2DKZA

Solution structure of the sam_pnt-domain of the hypothetical protein loc64762
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
GSSGSSGPWQPPADLSGLSIEEVSKSLRFIGLSEDVISFFVTEKIDGNLLVQLTEEILSEDFKLSKLQVKKIMQFINGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein LOC64762
publication title Solution structure of the SAM_PNT-domain of the hypothetical protein LOC64762
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2dkzA01
4NJ8A 5KNIA 1PK1B 3K1RB 1UQVA 2K4PA 1V85A 2FE9A 2QB0A 1SV4A 1DXSA 3BS5A 1LKYA 2ESEA 1X40A 3HILA 4IS7A 2L5YA 1X66A 5JRTA 1F0MA 2JV3A 1SXDA 3KKAC 2DKZA 4MHVA 2EANA 4NL9C 3BQ7A 2D3DA 2KSOB 3SENA 2D8CA 3TACB 3KKAA 3TADA 1PK1A 2K60A 1COKA 2QKQA 2KIVA 2F44A 1SXEA 2QARB 2ES6A 2QB1A 2EAOA 2F8KA 2YTUA 1WWUA 3SEIA 1B4FA 1KW4A 2E8NA 4RQNA 5J8YC 3BS7A 2F3NA 1Z1VA 2DL0A 4RQMA 2DKXA 2KMDA 4NL9A 2B6GA 2KSOA 5J8YA 5JTIA 1PK3A 4PZNA 2KG5A 2LPEA 2E8OA 3IDWA 2Y9TA 1OXJA 4PZOA 1V38A 2EAMA 5L1MA 2QB0B 1SV0C 1UCVA 1JI7A 5F3XB 1OW5A 2E8PA 3BS5B 1LKYB 2E8MA 2QARA 1RG6A 1B0XA 2KE7A 3H8MA 1SV0A 2Y9UA 1SGGA 2EAPA 1WWVA 5JU5A 2LMRA 1X9XA 3TADC 2GLEA
chains in the Genus database with same CATH superfamily
2KV2A 2EZXA 5TISU 3RJJA 1L3SA 1DK2A 9ICMA 1JX4A 2KP7A 2H3VA 9ICOA 3RRGA 3SQIA 8ICSA 4IL6U 1XC9A 4I2FA 2HVIA 3JPRA 1RQLA 2DWQA 2XVTA 2E3TA 9ICBA 2BDUA 4P4MA 2AJQA 5EWEA 1J2MA 4F5OA 5KFOA 4I27A 3M9NB 4C8KA 4KLGA 2W8LA 1SWVA 8ICYA 3KOOA 4ECRA 2D3DA 5AIBA 5AICA 4ED2A 4BJQA 1ZQVA 5AKEA 3TACB 1CI4A 3KKAA 4KLMA 2W03A 1PK1A 4MFCA 1YT3A 7ICEA 1HUOA 4QZAA 4Z6EA 2R8JA 1QLNA 4P0QA 3ZDEA 3D6JA 1FO4A 1S0MA 1WWUA 4DL2A 1B4FA 1ZQGA 2ZIXB 4BUGA 5J8YC 1ZQEA 3BZKA 3WKBA 4J9RA 2N1RA 1TFRA 4RQMA 3PO5A 2DUYA 3Q8RB 4QZ8A 2KSOA 5CWRA 1GO3F 1RYSA 3TI0A 4UB4A 3KZXA 4RU9A 4F5NA 2R8GA 3HX0A 7ICFA 1OUQA 4AYBC 5KFHA 4EX7A 3CW2C 1J2NA 2Y9UA 4RQ6A 1EXNA 1FFUA 3QEAZ 1PVPA 3HP6A 1ZOLA 5HMMA 1DK3A 2EZYA 4UBBA 5KFVA 3QU7A 5IILA 2JEIA 3QE9Y 5AKKA 4NLZA 3I28A 4RQ7A 4F3OA 1IIPA 2EQYA 2K4HA 2KEYA 4YVZA 2XCPA 4DS4A 4TUSA 3RB4A 3SMVA 3PR5B 1B43A 3ZDCA 1KKXA 5H2FU 2FLPA 5KG1A 1ZQMA 2ZJ8A 3G6VA 1SWWA 5KFNA 4UB6U 4I2DA 7ICKA 5KTQA 2EANA 1XO1A 1Z00B 4NLKA 5DQGA 5J2IA 5AI0A 3HRDD 2HOQA 4M9JA 4DQIA 3IHQB 3LVWA 2OEHA 4WJ3B 3RBDA 3VCBA 1T4GA 2K60A 4AYBF 2HDOA 2J6SA 4OJLA 7ICHA 4Q43A 1TKDA 1ZQZA 3QUTA 5J29A 3NRZA 2F8KA 4F5PA 5AHXA 3UM9A 4O3RA 4FZLA 3BS7A 4KMOB 2WF8A 1L5UA 2NRVA 4PGYA 4NL9A 8ICEA 2KHQA 4PZOA 1QH9A 4RUAA 5AI6A 1V38A 4O3SA 2YB1A 4OD0A 3A0HU 5F3XB 7ICNA 4JK1A 4KLIA 3H0MB 4KLEA 4ED0A 1DOQA 3RJHA 1XSLA 4ED7A 5DB6A 4M2YA 5J0WA 2DPJA 2ZIXA 1X6JA 8ICLA 4F2RA 2WB1C 4YMNA 2RDJA 3D2QA 3ETRA 4DOBA 2V4RA 4QIWC 2IHMA 3UXOA 1ZETA 5ALNA 4U6PA 1V85A 4DCCA 3GDXA 5L1IA 3N97B 4FFDA 3G6YA 1ECWA 4P4OA 1BPYA 3KD3A 2MA1A 5J0PA 7ICVA 1RYRA 3PX0A 3ONNA 1N60A 2AU0A 4DSIA 4J9PA 2BPFA 2DGZA 5C0YA 2BDPA 1NJWA 1ZQBA 4ECQA 8ICMA 1F44A 4CRXA 4RT3A 1S10A 2WF5A 3WK8A 5C5JA 2I5HA 2FMQA 1TAMA 3HT3A 2LHTA 4JB3A 4EENA 4M9LA 3AU2A 4R8UB 1ZQWA 4O3PA 1PZNA 2BZFA 3L5KA 1XS9D 4NLCA 3FAHA 1Z00A 3AU6A 1Q3VA 8ICTA 4YD2A 4JWNA 2LM1A 5IIKA 4Z6DA 1PK3A 2KG5A 3SV3A 2HVHA 1U9LA 4YQWA 3A0BU 4O5KA 2HHWA 3N28A 1D8BA 9ICHA 2EZZA 5EE1A 1L3VA 1ED1A 4PH5A 1S97A 4I2CA 2AGOA 5KG0A 1L8LA 3TARA 8ICHA 3GIJA 5AI5A 2AQ0A 2P6UA 4KN4A 1DGJA 4PHEA 4KN7A 2KKVA 5KT4A 3GIIA 1WWVA 4FBUA 4ECUA 1K1SA 3WU2U 3QU4A 3TAPA 3HPOA 4FZMA 4CF3A 3PW4A 2DPIA 2J6UA 2E5SA 4DQQA 5ALSA 4RPYA 2HHUA 5KFQA 4QJFB 2ZG6A 1PVRA 4QWDA 7ICTA 2NRXA 3EPIA 2JRZA 4YG2A 3MR2A 3MFIA 3RB3A 4Y2RA 5EE0A 4J9LA 1Z3EB 2KVSA 3RFAA 4PJ0U 4FS1A 3JPPA 1L6NA 2XIDA 3T5HA 1HIWA 4QZIA 2CRXA 1IV8A 1XSNA 1F5SA 4ZOHC 5KG6A 5KT3A 2BPGA 1L3UA 5ALHA 3Q8PB 5AKLA 3NS1A 4ELUA 1DGSA 4YMOA 3F5EA 2KOBA 5KAIU 1RDFA 4MEXA 4F2SA 2A1JB 4QZBA 3WKAA 1D8YA 1O03A 2KZ3A 3GIMA 2DBYA 2UVWA 4BWJA 4Z6FA 1HEKA 3SAHA 2FPMA 3BQ0A 5BPCA 4RNOA 2W55A 2ZJAA 4ECWA 1TVAA 4EX6A 2DKXA 3H0LB 4US8A 4DWIA 5J8YA 1JXLA 4NY8A 2G09A 3MDAA 3IDWA 1S76D 3AM9A 3T79A 3F53A 3EPGA 4UAVA 5J2JA 5EOZA 3IG8A 2XY5A 4UB2A 3Q8QB 3PSFA 2YMPA 2VIXA 2OWOA 2WAQC 5AKGA 5KG5A 3PMLA 8ICBA 5HR6A 3SZ2A 1BNPA 1X9MA 1X9SA 2H3IA 3NASA 5AM3A 4IC9A 2PMZC 3HKZC 5FP0A 2K4PA 4F72A 5AM2A 2YB4A 5AI8A 5D49A 3H40A 1S8OA 5KG7A 1KRPA 2HHSA 1X40A 3ZD9A 1N56A 2YMLA 1NJYA 1V9PA 4UAWA 4UAZA 3KHRA 1NK9A 4JWMA 5AK6A 3LK9A 3PW5A 5TZVA 1K1QA 3E58A 3BZCA 5HNKA 3OJSA 3TADA 4I2HA 2FDRA 5AKZA 3E2EA 5IIOA 5KFMA 2ZUDA 2ALZA 4DEZA 1B22A 5KFAA 2I6XA 5J0TA 5DG7A 3ED5A 3QUQA 4EEKA 1TK8A 2KFNA 3RJIA 3MGIA 3V7JA 1JALA 3NTUA 5KT2A 5IINA 1ZQHA 4O3NA 4UQGA 3TQ1A 3V6HA 3L3FX 4Y2YA 1Q3UA 2HHTA 3ORYA 2HMXA 4F4YA 3C21A 4IR9A 2LKYA 8ICQA 5DB8A 5DB9A 2A1JA 1ZJMA 4OJ6A 1TE2A 4Y2PA 4ICAA 1SGGA 3LVVA 4PGQA 3LDAA 4Y2UA 3UQ0A 1Q46A 2MU2A 2R18A 2XGQA 5CR0A 5DLGA 3C28A 3QXGA 2RQ5A 5D46A 9ICFA 5L1JA 4XA5A 8ICJA 4J9QA 3GU3A 3MR6A 1NKCA 4BXOB 2ESEA 5DGAA 1D8LA 1BPXA 4MFAA 2R8HA 2Y0SF 4QZ9A 1F0MA 2KNJA 4YD1A 3C2LA 5ALEA 5EWFA 3OSPA 2KHVA 5HHHA 1FIQA 5B5EU 4JV0A 2D8CA 1NK4A 5KFYA 4A8EA 2KVCA 1ZJNA 3UMCA 3DDHA 2K8BB 2GWSA 1BPBA 2KIVA 2VJ4A 2F44A 2GO7A 3F2DA 2KZZA 3QUBA 8ICPA 3T5JA 4R66A 3M7DA 4F4ZA 2W04A 5AKIA 4KX3A 3BDPA 2F77X 5J0UA 4IQTA 3TKAA 4JUZA 4QWBA 4EELA 4QZCA 3EYZA 2YMQA 2KJ9A 3M8RA 1PUZA 3PX4A 3EUB2 4I2EA 5KFDA 1IXRA 4DFMA 8ICKA 2P66A 1MA7A 2QB0B 1RM6C 1XWLA 4U7CA 3QU9A 1AROP 2G5HB 2E8MA 1T94A 4C0ZA 2C2RA 5KG4A 1IM4A 5ALVA 1HUZA 3RAXA 5HR7A 4C80A 4RPZA 2MUTB 3AEVA 3RRHA 2HBMA 1A6SA 2LI6A 1X9XA 2LYBA 2MSNA 2GLEA 1NK6A 1TK0A 2ASLA 5KFLA 1MN8A 1AQ6A 1NK0A 2BKEA 2ISPA 2ZJ5A 5KG3A 1KFSA 3PMNA 4F8RA 4KLDA 1JN3A 4RQ8A 5CP2A 2WTFA 3PVXA 2YMMA 3NVWA 3GILA 4C8LA 3F2BA 4RQ2A 3RJFA 5JRTA 4Q45A 2W9BB 4K4IA 4DFJA 2K89A 1ZQAA 4DOAA 8ICVA 1ZD5A 5J2FA 4DL6A 4FZNA 2FLLA 4P0PB 1U45A 1L7PA 3N4MB 2GOLA 3IN5A 3UMGA 1BGXT 2BCVA 1KFDA 3GFKB 4IR1A 2K8AA 4CF4A 4B6JA 1KLNA 4EZ9A 2FLNA 1NI3A 1CUKA 2QARB 3ALRA 5BOLA 4B9NA 5ALZA 3T5LA 4BXOA 1ZQFA 4G3IA 3IP4B 4US9A 2KN7A 3FC4A 2UVRA 3V72A 5KL1B 3PSIA 3RTVA 3DEEA 3KHGA 4I28A 4QZFA 2E8OA 1UPHA 5AI4A 5KFEA 3QZ7A 2IHNA 2PFQA 1OXJA 4MFFA 9ICSA 4J9SA 9ICJA 3H8WA 2BCSA 1L8OA 1KSPA 4DSEA 4NLGA 3BS5B 4J9OA 1ZQOA 2V4QA 3WKCA 4GLXA 1QSLA 1WCNA 4RUCA 4QWAA 3T3FA 4YR2A 4ED1A 5CJ7A 3Q8LA 4R65A 1Z4NA 4K4HA 5JU5A 1JUDA 1ZQIA 2FI1A 3C2MA 1QQ5A 4RQ0A 3B0YA 4DL4A 1ZD4A 1RYUA 2A1AA 4I2BA 3TFRA 4ED6A 2OYYA 4YXJA 3OHAA 3QU5A 2QB0A 2ZIWB 1SV4A 5DB7A 2HCFA 3EWAA 1WCLA 1UHUA 9ICKA 2DFLA 4OO1J 2LYAA 4KLOA 3O0FA 5KFUA 4YR3A 3LWLA 2MUTA 4J9KA 8ICRA 4C7YA 4DF4A 4QWEA 1MQ2A 5KL8B 4LVSA 1ZQXA 7ICOA 5J0SA 3CNHA 1QSYA 2G08A 1SL0A 4Y2SA 5DKWA 2HHVA 4M0AA 4FS2A 1RZTA 5CA7A 1ZD2P 1UT5A 1DRGA 3K1ZA 2W9BA 3H4BA 5AKHA 3UXNA 3PR4A 2IA6A 3JPSA 4P0PA 1T3QA 8ICUA 4NLNA 2HOFA 3F5AA 4DL7A 4OJ5A 4PZNA 3KHHA 5ALQA 3PNCA 4EEYA 2EAMA 1NZBA 3OJUA 5J2CA 3SAGA 1SV0C 2ZIVB 5G5GA 2PI5A 4M04A 9ICTA 4TQRA 4B9MA 4DFKA 2QARA 2WB1F 4C8MA 1C7YA 1Z4OA 4C4TA 3OGUA 1NKBA 4QIWF 2WFAA 3ISBA 3PW0A 3M1YA 4DLGA 1ZRNA 4UARA 1CRXA 4M9HA 4M9GA 1N5XA 3AQFA 5J0OA 4C8OA 4CE6A 4XRHA 4JV1A 1X2IA 1VLBA 2FE9A 3BS5A 4R63A 1NKEA 4FBTA 3KHLA 4B9SA 4CGZA 1KQQA 3ZDAA 4M9NA 1KEJA 2HBKA 2XC9A 1QQ7A 4KLFA 2JZBB 4UAYA 3SENA 1T3NA 3RJEA 9ICNA 2A3VA 1UT8A 4DO9A 4O9MA 5KFRA 1Z1BA 4G9BA 2CXYA 4RQ1A 2C2DA 1SXEA 3VC8A 2AH5A 3KTQA 2ES6A 2ZIWA 3QUCA 1NNLA 3NVZA 3PY8A 5AM1A 2RP5A 4YP3A 4Y2XA 2C2EA 1L7OA 1LB2B 3U26A 4DSFA 3IM1A 4Y2VA 2AGQA 3JPOA 5ALTA 1RXVA 2VA3A 4Y2JA 4YXMA 3ZI4A 1V97A 2BQRA 3OTQA 5CRXA 3NGDA 5AK5A 7ICUA 4UB5A 4BX9C 4C4RA 3J81j 3FDSA 1HJPA 5L1KA 5DDMA 3QYPA 2XCAA 2XICA 1SL2A 2KFZA 2VA8A 4ECYA 2FMPA 1IG6A 2RLTA 2YN4A 3M8SA 3N7SC 4UASA 2CPRA 2HW3A 2C22A 4DLEA 2G06A 3UQ2A 2AQ4A 2W8KA 2W3SA 2IBKA 5ALGA 1ZQ1C 2XY7A 9ICUA 2IMWP 2B0CA 2NYVA 2VA2A 2WF6A 3FYHA 1MQ3A 2ZIVA 3TFSA 3PSPA 5IIJA 5T14A 3C29A 1S0OA 2W7PA 2LM4A 1MC8A 3BQTA 3I76A 2JV3A 8ICWA 3RH5A 4NL9C 3RB0A 3N7RC 3BQ7A 2D6FC 2KIWA 2R8KA 3SD7A 4KLTA 2UVUA 5KFXA 5DLFA 3RR7A 1ZQYA 1ZRMA 7ICLA 3LYSA 4EZ6A 1L7MA 1NOMA 3N7PD 1COKA 4XQ8A 3AUOA 1A76A 2ZXHA 1QTMA 2W9MA 3PX6A 4USAA 5J2DA 1YZ6A 1KW4A 3ZDBA 1SIJA 4KLUA 3QU2A 5ALJA 3GV5B 1Z1VA 2W9CB 2BQUA 8ICOA 2DL0A 3M6ZA 3JPNA 2JZBA 4C7ZA 1NK5A 8ICNA 4QZDA 4PHDA 3D2NA 4UAUA 4YN4A 1BPEA 4O3QA 8ICIA 1BPDA 2BCUA 2WAQF 3SV4A 2IOFK 5KFKA 2XO7A 1ZXIA 2RDIA 2KKPA 1N62A 4HYKA 3M9OB 3RH6A 5F9LA 2BHNA 5AKJA 2PMZF 2EAPA 2F8LA 3HKZF 3QEBZ 4OJOA 5J0RA 3K75D 2A19A 4J03A 2OHFA 3PZPA 1A0PA 5ALRA 2HOIA 3MGVA 3CP8A 2ZUCA 1J97A 3CYMA 4Y2QA 3V6KA 3GV7B 3BQ2A 2W7OA 2OH2A 5DG9A 1JXEA 5DG8A 1S5LU 4O3OA 4ED3A 8ICZA 3THVA 2MRLA 1M6YA 2P6RA 1FEZA 4KLSA 4F5QA 1O08A 2RRDA 1URJA 2GH1A 2JMGA 3ISCA 4YCXA 1PVQA 5DBAA 3H4DA 4OJPA 2H3QA 2IOHA 1SKRA 5D4BA 4GXKA 1BPZA 3IG5A 4YR0A 5J2GA 7ICMA 3OSNA 4ACOA 3BJYA 1N5WA 3Q8KA 4RNMA 3C5FA 1N2XA 3KBBA 5AM0A 9ICCA 5KFTA 5J0QA 2JHDA 9ICAA 2ZIUB 2BQ3A 2JR5A 5KT6A 5KFJA 2IOFA 3PO4A 2ASDA 4JV2A 2B6GA 2W54A 1X9WA 4J9MA 1N61A 4Y2TA 2M0NA 1Z19A 4IRDA 4NM1A 4GXJA 1RG6A 4KLQA 1T8EA 1SL1A 2KE7A 3GZFA 4P2HA 8ICXA 2HBLA 5ALPA 4QWCA 1SV0A 4C4SA 2NO5A 3BQ1A 1TAQA 4F50A 4TUPA 1C20A 4QZEA 1SZPA 3WK9A 2W9CA 2VANA 3RH4A 2NRTA 3Q8SB 4GC7A 2KK0A 5HHIA 4NJ8A 3H8JA 2BCRA 4B9UA 1A77A 5DGBA 5J0YA 7ICJA 3PW2A 5KFIA 1LV5A 3ISDA 5A0LA 4NLBA 2ISOA 4I29A 4GIBA 4F4KA 2ZUBA 3B0XA 5ALIA 5ALLA 9ICRA 4IQVA 3MFHA 5AI9A 5EE9A 4PGXA 2H5XA 3UPQA 4MHVA 5E79U 1NJZA 3C1YA 4BGDA 3AL0B 2Q0ZX 4PPXA 3K4GA 9ICWA 9ICQA 3S6JA 2CN1A 3F2CA 4RQ5A 2FPKA 4DL3A 1NK7A 4M47A 4QW9A 4F5RA 3WK6A 4ECXA 2C28A 3NVVA 7ICSA 1LVHA 1U4BA 4KTQA 1NJXA 1BVSA 3RR8A 7ICQA 2KD1A 2PI4A 1ZQQA 2NRWA 5AKXA 5AM5A 2OCEA 5K4LA 5ALFA 4DOCA 2HHQA 1SB3C 2LPEA 5KFSA 1TAUA 3NVYA 4EBDA 5BOMA 2R8IA 2G07A 2E8PA 2LBOA 5DQHA 3KFUF 4LJXA 4JMUA 5EE3A 3R9KA 2AHOB 2LYHA 4I2JA 3HWTA 4IQUA 1KL9A 2ZIUA 4ELVA 4KLHA 2JH1A 9ICPA 1WG8A 5ALKA 5J2AA 3RBEA 1ZYQA 2LMRA 3AQEA 4F4XA 4BWMA 3QX7A 3TADC 3I1YA 4DQPA 4YMMA 3NUQA 5KNIA 2JEFA 3JPTA 2FPLA 2NO4A 2I9GA 5DBBA 1QCKA 4IQWA 5AM4A 3KZIU 1YZ7A 4ED8A 4RZRA 2PXIA 1N48A 1RXWA 3PW7A 3GQCA 4TQSA 1ZQCA 3MC1A 2F76X 2XI9A 2F2AB 3EZ5A 3D2SA 4F92B 5J0XA 1ZQDA 1MSWD 1RQNA 5KAFU 4DL5A 1ZQRA 4CCHA 5IIIA 5AK4A 5ALOA 5CHGA 4MF8A 4TURA 1P7DA 4I2IA 4F91B 4P4PA 4ZH4A 2K8CB 5J2BA 4RQNA 2AXTU 4UATA 2G0AA 3MGHA 4GFJA 4UW9A 4DQRA 5ALMA 4F4WA 4DQSA 2KMDA 4FO6A 3WKEA 5ALXA 1SZHA 2BPCA 4UB8U 4QNLA 3SR6A 4LZDA 3MBYA 5L1MA 2W3RA 2JH7A 1SKWA 1OW5A 3WKDA 1LKYB 1BNOA 2M9NA 4CNQA 5ALYA 1ZQLA 3H8SA 2EDUA 2JEJA 4K4GA 2O6KA 3HW8A 3OHBA 2Z7JA 4NWIA 2KTQA 4GXIA 3RAQA 1U49A 2ZXIA 3PSTA 5KFPA 2ASJA 4O0IA 1JRPA 2W11A 1ZQUA 5AKYA 3MABA 5KFZA 1U47A 2NV3A 1JMSA 4CDGA 4B9LA 4EYIB 1XNSA 1FFVA 4F93B 2HI0A 2NRZA 1SXDA 4E0DA 5KT7A 3KKAC 5KFFA 8ICAA 5EWGA 9ICVA 2ZTEA 8ICFA 4RPXA 2JEGA 5DDYA 3DV9A 3E0FA 2H3FA 2QKQA 4NXZA 3V6JA 1KDHA 2ODGA 9ICEA 3H0RB 1ZQPA 5J2KA 4QZHA 9ICXA 4DSKA 2E8NA 2Y1JA 4PL1A 5DBCA 1KN5A 4DFDA 4KLJA 2H3ZA 4DFPA 3L4PA 1K5OA 2VKQA 3Q8MA 5HMLA 4IRCA 4KITB 4YFKA 5CB1A 3B9JA 3H7IA 2I1QA 4F71A 2EH9A 2Y9TA 8ICGA 1ZQKA 4PHAA 1COOA 2DF4B 1UCVA 2Y1IA 3ZDDA 1NZPA 1JROA 1D9DA 5DQIA 4ECTA 2YY6A 4MF2A 2KZMA 4O5CA 4AP9A 3RF9A 2PFOA 1U48A 4UB3A 4ECZA 3OPXA 2MAXA 2G5IB 4M6WB 5KFBA 2F1JA 3T5KA 3QNMA 5IIMA 1S0VA 1CEZA 2HBJA 4EBCA 4DS5A 4RQ4A 4B9TA 3ETLA 3C2KA 4ELTA 9ICLA 3WK7A 1LKYA 5ALWA 3QZ8A 8ICCA 2KICA 2YQEA 2Q4TA 3WK5A 2L5YA 4O5EA 4QZGA 1X66A 1VDVA 4PL2A 2J6TA 5J2EA 4UB1A 2OXOA 5AIAA 1N63A 2K4IA 2YX8A 3SYZA 2KJ5A 2PFNA 5KFGA 2UVVA 3JPQA 1UA0A 3MR5A 4X5VA 2BCQA 4GC6A 4LZGA 4I2AA 2F1HA 1QQ6A 4XUSA 2XGPA 2BGWA 1TK5A 3SI8A 5CEHA 1WYGA 2YTUA 4ECVA 3SEIA 1TV9A 1S0NA 1Q8KA 4NV0A 2HSZA 7ICIA 2WF9A 3ZD8A 1ZD3A 1XO0A 1ZQNA 4DSJA 1ZQSA 4RQ3A 2F3NA 1ZQTA 4B9VA 1VJ5A 1L3TA 3GIKA 4R8UA 1NK8A 2BR0A 4Q8EA 5ALUA 1UA1A 1X6IA 4R64A 3RB6A 2OM6A 2WF7A 3UXPA 2XY6A 7ICGA 1D9FA 2WHEA 3C23A 4CF5A 5HP4A 5JUMA 1B0XA 3IV6A 5GTHU 5GTIU 7ICPA 5KFCA 1S77D 3H8MA 1Y88A 2AGPA 5KT5A 1T7PA 3GV8B 2ATLA 5AK3A 4NM2A 9ICGA 1KBUA 4MEYA 1PK1B 3K1RB 1JIHA 1UQVA 2RHFA 4Z6CA 1RPLA 3MR3A 2P35A 3FM9A 3RJKA 4Q44A 2W43A 3WK4A 3EW9A 4QW8A 1DXSA 1SKSA 1KFTA 4P0QB 4OCZA 3HILA 4RNNA 4IS7A 5ALDA 2QLTA 4KLLA 3V7KA 2FJ6A 4I2GA 2DKZA 4EBEA 3NRWA 4M6WA 4DSLA 2KSOB 1X42A 5L9XA 1ZQJA 5F9NA 2JXJA 2K4EA 2Y0SC 3ICXA 2DQNB 4Q8FA 4IRKA 5B66U 3C5GA 4UBCA 3IRUA 7ICRA 2VJ5A 9ICIA 4BDPA 4J9NA 2QB1A 2EAOA 2F1IA 3M6KA 1KTQA 2ZTDA 3RJGA 2W9AA 3MDCA 3AN1A 3V7LA 1L7NA 3CRXA 3PV8A 3G6XA 3SAFA 5JTIA 2ZTCA 3UMBA 2V9WA 4DF8A 1XU4A 1H38A 4PHPA 3TANA 1JI7A 2E1EA 3LWMA 2HHXA 2PFPA 4KMUA 2B21A 2KJ8A 4KX5A 5L1LA 1WUDA 2E1FA 5KFWA 3AMZA 3C1ZA 4HAIA 4TUQA 3M9MB 2PKEA 1QSSA 4C8NA 2JGAA 2FMSA 1XSPA 5J2HA 3HJEA 1S9FA 4O3MA 5G5HA 5KG2A 4ECSA 3TAQA 4RT2A 4EYHB 4FE3A
chains in the Genus database with same CATH topology
4NJ8A 5KNIA 1PK1B 3K1RB 1UQVA 2K4PA 1V85A 2FE9A 2QB0A 1SV4A 1DXSA 3BS5A 1LKYA 2ESEA 1X40A 3HILA 4IS7A 2L5YA 1X66A 5JRTA 1F0MA 2JV3A 1SXDA 3KKAC 2DKZA 4MHVA 2EANA 4NL9C 3BQ7A 2D3DA 2KSOB 3SENA 2D8CA 3TACB 3KKAA 3TADA 1PK1A 2K60A 1COKA 2QKQA 2KIVA 2F44A 1SXEA 2QARB 2ES6A 2QB1A 2EAOA 2F8KA 2YTUA 1WWUA 3SEIA 1B4FA 1KW4A 2E8NA 4RQNA 5J8YC 3BS7A 2F3NA 1Z1VA 2DL0A 4RQMA 2DKXA 2KMDA 4NL9A 2B6GA 2KSOA 5J8YA 5JTIA 1PK3A 4PZNA 2KG5A 2LPEA 2E8OA 3IDWA 2Y9TA 1OXJA 4PZOA 1V38A 2EAMA 5L1MA 2QB0B 1SV0C 1UCVA 1JI7A 5F3XB 1OW5A 2E8PA 3BS5B 1LKYB 2E8MA 2QARA 1RG6A 1B0XA 2KE7A 3H8MA 1SV0A 2Y9UA 1SGGA 2EAPA 1WWVA 5JU5A 2LMRA 1X9XA 3TADC 2GLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ8 A;  5KNI A;  1PK1 B;  3K1R B;  1UQV A;  2K4P A;  1V85 A;  2FE9 A;  2QB0 A;  1SV4 A;  1DXS A;  3BS5 A;  1LKY A;  2ESE A;  1X40 A;  3HIL A;  4IS7 A;  2L5Y A;  1X66 A;  5JRT A;  1F0M A;  2JV3 A;  1SXD A;  3KKA C;  2DKZ A;  4MHV A;  2EAN A;  4NL9 C;  3BQ7 A;  2D3D A;  2KSO B;  3SEN A;  2D8C A;  3TAC B;  3KKA A;  3TAD A;  1PK1 A;  2K60 A;  1COK A;  2QKQ A;  2KIV A;  2F44 A;  1SXE A;  2QAR B;  2ES6 A;  2QB1 A;  2EAO A;  2F8K A;  2YTU A;  1WWU A;  3SEI A;  1B4F A;  1KW4 A;  2E8N A;  4RQN A;  5J8Y C;  3BS7 A;  2F3N A;  1Z1V A;  2DL0 A;  4RQM A;  2DKX A;  2KMD A;  4NL9 A;  2B6G A;  2KSO A;  5J8Y A;  5JTI A;  1PK3 A;  4PZN A;  2KG5 A;  2LPE A;  2E8O A;  3IDW A;  2Y9T A;  1OXJ A;  4PZO A;  1V38 A;  2EAM A;  5L1M A;  2QB0 B;  1SV0 C;  1UCV A;  1JI7 A;  5F3X B;  1OW5 A;  2E8P A;  3BS5 B;  1LKY B;  2E8M A;  2QAR A;  1RG6 A;  1B0X A;  2KE7 A;  3H8M A;  1SV0 A;  2Y9U A;  1SGG A;  2EAP A;  1WWV A;  5JU5 A;  2LMR A;  1X9X A;  3TAD C;  2GLE A; 
#chains in the Genus database with same CATH topology
 2KV2 A;  2EZX A;  5TIS U;  3RJJ A;  1L3S A;  1DK2 A;  9ICM A;  1JX4 A;  2KP7 A;  2H3V A;  9ICO A;  3RRG A;  3SQI A;  8ICS A;  4IL6 U;  1XC9 A;  4I2F A;  2HVI A;  3JPR A;  1RQL A;  2DWQ A;  2XVT A;  2E3T A;  9ICB A;  2BDU A;  4P4M A;  2AJQ A;  5EWE A;  1J2M A;  4F5O A;  5KFO A;  4I27 A;  3M9N B;  4C8K A;  4KLG A;  2W8L A;  1SWV A;  8ICY A;  3KOO A;  4ECR A;  2D3D A;  5AIB A;  5AIC A;  4ED2 A;  4BJQ A;  1ZQV A;  5AKE A;  3TAC B;  1CI4 A;  3KKA A;  4KLM A;  2W03 A;  1PK1 A;  4MFC A;  1YT3 A;  7ICE A;  1HUO A;  4QZA A;  4Z6E A;  2R8J A;  1QLN A;  4P0Q A;  3ZDE A;  3D6J A;  1FO4 A;  1S0M A;  1WWU A;  4DL2 A;  1B4F A;  1ZQG A;  2ZIX B;  4BUG A;  5J8Y C;  1ZQE A;  3BZK A;  3WKB A;  4J9R A;  2N1R A;  1TFR A;  4RQM A;  3PO5 A;  2DUY A;  3Q8R B;  4QZ8 A;  2KSO A;  5CWR A;  1GO3 F;  1RYS A;  3TI0 A;  4UB4 A;  3KZX A;  4RU9 A;  4F5N A;  2R8G A;  3HX0 A;  7ICF A;  1OUQ A;  4AYB C;  5KFH A;  4EX7 A;  3CW2 C;  1J2N A;  2Y9U A;  4RQ6 A;  1EXN A;  1FFU A;  3QEA Z;  1PVP A;  3HP6 A;  1ZOL A;  5HMM A;  1DK3 A;  2EZY A;  4UBB A;  5KFV A;  3QU7 A;  5IIL A;  2JEI A;  3QE9 Y;  5AKK A;  4NLZ A;  3I28 A;  4RQ7 A;  4F3O A;  1IIP A;  2EQY A;  2K4H A;  2KEY A;  4YVZ A;  2XCP A;  4DS4 A;  4TUS A;  3RB4 A;  3SMV A;  3PR5 B;  1B43 A;  3ZDC A;  1KKX A;  5H2F U;  2FLP A;  5KG1 A;  1ZQM A;  2ZJ8 A;  3G6V A;  1SWW A;  5KFN A;  4UB6 U;  4I2D A;  7ICK A;  5KTQ A;  2EAN A;  1XO1 A;  1Z00 B;  4NLK A;  5DQG A;  5J2I A;  5AI0 A;  3HRD D;  2HOQ A;  4M9J A;  4DQI A;  3IHQ B;  3LVW A;  2OEH A;  4WJ3 B;  3RBD A;  3VCB A;  1T4G A;  2K60 A;  4AYB F;  2HDO A;  2J6S A;  4OJL A;  7ICH A;  4Q43 A;  1TKD A;  1ZQZ A;  3QUT A;  5J29 A;  3NRZ A;  2F8K A;  4F5P A;  5AHX A;  3UM9 A;  4O3R A;  4FZL A;  3BS7 A;  4KMO B;  2WF8 A;  1L5U A;  2NRV A;  4PGY A;  4NL9 A;  8ICE A;  2KHQ A;  4PZO A;  1QH9 A;  4RUA A;  5AI6 A;  1V38 A;  4O3S A;  2YB1 A;  4OD0 A;  3A0H U;  5F3X B;  7ICN A;  4JK1 A;  4KLI A;  3H0M B;  4KLE A;  4ED0 A;  1DOQ A;  3RJH A;  1XSL A;  4ED7 A;  5DB6 A;  4M2Y A;  5J0W A;  2DPJ A;  2ZIX A;  1X6J A;  8ICL A;  4F2R A;  2WB1 C;  4YMN A;  2RDJ A;  3D2Q A;  3ETR A;  4DOB A;  2V4R A;  4QIW C;  2IHM A;  3UXO A;  1ZET A;  5ALN A;  4U6P A;  1V85 A;  4DCC A;  3GDX A;  5L1I A;  3N97 B;  4FFD A;  3G6Y A;  1ECW A;  4P4O A;  1BPY A;  3KD3 A;  2MA1 A;  5J0P A;  7ICV A;  1RYR A;  3PX0 A;  3ONN A;  1N60 A;  2AU0 A;  4DSI A;  4J9P A;  2BPF A;  2DGZ A;  5C0Y A;  2BDP A;  1NJW A;  1ZQB A;  4ECQ A;  8ICM A;  1F44 A;  4CRX A;  4RT3 A;  1S10 A;  2WF5 A;  3WK8 A;  5C5J A;  2I5H A;  2FMQ A;  1TAM A;  3HT3 A;  2LHT A;  4JB3 A;  4EEN A;  4M9L A;  3AU2 A;  4R8U B;  1ZQW A;  4O3P A;  1PZN A;  2BZF A;  3L5K A;  1XS9 D;  4NLC A;  3FAH A;  1Z00 A;  3AU6 A;  1Q3V A;  8ICT A;  4YD2 A;  4JWN A;  2LM1 A;  5IIK A;  4Z6D A;  1PK3 A;  2KG5 A;  3SV3 A;  2HVH A;  1U9L A;  4YQW A;  3A0B U;  4O5K A;  2HHW A;  3N28 A;  1D8B A;  9ICH A;  2EZZ A;  5EE1 A;  1L3V A;  1ED1 A;  4PH5 A;  1S97 A;  4I2C A;  2AGO A;  5KG0 A;  1L8L A;  3TAR A;  8ICH A;  3GIJ A;  5AI5 A;  2AQ0 A;  2P6U A;  4KN4 A;  1DGJ A;  4PHE A;  4KN7 A;  2KKV A;  5KT4 A;  3GII A;  1WWV A;  4FBU A;  4ECU A;  1K1S A;  3WU2 U;  3QU4 A;  3TAP A;  3HPO A;  4FZM A;  4CF3 A;  3PW4 A;  2DPI A;  2J6U A;  2E5S A;  4DQQ A;  5ALS A;  4RPY A;  2HHU A;  5KFQ A;  4QJF B;  2ZG6 A;  1PVR A;  4QWD A;  7ICT A;  2NRX A;  3EPI A;  2JRZ A;  4YG2 A;  3MR2 A;  3MFI A;  3RB3 A;  4Y2R A;  5EE0 A;  4J9L A;  1Z3E B;  2KVS A;  3RFA A;  4PJ0 U;  4FS1 A;  3JPP A;  1L6N A;  2XID A;  3T5H A;  1HIW A;  4QZI A;  2CRX A;  1IV8 A;  1XSN A;  1F5S A;  4ZOH C;  5KG6 A;  5KT3 A;  2BPG A;  1L3U A;  5ALH A;  3Q8P B;  5AKL A;  3NS1 A;  4ELU A;  1DGS A;  4YMO A;  3F5E A;  2KOB A;  5KAI U;  1RDF A;  4MEX A;  4F2S A;  2A1J B;  4QZB A;  3WKA A;  1D8Y A;  1O03 A;  2KZ3 A;  3GIM A;  2DBY A;  2UVW A;  4BWJ A;  4Z6F A;  1HEK A;  3SAH A;  2FPM A;  3BQ0 A;  5BPC A;  4RNO A;  2W55 A;  2ZJA A;  4ECW A;  1TVA A;  4EX6 A;  2DKX A;  3H0L B;  4US8 A;  4DWI A;  5J8Y A;  1JXL A;  4NY8 A;  2G09 A;  3MDA A;  3IDW A;  1S76 D;  3AM9 A;  3T79 A;  3F53 A;  3EPG A;  4UAV A;  5J2J A;  5EOZ A;  3IG8 A;  2XY5 A;  4UB2 A;  3Q8Q B;  3PSF A;  2YMP A;  2VIX A;  2OWO A;  2WAQ C;  5AKG A;  5KG5 A;  3PML A;  8ICB A;  5HR6 A;  3SZ2 A;  1BNP A;  1X9M A;  1X9S A;  2H3I A;  3NAS A;  5AM3 A;  4IC9 A;  2PMZ C;  3HKZ C;  5FP0 A;  2K4P A;  4F72 A;  5AM2 A;  2YB4 A;  5AI8 A;  5D49 A;  3H40 A;  1S8O A;  5KG7 A;  1KRP A;  2HHS A;  1X40 A;  3ZD9 A;  1N56 A;  2YML A;  1NJY A;  1V9P A;  4UAW A;  4UAZ A;  3KHR A;  1NK9 A;  4JWM A;  5AK6 A;  3LK9 A;  3PW5 A;  5TZV A;  1K1Q A;  3E58 A;  3BZC A;  5HNK A;  3OJS A;  3TAD A;  4I2H A;  2FDR A;  5AKZ A;  3E2E A;  5IIO A;  5KFM A;  2ZUD A;  2ALZ A;  4DEZ A;  1B22 A;  5KFA A;  2I6X A;  5J0T A;  5DG7 A;  3ED5 A;  3QUQ A;  4EEK A;  1TK8 A;  2KFN A;  3RJI A;  3MGI A;  3V7J A;  1JAL A;  3NTU A;  5KT2 A;  5IIN A;  1ZQH A;  4O3N A;  4UQG A;  3TQ1 A;  3V6H A;  3L3F X;  4Y2Y A;  1Q3U A;  2HHT A;  3ORY A;  2HMX A;  4F4Y A;  3C21 A;  4IR9 A;  2LKY A;  8ICQ A;  5DB8 A;  5DB9 A;  2A1J A;  1ZJM A;  4OJ6 A;  1TE2 A;  4Y2P A;  4ICA A;  1SGG A;  3LVV A;  4PGQ A;  3LDA A;  4Y2U A;  3UQ0 A;  1Q46 A;  2MU2 A;  2R18 A;  2XGQ A;  5CR0 A;  5DLG A;  3C28 A;  3QXG A;  2RQ5 A;  5D46 A;  9ICF A;  5L1J A;  4XA5 A;  8ICJ A;  4J9Q A;  3GU3 A;  3MR6 A;  1NKC A;  4BXO B;  2ESE A;  5DGA A;  1D8L A;  1BPX A;  4MFA A;  2R8H A;  2Y0S F;  4QZ9 A;  1F0M A;  2KNJ A;  4YD1 A;  3C2L A;  5ALE A;  5EWF A;  3OSP A;  2KHV A;  5HHH A;  1FIQ A;  5B5E U;  4JV0 A;  2D8C A;  1NK4 A;  5KFY A;  4A8E A;  2KVC A;  1ZJN A;  3UMC A;  3DDH A;  2K8B B;  2GWS A;  1BPB A;  2KIV A;  2VJ4 A;  2F44 A;  2GO7 A;  3F2D A;  2KZZ A;  3QUB A;  8ICP A;  3T5J A;  4R66 A;  3M7D A;  4F4Z A;  2W04 A;  5AKI A;  4KX3 A;  3BDP A;  2F77 X;  5J0U A;  4IQT A;  3TKA A;  4JUZ A;  4QWB A;  4EEL A;  4QZC A;  3EYZ A;  2YMQ A;  2KJ9 A;  3M8R A;  1PUZ A;  3PX4 A;  3EUB 2;  4I2E A;  5KFD A;  1IXR A;  4DFM A;  8ICK A;  2P66 A;  1MA7 A;  2QB0 B;  1RM6 C;  1XWL A;  4U7C A;  3QU9 A;  1ARO P;  2G5H B;  2E8M A;  1T94 A;  4C0Z A;  2C2R A;  5KG4 A;  1IM4 A;  5ALV A;  1HUZ A;  3RAX A;  5HR7 A;  4C80 A;  4RPZ A;  2MUT B;  3AEV A;  3RRH A;  2HBM A;  1A6S A;  2LI6 A;  1X9X A;  2LYB A;  2MSN A;  2GLE A;  1NK6 A;  1TK0 A;  2ASL A;  5KFL A;  1MN8 A;  1AQ6 A;  1NK0 A;  2BKE A;  2ISP A;  2ZJ5 A;  5KG3 A;  1KFS A;  3PMN A;  4F8R A;  4KLD A;  1JN3 A;  4RQ8 A;  5CP2 A;  2WTF A;  3PVX A;  2YMM A;  3NVW A;  3GIL A;  4C8L A;  3F2B A;  4RQ2 A;  3RJF A;  5JRT A;  4Q45 A;  2W9B B;  4K4I A;  4DFJ A;  2K89 A;  1ZQA A;  4DOA A;  8ICV A;  1ZD5 A;  5J2F A;  4DL6 A;  4FZN A;  2FLL A;  4P0P B;  1U45 A;  1L7P A;  3N4M B;  2GOL A;  3IN5 A;  3UMG A;  1BGX T;  2BCV A;  1KFD A;  3GFK B;  4IR1 A;  2K8A A;  4CF4 A;  4B6J A;  1KLN A;  4EZ9 A;  2FLN A;  1NI3 A;  1CUK A;  2QAR B;  3ALR A;  5BOL A;  4B9N A;  5ALZ A;  3T5L A;  4BXO A;  1ZQF A;  4G3I A;  3IP4 B;  4US9 A;  2KN7 A;  3FC4 A;  2UVR A;  3V72 A;  5KL1 B;  3PSI A;  3RTV A;  3DEE A;  3KHG A;  4I28 A;  4QZF A;  2E8O A;  1UPH A;  5AI4 A;  5KFE A;  3QZ7 A;  2IHN A;  2PFQ A;  1OXJ A;  4MFF A;  9ICS A;  4J9S A;  9ICJ A;  3H8W A;  2BCS A;  1L8O A;  1KSP A;  4DSE A;  4NLG A;  3BS5 B;  4J9O A;  1ZQO A;  2V4Q A;  3WKC A;  4GLX A;  1QSL A;  1WCN A;  4RUC A;  4QWA A;  3T3F A;  4YR2 A;  4ED1 A;  5CJ7 A;  3Q8L A;  4R65 A;  1Z4N A;  4K4H A;  5JU5 A;  1JUD A;  1ZQI A;  2FI1 A;  3C2M A;  1QQ5 A;  4RQ0 A;  3B0Y A;  4DL4 A;  1ZD4 A;  1RYU A;  2A1A A;  4I2B A;  3TFR A;  4ED6 A;  2OYY A;  4YXJ A;  3OHA A;  3QU5 A;  2QB0 A;  2ZIW B;  1SV4 A;  5DB7 A;  2HCF A;  3EWA A;  1WCL A;  1UHU A;  9ICK A;  2DFL A;  4OO1 J;  2LYA A;  4KLO A;  3O0F A;  5KFU A;  4YR3 A;  3LWL A;  2MUT A;  4J9K A;  8ICR A;  4C7Y A;  4DF4 A;  4QWE A;  1MQ2 A;  5KL8 B;  4LVS A;  1ZQX A;  7ICO A;  5J0S A;  3CNH A;  1QSY A;  2G08 A;  1SL0 A;  4Y2S A;  5DKW A;  2HHV A;  4M0A A;  4FS2 A;  1RZT A;  5CA7 A;  1ZD2 P;  1UT5 A;  1DRG A;  3K1Z A;  2W9B A;  3H4B A;  5AKH A;  3UXN A;  3PR4 A;  2IA6 A;  3JPS A;  4P0P A;  1T3Q A;  8ICU A;  4NLN A;  2HOF A;  3F5A A;  4DL7 A;  4OJ5 A;  4PZN A;  3KHH A;  5ALQ A;  3PNC A;  4EEY A;  2EAM A;  1NZB A;  3OJU A;  5J2C A;  3SAG A;  1SV0 C;  2ZIV B;  5G5G A;  2PI5 A;  4M04 A;  9ICT A;  4TQR A;  4B9M A;  4DFK A;  2QAR A;  2WB1 F;  4C8M A;  1C7Y A;  1Z4O A;  4C4T A;  3OGU A;  1NKB A;  4QIW F;  2WFA A;  3ISB A;  3PW0 A;  3M1Y A;  4DLG A;  1ZRN A;  4UAR A;  1CRX A;  4M9H A;  4M9G A;  1N5X A;  3AQF A;  5J0O A;  4C8O A;  4CE6 A;  4XRH A;  4JV1 A;  1X2I A;  1VLB A;  2FE9 A;  3BS5 A;  4R63 A;  1NKE A;  4FBT A;  3KHL A;  4B9S A;  4CGZ A;  1KQQ A;  3ZDA A;  4M9N A;  1KEJ A;  2HBK A;  2XC9 A;  1QQ7 A;  4KLF A;  2JZB B;  4UAY A;  3SEN A;  1T3N A;  3RJE A;  9ICN A;  2A3V A;  1UT8 A;  4DO9 A;  4O9M A;  5KFR A;  1Z1B A;  4G9B A;  2CXY A;  4RQ1 A;  2C2D A;  1SXE A;  3VC8 A;  2AH5 A;  3KTQ A;  2ES6 A;  2ZIW A;  3QUC A;  1NNL A;  3NVZ A;  3PY8 A;  5AM1 A;  2RP5 A;  4YP3 A;  4Y2X A;  2C2E A;  1L7O A;  1LB2 B;  3U26 A;  4DSF A;  3IM1 A;  4Y2V A;  2AGQ A;  3JPO A;  5ALT A;  1RXV A;  2VA3 A;  4Y2J A;  4YXM A;  3ZI4 A;  1V97 A;  2BQR A;  3OTQ A;  5CRX A;  3NGD A;  5AK5 A;  7ICU A;  4UB5 A;  4BX9 C;  4C4R A;  3J81 j;  3FDS A;  1HJP A;  5L1K A;  5DDM A;  3QYP A;  2XCA A;  2XIC A;  1SL2 A;  2KFZ A;  2VA8 A;  4ECY A;  2FMP A;  1IG6 A;  2RLT A;  2YN4 A;  3M8S A;  3N7S C;  4UAS A;  2CPR A;  2HW3 A;  2C22 A;  4DLE A;  2G06 A;  3UQ2 A;  2AQ4 A;  2W8K A;  2W3S A;  2IBK A;  5ALG A;  1ZQ1 C;  2XY7 A;  9ICU A;  2IMW P;  2B0C A;  2NYV A;  2VA2 A;  2WF6 A;  3FYH A;  1MQ3 A;  2ZIV A;  3TFS A;  3PSP A;  5IIJ A;  5T14 A;  3C29 A;  1S0O A;  2W7P A;  2LM4 A;  1MC8 A;  3BQT A;  3I76 A;  2JV3 A;  8ICW A;  3RH5 A;  4NL9 C;  3RB0 A;  3N7R C;  3BQ7 A;  2D6F C;  2KIW A;  2R8K A;  3SD7 A;  4KLT A;  2UVU A;  5KFX A;  5DLF A;  3RR7 A;  1ZQY A;  1ZRM A;  7ICL A;  3LYS A;  4EZ6 A;  1L7M A;  1NOM A;  3N7P D;  1COK A;  4XQ8 A;  3AUO A;  1A76 A;  2ZXH A;  1QTM A;  2W9M A;  3PX6 A;  4USA A;  5J2D A;  1YZ6 A;  1KW4 A;  3ZDB A;  1SIJ A;  4KLU A;  3QU2 A;  5ALJ A;  3GV5 B;  1Z1V A;  2W9C B;  2BQU A;  8ICO A;  2DL0 A;  3M6Z A;  3JPN A;  2JZB A;  4C7Z A;  1NK5 A;  8ICN A;  4QZD A;  4PHD A;  3D2N A;  4UAU A;  4YN4 A;  1BPE A;  4O3Q A;  8ICI A;  1BPD A;  2BCU A;  2WAQ F;  3SV4 A;  2IOF K;  5KFK A;  2XO7 A;  1ZXI A;  2RDI A;  2KKP A;  1N62 A;  4HYK A;  3M9O B;  3RH6 A;  5F9L A;  2BHN A;  5AKJ A;  2PMZ F;  2EAP A;  2F8L A;  3HKZ F;  3QEB Z;  4OJO A;  5J0R A;  3K75 D;  2A19 A;  4J03 A;  2OHF A;  3PZP A;  1A0P A;  5ALR A;  2HOI A;  3MGV A;  3CP8 A;  2ZUC A;  1J97 A;  3CYM A;  4Y2Q A;  3V6K A;  3GV7 B;  3BQ2 A;  2W7O A;  2OH2 A;  5DG9 A;  1JXE A;  5DG8 A;  1S5L U;  4O3O A;  4ED3 A;  8ICZ A;  3THV A;  2MRL A;  1M6Y A;  2P6R A;  1FEZ A;  4KLS A;  4F5Q A;  1O08 A;  2RRD A;  1URJ A;  2GH1 A;  2JMG A;  3ISC A;  4YCX A;  1PVQ A;  5DBA A;  3H4D A;  4OJP A;  2H3Q A;  2IOH A;  1SKR A;  5D4B A;  4GXK A;  1BPZ A;  3IG5 A;  4YR0 A;  5J2G A;  7ICM A;  3OSN A;  4ACO A;  3BJY A;  1N5W A;  3Q8K A;  4RNM A;  3C5F A;  1N2X A;  3KBB A;  5AM0 A;  9ICC A;  5KFT A;  5J0Q A;  2JHD A;  9ICA A;  2ZIU B;  2BQ3 A;  2JR5 A;  5KT6 A;  5KFJ A;  2IOF A;  3PO4 A;  2ASD A;  4JV2 A;  2B6G A;  2W54 A;  1X9W A;  4J9M A;  1N61 A;  4Y2T A;  2M0N A;  1Z19 A;  4IRD A;  4NM1 A;  4GXJ A;  1RG6 A;  4KLQ A;  1T8E A;  1SL1 A;  2KE7 A;  3GZF A;  4P2H A;  8ICX A;  2HBL A;  5ALP A;  4QWC A;  1SV0 A;  4C4S A;  2NO5 A;  3BQ1 A;  1TAQ A;  4F50 A;  4TUP A;  1C20 A;  4QZE A;  1SZP A;  3WK9 A;  2W9C A;  2VAN A;  3RH4 A;  2NRT A;  3Q8S B;  4GC7 A;  2KK0 A;  5HHI A;  4NJ8 A;  3H8J A;  2BCR A;  4B9U A;  1A77 A;  5DGB A;  5J0Y A;  7ICJ A;  3PW2 A;  5KFI A;  1LV5 A;  3ISD A;  5A0L A;  4NLB A;  2ISO A;  4I29 A;  4GIB A;  4F4K A;  2ZUB A;  3B0X A;  5ALI A;  5ALL A;  9ICR A;  4IQV A;  3MFH A;  5AI9 A;  5EE9 A;  4PGX A;  2H5X A;  3UPQ A;  4MHV A;  5E79 U;  1NJZ A;  3C1Y A;  4BGD A;  3AL0 B;  2Q0Z X;  4PPX A;  3K4G A;  9ICW A;  9ICQ A;  3S6J A;  2CN1 A;  3F2C A;  4RQ5 A;  2FPK A;  4DL3 A;  1NK7 A;  4M47 A;  4QW9 A;  4F5R A;  3WK6 A;  4ECX A;  2C28 A;  3NVV A;  7ICS A;  1LVH A;  1U4B A;  4KTQ A;  1NJX A;  1BVS A;  3RR8 A;  7ICQ A;  2KD1 A;  2PI4 A;  1ZQQ A;  2NRW A;  5AKX A;  5AM5 A;  2OCE A;  5K4L A;  5ALF A;  4DOC A;  2HHQ A;  1SB3 C;  2LPE A;  5KFS A;  1TAU A;  3NVY A;  4EBD A;  5BOM A;  2R8I A;  2G07 A;  2E8P A;  2LBO A;  5DQH A;  3KFU F;  4LJX A;  4JMU A;  5EE3 A;  3R9K A;  2AHO B;  2LYH A;  4I2J A;  3HWT A;  4IQU A;  1KL9 A;  2ZIU A;  4ELV A;  4KLH A;  2JH1 A;  9ICP A;  1WG8 A;  5ALK A;  5J2A A;  3RBE A;  1ZYQ A;  2LMR A;  3AQE A;  4F4X A;  4BWM A;  3QX7 A;  3TAD C;  3I1Y A;  4DQP A;  4YMM A;  3NUQ A;  5KNI A;  2JEF A;  3JPT A;  2FPL A;  2NO4 A;  2I9G A;  5DBB A;  1QCK A;  4IQW A;  5AM4 A;  3KZI U;  1YZ7 A;  4ED8 A;  4RZR A;  2PXI A;  1N48 A;  1RXW A;  3PW7 A;  3GQC A;  4TQS A;  1ZQC A;  3MC1 A;  2F76 X;  2XI9 A;  2F2A B;  3EZ5 A;  3D2S A;  4F92 B;  5J0X A;  1ZQD A;  1MSW D;  1RQN A;  5KAF U;  4DL5 A;  1ZQR A;  4CCH A;  5III A;  5AK4 A;  5ALO A;  5CHG A;  4MF8 A;  4TUR A;  1P7D A;  4I2I A;  4F91 B;  4P4P A;  4ZH4 A;  2K8C B;  5J2B A;  4RQN A;  2AXT U;  4UAT A;  2G0A A;  3MGH A;  4GFJ A;  4UW9 A;  4DQR A;  5ALM A;  4F4W A;  4DQS A;  2KMD A;  4FO6 A;  3WKE A;  5ALX A;  1SZH A;  2BPC A;  4UB8 U;  4QNL A;  3SR6 A;  4LZD A;  3MBY A;  5L1M A;  2W3R A;  2JH7 A;  1SKW A;  1OW5 A;  3WKD A;  1LKY B;  1BNO A;  2M9N A;  4CNQ A;  5ALY A;  1ZQL A;  3H8S A;  2EDU A;  2JEJ A;  4K4G A;  2O6K A;  3HW8 A;  3OHB A;  2Z7J A;  4NWI A;  2KTQ A;  4GXI A;  3RAQ A;  1U49 A;  2ZXI A;  3PST A;  5KFP A;  2ASJ A;  4O0I A;  1JRP A;  2W11 A;  1ZQU A;  5AKY A;  3MAB A;  5KFZ A;  1U47 A;  2NV3 A;  1JMS A;  4CDG A;  4B9L A;  4EYI B;  1XNS A;  1FFV A;  4F93 B;  2HI0 A;  2NRZ A;  1SXD A;  4E0D A;  5KT7 A;  3KKA C;  5KFF A;  8ICA A;  5EWG A;  9ICV A;  2ZTE A;  8ICF A;  4RPX A;  2JEG A;  5DDY A;  3DV9 A;  3E0F A;  2H3F A;  2QKQ A;  4NXZ A;  3V6J A;  1KDH A;  2ODG A;  9ICE A;  3H0R B;  1ZQP A;  5J2K A;  4QZH A;  9ICX A;  4DSK A;  2E8N A;  2Y1J A;  4PL1 A;  5DBC A;  1KN5 A;  4DFD A;  4KLJ A;  2H3Z A;  4DFP A;  3L4P A;  1K5O A;  2VKQ A;  3Q8M A;  5HML A;  4IRC A;  4KIT B;  4YFK A;  5CB1 A;  3B9J A;  3H7I A;  2I1Q A;  4F71 A;  2EH9 A;  2Y9T A;  8ICG A;  1ZQK A;  4PHA A;  1COO A;  2DF4 B;  1UCV A;  2Y1I A;  3ZDD A;  1NZP A;  1JRO A;  1D9D A;  5DQI A;  4ECT A;  2YY6 A;  4MF2 A;  2KZM A;  4O5C A;  4AP9 A;  3RF9 A;  2PFO A;  1U48 A;  4UB3 A;  4ECZ A;  3OPX A;  2MAX A;  2G5I B;  4M6W B;  5KFB A;  2F1J A;  3T5K A;  3QNM A;  5IIM A;  1S0V A;  1CEZ A;  2HBJ A;  4EBC A;  4DS5 A;  4RQ4 A;  4B9T A;  3ETL A;  3C2K A;  4ELT A;  9ICL A;  3WK7 A;  1LKY A;  5ALW A;  3QZ8 A;  8ICC A;  2KIC A;  2YQE A;  2Q4T A;  3WK5 A;  2L5Y A;  4O5E A;  4QZG A;  1X66 A;  1VDV A;  4PL2 A;  2J6T A;  5J2E A;  4UB1 A;  2OXO A;  5AIA A;  1N63 A;  2K4I A;  2YX8 A;  3SYZ A;  2KJ5 A;  2PFN A;  5KFG A;  2UVV A;  3JPQ A;  1UA0 A;  3MR5 A;  4X5V A;  2BCQ A;  4GC6 A;  4LZG A;  4I2A A;  2F1H A;  1QQ6 A;  4XUS A;  2XGP A;  2BGW A;  1TK5 A;  3SI8 A;  5CEH A;  1WYG A;  2YTU A;  4ECV A;  3SEI A;  1TV9 A;  1S0N A;  1Q8K A;  4NV0 A;  2HSZ A;  7ICI A;  2WF9 A;  3ZD8 A;  1ZD3 A;  1XO0 A;  1ZQN A;  4DSJ A;  1ZQS A;  4RQ3 A;  2F3N A;  1ZQT A;  4B9V A;  1VJ5 A;  1L3T A;  3GIK A;  4R8U A;  1NK8 A;  2BR0 A;  4Q8E A;  5ALU A;  1UA1 A;  1X6I A;  4R64 A;  3RB6 A;  2OM6 A;  2WF7 A;  3UXP A;  2XY6 A;  7ICG A;  1D9F A;  2WHE A;  3C23 A;  4CF5 A;  5HP4 A;  5JUM A;  1B0X A;  3IV6 A;  5GTH U;  5GTI U;  7ICP A;  5KFC A;  1S77 D;  3H8M A;  1Y88 A;  2AGP A;  5KT5 A;  1T7P A;  3GV8 B;  2ATL A;  5AK3 A;  4NM2 A;  9ICG A;  1KBU A;  4MEY A;  1PK1 B;  3K1R B;  1JIH A;  1UQV A;  2RHF A;  4Z6C A;  1RPL A;  3MR3 A;  2P35 A;  3FM9 A;  3RJK A;  4Q44 A;  2W43 A;  3WK4 A;  3EW9 A;  4QW8 A;  1DXS A;  1SKS A;  1KFT A;  4P0Q B;  4OCZ A;  3HIL A;  4RNN A;  4IS7 A;  5ALD A;  2QLT A;  4KLL A;  3V7K A;  2FJ6 A;  4I2G A;  2DKZ A;  4EBE A;  3NRW A;  4M6W A;  4DSL A;  2KSO B;  1X42 A;  5L9X A;  1ZQJ A;  5F9N A;  2JXJ A;  2K4E A;  2Y0S C;  3ICX A;  2DQN B;  4Q8F A;  4IRK A;  5B66 U;  3C5G A;  4UBC A;  3IRU A;  7ICR A;  2VJ5 A;  9ICI A;  4BDP A;  4J9N A;  2QB1 A;  2EAO A;  2F1I A;  3M6K A;  1KTQ A;  2ZTD A;  3RJG A;  2W9A A;  3MDC A;  3AN1 A;  3V7L A;  1L7N A;  3CRX A;  3PV8 A;  3G6X A;  3SAF A;  5JTI A;  2ZTC A;  3UMB A;  2V9W A;  4DF8 A;  1XU4 A;  1H38 A;  4PHP A;  3TAN A;  1JI7 A;  2E1E A;  3LWM A;  2HHX A;  2PFP A;  4KMU A;  2B21 A;  2KJ8 A;  4KX5 A;  5L1L A;  1WUD A;  2E1F A;  5KFW A;  3AMZ A;  3C1Z A;  4HAI A;  4TUQ A;  3M9M B;  2PKE A;  1QSS A;  4C8N A;  2JGA A;  2FMS A;  1XSP A;  5J2H A;  3HJE A;  1S9F A;  4O3M A;  5G5H A;  5KG2 A;  4ECS A;  3TAQ A;  4RT2 A;  4EYH B;  4FE3 A; 
#chains in the Genus database with same CATH homology
 4NJ8 A;  5KNI A;  1PK1 B;  3K1R B;  1UQV A;  2K4P A;  1V85 A;  2FE9 A;  2QB0 A;  1SV4 A;  1DXS A;  3BS5 A;  1LKY A;  2ESE A;  1X40 A;  3HIL A;  4IS7 A;  2L5Y A;  1X66 A;  5JRT A;  1F0M A;  2JV3 A;  1SXD A;  3KKA C;  2DKZ A;  4MHV A;  2EAN A;  4NL9 C;  3BQ7 A;  2D3D A;  2KSO B;  3SEN A;  2D8C A;  3TAC B;  3KKA A;  3TAD A;  1PK1 A;  2K60 A;  1COK A;  2QKQ A;  2KIV A;  2F44 A;  1SXE A;  2QAR B;  2ES6 A;  2QB1 A;  2EAO A;  2F8K A;  2YTU A;  1WWU A;  3SEI A;  1B4F A;  1KW4 A;  2E8N A;  4RQN A;  5J8Y C;  3BS7 A;  2F3N A;  1Z1V A;  2DL0 A;  4RQM A;  2DKX A;  2KMD A;  4NL9 A;  2B6G A;  2KSO A;  5J8Y A;  5JTI A;  1PK3 A;  4PZN A;  2KG5 A;  2LPE A;  2E8O A;  3IDW A;  2Y9T A;  1OXJ A;  4PZO A;  1V38 A;  2EAM A;  5L1M A;  2QB0 B;  1SV0 C;  1UCV A;  1JI7 A;  5F3X B;  1OW5 A;  2E8P A;  3BS5 B;  1LKY B;  2E8M A;  2QAR A;  1RG6 A;  1B0X A;  2KE7 A;  3H8M A;  1SV0 A;  2Y9U A;  1SGG A;  2EAP A;  1WWV A;  5JU5 A;  2LMR A;  1X9X A;  3TAD C;  2GLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...