J0S A;  2ZIU B;  1ZQQ A;  2MUT A;  1PK1 B;  1KRP A;  2YML A;  5DG9 A;  9ICV A;  3GIL A;  2ZTC A;  1XO0 A;  5HNK A;  1U4B A;  4YR2 A;  1KW4 A;  4RQ3 A;  2BDP A;  4F72 A;  5AI6 A;  3PO5 A;  9ICN A;  3N7P D;  2NRV A;  4FBT A;  7ICS A;  3D2S A;  2AJQ A;  4J9S A;  3ZDC A;  1ZJM A;  3H8W A;  4DSI A;  4QNL A;  1V38 A;  4O3O A;  4UBC A;  4KLG A;  4TUS A;  5KFA A;  5DGB A;  4U6P A;  2W7O A;  2KHV A;  2HHU A;  9ICJ A;  5DBB A;  2K4I A;  2NO5 A;  2F3N A;  1QSS A;  2KSO B;  8ICO A;  1K5O A;  2H5X A;  5JTI A;  1DOQ A;  4J9M A;  5ALW A;  4ECY A;  2VA8 A;  1M6Y A;  2HVH A;  2W54 A;  5ALX A;  4I2D A;  1COO A;  1TK8 A;  2FDR A;  3QUB A;  4IQU A;  1O08 A;  3H0R B;  1FIQ A;  1ECW A;  5J2J A;  3GQC A;  2F76 X;  1J97 A;  3HKZ C;  3QUT A;  3G6V A;  2HDO A;  5ALP A;  4PHD A;  2ASJ A;  2EZZ A;  4YFK A;  3SEN A;  1UA0 A;  3DDH A;  1N48 A;  4DF4 A;  5DQH A;  1ZQP A;  2IOH A;  4F93 B;  5AKE A;  1KTQ A;  5KFL A;  3RJG A;  2EH9 A;  2Z7J A;  2WAQ F;  1AQ6 A;  1FEZ A;  2JV3 A;  4KLM A;  3K1Z A;  4O3M A;  4UQG A;  4FZM A;  2FLN A;  1ED1 A;  5J0P A;  3JPR A;  4NLB A;  4M9L A;  5ALQ A;  5J0R A;  4QW9 A;  5J2K A;  1RXV A;  2WF7 A;  2C28 A;  9ICC A;  1TAQ A;  4P0Q A;  1BPB A;  2EAO A;  1JXE A;  5ALE A;  7ICL A;  4DQQ A;  2Y1J A;  5KT4 A;  2W9M A;  4RQ7 A;  2I5H A;  2FLP A;  4ED2 A;  3V7K A;  2IHM A;  4K4H A;  3AU2 A;  5K4L A;  3C2K A;  1ZQH A;  4F5N A;  4Q8E A;  3TI0 A;  5KG5 A;  1V85 A;  3C21 A;  4EYH B;  2KJ5 A;  4I2G A;  3JPT A;  2AU0 A;  1HEK A;  1NI3 A;  3PY8 A;  3PVX A;  5J8Y A;  3WK8 A;  2BPF A;  7ICJ A;  2MUT B;  3GV5 B;  2C2D A;  5HHI A;  5KTQ A;  3OHA A;  2UVR A;  3I76 A;  2HHW A;  3T5H A;  2YB1 A;  1ZQB A;  4NLC A;  4UAS A;  5CR0 A;  3V6J A;  1VDV A;  4A8E A;  3KTQ A;  2V4Q A;  2JHD A;  3A0B U;  4QZF A;  8ICH A;  3S6J A;  2W55 A;  1WWU A;  1ZYQ A;  4F3O A;  4RQ0 A;  1Z3E B;  1C20 A;  2ALZ A;  9ICG A;  4QWC A;  3C5G A;  2EQY A;  2RRD A;  5DB8 A;  2ZG6 A;  2Y9T A;  4MFC A;  5EWG A;  8ICN A;  5L1M A;  4JK1 A;  2A1A A;  5KT3 A;  4Z6D A;  2XC9 A;  4B9L A;  1SGG A;  2MU2 A;  3F5E A;  5FP0 A;  4RPX A;  3Q8R B;  4DSJ A;  1B43 A;  1SV0 A;  4PZO A;  5HR7 A;  4RQ8 A;  3PML A;  3MGV A;  4J9L A;  3E0F A;  4M6W A;  4FZL A;  3UMB A;  3PZP A;  4DEZ A;  1NZP A;  2HCF A;  1SWV A;  4UBB A;  1ZQJ A;  1QSY A;  4Q43 A;  5EE9 A;  2KD1 A;  4O5E A;  4BXO A;  1YT3 A;  3KHG A;  2C22 A;  2K8C B;  4PPX A;  4RT2 A;  4FS1 A;  3VCB A;  3GDX A;  1B0X A;  2W3S A;  3V7J A;  2NV3 A;  3GII A;  2GH1 A;  3WKB A;  1JRO A;  5KFG A;  1T94 A;  3NVV A;  5KFX A;  2B21 A;  3LVV A;  3MR3 A;  8ICB A;  3MDA A;  2HHX A;  3MR6 A;  3TAP A;  3C28 A;  1ZQR A;  4RQ6 A;  3GZF A;  3H8J A;  2DBY A;  2MRL A;  1MN8 A;  1QQ5 A;  1RYR A;  2Q0Z X;  2KIW A;  1ZQT A;  2Y1I A;  5KFZ A;  3MDC A;  5AK3 A;  3C23 A;  4J9R A;  2A1J B;  2YN4 A;  4JMU A;  2KK0 A;  3PSI A;  1N60 A;  3HWT A;  3H0M B;  3UQ0 A;  2NO4 A;  2WHE A;  4TUR A;  4OD0 A;  3V7L A;  2W03 A;  3RJF A;  2DFL A;  4YP3 A;  1RZT A;  4QJF B;  3ICX A;  2XID A;  2DPI A;  5CP2 A;  1A6S A;  4J9Q A;  2KTQ A;  4P0Q B;  7ICO A;  4QZB A;  3GV7 B;  3A0H U;  5IIL A;  5AI9 A;  5ALG A;  3I28 A;  4RNN A;  5EE0 A;  4M0A A;  5L1J A;  1QCK A;  4C4T A;  4JWM A;  2XY6 A;  4B9U A;  5EE1 A;  2C2E A;  2BR0 A;  2F8K A;  7ICU A;  5ALI A;  2CPR A;  2YY6 A;  4O9M A;  8ICT A;  4DFM A;  2AXT U;  3MR5 A;  3TAC B;  5ALR A;  1V9P A;  7ICK A;  2V9W A;  4ICA A;  1S0O A;  1KSP A;  1TFR A;  5C0Y A;  2YMM A;  2FMQ A;  4O3R A;  1T3Q A;  1BPD A;  5ALV A;  1SZP A;  4MFA A;  3BS7 A;  2JZB B;  3Q8S B;  3RR7 A;  1X9S A;  1ZJN A;  5C5J A;  4F5Q A;  3L3F X;  3OHB A;  1PVQ A;  8ICQ A;  5ALO A;  5J2G A;  4EEY A;  1NK8 A;  2XGQ A;  2ASL A;  4UAZ A;  2ZIU A;  9ICO A;  1U48 A;  8ICW A;  2BCR A;  9ICI A;  1PK1 A;  4ECX A;  4P4M A;  7ICM A;  4NL9 A;  3PNC A;  1QSL A;  3SYZ A;  1DK3 A;  4IRD A;  3THV A;  3WK9 A;  3AEV A;  4EZ9 A;  1L7O A;  2KEY A;  2WB1 C;  4RU9 A;  3GIM A;  1Z00 A;  3Q8L A;  5J2C A;  2FPM A;  3UMG A;  1KL9 A;  4AYB C;  1YZ7 A;  4QZD A;  2E8P A;  3WK4 A;  3PX0 A;  1JUD A;  2A3V A;  2R8K A;  3RJK A;  5JU5 A;  3RJI A;  4MEY A;  4O5K A;  4C0Z A;  2GOL A;  2JEI A;  2HMX A;  3CP8 A;  5HMM A;  1ZQW A;  3M1Y A;  1D8B A;  4IR9 A;  4EEK A;  2XI9 A;  3EPG A;  3WKC A;  4FZN A;  2OH2 A;  3RBD A;  5ALF A;  1Q46 A;  4OO1 J;  2KSO A;  1DGJ A;  3RB0 A;  3N7R C;  1MSW D;  3IG5 A;  7ICR A;  3UQ2 A;  2HHS A;  2NRT A;  2WF6 A;  4TUP A;  4YQW A;  3EWA A;  1UQV A;  1DXS A;  4IQV A;  1F0M A;  4RNM A;  1ZQV A;  3RTV A;  5CJ7 A;  4MEX A;  5GTI U;  1T4G A;  2EDU A;  3QNM A;  2VIX A;  2AGQ A;  1UCV A;  1WYG A;  3LWL A;  9ICX A;  5J0W A;  2XY5 A;  3RRG A;  4RT3 A;  2JEG A;  2OYY A;  4G9B A;  3PX6 A;  1PVR A;  2L5Y A;  5BOL A;  2R8H A;  1WUD A;  1JX4 A;  5BOM A;  5DG8 A;  2ZUB A;  4I28 A;  2HBM A;  4F4K A;  2VA3 A;  2E8N A;  4DL3 A;  4NWI A;  4DF8 A;  1TKD A;  2BCQ A;  1L7P A;  2ZIX B;  2KP7 A;  1PZN A;  1ZQK A;  3MC1 A;  5KFD A;  3F2D A;  2I6X A;  3MAB A;  5KNI A;  5DB7 A;  3L5K A;  3C1Y A;  4G3I A;  3MR2 A;  4LVS A;  2IHN A;  9ICF A;  5H2F U;  4YR0 A;  1KEJ A;  4KTQ A;  3IRU A;  1IIP A;  2PMZ F;  3KHL A;  3LVW A;  3N7S C;  1SKS A;  1SKR A;  2ZIW B;  3J81 j;  2WTF A;  2QKQ A;  3HP6 A;  1D8Y A;  3V6K A;  5J0U A;  5KG0 A;  2XO7 A;  2OWO A;  4B9M A;  1BNO A;  1L3U A;  2LBO A;  4EBE A;  5HHH A;  1QQ6 A;  1RG6 A;  3QUC A;  4J9K A;  5CA7 A;  3EZ5 A;  1ZET A;  4BGD A;  1X40 A;  3PSF A;  1JRP A;  1URJ A;  1U49 A;  5HP4 A;  5AKI A;  1NJY A;  2EAN A;  3TAQ A;  3N97 B;  2P6R A;  1ZXI A; 
#chains in the Genus database with same CATH homology
 2KSO A;  2F8K A;  1SV0 A;  4PZO A;  1B4F A;  1KW4 A;  2KG5 A;  1Z1V A;  3TAC B;  2YTU A;  2DKX A;  1UQV A;  1DXS A;  1F0M A;  3BS5 A;  3BQ7 A;  2F44 A;  3H8M A;  4IS7 A;  2QAR A;  1SV4 A;  1UCV A;  3SEI A;  2E8M A;  2B6G A;  1X9X A;  2EAO A;  1X66 A;  3BS7 A;  1V38 A;  2L5Y A;  1B0X A;  2K4P A;  2D3D A;  4RQN A;  2KIV A;  2LMR A;  4RQM A;  4NJ8 A;  1OXJ A;  2E8N A;  3TAD C;  2F3N A;  2D8C A;  1OW5 A;  2KSO B;  3TAD A;  2K60 A;  1V85 A;  5JTI A;  1LKY A;  1PK1 A;  4NL9 C;  4NL9 A;  5J8Y C;  5KNI A;  2KE7 A;  5J8Y A;  1PK3 A;  2DKZ A;  2EAM A;  2EAP A;  2QB0 B;  3HIL A;  2ES6 A;  2QAR B;  2ESE A;  2DL0 A;  2FE9 A;  2QB1 A;  3KKA C;  2E8P A;  2QKQ A;  3KKA A;  3SEN A;  1SXE A;  1COK A;  2KMD A;  2Y9U A;  3IDW A;  5JU5 A;  2GLE A;  4PZN A;  1WWU A;  3BS5 B;  1RG6 A;  4MHV A;  1WWV A;  1LKY B;  1PK1 B;  5JRT A;  1X40 A;  1SXD A;  2E8O A;  2QB0 A;  2Y9T A;  2JV3 A;  2LPE A;  5L1M A;  1JI7 A;  2EAN A;  1SGG A;  3K1R B;  5F3X B;  1SV0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...