2DL1A

Solution structure of the mit domain from human spartin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
GSSGSSGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the MIT domain from human Spartin
rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Spartin
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2dl1A01
2LRKA 5FVKA 4U33A 3ZT6A 4U2ZA 3K1SA 4U3CA 3ZT7A 2LRLA 2CRBA 1WFDA 2V6YA 5CJ5A 2RPAA 2V6XA 2DL1A 4WZXA 4CN1A 1YXRA 3EABA 5LB7B 4U7YA 2K3WA 4U31A 4U2YA 2W2UA 5CGMA 3ZT5A 2A9UA 3ZSTA 1WR0A 2JQHA 2V6YB 2JQKA 2JQ9A 4IT4A 2MPKA 4CN6A 4A5XA 4NIQA 4CN4A 4U7IA 2WWVA 2CPTA 2XZEA 5FVLA 3ZSSA 4P1NA 1WCRA 4ZEYA 2WY2A
chains in the Genus database with same CATH superfamily
2UUBT 4WBOA 3H3AA 5FVKA 1IJ6A 2FBWA 4EZ4A 1UURA 3KFWX 4F8HA 5JDQA 4GKJT 5AQJB 4U3CA 5LYJE 2V6YA 2WMNA 3OVUA 2IMLA 3A7MA 3AAIA 3ONXA 3O1JA 2WWUA 1T72A 1HNWT 5TAOA 3UUBA 5FMNA 5IYZE 3L09A 5FYMA 1I6ZA 2XY8B 3ZT5A 2A9UA 2M6BA 4AKIA 4ASKA 2EHOC 4ERRA 5ABEA 1NWMX 3CVRA 4I43B 4AQFC 2JQ9A 3UQ4A 2V26A 3PU3A 3HA4A 3HKCE 4CXYA 2X0HA 2ZM2A 2NTXA 2CA5A 4QH1A 2WWVA 5LXTE 2C5KT 1KFYA 1HNZT 2BKOA 3UTKA 1QSDA 4LMLA 2LM2A 2ACZA 3QOFA 5FXVA 5LBQB 5LGUB 4ISTA 4CXXA 2BG9E 1W09A 2HPLA 4LFCT 3H37A 2CHNA 5IWAT 2H3RA 2HPJA 3AEBA 1OEDE 2J1DG 1YKEB 2LRKA 1EZ3A 2V7MA 4PK5A 4UV8B 3RYIE 1HX1B 3OPCA 2W00A 4HFHA 2J62A 2YDRA 1NEKA 3K8PC 1WR6A 4HGAA 4TX5A 5AQPB 1OEDA 3BQKA 2F4VT 1FMWA 2I59A 2L9QA 1S35A 3MA9A 1HX8A 2VVNA 4ZHQE 5LHHB 4DR5T 1XNRT 2WAUA 3CX8B 2VKDA 2X67A 4NUUA 2L8KA 3MJXA 4QWNB 4C91A 5L3DB 4JI5T 5LGNB 2FJEA 3MZKB 2YDQA 3PUYF 5FY0A 3FHNA 2BG9B 3L39A 1HFAA 4IL4A 4O2AE 5F8PA 3C4WA 3PV0F 2DHRA 2XAHB 1LVKA 3AE6A 2WZIA 3P4SA 4DBQA 4O4HE 3RLFF 3LFMA 4OYKA 4JEHB 5KXJA 3T1HT 1XDPA 5FP3A 2JIWA 2BVMA 4IGUA 3T8OA 2Q9QC 3ZCIA 3C51A 1ZHCA 1R8IA 2C5JA 3BK9A 3N9MA 3UU5A 3FBLA 2IHR1 4ZS3A 4TV8E 1Z8UA 2XAGB 3VR8A 3UT5E 3AEFA 2ES0A 4M1PA 4EGWA 3UQ7A 2KZ7B 4AQYT 2VL0A 3GA8A 2XAJB 2MYSA 3QK6A 4LF9T 2QGSA 2K5BB 3SOLA 1M62A 3WI3A 2SPCA 3AVRA 3PUGA 4HTEA 5LG3A 1S94A 3LG7A 3Q5WA 2XJ7A 2HH7A 5LOVE 4V1Av 4B6XA 2IAKA 2UXXB 3UFGA 3RI5A 2LT3A 3LK3B 2X9XA 1YW0A 3RRWA 4DV1T 4DMVA 2Y6XA 4ZZBA 4HWIB 3KV5A 1VCTA 4GYRA 4HFVA 3QNUA 4HFBA 1CHUA 3IBPA 4EZHA 1GQEA 3EI0A 4X66T 2E5LT 2WBLA 2AE9A 1UX5A 4KUMB 3J7Yq 3KBTA 2YDSA 3JAEA 4KX6A 4OK0A 2Q9QA 5L3GB 2ZM6T 3N9NA 4TV9E 2H88A 2N1GA 1M7KA 1FEWA 4U33A 3SWHA 2DLRA 5J2UE 5KDMC 5IHYA 3RHWA 5E0OA 1MIWA 4IDNA 3HI2A 2XQ3A 2W67A 2Y8DA 3MACA 3Q9DA 2MTQA 2R6GF 4U2YA 5CA0E 5F3JA 3PUAA 2D0UA 3KDSE 4X1IE 4DMWA 4IE5A 4EYUA 2WDQA 4AQGA 3HKBE 2FUPA 3LBXB 5JQGE 1HG5A 5FL1A 2XQAA 3S4UA 1HS7A 2YU2A 3ONJA 4BA9A 4DV5T 2NTYA 1QLBA 2E9XB 3RIAA 5IUXA 1OWAA 3GN5B 5JRCA 1Z0PA 4A56A 2Q9QD 4P1NA 4YT0A 4JUYA 3GWHA 3AE5A 3AVSA 5CGMA 1DU2A 2W63A 4HEAA 5AQVB 5L3EB 4MFRA 2EHOA 3X1DA 4Z8XA 5LJNA 2FJBA 3I0QA 4DV3T 3AEDA 3B57A 4X64T 4BAYB 4Q25A 4TNVA 3A5XA 2JPFA 1KF6A 4HFDA 1XWMA 3ANWA 1D0ZA 3FZHB 3MXZA 1KK7A 3RIFA 2RPAA 3RRCA 3KV9A 3PDYA 5AFUL 3AA0B 2J47A 3EABA 4HFCA 1E7PA 3ZMUB 4ZS2A 3CX6B 4IDPA 4GK5E 1UK5A 3GN5A 5HXHA 3AA6B 1HG2A 3HL6A 2E9XC 4YJ3E 1FIOA 2W62A 2XQ4A 3P4PA 4UR9A 5HAXA 4EV6A 4ZI7E 1LRZA 2XHEB 1OEDC 3SS1A 2ZLYA 2XSBA 5HCJA 4QH5A 3ZKRA 3ZCJA 3VU7H 2K9AA 4YHJA 4IHJE 5JDHA 2YKSA 3UU4A 3UFEA 1D1BA 4IREA 4JI8T 2IUBA 3N9LA 4H9OC 2PJQA 2CLYB 4NPPA 3V5UA 2V1DB 5EK3A 2CMRA 2LRLA 2RA1A 1X9BA 2CHOA 3AE7A 1T98A 3PE0A 3I9WA 3M3ZB 4GIWA 4IE4A 2WS3A 2BG9A 2DWGA 2ZMAA 3LDQB 3O4XE 2FJAA 2XASB 1FMVA 3IF8B 3PUZF 3Q5XA 4GK0E 1J5WA 4HWHA 4MLKA 2BS4A 4N78D 4U31A 2IW5B 4AIUA 2NP9A 2V7IA 1W9RA 4JI2T 4I4TE 4JLEA 4PJNA 1OEDB 4OX9T 2BVLA 2Y48B 4QX8B 5EK2A 2H7OA 3P7IA 3N9QA 5HEGA 3RKOA 4PFOA 1OXZA 5FY7A 2V7JA 4X1YE 2ODUA 2I0MA 5FVLA 2LSIA 2JRKA 2XM2A 4JI4T 1G73A 4F6RC 2VKHA 4UELA 3E22E 3ZMTB 4DV0T 5JR9B 4LFAT 4LF5T 4YHHT 4A97A 2UU9T 4DNDA 5HYAA 3BQLA 2LJLA 3RYCE 4L5GA 2YOEA 4ZXLA 4QHOA 3R6NA 3JADA 4JEUB 3UU6A 5CJ5A 4ILBA 2V7LA 5ADXL 3F31A 4KI0F 3FXDB 5M4YA 4WW0A 2BKPA 3NBXX 5AQLB 4LF8T 2BZBA 4AKHA 2XQ9A 3P50A 4KBMB 5HWYA 4UV9B 3Q5EA 3FZLB 5LG4A 1Y01A 2D2SA 4I0UA 2HN2A 4WNKA 1KNRA 4DR1T 4TWHA 2MOZA 1ZKEA 2WDRA 1IBKT 3NZPA 3VHLA 4EEBA 2VB6A 1HTJF 2HHHT 2UXCT 1G8XA 4H9SE 1IZNB 3MK7C 2XUEA 2V5CA 1WCRA 3WAKA 4E7SA 1SUMB 2XQ5A 2VQET 1FJGT 3C4ZA 2VASA 2V8SV 2KMFA 4UF0B 1JNZA 1VRBA 5DABA 2ODVA 2I6HA 1O3XA 3KV4A 3RPUA 4AQFA 5JREA 1N34T 3DJBA 4QX7B 5AQSB 5HXCA 5JDMA 3ZT6A 5JVDE 5JDGA 4K0KT 1YD8G 3N2OA 3AE8A 3K1SA 3P8CD 3NRYA 2CRBA 3BQIA 3PUWF 5H6RB 3ZLIA 3VR9A 4H63V 5FXZA 4CQIA 5JH7E 2X0YA 5L4EA 4JI6T 1N36T 2UUCT 1WLXA 3NKZA 4OFZA 4UVCB 2X0LB 2WMOA 4LMKA 4JI0T 4X65T 4LF7T 2C5IT 4X62T 2W66A 3ZSTA 4B3TT 2XSAA 4ILUA 5J1GA 1HNXT 1MNDA 1AJ3A 2KINB 2B1EA 3N9PA 3AE9A 4I50E 2VVSA 3TLTA 5HEUA 3KV6A 4A5XA 5BR8T 4NXMT 4NXNT 1LKXA 1XNQT 2LKHA 4BJMA 3AE4A 3O1HA 4WBNE 2ZM8A 4OHFA 4FJOA 2XQ7A 4PJJA 3C98B 4U74A 4YTNA 4G63A 1UX4A 4YLHA 1CUNA 3CKDA 2A3DA 2CCQA 3JC6C 4ADZA 2E9XA 3HKEE 1D1AA 4GYSA 2LHNA 4ANJA 3RYFE 5JRCB 4G2AA 2WU2A 4HFEA 4DV7T 2KWHA 4O2BE 1U5PA 2LHRA 2LSJA 3ETVA 4WZXA 5L3CB 1NAFA 3ZJ1A 3TLVA 4XZCA 4CI2B 4O4JE 2M6IA 2XPKA 4KMCA 3UU3A 4AISA 4HFIA 3L8RA 3RKGA 1WR0A 2VKJA 3AB3B 5LHGB 3EDUA 3QC9A 4LF4T 2BS3A 4JI1T 1U4QA 3F57A 4PJMA 4IE6A 4CN4A 4U7IA 3ZPOA 4UXNB 3JCFA 2XTLA 5AQMB 3CK6A 3W15B 1MIYA 4JYAT 4P0BA 2VWAA 4YSZA 3AECA 1L0VA 3EUHA 4EIWA 1HF8A 2G0UA 2P9BA 2XQ6A 5ABFB 5J2TE 4HWFA 5LHIB 4PJLA 2MBGA 3C64A 3RC8A 4MALA 3ZYKA 3PUSA 4U2ZA 5FL0A 3AAAB 1US7B 4QXHB 1WFDA 2GK9A 4TZ4C 5DJQC 5AQHB 4QXCB 2DL1A 5AQIB 4P09A 5C8YE 4DR6T 5LNKA 1HCIA 2WZHA 3OYXA 2J4GA 3AXJA 4CXWA 4U7YA 2FJDA 5FNVE 3RYHE 3F2EA 3ZC1A 1UGOA 2KLQA 2D0TA 3IHRA 3MKDA 4MHCA 1IBLT 4NIQA 4QH4A 1J5ET 4MBQA 3WAJA 2XZEA 5CFBA 3V5SA 4X5TA 3ZSSA 2IC6A 2LOPA 3FZMB 4J2CA 4X20E 3UUXB 3DTOA 5HWXA 2X51A 1ZV4X 2CM0A 2LSKA 2WY2A 4CI3B 4ZEYA 4PK4A 3UU8A 4XAXB 5LP6E 3ZMSB 4DBRA 3I9YA 4K0UA 3G06A 4X1KE 4ILAA 1W0BA 4L9IA 4TWFA 5LBMA 2N9DA 4KP3C 3RX6A 2UXBT 1YXRA 1T8BA 3UULA 2Q9QB 2E2AA 3Q2MA 3ZN1B 3PUXF 1KNPA 3H3MA 4KHZF 5LB7B 4ZI2C 2A72A 2MAWA 2W2UA 3N5LA 2DCFA 4PW8A 3L3PA 3AA7B 4TUYE 5DQVA 5BMVE 2KNDA 2VK9A 1T7SA 1Y64B 2XM1A 4YXDA 3AE1A 1B7TA 3TKLB 4H9QC 3ZMVB 3CX7B 1BR1A 5L47A 1JNRA 3CMLA 2YU1A 4H9RC 5AQNB 2YEVC 2WU5A 5LA6E 5AQFB 2UUAT 2PG8A 1QUUA 4H63H 2XQ8A 3J9X1 2BS2A 2E9XD 2PBIA 4COFA 1YKHB 4O4LE 5L2LA 4CZZB 3OTOT 4KHPT 2XQYA 5EZYE 4AI6A 4ILCA 4XBFB 3FZFB 1YQ4A 3P4WA 1UUSA 3CIRA 1YQ3A 1MNEA 3Q5DA 5KX5E 5C3JA 2NWBA 5LMNT 1KNZA 2JMKA 2CWYA 2ACXA 2W0GA 3O1IA 5LCYA 1IAPA 1VCSA 3PUVF 5ABGA 4DV2T 2LOSA 2HN1A 2CXFA 4AKRB 2IDOB 5JR9C 4CI1B 3KVBA 2LKGA 2X68A 2CBIA 2K24A 3KINB 3M65A 4UF0A 2NW7A 3N2GE 2QRXA 1E2AA 2W4XA 5GONE 2QYWA 5AQGB 5HXSA 4YFSA 1E1HB 3IEEA 3UUMA 4HWDA 2JQQA 1MIVA 2RP4A 2JQHA 3PU8A 1SHZC 3HKDE 3TLSA 4FI5A 4U72A 2EHOD 3LK2B 2LEHA 4IL9A 5AQKB 5ETWA 3RGLA 1X79A 2X9HA 5F5WA 3ZEFB 5HXEA 4YSYA 2WDVA 3AAEB 2DNXA 3SFDA 5JDNA 3I0OA 2WQYA 5JDLA 4DUYT 3K3OA 4IE0A 2WP9A 4IDZA 1I94T 1SE7A 4DIDB 1XDOA 4NUVA 4AXPA 2YK0A 3VKGA 4H9PC 2KSRA 4ISSA 4HKAA 3OYZA 4EAHA 4BJNA 1D0XA 2QVAA 3LBXA 1H7CA 2AXDS 4A98A 2K48A 4HN9A 5LJMA 2NW9A 4YTMA 2A2FX 3OKQA 4WYVA 1ZOYA 1SA0E 4LFBT 2XAFB 2WCAA 4ZI3D 2OV9A 4OYJA 2V6YB 4UIGA 4GKKT 4JI3T 4E7ZA 4IT4A 2N2NA 2X9YA 3RH3A 3RIUA 3ZYMA 4YSXA 3QB5K 3TLUA 5ABFA 1BR4A 5FKYA 3FZKB 2X66A 3RF1A 3ZC0A 4AKLA 4PAGA 4HE8A 1D1CA 2YINA 3ANWB 3VRAA 3ZJ2A 3JC6D 3QUJA 4DV6T 5HEHA 2IC9A 3ETUA 5LGTB 2KT9A 2CXDA 4IIJE 3ZMZB 3AEAA 5J0ZA 3IA3A 2BBJA 1WYBA 2C0SA 5AQRB 5L4HA 3ZN0B 4DO0A 2KWIB 2CEAA 2WSSV 2E8IA 3JAFA 4TN7B 4O8SA 2QA7A 4QXBB 3RIUC 5AQOB 3ZT7A 2M67A 1HR0T 3PJAA 3OBVE 2IIUA 4UEMA 4YY3T 1W0AA 3ZYLA 3CQCB 5L3FB 1MMDA 1NENA 2VURA 4DV4T 1D0YA 2BDEA 3RQWA 3EDVA 3FB2A 4DR2T 2OA5A 5AQTB 2L3LA 2LM9A 2JQKA 1ZP0A 1KEYA 4PNIA 1XMQT 2JMHA 1IBMT 2LSGA 3AXJB 4H9NC 4Z91A 3ONLC 4DUZT 4GOUA 2CBJA 5AQQB 5LMUT 1IJ5A 3NVOA 3DP7A 2V5DA 3KVAA 2UXNB 3AEGA 3N2KE 3NZQA 2D9DA 5L3BB 5CA1E 3LSVA 4Z90A 4EB6E 2VQFT 3RC3A 3PTRB 3U3IA 3LK42 5H6QB 2LSYA 2NW8A 3ESLA 4I55E 3A8YC 5FXXA 3LJCA 4YTPA 1N32T 2KXPB 2PFVA 4B3ST 1WYCA 2VKOA 2NR4A 4DR3T 4PFPA 2UXDT 4L0RA 4HWCA 3TLWA 1VOMA 3CQGB 3FBZA 4CN1A 1LVFA 1J1JA 5C2TA 4LF6T 4EXTA 2B76A 5FXWA 2DWKA 3ABVA 4C90A 4QKNA 1MMAA 5JDFA 5ABHA 5HEJA 1XMOT 3AEEA 3I1AA 2D5UA 2BBHA 4P0AA 1MMNA 3D0TA 2MPKA 3E08A 3UUNA 4CN6A 4ZZCA 4B3MT 1MMGA 3P4QA 3NWIA 5JR9A 1ZEEA 2JJ9A 2WB5A 2X9WA 5CB4E 3CPZA 2BG9C 2E5VA 2LLYA 3PJAJ 4UVAB 3SFEA 4EYYR 5JTGA 5KMGP 2YN6A 3CWZB 1N33T 3AE2A 2ZM0A 4EOZB 1WRDA 4DR7T 5HXRA 3N9OA 3EHZA 3AA1B 3EVYA 3OJAA 3PUQA 3C4XA 2H89A 4DVDA 3C50A 3B13A 3EAMA 5FY1A 5EK4A 3T1YT 4UVBB 3RQUA 3GMIA 3VRBA 4B3RT 2V6XA 4ZI2D 3VKHA 3E0ZA 4JV5T 1BR2A 2WM9A 3NRXA 5DQWA 2PTFA 3FXEB 1V9DA 2LE8A 4LMJA 3PURA 2H7VC 2K3WA 4IDQA 2OLTA 2CE7A 3QB5A 4DR4T 4TNWA 4TWDA 2BKNA 3O9XA 3U78A 4IDOA 5HCMA 3K3NA 5HEOA 2V7KA 2VL8A 5A1LA 4JBWF 2DI4A 5AQUB 4ZI3C 2EHOB 2W61A 2CWOA 3SRZA 1UCUA 2CPTA 2NOXA 2XAQB 3AE3A 3B5MA 2CXLA 3CQXC 3K3QC 4IE7A 4ZOLE 3R84B 3HR0A 4EEDA 3KBUA 1BR0A 4JI7T 4AKGA 4PK6A 2Z6EA 4O4IE 2CLYC 3P4RA 1XZYA 4YJ2E
chains in the Genus database with same CATH topology
2LRKA 5FVKA 4U33A 3ZT6A 4U2ZA 3K1SA 4U3CA 3ZT7A 2LRLA 2CRBA 1WFDA 2V6YA 5CJ5A 2RPAA 2V6XA 2DL1A 4WZXA 4CN1A 1YXRA 3EABA 5LB7B 4U7YA 2K3WA 4U31A 4U2YA 2W2UA 5CGMA 3ZT5A 2A9UA 3ZSTA 1WR0A 2JQHA 2V6YB 2JQKA 2JQ9A 4IT4A 2MPKA 4CN6A 4A5XA 4NIQA 4CN4A 4U7IA 2WWVA 2CPTA 2XZEA 5FVLA 3ZSSA 4P1NA 1WCRA 4ZEYA 2WY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRK A;  5FVK A;  4U33 A;  3ZT6 A;  4U2Z A;  3K1S A;  4U3C A;  3ZT7 A;  2LRL A;  2CRB A;  1WFD A;  2V6Y A;  5CJ5 A;  2RPA A;  2V6X A;  2DL1 A;  4WZX A;  4CN1 A;  1YXR A;  3EAB A;  5LB7 B;  4U7Y A;  2K3W A;  4U31 A;  4U2Y A;  2W2U A;  5CGM A;  3ZT5 A;  2A9U A;  3ZST A;  1WR0 A;  2JQH A;  2V6Y B;  2JQK A;  2JQ9 A;  4IT4 A;  2MPK A;  4CN6 A;  4A5X A;  4NIQ A;  4CN4 A;  4U7I A;  2WWV A;  2CPT A;  2XZE A;  5FVL A;  3ZSS A;  4P1N A;  1WCR A;  4ZEY A;  2WY2 A; 
#chains in the Genus database with same CATH topology
 2UUB T;  4WBO A;  3H3A A;  5FVK A;  1IJ6 A;  2FBW A;  4EZ4 A;  1UUR A;  3KFW X;  4F8H A;  5JDQ A;  4GKJ T;  5AQJ B;  4U3C A;  5LYJ E;  2V6Y A;  2WMN A;  3OVU A;  2IML A;  3A7M A;  3AAI A;  3ONX A;  3O1J A;  2WWU A;  1T72 A;  1HNW T;  5TAO A;  3UUB A;  5FMN A;  5IYZ E;  3L09 A;  5FYM A;  1I6Z A;  2XY8 B;  3ZT5 A;  2A9U A;  2M6B A;  4AKI A;  4ASK A;  2EHO C;  4ERR A;  5ABE A;  1NWM X;  3CVR A;  4I43 B;  4AQF C;  2JQ9 A;  3UQ4 A;  2V26 A;  3PU3 A;  3HA4 A;  3HKC E;  4CXY A;  2X0H A;  2ZM2 A;  2NTX A;  2CA5 A;  4QH1 A;  2WWV A;  5LXT E;  2C5K T;  1KFY A;  1HNZ T;  2BKO A;  3UTK A;  1QSD A;  4LML A;  2LM2 A;  2ACZ A;  3QOF A;  5FXV A;  5LBQ B;  5LGU B;  4IST A;  4CXX A;  2BG9 E;  1W09 A;  2HPL A;  4LFC T;  3H37 A;  2CHN A;  5IWA T;  2H3R A;  2HPJ A;  3AEB A;  1OED E;  2J1D G;  1YKE B;  2LRK A;  1EZ3 A;  2V7M A;  4PK5 A;  4UV8 B;  3RYI E;  1HX1 B;  3OPC A;  2W00 A;  4HFH A;  2J62 A;  2YDR A;  1NEK A;  3K8P C;  1WR6 A;  4HGA A;  4TX5 A;  5AQP B;  1OED A;  3BQK A;  2F4V T;  1FMW A;  2I59 A;  2L9Q A;  1S35 A;  3MA9 A;  1HX8 A;  2VVN A;  4ZHQ E;  5LHH B;  4DR5 T;  1XNR T;  2WAU A;  3CX8 B;  2VKD A;  2X67 A;  4NUU A;  2L8K A;  3MJX A;  4QWN B;  4C91 A;  5L3D B;  4JI5 T;  5LGN B;  2FJE A;  3MZK B;  2YDQ A;  3PUY F;  5FY0 A;  3FHN A;  2BG9 B;  3L39 A;  1HFA A;  4IL4 A;  4O2A E;  5F8P A;  3C4W A;  3PV0 F;  2DHR A;  2XAH B;  1LVK A;  3AE6 A;  2WZI A;  3P4S A;  4DBQ A;  4O4H E;  3RLF F;  3LFM A;  4OYK A;  4JEH B;  5KXJ A;  3T1H T;  1XDP A;  5FP3 A;  2JIW A;  2BVM A;  4IGU A;  3T8O A;  2Q9Q C;  3ZCI A;  3C51 A;  1ZHC A;  1R8I A;  2C5J A;  3BK9 A;  3N9M A;  3UU5 A;  3FBL A;  2IHR 1;  4ZS3 A;  4TV8 E;  1Z8U A;  2XAG B;  3VR8 A;  3UT5 E;  3AEF A;  2ES0 A;  4M1P A;  4EGW A;  3UQ7 A;  2KZ7 B;  4AQY T;  2VL0 A;  3GA8 A;  2XAJ B;  2MYS A;  3QK6 A;  4LF9 T;  2QGS A;  2K5B B;  3SOL A;  1M62 A;  3WI3 A;  2SPC A;  3AVR A;  3PUG A;  4HTE A;  5LG3 A;  1S94 A;  3LG7 A;  3Q5W A;  2XJ7 A;  2HH7 A;  5LOV E;  4V1A v;  4B6X A;  2IAK A;  2UXX B;  3UFG A;  3RI5 A;  2LT3 A;  3LK3 B;  2X9X A;  1YW0 A;  3RRW A;  4DV1 T;  4DMV A;  2Y6X A;  4ZZB A;  4HWI B;  3KV5 A;  1VCT A;  4GYR A;  4HFV A;  3QNU A;  4HFB A;  1CHU A;  3IBP A;  4EZH A;  1GQE A;  3EI0 A;  4X66 T;  2E5L T;  2WBL A;  2AE9 A;  1UX5 A;  4KUM B;  3J7Y q;  3KBT A;  2YDS A;  3JAE A;  4KX6 A;  4OK0 A;  2Q9Q A;  5L3G B;  2ZM6 T;  3N9N A;  4TV9 E;  2H88 A;  2N1G A;  1M7K A;  1FEW A;  4U33 A;  3SWH A;  2DLR A;  5J2U E;  5KDM C;  5IHY A;  3RHW A;  5E0O A;  1MIW A;  4IDN A;  3HI2 A;  2XQ3 A;  2W67 A;  2Y8D A;  3MAC A;  3Q9D A;  2MTQ A;  2R6G F;  4U2Y A;  5CA0 E;  5F3J A;  3PUA A;  2D0U A;  3KDS E;  4X1I E;  4DMW A;  4IE5 A;  4EYU A;  2WDQ A;  4AQG A;  3HKB E;  2FUP A;  3LBX B;  5JQG E;  1HG5 A;  5FL1 A;  2XQA A;  3S4U A;  1HS7 A;  2YU2 A;  3ONJ A;  4BA9 A;  4DV5 T;  2NTY A;  1QLB A;  2E9X B;  3RIA A;  5IUX A;  1OWA A;  3GN5 B;  5JRC A;  1Z0P A;  4A56 A;  2Q9Q D;  4P1N A;  4YT0 A;  4JUY A;  3GWH A;  3AE5 A;  3AVS A;  5CGM A;  1DU2 A;  2W63 A;  4HEA A;  5AQV B;  5L3E B;  4MFR A;  2EHO A;  3X1D A;  4Z8X A;  5LJN A;  2FJB A;  3I0Q A;  4DV3 T;  3AED A;  3B57 A;  4X64 T;  4BAY B;  4Q25 A;  4TNV A;  3A5X A;  2JPF A;  1KF6 A;  4HFD A;  1XWM A;  3ANW A;  1D0Z A;  3FZH B;  3MXZ A;  1KK7 A;  3RIF A;  2RPA A;  3RRC A;  3KV9 A;  3PDY A;  5AFU L;  3AA0 B;  2J47 A;  3EAB A;  4HFC A;  1E7P A;  3ZMU B;  4ZS2 A;  3CX6 B;  4IDP A;  4GK5 E;  1UK5 A;  3GN5 A;  5HXH A;  3AA6 B;  1HG2 A;  3HL6 A;  2E9X C;  4YJ3 E;  1FIO A;  2W62 A;  2XQ4 A;  3P4P A;  4UR9 A;  5HAX A;  4EV6 A;  4ZI7 E;  1LRZ A;  2XHE B;  1OED C;  3SS1 A;  2ZLY A;  2XSB A;  5HCJ A;  4QH5 A;  3ZKR A;  3ZCJ A;  3VU7 H;  2K9A A;  4YHJ A;  4IHJ E;  5JDH A;  2YKS A;  3UU4 A;  3UFE A;  1D1B A;  4IRE A;  4JI8 T;  2IUB A;  3N9L A;  4H9O C;  2PJQ A;  2CLY B;  4NPP A;  3V5U A;  2V1D B;  5EK3 A;  2CMR A;  2LRL A;  2RA1 A;  1X9B A;  2CHO A;  3AE7 A;  1T98 A;  3PE0 A;  3I9W A;  3M3Z B;  4GIW A;  4IE4 A;  2WS3 A;  2BG9 A;  2DWG A;  2ZMA A;  3LDQ B;  3O4X E;  2FJA A;  2XAS B;  1FMV A;  3IF8 B;  3PUZ F;  3Q5X A;  4GK0 E;  1J5W A;  4HWH A;  4MLK A;  2BS4 A;  4N78 D;  4U31 A;  2IW5 B;  4AIU A;  2NP9 A;  2V7I A;  1W9R A;  4JI2 T;  4I4T E;  4JLE A;  4PJN A;  1OED B;  4OX9 T;  2BVL A;  2Y48 B;  4QX8 B;  5EK2 A;  2H7O A;  3P7I A;  3N9Q A;  5HEG A;  3RKO A;  4PFO A;  1OXZ A;  5FY7 A;  2V7J A;  4X1Y E;  2ODU A;  2I0M A;  5FVL A;  2LSI A;  2JRK A;  2XM2 A;  4JI4 T;  1G73 A;  4F6R C;  2VKH A;  4UEL A;  3E22 E;  3ZMT B;  4DV0 T;  5JR9 B;  4LFA T;  4LF5 T;  4YHH T;  4A97 A;  2UU9 T;  4DND A;  5HYA A;  3BQL A;  2LJL A;  3RYC E;  4L5G A;  2YOE A;  4ZXL A;  4QHO A;  3R6N A;  3JAD A;  4JEU B;  3UU6 A;  5CJ5 A;  4ILB A;  2V7L A;  5ADX L;  3F31 A;  4KI0 F;  3FXD B;  5M4Y A;  4WW0 A;  2BKP A;  3NBX X;  5AQL B;  4LF8 T;  2BZB A;  4AKH A;  2XQ9 A;  3P50 A;  4KBM B;  5HWY A;  4UV9 B;  3Q5E A;  3FZL B;  5LG4 A;  1Y01 A;  2D2S A;  4I0U A;  2HN2 A;  4WNK A;  1KNR A;  4DR1 T;  4TWH A;  2MOZ A;  1ZKE A;  2WDR A;  1IBK T;  3NZP A;  3VHL A;  4EEB A;  2VB6 A;  1HTJ F;  2HHH T;  2UXC T;  1G8X A;  4H9S E;  1IZN B;  3MK7 C;  2XUE A;  2V5C A;  1WCR A;  3WAK A;  4E7S A;  1SUM B;  2XQ5 A;  2VQE T;  1FJG T;  3C4Z A;  2VAS A;  2V8S V;  2KMF A;  4UF0 B;  1JNZ A;  1VRB A;  5DAB A;  2ODV A;  2I6H A;  1O3X A;  3KV4 A;  3RPU A;  4AQF A;  5JRE A;  1N34 T;  3DJB A;  4QX7 B;  5AQS B;  5HXC A;  5JDM A;  3ZT6 A;  5JVD E;  5JDG A;  4K0K T;  1YD8 G;  3N2O A;  3AE8 A;  3K1S A;  3P8C D;  3NRY A;  2CRB A;  3BQI A;  3PUW F;  5H6R B;  3ZLI A;  3VR9 A;  4H63 V;  5FXZ A;  4CQI A;  5JH7 E;  2X0Y A;  5L4E A;  4JI6 T;  1N36 T;  2UUC T;  1WLX A;  3NKZ A;  4OFZ A;  4UVC B;  2X0L B;  2WMO A;  4LMK A;  4JI0 T;  4X65 T;  4LF7 T;  2C5I T;  4X62 T;  2W66 A;  3ZST A;  4B3T T;  2XSA A;  4ILU A;  5J1G A;  1HNX T;  1MND A;  1AJ3 A;  2KIN B;  2B1E A;  3N9P A;  3AE9 A;  4I50 E;  2VVS A;  3TLT A;  5HEU A;  3KV6 A;  4A5X A;  5BR8 T;  4NXM T;  4NXN T;  1LKX A;  1XNQ T;  2LKH A;  4BJM A;  3AE4 A;  3O1H A;  4WBN E;  2ZM8 A;  4OHF A;  4FJO A;  2XQ7 A;  4PJJ A;  3C98 B;  4U74 A;  4YTN A;  4G63 A;  1UX4 A;  4YLH A;  1CUN A;  3CKD A;  2A3D A;  2CCQ A;  3JC6 C;  4ADZ A;  2E9X A;  3HKE E;  1D1A A;  4GYS A;  2LHN A;  4ANJ A;  3RYF E;  5JRC B;  4G2A A;  2WU2 A;  4HFE A;  4DV7 T;  2KWH A;  4O2B E;  1U5P A;  2LHR A;  2LSJ A;  3ETV A;  4WZX A;  5L3C B;  1NAF A;  3ZJ1 A;  3TLV A;  4XZC A;  4CI2 B;  4O4J E;  2M6I A;  2XPK A;  4KMC A;  3UU3 A;  4AIS A;  4HFI A;  3L8R A;  3RKG A;  1WR0 A;  2VKJ A;  3AB3 B;  5LHG B;  3EDU A;  3QC9 A;  4LF4 T;  2BS3 A;  4JI1 T;  1U4Q A;  3F57 A;  4PJM A;  4IE6 A;  4CN4 A;  4U7I A;  3ZPO A;  4UXN B;  3JCF A;  2XTL A;  5AQM B;  3CK6 A;  3W15 B;  1MIY A;  4JYA T;  4P0B A;  2VWA A;  4YSZ A;  3AEC A;  1L0V A;  3EUH A;  4EIW A;  1HF8 A;  2G0U A;  2P9B A;  2XQ6 A;  5ABF B;  5J2T E;  4HWF A;  5LHI B;  4PJL A;  2MBG A;  3C64 A;  3RC8 A;  4MAL A;  3ZYK A;  3PUS A;  4U2Z A;  5FL0 A;  3AAA B;  1US7 B;  4QXH B;  1WFD A;  2GK9 A;  4TZ4 C;  5DJQ C;  5AQH B;  4QXC B;  2DL1 A;  5AQI B;  4P09 A;  5C8Y E;  4DR6 T;  5LNK A;  1HCI A;  2WZH A;  3OYX A;  2J4G A;  3AXJ A;  4CXW A;  4U7Y A;  2FJD A;  5FNV E;  3RYH E;  3F2E A;  3ZC1 A;  1UGO A;  2KLQ A;  2D0T A;  3IHR A;  3MKD A;  4MHC A;  1IBL T;  4NIQ A;  4QH4 A;  1J5E T;  4MBQ A;  3WAJ A;  2XZE A;  5CFB A;  3V5S A;  4X5T A;  3ZSS A;  2IC6 A;  2LOP A;  3FZM B;  4J2C A;  4X20 E;  3UUX B;  3DTO A;  5HWX A;  2X51 A;  1ZV4 X;  2CM0 A;  2LSK A;  2WY2 A;  4CI3 B;  4ZEY A;  4PK4 A;  3UU8 A;  4XAX B;  5LP6 E;  3ZMS B;  4DBR A;  3I9Y A;  4K0U A;  3G06 A;  4X1K E;  4ILA A;  1W0B A;  4L9I A;  4TWF A;  5LBM A;  2N9D A;  4KP3 C;  3RX6 A;  2UXB T;  1YXR A;  1T8B A;  3UUL A;  2Q9Q B;  2E2A A;  3Q2M A;  3ZN1 B;  3PUX F;  1KNP A;  3H3M A;  4KHZ F;  5LB7 B;  4ZI2 C;  2A72 A;  2MAW A;  2W2U A;  3N5L A;  2DCF A;  4PW8 A;  3L3P A;  3AA7 B;  4TUY E;  5DQV A;  5BMV E;  2KND A;  2VK9 A;  1T7S A;  1Y64 B;  2XM1 A;  4YXD A;  3AE1 A;  1B7T A;  3TKL B;  4H9Q C;  3ZMV B;  3CX7 B;  1BR1 A;  5L47 A;  1JNR A;  3CML A;  2YU1 A;  4H9R C;  5AQN B;  2YEV C;  2WU5 A;  5LA6 E;  5AQF B;  2UUA T;  2PG8 A;  1QUU A;  4H63 H;  2XQ8 A;  3J9X 1;  2BS2 A;  2E9X D;  2PBI A;  4COF A;  1YKH B;  4O4L E;  5L2L A;  4CZZ B;  3OTO T;  4KHP T;  2XQY A;  5EZY E;  4AI6 A;  4ILC A;  4XBF B;  3FZF B;  1YQ4 A;  3P4W A;  1UUS A;  3CIR A;  1YQ3 A;  1MNE A;  3Q5D A;  5KX5 E;  5C3J A;  2NWB A;  5LMN T;  1KNZ A;  2JMK A;  2CWY A;  2ACX A;  2W0G A;  3O1I A;  5LCY A;  1IAP A;  1VCS A;  3PUV F;  5ABG A;  4DV2 T;  2LOS A;  2HN1 A;  2CXF A;  4AKR B;  2IDO B;  5JR9 C;  4CI1 B;  3KVB A;  2LKG A;  2X68 A;  2CBI A;  2K24 A;  3KIN B;  3M65 A;  4UF0 A;  2NW7 A;  3N2G E;  2QRX A;  1E2A A;  2W4X A;  5GON E;  2QYW A;  5AQG B;  5HXS A;  4YFS A;  1E1H B;  3IEE A;  3UUM A;  4HWD A;  2JQQ A;  1MIV A;  2RP4 A;  2JQH A;  3PU8 A;  1SHZ C;  3HKD E;  3TLS A;  4FI5 A;  4U72 A;  2EHO D;  3LK2 B;  2LEH A;  4IL9 A;  5AQK B;  5ETW A;  3RGL A;  1X79 A;  2X9H A;  5F5W A;  3ZEF B;  5HXE A;  4YSY A;  2WDV A;  3AAE B;  2DNX A;  3SFD A;  5JDN A;  3I0O A;  2WQY A;  5JDL A;  4DUY T;  3K3O A;  4IE0 A;  2WP9 A;  4IDZ A;  1I94 T;  1SE7 A;  4DID B;  1XDO A;  4NUV A;  4AXP A;  2YK0 A;  3VKG A;  4H9P C;  2KSR A;  4ISS A;  4HKA A;  3OYZ A;  4EAH A;  4BJN A;  1D0X A;  2QVA A;  3LBX A;  1H7C A;  2AXD S;  4A98 A;  2K48 A;  4HN9 A;  5LJM A;  2NW9 A;  4YTM A;  2A2F X;  3OKQ A;  4WYV A;  1ZOY A;  1SA0 E;  4LFB T;  2XAF B;  2WCA A;  4ZI3 D;  2OV9 A;  4OYJ A;  2V6Y B;  4UIG A;  4GKK T;  4JI3 T;  4E7Z A;  4IT4 A;  2N2N A;  2X9Y A;  3RH3 A;  3RIU A;  3ZYM A;  4YSX A;  3QB5 K;  3TLU A;  5ABF A;  1BR4 A;  5FKY A;  3FZK B;  2X66 A;  3RF1 A;  3ZC0 A;  4AKL A;  4PAG A;  4HE8 A;  1D1C A;  2YIN A;  3ANW B;  3VRA A;  3ZJ2 A;  3JC6 D;  3QUJ A;  4DV6 T;  5HEH A;  2IC9 A;  3ETU A;  5LGT B;  2KT9 A;  2CXD A;  4IIJ E;  3ZMZ B;  3AEA A;  5J0Z A;  3IA3 A;  2BBJ A;  1WYB A;  2C0S A;  5AQR B;  5L4H A;  3ZN0 B;  4DO0 A;  2KWI B;  2CEA A;  2WSS V;  2E8I A;  3JAF A;  4TN7 B;  4O8S A;  2QA7 A;  4QXB B;  3RIU C;  5AQO B;  3ZT7 A;  2M67 A;  1HR0 T;  3PJA A;  3OBV E;  2IIU A;  4UEM A;  4YY3 T;  1W0A A;  3ZYL A;  3CQC B;  5L3F B;  1MMD A;  1NEN A;  2VUR A;  4DV4 T;  1D0Y A;  2BDE A;  3RQW A;  3EDV A;  3FB2 A;  4DR2 T;  2OA5 A;  5AQT B;  2L3L A;  2LM9 A;  2JQK A;  1ZP0 A;  1KEY A;  4PNI A;  1XMQ T;  2JMH A;  1IBM T;  2LSG A;  3AXJ B;  4H9N C;  4Z91 A;  3ONL C;  4DUZ T;  4GOU A;  2CBJ A;  5AQQ B;  5LMU T;  1IJ5 A;  3NVO A;  3DP7 A;  2V5D A;  3KVA A;  2UXN B;  3AEG A;  3N2K E;  3NZQ A;  2D9D A;  5L3B B;  5CA1 E;  3LSV A;  4Z90 A;  4EB6 E;  2VQF T;  3RC3 A;  3PTR B;  3U3I A;  3LK4 2;  5H6Q B;  2LSY A;  2NW8 A;  3ESL A;  4I55 E;  3A8Y C;  5FXX A;  3LJC A;  4YTP A;  1N32 T;  2KXP B;  2PFV A;  4B3S T;  1WYC A;  2VKO A;  2NR4 A;  4DR3 T;  4PFP A;  2UXD T;  4L0R A;  4HWC A;  3TLW A;  1VOM A;  3CQG B;  3FBZ A;  4CN1 A;  1LVF A;  1J1J A;  5C2T A;  4LF6 T;  4EXT A;  2B76 A;  5FXW A;  2DWK A;  3ABV A;  4C90 A;  4QKN A;  1MMA A;  5JDF A;  5ABH A;  5HEJ A;  1XMO T;  3AEE A;  3I1A A;  2D5U A;  2BBH A;  4P0A A;  1MMN A;  3D0T A;  2MPK A;  3E08 A;  3UUN A;  4CN6 A;  4ZZC A;  4B3M T;  1MMG A;  3P4Q A;  3NWI A;  5JR9 A;  1ZEE A;  2JJ9 A;  2WB5 A;  2X9W A;  5CB4 E;  3CPZ A;  2BG9 C;  2E5V A;  2LLY A;  3PJA J;  4UVA B;  3SFE A;  4EYY R;  5JTG A;  5KMG P;  2YN6 A;  3CWZ B;  1N33 T;  3AE2 A;  2ZM0 A;  4EOZ B;  1WRD A;  4DR7 T;  5HXR A;  3N9O A;  3EHZ A;  3AA1 B;  3EVY A;  3OJA A;  3PUQ A;  3C4X A;  2H89 A;  4DVD A;  3C50 A;  3B13 A;  3EAM A;  5FY1 A;  5EK4 A;  3T1Y T;  4UVB B;  3RQU A;  3GMI A;  3VRB A;  4B3R T;  2V6X A;  4ZI2 D;  3VKH A;  3E0Z A;  4JV5 T;  1BR2 A;  2WM9 A;  3NRX A;  5DQW A;  2PTF A;  3FXE B;  1V9D A;  2LE8 A;  4LMJ A;  3PUR A;  2H7V C;  2K3W A;  4IDQ A;  2OLT A;  2CE7 A;  3QB5 A;  4DR4 T;  4TNW A;  4TWD A;  2BKN A;  3O9X A;  3U78 A;  4IDO A;  5HCM A;  3K3N A;  5HEO A;  2V7K A;  2VL8 A;  5A1L A;  4JBW F;  2DI4 A;  5AQU B;  4ZI3 C;  2EHO B;  2W61 A;  2CWO A;  3SRZ A;  1UCU A;  2CPT A;  2NOX A;  2XAQ B;  3AE3 A;  3B5M A;  2CXL A;  3CQX C;  3K3Q C;  4IE7 A;  4ZOL E;  3R84 B;  3HR0 A;  4EED A;  3KBU A;  1BR0 A;  4JI7 T;  4AKG A;  4PK6 A;  2Z6E A;  4O4I E;  2CLY C;  3P4R A;  1XZY A;  4YJ2 E; 
#chains in the Genus database with same CATH homology
 2LRK A;  5FVK A;  4U33 A;  3ZT6 A;  4U2Z A;  3K1S A;  4U3C A;  3ZT7 A;  2LRL A;  2CRB A;  1WFD A;  2V6Y A;  5CJ5 A;  2RPA A;  2V6X A;  2DL1 A;  4WZX A;  4CN1 A;  1YXR A;  3EAB A;  5LB7 B;  4U7Y A;  2K3W A;  4U31 A;  4U2Y A;  2W2U A;  5CGM A;  3ZT5 A;  2A9U A;  3ZST A;  1WR0 A;  2JQH A;  2V6Y B;  2JQK A;  2JQ9 A;  4IT4 A;  2MPK A;  4CN6 A;  4A5X A;  4NIQ A;  4CN4 A;  4U7I A;  2WWV A;  2CPT A;  2XZE A;  5FVL A;  3ZSS A;  4P1N A;  1WCR A;  4ZEY A;  2WY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...