2DL1A

Solution structure of the mit domain from human spartin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
b'GSSGSSGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spartin
publication title Solution structure of the MIT domain from human Spartin
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2dl1A01
4CN4A 2JQKA 4P1NA 4U31A 4U2ZA 4CN1A 1YXRA 1WR0A 1WFDA 4A5XA 2K3WA 2WWVA 4CN6A 2V6YA 2A9UA 4U2YA 4WZXA 4NIQA 3ZT6A 5CJ5A 2V6XA 2CPTA 5LB7B 3ZSTA 3EABA 5FVKA 2MPKA 2RPAA 2CRBA 3ZT7A 3ZT5A 2V6YB 2LRKA 2JQ9A 4U7IA 2DL1A 4U33A 2JQHA 3K1SA 4U7YA 4ZEYA 2WY2A 3ZSSA 1WCRA 2W2UA 2XZEA 5CGMA 4U3CA 5FVLA 4IT4A 2LRLA
chains in the Genus database with same CATH superfamily
2WU2A 5LJNA 2BS4A 5BR8T 2LSIA 5KX5E 2A9UA 3GA8A 4TNVA 3N5LA 4TN7B 2XAHB 4COFA 4U72A 1N32T 3PE0A 5F8PA 2BKOA 1UX5A 1ZEEA 2WWUA 4ISTA 2V5CA 5HEGA 2ES0A 2MTQA 5CA0E 5LMNT 3AE6A 4GOUA 5HXEA 3DTOA 4B3RT 2XASB 2DWKA 3N2GE 3S4UA 3I0QA 2J62A 2V5DA 2VKOA 2LHRA 4TWFA 5AQIB 4YJ2E 2CBIA 5DQWA 3RYFE 5FKYA 4DV1T 4DR4T 4I55E 3AEEA 3N9NA 1BR2A 4HFEA 1XZYA 3T8OA 4X1KE 3V5SA 4PFPA 1T72A 3ZSTA 3AE3A 5HWYA 4PNIA 3UTKA 5FNVE 3ONLC 3RKGA 2IMLA 2BS3A 1SA0E 3P7IA 3PURA 2X0HA 3TLVA 3VKHA 3RX6A 4Z91A 3IA3A 2HH7A 4A97A 3CPZA 4LFBT 3L39A 3P4WA 5JDLA 3Q2MA 4WZXA 3OTOT 4MFRA 2KSRA 2JJ9A 4LFCT 2LHNA 2BG9B 1M62A 5AQJB 4LF6T 3FHNA 5ABHA 5AQFB 3DJBA 1IBLT 5JDHA 4MALA 2HN2A 1T8BA 2X67A 2N2NA 4B6XA 4OX9T 2QGSA 2E5LT 4HFIA 2NR4A 4U2ZA 3UT5E 2H7VC 4UVCB 2XSAA 2VKHA 5JRCA 1G73A 4P0BA 1MIWA 4BJNA 4NXNT 2XAFB 2X0YA 3AE1A 2K24A 1MIVA 2JQKA 5EK2A 3PUWF 4ISSA 5L3DB 4DV4T 2V7IA 4IHJE 5AQRB 5LCYA 1OEDC 4EZ4A 5FVLA 3PUZF 3PUGA 2FJBA 2KZ7B 2JIWA 3BQLA 3O1JA 4DMWA 5CB4E 1UUSA 3LK2B 1GQEA 5FL0A 4JI5T 3NVOA 5HXRA 5FL1A 5J0ZA 4UV8B 3AEAA 4YHHT 3RIFA 4IE0A 5JTGA 3GMIA 3VR9A 4TNWA 4U31A 2VVSA 3SOLA 1S35A 5LBMA 3E22E 3RRWA 2CHOA 1AJ3A 1N33T 1I94T 4DV0T 1KEYA 3KV4A 4KBMB 3VU7H 3QB5A 1UURA 2XQ4A 2M67A 2KWIB 4TV9E 5ETWA 3RIUC 4AISA 1MMDA 4LF8T 2W62A 4H63H 3F2EA 1J1JA 4E7ZA 5HWXA 4L5GA 5FMNA 2LEHA 4HFVA 4X66T 2ZM6T 3UU8A 3L8RA 1YQ4A 3TLWA 2D5UA 4YHJA 2V8SV 3ZYMA 4TZ4C 2RA1A 3AA7B 5AQVB 4H9OC 2WB5A 4DVDA 1U4QA 4NXMT 4I43B 3RI5A 3NBXX 2PFVA 2X9YA 3JAEA 4IE7A 4DMVA 5LA6E 3UULA 2UUCT 3UFGA 2DLRA 5GONE 4X64T 4ZEYA 3AAEB 1IBKT 4HWDA 2HPLA 2KXPB 3B13A 2Q9QC 2YU1A 5HEOA 3EUHA 3M3ZB 5HEJA 2K3WA 3ZC0A 4EIWA 5L4EA 2XQ3A 3MXZA 3AVRA 3N9QA 2BKNA 3RYCE 4N78D 1NENA 2LOPA 4ZI2D 3I9WA 3MA9A 2CBJA 3ZT5A 4ANJA 5AQGB 3RH3A 4OYKA 4YTNA 3LJCA 4O2AE 4JI4T 5F5WA 4G2AA 3AAIA 4P0AA 2LSYA 4HFHA 3AE8A 2XM1A 2VQET 1DU2A 2W66A 2YK0A 4EAHA 3E08A 4JI0T 2XTLA 4GK0E 4NUUA 5C8YE 2AE9A 2JRKA 4ILCA 3R84B 5L47A 1YKHB 2LOSA 4KHZF 2XUEA 3QK6A 4IDNA 4ASKA 2PG8A 1Y64B 4HWIB 3B5MA 4AKRB 1HG5A 2XAJB 4HGAA 2V6YA 4AQFC 5JREA 4TX5A 5JH7E 2DHRA 4XAXB 2Q9QD 1I6ZA 4H9SE 3RRCA 4HFBA 5LMUT 3CQCB 2QYWA 5ABFA 4QH5A 3HL6A 4YLHA 2FJEA 4LFAT 2LSJA 2WQYA 4AKIA 5FYMA 3UUNA 2YOEA 3UUMA 1US7B 2KINB 3IBPA 4GKKT 4DR5T 2YINA 4X65T 2LRLA 3KVBA 5KMGP 1HCIA 2BG9C 1WYBA 3E0ZA 3NWIA 3HR0A 4LMJA 3N2OA 4IL4A 5LGNB 2Q9QB 2PBIA 4DV7T 2CRBA 4QX8B 3ANWB 4X1IE 4YTPA 2EHOD 4O2BE 4HWCA 2X51A 2WSSV 5FY7A 4OYJA 1OEDA 2UXXB 2IC6A 5J2TE 2V7KA 1HR0T 1UK5A 3LK42 3BK9A 3O9XA 4LF9T 4DO0A 1FJGT 3UQ7A 3BQIA 4DUYT 4EEDA 4DR2T 1LVFA 2X9WA 3RQUA 3ZMTB 3N9PA 3FZMB 2BG9E 4WNKA 3JAFA 1IBMT 3ZPOA 1HX8A 4A5XA 1SHZC 2K5BB 3AB3B 4ZZCA 4PJLA 2C0SA 2EHOB 4AKLA 2N9DA 4UEMA 2CWYA 3Q5XA 3K3OA 3TLSA 3A7MA 3D0TA 1J5WA 4A56A 4PW8A 5CFBA 2LM2A 5TAOA 1U5PA 3FB2A 3RIUA 3RYHE 3EHZA 2LT3A 4H9PC 2XAGB 3X1DA 1XWMA 4HFDA 4CI1B 3FZFB 1WYCA 5LP6E 2VKJA 1VCTA 4YSZA 2V7JA 3UFEA 2WM9A 2L3LA 2LJLA 3CX7B 4B3TT 1HS7A 1JNRA 3WAJA 4K0KT 2NTYA 5C2TA 1HNZT 4HE8A 2ACXA 4DR1T 3IHRA 1HTJF 1UX4A 1HX1B 2E2AA 4LMKA 3HKDE 3ESLA 3H3AA 1D0XA 4QHOA 3VRBA 2CLYB 2Q9QA 4IDZA 3ANWA 2WU5A 3O1IA 4MLKA 4IIJE 2UU9T 4PK4A 5HYAA 3Q5WA 5HXSA 3FXDB 1OXZA 1ZHCA 1B7TA 4AQYT 2J47A 4YXDA 1E7PA 3RF1A 3ZMZB 4X62T 4L0RA 2F4VT 2C5JA 2NP9A 4IL9A 2JQQA 1BR1A 4EGWA 2Y8DA 2LSGA 3VKGA 2JQHA 3KDSE 3K3NA 4IDOA 1T98A 1KK7A 4AKGA 1WCRA 4IT4A 2M6IA 1YD8G 4IDPA 1SUMB 3PTRB 5A1LA 5JDNA 3SWHA 5FXZA 3NRYA 2CEAA 3A5XA 2RPAA 5L3EB 2UUAT 5AQNB 2YU2A 1UCUA 4JLEA 3N2KE 2H3RA 4JV5T 2ZM2A 2WWVA 2XQYA 1L0VA 5FXXA 4KI0F 2KMFA 2YDQA 2VKDA 3AECA 1XDPA 4WBNE 1KNZA 2IC9A 2X68A 3O4XE 5H6QB 1XNQT 4GK5E 3FZHB 3OJAA 4U2YA 5ABEA 4YJ3E 2B1EA 2XQ9A 4AQFA 4YY3T 1V9DA 4Q25A 1HF8A 5HAXA 2PJQA 4DV6T 5JDFA 4QXCB 3M65A 2A2FX 5BMVE 2BBHA 4HEAA 4EYUA 5AQKB 3VRAA 3PUXF 4IGUA 4CZZB 4TWHA 4L9IA 1LRZA 4ZI2C 4C91A 3UUBA 2JMHA 1N34T 2VWAA 4DV5T 3ZN0B 4KP3C 4IDQA 3WI3A 3AAAB 2BG9A 1D0ZA 3ONJA 4KX6A 2DL1A 2E9XD 2VL8A 3FBLA 4PFOA 4PJMA 4UVBB 4ILAA 2H88A 3KVAA 4JI1T 3ZYLA 4FJOA 2WMNA 3LBXB 4CN4A 4DR6T 5LYJE 4JEHB 3ZMUB 1R8IA 5FY1A 5LG4A 4ZHQE 5AFUL 3ZEFB 2QA7A 3C64A 4PK5A 3N9MA 5LXTE 1G8XA 3AXJB 4NUVA 3RIAA 3BQKA 4JI6T 5F3JA 2VVNA 3ZC1A 4GIWA 3F31A 1OWAA 4UV9B 4ZS2A 3JC6D 2GK9A 2QVAA 2E9XB 3RPUA 2G0UA 3P4PA 2UXCT 2L8KA 1IJ6A 1MNDA 2WCAA 4QXHB 2XZEA 4X20E 4DR3T 1FMVA 3I9YA 1WR0A 3NKZA 3KBTA 1IZNB 3AE4A 4IE5A 3FZLB 2D0TA 2ZLYA 3G06A 2YEVC 3CX8B 5AQQB 2H7OA 1D1AA 4ERRA 4AI6A 2XQ7A 3KV6A 2Y6XA 2WDVA 5LGUB 4TWDA 4ZXLA 2C5KT 2J1DG 4H63V 1EZ3A 2IAKA 5JDGA 5LGTB 1M7KA 1KNPA 3ZLIA 3ZJ2A 2YN6A 3MKDA 5JDMA 3EAMA 2EHOC 3NZPA 1LKXA 4EYYR 2FBWA 4FI5A 2MYSA 4IE4A 4BJMA 3Q5DA 1ZOYA 2IDOB 3MACA 2W63A 3PJAJ 2WS3A 2D2SA 4GKJT 3GN5B 1CUNA 3N9LA 2BVLA 3EVYA 4LF7T 5DQVA 4F8HA 1IAPA 5HEUA 5JQGE 4EB6E 2QRXA 5AQLB 3AEBA 3UU5A 5JR9B 4H9QC 1WLXA 4GYSA 5C3JA 4U7YA 4TUYE 5ABGA 2W00A 2VL0A 2X9XA 2XHEB 2NWBA 5L3CB 4ZI7E 4NIQA 2SPCA 2I0MA 3U3IA 4O4HE 2J4GA 2PTFA 3AE7A 3ONXA 4YSXA 3FXEB 3RYIE 4CXXA 2CHNA 4HTEA 4UF0B 3ABVA 2XQ6A 3PDYA 3ZCIA 3RC8A 2V6XA 2DCFA 3CIRA 3AEFA 2MAWA 4C90A 2CLYC 3J9X1 4ZOLE 5AQTB 5LBQB 4CI2B 4F6RC 5L3GB 2X0LB 2L9QA 4HN9A 2KLQA 2UXNB 5FY0A 1YXRA 4O8SA 2V1DB 5L2LA 4DV2T 2XJ7A 4JI3T 5IUXA 2LRKA 5HCJA 3IEEA 2DWGA 2WDRA 5DJQC 3LSVA 4JEUB 3TKLB 1BR0A 2ZM0A 4UVAB 3MK7C 2BDEA 4X1YE 4V1Av 4KHPT 2KWHA 4Z90A 4ZI3D 3P4SA 4HFCA 3K1SA 1MMGA 5HXCA 3L3PA 3ZJ1A 2WDQA 2W61A 4X5TA 2OLTA 2WBLA 2LKHA 2ZM8A 1W0BA 4EXTA 4PK6A 2ACZA 1QSDA 3P8CD 2JPFA 4U33A 3PV0F 2V7LA 3I0OA 2C5IT 4HWHA 3VHLA 2VK9A 3I1AA 4UELA 1WRDA 4YTMA 5FP3A 4O4LE 2CWOA 2FJDA 2CA5A 2XQ8A 4TV8E 1VOMA 5JVDE 5M4YA 5JRCB 3AEDA 2A72A 3AE5A 4AQGA 3PUYF 1FEWA 1D1BA 4AXPA 3SFDA 3TLTA 4B3ST 3C98B 4UF0A 2VB6A 1O3XA 2V26A 3UU4A 4WBOA 2WMOA 3LG7A 4DUZT 2MBGA 3Q5EA 2BVMA 5IHYA 5EK3A 2X9HA 3C51A 3LK3B 1XNRT 3PUVF 3AE9A 4QH1A 5J1GA 3FZKB 2WP9A 4DNDA 2NW9A 1H7CA 2CXLA 2E8IA 3UQ4A 2N1GA 3T1YT 3PU8A 3C4WA 4B3MT 3EDUA 3HA4A 2CXDA 3CWZB 2ODUA 3H3MA 2ODVA 3EABA 2NW7A 4H9NC 4KMCA 4QKNA 1ZKEA 3ZT7A 4UXNB 3PUQA 1D1CA 2W0GA 2CCQA 2I59A 3L09A 5ADXL 3WAKA 3KV5A 4WW0A 3NRXA 2XAQB 4J2CA 2XQ5A 4YT0A 5CA1E 2K48A 1J5ET 3DP7A 4XZCA 4I0UA 3HI2A 2UXDT 2WY2A 2IUBA 2E9XC 1YW0A 2EHOA 3Q9DA 3OVUA 1SE7A 3ZKRA 4JI2T 1QLBA 4NPPA 4YFSA 1KNRA 3J7Yq 3RHWA 3OYZA 5LOVE 1XMOT 1UGOA 4DBRA 1FMWA 3NZQA 3SRZA 5EK4A 2Z6EA 4OHFA 4U74A 1NEKA 3JADA 3PJAA 1W09A 2OV9A 4QX7B 3ZMSB 4ILBA 2BKPA 2YKSA 2V7MA 3JC6C 4CXYA 3W15B 4DR7T 2XPKA 2KT9A 5AQHB 2YDRA 3CK6A 4WYVA 5JDQA 2CXFA 3LDQB 1QUUA 4P09A 4DIDB 3FBZA 1Z8UA 4QH4A 3P4QA 2BS2A 2Y48B 3AA1B 4KUMB 2BZBA 3CKDA 1T7SA 3U78A 1MNEA 1MMAA 5FXVA 1FIOA 4YSYA 2M6BA 2NW8A 4I50E 4PJJA 5JR9C 1W0AA 5LHIB 1Z0PA 4PAGA 3JCFA 5LB7B 4UR9A 3T1HT 4JYAT 2FJAA 1OEDE 2WAUA 3AE2A 2LE8A 1JNZA 4LMLA 4I4TE 5L3FB 1IJ5A 2NTXA 5HEHA 3EDVA 5FVKA 1Y01A 3R6NA 3OPCA 5EZYE 3MZKB 3UUXB 4JUYA 2B76A 3HKBE 4ADZA 3PUSA 3C4XA 3ZN1B 3F57A 2XSBA 1N36T 4MHCA 2V6YB 3C4ZA 2ZMAA 4CQIA 2LLYA 2I6HA 1E1HB 4O4JE 3AA0B 1HG2A 3QNUA 2VASA 5ABFB 2VURA 3GWHA 2LSKA 3KINB 4ILUA 1HNXT 2DNXA 3RQWA 3QC9A 1HNWT 2UUBT 2D9DA 2W4XA 1YKEB 3O1HA 5J2UE 2IHR1 1X9BA 2A3DA 3ZT6A 4AKHA 2IW5B 1XMQT 3HKEE 2WZIA 5AQSB 3K8PC 3RC3A 2XY8B 3SS1A 1NWMX 3MJXA 1HFAA 3OKQA 2XM2A 4P1NA 3UU6A 2YDSA 1MMNA 3HKCE 2E5VA 1OEDB 4BAYB 4A98A 3N9OA 1YQ3A 4M1PA 3UU3A 2MOZA 1ZP0A 5AQUB 4QXBB 2H89A 2HPJA 2CE7A 4ZI3C 3CQXC 2W2UA 5L4HA 2R6GF 2RP4A 4GYRA 2CMRA 2BBJA 3RLFF 1VRBA 2DI4A 3K3QC 5CJ5A 5HCMA 5LNKA 2CPTA 4CXWA 3KV9A 3AEGA 5LHGB 4IE6A 4U7IA 3V5UA 2KNDA 3LBXA 4CI3B 1WR6A 4HWFA 2XQAA 3ZCJA 2LKGA 5E0OA 1CHUA 4E7SA 2AXDS 2HHHT 4CN1A 2X66A 3CX6B 4ZZBA 3ETVA 3AXJA 4G63A 1D0YA 4JBWF 4PJNA 3SFEA 1W9RA 3CVRA 5HXHA 2OA5A 2E9XA 3TLUA 1WFDA 4LF4T 3OYXA 2HN1A 4HKAA 5DABA 4DBQA 3QUJA 3OBVE 2MPKA 5FXWA 3B57A 3AVSA 3KFWX 4IREA 1XDOA 5IWAT 3PU3A 3CQGB 3QOFA 5CGMA 3ZYKA 3VR8A 2LM9A 2UXBT 3A8YC 4JI7T 2P9BA 2CM0A 3AA6B 4Z8XA 2W67A 3PUAA 4QWNB 3P4RA 5LHHB 4EEBA 4ZS3A 4EOZB 3CMLA 4BA9A 4U3CA 4EZHA 5KDMC 1BR4A 3QB5K 5IYZE 2K9AA 5AQMB 4AIUA 2WZHA 3EI0A 3RKOA 1X79A 1KFYA 3LFMA 5L3BB 1LVKA 1KF6A 5LJMA 4DV3T 1MIYA 5AQPB 1VCSA 5KXJA 2VQFT 3KBUA 4K0UA 3ETUA 5LG3A 2IIUA 4CN6A 4JI8T 3GN5A 4LF5T 3C50A 3H37A 1ZV4X 3ZMVB 1S94A 2FUPA 1E2AA 4EV6A 3ZSSA 1NAFA 4H9RC 4UIGA 4O4IE 2D0UA 5AQOB 5JR9A 2JMKA 3IF8B 3RGLA 2NOXA 4OFZA 3P50A 2JQ9A 4XBFB 4OK0A 4MBQA 5H6RB
chains in the Genus database with same CATH topology
4CN4A 2JQKA 4P1NA 4U31A 4U2ZA 4CN1A 1YXRA 1WR0A 1WFDA 4A5XA 2K3WA 2WWVA 4CN6A 2V6YA 2A9UA 4U2YA 4WZXA 4NIQA 3ZT6A 5CJ5A 2V6XA 2CPTA 5LB7B 3ZSTA 3EABA 5FVKA 2MPKA 2RPAA 2CRBA 3ZT7A 3ZT5A 2V6YB 2LRKA 2JQ9A 4U7IA 2DL1A 4U33A 2JQHA 3K1SA 4U7YA 4ZEYA 2WY2A 3ZSSA 1WCRA 2W2UA 2XZEA 5CGMA 4U3CA 5FVLA 4IT4A 2LRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CN4 A;  2JQK A;  4P1N A;  4U31 A;  4U2Z A;  4CN1 A;  1YXR A;  1WR0 A;  1WFD A;  4A5X A;  2K3W A;  2WWV A;  4CN6 A;  2V6Y A;  2A9U A;  4U2Y A;  4WZX A;  4NIQ A;  3ZT6 A;  5CJ5 A;  2V6X A;  2CPT A;  5LB7 B;  3ZST A;  3EAB A;  5FVK A;  2MPK A;  2RPA A;  2CRB A;  3ZT7 A;  3ZT5 A;  2V6Y B;  2LRK A;  2JQ9 A;  4U7I A;  2DL1 A;  4U33 A;  2JQH A;  3K1S A;  4U7Y A;  4ZEY A;  2WY2 A;  3ZSS A;  1WCR A;  2W2U A;  2XZE A;  5CGM A;  4U3C A;  5FVL A;  4IT4 A;  2LRL A; 
#chains in the Genus database with same CATH topology
 2WU2 A;  5LJN A;  2BS4 A;  5BR8 T;  2LSI A;  5KX5 E;  2A9U A;  3GA8 A;  4TNV A;  3N5L A;  4TN7 B;  2XAH B;  4COF A;  4U72 A;  1N32 T;  3PE0 A;  5F8P A;  2BKO A;  1UX5 A;  1ZEE A;  2WWU A;  4IST A;  2V5C A;  5HEG A;  2ES0 A;  2MTQ A;  5CA0 E;  5LMN T;  3AE6 A;  4GOU A;  5HXE A;  3DTO A;  4B3R T;  2XAS B;  2DWK A;  3N2G E;  3S4U A;  3I0Q A;  2J62 A;  2V5D A;  2VKO A;  2LHR A;  4TWF A;  5AQI B;  4YJ2 E;  2CBI A;  5DQW A;  3RYF E;  5FKY A;  4DV1 T;  4DR4 T;  4I55 E;  3AEE A;  3N9N A;  1BR2 A;  4HFE A;  1XZY A;  3T8O A;  4X1K E;  3V5S A;  4PFP A;  1T72 A;  3ZST A;  3AE3 A;  5HWY A;  4PNI A;  3UTK A;  5FNV E;  3ONL C;  3RKG A;  2IML A;  2BS3 A;  1SA0 E;  3P7I A;  3PUR A;  2X0H A;  3TLV A;  3VKH A;  3RX6 A;  4Z91 A;  3IA3 A;  2HH7 A;  4A97 A;  3CPZ A;  4LFB T;  3L39 A;  3P4W A;  5JDL A;  3Q2M A;  4WZX A;  3OTO T;  4MFR A;  2KSR A;  2JJ9 A;  4LFC T;  2LHN A;  2BG9 B;  1M62 A;  5AQJ B;  4LF6 T;  3FHN A;  5ABH A;  5AQF B;  3DJB A;  1IBL T;  5JDH A;  4MAL A;  2HN2 A;  1T8B A;  2X67 A;  2N2N A;  4B6X A;  4OX9 T;  2QGS A;  2E5L T;  4HFI A;  2NR4 A;  4U2Z A;  3UT5 E;  2H7V C;  4UVC B;  2XSA A;  2VKH A;  5JRC A;  1G73 A;  4P0B A;  1MIW A;  4BJN A;  4NXN T;  2XAF B;  2X0Y A;  3AE1 A;  2K24 A;  1MIV A;  2JQK A;  5EK2 A;  3PUW F;  4ISS A;  5L3D B;  4DV4 T;  2V7I A;  4IHJ E;  5AQR B;  5LCY A;  1OED C;  4EZ4 A;  5FVL A;  3PUZ F;  3PUG A;  2FJB A;  2KZ7 B;  2JIW A;  3BQL A;  3O1J A;  4DMW A;  5CB4 E;  1UUS A;  3LK2 B;  1GQE A;  5FL0 A;  4JI5 T;  3NVO A;  5HXR A;  5FL1 A;  5J0Z A;  4UV8 B;  3AEA A;  4YHH T;  3RIF A;  4IE0 A;  5JTG A;  3GMI A;  3VR9 A;  4TNW A;  4U31 A;  2VVS A;  3SOL A;  1S35 A;  5LBM A;  3E22 E;  3RRW A;  2CHO A;  1AJ3 A;  1N33 T;  1I94 T;  4DV0 T;  1KEY A;  3KV4 A;  4KBM B;  3VU7 H;  3QB5 A;  1UUR A;  2XQ4 A;  2M67 A;  2KWI B;  4TV9 E;  5ETW A;  3RIU C;  4AIS A;  1MMD A;  4LF8 T;  2W62 A;  4H63 H;  3F2E A;  1J1J A;  4E7Z A;  5HWX A;  4L5G A;  5FMN A;  2LEH A;  4HFV A;  4X66 T;  2ZM6 T;  3UU8 A;  3L8R A;  1YQ4 A;  3TLW A;  2D5U A;  4YHJ A;  2V8S V;  3ZYM A;  4TZ4 C;  2RA1 A;  3AA7 B;  5AQV B;  4H9O C;  2WB5 A;  4DVD A;  1U4Q A;  4NXM T;  4I43 B;  3RI5 A;  3NBX X;  2PFV A;  2X9Y A;  3JAE A;  4IE7 A;  4DMV A;  5LA6 E;  3UUL A;  2UUC T;  3UFG A;  2DLR A;  5GON E;  4X64 T;  4ZEY A;  3AAE B;  1IBK T;  4HWD A;  2HPL A;  2KXP B;  3B13 A;  2Q9Q C;  2YU1 A;  5HEO A;  3EUH A;  3M3Z B;  5HEJ A;  2K3W A;  3ZC0 A;  4EIW A;  5L4E A;  2XQ3 A;  3MXZ A;  3AVR A;  3N9Q A;  2BKN A;  3RYC E;  4N78 D;  1NEN A;  2LOP A;  4ZI2 D;  3I9W A;  3MA9 A;  2CBJ A;  3ZT5 A;  4ANJ A;  5AQG B;  3RH3 A;  4OYK A;  4YTN A;  3LJC A;  4O2A E;  4JI4 T;  5F5W A;  4G2A A;  3AAI A;  4P0A A;  2LSY A;  4HFH A;  3AE8 A;  2XM1 A;  2VQE T;  1DU2 A;  2W66 A;  2YK0 A;  4EAH A;  3E08 A;  4JI0 T;  2XTL A;  4GK0 E;  4NUU A;  5C8Y E;  2AE9 A;  2JRK A;  4ILC A;  3R84 B;  5L47 A;  1YKH B;  2LOS A;  4KHZ F;  2XUE A;  3QK6 A;  4IDN A;  4ASK A;  2PG8 A;  1Y64 B;  4HWI B;  3B5M A;  4AKR B;  1HG5 A;  2XAJ B;  4HGA A;  2V6Y A;  4AQF C;  5JRE A;  4TX5 A;  5JH7 E;  2DHR A;  4XAX B;  2Q9Q D;  1I6Z A;  4H9S E;  3RRC A;  4HFB A;  5LMU T;  3CQC B;  2QYW A;  5ABF A;  4QH5 A;  3HL6 A;  4YLH A;  2FJE A;  4LFA T;  2LSJ A;  2WQY A;  4AKI A;  5FYM A;  3UUN A;  2YOE A;  3UUM A;  1US7 B;  2KIN B;  3IBP A;  4GKK T;  4DR5 T;  2YIN A;  4X65 T;  2LRL A;  3KVB A;  5KMG P;  1HCI A;  2BG9 C;  1WYB A;  3E0Z A;  3NWI A;  3HR0 A;  4LMJ A;  3N2O A;  4IL4 A;  5LGN B;  2Q9Q B;  2PBI A;  4DV7 T;  2CRB A;  4QX8 B;  3ANW B;  4X1I E;  4YTP A;  2EHO D;  4O2B E;  4HWC A;  2X51 A;  2WSS V;  5FY7 A;  4OYJ A;  1OED A;  2UXX B;  2IC6 A;  5J2T E;  2V7K A;  1HR0 T;  1UK5 A;  3LK4 2;  3BK9 A;  3O9X A;  4LF9 T;  4DO0 A;  1FJG T;  3UQ7 A;  3BQI A;  4DUY T;  4EED A;  4DR2 T;  1LVF A;  2X9W A;  3RQU A;  3ZMT B;  3N9P A;  3FZM B;  2BG9 E;  4WNK A;  3JAF A;  1IBM T;  3ZPO A;  1HX8 A;  4A5X A;  1SHZ C;  2K5B B;  3AB3 B;  4ZZC A;  4PJL A;  2C0S A;  2EHO B;  4AKL A;  2N9D A;  4UEM A;  2CWY A;  3Q5X A;  3K3O A;  3TLS A;  3A7M A;  3D0T A;  1J5W A;  4A56 A;  4PW8 A;  5CFB A;  2LM2 A;  5TAO A;  1U5P A;  3FB2 A;  3RIU A;  3RYH E;  3EHZ A;  2LT3 A;  4H9P C;  2XAG B;  3X1D A;  1XWM A;  4HFD A;  4CI1 B;  3FZF B;  1WYC A;  5LP6 E;  2VKJ A;  1VCT A;  4YSZ A;  2V7J A;  3UFE A;  2WM9 A;  2L3L A;  2LJL A;  3CX7 B;  4B3T T;  1HS7 A;  1JNR A;  3WAJ A;  4K0K T;  2NTY A;  5C2T A;  1HNZ T;  4HE8 A;  2ACX A;  4DR1 T;  3IHR A;  1HTJ F;  1UX4 A;  1HX1 B;  2E2A A;  4LMK A;  3HKD E;  3ESL A;  3H3A A;  1D0X A;  4QHO A;  3VRB A;  2CLY B;  2Q9Q A;  4IDZ A;  3ANW A;  2WU5 A;  3O1I A;  4MLK A;  4IIJ E;  2UU9 T;  4PK4 A;  5HYA A;  3Q5W A;  5HXS A;  3FXD B;  1OXZ A;  1ZHC A;  1B7T A;  4AQY T;  2J47 A;  4YXD A;  1E7P A;  3RF1 A;  3ZMZ B;  4X62 T;  4L0R A;  2F4V T;  2C5J A;  2NP9 A;  4IL9 A;  2JQQ A;  1BR1 A;  4EGW A;  2Y8D A;  2LSG A;  3VKG A;  2JQH A;  3KDS E;  3K3N A;  4IDO A;  1T98 A;  1KK7 A;  4AKG A;  1WCR A;  4IT4 A;  2M6I A;  1YD8 G;  4IDP A;  1SUM B;  3PTR B;  5A1L A;  5JDN A;  3SWH A;  5FXZ A;  3NRY A;  2CEA A;  3A5X A;  2RPA A;  5L3E B;  2UUA T;  5AQN B;  2YU2 A;  1UCU A;  4JLE A;  3N2K E;  2H3R A;  4JV5 T;  2ZM2 A;  2WWV A;  2XQY A;  1L0V A;  5FXX A;  4KI0 F;  2KMF A;  2YDQ A;  2VKD A;  3AEC A;  1XDP A;  4WBN E;  1KNZ A;  2IC9 A;  2X68 A;  3O4X E;  5H6Q B;  1XNQ T;  4GK5 E;  3FZH B;  3OJA A;  4U2Y A;  5ABE A;  4YJ3 E;  2B1E A;  2XQ9 A;  4AQF A;  4YY3 T;  1V9D A;  4Q25 A;  1HF8 A;  5HAX A;  2PJQ A;  4DV6 T;  5JDF A;  4QXC B;  3M65 A;  2A2F X;  5BMV E;  2BBH A;  4HEA A;  4EYU A;  5AQK B;  3VRA A;  3PUX F;  4IGU A;  4CZZ B;  4TWH A;  4L9I A;  1LRZ A;  4ZI2 C;  4C91 A;  3UUB A;  2JMH A;  1N34 T;  2VWA A;  4DV5 T;  3ZN0 B;  4KP3 C;  4IDQ A;  3WI3 A;  3AAA B;  2BG9 A;  1D0Z A;  3ONJ A;  4KX6 A;  2DL1 A;  2E9X D;  2VL8 A;  3FBL A;  4PFO A;  4PJM A;  4UVB B;  4ILA A;  2H88 A;  3KVA A;  4JI1 T;  3ZYL A;  4FJO A;  2WMN A;  3LBX B;  4CN4 A;  4DR6 T;  5LYJ E;  4JEH B;  3ZMU B;  1R8I A;  5FY1 A;  5LG4 A;  4ZHQ E;  5AFU L;  3ZEF B;  2QA7 A;  3C64 A;  4PK5 A;  3N9M A;  5LXT E;  1G8X A;  3AXJ B;  4NUV A;  3RIA A;  3BQK A;  4JI6 T;  5F3J A;  2VVN A;  3ZC1 A;  4GIW A;  3F31 A;  1OWA A;  4UV9 B;  4ZS2 A;  3JC6 D;  2GK9 A;  2QVA A;  2E9X B;  3RPU A;  2G0U A;  3P4P A;  2UXC T;  2L8K A;  1IJ6 A;  1MND A;  2WCA A;  4QXH B;  2XZE A;  4X20 E;  4DR3 T;  1FMV A;  3I9Y A;  1WR0 A;  3NKZ A;  3KBT A;  1IZN B;  3AE4 A;  4IE5 A;  3FZL B;  2D0T A;  2ZLY A;  3G06 A;  2YEV C;  3CX8 B;  5AQQ B;  2H7O A;  1D1A A;  4ERR A;  4AI6 A;  2XQ7 A;  3KV6 A;  2Y6X A;  2WDV A;  5LGU B;  4TWD A;  4ZXL A;  2C5K T;  2J1D G;  4H63 V;  1EZ3 A;  2IAK A;  5JDG A;  5LGT B;  1M7K A;  1KNP A;  3ZLI A;  3ZJ2 A;  2YN6 A;  3MKD A;  5JDM A;  3EAM A;  2EHO C;  3NZP A;  1LKX A;  4EYY R;  2FBW A;  4FI5 A;  2MYS A;  4IE4 A;  4BJM A;  3Q5D A;  1ZOY A;  2IDO B;  3MAC A;  2W63 A;  3PJA J;  2WS3 A;  2D2S A;  4GKJ T;  3GN5 B;  1CUN A;  3N9L A;  2BVL A;  3EVY A;  4LF7 T;  5DQV A;  4F8H A;  1IAP A;  5HEU A;  5JQG E;  4EB6 E;  2QRX A;  5AQL B;  3AEB A;  3UU5 A;  5JR9 B;  4H9Q C;  1WLX A;  4GYS A;  5C3J A;  4U7Y A;  4TUY E;  5ABG A;  2W00 A;  2VL0 A;  2X9X A;  2XHE B;  2NWB A;  5L3C B;  4ZI7 E;  4NIQ A;  2SPC A;  2I0M A;  3U3I A;  4O4H E;  2J4G A;  2PTF A;  3AE7 A;  3ONX A;  4YSX A;  3FXE B;  3RYI E;  4CXX A;  2CHN A;  4HTE A;  4UF0 B;  3ABV A;  2XQ6 A;  3PDY A;  3ZCI A;  3RC8 A;  2V6X A;  2DCF A;  3CIR A;  3AEF A;  2MAW A;  4C90 A;  2CLY C;  3J9X 1;  4ZOL E;  5AQT B;  5LBQ B;  4CI2 B;  4F6R C;  5L3G B;  2X0L B;  2L9Q A;  4HN9 A;  2KLQ A;  2UXN B;  5FY0 A;  1YXR A;  4O8S A;  2V1D B;  5L2L A;  4DV2 T;  2XJ7 A;  4JI3 T;  5IUX A;  2LRK A;  5HCJ A;  3IEE A;  2DWG A;  2WDR A;  5DJQ C;  3LSV A;  4JEU B;  3TKL B;  1BR0 A;  2ZM0 A;  4UVA B;  3MK7 C;  2BDE A;  4X1Y E;  4V1A v;  4KHP T;  2KWH A;  4Z90 A;  4ZI3 D;  3P4S A;  4HFC A;  3K1S A;  1MMG A;  5HXC A;  3L3P A;  3ZJ1 A;  2WDQ A;  2W61 A;  4X5T A;  2OLT A;  2WBL A;  2LKH A;  2ZM8 A;  1W0B A;  4EXT A;  4PK6 A;  2ACZ A;  1QSD A;  3P8C D;  2JPF A;  4U33 A;  3PV0 F;  2V7L A;  3I0O A;  2C5I T;  4HWH A;  3VHL A;  2VK9 A;  3I1A A;  4UEL A;  1WRD A;  4YTM A;  5FP3 A;  4O4L E;  2CWO A;  2FJD A;  2CA5 A;  2XQ8 A;  4TV8 E;  1VOM A;  5JVD E;  5M4Y A;  5JRC B;  3AED A;  2A72 A;  3AE5 A;  4AQG A;  3PUY F;  1FEW A;  1D1B A;  4AXP A;  3SFD A;  3TLT A;  4B3S T;  3C98 B;  4UF0 A;  2VB6 A;  1O3X A;  2V26 A;  3UU4 A;  4WBO A;  2WMO A;  3LG7 A;  4DUZ T;  2MBG A;  3Q5E A;  2BVM A;  5IHY A;  5EK3 A;  2X9H A;  3C51 A;  3LK3 B;  1XNR T;  3PUV F;  3AE9 A;  4QH1 A;  5J1G A;  3FZK B;  2WP9 A;  4DND A;  2NW9 A;  1H7C A;  2CXL A;  2E8I A;  3UQ4 A;  2N1G A;  3T1Y T;  3PU8 A;  3C4W A;  4B3M T;  3EDU A;  3HA4 A;  2CXD A;  3CWZ B;  2ODU A;  3H3M A;  2ODV A;  3EAB A;  2NW7 A;  4H9N C;  4KMC A;  4QKN A;  1ZKE A;  3ZT7 A;  4UXN B;  3PUQ A;  1D1C A;  2W0G A;  2CCQ A;  2I59 A;  3L09 A;  5ADX L;  3WAK A;  3KV5 A;  4WW0 A;  3NRX A;  2XAQ B;  4J2C A;  2XQ5 A;  4YT0 A;  5CA1 E;  2K48 A;  1J5E T;  3DP7 A;  4XZC A;  4I0U A;  3HI2 A;  2UXD T;  2WY2 A;  2IUB A;  2E9X C;  1YW0 A;  2EHO A;  3Q9D A;  3OVU A;  1SE7 A;  3ZKR A;  4JI2 T;  1QLB A;  4NPP A;  4YFS A;  1KNR A;  3J7Y q;  3RHW A;  3OYZ A;  5LOV E;  1XMO T;  1UGO A;  4DBR A;  1FMW A;  3NZQ A;  3SRZ A;  5EK4 A;  2Z6E A;  4OHF A;  4U74 A;  1NEK A;  3JAD A;  3PJA A;  1W09 A;  2OV9 A;  4QX7 B;  3ZMS B;  4ILB A;  2BKP A;  2YKS A;  2V7M A;  3JC6 C;  4CXY A;  3W15 B;  4DR7 T;  2XPK A;  2KT9 A;  5AQH B;  2YDR A;  3CK6 A;  4WYV A;  5JDQ A;  2CXF A;  3LDQ B;  1QUU A;  4P09 A;  4DID B;  3FBZ A;  1Z8U A;  4QH4 A;  3P4Q A;  2BS2 A;  2Y48 B;  3AA1 B;  4KUM B;  2BZB A;  3CKD A;  1T7S A;  3U78 A;  1MNE A;  1MMA A;  5FXV A;  1FIO A;  4YSY A;  2M6B A;  2NW8 A;  4I50 E;  4PJJ A;  5JR9 C;  1W0A A;  5LHI B;  1Z0P A;  4PAG A;  3JCF A;  5LB7 B;  4UR9 A;  3T1H T;  4JYA T;  2FJA A;  1OED E;  2WAU A;  3AE2 A;  2LE8 A;  1JNZ A;  4LML A;  4I4T E;  5L3F B;  1IJ5 A;  2NTX A;  5HEH A;  3EDV A;  5FVK A;  1Y01 A;  3R6N A;  3OPC A;  5EZY E;  3MZK B;  3UUX B;  4JUY A;  2B76 A;  3HKB E;  4ADZ A;  3PUS A;  3C4X A;  3ZN1 B;  3F57 A;  2XSB A;  1N36 T;  4MHC A;  2V6Y B;  3C4Z A;  2ZMA A;  4CQI A;  2LLY A;  2I6H A;  1E1H B;  4O4J E;  3AA0 B;  1HG2 A;  3QNU A;  2VAS A;  5ABF B;  2VUR A;  3GWH A;  2LSK A;  3KIN B;  4ILU A;  1HNX T;  2DNX A;  3RQW A;  3QC9 A;  1HNW T;  2UUB T;  2D9D A;  2W4X A;  1YKE B;  3O1H A;  5J2U E;  2IHR 1;  1X9B A;  2A3D A;  3ZT6 A;  4AKH A;  2IW5 B;  1XMQ T;  3HKE E;  2WZI A;  5AQS B;  3K8P C;  3RC3 A;  2XY8 B;  3SS1 A;  1NWM X;  3MJX A;  1HFA A;  3OKQ A;  2XM2 A;  4P1N A;  3UU6 A;  2YDS A;  1MMN A;  3HKC E;  2E5V A;  1OED B;  4BAY B;  4A98 A;  3N9O A;  1YQ3 A;  4M1P A;  3UU3 A;  2MOZ A;  1ZP0 A;  5AQU B;  4QXB B;  2H89 A;  2HPJ A;  2CE7 A;  4ZI3 C;  3CQX C;  2W2U A;  5L4H A;  2R6G F;  2RP4 A;  4GYR A;  2CMR A;  2BBJ A;  3RLF F;  1VRB A;  2DI4 A;  3K3Q C;  5CJ5 A;  5HCM A;  5LNK A;  2CPT A;  4CXW A;  3KV9 A;  3AEG A;  5LHG B;  4IE6 A;  4U7I A;  3V5U A;  2KND A;  3LBX A;  4CI3 B;  1WR6 A;  4HWF A;  2XQA A;  3ZCJ A;  2LKG A;  5E0O A;  1CHU A;  4E7S A;  2AXD S;  2HHH T;  4CN1 A;  2X66 A;  3CX6 B;  4ZZB A;  3ETV A;  3AXJ A;  4G63 A;  1D0Y A;  4JBW F;  4PJN A;  3SFE A;  1W9R A;  3CVR A;  5HXH A;  2OA5 A;  2E9X A;  3TLU A;  1WFD A;  4LF4 T;  3OYX A;  2HN1 A;  4HKA A;  5DAB A;  4DBQ A;  3QUJ A;  3OBV E;  2MPK A;  5FXW A;  3B57 A;  3AVS A;  3KFW X;  4IRE A;  1XDO A;  5IWA T;  3PU3 A;  3CQG B;  3QOF A;  5CGM A;  3ZYK A;  3VR8 A;  2LM9 A;  2UXB T;  3A8Y C;  4JI7 T;  2P9B A;  2CM0 A;  3AA6 B;  4Z8X A;  2W67 A;  3PUA A;  4QWN B;  3P4R A;  5LHH B;  4EEB A;  4ZS3 A;  4EOZ B;  3CML A;  4BA9 A;  4U3C A;  4EZH A;  5KDM C;  1BR4 A;  3QB5 K;  5IYZ E;  2K9A A;  5AQM B;  4AIU A;  2WZH A;  3EI0 A;  3RKO A;  1X79 A;  1KFY A;  3LFM A;  5L3B B;  1LVK A;  1KF6 A;  5LJM A;  4DV3 T;  1MIY A;  5AQP B;  1VCS A;  5KXJ A;  2VQF T;  3KBU A;  4K0U A;  3ETU A;  5LG3 A;  2IIU A;  4CN6 A;  4JI8 T;  3GN5 A;  4LF5 T;  3C50 A;  3H37 A;  1ZV4 X;  3ZMV B;  1S94 A;  2FUP A;  1E2A A;  4EV6 A;  3ZSS A;  1NAF A;  4H9R C;  4UIG A;  4O4I E;  2D0U A;  5AQO B;  5JR9 A;  2JMK A;  3IF8 B;  3RGL A;  2NOX A;  4OFZ A;  3P50 A;  2JQ9 A;  4XBF B;  4OK0 A;  4MBQ A;  5H6R B; 
#chains in the Genus database with same CATH homology
 4CN4 A;  2JQK A;  4P1N A;  4U31 A;  4U2Z A;  4CN1 A;  1YXR A;  1WR0 A;  1WFD A;  4A5X A;  2K3W A;  2WWV A;  4CN6 A;  2V6Y A;  2A9U A;  4U2Y A;  4WZX A;  4NIQ A;  3ZT6 A;  5CJ5 A;  2V6X A;  2CPT A;  5LB7 B;  3ZST A;  3EAB A;  5FVK A;  2MPK A;  2RPA A;  2CRB A;  3ZT7 A;  3ZT5 A;  2V6Y B;  2LRK A;  2JQ9 A;  4U7I A;  2DL1 A;  4U33 A;  2JQH A;  3K1S A;  4U7Y A;  4ZEY A;  2WY2 A;  3ZSS A;  1WCR A;  2W2U A;  2XZE A;  5CGM A;  4U3C A;  5FVL A;  4IT4 A;  2LRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...