2DL1A

Solution structure of the mit domain from human spartin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
GSSGSSGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the MIT domain from human Spartin
rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Spartin
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2dl1A01
4IT4A 3ZT7A 1YXRA 5FVKA 2V6XA 4ZEYA 2CPTA 5LB7B 2LRLA 5FVLA 2V6YA 2W2UA 4U7IA 4U33A 4WZXA 4U31A 2WY2A 2WWVA 1WFDA 4CN4A 2LRKA 3ZT6A 1WR0A 2JQKA 4U7YA 4NIQA 2RPAA 2MPKA 5CJ5A 3ZSSA 3ZSTA 2JQHA 4CN1A 3EABA 2V6YB 4U2ZA 2XZEA 4U2YA 3ZT5A 1WCRA 2DL1A 4A5XA 4CN6A 2K3WA 2JQ9A 4U3CA 4P1NA 5CGMA 2CRBA 3K1SA 2A9UA
chains in the Genus database with same CATH superfamily
1WLXA 3C51A 3LDQB 3NZQA 3S4UA 4NXMT 3HA4A 4PJNA 2W2UA 1HNXT 5LJMA 1B7TA 2WMNA 3MA9A 2D0TA 3U3IA 2W00A 4DBRA 1MMAA 3AVRA 4I50E 1ZKEA 2D0UA 3L09A 3AE1A 5L2LA 2C5KT 2J1DG 2P9BA 1MIWA 2XSAA 3JAEA 3BQLA 4KHZF 4ADZA 4DMVA 3V5SA 4AI6A 4H63H 5AQKB 3K3NA 2X66A 1Y01A 1IJ5A 2WCAA 4UVCB 4UF0B 4B6XA 4YY3T 5LG4A 2LEHA 5M4YA 2ES0A 2VKHA 2M6IA 2XAHB 2IAKA 2ZMAA 4O4JE 1W0AA 1FJGT 1UK5A 4DR6T 5FXXA 4KHPT 5LXTE 4TNWA 2YEVC 1HG2A 3PUYF 4HFBA 3ZYMA 2WDVA 4U3CA 5CGMA 3AE2A 2XSBA 5JDLA 4MHCA 2XPKA 3AXJB 2HH7A 3RIFA 3TLSA 3ZCIA 2DCFA 4UEMA 3IBPA 4ZEYA 4EB6E 3AEDA 4OX9T 2CXLA 3I0OA 4GIWA 4IE7A 5FXWA 3LJCA 3JC6C 3N9QA 2BS2A 1G8XA 2BZBA 2W63A 3FZFB 3MACA 3PTRB 3R6NA 3A7MA 3IHRA 4X1YE 4A98A 3RIUC 2UUCT 4AQYT 3ZT6A 4C90A 4M1PA 4JLEA 3UU8A 4ZS3A 2LE8A 1HS7A 2HN2A 2A3DA 4YSXA 5JREA 4TWFA 5A1LA 4DV5T 5FMNA 3TLTA 1NAFA 2Y6XA 3N9PA 4QXCB 2KSRA 3B5MA 3NRYA 2XM2A 4FI5A 5FP3A 2KLQA 4I4TE 5FNVE 4PJJA 5AQHB 3TLUA 2X67A 3TLVA 4DVDA 4XBFB 4A5XA 3CVRA 2BS3A 4IL4A 3K1SA 4DV4T 5JR9C 2QGSA 2UUAT 2CE7A 1NENA 4YHHT 4X1IE 5FXVA 4LFAT 4NPPA 1YKEB 5HEJA 1OEDE 3QC9A 1VRBA 5AQQB 4ANJA 5CA1E 3VR9A 3C4ZA 5FY0A 4ZHQE 4O8SA 4U31A 4CXWA 1G73A 2VL0A 2YDSA 3ZPOA 3T1YT 2XAFB 2FJAA 4AQGA 3L8RA 3AE5A 2CLYB 3F31A 5AQUB 2DWKA 2ZLYA 4OFZA 3RKOA 2ZM2A 2SPCA 4LF8T 4DBQA 4YSZA 3JCFA 3P4RA 4JI6T 4PJMA 3TLWA 4IL9A 3LK3B 4DUZT 2XQ4A 2LKHA 3EABA 1GQEA 2XQ5A 2WB5A 4DNDA 2XZEA 4U2YA 2WU5A 1BR0A 2X0HA 4JYAT 2WMOA 2DNXA 5LG3A 2E9XC 4CN6A 4ZI2D 5CA0E 2LOSA 3K8PC 2CRBA 3N2KE 5AQTB 2BKOA 4DV2T 4DMWA 5AQGB 3A8YC 3N9LA 2EHOD 1D0XA 3NBXX 4PK5A 5HXHA 3N9OA 4HWIB 4YTNA 3L3PA 4XZCA 2OLTA 2L9QA 4JEHB 1T72A 2MAWA 2NR4A 4MFRA 3SFEA 4B3MT 4FJOA 3ZMTB 4AQFA 5J2UE 1JNZA 1WR0A 3KVAA 2XAQB 4HTEA 3RX6A 3O4XE 2E9XB 4WBOA 1VCSA 1WYBA 2YINA 2VB6A 5C3JA 2KZ7B 2JIWA 3RQUA 3C4XA 2HN1A 4LMJA 5L3EB 2LSIA 1LVKA 2QVAA 2UUBT 1NWMX 4F6RC 4EXTA 3NKZA 1UX4A 4IHJE 4IDNA 2PBIA 2V26A 4KI0F 3ZN0B 4L0RA 2NW9A 3OBVE 1SHZC 1IBLT 3CX7B 5LA6E 3KDSE 3R84B 3HKDE 4JI1T 4LFCT 2CBJA 4HWCA 1T7SA 1U4QA 4QXBB 1OXZA 4BA9A 1ZP0A 1OEDC 3AEAA 3BK9A 2NOXA 1Z8UA 3DTOA 2MBGA 3VU7H 2XAGB 1V9DA 2FBWA 2VASA 3UU5A 2V7KA 3AA7B 3ZC0A 2C5IT 3H3MA 4CI3B 2YKSA 4YTPA 2WBLA 5ABGA 4ZS2A 2ODUA 4DO0A 2BVMA 3I9WA 5LGUB 2WU2A 3AE9A 3G06A 3K3QC 4LF6T 1O3XA 4F8HA 2AXDS 3CQGB 3FBZA 3QK6A 1HCIA 4TNVA 5AQOB 1D0ZA 3HR0A 4EEBA 5L3CB 2WM9A 4X66T 4KUMB 3DP7A 2X9YA 3KFWX 2WDRA 3WI3A 2BKNA 2VL8A 2XM1A 2EHOA 1H7CA 2MTQA 3AAAB 2BKPA 3C98B 4CN1A 5ABFB 1J5ET 4YSYA 2NP9A 3J9X1 4U2ZA 5HXEA 1VCTA 5F5WA 3OKQA 3PUZF 2LHRA 2K48A 3AE6A 2L3LA 2K24A 2V7IA 1E7PA 2W4XA 2XQ7A 2VQET 2K5BB 5AQJB 2V7LA 3AEEA 3C64A 3FB2A 2LKGA 3UFEA 3JADA 4ZI3D 3FZLB 2L8KA 2WSSV 2M6BA 3EHZA 3P4WA 2WAUA 4LF5T 2XHEB 3B57A 3H3AA 3PUAA 3ONLC 3Q5WA 2V7MA 4AQFC 4U72A 4E7ZA 1N34T 1KF6A 3F2EA 4AIUA 1UUSA 3OVUA 4COFA 3D0TA 2V5DA 1IZNB 5L3DB 1LVFA 4HWDA 5LHHB 4B3TT 2VKDA 3LBXB 2DHRA 3AE3A 2CMRA 2PFVA 2MPKA 4DIDB 1XZYA 1CHUA 3AXJA 2Y48B 3RHWA 2KWIB 3CX8B 4YHJA 2ODVA 3W15B 3CMLA 4ZI2C 4HFCA 4JI5T 3ZJ2A 1D0YA 5JR9A 2LM9A 5LNKA 4DUYT 3JAFA 2CA5A 1LRZA 3JC6D 2J4GA 2KINB 3P4PA 4KX6A 4WYVA 1HR0T 5H6QB 5E0OA 3O9XA 4LFBT 3M65A 1YXRA 3SWHA 1QLBA 4DV1T 3PDYA 3BQKA 3ZC1A 4AISA 4JBWF 2VURA 2W67A 4PW8A 4E7SA 5HYAA 1IAPA 2ACZA 2N2NA 1SA0E 1UX5A 3FZKB 5IHYA 5HWYA 2X51A 3U78A 2EHOC 3LBXA 1W0BA 3LFMA 1NEKA 2BG9E 4MBQA 1FMVA 4PFOA 4UELA 4YT0A 1W09A 2LT3A 4Z91A 4EZHA 1MNDA 2BS4A 2KT9A 2J47A 3N2GE 4YLHA 4IDOA 2PG8A 3ZMVB 2DWGA 2LSKA 3UT5E 5HXSA 3F57A 3T8OA 3KV6A 2IW5B 4ASKA 3ETVA 4G2AA 4P0BA 4EAHA 2XAJB 3N2OA 4TX5A 1JNRA 3RRCA 5C8YE 2BBHA 4NXNT 4QKNA 4YJ3E 4V1Av 3UUMA 4H9SE 4YXDA 3KV4A 2RP4A 5LP6E 3KV9A 5L3BB 2Q9QC 4I43B 3VHLA 4JEUB 3K3OA 3WAKA 4ILCA 3SFDA 4TN7B 2UXCT 1UGOA 2V1DB 4U7IA 2KNDA 2WY2A 3N9NA 4WNKA 4GOUA 4H63V 2ZM8A 3NZPA 1BR2A 1EZ3A 4HFEA 3ONJA 1S35A 1WRDA 3UULA 2XQYA 3RLFF 5LOVE 1QUUA 3EVYA 3B13A 3UUXB 2H88A 5KX5E 4X65T 5FL1A 4EYUA 2WP9A 3EUHA 3ZCJA 4QX7B 5HCMA 4HWFA 5BR8T 3ZN1B 1ZHCA 4TZ4C 2NTXA 3VKGA 3O1HA 3LK2B 2NW7A 3RYHE 1YQ3A 1WCRA 2FJEA 2E5LT 3MJXA 2X9HA 2JJ9A 3PV0F 5H6RB 4ISTA 2ZM0A 3P4SA 3UU3A 1FIOA 1DU2A 4AKGA 2XQ8A 3AAEB 2R6GF 5JQGE 4U33A 3SOLA 3CWZB 3ONXA 3P7IA 3AVSA 5AQVB 5JDHA 3ZKRA 2LRKA 2X0LB 4TUYE 5IYZE 5BMVE 2N9DA 2PJQA 1M7KA 1YQ4A 2XY8B 2X9WA 3NVOA 5EK3A 1MMNA 2J62A 3AECA 4UXNB 5L4EA 4A97A 4JI3T 4QH1A 2RPAA 3ZYLA 2UXDT 2BG9B 4QHOA 2H3RA 1X9BA 4HWHA 5L3FB 3Q5EA 5HEGA 4NUVA 2VVNA 2CWYA 2E9XA 2MOZA 4IE5A 1XNQT 2YN6A 3KVBA 1J5WA 1OWAA 1X79A 2YDQA 1MIYA 1WR6A 2YOEA 3PE0A 2M67A 3UTKA 5DJQC 5CFBA 1MIVA 2IUBA 3HKBE 4H9NC 4ILBA 2XQAA 3KBTA 4O4LE 2WDQA 4P1NA 2BVLA 4AXPA 3RIAA 5LHIB 2NW8A 3P4QA 2A9UA 2CHNA 3VR8A 4OYKA 2LOPA 5FVKA 2FJBA 3RIUA 2LRLA 2QA7A 4OYJA 4WZXA 4QXHB 1HFAA 3N5LA 5AQFB 1WFDA 3KV5A 4YFSA 3RF1A 4AKIA 3KBUA 2VWAA 5FY1A 2RA1A 4ILAA 2JQKA 5HWXA 3IEEA 5ETWA 3P8CD 4H9OC 4IDQA 4ZI7E 1AJ3A 4JI8T 4MLKA 1Y64B 3GN5B 4JI4T 1D1AA 4ZI3C 3MXZA 3ANWA 1YKHB 3E08A 5AQMB 4CI2B 2X9XA 3OYZA 3ZYKA 3QB5A 1KEYA 2KMFA 4HFIA 4IREA 5AQSB 2WWUA 2JRKA 2DL1A 2KXPB 5EK4A 2CXFA 3UUNA 4A56A 4BAYB 4BJNA 3RC8A 2IC6A 3GN5A 2VKJA 2IHR1 1S94A 4ZZBA 1HF8A 3VRBA 1CUNA 3T1HT 3ZMSB 4H9RC 2V6XA 4CXXA 2VKOA 3N9MA 5AQPB 5LHGB 2W0GA 4TV9E 2WWVA 2IMLA 4CI1B 1XNRT 2LSJA 4IE4A 4P09A 1HX8A 5L47A 4GYSA 4UVAB 2Q9QD 4ILUA 4K0UA 3PUGA 3ZEFB 2JQQA 2UXNB 4HFDA 3AB3B 4IE0A 1YW0A 5EK2A 5C2TA 3M3ZB 3E0ZA 5ABFA 2JPFA 1MNEA 4OHFA 3LK42 5TAOA 5CJ5A 5JDGA 4GKKT 5KMGP 2XQ3A 2K9AA 3MKDA 3ZJ1A 2IDOB 2JQHA 3NWIA 4PFPA 3ZSTA 5JDMA 4QH4A 5LJNA 2X68A 3CQCB 3UFGA 4TWDA 4X20E 2BG9C 3RI5A 3RQWA 5LGNB 3PURA 3PJAJ 3QB5K 1MMDA 2K3WA 3L39A 3OYXA 2WZHA 3FHNA 3QOFA 4B3RT 3VKHA 3UUBA 1ZEEA 3RC3A 1HNZT 5DABA 1D1CA 5JDNA 1BR1A 3ZT7A 3FXEB 3PUWF 2DI4A 3AE4A 3GWHA 3OJAA 3HI2A 3Q5DA 5FY7A 2VVSA 3AA6B 1W9RA 4OK0A 4TV8E 5LB7B 1T98A 3AE7A 3C50A 4H9QC 5LYJE 2XQ6A 2A72A 1IBKT 5JRCB 1UCUA 4IDPA 4O4IE 1FMWA 2XJ7A 2UXBT 2HHHT 4KMCA 3CK6A 2LJLA 3P50A 1YD8G 4U7YA 3LG7A 4UF0A 4ZZCA 4DR3T 3HKCE 2UXXB 1Z0PA 3EI0A 3WAJA 1SE7A 2GK9A 4HFHA 3RRWA 3V5UA 4B3ST 1HG5A 2JMHA 3FZMB 4AKRB 3VRAA 5IUXA 3RH3A 1L0VA 3RYCE 2B76A 1LKXA 5HXCA 5AQIB 3CQXC 3ETUA 4HE8A 5CB4E 2CWOA 2LM2A 4CXYA 3A5XA 4O2BE 5JH7E 2BDEA 3IA3A 4BJMA 2XUEA 2UU9T 4LMLA 3FBLA 1KNZA 1J1JA 2CLYC 4JI2T 1KFYA 4J2CA 5GONE 5LCYA 5J2TE 3NRXA 1KNRA 4PAGA 1WYCA 4IIJE 4C91A 4DR4T 4LMKA 4UVBB 4CQIA 2PTFA 1KK7A 4EV6A 2DLRA 4X5TA 2D9DA 5JR9B 4G63A 1IBMT 4AKHA 2OV9A 3MK7C 4DR7T 4Z90A 2WZIA 5HEUA 2BBJA 4QH5A 3AA1B 3ANWB 3O1IA 2V5CA 3LSVA 2CCQA 3PUVF 5HAXA 1M62A 4AKLA 1HNWT 4YTMA 5DQVA 1KNPA 2BG9A 4UR9A 3J7Yq 3ZLIA 3GMIA 1OEDA 2V6YB 5LMUT 5AFUL 2Z6EA 4EZ4A 3EDVA 2E2AA 1ZV4X 4WW0A 2LSGA 4UV8B 5IWAT 3SRZA 2F4VT 3AEGA 4Q25A 5LBQB 2CHOA 2C5JA 1I6ZA 3QNUA 4KBMB 4UV9B 2CBIA 4LF9T 4X1KE 3RYFE 4HEAA 4K0KT 3RPUA 4KP3C 5FYMA 3AEFA 4I55E 3Q9DA 2VQFT 1HTJF 2CPTA 3UQ7A 5HEHA 2D5UA 3UQ4A 2QRXA 4PJLA 4CN4A 4EIWA 3FZHB 3ZMZB 1N32T 3Q5XA 4GK0E 4ISSA 5L3GB 2NWBA 5FXZA 4JI0T 4EOZB 4ERRA 4DR2T 1N33T 2XASB 1U5PA 4NUUA 5HEOA 2XQ9A 3I0QA 1D1BA 5LGTB 1FEWA 4GYRA 4QWNB 1QSDA 3Q2MA 3RKGA 3I9YA 2CEAA 2WS3A 5F3JA 1I94T 4L5GA 1E2AA 4P0AA 3AEBA 5J0ZA 1XWMA 1BR4A 3AAIA 3PU8A 2E8IA 2I6HA 3PJAA 4GK5E 1VOMA 2JQ9A 5HXRA 5KXJA 2WQYA 2A2FX 2FUPA 2G0UA 4MALA 5FVLA 4DV6T 2H89A 4YJ2E 5ADXL 3HL6A 4TWHA 2H7VC 3CKDA 4L9IA 5HCJA 4DV3T 1OEDB 2V6YA 1R8IA 2CXDA 5JRCA 1MMGA 4EYYR 5DQWA 3CPZA 4XAXB 2HPLA 3OPCA 2YDRA 5J1GA 1XDOA 1HX1B 2Q9QA 4WBNE 2KWHA 2LLYA 2LSYA 2XTLA 2MYSA 3KINB 2HPJA 3PUQA 4I0UA 4U74A 4PNIA 4H9PC 5JTGA 4DV7T 2D2SA 3EAMA 3ZSSA 5KDMC 4QX8B 2I59A 2N1GA 1US7B 3E22E 2YK0A 3GA8A 3PUXF 4LF7T 3I1AA 3X1DA 4O4HE 4DR5T 3IF8B 5ABHA 1XMOT 4DV0T 4UIGA 2W66A 2Y8DA 2YU1A 2FJDA 5EZYE 1UURA 4X62T 3OTOT 3C4WA 5LMNT 2E5VA 4PK6A 4JV5T 4IT4A 3CIRA 2LHNA 4ZXLA 4X64T 3ZMUB 4EGWA 4GKJT 2JMKA 4HGAA 5FKYA 4O2AE 3ESLA 3DJBA 2C0SA 2W61A 5JDQA 1XMQT 3UU6A 2VK9A 2Q9QB 5L4HA 2CM0A 1IJ6A 4JUYA 5F8PA 1SUMB 2IC9A 5FL0A 5JVDE 2IIUA 4DR1T 3FXDB 1N36T 3BQIA 5ABEA 2YU2A 4NIQA 1E1HB 2ACXA 2B1EA 2OA5A 2V7JA 2H7OA 1XDPA 3PU3A 4HFVA 5AQLB 4IDZA 2AE9A 3RYIE 3H37A 2I0MA 3AA0B 3SS1A 3ABVA 5AQNB 1T8BA 3MZKB 5JDFA 2V8SV 3PUSA 3UU4A 3AE8A 4Z8XA 4HKAA 2ZM6T 3ZT5A 4LF4T 2W62A 2QYWA 4CZZB 4EEDA 2NTYA 3QUJA 3HKEE 3TKLB 4HN9A 4PK4A 3EDUA 3O1JA 4IE6A 5LBMA 3RGLA 4N78D 5AQRB 4JI7T 4IGUA 4ZOLE 3CX6B 2X0YA 1ZOYA 2E9XD 2EHOB
chains in the Genus database with same CATH topology
4IT4A 3ZT7A 1YXRA 5FVKA 2V6XA 4ZEYA 2CPTA 5LB7B 2LRLA 5FVLA 2V6YA 2W2UA 4U7IA 4U33A 4WZXA 4U31A 2WY2A 2WWVA 1WFDA 4CN4A 2LRKA 3ZT6A 1WR0A 2JQKA 4U7YA 4NIQA 2RPAA 2MPKA 5CJ5A 3ZSSA 3ZSTA 2JQHA 4CN1A 3EABA 2V6YB 4U2ZA 2XZEA 4U2YA 3ZT5A 1WCRA 2DL1A 4A5XA 4CN6A 2K3WA 2JQ9A 4U3CA 4P1NA 5CGMA 2CRBA 3K1SA 2A9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT4 A;  3ZT7 A;  1YXR A;  5FVK A;  2V6X A;  4ZEY A;  2CPT A;  5LB7 B;  2LRL A;  5FVL A;  2V6Y A;  2W2U A;  4U7I A;  4U33 A;  4WZX A;  4U31 A;  2WY2 A;  2WWV A;  1WFD A;  4CN4 A;  2LRK A;  3ZT6 A;  1WR0 A;  2JQK A;  4U7Y A;  4NIQ A;  2RPA A;  2MPK A;  5CJ5 A;  3ZSS A;  3ZST A;  2JQH A;  4CN1 A;  3EAB A;  2V6Y B;  4U2Z A;  2XZE A;  4U2Y A;  3ZT5 A;  1WCR A;  2DL1 A;  4A5X A;  4CN6 A;  2K3W A;  2JQ9 A;  4U3C A;  4P1N A;  5CGM A;  2CRB A;  3K1S A;  2A9U A; 
#chains in the Genus database with same CATH topology
 1WLX A;  3C51 A;  3LDQ B;  3NZQ A;  3S4U A;  4NXM T;  3HA4 A;  4PJN A;  2W2U A;  1HNX T;  5LJM A;  1B7T A;  2WMN A;  3MA9 A;  2D0T A;  3U3I A;  2W00 A;  4DBR A;  1MMA A;  3AVR A;  4I50 E;  1ZKE A;  2D0U A;  3L09 A;  3AE1 A;  5L2L A;  2C5K T;  2J1D G;  2P9B A;  1MIW A;  2XSA A;  3JAE A;  3BQL A;  4KHZ F;  4ADZ A;  4DMV A;  3V5S A;  4AI6 A;  4H63 H;  5AQK B;  3K3N A;  2X66 A;  1Y01 A;  1IJ5 A;  2WCA A;  4UVC B;  4UF0 B;  4B6X A;  4YY3 T;  5LG4 A;  2LEH A;  5M4Y A;  2ES0 A;  2VKH A;  2M6I A;  2XAH B;  2IAK A;  2ZMA A;  4O4J E;  1W0A A;  1FJG T;  1UK5 A;  4DR6 T;  5FXX A;  4KHP T;  5LXT E;  4TNW A;  2YEV C;  1HG2 A;  3PUY F;  4HFB A;  3ZYM A;  2WDV A;  4U3C A;  5CGM A;  3AE2 A;  2XSB A;  5JDL A;  4MHC A;  2XPK A;  3AXJ B;  2HH7 A;  3RIF A;  3TLS A;  3ZCI A;  2DCF A;  4UEM A;  3IBP A;  4ZEY A;  4EB6 E;  3AED A;  4OX9 T;  2CXL A;  3I0O A;  4GIW A;  4IE7 A;  5FXW A;  3LJC A;  3JC6 C;  3N9Q A;  2BS2 A;  1G8X A;  2BZB A;  2W63 A;  3FZF B;  3MAC A;  3PTR B;  3R6N A;  3A7M A;  3IHR A;  4X1Y E;  4A98 A;  3RIU C;  2UUC T;  4AQY T;  3ZT6 A;  4C90 A;  4M1P A;  4JLE A;  3UU8 A;  4ZS3 A;  2LE8 A;  1HS7 A;  2HN2 A;  2A3D A;  4YSX A;  5JRE A;  4TWF A;  5A1L A;  4DV5 T;  5FMN A;  3TLT A;  1NAF A;  2Y6X A;  3N9P A;  4QXC B;  2KSR A;  3B5M A;  3NRY A;  2XM2 A;  4FI5 A;  5FP3 A;  2KLQ A;  4I4T E;  5FNV E;  4PJJ A;  5AQH B;  3TLU A;  2X67 A;  3TLV A;  4DVD A;  4XBF B;  4A5X A;  3CVR A;  2BS3 A;  4IL4 A;  3K1S A;  4DV4 T;  5JR9 C;  2QGS A;  2UUA T;  2CE7 A;  1NEN A;  4YHH T;  4X1I E;  5FXV A;  4LFA T;  4NPP A;  1YKE B;  5HEJ A;  1OED E;  3QC9 A;  1VRB A;  5AQQ B;  4ANJ A;  5CA1 E;  3VR9 A;  3C4Z A;  5FY0 A;  4ZHQ E;  4O8S A;  4U31 A;  4CXW A;  1G73 A;  2VL0 A;  2YDS A;  3ZPO A;  3T1Y T;  2XAF B;  2FJA A;  4AQG A;  3L8R A;  3AE5 A;  2CLY B;  3F31 A;  5AQU B;  2DWK A;  2ZLY A;  4OFZ A;  3RKO A;  2ZM2 A;  2SPC A;  4LF8 T;  4DBQ A;  4YSZ A;  3JCF A;  3P4R A;  4JI6 T;  4PJM A;  3TLW A;  4IL9 A;  3LK3 B;  4DUZ T;  2XQ4 A;  2LKH A;  3EAB A;  1GQE A;  2XQ5 A;  2WB5 A;  4DND A;  2XZE A;  4U2Y A;  2WU5 A;  1BR0 A;  2X0H A;  4JYA T;  2WMO A;  2DNX A;  5LG3 A;  2E9X C;  4CN6 A;  4ZI2 D;  5CA0 E;  2LOS A;  3K8P C;  2CRB A;  3N2K E;  5AQT B;  2BKO A;  4DV2 T;  4DMW A;  5AQG B;  3A8Y C;  3N9L A;  2EHO D;  1D0X A;  3NBX X;  4PK5 A;  5HXH A;  3N9O A;  4HWI B;  4YTN A;  3L3P A;  4XZC A;  2OLT A;  2L9Q A;  4JEH B;  1T72 A;  2MAW A;  2NR4 A;  4MFR A;  3SFE A;  4B3M T;  4FJO A;  3ZMT B;  4AQF A;  5J2U E;  1JNZ A;  1WR0 A;  3KVA A;  2XAQ B;  4HTE A;  3RX6 A;  3O4X E;  2E9X B;  4WBO A;  1VCS A;  1WYB A;  2YIN A;  2VB6 A;  5C3J A;  2KZ7 B;  2JIW A;  3RQU A;  3C4X A;  2HN1 A;  4LMJ A;  5L3E B;  2LSI A;  1LVK A;  2QVA A;  2UUB T;  1NWM X;  4F6R C;  4EXT A;  3NKZ A;  1UX4 A;  4IHJ E;  4IDN A;  2PBI A;  2V26 A;  4KI0 F;  3ZN0 B;  4L0R A;  2NW9 A;  3OBV E;  1SHZ C;  1IBL T;  3CX7 B;  5LA6 E;  3KDS E;  3R84 B;  3HKD E;  4JI1 T;  4LFC T;  2CBJ A;  4HWC A;  1T7S A;  1U4Q A;  4QXB B;  1OXZ A;  4BA9 A;  1ZP0 A;  1OED C;  3AEA A;  3BK9 A;  2NOX A;  1Z8U A;  3DTO A;  2MBG A;  3VU7 H;  2XAG B;  1V9D A;  2FBW A;  2VAS A;  3UU5 A;  2V7K A;  3AA7 B;  3ZC0 A;  2C5I T;  3H3M A;  4CI3 B;  2YKS A;  4YTP A;  2WBL A;  5ABG A;  4ZS2 A;  2ODU A;  4DO0 A;  2BVM A;  3I9W A;  5LGU B;  2WU2 A;  3AE9 A;  3G06 A;  3K3Q C;  4LF6 T;  1O3X A;  4F8H A;  2AXD S;  3CQG B;  3FBZ A;  3QK6 A;  1HCI A;  4TNV A;  5AQO B;  1D0Z A;  3HR0 A;  4EEB A;  5L3C B;  2WM9 A;  4X66 T;  4KUM B;  3DP7 A;  2X9Y A;  3KFW X;  2WDR A;  3WI3 A;  2BKN A;  2VL8 A;  2XM1 A;  2EHO A;  1H7C A;  2MTQ A;  3AAA B;  2BKP A;  3C98 B;  4CN1 A;  5ABF B;  1J5E T;  4YSY A;  2NP9 A;  3J9X 1;  4U2Z A;  5HXE A;  1VCT A;  5F5W A;  3OKQ A;  3PUZ F;  2LHR A;  2K48 A;  3AE6 A;  2L3L A;  2K24 A;  2V7I A;  1E7P A;  2W4X A;  2XQ7 A;  2VQE T;  2K5B B;  5AQJ B;  2V7L A;  3AEE A;  3C64 A;  3FB2 A;  2LKG A;  3UFE A;  3JAD A;  4ZI3 D;  3FZL B;  2L8K A;  2WSS V;  2M6B A;  3EHZ A;  3P4W A;  2WAU A;  4LF5 T;  2XHE B;  3B57 A;  3H3A A;  3PUA A;  3ONL C;  3Q5W A;  2V7M A;  4AQF C;  4U72 A;  4E7Z A;  1N34 T;  1KF6 A;  3F2E A;  4AIU A;  1UUS A;  3OVU A;  4COF A;  3D0T A;  2V5D A;  1IZN B;  5L3D B;  1LVF A;  4HWD A;  5LHH B;  4B3T T;  2VKD A;  3LBX B;  2DHR A;  3AE3 A;  2CMR A;  2PFV A;  2MPK A;  4DID B;  1XZY A;  1CHU A;  3AXJ A;  2Y48 B;  3RHW A;  2KWI B;  3CX8 B;  4YHJ A;  2ODV A;  3W15 B;  3CML A;  4ZI2 C;  4HFC A;  4JI5 T;  3ZJ2 A;  1D0Y A;  5JR9 A;  2LM9 A;  5LNK A;  4DUY T;  3JAF A;  2CA5 A;  1LRZ A;  3JC6 D;  2J4G A;  2KIN B;  3P4P A;  4KX6 A;  4WYV A;  1HR0 T;  5H6Q B;  5E0O A;  3O9X A;  4LFB T;  3M65 A;  1YXR A;  3SWH A;  1QLB A;  4DV1 T;  3PDY A;  3BQK A;  3ZC1 A;  4AIS A;  4JBW F;  2VUR A;  2W67 A;  4PW8 A;  4E7S A;  5HYA A;  1IAP A;  2ACZ A;  2N2N A;  1SA0 E;  1UX5 A;  3FZK B;  5IHY A;  5HWY A;  2X51 A;  3U78 A;  2EHO C;  3LBX A;  1W0B A;  3LFM A;  1NEK A;  2BG9 E;  4MBQ A;  1FMV A;  4PFO A;  4UEL A;  4YT0 A;  1W09 A;  2LT3 A;  4Z91 A;  4EZH A;  1MND A;  2BS4 A;  2KT9 A;  2J47 A;  3N2G E;  4YLH A;  4IDO A;  2PG8 A;  3ZMV B;  2DWG A;  2LSK A;  3UT5 E;  5HXS A;  3F57 A;  3T8O A;  3KV6 A;  2IW5 B;  4ASK A;  3ETV A;  4G2A A;  4P0B A;  4EAH A;  2XAJ B;  3N2O A;  4TX5 A;  1JNR A;  3RRC A;  5C8Y E;  2BBH A;  4NXN T;  4QKN A;  4YJ3 E;  4V1A v;  3UUM A;  4H9S E;  4YXD A;  3KV4 A;  2RP4 A;  5LP6 E;  3KV9 A;  5L3B B;  2Q9Q C;  4I43 B;  3VHL A;  4JEU B;  3K3O A;  3WAK A;  4ILC A;  3SFD A;  4TN7 B;  2UXC T;  1UGO A;  2V1D B;  4U7I A;  2KND A;  2WY2 A;  3N9N A;  4WNK A;  4GOU A;  4H63 V;  2ZM8 A;  3NZP A;  1BR2 A;  1EZ3 A;  4HFE A;  3ONJ A;  1S35 A;  1WRD A;  3UUL A;  2XQY A;  3RLF F;  5LOV E;  1QUU A;  3EVY A;  3B13 A;  3UUX B;  2H88 A;  5KX5 E;  4X65 T;  5FL1 A;  4EYU A;  2WP9 A;  3EUH A;  3ZCJ A;  4QX7 B;  5HCM A;  4HWF A;  5BR8 T;  3ZN1 B;  1ZHC A;  4TZ4 C;  2NTX A;  3VKG A;  3O1H A;  3LK2 B;  2NW7 A;  3RYH E;  1YQ3 A;  1WCR A;  2FJE A;  2E5L T;  3MJX A;  2X9H A;  2JJ9 A;  3PV0 F;  5H6R B;  4IST A;  2ZM0 A;  3P4S A;  3UU3 A;  1FIO A;  1DU2 A;  4AKG A;  2XQ8 A;  3AAE B;  2R6G F;  5JQG E;  4U33 A;  3SOL A;  3CWZ B;  3ONX A;  3P7I A;  3AVS A;  5AQV B;  5JDH A;  3ZKR A;  2LRK A;  2X0L B;  4TUY E;  5IYZ E;  5BMV E;  2N9D A;  2PJQ A;  1M7K A;  1YQ4 A;  2XY8 B;  2X9W A;  3NVO A;  5EK3 A;  1MMN A;  2J62 A;  3AEC A;  4UXN B;  5L4E A;  4A97 A;  4JI3 T;  4QH1 A;  2RPA A;  3ZYL A;  2UXD T;  2BG9 B;  4QHO A;  2H3R A;  1X9B A;  4HWH A;  5L3F B;  3Q5E A;  5HEG A;  4NUV A;  2VVN A;  2CWY A;  2E9X A;  2MOZ A;  4IE5 A;  1XNQ T;  2YN6 A;  3KVB A;  1J5W A;  1OWA A;  1X79 A;  2YDQ A;  1MIY A;  1WR6 A;  2YOE A;  3PE0 A;  2M67 A;  3UTK A;  5DJQ C;  5CFB A;  1MIV A;  2IUB A;  3HKB E;  4H9N C;  4ILB A;  2XQA A;  3KBT A;  4O4L E;  2WDQ A;  4P1N A;  2BVL A;  4AXP A;  3RIA A;  5LHI B;  2NW8 A;  3P4Q A;  2A9U A;  2CHN A;  3VR8 A;  4OYK A;  2LOP A;  5FVK A;  2FJB A;  3RIU A;  2LRL A;  2QA7 A;  4OYJ A;  4WZX A;  4QXH B;  1HFA A;  3N5L A;  5AQF B;  1WFD A;  3KV5 A;  4YFS A;  3RF1 A;  4AKI A;  3KBU A;  2VWA A;  5FY1 A;  2RA1 A;  4ILA A;  2JQK A;  5HWX A;  3IEE A;  5ETW A;  3P8C D;  4H9O C;  4IDQ A;  4ZI7 E;  1AJ3 A;  4JI8 T;  4MLK A;  1Y64 B;  3GN5 B;  4JI4 T;  1D1A A;  4ZI3 C;  3MXZ A;  3ANW A;  1YKH B;  3E08 A;  5AQM B;  4CI2 B;  2X9X A;  3OYZ A;  3ZYK A;  3QB5 A;  1KEY A;  2KMF A;  4HFI A;  4IRE A;  5AQS B;  2WWU A;  2JRK A;  2DL1 A;  2KXP B;  5EK4 A;  2CXF A;  3UUN A;  4A56 A;  4BAY B;  4BJN A;  3RC8 A;  2IC6 A;  3GN5 A;  2VKJ A;  2IHR 1;  1S94 A;  4ZZB A;  1HF8 A;  3VRB A;  1CUN A;  3T1H T;  3ZMS B;  4H9R C;  2V6X A;  4CXX A;  2VKO A;  3N9M A;  5AQP B;  5LHG B;  2W0G A;  4TV9 E;  2WWV A;  2IML A;  4CI1 B;  1XNR T;  2LSJ A;  4IE4 A;  4P09 A;  1HX8 A;  5L47 A;  4GYS A;  4UVA B;  2Q9Q D;  4ILU A;  4K0U A;  3PUG A;  3ZEF B;  2JQQ A;  2UXN B;  4HFD A;  3AB3 B;  4IE0 A;  1YW0 A;  5EK2 A;  5C2T A;  3M3Z B;  3E0Z A;  5ABF A;  2JPF A;  1MNE A;  4OHF A;  3LK4 2;  5TAO A;  5CJ5 A;  5JDG A;  4GKK T;  5KMG P;  2XQ3 A;  2K9A A;  3MKD A;  3ZJ1 A;  2IDO B;  2JQH A;  3NWI A;  4PFP A;  3ZST A;  5JDM A;  4QH4 A;  5LJN A;  2X68 A;  3CQC B;  3UFG A;  4TWD A;  4X20 E;  2BG9 C;  3RI5 A;  3RQW A;  5LGN B;  3PUR A;  3PJA J;  3QB5 K;  1MMD A;  2K3W A;  3L39 A;  3OYX A;  2WZH A;  3FHN A;  3QOF A;  4B3R T;  3VKH A;  3UUB A;  1ZEE A;  3RC3 A;  1HNZ T;  5DAB A;  1D1C A;  5JDN A;  1BR1 A;  3ZT7 A;  3FXE B;  3PUW F;  2DI4 A;  3AE4 A;  3GWH A;  3OJA A;  3HI2 A;  3Q5D A;  5FY7 A;  2VVS A;  3AA6 B;  1W9R A;  4OK0 A;  4TV8 E;  5LB7 B;  1T98 A;  3AE7 A;  3C50 A;  4H9Q C;  5LYJ E;  2XQ6 A;  2A72 A;  1IBK T;  5JRC B;  1UCU A;  4IDP A;  4O4I E;  1FMW A;  2XJ7 A;  2UXB T;  2HHH T;  4KMC A;  3CK6 A;  2LJL A;  3P50 A;  1YD8 G;  4U7Y A;  3LG7 A;  4UF0 A;  4ZZC A;  4DR3 T;  3HKC E;  2UXX B;  1Z0P A;  3EI0 A;  3WAJ A;  1SE7 A;  2GK9 A;  4HFH A;  3RRW A;  3V5U A;  4B3S T;  1HG5 A;  2JMH A;  3FZM B;  4AKR B;  3VRA A;  5IUX A;  3RH3 A;  1L0V A;  3RYC E;  2B76 A;  1LKX A;  5HXC A;  5AQI B;  3CQX C;  3ETU A;  4HE8 A;  5CB4 E;  2CWO A;  2LM2 A;  4CXY A;  3A5X A;  4O2B E;  5JH7 E;  2BDE A;  3IA3 A;  4BJM A;  2XUE A;  2UU9 T;  4LML A;  3FBL A;  1KNZ A;  1J1J A;  2CLY C;  4JI2 T;  1KFY A;  4J2C A;  5GON E;  5LCY A;  5J2T E;  3NRX A;  1KNR A;  4PAG A;  1WYC A;  4IIJ E;  4C91 A;  4DR4 T;  4LMK A;  4UVB B;  4CQI A;  2PTF A;  1KK7 A;  4EV6 A;  2DLR A;  4X5T A;  2D9D A;  5JR9 B;  4G63 A;  1IBM T;  4AKH A;  2OV9 A;  3MK7 C;  4DR7 T;  4Z90 A;  2WZI A;  5HEU A;  2BBJ A;  4QH5 A;  3AA1 B;  3ANW B;  3O1I A;  2V5C A;  3LSV A;  2CCQ A;  3PUV F;  5HAX A;  1M62 A;  4AKL A;  1HNW T;  4YTM A;  5DQV A;  1KNP A;  2BG9 A;  4UR9 A;  3J7Y q;  3ZLI A;  3GMI A;  1OED A;  2V6Y B;  5LMU T;  5AFU L;  2Z6E A;  4EZ4 A;  3EDV A;  2E2A A;  1ZV4 X;  4WW0 A;  2LSG A;  4UV8 B;  5IWA T;  3SRZ A;  2F4V T;  3AEG A;  4Q25 A;  5LBQ B;  2CHO A;  2C5J A;  1I6Z A;  3QNU A;  4KBM B;  4UV9 B;  2CBI A;  4LF9 T;  4X1K E;  3RYF E;  4HEA A;  4K0K T;  3RPU A;  4KP3 C;  5FYM A;  3AEF A;  4I55 E;  3Q9D A;  2VQF T;  1HTJ F;  2CPT A;  3UQ7 A;  5HEH A;  2D5U A;  3UQ4 A;  2QRX A;  4PJL A;  4CN4 A;  4EIW A;  3FZH B;  3ZMZ B;  1N32 T;  3Q5X A;  4GK0 E;  4ISS A;  5L3G B;  2NWB A;  5FXZ A;  4JI0 T;  4EOZ B;  4ERR A;  4DR2 T;  1N33 T;  2XAS B;  1U5P A;  4NUU A;  5HEO A;  2XQ9 A;  3I0Q A;  1D1B A;  5LGT B;  1FEW A;  4GYR A;  4QWN B;  1QSD A;  3Q2M A;  3RKG A;  3I9Y A;  2CEA A;  2WS3 A;  5F3J A;  1I94 T;  4L5G A;  1E2A A;  4P0A A;  3AEB A;  5J0Z A;  1XWM A;  1BR4 A;  3AAI A;  3PU8 A;  2E8I A;  2I6H A;  3PJA A;  4GK5 E;  1VOM A;  2JQ9 A;  5HXR A;  5KXJ A;  2WQY A;  2A2F X;  2FUP A;  2G0U A;  4MAL A;  5FVL A;  4DV6 T;  2H89 A;  4YJ2 E;  5ADX L;  3HL6 A;  4TWH A;  2H7V C;  3CKD A;  4L9I A;  5HCJ A;  4DV3 T;  1OED B;  2V6Y A;  1R8I A;  2CXD A;  5JRC A;  1MMG A;  4EYY R;  5DQW A;  3CPZ A;  4XAX B;  2HPL A;  3OPC A;  2YDR A;  5J1G A;  1XDO A;  1HX1 B;  2Q9Q A;  4WBN E;  2KWH A;  2LLY A;  2LSY A;  2XTL A;  2MYS A;  3KIN B;  2HPJ A;  3PUQ A;  4I0U A;  4U74 A;  4PNI A;  4H9P C;  5JTG A;  4DV7 T;  2D2S A;  3EAM A;  3ZSS A;  5KDM C;  4QX8 B;  2I59 A;  2N1G A;  1US7 B;  3E22 E;  2YK0 A;  3GA8 A;  3PUX F;  4LF7 T;  3I1A A;  3X1D A;  4O4H E;  4DR5 T;  3IF8 B;  5ABH A;  1XMO T;  4DV0 T;  4UIG A;  2W66 A;  2Y8D A;  2YU1 A;  2FJD A;  5EZY E;  1UUR A;  4X62 T;  3OTO T;  3C4W A;  5LMN T;  2E5V A;  4PK6 A;  4JV5 T;  4IT4 A;  3CIR A;  2LHN A;  4ZXL A;  4X64 T;  3ZMU B;  4EGW A;  4GKJ T;  2JMK A;  4HGA A;  5FKY A;  4O2A E;  3ESL A;  3DJB A;  2C0S A;  2W61 A;  5JDQ A;  1XMQ T;  3UU6 A;  2VK9 A;  2Q9Q B;  5L4H A;  2CM0 A;  1IJ6 A;  4JUY A;  5F8P A;  1SUM B;  2IC9 A;  5FL0 A;  5JVD E;  2IIU A;  4DR1 T;  3FXD B;  1N36 T;  3BQI A;  5ABE A;  2YU2 A;  4NIQ A;  1E1H B;  2ACX A;  2B1E A;  2OA5 A;  2V7J A;  2H7O A;  1XDP A;  3PU3 A;  4HFV A;  5AQL B;  4IDZ A;  2AE9 A;  3RYI E;  3H37 A;  2I0M A;  3AA0 B;  3SS1 A;  3ABV A;  5AQN B;  1T8B A;  3MZK B;  5JDF A;  2V8S V;  3PUS A;  3UU4 A;  3AE8 A;  4Z8X A;  4HKA A;  2ZM6 T;  3ZT5 A;  4LF4 T;  2W62 A;  2QYW A;  4CZZ B;  4EED A;  2NTY A;  3QUJ A;  3HKE E;  3TKL B;  4HN9 A;  4PK4 A;  3EDU A;  3O1J A;  4IE6 A;  5LBM A;  3RGL A;  4N78 D;  5AQR B;  4JI7 T;  4IGU A;  4ZOL E;  3CX6 B;  2X0Y A;  1ZOY A;  2E9X D;  2EHO B; 
#chains in the Genus database with same CATH homology
 4IT4 A;  3ZT7 A;  1YXR A;  5FVK A;  2V6X A;  4ZEY A;  2CPT A;  5LB7 B;  2LRL A;  5FVL A;  2V6Y A;  2W2U A;  4U7I A;  4U33 A;  4WZX A;  4U31 A;  2WY2 A;  2WWV A;  1WFD A;  4CN4 A;  2LRK A;  3ZT6 A;  1WR0 A;  2JQK A;  4U7Y A;  4NIQ A;  2RPA A;  2MPK A;  5CJ5 A;  3ZSS A;  3ZST A;  2JQH A;  4CN1 A;  3EAB A;  2V6Y B;  4U2Z A;  2XZE A;  4U2Y A;  3ZT5 A;  1WCR A;  2DL1 A;  4A5X A;  4CN6 A;  2K3W A;  2JQ9 A;  4U3C A;  4P1N A;  5CGM A;  2CRB A;  3K1S A;  2A9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...