2DKZA

Solution structure of the sam_pnt-domain of the hypothetical protein loc64762
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
GSSGSSGPWQPPADLSGLSIEEVSKSLRFIGLSEDVISFFVTEKIDGNLLVQLTEEILSEDFKLSKLQVKKIMQFINGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SAM_PNT-domain of the hypothetical protein LOC64762
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords hypothetical protein LOC64762
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2dkzA01
2D8CA 3TADC 3BS5B 2KSOA 2KIVA 3SENA 2KMDA 1RG6A 2GLEA 1PK1B 3SEIA 5KNIA 1LKYB 1OXJA 2LMRA 1X66A 2JV3A 1KW4A 2FE9A 2LPEA 3BS5A 4PZOA 3KKAA 1PK1A 2K60A 2KE7A 5JTIA 3TADA 2DKZA 4NJ8A 1F0MA 2EAPA 2KG5A 2QARA 2E8MA 1SGGA 4NL9C 2EAMA 2QB1A 1PK3A 1B0XA 2ES6A 1X9XA 3TACB 2DKXA 3H8MA 1Z1VA 1V85A 1LKYA 3BS7A 5L1MA 3HILA 1SV0A 1DXSA 2Y9TA 3KKAC 2ESEA 5F3XB 2F44A 4IS7A 4NL9A 1SV4A 1SV0C 3K1RB 2DL0A 5JRTA 2EAOA 4RQNA 1B4FA 4PZNA 5J8YC 1OW5A 1SXEA 2L5YA 1WWVA 2D3DA 1UCVA 2KSOB 4RQMA 2K4PA 1COKA 3IDWA 5JU5A 2F3NA 2E8PA 2EANA 2E8OA 2YTUA 5J8YA 2QB0B 2Y9UA 1X40A 3BQ7A 2E8NA 1V38A 2QB0A 2B6GA 2QARB 2F8KA 4MHVA 1UQVA 2QKQA 1WWUA 1SXDA 1JI7A
chains in the Genus database with same CATH superfamily
4C4SA 3SQIA 2Y0SF 2EZZA 1NK7A 1XNSA 1ZQHA 4F4YA 1S0NA 3K4GA 2ZIUB 2F8LA 1SZHA 3EYZA 1AROP 1S10A 2FLLA 1Z00A 4TURA 1OXJA 2XIDA 5DKWA 5J2HA 4RNMA 3RJHA 2ZJ8A 4EENA 2OWOA 4UQGA 1Q8KA 4CCHA 4O3NA 2ODGA 1L7PA 5KFTA 5JTIA 4J9MA 4B9LA 2LYHA 2JGAA 1KFDA 1TK8A 5TISU 3V72A 1IXRA 2EAMA 2QB1A 4ED6A 5AKXA 3TARA 3TACB 3N7PD 3GQCA 1ZJMA 2F77X 5J2FA 5ALHA 8ICSA 1V85A 2KV2A 3IV6A 4DCCA 2CN1A 2OYYA 2AGQA 3LWMA 5L1MA 1SIJA 3HX0A 4I2JA 4C8NA 2JH7A 2JZBA 4UB1A 3WK6A 1RQLA 5KG7A 4F4XA 3E58A 8ICTA 2YMQA 1M6YA 4QZHA 4OO1J 5D49A 3THVA 4QWBA 1NJZA 1Z4NA 1BPZA 3SAFA 2D3DA 2ATLA 3ZI4A 2P35A 1X9SA 3N4MB 2E8PA 4QW9A 3H0MB 4F91B 4RQ8A 3IHQB 2E8NA 4ACOA 3M7DA 3H0RB 2F8KA 1SKRA 2DBYA 5KFFA 5KAFU 2QKQA 4ED0A 3HT3A 1U47A 1OUQA 2HDOA 4YFKA 1NJXA 4DQPA 2B0CA 3OPXA 4ED7A 4YQWA 2KMDA 1U9LA 5AIAA 2BCUA 1ZQDA 2MA1A 1IG6A 2AU0A 1PK1B 3ISDA 4F71A 2E3TA 5HR7A 1ZQBA 1JX4A 4I2IA 2WB1F 3TFSA 5KFZA 3D6JA 1T7PA 3ORYA 7ICMA 9ICBA 4KLUA 4Q45A 2EZYA 1VLBA 3AU2A 4P2HA 5F9LA 3CNHA 4EYIB 4KLLA 5AM2A 3PSTA 4PGYA 2DKXA 3KOOA 2WF6A 1ZQNA 3C29A 4DF8A 2K8BB 3KD3A 5ALRA 3Q8SB 4YMNA 3QU7A 5G5HA 1HIWA 2G09A 3V6JA 3ZDBA 2AQ4A 1LB2B 3V6HA 1SWWA 4KMOB 2KKVA 4Q8EA 3IP4B 3Q8QB 4DSFA 4KLJA 1LV5A 2HCFA 2XGPA 4AYBF 1SB3C 4J9OA 3PSPA 4JMUA 4EZ9A 2W8LA 5AM1A 1N56A 2WAQC 3SI8A 1UT8A 3C2KA 4MFCA 5KFAA 4FZNA 3TKAA 2CPRA 1XU4A 4A8EA 1ZQ1C 4JV2A 1MA7A 3ALRA 4DOAA 1SXDA 2RLTA 2D8CA 3EPGA 4F5OA 2LM1A 3N7SC 4KITB 2F1HA 4FE3A 4GIBA 4Y2XA 2ZTCA 2W9CA 4GXJA 1NK8A 4YG2A 1RG6A 3H4DA 5AK6A 8ICGA 2VJ4A 2NRXA 5AI9A 3SEIA 2AH5A 4B9VA 3M8SA 1PZNA 5J29A 2RP5A 3M6KA 4KLDA 1ZQLA 1X66A 1ZQIA 2Q0ZX 4DL5A 2GO7A 8ICCA 2K60A 4QNLA 5TZVA 4NJ8A 4QZEA 2Y1IA 2KEYA 3FC4A 3PY8A 5ALVA 2EQYA 2ZIUA 3G6XA 5J2GA 5HP4A 1ZD3A 3RH5A 3OSPA 4PGQA 2RDJA 8ICLA 2XY6A 2AGOA 1K1QA 4F2RA 1SV4A 2YMLA 3C2LA 2PI4A 2ASLA 2H5XA 1A6SA 2ZIVA 8ICMA 3VCBA 3Q8KA 1B4FA 3VC8A 2HSZA 1SXEA 2BQUA 4FFDA 1MQ2A 5ALKA 2KJ8A 3AQFA 2J6UA 5KT4A 1X9WA 4RQMA 4F72A 2BCRA 2H3VA 3OTQA 3IDWA 4KLTA 2F3NA 4ED3A 4JV0A 9ICCA 4P4MA 2R8JA 4MFAA 4F2SA 1J2NA 4YD2A 4XRHA 4GXIA 1D9FA 3ZDAA 2C2EA 1UPHA 2VANA 3SV3A 5IIMA 4ELVA 5J2AA 1UQVA 4Q8FA 9ICMA 2KICA 3L3FX 1QSLA 3BS5B 3AUOA 9ICNA 4C8MA 5HMMA 3D2QA 5BOMA 4UBCA 5KFKA 4UBBA 2KN7A 9ICVA 2PFPA 5ALXA 5ALYA 4DQRA 1S9FA 4IQTA 2HBJA 3AQEA 4P0QA 4M04A 9ICSA 3C5FA 4AP9A 2LPEA 9ICLA 2ZIWA 2WF7A 2P6UA 1WCNA 4P0QB 2K4IA 4ECTA 4EELA 4I2AA 4RZRA 4J9NA 4CRXA 4OD0A 4ECWA 5AM4A 3I1YA 1UHUA 3JPQA 3DV9A 2JEJA 3NS1A 3HILA 3PMLA 3K1ZA 2DUYA 4R66A 1Z19A 4PL2A 3N97B 3WK8A 2IBKA 3GV5B 2JHDA 2BCVA 4IL6U 2FPKA 1OW5A 3MFHA 5AIBA 4EZ6A 1J2MA 3HPOA 1KDHA 4KLMA 5KG0A 2FMPA 2MAXA 5AKYA 1RXWA 1DGSA 1WWVA 3RB3A 3M9OB 3BQ2A 2IHMA 3RBEA 3M1YA 4FZMA 2HHWA 8ICQA 3NUQA 4YXJA 3RR7A 2LKYA 3G6VA 3SR6A 2WF9A 5B66U 3MR2A 4LJXA 1QQ5A 2ZIVB 2A1JB 2B21A 2OM6A 4UB2A 3MR3A 5KFDA 2KHQA 2KOBA 2JEIA 2KFNA 4YCXA 3WKCA 1X6JA 3PVXA 3HWTA 1XSNA 1WWUA 4F3OA 1ZQAA 1K1SA 2EH9A 4DWIA 2G5IB 1ZD5A 1AQ6A 4M6WA 1UT5A 2NO5A 5AK4A 5KG3A 5B5EU 4DSIA 4YR0A 2O6KA 3E0FA 4KX3A 9ICPA 3H8WA 4DFPA 3RR8A 4DSKA 2OCEA 3JPRA 4J9KA 2BHNA 1RM6C 4KLEA 2W11A 4QZIA 2W9CB 5KFWA 5KT3A 4F5RA 3HKZC 1C20A 4BX9C 2DFLA 2H3QA 1ZQOA 3H8MA 3GDXA 5AM3A 3J81j 2M0NA 2IHNA 5H2FU 1DXSA 3BQ1A 3WK7A 4Z6EA 2N1RA 1HJPA 4JK1A 3CW2C 5ALQA 4QWCA 4RQ4A 1DK2A 3ONNA 3H8JA 4QZDA 1FFVA 1V9PA 2ZG6A 1Z3EB 1ZRMA 1JUDA 2G0AA 4K4GA 8ICXA 1DK3A 1S0VA 1JALA 4P4OA 5DB9A 2ALZA 3CP8A 5KFCA 2QLTA 1QSYA 2ZJAA 1KBUA 1ZQMA 3TAQA 4PJ0U 2EZXA 4ED2A 2QB0B 9ICFA 5E79U 3LVWA 1L3VA 3BQ7A 3F2DA 4Y2VA 4PPXA 2K89A 2QARB 2W9MA 4QZGA 3ED5A 3V6KA 3NVZA 3PZPA 3CYMA 1U4BA 2VIXA 3KFUF 1L5UA 5KFHA 4PHPA 7ICPA 4NWIA 2MRLA 4C4RA 2YMPA 4M9JA 5DLFA 5J2CA 3ETRA 1COOA 1RYRA 2BKEA 2PKEA 4BDPA 3IN5A 5CP2A 3ICXA 4IRCA 1NOMA 5ALEA 4RUAA 2WAQF 1JMSA 1BPXA 3Q8MA 3KKAA 5ALPA 3T5JA 2KZ3A 4XQ8A 3T5LA 4DSLA 2DKZA 2KG5A 2C22A 4PH5A 4I2EA 3QNMA 1WG8A 3FAHA 8ICWA 5HHIA 9ICIA 3EPIA 3TAPA 4J9SA 5KG4A 2VA8A 3MGHA 3GV7B 5KG1A 1ZQEA 1NK9A 4C4TA 2WTFA 4J03A 3RB4A 3QZ7A 2GOLA 2F1IA 5AM0A 4KTQA 3RH4A 4CF4A 9ICXA 2JXJA 2XY5A 2PFQA 4RU9A 1QQ6A 3AEVA 4I28A 2WHEA 1XO0A 4OJOA 7ICKA 4EEKA 1TV9A 4UARA 5DBBA 1T3QA 4YXMA 3NRWA 3KTQA 3RB6A 2HHXA 2KVSA 2FI1A 5CB1A 1Z1BA 2ZTDA 4FO6A 3ZDCA 9ICKA 2WF8A 1JROA 1F5SA 4DS5A 5KFQA 1S97A 4ICAA 8ICHA 3ZD8A 2A1AA 1LVHA 4M2YA 4Y2PA 3QXGA 2HVHA 4WJ3B 2F2AB 4EBDA 1L8OA 5ALLA 4QW8A 2FMQA 1SZPA 5AKIA 5IIKA 8ICVA 3BZKA 3DDHA 7ICIA 2V4QA 3JPSA 5KAIU 4DFKA 1ZQJA 2J6SA 1N5WA 5DGBA 4I27A 2ISOA 2JH1A 5ALOA 1LKYA 1PUZA 5KT6A 1MC8A 4EEYA 4C8OA 3C23A 8ICIA 4GC6A 4O3QA 4QZ8A 4CF3A 1RPLA 4R65A 4I2CA 3PMNA 3PX6A 4GLXA 3NVVA 2KSOB 2R8GA 3L5KA 1CUKA 5KT7A 5D4BA 2KZMA 2WF5A 2FPMA 2YMMA 4DFMA 1PVPA 1JXEA 1MN8A 2NRWA 2KZZA 7ICVA 5ALZA 1V38A 5EE3A 1L3TA 1J97A 3RH6A 4DL6A 1XO1A 5J2JA 4GC7A 5AK3A 2UVRA 9ICTA 2LI6A 2BQ3A 2KJ9A 5DQHA 2HOFA 5J0OA 1Q46A 8ICBA 3LWLA 4I2BA 4F4WA 1ZQSA 2GLEA 3GZFA 1SKWA 3NASA 4MF2A 2PXIA 4UB3A 9ICAA 5KFSA 4QZAA 2H3ZA 3GU3A 4IQVA 1S0MA 2F76X 1N61A 1GO3F 2XO7A 5CJ7A 1JN3A 5EWFA 1HEKA 1PK1A 5J0YA 5AI6A 4FS1A 1RYSA 3C21A 4CF5A 1NZPA 1SGGA 1S5LU 4F5NA 3B0XA 3WK4A 2BPGA 1KFTA 2FMSA 1Y88A 4DOBA 1TE2A 5J0PA 1TVAA 1QH9A 4F4KA 4Y2QA 4M9LA 4AYBC 4BGDA 4DFDA 3KKAC 4I2FA 2ESEA 4IS7A 2HHSA 3QYPA 4QWEA 2W7PA 4NM1A 2IOFK 2W3SA 4I29A 4PZNA 4DQQA 2L5YA 3M9MB 1NJYA 3UMCA 1RXVA 4B9UA 4C80A 3NGDA 2JZBB 4GFJA 5CWRA 5J2BA 4DL7A 5IIJA 3RJJA 4EBCA 5CHGA 2HHQA 3PW4A 1F44A 1X40A 1CI4A 3D2SA 2HMXA 2VJ5A 4YR2A 3HW8A 8ICPA 2P66A 3F53A 4MHVA 3JPOA 1TFRA 1BNOA 1YZ6A 2NRTA 5ALFA 4O3RA 4K4HA 2EDUA 2JR5A 2KIVA 8ICZA 2LYBA 3SENA 5IILA 2R18A 2IOFA 4ECZA 1N2XA 4IRKA 1YT3A 3MABA 2BDPA 2DQNB 1PVQA 3ETLA 4US8A 3SAGA 3OJSA 1SKSA 3IRUA 3QEBZ 3A0HU 4O5EA 1ZQVA 3BZCA 4O9MA 2V4RA 2W9AA 2XI9A 1ZQTA 5EE1A 1QCKA 2HHTA 2HOQA 5CRXA 1P7DA 1KQQA 4I2GA 1RDFA 1L7OA 2ZIWB 4QZCA 5KFRA 2NV3A 3AL0B 1KRPA 7ICQA 1EXNA 3MGIA 4QWDA 3LDAA 3H0LB 3NRZA 5J2KA 1RYUA 4JV1A 2JRZA 3F2CA 3ZD9A 2BCQA 4G3IA 2HBMA 4UB4A 4RUCA 1BPDA 3V7KA 5AI8A 5AHXA 1Q3UA 2KFZA 3BQ0A 3T79A 5KFIA 3SYZA 3H4BA 2I1QA 4DO9A 1ZQXA 4CE6A 3O0FA 2MSNA 4DSEA 1ZOLA 5J2IA 1D9DA 4OJ6A 5DB8A 3T3FA 2W55A 2BDUA 1TAQA 3RBDA 2EANA 2YTUA 3TFRA 4QIWF 2HHUA 4DS4A 2GWSA 1XSPA 4O5KA 4R64A 1L6NA 4CGZA 3RJGA 3B9JA 3OSNA 4B9TA 5EOZA 2BZFA 5DLGA 4F8RA 1ZD2P 2XC9A 2KSOA 4NM2A 3M8RA 4F5QA 4Y2JA 1DGJA 4XA5A 2MU2A 4CNQA 2ZTEA 4RQ5A 1IM4A 1ZXIA 2XGQA 4UB8U 1ZQUA 2G5HB 2MUTB 5KFMA 3ZDEA 1TKDA 4ED1A 5JUMA 5AKJA 4YD1A 4PZOA 5KFOA 2ISPA 4FZLA 1S0OA 4DSJA 1TK5A 3PR5B 4JB3A 4KN4A 2JMGA 3QU4A 4RPZA 4C0ZA 1A0PA 5GTHU 5G5GA 2KTQA 4YVZA 1YZ7A 1NKBA 3L4PA 3PSIA 4KLQA 2D6FC 5KL1B 2I9GA 1SV0C 3K1RB 1RZTA 9ICJA 4OJPA 5ALJA 5K4LA 3RRGA 5KFUA 4DF4A 5AICA 4R8UB 4Y2RA 3R9KA 1NNLA 5KFGA 4OJLA 3UXNA 4DL4A 4O3SA 4MEYA 4GXKA 1Q3VA 1NZBA 3C1ZA 7ICHA 1B43A 3C5GA 4Y2TA 2ZXHA 5L1JA 1BVSA 3V7LA 5J0UA 4NLCA 3GV8B 5L9XA 1JIHA 3BDPA 4R63A 3PW7A 4KLHA 4Z6DA 3LYSA 3MR5A 3QUCA 4B9SA 4BWJA 2DPIA 2QB0A 1QSSA 1TAUA 3RJEA 4CDGA 2K4EA 4DL3A 3WKEA 2FE9A 3HJEA 1Z00B 4FS2A 9ICGA 1T4GA 5J0TA 4IRDA 5D46A 3AU6A 1D8LA 3T5KA 3SZ2A 7ICRA 1CRXA 2ZJ5A 2IOHA 2LHTA 1MSWD 4NLNA 1L3SA 3QUQA 1D8YA 1LKYB 3PW5A 1L7NA 3QZ8A 2KNJA 2JEFA 3BS5A 2VKQA 5DBCA 4IR1A 5DDMA 4TQRA 5KT5A 1O03A 4RQ6A 2BPCA 5BOLA 3EZ5A 4P4PA 1BNPA 4PL1A 1ZETA 2C2RA 5CA7A 2C28A 5KFXA 3ZDDA 5AI5A 3HP6A 2K4HA 3EWAA 1ZQRA 4Y2UA 3KHGA 2Y1JA 1N48A 3C1YA 1U48A 4Q44A 5L1LA 2NRVA 2R8KA 2K8AA 8ICKA 3GIKA 3PO4A 3MFIA 3QU5A 4UATA 3PR4A 3CRXA 3RTVA 5F9NA 4EX7A 4NLGA 3HKZF 2ZIXA 4ECYA 2JEGA 4M0AA 3UXOA 4MF8A 1TK0A 4KLSA 2WB1C 4KLFA 2YB1A 2E5SA 5AKKA 4O3MA 1K5OA 2CXYA 3BJYA 3RAXA 4M9HA 1ZQKA 4M9NA 4M47A 4C8KA 2OEHA 3GFKB 5KTQA 4E0DA 1BPBA 3UXPA 3N7RC 3TADC 1WUDA 2NYVA 3F5AA 2UVVA 1TAMA 4ECSA 4US9A 1VDVA 3S6JA 4ZOHC 4EX6A 4MEXA 2PMZC 1L7MA 4RNNA 2PFOA 3G6YA 4DLEA 1FFUA 1NK4A 1N5XA 2KP7A 2IA6A 2VA2A 4KLIA 4F93B 5KT2A 1NKEA 4YR3A 1NK0A 5DDYA 2RHFA 2HBLA 3WK9A 4RQ7A 8ICJA 2A1JA 4RPYA 4RQ3A 3WKDA 5GTIU 1DRGA 1F0MA 2EAPA 1T3NA 3PW0A 7ICSA 2W3RA 4YMMA 1A77A 3UM9A 4NL9C 5HNKA 1SL2A 2ES6A 3M6ZA 3F2BA 1ED1A 2KD1A 2MUTA 3BS7A 9ICQA 5DQGA 5J0RA 2E1EA 1SV0A 5C0YA 5AI4A 2GH1A 4NL9A 3H40A 2NO4A 2KHVA 5DBAA 2BR0A 3RJFA 9ICHA 4RQNA 4TUQA 1H38A 4QJFB 5ALIA 2W9BB 1URJA 1ZD4A 3KZXA 1NI3A 2W8KA 2AXTU 2W9BA 1XS9D 3RAQA 5J0SA 5IINA 2XICA 2Z7JA 3FM9A 2OXOA 4BXOB 4P0PA 1WYGA 5KL8B 4X5VA 5KFYA 5DQIA 4IQWA 1S76D 2E8OA 5EE0A 5J8YA 2XVTA 4UASA 3PW2A 1KTQA 2FDRA 3NTUA 2G06A 8ICUA 2E1FA 4BUGA 4F92B 3PX4A 3E2EA 3PV8A 2FJ6A 4R8UA 3FDSA 2FPLA 2PMZF 4Y2SA 1BPYA 2LM4A 4HAIA 9ICUA 3EW9A 4M9GA 3OJUA 4UAZA 2BCSA 4Z6CA 4RQ0A 1VJ5A 4NXZA 8ICYA 2YX8A 5KFBA 1QLNA 2LMRA 8ICOA 1RQNA 3QUBA 4ECRA 5FP0A 3TQ1A 1N63A 5ALNA 2KJ5A 2ZXIA 5IIIA 4UB5A 1S8OA 2M9NA 4U7CA 3KHLA 4C7YA 2DF4B 1SWVA 4QZBA 3JPTA 2QARA 7ICGA 1X9MA 3NVWA 1D8BA 3MR6A 3QU9A 5DGAA 4KN7A 3N28A 8ICEA 1PVRA 7ICLA 1HUZA 4PHDA 2Y9TA 3DEEA 4NLBA 3RJIA 3SD7A 5ALDA 4M6WB 5J0QA 2HBKA 5J0XA 2BPFA 5J0WA 1O08A 4BWMA 3GIMA 4C7ZA 5J8YC 3UMGA 3PSFA 4J9PA 1FIQA 4OJ5A 4DOCA 2NRZA 3LVVA 4QZFA 1COKA 1IV8A 5KG2A 4UAWA 1KEJA 1V97A 3BQTA 1ZQPA 4ECUA 2H3IA 2H3FA 5DG9A 4NLZA 1A76A 3WKBA 5AKZA 7ICTA 3AMZA 1ZQYA 4RNOA 2F1JA 2W04A 5ALUA 1JI7A 5AKGA 4JUZA 1N60A 9ICWA 4RT3A 5KFVA 2C2DA 1XWLA 4PHEA 3KBBA 3MC1A 4C8LA 4O3OA 1B22A 2K8CB 3RFAA 1BGXT 1DOQA 4J9QA 5HR6A 3RF9A 2ASDA 4QZ9A 4KMUA 4LZDA 4Q43A 1XC9A 1KW4A 2W7OA 2W03A 2ZIXB 3F5EA 4UAVA 5EE9A 5ALGA 2UVUA 5L1IA 1T8EA 9ICRA 2E8MA 4F5PA 4DFJA 3JPNA 1PK3A 5DB6A 1ZQFA 2HVIA 1S77D 3H8SA 5L1KA 5ALSA 3KZIU 1N62A 4JWMA 1KN5A 4IC9A 4ZH4A 4LVSA 3LK9A 1UA1A 4HYKA 1SL1A 5CEHA 2PFNA 4Z6FA 5JRTA 2EAOA 1ECWA 3ISCA 1BPEA 8ICNA 5KFLA 2P6RA 2I6XA 4KLOA 1KL9A 1UCVA 4KX5A 1U45A 2RDIA 7ICNA 2FLPA 5C5JA 3D2NA 7ICOA 4OCZA 3OHBA 2XY7A 3WKAA 2KVCA 4XUSA 3B0YA 4J9RA 3KHRA 2RRDA 1U49A 1L8LA 4ELTA 3JPPA 3SAHA 2IMWP 2DWQA 4F4ZA 2V9WA 3K75D 3RRHA 2J6TA 1QQ7A 1NK5A 1ZQZA 3GIJA 5HMLA 1L3UA 4QWAA 4Y2YA 2HOIA 4PHAA 3RJKA 1NJWA 2CRXA 7ICUA 4IQUA 1NK6A 5J2EA 9ICOA 4FBTA 3SV4A 7ICEA 2YQEA 5EWGA 3U26A 3H7IA 1X42A 3WK5A 1C7YA 3NVYA 1KFSA 3MDAA 1ZQWA 5HHHA 3I28A 3Q8PB 2KE7A 3TI0A 4ECXA 3UPQA 3QEAZ 2ZUDA 1ZJNA 3WU2U 3FYHA 3EUB2 2AQ0A 4BXOA 4P0PB 5KFJA 5KG5A 4ECQA 4J9LA 5AKLA 4NV0A 1FEZA 1Z1VA 5KFPA 5AI0A 4UAYA 5F3XB 2F44A 1JRPA 4RT2A 3C28A 4O0IA 1ZRNA 2PI5A 1T94A 3UQ2A 4RQ2A 9ICEA 1QTMA 3KHHA 2AHOB 4UAUA 2W43A 1FO4A 3QX7A 4ECVA 8ICAA 2YY6A 4QIWC 2LYAA 2FLNA 1HUOA 4EYHB 1KLNA 4ELUA 3GILA 2BGWA 4YMOA 1ZQGA 3MBYA 2W54A 3QUTA 5AKHA 4UB6U 4JWNA 1WCLA 5T14A 2R8HA 3QU2A 8ICRA 5ALTA 2BQRA 5IIOA 1NKCA 2B6GA 2HW3A 4YP3A 7ICJA 1UA0A 3IG8A 5BPCA 1ZQCA 1Z4OA 3Q8LA 4DLGA 4RPXA 3IM1A 1JXLA 4B9NA 2KKPA 4I2HA 2VA3A 3OHAA 1CEZA 4BJQA 4USAA 3T5HA 5DG8A 2ASJA 2LBOA 3GIIA 2Y0SC 3TANA 4NLKA 2OH2A 5KNIA 3M9NB 3MDCA 4DQSA 4DQIA 5KFEA 5EWEA 5DG7A 4LZGA 4UW9A 2HI0A 2JV3A 4I2DA 2UVWA 4B6JA 4KLGA 2ZUBA 3TADA 3V7JA 2RQ5A 4O3PA 8ICFA 2DGZA 2AGPA 4TUSA 3QE9Y 2KIWA 5DB7A 2AJQA 3PO5A 1B0XA 1X9XA 1X6IA 2KK0A 3OGUA 1SL0A 2DPJA 2XCPA 2I5HA 5AK5A 2YN4A 4NY8A 7ICFA 1MQ3A 2YB4A 5AKEA 3RB0A 1KSPA 1KKXA 3UMBA 1XSLA 4YN4A 3A0BU 3IG5A 1ZQQA 1X2IA 1ZYQA 3I76A 3Q8RB 3AN1A 4G9BA 1IIPA 2A3VA 4DEZA 4DL2A 2DL0A 3MGVA 4F50A 4EBEA 4B9MA 4U6PA 2ZUCA 2OHFA 2A19A 2WFAA 5ALWA 5J2DA 4FBUA 2G08A 5ALMA 3ISBA 3HRDD 4MFFA 2Q4TA 4IR9A 2K4PA 5CR0A 5JU5A 2XCAA 3PX0A 5KFNA 4K4IA 4TQSA 2R8IA 4TUPA 5AM5A 2Y9UA 4ED8A 3AM9A 3SMVA 4PGXA 2HHVA 3C2MA 5A0LA 5KG6A 3PNCA 3UQ0A 4O5CA 4RQ1A 2G07A
chains in the Genus database with same CATH topology
2D8CA 3TADC 3BS5B 2KSOA 2KIVA 3SENA 2KMDA 1RG6A 2GLEA 1PK1B 3SEIA 5KNIA 1LKYB 1OXJA 2LMRA 1X66A 2JV3A 1KW4A 2FE9A 2LPEA 3BS5A 4PZOA 3KKAA 1PK1A 2K60A 2KE7A 5JTIA 3TADA 2DKZA 4NJ8A 1F0MA 2EAPA 2KG5A 2QARA 2E8MA 1SGGA 4NL9C 2EAMA 2QB1A 1PK3A 1B0XA 2ES6A 1X9XA 3TACB 2DKXA 3H8MA 1Z1VA 1V85A 1LKYA 3BS7A 5L1MA 3HILA 1SV0A 1DXSA 2Y9TA 3KKAC 2ESEA 5F3XB 2F44A 4IS7A 4NL9A 1SV4A 1SV0C 3K1RB 2DL0A 5JRTA 2EAOA 4RQNA 1B4FA 4PZNA 5J8YC 1OW5A 1SXEA 2L5YA 1WWVA 2D3DA 1UCVA 2KSOB 4RQMA 2K4PA 1COKA 3IDWA 5JU5A 2F3NA 2E8PA 2EANA 2E8OA 2YTUA 5J8YA 2QB0B 2Y9UA 1X40A 3BQ7A 2E8NA 1V38A 2QB0A 2B6GA 2QARB 2F8KA 4MHVA 1UQVA 2QKQA 1WWUA 1SXDA 1JI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8C A;  3TAD C;  3BS5 B;  2KSO A;  2KIV A;  3SEN A;  2KMD A;  1RG6 A;  2GLE A;  1PK1 B;  3SEI A;  5KNI A;  1LKY B;  1OXJ A;  2LMR A;  1X66 A;  2JV3 A;  1KW4 A;  2FE9 A;  2LPE A;  3BS5 A;  4PZO A;  3KKA A;  1PK1 A;  2K60 A;  2KE7 A;  5JTI A;  3TAD A;  2DKZ A;  4NJ8 A;  1F0M A;  2EAP A;  2KG5 A;  2QAR A;  2E8M A;  1SGG A;  4NL9 C;  2EAM A;  2QB1 A;  1PK3 A;  1B0X A;  2ES6 A;  1X9X A;  3TAC B;  2DKX A;  3H8M A;  1Z1V A;  1V85 A;  1LKY A;  3BS7 A;  5L1M A;  3HIL A;  1SV0 A;  1DXS A;  2Y9T A;  3KKA C;  2ESE A;  5F3X B;  2F44 A;  4IS7 A;  4NL9 A;  1SV4 A;  1SV0 C;  3K1R B;  2DL0 A;  5JRT A;  2EAO A;  4RQN A;  1B4F A;  4PZN A;  5J8Y C;  1OW5 A;  1SXE A;  2L5Y A;  1WWV A;  2D3D A;  1UCV A;  2KSO B;  4RQM A;  2K4P A;  1COK A;  3IDW A;  5JU5 A;  2F3N A;  2E8P A;  2EAN A;  2E8O A;  2YTU A;  5J8Y A;  2QB0 B;  2Y9U A;  1X40 A;  3BQ7 A;  2E8N A;  1V38 A;  2QB0 A;  2B6G A;  2QAR B;  2F8K A;  4MHV A;  1UQV A;  2QKQ A;  1WWU A;  1SXD A;  1JI7 A; 
#chains in the Genus database with same CATH topology
 4C4S A;  3SQI A;  2Y0S F;  2EZZ A;  1NK7 A;  1XNS A;  1ZQH A;  4F4Y A;  1S0N A;  3K4G A;  2ZIU B;  2F8L A;  1SZH A;  3EYZ A;  1ARO P;  1S10 A;  2FLL A;  1Z00 A;  4TUR A;  1OXJ A;  2XID A;  5DKW A;  5J2H A;  4RNM A;  3RJH A;  2ZJ8 A;  4EEN A;  2OWO A;  4UQG A;  1Q8K A;  4CCH A;  4O3N A;  2ODG A;  1L7P A;  5KFT A;  5JTI A;  4J9M A;  4B9L A;  2LYH A;  2JGA A;  1KFD A;  1TK8 A;  5TIS U;  3V72 A;  1IXR A;  2EAM A;  2QB1 A;  4ED6 A;  5AKX A;  3TAR A;  3TAC B;  3N7P D;  3GQC A;  1ZJM A;  2F77 X;  5J2F A;  5ALH A;  8ICS A;  1V85 A;  2KV2 A;  3IV6 A;  4DCC A;  2CN1 A;  2OYY A;  2AGQ A;  3LWM A;  5L1M A;  1SIJ A;  3HX0 A;  4I2J A;  4C8N A;  2JH7 A;  2JZB A;  4UB1 A;  3WK6 A;  1RQL A;  5KG7 A;  4F4X A;  3E58 A;  8ICT A;  2YMQ A;  1M6Y A;  4QZH A;  4OO1 J;  5D49 A;  3THV A;  4QWB A;  1NJZ A;  1Z4N A;  1BPZ A;  3SAF A;  2D3D A;  2ATL A;  3ZI4 A;  2P35 A;  1X9S A;  3N4M B;  2E8P A;  4QW9 A;  3H0M B;  4F91 B;  4RQ8 A;  3IHQ B;  2E8N A;  4ACO A;  3M7D A;  3H0R B;  2F8K A;  1SKR A;  2DBY A;  5KFF A;  5KAF U;  2QKQ A;  4ED0 A;  3HT3 A;  1U47 A;  1OUQ A;  2HDO A;  4YFK A;  1NJX A;  4DQP A;  2B0C A;  3OPX A;  4ED7 A;  4YQW A;  2KMD A;  1U9L A;  5AIA A;  2BCU A;  1ZQD A;  2MA1 A;  1IG6 A;  2AU0 A;  1PK1 B;  3ISD A;  4F71 A;  2E3T A;  5HR7 A;  1ZQB A;  1JX4 A;  4I2I A;  2WB1 F;  3TFS A;  5KFZ A;  3D6J A;  1T7P A;  3ORY A;  7ICM A;  9ICB A;  4KLU A;  4Q45 A;  2EZY A;  1VLB A;  3AU2 A;  4P2H A;  5F9L A;  3CNH A;  4EYI B;  4KLL A;  5AM2 A;  3PST A;  4PGY A;  2DKX A;  3KOO A;  2WF6 A;  1ZQN A;  3C29 A;  4DF8 A;  2K8B B;  3KD3 A;  5ALR A;  3Q8S B;  4YMN A;  3QU7 A;  5G5H A;  1HIW A;  2G09 A;  3V6J A;  3ZDB A;  2AQ4 A;  1LB2 B;  3V6H A;  1SWW A;  4KMO B;  2KKV A;  4Q8E A;  3IP4 B;  3Q8Q B;  4DSF A;  4KLJ A;  1LV5 A;  2HCF A;  2XGP A;  4AYB F;  1SB3 C;  4J9O A;  3PSP A;  4JMU A;  4EZ9 A;  2W8L A;  5AM1 A;  1N56 A;  2WAQ C;  3SI8 A;  1UT8 A;  3C2K A;  4MFC A;  5KFA A;  4FZN A;  3TKA A;  2CPR A;  1XU4 A;  4A8E A;  1ZQ1 C;  4JV2 A;  1MA7 A;  3ALR A;  4DOA A;  1SXD A;  2RLT A;  2D8C A;  3EPG A;  4F5O A;  2LM1 A;  3N7S C;  4KIT B;  2F1H A;  4FE3 A;  4GIB A;  4Y2X A;  2ZTC A;  2W9C A;  4GXJ A;  1NK8 A;  4YG2 A;  1RG6 A;  3H4D A;  5AK6 A;  8ICG A;  2VJ4 A;  2NRX A;  5AI9 A;  3SEI A;  2AH5 A;  4B9V A;  3M8S A;  1PZN A;  5J29 A;  2RP5 A;  3M6K A;  4KLD A;  1ZQL A;  1X66 A;  1ZQI A;  2Q0Z X;  4DL5 A;  2GO7 A;  8ICC A;  2K60 A;  4QNL A;  5TZV A;  4NJ8 A;  4QZE A;  2Y1I A;  2KEY A;  3FC4 A;  3PY8 A;  5ALV A;  2EQY A;  2ZIU A;  3G6X A;  5J2G A;  5HP4 A;  1ZD3 A;  3RH5 A;  3OSP A;  4PGQ A;  2RDJ A;  8ICL A;  2XY6 A;  2AGO A;  1K1Q A;  4F2R A;  1SV4 A;  2YML A;  3C2L A;  2PI4 A;  2ASL A;  2H5X A;  1A6S A;  2ZIV A;  8ICM A;  3VCB A;  3Q8K A;  1B4F A;  3VC8 A;  2HSZ A;  1SXE A;  2BQU A;  4FFD A;  1MQ2 A;  5ALK A;  2KJ8 A;  3AQF A;  2J6U A;  5KT4 A;  1X9W A;  4RQM A;  4F72 A;  2BCR A;  2H3V A;  3OTQ A;  3IDW A;  4KLT A;  2F3N A;  4ED3 A;  4JV0 A;  9ICC A;  4P4M A;  2R8J A;  4MFA A;  4F2S A;  1J2N A;  4YD2 A;  4XRH A;  4GXI A;  1D9F A;  3ZDA A;  2C2E A;  1UPH A;  2VAN A;  3SV3 A;  5IIM A;  4ELV A;  5J2A A;  1UQV A;  4Q8F A;  9ICM A;  2KIC A;  3L3F X;  1QSL A;  3BS5 B;  3AUO A;  9ICN A;  4C8M A;  5HMM A;  3D2Q A;  5BOM A;  4UBC A;  5KFK A;  4UBB A;  2KN7 A;  9ICV A;  2PFP A;  5ALX A;  5ALY A;  4DQR A;  1S9F A;  4IQT A;  2HBJ A;  3AQE A;  4P0Q A;  4M04 A;  9ICS A;  3C5F A;  4AP9 A;  2LPE A;  9ICL A;  2ZIW A;  2WF7 A;  2P6U A;  1WCN A;  4P0Q B;  2K4I A;  4ECT A;  4EEL A;  4I2A A;  4RZR A;  4J9N A;  4CRX A;  4OD0 A;  4ECW A;  5AM4 A;  3I1Y A;  1UHU A;  3JPQ A;  3DV9 A;  2JEJ A;  3NS1 A;  3HIL A;  3PML A;  3K1Z A;  2DUY A;  4R66 A;  1Z19 A;  4PL2 A;  3N97 B;  3WK8 A;  2IBK A;  3GV5 B;  2JHD A;  2BCV A;  4IL6 U;  2FPK A;  1OW5 A;  3MFH A;  5AIB A;  4EZ6 A;  1J2M A;  3HPO A;  1KDH A;  4KLM A;  5KG0 A;  2FMP A;  2MAX A;  5AKY A;  1RXW A;  1DGS A;  1WWV A;  3RB3 A;  3M9O B;  3BQ2 A;  2IHM A;  3RBE A;  3M1Y A;  4FZM A;  2HHW A;  8ICQ A;  3NUQ A;  4YXJ A;  3RR7 A;  2LKY A;  3G6V A;  3SR6 A;  2WF9 A;  5B66 U;  3MR2 A;  4LJX A;  1QQ5 A;  2ZIV B;  2A1J B;  2B21 A;  2OM6 A;  4UB2 A;  3MR3 A;  5KFD A;  2KHQ A;  2KOB A;  2JEI A;  2KFN A;  4YCX A;  3WKC A;  1X6J A;  3PVX A;  3HWT A;  1XSN A;  1WWU A;  4F3O A;  1ZQA A;  1K1S A;  2EH9 A;  4DWI A;  2G5I B;  1ZD5 A;  1AQ6 A;  4M6W A;  1UT5 A;  2NO5 A;  5AK4 A;  5KG3 A;  5B5E U;  4DSI A;  4YR0 A;  2O6K A;  3E0F A;  4KX3 A;  9ICP A;  3H8W A;  4DFP A;  3RR8 A;  4DSK A;  2OCE A;  3JPR A;  4J9K A;  2BHN A;  1RM6 C;  4KLE A;  2W11 A;  4QZI A;  2W9C B;  5KFW A;  5KT3 A;  4F5R A;  3HKZ C;  1C20 A;  4BX9 C;  2DFL A;  2H3Q A;  1ZQO A;  3H8M A;  3GDX A;  5AM3 A;  3J81 j;  2M0N A;  2IHN A;  5H2F U;  1DXS A;  3BQ1 A;  3WK7 A;  4Z6E A;  2N1R A;  1HJP A;  4JK1 A;  3CW2 C;  5ALQ A;  4QWC A;  4RQ4 A;  1DK2 A;  3ONN A;  3H8J A;  4QZD A;  1FFV A;  1V9P A;  2ZG6 A;  1Z3E B;  1ZRM A;  1JUD A;  2G0A A;  4K4G A;  8ICX A;  1DK3 A;  1S0V A;  1JAL A;  4P4O A;  5DB9 A;  2ALZ A;  3CP8 A;  5KFC A;  2QLT A;  1QSY A;  2ZJA A;  1KBU A;  1ZQM A;  3TAQ A;  4PJ0 U;  2EZX A;  4ED2 A;  2QB0 B;  9ICF A;  5E79 U;  3LVW A;  1L3V A;  3BQ7 A;  3F2D A;  4Y2V A;  4PPX A;  2K89 A;  2QAR B;  2W9M A;  4QZG A;  3ED5 A;  3V6K A;  3NVZ A;  3PZP A;  3CYM A;  1U4B A;  2VIX A;  3KFU F;  1L5U A;  5KFH A;  4PHP A;  7ICP A;  4NWI A;  2MRL A;  4C4R A;  2YMP A;  4M9J A;  5DLF A;  5J2C A;  3ETR A;  1COO A;  1RYR A;  2BKE A;  2PKE A;  4BDP A;  3IN5 A;  5CP2 A;  3ICX A;  4IRC A;  1NOM A;  5ALE A;  4RUA A;  2WAQ F;  1JMS A;  1BPX A;  3Q8M A;  3KKA A;  5ALP A;  3T5J A;  2KZ3 A;  4XQ8 A;  3T5L A;  4DSL A;  2DKZ A;  2KG5 A;  2C22 A;  4PH5 A;  4I2E A;  3QNM A;  1WG8 A;  3FAH A;  8ICW A;  5HHI A;  9ICI A;  3EPI A;  3TAP A;  4J9S A;  5KG4 A;  2VA8 A;  3MGH A;  3GV7 B;  5KG1 A;  1ZQE A;  1NK9 A;  4C4T A;  2WTF A;  4J03 A;  3RB4 A;  3QZ7 A;  2GOL A;  2F1I A;  5AM0 A;  4KTQ A;  3RH4 A;  4CF4 A;  9ICX A;  2JXJ A;  2XY5 A;  2PFQ A;  4RU9 A;  1QQ6 A;  3AEV A;  4I28 A;  2WHE A;  1XO0 A;  4OJO A;  7ICK A;  4EEK A;  1TV9 A;  4UAR A;  5DBB A;  1T3Q A;  4YXM A;  3NRW A;  3KTQ A;  3RB6 A;  2HHX A;  2KVS A;  2FI1 A;  5CB1 A;  1Z1B A;  2ZTD A;  4FO6 A;  3ZDC A;  9ICK A;  2WF8 A;  1JRO A;  1F5S A;  4DS5 A;  5KFQ A;  1S97 A;  4ICA A;  8ICH A;  3ZD8 A;  2A1A A;  1LVH A;  4M2Y A;  4Y2P A;  3QXG A;  2HVH A;  4WJ3 B;  2F2A B;  4EBD A;  1L8O A;  5ALL A;  4QW8 A;  2FMQ A;  1SZP A;  5AKI A;  5IIK A;  8ICV A;  3BZK A;  3DDH A;  7ICI A;  2V4Q A;  3JPS A;  5KAI U;  4DFK A;  1ZQJ A;  2J6S A;  1N5W A;  5DGB A;  4I27 A;  2ISO A;  2JH1 A;  5ALO A;  1LKY A;  1PUZ A;  5KT6 A;  1MC8 A;  4EEY A;  4C8O A;  3C23 A;  8ICI A;  4GC6 A;  4O3Q A;  4QZ8 A;  4CF3 A;  1RPL A;  4R65 A;  4I2C A;  3PMN A;  3PX6 A;  4GLX A;  3NVV A;  2KSO B;  2R8G A;  3L5K A;  1CUK A;  5KT7 A;  5D4B A;  2KZM A;  2WF5 A;  2FPM A;  2YMM A;  4DFM A;  1PVP A;  1JXE A;  1MN8 A;  2NRW A;  2KZZ A;  7ICV A;  5ALZ A;  1V38 A;  5EE3 A;  1L3T A;  1J97 A;  3RH6 A;  4DL6 A;  1XO1 A;  5J2J A;  4GC7 A;  5AK3 A;  2UVR A;  9ICT A;  2LI6 A;  2BQ3 A;  2KJ9 A;  5DQH A;  2HOF A;  5J0O A;  1Q46 A;  8ICB A;  3LWL A;  4I2B A;  4F4W A;  1ZQS A;  2GLE A;  3GZF A;  1SKW A;  3NAS A;  4MF2 A;  2PXI A;  4UB3 A;  9ICA A;  5KFS A;  4QZA A;  2H3Z A;  3GU3 A;  4IQV A;  1S0M A;  2F76 X;  1N61 A;  1GO3 F;  2XO7 A;  5CJ7 A;  1JN3 A;  5EWF A;  1HEK A;  1PK1 A;  5J0Y A;  5AI6 A;  4FS1 A;  1RYS A;  3C21 A;  4CF5 A;  1NZP A;  1SGG A;  1S5L U;  4F5N A;  3B0X A;  3WK4 A;  2BPG A;  1KFT A;  2FMS A;  1Y88 A;  4DOB A;  1TE2 A;  5J0P A;  1TVA A;  1QH9 A;  4F4K A;  4Y2Q A;  4M9L A;  4AYB C;  4BGD A;  4DFD A;  3KKA C;  4I2F A;  2ESE A;  4IS7 A;  2HHS A;  3QYP A;  4QWE A;  2W7P A;  4NM1 A;  2IOF K;  2W3S A;  4I29 A;  4PZN A;  4DQQ A;  2L5Y A;  3M9M B;  1NJY A;  3UMC A;  1RXV A;  4B9U A;  4C80 A;  3NGD A;  2JZB B;  4GFJ A;  5CWR A;  5J2B A;  4DL7 A;  5IIJ A;  3RJJ A;  4EBC A;  5CHG A;  2HHQ A;  3PW4 A;  1F44 A;  1X40 A;  1CI4 A;  3D2S A;  2HMX A;  2VJ5 A;  4YR2 A;  3HW8 A;  8ICP A;  2P66 A;  3F53 A;  4MHV A;  3JPO A;  1TFR A;  1BNO A;  1YZ6 A;  2NRT A;  5ALF A;  4O3R A;  4K4H A;  2EDU A;  2JR5 A;  2KIV A;  8ICZ A;  2LYB A;  3SEN A;  5IIL A;  2R18 A;  2IOF A;  4ECZ A;  1N2X A;  4IRK A;  1YT3 A;  3MAB A;  2BDP A;  2DQN B;  1PVQ A;  3ETL A;  4US8 A;  3SAG A;  3OJS A;  1SKS A;  3IRU A;  3QEB Z;  3A0H U;  4O5E A;  1ZQV A;  3BZC A;  4O9M A;  2V4R A;  2W9A A;  2XI9 A;  1ZQT A;  5EE1 A;  1QCK A;  2HHT A;  2HOQ A;  5CRX A;  1P7D A;  1KQQ A;  4I2G A;  1RDF A;  1L7O A;  2ZIW B;  4QZC A;  5KFR A;  2NV3 A;  3AL0 B;  1KRP A;  7ICQ A;  1EXN A;  3MGI A;  4QWD A;  3LDA A;  3H0L B;  3NRZ A;  5J2K A;  1RYU A;  4JV1 A;  2JRZ A;  3F2C A;  3ZD9 A;  2BCQ A;  4G3I A;  2HBM A;  4UB4 A;  4RUC A;  1BPD A;  3V7K A;  5AI8 A;  5AHX A;  1Q3U A;  2KFZ A;  3BQ0 A;  3T79 A;  5KFI A;  3SYZ A;  3H4B A;  2I1Q A;  4DO9 A;  1ZQX A;  4CE6 A;  3O0F A;  2MSN A;  4DSE A;  1ZOL A;  5J2I A;  1D9D A;  4OJ6 A;  5DB8 A;  3T3F A;  2W55 A;  2BDU A;  1TAQ A;  3RBD A;  2EAN A;  2YTU A;  3TFR A;  4QIW F;  2HHU A;  4DS4 A;  2GWS A;  1XSP A;  4O5K A;  4R64 A;  1L6N A;  4CGZ A;  3RJG A;  3B9J A;  3OSN A;  4B9T A;  5EOZ A;  2BZF A;  5DLG A;  4F8R A;  1ZD2 P;  2XC9 A;  2KSO A;  4NM2 A;  3M8R A;  4F5Q A;  4Y2J A;  1DGJ A;  4XA5 A;  2MU2 A;  4CNQ A;  2ZTE A;  4RQ5 A;  1IM4 A;  1ZXI A;  2XGQ A;  4UB8 U;  1ZQU A;  2G5H B;  2MUT B;  5KFM A;  3ZDE A;  1TKD A;  4ED1 A;  5JUM A;  5AKJ A;  4YD1 A;  4PZO A;  5KFO A;  2ISP A;  4FZL A;  1S0O A;  4DSJ A;  1TK5 A;  3PR5 B;  4JB3 A;  4KN4 A;  2JMG A;  3QU4 A;  4RPZ A;  4C0Z A;  1A0P A;  5GTH U;  5G5G A;  2KTQ A;  4YVZ A;  1YZ7 A;  1NKB A;  3L4P A;  3PSI A;  4KLQ A;  2D6F C;  5KL1 B;  2I9G A;  1SV0 C;  3K1R B;  1RZT A;  9ICJ A;  4OJP A;  5ALJ A;  5K4L A;  3RRG A;  5KFU A;  4DF4 A;  5AIC A;  4R8U B;  4Y2R A;  3R9K A;  1NNL A;  5KFG A;  4OJL A;  3UXN A;  4DL4 A;  4O3S A;  4MEY A;  4GXK A;  1Q3V A;  1NZB A;  3C1Z A;  7ICH A;  1B43 A;  3C5G A;  4Y2T A;  2ZXH A;  5L1J A;  1BVS A;  3V7L A;  5J0U A;  4NLC A;  3GV8 B;  5L9X A;  1JIH A;  3BDP A;  4R63 A;  3PW7 A;  4KLH A;  4Z6D A;  3LYS A;  3MR5 A;  3QUC A;  4B9S A;  4BWJ A;  2DPI A;  2QB0 A;  1QSS A;  1TAU A;  3RJE A;  4CDG A;  2K4E A;  4DL3 A;  3WKE A;  2FE9 A;  3HJE A;  1Z00 B;  4FS2 A;  9ICG A;  1T4G A;  5J0T A;  4IRD A;  5D46 A;  3AU6 A;  1D8L A;  3T5K A;  3SZ2 A;  7ICR A;  1CRX A;  2ZJ5 A;  2IOH A;  2LHT A;  1MSW D;  4NLN A;  1L3S A;  3QUQ A;  1D8Y A;  1LKY B;  3PW5 A;  1L7N A;  3QZ8 A;  2KNJ A;  2JEF A;  3BS5 A;  2VKQ A;  5DBC A;  4IR1 A;  5DDM A;  4TQR A;  5KT5 A;  1O03 A;  4RQ6 A;  2BPC A;  5BOL A;  3EZ5 A;  4P4P A;  1BNP A;  4PL1 A;  1ZET A;  2C2R A;  5CA7 A;  2C28 A;  5KFX A;  3ZDD A;  5AI5 A;  3HP6 A;  2K4H A;  3EWA A;  1ZQR A;  4Y2U A;  3KHG A;  2Y1J A;  1N48 A;  3C1Y A;  1U48 A;  4Q44 A;  5L1L A;  2NRV A;  2R8K A;  2K8A A;  8ICK A;  3GIK A;  3PO4 A;  3MFI A;  3QU5 A;  4UAT A;  3PR4 A;  3CRX A;  3RTV A;  5F9N A;  4EX7 A;  4NLG A;  3HKZ F;  2ZIX A;  4ECY A;  2JEG A;  4M0A A;  3UXO A;  4MF8 A;  1TK0 A;  4KLS A;  2WB1 C;  4KLF A;  2YB1 A;  2E5S A;  5AKK A;  4O3M A;  1K5O A;  2CXY A;  3BJY A;  3RAX A;  4M9H A;  1ZQK A;  4M9N A;  4M47 A;  4C8K A;  2OEH A;  3GFK B;  5KTQ A;  4E0D A;  1BPB A;  3UXP A;  3N7R C;  3TAD C;  1WUD A;  2NYV A;  3F5A A;  2UVV A;  1TAM A;  4ECS A;  4US9 A;  1VDV A;  3S6J A;  4ZOH C;  4EX6 A;  4MEX A;  2PMZ C;  1L7M A;  4RNN A;  2PFO A;  3G6Y A;  4DLE A;  1FFU A;  1NK4 A;  1N5X A;  2KP7 A;  2IA6 A;  2VA2 A;  4KLI A;  4F93 B;  5KT2 A;  1NKE A;  4YR3 A;  1NK0 A;  5DDY A;  2RHF A;  2HBL A;  3WK9 A;  4RQ7 A;  8ICJ A;  2A1J A;  4RPY A;  4RQ3 A;  3WKD A;  5GTI U;  1DRG A;  1F0M A;  2EAP A;  1T3N A;  3PW0 A;  7ICS A;  2W3R A;  4YMM A;  1A77 A;  3UM9 A;  4NL9 C;  5HNK A;  1SL2 A;  2ES6 A;  3M6Z A;  3F2B A;  1ED1 A;  2KD1 A;  2MUT A;  3BS7 A;  9ICQ A;  5DQG A;  5J0R A;  2E1E A;  1SV0 A;  5C0Y A;  5AI4 A;  2GH1 A;  4NL9 A;  3H40 A;  2NO4 A;  2KHV A;  5DBA A;  2BR0 A;  3RJF A;  9ICH A;  4RQN A;  4TUQ A;  1H38 A;  4QJF B;  5ALI A;  2W9B B;  1URJ A;  1ZD4 A;  3KZX A;  1NI3 A;  2W8K A;  2AXT U;  2W9B A;  1XS9 D;  3RAQ A;  5J0S A;  5IIN A;  2XIC A;  2Z7J A;  3FM9 A;  2OXO A;  4BXO B;  4P0P A;  1WYG A;  5KL8 B;  4X5V A;  5KFY A;  5DQI A;  4IQW A;  1S76 D;  2E8O A;  5EE0 A;  5J8Y A;  2XVT A;  4UAS A;  3PW2 A;  1KTQ A;  2FDR A;  3NTU A;  2G06 A;  8ICU A;  2E1F A;  4BUG A;  4F92 B;  3PX4 A;  3E2E A;  3PV8 A;  2FJ6 A;  4R8U A;  3FDS A;  2FPL A;  2PMZ F;  4Y2S A;  1BPY A;  2LM4 A;  4HAI A;  9ICU A;  3EW9 A;  4M9G A;  3OJU A;  4UAZ A;  2BCS A;  4Z6C A;  4RQ0 A;  1VJ5 A;  4NXZ A;  8ICY A;  2YX8 A;  5KFB A;  1QLN A;  2LMR A;  8ICO A;  1RQN A;  3QUB A;  4ECR A;  5FP0 A;  3TQ1 A;  1N63 A;  5ALN A;  2KJ5 A;  2ZXI A;  5III A;  4UB5 A;  1S8O A;  2M9N A;  4U7C A;  3KHL A;  4C7Y A;  2DF4 B;  1SWV A;  4QZB A;  3JPT A;  2QAR A;  7ICG A;  1X9M A;  3NVW A;  1D8B A;  3MR6 A;  3QU9 A;  5DGA A;  4KN7 A;  3N28 A;  8ICE A;  1PVR A;  7ICL A;  1HUZ A;  4PHD A;  2Y9T A;  3DEE A;  4NLB A;  3RJI A;  3SD7 A;  5ALD A;  4M6W B;  5J0Q A;  2HBK A;  5J0X A;  2BPF A;  5J0W A;  1O08 A;  4BWM A;  3GIM A;  4C7Z A;  5J8Y C;  3UMG A;  3PSF A;  4J9P A;  1FIQ A;  4OJ5 A;  4DOC A;  2NRZ A;  3LVV A;  4QZF A;  1COK A;  1IV8 A;  5KG2 A;  4UAW A;  1KEJ A;  1V97 A;  3BQT A;  1ZQP A;  4ECU A;  2H3I A;  2H3F A;  5DG9 A;  4NLZ A;  1A76 A;  3WKB A;  5AKZ A;  7ICT A;  3AMZ A;  1ZQY A;  4RNO A;  2F1J A;  2W04 A;  5ALU A;  1JI7 A;  5AKG A;  4JUZ A;  1N60 A;  9ICW A;  4RT3 A;  5KFV A;  2C2D A;  1XWL A;  4PHE A;  3KBB A;  3MC1 A;  4C8L A;  4O3O A;  1B22 A;  2K8C B;  3RFA A;  1BGX T;  1DOQ A;  4J9Q A;  5HR6 A;  3RF9 A;  2ASD A;  4QZ9 A;  4KMU A;  4LZD A;  4Q43 A;  1XC9 A;  1KW4 A;  2W7O A;  2W03 A;  2ZIX B;  3F5E A;  4UAV A;  5EE9 A;  5ALG A;  2UVU A;  5L1I A;  1T8E A;  9ICR A;  2E8M A;  4F5P A;  4DFJ A;  3JPN A;  1PK3 A;  5DB6 A;  1ZQF A;  2HVI A;  1S77 D;  3H8S A;  5L1K A;  5ALS A;  3KZI U;  1N62 A;  4JWM A;  1KN5 A;  4IC9 A;  4ZH4 A;  4LVS A;  3LK9 A;  1UA1 A;  4HYK A;  1SL1 A;  5CEH A;  2PFN A;  4Z6F A;  5JRT A;  2EAO A;  1ECW A;  3ISC A;  1BPE A;  8ICN A;  5KFL A;  2P6R A;  2I6X A;  4KLO A;  1KL9 A;  1UCV A;  4KX5 A;  1U45 A;  2RDI A;  7ICN A;  2FLP A;  5C5J A;  3D2N A;  7ICO A;  4OCZ A;  3OHB A;  2XY7 A;  3WKA A;  2KVC A;  4XUS A;  3B0Y A;  4J9R A;  3KHR A;  2RRD A;  1U49 A;  1L8L A;  4ELT A;  3JPP A;  3SAH A;  2IMW P;  2DWQ A;  4F4Z A;  2V9W A;  3K75 D;  3RRH A;  2J6T A;  1QQ7 A;  1NK5 A;  1ZQZ A;  3GIJ A;  5HML A;  1L3U A;  4QWA A;  4Y2Y A;  2HOI A;  4PHA A;  3RJK A;  1NJW A;  2CRX A;  7ICU A;  4IQU A;  1NK6 A;  5J2E A;  9ICO A;  4FBT A;  3SV4 A;  7ICE A;  2YQE A;  5EWG A;  3U26 A;  3H7I A;  1X42 A;  3WK5 A;  1C7Y A;  3NVY A;  1KFS A;  3MDA A;  1ZQW A;  5HHH A;  3I28 A;  3Q8P B;  2KE7 A;  3TI0 A;  4ECX A;  3UPQ A;  3QEA Z;  2ZUD A;  1ZJN A;  3WU2 U;  3FYH A;  3EUB 2;  2AQ0 A;  4BXO A;  4P0P B;  5KFJ A;  5KG5 A;  4ECQ A;  4J9L A;  5AKL A;  4NV0 A;  1FEZ A;  1Z1V A;  5KFP A;  5AI0 A;  4UAY A;  5F3X B;  2F44 A;  1JRP A;  4RT2 A;  3C28 A;  4O0I A;  1ZRN A;  2PI5 A;  1T94 A;  3UQ2 A;  4RQ2 A;  9ICE A;  1QTM A;  3KHH A;  2AHO B;  4UAU A;  2W43 A;  1FO4 A;  3QX7 A;  4ECV A;  8ICA A;  2YY6 A;  4QIW C;  2LYA A;  2FLN A;  1HUO A;  4EYH B;  1KLN A;  4ELU A;  3GIL A;  2BGW A;  4YMO A;  1ZQG A;  3MBY A;  2W54 A;  3QUT A;  5AKH A;  4UB6 U;  4JWN A;  1WCL A;  5T14 A;  2R8H A;  3QU2 A;  8ICR A;  5ALT A;  2BQR A;  5IIO A;  1NKC A;  2B6G A;  2HW3 A;  4YP3 A;  7ICJ A;  1UA0 A;  3IG8 A;  5BPC A;  1ZQC A;  1Z4O A;  3Q8L A;  4DLG A;  4RPX A;  3IM1 A;  1JXL A;  4B9N A;  2KKP A;  4I2H A;  2VA3 A;  3OHA A;  1CEZ A;  4BJQ A;  4USA A;  3T5H A;  5DG8 A;  2ASJ A;  2LBO A;  3GII A;  2Y0S C;  3TAN A;  4NLK A;  2OH2 A;  5KNI A;  3M9N B;  3MDC A;  4DQS A;  4DQI A;  5KFE A;  5EWE A;  5DG7 A;  4LZG A;  4UW9 A;  2HI0 A;  2JV3 A;  4I2D A;  2UVW A;  4B6J A;  4KLG A;  2ZUB A;  3TAD A;  3V7J A;  2RQ5 A;  4O3P A;  8ICF A;  2DGZ A;  2AGP A;  4TUS A;  3QE9 Y;  2KIW A;  5DB7 A;  2AJQ A;  3PO5 A;  1B0X A;  1X9X A;  1X6I A;  2KK0 A;  3OGU A;  1SL0 A;  2DPJ A;  2XCP A;  2I5H A;  5AK5 A;  2YN4 A;  4NY8 A;  7ICF A;  1MQ3 A;  2YB4 A;  5AKE A;  3RB0 A;  1KSP A;  1KKX A;  3UMB A;  1XSL A;  4YN4 A;  3A0B U;  3IG5 A;  1ZQQ A;  1X2I A;  1ZYQ A;  3I76 A;  3Q8R B;  3AN1 A;  4G9B A;  1IIP A;  2A3V A;  4DEZ A;  4DL2 A;  2DL0 A;  3MGV A;  4F50 A;  4EBE A;  4B9M A;  4U6P A;  2ZUC A;  2OHF A;  2A19 A;  2WFA A;  5ALW A;  5J2D A;  4FBU A;  2G08 A;  5ALM A;  3ISB A;  3HRD D;  4MFF A;  2Q4T A;  4IR9 A;  2K4P A;  5CR0 A;  5JU5 A;  2XCA A;  3PX0 A;  5KFN A;  4K4I A;  4TQS A;  2R8I A;  4TUP A;  5AM5 A;  2Y9U A;  4ED8 A;  3AM9 A;  3SMV A;  4PGX A;  2HHV A;  3C2M A;  5A0L A;  5KG6 A;  3PNC A;  3UQ0 A;  4O5C A;  4RQ1 A;  2G07 A; 
#chains in the Genus database with same CATH homology
 2D8C A;  3TAD C;  3BS5 B;  2KSO A;  2KIV A;  3SEN A;  2KMD A;  1RG6 A;  2GLE A;  1PK1 B;  3SEI A;  5KNI A;  1LKY B;  1OXJ A;  2LMR A;  1X66 A;  2JV3 A;  1KW4 A;  2FE9 A;  2LPE A;  3BS5 A;  4PZO A;  3KKA A;  1PK1 A;  2K60 A;  2KE7 A;  5JTI A;  3TAD A;  2DKZ A;  4NJ8 A;  1F0M A;  2EAP A;  2KG5 A;  2QAR A;  2E8M A;  1SGG A;  4NL9 C;  2EAM A;  2QB1 A;  1PK3 A;  1B0X A;  2ES6 A;  1X9X A;  3TAC B;  2DKX A;  3H8M A;  1Z1V A;  1V85 A;  1LKY A;  3BS7 A;  5L1M A;  3HIL A;  1SV0 A;  1DXS A;  2Y9T A;  3KKA C;  2ESE A;  5F3X B;  2F44 A;  4IS7 A;  4NL9 A;  1SV4 A;  1SV0 C;  3K1R B;  2DL0 A;  5JRT A;  2EAO A;  4RQN A;  1B4F A;  4PZN A;  5J8Y C;  1OW5 A;  1SXE A;  2L5Y A;  1WWV A;  2D3D A;  1UCV A;  2KSO B;  4RQM A;  2K4P A;  1COK A;  3IDW A;  5JU5 A;  2F3N A;  2E8P A;  2EAN A;  2E8O A;  2YTU A;  5J8Y A;  2QB0 B;  2Y9U A;  1X40 A;  3BQ7 A;  2E8N A;  1V38 A;  2QB0 A;  2B6G A;  2QAR B;  2F8K A;  4MHV A;  1UQV A;  2QKQ A;  1WWU A;  1SXD A;  1JI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...