2DKZA

Solution structure of the sam_pnt-domain of the hypothetical protein loc64762
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
GSSGSSGPWQPPADLSGLSIEEVSKSLRFIGLSEDVISFFVTEKIDGNLLVQLTEEILSEDFKLSKLQVKKIMQFINGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein LOC64762
publication title Solution structure of the SAM_PNT-domain of the hypothetical protein LOC64762
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2dkzA01
1X66A 1PK1B 2EANA 2QARA 2ES6A 2Y9TA 2Y9UA 1V85A 2LPEA 3TADC 1LKYB 1UCVA 3H8MA 2KG5A 2L5YA 3TADA 1SXDA 4RQNA 2QKQA 3BQ7A 2QB1A 1SV0A 1SV4A 2KE7A 4NJ8A 2D8CA 1JI7A 1X40A 2QARB 5J8YA 1PK3A 3IDWA 1RG6A 3KKAC 1SV0C 5F3XB 1SGGA 3K1RB 3BS7A 2B6GA 1WWVA 3KKAA 1V38A 5L1MA 1B0XA 5JTIA 5J8YC 1SXEA 1OXJA 2EAOA 3SENA 2FE9A 1COKA 2F44A 2E8PA 2E8NA 2YTUA 2LMRA 5JRTA 5KNIA 3BS5A 2F8KA 2F3NA 2KSOA 2QB0A 4PZNA 2ESEA 2K60A 4NL9C 2DKZA 1PK1A 2EAPA 2K4PA 2JV3A 2EAMA 4NL9A 2E8MA 2E8OA 4MHVA 1B4FA 1DXSA 1LKYA 1X9XA 2GLEA 2KIVA 1Z1VA 2DKXA 3TACB 1F0MA 2DL0A 1UQVA 1WWUA 3BS5B 3HILA 4IS7A 2KMDA 4PZOA 1OW5A 2KSOB 2QB0B 5JU5A 3SEIA 4RQMA 1KW4A 2D3DA
chains in the Genus database with same CATH superfamily
7ICGA 1N56A 5KFWA 3M9OB 2NO5A 1ZD5A 1V85A 4M6WB 4JWMA 1UA1A 3JPTA 3EWAA 3KZIU 4O5EA 5J2GA 4BWJA 2BGWA 5J0WA 1NK8A 2K4IA 3DV9A 1ZQYA 1ZQKA 9ICLA 1KDHA 2HOIA 4Q8EA 1L8LA 5KFYA 4NLKA 3NUQA 3BZKA 1XU4A 3MBYA 1SL2A 1IM4A 4JUZA 3QUBA 3QE9Y 4M9LA 2VKQA 3BJYA 2XY5A 3SV3A 3ALRA 4QZGA 4RQ8A 4OJPA 1FFUA 1JXLA 1ZQRA 1ZJMA 4MFAA 4QW8A 3CP8A 3QU7A 4C80A 2PI5A 2F1JA 1X6IA 3WK8A 4P0PA 4DSFA 4KLJA 3QUQA 2QB0A 4MFFA 1ZRMA 1TAUA 4EZ6A 3E0FA 3RJFA 1ZETA 1FIQA 5IILA 4HAIA 1ZQPA 4F2RA 1CEZA 7ICNA 2E8OA 4ECQA 4RQ1A 4UATA 3UQ0A 2DUYA 5H2FU 1SKRA 4BUGA 8ICAA 2XCAA 3GU3A 3V72A 1C20A 5IIMA 1KW4A 1SKSA 1CI4A 4F5OA 2FPKA 2AJQA 1UPHA 2NRXA 4KITB 2IA6A 8ICKA 5KFVA 1A76A 5L1LA 5KFKA 2Y9UA 1ZQMA 2DPJA 2HVHA 2FMPA 2KZZA 1SXDA 4RQNA 3PX6A 1X9SA 1SV0A 3ZDBA 5B66U 2PXIA 2BQ3A 1XS9D 8ICEA 3TQ1A 2ODGA 2ASLA 1XNSA 4I2CA 2F77X 3JPSA 5DB8A 3RAQA 1S10A 5AIBA 8ICQA 3ISCA 5DB6A 4Z6DA 2E1EA 3PW0A 2N1RA 1RYUA 4I2GA 3SAGA 5CJ7A 4Q45A 4JV2A 4F50A 3HKZF 4GIBA 4O9MA 2MUTB 1QSSA 4OD0A 3N97B 1HJPA 1UT8A 3MGHA 5TZVA 2J6TA 3ZDEA 4AYBC 1MC8A 3D2SA 3N28A 2J6UA 4RT3A 4K4IA 2KN7A 4LVSA 2XCPA 7ICVA 1X42A 2DPIA 5HHHA 3HW8A 1NJZA 4NLBA 9ICVA 2ZXHA 1Z1VA 5AM5A 4Y2VA 4C8KA 5HMLA 4DL2A 2PKEA 1X2IA 5AM0A 3SMVA 5ALDA 5KAIU 2ZIWB 4DL5A 2W03A 8ICSA 3M7DA 4O3MA 4J9PA 8ICOA 4IQVA 4PHDA 1VJ5A 4ED2A 2MRLA 1HUOA 3BQ2A 1ZJNA 1L7MA 4ED1A 3C28A 4Q44A 4F93B 5AM4A 2YMPA 4YD1A 2LPEA 5AI6A 1D9FA 2K8AA 2LKYA 4DS5A 4BWMA 5J0OA 2Q0ZX 1TV9A 2VJ5A 4ECYA 2VA2A 5IIJA 2WFAA 5AI0A 4UB1A 2F76X 4P0QA 1ZQAA 5KG1A 3AN1A 5C5JA 4EYHB 3NVWA 5IIKA 4BX9C 4RQ4A 2F8LA 2ZIUB 3AL0B 1X6JA 2NRZA 3F2DA 5KFLA 2KFNA 2ZG6A 1WCLA 4NLZA 4QWAA 3HP6A 4Y2SA 3GV5B 2W9CA 1Z3EB 2CXYA 3KHGA 2GH1A 4ELTA 4UAZA 1BPBA 1AQ6A 3AU6A 3C5FA 2F44A 7ICHA 3M6ZA 3TFSA 1BVSA 1U4BA 3VCBA 3FC4A 2VA3A 3IP4B 4KN7A 4O3PA 4B9LA 3T5LA 3THVA 4DFMA 2C2EA 7ICOA 2DQNB 2DFLA 3H8SA 1TAMA 3AUOA 5CRXA 3NASA 4RPXA 2ZUDA 3ORYA 5KFIA 4UB5A 4NL9A 2FPLA 3PW5A 1TK5A 2IOFK 4IR1A 2GLEA 2K8BB 2A1AA 2VIXA 4UASA 4X5VA 1IG6A 3BS5B 4PZOA 7ICRA 4IS7A 2EDUA 4F4WA 4P4PA 4OJOA 2K8CB 2IHNA 1YT3A 5AI5A 4ED8A 2EANA 2WF5A 4KLLA 4EEKA 5CR0A 3RB4A 8ICZA 5T14A 4B9UA 4RU9A 1UCVA 4O3QA 2W43A 4QIWC 2R8KA 4DSJA 2L5YA 3QU5A 4RZRA 7ICSA 4F92B 1WCNA 2QKQA 4PGXA 2QB1A 3VC8A 3UM9A 3BZCA 3I28A 2EZYA 1Q8KA 4BDPA 1GO3F 3ETLA 3H4DA 2WF9A 1L7NA 3NRWA 1ZD2P 3LVVA 5KFFA 5DLFA 3HPOA 5KFGA 2I1QA 1RG6A 4B9NA 4DQRA 5HMMA 3RBDA 4C8NA 9ICBA 4OJ5A 4CF4A 1B0XA 1SZPA 4DL6A 2YQEA 5EWGA 2XY6A 1COOA 4YR2A 5DQHA 4QWEA 1C7YA 3D2NA 2D6FC 3H0LB 5ALEA 4M9GA 3RF9A 2BKEA 4IRCA 8ICWA 1SWVA 3OHAA 4EX7A 1NNLA 1FO4A 4ELUA 3DDHA 2DGZA 5DBBA 2F8KA 1WYGA 1NZPA 1WUDA 3RH6A 4NL9C 1T8EA 2ZIVB 3HJEA 5KFQA 5K4LA 2K4PA 2PFNA 4RUAA 3IG5A 2FMQA 4EBCA 4M6WA 4EELA 1S8OA 2IHMA 2W9BB 5HNKA 1ZD3A 2BDUA 4Y2YA 4A8EA 1NK5A 5KFZA 3C5GA 4RQ2A 1F0MA 2NV3A 4EYIB 1RQNA 4LJXA 2A19A 4XA5A 5J2CA 2A1JB 4K4HA 2HI0A 3GIMA 3MR6A 2AXTU 1XO1A 2Y0SC 4M9NA 4DS4A 4USAA 3TFRA 4Q8FA 1WG8A 5E79U 2DF4B 4PL2A 8ICLA 1LKYB 3K4GA 2HHTA 3WK9A 1U47A 3H8MA 2F2AB 4Y2QA 1N2XA 3SQIA 3MGVA 4DSLA 2KZMA 5L1JA 2R8IA 4R64A 3KOOA 4F91B 2E3TA 5FP0A 1NK0A 9ICMA 1A0PA 9ICKA 4PHEA 1RXVA 4BXOB 4DOCA 2OH2A 1T3NA 4UAVA 2O6KA 1IIPA 3IDWA 1S97A 4BJQA 4XRHA 3QNMA 2W8KA 4YP3A 4R63A 2YB4A 4G9BA 3N7RC 3RJIA 3H4BA 3Q8LA 4B6JA 3WU2U 4M9HA 5F9LA 1UHUA 4DLEA 2MSNA 5AM2A 1F44A 4ZH4A 2ASJA 3T79A 1N5WA 5AI8A 5CHGA 2G0AA 4F71A 5KFRA 5TISU 2M0NA 4GC7A 2HSZA 4KLTA 3RR8A 3UXPA 5AKLA 4KLFA 5EWEA 1OUQA 1O03A 2PMZF 2HHVA 3LYSA 1MN8A 4M0AA 4UB3A 1EXNA 1Z19A 1Z00B 2PMZC 2AQ0A 4DOBA 4ELVA 4IRKA 3PSIA 1IV8A 2WB1F 5KG6A 4YMOA 2ZJ5A 4CE6A 3H8JA 1SKWA 2FI1A 2NYVA 3Q8KA 3D2QA 3E58A 1NJWA 2ZXIA 9ICOA 5GTIU 4UAUA 5ALMA 1KLNA 2MUTA 3A0HU 3K75D 2KD1A 1NK9A 1S0VA 2W9AA 2RDJA 2JH7A 1NJYA 4C4SA 4MF8A 4KTQA 2HDOA 7ICJA 1JMSA 1V97A 3AU2A 2BQRA 5AK4A 4GC6A 1SGGA 4CCHA 2HOFA 4J9QA 4FBTA 3IV6A 2PFPA 2BCRA 5L1MA 3LVWA 4C0ZA 3WKBA 1ZYQA 2RQ5A 4DQPA 1PVRA 2OXOA 3Q8RB 3T3FA 2V9WA 4B9SA 3MR5A 1S0MA 2JR5A 5ALGA 5J2HA 3UXOA 2ZIWA 4I2DA 2KVCA 2JEFA 9ICJA 1Z1BA 4KX5A 2JEJA 4KMOB 5BPCA 1NI3A 5J2FA 3ISDA 1BPDA 2MU2A 2FJ6A 3OJUA 1NOMA 3KBBA 5KFSA 1TFRA 3RFAA 3H8WA 4QJFB 4NM1A 4P4OA 1N63A 5ALSA 1ZQLA 9ICCA 3BQTA 5ALZA 5CEHA 4YFKA 2BCQA 2XIDA 1SWWA 3QUCA 1K1SA 1RQLA 3SD7A 4I28A 2BZFA 9ICUA 2OWOA 3TKAA 3WK5A 7ICFA 3GZFA 4QZDA 4ECVA 3QU9A 2ISPA 5J2BA 2JEGA 2P35A 5J0UA 2W7OA 2Y1JA 4CDGA 5D46A 2HHWA 2GOLA 3TADA 2W9MA 4F72A 4FFDA 5DLGA 5ALTA 1SV4A 1ZQUA 1KFSA 2W7PA 1X40A 3OTQA 7ICUA 2AH5A 9ICNA 4B9TA 5J0YA 2W55A 9ICEA 2W04A 1BGXT 4M04A 2JRZA 1RPLA 2F1HA 4F4KA 2FPMA 3MABA 4GXKA 2EZXA 5KG4A 3AEVA 2BCVA 3RH4A 1JUDA 1QQ5A 5AHXA 4C8OA 1XSPA 1COKA 4GFJA 4F4YA 1KQQA 3RR7A 5B5EU 1NK4A 2HVIA 3MGIA 3MC1A 3BS5A 5L1IA 1T3QA 3UMCA 2K4EA 4UB6U 3I76A 4FO6A 4MEXA 3F2BA 1L5UA 5J2JA 2W3RA 1K1QA 2W54A 1N61A 3QUTA 2G06A 2E8MA 2HBJA 3PW7A 9ICFA 2KIVA 1O08A 3PSTA 3M8SA 3MFIA 2G09A 3TACB 5CA7A 3HKZC 4CNQA 3QYPA 4US9A 2DWQA 2KSOB 3F2CA 4RQMA 3OSPA 2D3DA 2M9NA 3ZD9A 1ZQDA 3N7PD 4F2SA 1PK1B 3U26A 2PI4A 1P7DA 3PNCA 4DQIA 1ZQOA 5AICA 3BQ0A 3Q8SB 3SYZA 4IR9A 3TADC 3FDSA 2WF7A 2V4QA 4QZ8A 3FM9A 2XVTA 3F5EA 3QZ8A 1QSLA 5D4BA 5J0XA 1XC9A 3NVYA 3IM1A 3IHQB 5HHIA 2Y1IA 3CNHA 1PVQA 4EBEA 3QEAZ 3QU2A 5J8YA 2HHUA 3B9JA 3EW9A 5ALYA 4IQTA 3AM9A 1S9FA 1SV0C 4KLQA 5F3XB 5KFUA 2J6SA 4YVZA 4KLOA 2B6GA 8ICTA 2ZIVA 1JXEA 5DBAA 2EZZA 2LYAA 3ZI4A 4J9NA 3SENA 3N7SC 1BPZA 4C8LA 2W9BA 2H3ZA 1F5SA 4Z6CA 1A77A 5CB1A 1J97A 2P6UA 2OCEA 5ALRA 1S76D 2A1JA 3RH5A 4RPYA 2C2RA 2P6RA 4NLCA 4NV0A 1ZQXA 3C1ZA 5CWRA 3RB0A 5J2DA 9ICSA 1LV5A 3KTQA 3H7IA 2NRWA 1RZTA 1ZQGA 1LKYA 7ICTA 4PH5A 1ZQBA 2JXJA 4KLHA 1UQVA 1QQ7A 2C22A 1JALA 2KMDA 2WF6A 4J03A 2E1FA 4IRDA 4DFDA 5ALKA 5AK5A 4BXOA 4Y2XA 4MF2A 4QNLA 5DG7A 3Q8MA 4CF5A 3A0BU 2ES6A 2Y9TA 4U7CA 7ICEA 2KHVA 1DGJA 2YMMA 1QCKA 5KG0A 4RPZA 4DSEA 2HMXA 4DO9A 1U48A 5IIOA 3EPGA 1X9MA 1DK3A 4O5KA 4OJ6A 4YXMA 2G07A 1AROP 3WK7A 4UBBA 4KMUA 3R9KA 1U49A 5J2AA 3MFHA 4QZIA 1RYSA 4J9LA 5AKIA 4RQ5A 4O3RA 5HR6A 4UW9A 1NKBA 7ICIA 9ICQA 3MDAA 1B43A 2B21A 3L3FX 3BDPA 2CPRA 2KIWA 2KKVA 4P2HA 4NWIA 2KHQA 1XSLA 3QEBZ 2HHXA 5EE0A 4ECTA 4QZHA 4TUSA 1KBUA 2H3QA 4O3OA 3M9NB 3CW2C 4RQ6A 1ZXIA 3HWTA 4OCZA 1L6NA 4NM2A 5KL8B 2JZBB 1Z00A 4QZAA 4PL1A 4PHPA 3V7KA 2DKZA 1RYRA 2I6XA 3GV7B 4B9MA 1NKCA 2BDPA 2ZTDA 2BPGA 2YY6A 4KLGA 4MFCA 2IOHA 4CGZA 1B4FA 3ZDCA 3MR3A 3JPOA 4IQUA 3UMGA 4PGQA 3K1ZA 4O3NA 3H40A 3HILA 4DCCA 1T94A 2NRVA 4DQQA 1RM6C 2AHOB 3I1YA 2LM4A 3NRZA 4JK1A 5BOMA 5AM3A 1ZQJA 2ZJ8A 4DEZA 5KT6A 9ICXA 4DL4A 5AKKA 3PV8A 2KG5A 1D8LA 3C1YA 1N60A 4US8A 3N4MB 5KFDA 1Q3VA 3OGUA 2IBKA 1VDVA 3S6JA 1VLBA 4YMNA 5KFAA 5IINA 4NJ8A 2WAQF 1MA7A 4FZNA 3PR5B 4F4ZA 2BPFA 2QLTA 3RJGA 5BOLA 2MAXA 1ZQVA 4DOAA 3ZDAA 1Y88A 1NZBA 3V7JA 5KFEA 1NK6A 3SR6A 5DDMA 4KLMA 1WWVA 2LYHA 3AQFA 4YXJA 2I9GA 4ED0A 1SXEA 5AKYA 1DRGA 3D6JA 3HT3A 8ICUA 1ZQ1C 4PPXA 2E8NA 1UT5A 4DF4A 5AKHA 4ECUA 5KG3A 1PZNA 3KD3A 4LZDA 2XGQA 3GV8B 3RJKA 4PHAA 5KG5A 1SL1A 4G3IA 1PVPA 1NK7A 8ICYA 5G5GA 2IOFA 2HBMA 4I2JA 3OHBA 2UVVA 3KHLA 2K89A 4JV0A 4BGDA 4RQ0A 1KFDA 1BNOA 2ATLA 2LHTA 8ICFA 1S77D 5DDYA 5KFPA 2BPCA 4DSIA 1HIWA 4UAWA 1RXWA 3V6JA 3AMZA 3KHRA 2WF8A 5DB9A 2HBKA 2AGOA 3ZDDA 1S0NA 5KT7A 1MQ3A 1KEJA 2ALZA 1KRPA 1L8OA 5KT2A 4NY8A 1IXRA 1K5OA 4UB4A 2XGPA 7ICKA 1KKXA 4IL6U 4YR3A 3PR4A 5C0YA 4O0IA 3SZ2A 5L9XA 1JROA 1L7PA 3C2MA 2D8CA 3AQEA 4P4MA 8ICNA 2QARB 2PFOA 4I2BA 1KSPA 2FLPA 3PZPA 1LB2B 9ICAA 3T5KA 1Q3UA 2WB1C 3LDAA 4DSKA 3T5JA 4DL7A 5ALWA 5JUMA 3KKAA 1DGSA 1TAQA 3RAXA 4RUCA 1L3SA 1KL9A 4UB2A 1LVHA 3LWLA 2VJ4A 2ZTEA 2R8HA 4CRXA 8ICBA 1HEKA 2YTUA 1U9LA 2OM6A 5J0PA 7ICLA 2KNJA 4FZLA 2F3NA 2KSOA 1TVAA 1XO0A 3QX7A 8ICCA 1V9PA 2EH9A 8ICPA 5ALLA 5AKEA 1PK1A 5EOZA 2BCSA 2Z7JA 1CUKA 5AK6A 3L5KA 4UQGA 3OJSA 4ECZA 4LZGA 4EX6A 2OEHA 4ED7A 4ECXA 2JH1A 4RQ7A 1WWUA 1JX4A 3G6YA 2YB1A 2FLLA 2F1IA 4KLEA 2K4HA 2EQYA 4QZFA 3RRGA 3G6VA 4JB3A 5ALVA 1FFVA 5AKXA 4WJ3B 3RJEA 4Y2JA 3RBEA 4QW9A 4TUQA 2G5HB 3C29A 3V6HA 4KLUA 1ED1A 2ZUBA 3ED5A 5AIAA 4RQ3A 4YN4A 1S0OA 3BQ7A 1N5XA 4I2IA 5ALJA 4ED3A 1JI7A 4RNOA 2HOQA 2KVSA 4FS2A 3NS1A 2JGAA 1ZQTA 2ZIUA 5KT5A 5KT3A 3KKAC 3EYZA 4Y2PA 2HW3A 2XO7A 4DQSA 3IRUA 3RB3A 3L4PA 4GXIA 2RP5A 5JTIA 3HRDD 1JIHA 2EAOA 2KOBA 2HHQA 3JPNA 2CRXA 1CRXA 7ICQA 3ETRA 3RJJA 2H3IA 2ZIXB 2C28A 1ZQFA 4KLIA 3FYHA 4M9JA 4YD2A 4M47A 2KEYA 2RDIA 2I5HA 8ICJA 3EUB2 1Z4NA 2JV3A 3J81j 2EAMA 4IQWA 4MHVA 5EE9A 2AGQA 1X9XA 4DF8A 3V6KA 1MSWD 5EE3A 1SIJA 3MDCA 4QZ9A 1ZRNA 4I2FA 4UARA 5JU5A 3SEIA 2KV2A 1JN3A 4QWDA 4E0DA 4NLNA 4QWCA 3KHHA 4FZMA 2XC9A 1KN5A 4B9VA 1HUZA 5J0SA 2R8GA 4NXZA 4R65A 2A3VA 8ICIA 1DOQA 3JPQA 3JPPA 4K4GA 5J2IA 1J2MA 4R8UB 1ZQCA 1QTMA 3PMLA 2R8JA 1L3TA 3RRHA 4RNMA 5DG9A 2IMWP 4DWIA 2KE7A 5ALUA 4AYBF 3PMNA 7ICMA 4Z6FA 5DKWA 3PVXA 3BQ1A 5AK3A 2RHFA 1PK3A 1KTQA 1D9DA 3NGDA 8ICRA 4R66A 2JZBA 4YG2A 3TARA 1YZ6A 2XY7A 3K1RB 1ECWA 5J29A 3KFUF 2VA8A 2R18A 4QZEA 3SI8A 3RJHA 2KICA 1ZQQA 1OXJA 4DFKA 4OO1J 2AGPA 7ICPA 1FEZA 2NRTA 5KFCA 1A6SA 2OYYA 4TQSA 1H38A 3TAQA 1SZHA 2WTFA 3FAHA 5KNIA 5AKGA 2V4RA 1TK0A 3B0YA 4ECSA 4GXJA 3PX4A 3F53A 2W3SA 2JMGA 4XQ8A 2EAPA 4M2YA 4F5NA 5KFNA 4EENA 3M1YA 5J2EA 2DBYA 2YMLA 4Y2RA 2YMQA 5DQGA 1DXSA 5ALIA 3WK6A 1ZQWA 5KL1B 4OJLA 5DQIA 3LK9A 5J0QA 2HHSA 2AQ4A 4C8MA 4PGYA 1XWLA 3WKAA 2ISOA 3NVZA 4P0PB 1SB3C 2ZJAA 2QB0B 4NLGA 2W11A 2WHEA 5AKZA 4ED6A 4TUPA 3PW4A 3IG8A 3NVVA 3WKCA 4JWNA 2LI6A 1T4GA 3EPIA 2B0CA 5F9NA 5ALFA 3NTUA 2FMSA 4ACOA 1D8BA 4ECWA 1ZQHA 3OPXA 5DGAA 3CYMA 3O0FA 4TQRA 3TI0A 3IN5A 1PUZA 5IIIA 4KX3A 4DFPA 1BPYA 4C4RA 2W8LA 9ICIA 4UAYA 4FS1A 3CRXA 4Z6EA 1Q46A 2KJ8A 1L3VA 2KZ3A 3KZXA 1QQ6A 3F5AA 2G5IB 2KJ9A 3QZ7A 2ZTCA 3QU4A 3PO4A 4J9KA 1T7PA 5AI9A 4FE3A 1KFTA 2KKPA 1ZD4A 3MR2A 4CF3A 1U45A 5J2KA 3T5HA 3ONNA 2BCUA 9ICRA 4UBCA 3WK4A 5J8YC 5KT4A 4KN4A 3UXNA 3HX0A 4YR0A 1NJXA 5EE1A 3C21A 1MQ2A 4C7YA 5DG8A 5KFMA 5KFJA 3ICXA 3PSFA 1L3UA 2KP7A 5AI4A 4ZOHC 2K60A 4JMUA 2RLTA 4QIWF 1L7OA 3PO5A 2PFQA 3LWMA 1QSYA 2H3VA 4C4TA 1B22A 1D8YA 5KG2A 1BNPA 9ICTA 3UPQA 1OW5A 4O5CA 2HBLA 1X66A 4I2HA 5EWFA 4Y2TA 5KFBA 2QARA 4QZCA 5KFHA 3SAFA 1YZ7A 5GTHU 2YN4A 4J9MA 2YX8A 1URJA 3UQ2A 5AKJA 4C7ZA 9ICGA 3PW2A 3PY8A 2JHDA 3PX0A 2UVWA 3H0MB 1BPEA 4EZ9A 3GFKB 3GDXA 3UMBA 5L1KA 4MEYA 3RTVA 1ZQEA 5KAFU 3ISBA 5ALHA 1DK2A 1UA0A 4IC9A 4F5PA 4Q43A 4F3OA 3GQCA 1X9WA 4F8RA 1XSNA 3Q8PB 2BHNA 2OHFA 1TE2A 5CP2A 4AP9A 4P0QB 2HCFA 8ICGA 3EZ5A 1ZOLA 2Q4TA 3GIJA 4FBUA 2FE9A 5ALNA 5ALQA 2KJ5A 2E8PA 3ZD8A 1QH9A 4EEYA 2LYBA 4I27A 5JRTA 9ICWA 3Q8QB 2Y0SF 3WKEA 2FLNA 2AU0A 2WAQC 2KK0A 4TURA 5KG7A 5ALPA 4PZNA 4GLXA 4ICAA 4EBDA 2JEIA 3PSPA 4DLGA 1TKDA 2P66A 2H5XA 2W9CB 2UVRA 3RB6A 1RDFA 4DL3A 2DKXA 8ICXA 1N62A 3SV4A 2DL0A 3C2LA 4KLSA 3QXGA 4HYKA 4U6PA 3M8RA 3GIKA 2NO4A 5D49A 2G08A 2C2DA 3E2EA 4QZBA 9ICPA 2FDRA 8ICVA 4I2EA 4Y2UA 5KFTA 3GIIA 3GILA 3TAPA 2LBOA 2H3FA 1M6YA 4PJ0U 1QLNA 9ICHA 4J9SA 3C2KA 5KFOA 2XI9A 4ECRA 4RNNA 4YMMA 4F5RA 4I2AA 2ZIXA 2GWSA 5J0TA 1ZQSA 5ALXA 4QWBA 1J2NA 5G5HA 2CN1A 1SL0A 4YCXA 3BS7A 1ZQIA 4UB8U 2KFZA 5DGBA 3OSNA 1V38A 4DFJA 8ICHA 4XUSA 4F4XA 3M9MB 1TK8A 2MA1A 3V7LA 5AM1A 3JPRA 1ZQNA 4O3SA 1NKEA 2BR0A 1JRPA 2LMRA 3G6XA 4I29A 1N48A 2ASDA 2VANA 4J9OA 4F5QA 2BQUA 2ESEA 3H0RB 3C23A 2GO7A 3SAHA 4YQWA 2ZUCA 2XICA 3M6KA 5HR7A 8ICMA 3B0XA 1Z4OA 5J0RA 1ZQZA 5A0LA 1BPXA 2E5SA 2RRDA 4R8UA 3DEEA 5KFXA 2UVUA 4RT2A 5ALOA 4KLDA 2LM1A 2KTQA 5KTQA 5HP4A 5DB7A 4J9RA 5DBCA 1S5LU 4JV1A 3TANA 3WKDA
chains in the Genus database with same CATH topology
1X66A 1PK1B 2EANA 2QARA 2ES6A 2Y9TA 2Y9UA 1V85A 2LPEA 3TADC 1LKYB 1UCVA 3H8MA 2KG5A 2L5YA 3TADA 1SXDA 4RQNA 2QKQA 3BQ7A 2QB1A 1SV0A 1SV4A 2KE7A 4NJ8A 2D8CA 1JI7A 1X40A 2QARB 5J8YA 1PK3A 3IDWA 1RG6A 3KKAC 1SV0C 5F3XB 1SGGA 3K1RB 3BS7A 2B6GA 1WWVA 3KKAA 1V38A 5L1MA 1B0XA 5JTIA 5J8YC 1SXEA 1OXJA 2EAOA 3SENA 2FE9A 1COKA 2F44A 2E8PA 2E8NA 2YTUA 2LMRA 5JRTA 5KNIA 3BS5A 2F8KA 2F3NA 2KSOA 2QB0A 4PZNA 2ESEA 2K60A 4NL9C 2DKZA 1PK1A 2EAPA 2K4PA 2JV3A 2EAMA 4NL9A 2E8MA 2E8OA 4MHVA 1B4FA 1DXSA 1LKYA 1X9XA 2GLEA 2KIVA 1Z1VA 2DKXA 3TACB 1F0MA 2DL0A 1UQVA 1WWUA 3BS5B 3HILA 4IS7A 2KMDA 4PZOA 1OW5A 2KSOB 2QB0B 5JU5A 3SEIA 4RQMA 1KW4A 2D3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X66 A;  1PK1 B;  2EAN A;  2QAR A;  2ES6 A;  2Y9T A;  2Y9U A;  1V85 A;  2LPE A;  3TAD C;  1LKY B;  1UCV A;  3H8M A;  2KG5 A;  2L5Y A;  3TAD A;  1SXD A;  4RQN A;  2QKQ A;  3BQ7 A;  2QB1 A;  1SV0 A;  1SV4 A;  2KE7 A;  4NJ8 A;  2D8C A;  1JI7 A;  1X40 A;  2QAR B;  5J8Y A;  1PK3 A;  3IDW A;  1RG6 A;  3KKA C;  1SV0 C;  5F3X B;  1SGG A;  3K1R B;  3BS7 A;  2B6G A;  1WWV A;  3KKA A;  1V38 A;  5L1M A;  1B0X A;  5JTI A;  5J8Y C;  1SXE A;  1OXJ A;  2EAO A;  3SEN A;  2FE9 A;  1COK A;  2F44 A;  2E8P A;  2E8N A;  2YTU A;  2LMR A;  5JRT A;  5KNI A;  3BS5 A;  2F8K A;  2F3N A;  2KSO A;  2QB0 A;  4PZN A;  2ESE A;  2K60 A;  4NL9 C;  2DKZ A;  1PK1 A;  2EAP A;  2K4P A;  2JV3 A;  2EAM A;  4NL9 A;  2E8M A;  2E8O A;  4MHV A;  1B4F A;  1DXS A;  1LKY A;  1X9X A;  2GLE A;  2KIV A;  1Z1V A;  2DKX A;  3TAC B;  1F0M A;  2DL0 A;  1UQV A;  1WWU A;  3BS5 B;  3HIL A;  4IS7 A;  2KMD A;  4PZO A;  1OW5 A;  2KSO B;  2QB0 B;  5JU5 A;  3SEI A;  4RQM A;  1KW4 A;  2D3D A; 
#chains in the Genus database with same CATH topology
 7ICG A;  1N56 A;  5KFW A;  3M9O B;  2NO5 A;  1ZD5 A;  1V85 A;  4M6W B;  4JWM A;  1UA1 A;  3JPT A;  3EWA A;  3KZI U;  4O5E A;  5J2G A;  4BWJ A;  2BGW A;  5J0W A;  1NK8 A;  2K4I A;  3DV9 A;  1ZQY A;  1ZQK A;  9ICL A;  1KDH A;  2HOI A;  4Q8E A;  1L8L A;  5KFY A;  4NLK A;  3NUQ A;  3BZK A;  1XU4 A;  3MBY A;  1SL2 A;  1IM4 A;  4JUZ A;  3QUB A;  3QE9 Y;  4M9L A;  2VKQ A;  3BJY A;  2XY5 A;  3SV3 A;  3ALR A;  4QZG A;  4RQ8 A;  4OJP A;  1FFU A;  1JXL A;  1ZQR A;  1ZJM A;  4MFA A;  4QW8 A;  3CP8 A;  3QU7 A;  4C80 A;  2PI5 A;  2F1J A;  1X6I A;  3WK8 A;  4P0P A;  4DSF A;  4KLJ A;  3QUQ A;  2QB0 A;  4MFF A;  1ZRM A;  1TAU A;  4EZ6 A;  3E0F A;  3RJF A;  1ZET A;  1FIQ A;  5IIL A;  4HAI A;  1ZQP A;  4F2R A;  1CEZ A;  7ICN A;  2E8O A;  4ECQ A;  4RQ1 A;  4UAT A;  3UQ0 A;  2DUY A;  5H2F U;  1SKR A;  4BUG A;  8ICA A;  2XCA A;  3GU3 A;  3V72 A;  1C20 A;  5IIM A;  1KW4 A;  1SKS A;  1CI4 A;  4F5O A;  2FPK A;  2AJQ A;  1UPH A;  2NRX A;  4KIT B;  2IA6 A;  8ICK A;  5KFV A;  1A76 A;  5L1L A;  5KFK A;  2Y9U A;  1ZQM A;  2DPJ A;  2HVH A;  2FMP A;  2KZZ A;  1SXD A;  4RQN A;  3PX6 A;  1X9S A;  1SV0 A;  3ZDB A;  5B66 U;  2PXI A;  2BQ3 A;  1XS9 D;  8ICE A;  3TQ1 A;  2ODG A;  2ASL A;  1XNS A;  4I2C A;  2F77 X;  3JPS A;  5DB8 A;  3RAQ A;  1S10 A;  5AIB A;  8ICQ A;  3ISC A;  5DB6 A;  4Z6D A;  2E1E A;  3PW0 A;  2N1R A;  1RYU A;  4I2G A;  3SAG A;  5CJ7 A;  4Q45 A;  4JV2 A;  4F50 A;  3HKZ F;  4GIB A;  4O9M A;  2MUT B;  1QSS A;  4OD0 A;  3N97 B;  1HJP A;  1UT8 A;  3MGH A;  5TZV A;  2J6T A;  3ZDE A;  4AYB C;  1MC8 A;  3D2S A;  3N28 A;  2J6U A;  4RT3 A;  4K4I A;  2KN7 A;  4LVS A;  2XCP A;  7ICV A;  1X42 A;  2DPI A;  5HHH A;  3HW8 A;  1NJZ A;  4NLB A;  9ICV A;  2ZXH A;  1Z1V A;  5AM5 A;  4Y2V A;  4C8K A;  5HML A;  4DL2 A;  2PKE A;  1X2I A;  5AM0 A;  3SMV A;  5ALD A;  5KAI U;  2ZIW B;  4DL5 A;  2W03 A;  8ICS A;  3M7D A;  4O3M A;  4J9P A;  8ICO A;  4IQV A;  4PHD A;  1VJ5 A;  4ED2 A;  2MRL A;  1HUO A;  3BQ2 A;  1ZJN A;  1L7M A;  4ED1 A;  3C28 A;  4Q44 A;  4F93 B;  5AM4 A;  2YMP A;  4YD1 A;  2LPE A;  5AI6 A;  1D9F A;  2K8A A;  2LKY A;  4DS5 A;  4BWM A;  5J0O A;  2Q0Z X;  1TV9 A;  2VJ5 A;  4ECY A;  2VA2 A;  5IIJ A;  2WFA A;  5AI0 A;  4UB1 A;  2F76 X;  4P0Q A;  1ZQA A;  5KG1 A;  3AN1 A;  5C5J A;  4EYH B;  3NVW A;  5IIK A;  4BX9 C;  4RQ4 A;  2F8L A;  2ZIU B;  3AL0 B;  1X6J A;  2NRZ A;  3F2D A;  5KFL A;  2KFN A;  2ZG6 A;  1WCL A;  4NLZ A;  4QWA A;  3HP6 A;  4Y2S A;  3GV5 B;  2W9C A;  1Z3E B;  2CXY A;  3KHG A;  2GH1 A;  4ELT A;  4UAZ A;  1BPB A;  1AQ6 A;  3AU6 A;  3C5F A;  2F44 A;  7ICH A;  3M6Z A;  3TFS A;  1BVS A;  1U4B A;  3VCB A;  3FC4 A;  2VA3 A;  3IP4 B;  4KN7 A;  4O3P A;  4B9L A;  3T5L A;  3THV A;  4DFM A;  2C2E A;  7ICO A;  2DQN B;  2DFL A;  3H8S A;  1TAM A;  3AUO A;  5CRX A;  3NAS A;  4RPX A;  2ZUD A;  3ORY A;  5KFI A;  4UB5 A;  4NL9 A;  2FPL A;  3PW5 A;  1TK5 A;  2IOF K;  4IR1 A;  2GLE A;  2K8B B;  2A1A A;  2VIX A;  4UAS A;  4X5V A;  1IG6 A;  3BS5 B;  4PZO A;  7ICR A;  4IS7 A;  2EDU A;  4F4W A;  4P4P A;  4OJO A;  2K8C B;  2IHN A;  1YT3 A;  5AI5 A;  4ED8 A;  2EAN A;  2WF5 A;  4KLL A;  4EEK A;  5CR0 A;  3RB4 A;  8ICZ A;  5T14 A;  4B9U A;  4RU9 A;  1UCV A;  4O3Q A;  2W43 A;  4QIW C;  2R8K A;  4DSJ A;  2L5Y A;  3QU5 A;  4RZR A;  7ICS A;  4F92 B;  1WCN A;  2QKQ A;  4PGX A;  2QB1 A;  3VC8 A;  3UM9 A;  3BZC A;  3I28 A;  2EZY A;  1Q8K A;  4BDP A;  1GO3 F;  3ETL A;  3H4D A;  2WF9 A;  1L7N A;  3NRW A;  1ZD2 P;  3LVV A;  5KFF A;  5DLF A;  3HPO A;  5KFG A;  2I1Q A;  1RG6 A;  4B9N A;  4DQR A;  5HMM A;  3RBD A;  4C8N A;  9ICB A;  4OJ5 A;  4CF4 A;  1B0X A;  1SZP A;  4DL6 A;  2YQE A;  5EWG A;  2XY6 A;  1COO A;  4YR2 A;  5DQH A;  4QWE A;  1C7Y A;  3D2N A;  2D6F C;  3H0L B;  5ALE A;  4M9G A;  3RF9 A;  2BKE A;  4IRC A;  8ICW A;  1SWV A;  3OHA A;  4EX7 A;  1NNL A;  1FO4 A;  4ELU A;  3DDH A;  2DGZ A;  5DBB A;  2F8K A;  1WYG A;  1NZP A;  1WUD A;  3RH6 A;  4NL9 C;  1T8E A;  2ZIV B;  3HJE A;  5KFQ A;  5K4L A;  2K4P A;  2PFN A;  4RUA A;  3IG5 A;  2FMQ A;  4EBC A;  4M6W A;  4EEL A;  1S8O A;  2IHM A;  2W9B B;  5HNK A;  1ZD3 A;  2BDU A;  4Y2Y A;  4A8E A;  1NK5 A;  5KFZ A;  3C5G A;  4RQ2 A;  1F0M A;  2NV3 A;  4EYI B;  1RQN A;  4LJX A;  2A19 A;  4XA5 A;  5J2C A;  2A1J B;  4K4H A;  2HI0 A;  3GIM A;  3MR6 A;  2AXT U;  1XO1 A;  2Y0S C;  4M9N A;  4DS4 A;  4USA A;  3TFR A;  4Q8F A;  1WG8 A;  5E79 U;  2DF4 B;  4PL2 A;  8ICL A;  1LKY B;  3K4G A;  2HHT A;  3WK9 A;  1U47 A;  3H8M A;  2F2A B;  4Y2Q A;  1N2X A;  3SQI A;  3MGV A;  4DSL A;  2KZM A;  5L1J A;  2R8I A;  4R64 A;  3KOO A;  4F91 B;  2E3T A;  5FP0 A;  1NK0 A;  9ICM A;  1A0P A;  9ICK A;  4PHE A;  1RXV A;  4BXO B;  4DOC A;  2OH2 A;  1T3N A;  4UAV A;  2O6K A;  1IIP A;  3IDW A;  1S97 A;  4BJQ A;  4XRH A;  3QNM A;  2W8K A;  4YP3 A;  4R63 A;  2YB4 A;  4G9B A;  3N7R C;  3RJI A;  3H4B A;  3Q8L A;  4B6J A;  3WU2 U;  4M9H A;  5F9L A;  1UHU A;  4DLE A;  2MSN A;  5AM2 A;  1F44 A;  4ZH4 A;  2ASJ A;  3T79 A;  1N5W A;  5AI8 A;  5CHG A;  2G0A A;  4F71 A;  5KFR A;  5TIS U;  2M0N A;  4GC7 A;  2HSZ A;  4KLT A;  3RR8 A;  3UXP A;  5AKL A;  4KLF A;  5EWE A;  1OUQ A;  1O03 A;  2PMZ F;  2HHV A;  3LYS A;  1MN8 A;  4M0A A;  4UB3 A;  1EXN A;  1Z19 A;  1Z00 B;  2PMZ C;  2AQ0 A;  4DOB A;  4ELV A;  4IRK A;  3PSI A;  1IV8 A;  2WB1 F;  5KG6 A;  4YMO A;  2ZJ5 A;  4CE6 A;  3H8J A;  1SKW A;  2FI1 A;  2NYV A;  3Q8K A;  3D2Q A;  3E58 A;  1NJW A;  2ZXI A;  9ICO A;  5GTI U;  4UAU A;  5ALM A;  1KLN A;  2MUT A;  3A0H U;  3K75 D;  2KD1 A;  1NK9 A;  1S0V A;  2W9A A;  2RDJ A;  2JH7 A;  1NJY A;  4C4S A;  4MF8 A;  4KTQ A;  2HDO A;  7ICJ A;  1JMS A;  1V97 A;  3AU2 A;  2BQR A;  5AK4 A;  4GC6 A;  1SGG A;  4CCH A;  2HOF A;  4J9Q A;  4FBT A;  3IV6 A;  2PFP A;  2BCR A;  5L1M A;  3LVW A;  4C0Z A;  3WKB A;  1ZYQ A;  2RQ5 A;  4DQP A;  1PVR A;  2OXO A;  3Q8R B;  3T3F A;  2V9W A;  4B9S A;  3MR5 A;  1S0M A;  2JR5 A;  5ALG A;  5J2H A;  3UXO A;  2ZIW A;  4I2D A;  2KVC A;  2JEF A;  9ICJ A;  1Z1B A;  4KX5 A;  2JEJ A;  4KMO B;  5BPC A;  1NI3 A;  5J2F A;  3ISD A;  1BPD A;  2MU2 A;  2FJ6 A;  3OJU A;  1NOM A;  3KBB A;  5KFS A;  1TFR A;  3RFA A;  3H8W A;  4QJF B;  4NM1 A;  4P4O A;  1N63 A;  5ALS A;  1ZQL A;  9ICC A;  3BQT A;  5ALZ A;  5CEH A;  4YFK A;  2BCQ A;  2XID A;  1SWW A;  3QUC A;  1K1S A;  1RQL A;  3SD7 A;  4I28 A;  2BZF A;  9ICU A;  2OWO A;  3TKA A;  3WK5 A;  7ICF A;  3GZF A;  4QZD A;  4ECV A;  3QU9 A;  2ISP A;  5J2B A;  2JEG A;  2P35 A;  5J0U A;  2W7O A;  2Y1J A;  4CDG A;  5D46 A;  2HHW A;  2GOL A;  3TAD A;  2W9M A;  4F72 A;  4FFD A;  5DLG A;  5ALT A;  1SV4 A;  1ZQU A;  1KFS A;  2W7P A;  1X40 A;  3OTQ A;  7ICU A;  2AH5 A;  9ICN A;  4B9T A;  5J0Y A;  2W55 A;  9ICE A;  2W04 A;  1BGX T;  4M04 A;  2JRZ A;  1RPL A;  2F1H A;  4F4K A;  2FPM A;  3MAB A;  4GXK A;  2EZX A;  5KG4 A;  3AEV A;  2BCV A;  3RH4 A;  1JUD A;  1QQ5 A;  5AHX A;  4C8O A;  1XSP A;  1COK A;  4GFJ A;  4F4Y A;  1KQQ A;  3RR7 A;  5B5E U;  1NK4 A;  2HVI A;  3MGI A;  3MC1 A;  3BS5 A;  5L1I A;  1T3Q A;  3UMC A;  2K4E A;  4UB6 U;  3I76 A;  4FO6 A;  4MEX A;  3F2B A;  1L5U A;  5J2J A;  2W3R A;  1K1Q A;  2W54 A;  1N61 A;  3QUT A;  2G06 A;  2E8M A;  2HBJ A;  3PW7 A;  9ICF A;  2KIV A;  1O08 A;  3PST A;  3M8S A;  3MFI A;  2G09 A;  3TAC B;  5CA7 A;  3HKZ C;  4CNQ A;  3QYP A;  4US9 A;  2DWQ A;  2KSO B;  3F2C A;  4RQM A;  3OSP A;  2D3D A;  2M9N A;  3ZD9 A;  1ZQD A;  3N7P D;  4F2S A;  1PK1 B;  3U26 A;  2PI4 A;  1P7D A;  3PNC A;  4DQI A;  1ZQO A;  5AIC A;  3BQ0 A;  3Q8S B;  3SYZ A;  4IR9 A;  3TAD C;  3FDS A;  2WF7 A;  2V4Q A;  4QZ8 A;  3FM9 A;  2XVT A;  3F5E A;  3QZ8 A;  1QSL A;  5D4B A;  5J0X A;  1XC9 A;  3NVY A;  3IM1 A;  3IHQ B;  5HHI A;  2Y1I A;  3CNH A;  1PVQ A;  4EBE A;  3QEA Z;  3QU2 A;  5J8Y A;  2HHU A;  3B9J A;  3EW9 A;  5ALY A;  4IQT A;  3AM9 A;  1S9F A;  1SV0 C;  4KLQ A;  5F3X B;  5KFU A;  2J6S A;  4YVZ A;  4KLO A;  2B6G A;  8ICT A;  2ZIV A;  1JXE A;  5DBA A;  2EZZ A;  2LYA A;  3ZI4 A;  4J9N A;  3SEN A;  3N7S C;  1BPZ A;  4C8L A;  2W9B A;  2H3Z A;  1F5S A;  4Z6C A;  1A77 A;  5CB1 A;  1J97 A;  2P6U A;  2OCE A;  5ALR A;  1S76 D;  2A1J A;  3RH5 A;  4RPY A;  2C2R A;  2P6R A;  4NLC A;  4NV0 A;  1ZQX A;  3C1Z A;  5CWR A;  3RB0 A;  5J2D A;  9ICS A;  1LV5 A;  3KTQ A;  3H7I A;  2NRW A;  1RZT A;  1ZQG A;  1LKY A;  7ICT A;  4PH5 A;  1ZQB A;  2JXJ A;  4KLH A;  1UQV A;  1QQ7 A;  2C22 A;  1JAL A;  2KMD A;  2WF6 A;  4J03 A;  2E1F A;  4IRD A;  4DFD A;  5ALK A;  5AK5 A;  4BXO A;  4Y2X A;  4MF2 A;  4QNL A;  5DG7 A;  3Q8M A;  4CF5 A;  3A0B U;  2ES6 A;  2Y9T A;  4U7C A;  7ICE A;  2KHV A;  1DGJ A;  2YMM A;  1QCK A;  5KG0 A;  4RPZ A;  4DSE A;  2HMX A;  4DO9 A;  1U48 A;  5IIO A;  3EPG A;  1X9M A;  1DK3 A;  4O5K A;  4OJ6 A;  4YXM A;  2G07 A;  1ARO P;  3WK7 A;  4UBB A;  4KMU A;  3R9K A;  1U49 A;  5J2A A;  3MFH A;  4QZI A;  1RYS A;  4J9L A;  5AKI A;  4RQ5 A;  4O3R A;  5HR6 A;  4UW9 A;  1NKB A;  7ICI A;  9ICQ A;  3MDA A;  1B43 A;  2B21 A;  3L3F X;  3BDP A;  2CPR A;  2KIW A;  2KKV A;  4P2H A;  4NWI A;  2KHQ A;  1XSL A;  3QEB Z;  2HHX A;  5EE0 A;  4ECT A;  4QZH A;  4TUS A;  1KBU A;  2H3Q A;  4O3O A;  3M9N B;  3CW2 C;  4RQ6 A;  1ZXI A;  3HWT A;  4OCZ A;  1L6N A;  4NM2 A;  5KL8 B;  2JZB B;  1Z00 A;  4QZA A;  4PL1 A;  4PHP A;  3V7K A;  2DKZ A;  1RYR A;  2I6X A;  3GV7 B;  4B9M A;  1NKC A;  2BDP A;  2ZTD A;  2BPG A;  2YY6 A;  4KLG A;  4MFC A;  2IOH A;  4CGZ A;  1B4F A;  3ZDC A;  3MR3 A;  3JPO A;  4IQU A;  3UMG A;  4PGQ A;  3K1Z A;  4O3N A;  3H40 A;  3HIL A;  4DCC A;  1T94 A;  2NRV A;  4DQQ A;  1RM6 C;  2AHO B;  3I1Y A;  2LM4 A;  3NRZ A;  4JK1 A;  5BOM A;  5AM3 A;  1ZQJ A;  2ZJ8 A;  4DEZ A;  5KT6 A;  9ICX A;  4DL4 A;  5AKK A;  3PV8 A;  2KG5 A;  1D8L A;  3C1Y A;  1N60 A;  4US8 A;  3N4M B;  5KFD A;  1Q3V A;  3OGU A;  2IBK A;  1VDV A;  3S6J A;  1VLB A;  4YMN A;  5KFA A;  5IIN A;  4NJ8 A;  2WAQ F;  1MA7 A;  4FZN A;  3PR5 B;  4F4Z A;  2BPF A;  2QLT A;  3RJG A;  5BOL A;  2MAX A;  1ZQV A;  4DOA A;  3ZDA A;  1Y88 A;  1NZB A;  3V7J A;  5KFE A;  1NK6 A;  3SR6 A;  5DDM A;  4KLM A;  1WWV A;  2LYH A;  3AQF A;  4YXJ A;  2I9G A;  4ED0 A;  1SXE A;  5AKY A;  1DRG A;  3D6J A;  3HT3 A;  8ICU A;  1ZQ1 C;  4PPX A;  2E8N A;  1UT5 A;  4DF4 A;  5AKH A;  4ECU A;  5KG3 A;  1PZN A;  3KD3 A;  4LZD A;  2XGQ A;  3GV8 B;  3RJK A;  4PHA A;  5KG5 A;  1SL1 A;  4G3I A;  1PVP A;  1NK7 A;  8ICY A;  5G5G A;  2IOF A;  2HBM A;  4I2J A;  3OHB A;  2UVV A;  3KHL A;  2K89 A;  4JV0 A;  4BGD A;  4RQ0 A;  1KFD A;  1BNO A;  2ATL A;  2LHT A;  8ICF A;  1S77 D;  5DDY A;  5KFP A;  2BPC A;  4DSI A;  1HIW A;  4UAW A;  1RXW A;  3V6J A;  3AMZ A;  3KHR A;  2WF8 A;  5DB9 A;  2HBK A;  2AGO A;  3ZDD A;  1S0N A;  5KT7 A;  1MQ3 A;  1KEJ A;  2ALZ A;  1KRP A;  1L8O A;  5KT2 A;  4NY8 A;  1IXR A;  1K5O A;  4UB4 A;  2XGP A;  7ICK A;  1KKX A;  4IL6 U;  4YR3 A;  3PR4 A;  5C0Y A;  4O0I A;  3SZ2 A;  5L9X A;  1JRO A;  1L7P A;  3C2M A;  2D8C A;  3AQE A;  4P4M A;  8ICN A;  2QAR B;  2PFO A;  4I2B A;  1KSP A;  2FLP A;  3PZP A;  1LB2 B;  9ICA A;  3T5K A;  1Q3U A;  2WB1 C;  3LDA A;  4DSK A;  3T5J A;  4DL7 A;  5ALW A;  5JUM A;  3KKA A;  1DGS A;  1TAQ A;  3RAX A;  4RUC A;  1L3S A;  1KL9 A;  4UB2 A;  1LVH A;  3LWL A;  2VJ4 A;  2ZTE A;  2R8H A;  4CRX A;  8ICB A;  1HEK A;  2YTU A;  1U9L A;  2OM6 A;  5J0P A;  7ICL A;  2KNJ A;  4FZL A;  2F3N A;  2KSO A;  1TVA A;  1XO0 A;  3QX7 A;  8ICC A;  1V9P A;  2EH9 A;  8ICP A;  5ALL A;  5AKE A;  1PK1 A;  5EOZ A;  2BCS A;  2Z7J A;  1CUK A;  5AK6 A;  3L5K A;  4UQG A;  3OJS A;  4ECZ A;  4LZG A;  4EX6 A;  2OEH A;  4ED7 A;  4ECX A;  2JH1 A;  4RQ7 A;  1WWU A;  1JX4 A;  3G6Y A;  2YB1 A;  2FLL A;  2F1I A;  4KLE A;  2K4H A;  2EQY A;  4QZF A;  3RRG A;  3G6V A;  4JB3 A;  5ALV A;  1FFV A;  5AKX A;  4WJ3 B;  3RJE A;  4Y2J A;  3RBE A;  4QW9 A;  4TUQ A;  2G5H B;  3C29 A;  3V6H A;  4KLU A;  1ED1 A;  2ZUB A;  3ED5 A;  5AIA A;  4RQ3 A;  4YN4 A;  1S0O A;  3BQ7 A;  1N5X A;  4I2I A;  5ALJ A;  4ED3 A;  1JI7 A;  4RNO A;  2HOQ A;  2KVS A;  4FS2 A;  3NS1 A;  2JGA A;  1ZQT A;  2ZIU A;  5KT5 A;  5KT3 A;  3KKA C;  3EYZ A;  4Y2P A;  2HW3 A;  2XO7 A;  4DQS A;  3IRU A;  3RB3 A;  3L4P A;  4GXI A;  2RP5 A;  5JTI A;  3HRD D;  1JIH A;  2EAO A;  2KOB A;  2HHQ A;  3JPN A;  2CRX A;  1CRX A;  7ICQ A;  3ETR A;  3RJJ A;  2H3I A;  2ZIX B;  2C28 A;  1ZQF A;  4KLI A;  3FYH A;  4M9J A;  4YD2 A;  4M47 A;  2KEY A;  2RDI A;  2I5H A;  8ICJ A;  3EUB 2;  1Z4N A;  2JV3 A;  3J81 j;  2EAM A;  4IQW A;  4MHV A;  5EE9 A;  2AGQ A;  1X9X A;  4DF8 A;  3V6K A;  1MSW D;  5EE3 A;  1SIJ A;  3MDC A;  4QZ9 A;  1ZRN A;  4I2F A;  4UAR A;  5JU5 A;  3SEI A;  2KV2 A;  1JN3 A;  4QWD A;  4E0D A;  4NLN A;  4QWC A;  3KHH A;  4FZM A;  2XC9 A;  1KN5 A;  4B9V A;  1HUZ A;  5J0S A;  2R8G A;  4NXZ A;  4R65 A;  2A3V A;  8ICI A;  1DOQ A;  3JPQ A;  3JPP A;  4K4G A;  5J2I A;  1J2M A;  4R8U B;  1ZQC A;  1QTM A;  3PML A;  2R8J A;  1L3T A;  3RRH A;  4RNM A;  5DG9 A;  2IMW P;  4DWI A;  2KE7 A;  5ALU A;  4AYB F;  3PMN A;  7ICM A;  4Z6F A;  5DKW A;  3PVX A;  3BQ1 A;  5AK3 A;  2RHF A;  1PK3 A;  1KTQ A;  1D9D A;  3NGD A;  8ICR A;  4R66 A;  2JZB A;  4YG2 A;  3TAR A;  1YZ6 A;  2XY7 A;  3K1R B;  1ECW A;  5J29 A;  3KFU F;  2VA8 A;  2R18 A;  4QZE A;  3SI8 A;  3RJH A;  2KIC A;  1ZQQ A;  1OXJ A;  4DFK A;  4OO1 J;  2AGP A;  7ICP A;  1FEZ A;  2NRT A;  5KFC A;  1A6S A;  2OYY A;  4TQS A;  1H38 A;  3TAQ A;  1SZH A;  2WTF A;  3FAH A;  5KNI A;  5AKG A;  2V4R A;  1TK0 A;  3B0Y A;  4ECS A;  4GXJ A;  3PX4 A;  3F53 A;  2W3S A;  2JMG A;  4XQ8 A;  2EAP A;  4M2Y A;  4F5N A;  5KFN A;  4EEN A;  3M1Y A;  5J2E A;  2DBY A;  2YML A;  4Y2R A;  2YMQ A;  5DQG A;  1DXS A;  5ALI A;  3WK6 A;  1ZQW A;  5KL1 B;  4OJL A;  5DQI A;  3LK9 A;  5J0Q A;  2HHS A;  2AQ4 A;  4C8M A;  4PGY A;  1XWL A;  3WKA A;  2ISO A;  3NVZ A;  4P0P B;  1SB3 C;  2ZJA A;  2QB0 B;  4NLG A;  2W11 A;  2WHE A;  5AKZ A;  4ED6 A;  4TUP A;  3PW4 A;  3IG8 A;  3NVV A;  3WKC A;  4JWN A;  2LI6 A;  1T4G A;  3EPI A;  2B0C A;  5F9N A;  5ALF A;  3NTU A;  2FMS A;  4ACO A;  1D8B A;  4ECW A;  1ZQH A;  3OPX A;  5DGA A;  3CYM A;  3O0F A;  4TQR A;  3TI0 A;  3IN5 A;  1PUZ A;  5III A;  4KX3 A;  4DFP A;  1BPY A;  4C4R A;  2W8L A;  9ICI A;  4UAY A;  4FS1 A;  3CRX A;  4Z6E A;  1Q46 A;  2KJ8 A;  1L3V A;  2KZ3 A;  3KZX A;  1QQ6 A;  3F5A A;  2G5I B;  2KJ9 A;  3QZ7 A;  2ZTC A;  3QU4 A;  3PO4 A;  4J9K A;  1T7P A;  5AI9 A;  4FE3 A;  1KFT A;  2KKP A;  1ZD4 A;  3MR2 A;  4CF3 A;  1U45 A;  5J2K A;  3T5H A;  3ONN A;  2BCU A;  9ICR A;  4UBC A;  3WK4 A;  5J8Y C;  5KT4 A;  4KN4 A;  3UXN A;  3HX0 A;  4YR0 A;  1NJX A;  5EE1 A;  3C21 A;  1MQ2 A;  4C7Y A;  5DG8 A;  5KFM A;  5KFJ A;  3ICX A;  3PSF A;  1L3U A;  2KP7 A;  5AI4 A;  4ZOH C;  2K60 A;  4JMU A;  2RLT A;  4QIW F;  1L7O A;  3PO5 A;  2PFQ A;  3LWM A;  1QSY A;  2H3V A;  4C4T A;  1B22 A;  1D8Y A;  5KG2 A;  1BNP A;  9ICT A;  3UPQ A;  1OW5 A;  4O5C A;  2HBL A;  1X66 A;  4I2H A;  5EWF A;  4Y2T A;  5KFB A;  2QAR A;  4QZC A;  5KFH A;  3SAF A;  1YZ7 A;  5GTH U;  2YN4 A;  4J9M A;  2YX8 A;  1URJ A;  3UQ2 A;  5AKJ A;  4C7Z A;  9ICG A;  3PW2 A;  3PY8 A;  2JHD A;  3PX0 A;  2UVW A;  3H0M B;  1BPE A;  4EZ9 A;  3GFK B;  3GDX A;  3UMB A;  5L1K A;  4MEY A;  3RTV A;  1ZQE A;  5KAF U;  3ISB A;  5ALH A;  1DK2 A;  1UA0 A;  4IC9 A;  4F5P A;  4Q43 A;  4F3O A;  3GQC A;  1X9W A;  4F8R A;  1XSN A;  3Q8P B;  2BHN A;  2OHF A;  1TE2 A;  5CP2 A;  4AP9 A;  4P0Q B;  2HCF A;  8ICG A;  3EZ5 A;  1ZOL A;  2Q4T A;  3GIJ A;  4FBU A;  2FE9 A;  5ALN A;  5ALQ A;  2KJ5 A;  2E8P A;  3ZD8 A;  1QH9 A;  4EEY A;  2LYB A;  4I27 A;  5JRT A;  9ICW A;  3Q8Q B;  2Y0S F;  3WKE A;  2FLN A;  2AU0 A;  2WAQ C;  2KK0 A;  4TUR A;  5KG7 A;  5ALP A;  4PZN A;  4GLX A;  4ICA A;  4EBD A;  2JEI A;  3PSP A;  4DLG A;  1TKD A;  2P66 A;  2H5X A;  2W9C B;  2UVR A;  3RB6 A;  1RDF A;  4DL3 A;  2DKX A;  8ICX A;  1N62 A;  3SV4 A;  2DL0 A;  3C2L A;  4KLS A;  3QXG A;  4HYK A;  4U6P A;  3M8R A;  3GIK A;  2NO4 A;  5D49 A;  2G08 A;  2C2D A;  3E2E A;  4QZB A;  9ICP A;  2FDR A;  8ICV A;  4I2E A;  4Y2U A;  5KFT A;  3GII A;  3GIL A;  3TAP A;  2LBO A;  2H3F A;  1M6Y A;  4PJ0 U;  1QLN A;  9ICH A;  4J9S A;  3C2K A;  5KFO A;  2XI9 A;  4ECR A;  4RNN A;  4YMM A;  4F5R A;  4I2A A;  2ZIX A;  2GWS A;  5J0T A;  1ZQS A;  5ALX A;  4QWB A;  1J2N A;  5G5H A;  2CN1 A;  1SL0 A;  4YCX A;  3BS7 A;  1ZQI A;  4UB8 U;  2KFZ A;  5DGB A;  3OSN A;  1V38 A;  4DFJ A;  8ICH A;  4XUS A;  4F4X A;  3M9M B;  1TK8 A;  2MA1 A;  3V7L A;  5AM1 A;  3JPR A;  1ZQN A;  4O3S A;  1NKE A;  2BR0 A;  1JRP A;  2LMR A;  3G6X A;  4I29 A;  1N48 A;  2ASD A;  2VAN A;  4J9O A;  4F5Q A;  2BQU A;  2ESE A;  3H0R B;  3C23 A;  2GO7 A;  3SAH A;  4YQW A;  2ZUC A;  2XIC A;  3M6K A;  5HR7 A;  8ICM A;  3B0X A;  1Z4O A;  5J0R A;  1ZQZ A;  5A0L A;  1BPX A;  2E5S A;  2RRD A;  4R8U A;  3DEE A;  5KFX A;  2UVU A;  4RT2 A;  5ALO A;  4KLD A;  2LM1 A;  2KTQ A;  5KTQ A;  5HP4 A;  5DB7 A;  4J9R A;  5DBC A;  1S5L U;  4JV1 A;  3TAN A;  3WKD A; 
#chains in the Genus database with same CATH homology
 1X66 A;  1PK1 B;  2EAN A;  2QAR A;  2ES6 A;  2Y9T A;  2Y9U A;  1V85 A;  2LPE A;  3TAD C;  1LKY B;  1UCV A;  3H8M A;  2KG5 A;  2L5Y A;  3TAD A;  1SXD A;  4RQN A;  2QKQ A;  3BQ7 A;  2QB1 A;  1SV0 A;  1SV4 A;  2KE7 A;  4NJ8 A;  2D8C A;  1JI7 A;  1X40 A;  2QAR B;  5J8Y A;  1PK3 A;  3IDW A;  1RG6 A;  3KKA C;  1SV0 C;  5F3X B;  1SGG A;  3K1R B;  3BS7 A;  2B6G A;  1WWV A;  3KKA A;  1V38 A;  5L1M A;  1B0X A;  5JTI A;  5J8Y C;  1SXE A;  1OXJ A;  2EAO A;  3SEN A;  2FE9 A;  1COK A;  2F44 A;  2E8P A;  2E8N A;  2YTU A;  2LMR A;  5JRT A;  5KNI A;  3BS5 A;  2F8K A;  2F3N A;  2KSO A;  2QB0 A;  4PZN A;  2ESE A;  2K60 A;  4NL9 C;  2DKZ A;  1PK1 A;  2EAP A;  2K4P A;  2JV3 A;  2EAM A;  4NL9 A;  2E8M A;  2E8O A;  4MHV A;  1B4F A;  1DXS A;  1LKY A;  1X9X A;  2GLE A;  2KIV A;  1Z1V A;  2DKX A;  3TAC B;  1F0M A;  2DL0 A;  1UQV A;  1WWU A;  3BS5 B;  3HIL A;  4IS7 A;  2KMD A;  4PZO A;  1OW5 A;  2KSO B;  2QB0 B;  5JU5 A;  3SEI A;  4RQM A;  1KW4 A;  2D3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...