2DL1A

Solution structure of the mit domain from human spartin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
GSSGSSGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spartin
publication title Solution structure of the MIT domain from human Spartin
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2dl1A01
1WR0A 2CRBA 4IT4A 1WFDA 2DL1A 2WY2A 4U2YA 3ZT7A 2V6XA 5LB7B 5CJ5A 2LRLA 2V6YA 4A5XA 1WCRA 2RPAA 4U7IA 2JQHA 2K3WA 2V6YB 4U3CA 2W2UA 2A9UA 4CN1A 5FVKA 2CPTA 5FVLA 3ZSTA 4P1NA 4CN4A 2JQ9A 2XZEA 5CGMA 4U31A 4CN6A 3ZSSA 3K1SA 4U2ZA 4WZXA 3ZT5A 4NIQA 4U33A 4U7YA 3ZT6A 2WWVA 1YXRA 4ZEYA 3EABA 2LRKA 2MPKA 2JQKA
chains in the Genus database with same CATH superfamily
3ZCJA 2IUBA 3RYIE 3UU5A 4DUYT 3P4RA 3AAAB 4J2CA 5JDNA 3UUXB 2M6BA 4A56A 2IC9A 2K24A 3F57A 2UXNB 4HWIB 4ZI7E 4MHCA 3PV0F 1E1HB 3SFDA 3SRZA 5JREA 1H7CA 4JI1T 3AE1A 3AVSA 5FXWA 2VQFT 2FJDA 4ZEYA 2V7JA 3O9XA 4TX5A 3ZC0A 1WLXA 3EHZA 2NOXA 4HWHA 2VVSA 4AQFC 5L47A 4V1Av 3B5MA 1MMGA 3K1SA 4WZXA 3PUQA 4B3MT 1UCUA 5HXHA 2W00A 2IDOB 3VHLA 5LP6E 1WFDA 4JUYA 2BG9E 2WM9A 2WQYA 4I55E 1MMDA 3GMIA 5L4HA 4TZ4C 1KNPA 3UU4A 2EHOC 2LSIA 5GONE 4A97A 5FL0A 2CBIA 3RIFA 5AQGB 1XNRT 3AE8A 4DR3T 4HGAA 3HKCE 1OEDA 2XSBA 4UV8B 3KBUA 2J4GA 4EIWA 3RF1A 2CPTA 3SFEA 5AQFB 2WB5A 2WAUA 3VKHA 3AA7B 5CFBA 2YN6A 4NIQA 3EDVA 4IIJE 2FJAA 5TAOA 5L3FB 5JRCB 3OBVE 4A5XA 3RIAA 1E2AA 3EAMA 4IDNA 4P0AA 3HA4A 2DLRA 3KFWX 2C0SA 4I50E 1IBLT 4N78D 1MMNA 3M65A 4TUYE 2KMFA 4IE4A 2LKHA 3OTOT 2VKHA 1SE7A 4F6RC 2C5KT 3E08A 2VKDA 2JQ9A 2H7VC 1NEKA 2Q9QA 2CE7A 1JNRA 2CA5A 2D9DA 3CWZB 3O1JA 2CXDA 4QXHB 4LF7T 4X1IE 4IHJE 5JVDE 2VB6A 3TKLB 2NW7A 5L3BB 3IBPA 3Q5DA 2A72A 5J1GA 2BKPA 4I4TE 3I0QA 4AKRB 5AQNB 3CKDA 1HS7A 2PJQA 5CA1E 4ZXLA 3R84B 3K3OA 3KBTA 3JAFA 3IA3A 4M1PA 4CN6A 3N5LA 3PURA 4GIWA 2X9YA 3RYFE 3AEFA 3CK6A 1JNZA 5HXSA 1D0YA 2ZLYA 3FZKB 5LMNT 2K3WA 3ZMTB 3V5UA 4LMJA 2CWOA 4H9PC 4PFOA 4DV2T 2JJ9A 4CXWA 4O4LE 2ZM6T 1WYCA 2XAQB 2Y6XA 3T8OA 5J2TE 2WWUA 4E7ZA 2KLQA 2L8KA 2GK9A 5FXVA 2WU2A 1OEDB 4WBNE 5ABHA 4HTEA 3AA6B 4O4JE 3FZLB 2YDSA 5AQRB 3VU7H 5KXJA 2UXBT 3LK2B 5LB7B 4QXCB 2Q9QD 2OA5A 4QH5A 3OVUA 4EV6A 5M4YA 3NWIA 4YHHT 5DABA 1T72A 3H37A 3Q5EA 3ZPOA 3N9NA 3ZMVB 3RRCA 4YHJA 3UQ4A 2W62A 4HWDA 2C5IT 2J47A 3RX6A 4U7YA 4QH1A 2Q9QB 4AKIA 3N9QA 5LBQB 2QRXA 2E8IA 3UFGA 2XQYA 2CXFA 5L3EB 1QSDA 2XQ3A 5FVLA 2K9AA 2J62A 2HN2A 1LVKA 2BBJA 3QC9A 3OJAA 4IGUA 2XQ4A 2KXPB 4ISTA 2LOPA 3RHWA 3NRYA 4YY3T 5J2UE 2LSGA 5HXEA 2F4VT 2J1DG 4Q25A 2W61A 1E7PA 4DV6T 1ZV4X 2EHOB 5HCMA 4YT0A 2H88A 2P9BA 3GA8A 5LMUT 3RRWA 4TWDA 3N9MA 4DV0T 2V6XA 2KWIB 3OPCA 2BKNA 2OLTA 4JI5T 4ZI3D 4EEBA 4ILCA 5C3JA 2MTQA 4CI1B 4ZI2C 1LKXA 2N1GA 3ZMSB 2DL1A 4EOZB 2DWGA 5FY1A 1HR0T 5AQSB 3TLSA 2E9XD 4UVAB 5HYAA 2UXCT 4IT4A 3QB5A 3RQUA 1HX1B 2LE8A 4FJOA 1MIWA 2VVNA 4ASKA 5FVKA 3DJBA 5AQVB 4CI3B 3O1IA 5BR8T 5LJNA 4L5GA 1VCTA 3RC3A 1D1BA 3A8YC 3PTRB 3MA9A 1U4QA 2X67A 1MIVA 3KV9A 4H63H 4UXNB 4JEHB 2RPAA 4KMCA 1ZP0A 2MAWA 3RIUC 4WBOA 3LJCA 2ACXA 2JQQA 1US7B 2M6IA 1KEYA 2KT9A 4YSZA 2NR4A 2WDQA 2YDRA 1YXRA 2XQ5A 1BR1A 2CLYB 2ZM2A 2BS4A 4OFZA 1XDOA 4C90A 1XDPA 2JQHA 4B3ST 1HG2A 2WDVA 3DTOA 1MNEA 3EI0A 1HG5A 5LOVE 4UVBB 4GKKT 3AEGA 3T1HT 2XQ7A 1HFAA 5F3JA 2XY8B 5CB4E 1J5ET 2L9QA 3AB3B 4IE5A 1YQ3A 5C8YE 2ODUA 3HKDE 1YW0A 2LSJA 4X65T 4LF9T 4HFEA 3Q2MA 5FXXA 1UURA 4ILUA 2LHRA 2WSSV 5IYZE 3KINB 4LFCT 2KNDA 1EZ3A 1MMAA 4LFAT 3RGLA 3OYZA 5A1LA 3PU3A 1VOMA 4AXPA 2VKJA 1ZHCA 3H3AA 3D0TA 3NKZA 2LRKA 2XM1A 1W0BA 5FL1A 3K8PC 4O4HE 3CX6B 3L09A 2IAKA 2XM2A 5F5WA 2V6YB 2WDRA 4UIGA 5F8PA 2WMOA 3CVRA 2LSYA 4JYAT 2MBGA 4B3RT 4IE0A 5HEOA 4F8HA 3CPZA 2BS2A 2D0TA 4ZS2A 4HFVA 4LF8T 3AXJA 3VRBA 5HXCA 3A7MA 3ESLA 5CGMA 5LHIB 3RH3A 3AEAA 4HFDA 4DR7T 4GKJT 3AE6A 2I0MA 3TLUA 2JPFA 3I9WA 1HNXT 4BA9A 2X68A 4X1KE 5L3GB 2FUPA 1IJ6A 5LXTE 3CMLA 2OV9A 5ABFA 4YJ2E 5KX5E 5LGUB 4LF5T 2FJEA 4DBRA 2Y8DA 2JIWA 3HKEE 1IJ5A 3ZT6A 3JC6C 3UTKA 2UU9T 3N2OA 3F2EA 4HE8A 4YTNA 2XQ8A 5JR9C 1CHUA 2DI4A 4JI2T 1N32T 4JI0T 5HWYA 3QOFA 2D5UA 2YINA 4ANJA 5IWAT 4TV8E 3C50A 4NUUA 3I9YA 1D1CA 2RA1A 2V1DB 4FI5A 1CUNA 3O4XE 3UU6A 5JDQA 3SOLA 5FNVE 4PFPA 2BBHA 4JI4T 3P8CD 4KHZF 3RPUA 4OYJA 1U5PA 4EGWA 3C98B 2HN1A 4KP3C 2L3LA 5FY0A 4IDOA 5C2TA 3PUAA 2LKGA 4KI0F 4EEDA 4LMKA 2VASA 1D1AA 3AAIA 4P1NA 5AQJB 2NW9A 4UELA 4EZHA 2XAJB 2VL0A 1XZYA 4YJ3E 5LBMA 4CQIA 3E22E 2A2FX 3RI5A 1WCRA 3QB5K 4WW0A 2H3RA 4AQFA 1FEWA 4MALA 4PJJA 5LHHB 1Z0PA 4PK6A 5JQGE 1WR0A 5L2LA 2V7IA 5JDHA 5H6RB 3UUNA 1UGOA 5AQKB 2A3DA 2I6HA 4TN7B 4YSXA 3C4XA 3AXJB 2EHOA 4GK0E 1OWAA 1SA0E 4YTMA 2CWYA 4OX9T 4X64T 2KINB 3ZT5A 1I6ZA 3KV6A 4HFIA 1LRZA 4PK4A 1BR4A 3QUJA 4IDZA 3ZYKA 3IHRA 5AQOB 3AE3A 1QLBA 1S94A 2XHEB 2XASB 2E5VA 4IL4A 2ZM0A 4PW8A 2IC6A 1W9RA 2V7MA 1KNRA 2YEVC 5ABFB 3RLFF 4ADZA 1NAFA 3JAEA 2WBLA 2IW5B 3JADA 2V26A 3PUWF 4DNDA 4EXTA 2MYSA 4KHPT 4HFHA 2DHRA 5LG3A 4U3CA 1WYBA 3IEEA 4IDQA 4UVCB 5LYJE 5LG4A 1W0AA 1IBMT 2H89A 3U78A 5E0OA 3NVOA 4DMVA 1OEDE 1N34T 1FIOA 3C51A 3CX8B 5L4EA 1G73A 1V9DA 1Z8UA 4HWFA 4WNKA 2X0LB 4CXXA 4DIDB 3NZQA 1SUMB 4Z91A 1NWMX 3KV4A 3RYCE 4QXBB 5AQQB 3PUVF 5AQPB 4DVDA 3P50A 3AEBA 4LF6T 4QKNA 2CMRA 4B3TT 2N9DA 3SWHA 2EHOD 4ZZCA 4H9OC 2D0UA 3PU8A 2AE9A 2IHR1 2IMLA 4E7SA 4YXDA 1N33T 2BG9C 3BQLA 2W2UA 1R8IA 3ZEFB 5EK3A 4ZS3A 3P7IA 3HKBE 3KVAA 4TNVA 4CZZB 1WR6A 4KX6A 2XQ6A 4MLKA 2MPKA 2H7OA 5AQUB 3VR9A 3RKOA 2BVLA 3P4QA 1L0VA 3CQXC 1XMOT 1IBKT 3TLWA 1OXZA 3Q5XA 3ZCIA 4DV4T 2VWAA 2WZIA 3LSVA 2UUAT 4G2AA 3C4ZA 4U7IA 1MIYA 1XNQT 3PUYF 2LM2A 3ZSTA 3JCFA 5AQIB 3AE2A 3H3MA 3N9PA 2W67A 3MZKB 1BR2A 2XQAA 3I1AA 2V6YA 5FXZA 2LLYA 2PBIA 5LGNB 1J1JA 2XQ9A 1M7KA 2KSRA 4IE7A 1XMQT 2UXDT 2NTYA 3CX7B 4LF4T 3ZC1A 3FZFB 3VRAA 1YQ4A 4JI8T 3B57A 3LBXA 1D0XA 2UUBT 2NTXA 4OHFA 2E2AA 5HEHA 4O2AE 2XZEA 4DV3T 3VR8A 2QA7A 5LHGB 4JI6T 4ISSA 2X0HA 2BG9A 3P4SA 4PAGA 2I59A 1AJ3A 3ZMZB 3DP7A 2PTFA 1I94T 4X5TA 2WWVA 4H63V 4GYRA 4U2YA 2LJLA 1YKHB 5EZYE 2CXLA 3AEDA 3ANWA 2XTLA 4IDPA 3AAEB 4XZCA 4JV5T 1GQEA 2V5DA 4IE6A 2WU5A 3L39A 5LGTB 3K3QC 4AQYT 3ZN1B 1W09A 2WP9A 4H9RC 3R6NA 5CA0E 1WRDA 3OYXA 2YU2A 2VURA 3ZLIA 5JDLA 2B1EA 2X9HA 4HKAA 2LSKA 1D0ZA 3LFMA 4LMLA 1VCSA 4BJNA 3L3PA 4YFSA 5JH7E 2G0UA 2VQET 4PJNA 5AQTB 4AISA 4LFBT 1YKEB 5AQHB 3ZMUB 2CHNA 4CI2B 4QHOA 3HL6A 4YLHA 2CHOA 4QH4A 2XAFB 3ZN0B 1HF8A 4DR1T 2Z6EA 1OEDC 1X9BA 2KZ7B 4U2ZA 4QX8B 1YD8G 5AFUL 2D2SA 1B7TA 1T8BA 2LRLA 2YK0A 5FKYA 2QGSA 4NXNT 4O2BE 1SHZC 5LA6E 4U72A 3FZHB 3PUGA 2DWKA 2NP9A 2ACZA 2X0YA 3ETUA 4DMWA 3UUBA 3BQKA 3HR0A 3RIUA 3PUXF 2JMHA 2W0GA 4QWNB 2XPKA 2ES0A 5EK2A 3LBXB 1HNWT 2ZMAA 3C4WA 4I43B 4JEUB 5HCJA 2V5CA 2Q9QC 3AECA 1UX4A 2BG9B 3GWHA 3FB2A 4EAHA 3UQ7A 5HEUA 4WYVA 4UEMA 5HEJA 4ERRA 3I0OA 4ZI2D 5HAXA 2W66A 3VKGA 2WMNA 2BS3A 2YOEA 4AQGA 3ANWB 3T1YT 4PJMA 3UU3A 4CN4A 3AE4A 3V5SA 4B6XA 1BR0A 3LG7A 2CBJA 2LT3A 3A5XA 4PK5A 4ZZBA 2ODVA 1IZNB 4TWHA 4DV7T 2YDQA 3WAJA 3AVRA 3FHNA 3AE7A 4HFBA 1MNDA 3S4UA 3KDSE 2JQKA 1T7SA 1X79A 2XSAA 2LEHA 3UULA 3EDUA 3EVYA 3P4WA 1HCIA 3AA0B 1QUUA 3SS1A 1Y64B 5JDGA 2LHNA 4ILBA 3HI2A 2WZHA 2X9WA 4ZI3C 3WI3A 2BVMA 1G8XA 1KF6A 3UU8A 2V8SV 4AKGA 4NXMT 4DR4T 3QNUA 4H9NC 2UUCT 1ZKEA 3EUHA 3U3IA 2PG8A 3UFEA 3KV5A 2RP4A 3OKQA 3ZJ2A 4G63A 4EYUA 4X66T 2CM0A 3WAKA 2E9XC 1DU2A 2BDEA 3BQIA 4ILAA 1HTJF 4XBFB 5AQMB 1N36T 2XJ7A 4DUZT 2XAHB 4OYKA 2VKOA 5JR9A 4CXYA 2BZBA 2CLYC 2BKOA 4EZ4A 4COFA 2NWBA 1HX8A 2A9UA 3MACA 2X9XA 2AXDS 5ABGA 1FMWA 3TLVA 4ZHQE 2DCFA 4ZOLE 3LK3B 1FMVA 1XWMA 4UF0A 4KBMB 3Q5WA 4HN9A 5EK4A 3EABA 3M3ZB 3NBXX 4O4IE 4JI3T 2QVAA 2M67A 5FYMA 2VK9A 5L3DB 3L8RA 5JDFA 3ZYMA 4L0RA 5ADXL 3LDQB 3FXDB 4P09A 2WS3A 3NRXA 2CCQA 1Y01A 4UV9B 3RC8A 3PJAJ 4H9SE 2X66A 2PFVA 3J9X1 2K48A 3GN5A 2DNXA 2VL8A 4HEAA 2V7KA 4KUMB 4YTPA 4AKLA 3ONLC 3J7Yq 3ONJA 4AI6A 2N2NA 4PJLA 3CQGB 3N9OA 1IAPA 2LOSA 3MXZA 2V7LA 4U31A 1O3XA 3X1DA 2E9XA 5HXRA 3FBZA 2MOZA 2B76A 3PJAA 2CRBA 4XAXB 4K0UA 1KNZA 3JC6D 4TNWA 3ONXA 3CIRA 3N2GE 3G06A 5KDMC 4P0BA 4O8SA 5LNKA 5DJQC 1VRBA 2LM9A 2C5JA 4DO0A 3ABVA 3E0ZA 2W4XA 4UR9A 4DR5T 3P4PA 3UT5E 2IIUA 3AA1B 5FMNA 4DV5T 3RKGA 4X1YE 4QX7B 3ZSSA 4K0KT 4MFRA 4A98A 2UXXB 4TWFA 3RQWA 1ZOYA 1KFYA 2QYWA 4AKHA 3NZPA 5IHYA 3CQCB 5JR9B 2WCAA 4DR6T 1LVFA 3C64A 4Z90A 2YU1A 3IF8B 3N2KE 3K3NA 1UX5A 4EB6E 4OK0A 4H9QC 4BAYB 3N9LA 4UF0B 4U74A 4GYSA 4AIUA 2WY2A 4NUVA 2FBWA 4YSYA 3MK7C 4X20E 2ZM8A 5H6QB 5HWXA 4EYYR 2XAGB 4Z8XA 2HHHT 2R6GF 4HFCA 4C91A 2HPJA 5LJMA 2Y48B 1M62A 3F31A 4U33A 3Q9DA 5DQWA 2W63A 3TLTA 3ETVA 1J5WA 3FZMB 3W15B 3ZT7A 4DV1T 3FBLA 2HPLA 1S35A 3GN5B 2K5BB 3FXEB 2JRKA 2CEAA 4JI7T 4GOUA 2HH7A 3AE9A 3ZKRA 4JBWF 1ZEEA 4TV9E 3QK6A 5FY7A 3MKDA 3UUMA 3PE0A 4NPPA 4HWCA 2NW8A 1HNZT 2E9XB 2FJBA 2KWHA 4DBQA 3BK9A 3O1HA 4I0UA 5CJ5A 1UUSA 2YKSA 3AEEA 1KK7A 5JTGA 3ZJ1A 4JLEA 4CN1A 5AQLB 4L9IA 4DR2T 5KMGP 5DQVA 3KVBA 3AE5A 2SPCA 4IREA 4IL9A 2E5LT 3MJXA 5BMVE 1UK5A 1T98A 1NENA 5FP3A 4GK5E 5ABEA 5L3CB 5HEGA 3PUSA 3LK42 4X62T 3PDYA 4PNIA 3RYHE 2X51A 5JDMA 5LCYA 4BJMA 5JRCA 5IUXA 3PUZF 3ZYLA 3B13A 5J0ZA 2JMKA 1FJGT 4MBQA 2XUEA 5ETWA
chains in the Genus database with same CATH topology
1WR0A 2CRBA 4IT4A 1WFDA 2DL1A 2WY2A 4U2YA 3ZT7A 2V6XA 5LB7B 5CJ5A 2LRLA 2V6YA 4A5XA 1WCRA 2RPAA 4U7IA 2JQHA 2K3WA 2V6YB 4U3CA 2W2UA 2A9UA 4CN1A 5FVKA 2CPTA 5FVLA 3ZSTA 4P1NA 4CN4A 2JQ9A 2XZEA 5CGMA 4U31A 4CN6A 3ZSSA 3K1SA 4U2ZA 4WZXA 3ZT5A 4NIQA 4U33A 4U7YA 3ZT6A 2WWVA 1YXRA 4ZEYA 3EABA 2LRKA 2MPKA 2JQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR0 A;  2CRB A;  4IT4 A;  1WFD A;  2DL1 A;  2WY2 A;  4U2Y A;  3ZT7 A;  2V6X A;  5LB7 B;  5CJ5 A;  2LRL A;  2V6Y A;  4A5X A;  1WCR A;  2RPA A;  4U7I A;  2JQH A;  2K3W A;  2V6Y B;  4U3C A;  2W2U A;  2A9U A;  4CN1 A;  5FVK A;  2CPT A;  5FVL A;  3ZST A;  4P1N A;  4CN4 A;  2JQ9 A;  2XZE A;  5CGM A;  4U31 A;  4CN6 A;  3ZSS A;  3K1S A;  4U2Z A;  4WZX A;  3ZT5 A;  4NIQ A;  4U33 A;  4U7Y A;  3ZT6 A;  2WWV A;  1YXR A;  4ZEY A;  3EAB A;  2LRK A;  2MPK A;  2JQK A; 
#chains in the Genus database with same CATH topology
 3ZCJ A;  2IUB A;  3RYI E;  3UU5 A;  4DUY T;  3P4R A;  3AAA B;  4J2C A;  5JDN A;  3UUX B;  2M6B A;  4A56 A;  2IC9 A;  2K24 A;  3F57 A;  2UXN B;  4HWI B;  4ZI7 E;  4MHC A;  3PV0 F;  1E1H B;  3SFD A;  3SRZ A;  5JRE A;  1H7C A;  4JI1 T;  3AE1 A;  3AVS A;  5FXW A;  2VQF T;  2FJD A;  4ZEY A;  2V7J A;  3O9X A;  4TX5 A;  3ZC0 A;  1WLX A;  3EHZ A;  2NOX A;  4HWH A;  2VVS A;  4AQF C;  5L47 A;  4V1A v;  3B5M A;  1MMG A;  3K1S A;  4WZX A;  3PUQ A;  4B3M T;  1UCU A;  5HXH A;  2W00 A;  2IDO B;  3VHL A;  5LP6 E;  1WFD A;  4JUY A;  2BG9 E;  2WM9 A;  2WQY A;  4I55 E;  1MMD A;  3GMI A;  5L4H A;  4TZ4 C;  1KNP A;  3UU4 A;  2EHO C;  2LSI A;  5GON E;  4A97 A;  5FL0 A;  2CBI A;  3RIF A;  5AQG B;  1XNR T;  3AE8 A;  4DR3 T;  4HGA A;  3HKC E;  1OED A;  2XSB A;  4UV8 B;  3KBU A;  2J4G A;  4EIW A;  3RF1 A;  2CPT A;  3SFE A;  5AQF B;  2WB5 A;  2WAU A;  3VKH A;  3AA7 B;  5CFB A;  2YN6 A;  4NIQ A;  3EDV A;  4IIJ E;  2FJA A;  5TAO A;  5L3F B;  5JRC B;  3OBV E;  4A5X A;  3RIA A;  1E2A A;  3EAM A;  4IDN A;  4P0A A;  3HA4 A;  2DLR A;  3KFW X;  2C0S A;  4I50 E;  1IBL T;  4N78 D;  1MMN A;  3M65 A;  4TUY E;  2KMF A;  4IE4 A;  2LKH A;  3OTO T;  2VKH A;  1SE7 A;  4F6R C;  2C5K T;  3E08 A;  2VKD A;  2JQ9 A;  2H7V C;  1NEK A;  2Q9Q A;  2CE7 A;  1JNR A;  2CA5 A;  2D9D A;  3CWZ B;  3O1J A;  2CXD A;  4QXH B;  4LF7 T;  4X1I E;  4IHJ E;  5JVD E;  2VB6 A;  3TKL B;  2NW7 A;  5L3B B;  3IBP A;  3Q5D A;  2A72 A;  5J1G A;  2BKP A;  4I4T E;  3I0Q A;  4AKR B;  5AQN B;  3CKD A;  1HS7 A;  2PJQ A;  5CA1 E;  4ZXL A;  3R84 B;  3K3O A;  3KBT A;  3JAF A;  3IA3 A;  4M1P A;  4CN6 A;  3N5L A;  3PUR A;  4GIW A;  2X9Y A;  3RYF E;  3AEF A;  3CK6 A;  1JNZ A;  5HXS A;  1D0Y A;  2ZLY A;  3FZK B;  5LMN T;  2K3W A;  3ZMT B;  3V5U A;  4LMJ A;  2CWO A;  4H9P C;  4PFO A;  4DV2 T;  2JJ9 A;  4CXW A;  4O4L E;  2ZM6 T;  1WYC A;  2XAQ B;  2Y6X A;  3T8O A;  5J2T E;  2WWU A;  4E7Z A;  2KLQ A;  2L8K A;  2GK9 A;  5FXV A;  2WU2 A;  1OED B;  4WBN E;  5ABH A;  4HTE A;  3AA6 B;  4O4J E;  3FZL B;  2YDS A;  5AQR B;  3VU7 H;  5KXJ A;  2UXB T;  3LK2 B;  5LB7 B;  4QXC B;  2Q9Q D;  2OA5 A;  4QH5 A;  3OVU A;  4EV6 A;  5M4Y A;  3NWI A;  4YHH T;  5DAB A;  1T72 A;  3H37 A;  3Q5E A;  3ZPO A;  3N9N A;  3ZMV B;  3RRC A;  4YHJ A;  3UQ4 A;  2W62 A;  4HWD A;  2C5I T;  2J47 A;  3RX6 A;  4U7Y A;  4QH1 A;  2Q9Q B;  4AKI A;  3N9Q A;  5LBQ B;  2QRX A;  2E8I A;  3UFG A;  2XQY A;  2CXF A;  5L3E B;  1QSD A;  2XQ3 A;  5FVL A;  2K9A A;  2J62 A;  2HN2 A;  1LVK A;  2BBJ A;  3QC9 A;  3OJA A;  4IGU A;  2XQ4 A;  2KXP B;  4IST A;  2LOP A;  3RHW A;  3NRY A;  4YY3 T;  5J2U E;  2LSG A;  5HXE A;  2F4V T;  2J1D G;  4Q25 A;  2W61 A;  1E7P A;  4DV6 T;  1ZV4 X;  2EHO B;  5HCM A;  4YT0 A;  2H88 A;  2P9B A;  3GA8 A;  5LMU T;  3RRW A;  4TWD A;  3N9M A;  4DV0 T;  2V6X A;  2KWI B;  3OPC A;  2BKN A;  2OLT A;  4JI5 T;  4ZI3 D;  4EEB A;  4ILC A;  5C3J A;  2MTQ A;  4CI1 B;  4ZI2 C;  1LKX A;  2N1G A;  3ZMS B;  2DL1 A;  4EOZ B;  2DWG A;  5FY1 A;  1HR0 T;  5AQS B;  3TLS A;  2E9X D;  4UVA B;  5HYA A;  2UXC T;  4IT4 A;  3QB5 A;  3RQU A;  1HX1 B;  2LE8 A;  4FJO A;  1MIW A;  2VVN A;  4ASK A;  5FVK A;  3DJB A;  5AQV B;  4CI3 B;  3O1I A;  5BR8 T;  5LJN A;  4L5G A;  1VCT A;  3RC3 A;  1D1B A;  3A8Y C;  3PTR B;  3MA9 A;  1U4Q A;  2X67 A;  1MIV A;  3KV9 A;  4H63 H;  4UXN B;  4JEH B;  2RPA A;  4KMC A;  1ZP0 A;  2MAW A;  3RIU C;  4WBO A;  3LJC A;  2ACX A;  2JQQ A;  1US7 B;  2M6I A;  1KEY A;  2KT9 A;  4YSZ A;  2NR4 A;  2WDQ A;  2YDR A;  1YXR A;  2XQ5 A;  1BR1 A;  2CLY B;  2ZM2 A;  2BS4 A;  4OFZ A;  1XDO A;  4C90 A;  1XDP A;  2JQH A;  4B3S T;  1HG2 A;  2WDV A;  3DTO A;  1MNE A;  3EI0 A;  1HG5 A;  5LOV E;  4UVB B;  4GKK T;  3AEG A;  3T1H T;  2XQ7 A;  1HFA A;  5F3J A;  2XY8 B;  5CB4 E;  1J5E T;  2L9Q A;  3AB3 B;  4IE5 A;  1YQ3 A;  5C8Y E;  2ODU A;  3HKD E;  1YW0 A;  2LSJ A;  4X65 T;  4LF9 T;  4HFE A;  3Q2M A;  5FXX A;  1UUR A;  4ILU A;  2LHR A;  2WSS V;  5IYZ E;  3KIN B;  4LFC T;  2KND A;  1EZ3 A;  1MMA A;  4LFA T;  3RGL A;  3OYZ A;  5A1L A;  3PU3 A;  1VOM A;  4AXP A;  2VKJ A;  1ZHC A;  3H3A A;  3D0T A;  3NKZ A;  2LRK A;  2XM1 A;  1W0B A;  5FL1 A;  3K8P C;  4O4H E;  3CX6 B;  3L09 A;  2IAK A;  2XM2 A;  5F5W A;  2V6Y B;  2WDR A;  4UIG A;  5F8P A;  2WMO A;  3CVR A;  2LSY A;  4JYA T;  2MBG A;  4B3R T;  4IE0 A;  5HEO A;  4F8H A;  3CPZ A;  2BS2 A;  2D0T A;  4ZS2 A;  4HFV A;  4LF8 T;  3AXJ A;  3VRB A;  5HXC A;  3A7M A;  3ESL A;  5CGM A;  5LHI B;  3RH3 A;  3AEA A;  4HFD A;  4DR7 T;  4GKJ T;  3AE6 A;  2I0M A;  3TLU A;  2JPF A;  3I9W A;  1HNX T;  4BA9 A;  2X68 A;  4X1K E;  5L3G B;  2FUP A;  1IJ6 A;  5LXT E;  3CML A;  2OV9 A;  5ABF A;  4YJ2 E;  5KX5 E;  5LGU B;  4LF5 T;  2FJE A;  4DBR A;  2Y8D A;  2JIW A;  3HKE E;  1IJ5 A;  3ZT6 A;  3JC6 C;  3UTK A;  2UU9 T;  3N2O A;  3F2E A;  4HE8 A;  4YTN A;  2XQ8 A;  5JR9 C;  1CHU A;  2DI4 A;  4JI2 T;  1N32 T;  4JI0 T;  5HWY A;  3QOF A;  2D5U A;  2YIN A;  4ANJ A;  5IWA T;  4TV8 E;  3C50 A;  4NUU A;  3I9Y A;  1D1C A;  2RA1 A;  2V1D B;  4FI5 A;  1CUN A;  3O4X E;  3UU6 A;  5JDQ A;  3SOL A;  5FNV E;  4PFP A;  2BBH A;  4JI4 T;  3P8C D;  4KHZ F;  3RPU A;  4OYJ A;  1U5P A;  4EGW A;  3C98 B;  2HN1 A;  4KP3 C;  2L3L A;  5FY0 A;  4IDO A;  5C2T A;  3PUA A;  2LKG A;  4KI0 F;  4EED A;  4LMK A;  2VAS A;  1D1A A;  3AAI A;  4P1N A;  5AQJ B;  2NW9 A;  4UEL A;  4EZH A;  2XAJ B;  2VL0 A;  1XZY A;  4YJ3 E;  5LBM A;  4CQI A;  3E22 E;  2A2F X;  3RI5 A;  1WCR A;  3QB5 K;  4WW0 A;  2H3R A;  4AQF A;  1FEW A;  4MAL A;  4PJJ A;  5LHH B;  1Z0P A;  4PK6 A;  5JQG E;  1WR0 A;  5L2L A;  2V7I A;  5JDH A;  5H6R B;  3UUN A;  1UGO A;  5AQK B;  2A3D A;  2I6H A;  4TN7 B;  4YSX A;  3C4X A;  3AXJ B;  2EHO A;  4GK0 E;  1OWA A;  1SA0 E;  4YTM A;  2CWY A;  4OX9 T;  4X64 T;  2KIN B;  3ZT5 A;  1I6Z A;  3KV6 A;  4HFI A;  1LRZ A;  4PK4 A;  1BR4 A;  3QUJ A;  4IDZ A;  3ZYK A;  3IHR A;  5AQO B;  3AE3 A;  1QLB A;  1S94 A;  2XHE B;  2XAS B;  2E5V A;  4IL4 A;  2ZM0 A;  4PW8 A;  2IC6 A;  1W9R A;  2V7M A;  1KNR A;  2YEV C;  5ABF B;  3RLF F;  4ADZ A;  1NAF A;  3JAE A;  2WBL A;  2IW5 B;  3JAD A;  2V26 A;  3PUW F;  4DND A;  4EXT A;  2MYS A;  4KHP T;  4HFH A;  2DHR A;  5LG3 A;  4U3C A;  1WYB A;  3IEE A;  4IDQ A;  4UVC B;  5LYJ E;  5LG4 A;  1W0A A;  1IBM T;  2H89 A;  3U78 A;  5E0O A;  3NVO A;  4DMV A;  1OED E;  1N34 T;  1FIO A;  3C51 A;  3CX8 B;  5L4E A;  1G73 A;  1V9D A;  1Z8U A;  4HWF A;  4WNK A;  2X0L B;  4CXX A;  4DID B;  3NZQ A;  1SUM B;  4Z91 A;  1NWM X;  3KV4 A;  3RYC E;  4QXB B;  5AQQ B;  3PUV F;  5AQP B;  4DVD A;  3P50 A;  3AEB A;  4LF6 T;  4QKN A;  2CMR A;  4B3T T;  2N9D A;  3SWH A;  2EHO D;  4ZZC A;  4H9O C;  2D0U A;  3PU8 A;  2AE9 A;  2IHR 1;  2IML A;  4E7S A;  4YXD A;  1N33 T;  2BG9 C;  3BQL A;  2W2U A;  1R8I A;  3ZEF B;  5EK3 A;  4ZS3 A;  3P7I A;  3HKB E;  3KVA A;  4TNV A;  4CZZ B;  1WR6 A;  4KX6 A;  2XQ6 A;  4MLK A;  2MPK A;  2H7O A;  5AQU B;  3VR9 A;  3RKO A;  2BVL A;  3P4Q A;  1L0V A;  3CQX C;  1XMO T;  1IBK T;  3TLW A;  1OXZ A;  3Q5X A;  3ZCI A;  4DV4 T;  2VWA A;  2WZI A;  3LSV A;  2UUA T;  4G2A A;  3C4Z A;  4U7I A;  1MIY A;  1XNQ T;  3PUY F;  2LM2 A;  3ZST A;  3JCF A;  5AQI B;  3AE2 A;  3H3M A;  3N9P A;  2W67 A;  3MZK B;  1BR2 A;  2XQA A;  3I1A A;  2V6Y A;  5FXZ A;  2LLY A;  2PBI A;  5LGN B;  1J1J A;  2XQ9 A;  1M7K A;  2KSR A;  4IE7 A;  1XMQ T;  2UXD T;  2NTY A;  3CX7 B;  4LF4 T;  3ZC1 A;  3FZF B;  3VRA A;  1YQ4 A;  4JI8 T;  3B57 A;  3LBX A;  1D0X A;  2UUB T;  2NTX A;  4OHF A;  2E2A A;  5HEH A;  4O2A E;  2XZE A;  4DV3 T;  3VR8 A;  2QA7 A;  5LHG B;  4JI6 T;  4ISS A;  2X0H A;  2BG9 A;  3P4S A;  4PAG A;  2I59 A;  1AJ3 A;  3ZMZ B;  3DP7 A;  2PTF A;  1I94 T;  4X5T A;  2WWV A;  4H63 V;  4GYR A;  4U2Y A;  2LJL A;  1YKH B;  5EZY E;  2CXL A;  3AED A;  3ANW A;  2XTL A;  4IDP A;  3AAE B;  4XZC A;  4JV5 T;  1GQE A;  2V5D A;  4IE6 A;  2WU5 A;  3L39 A;  5LGT B;  3K3Q C;  4AQY T;  3ZN1 B;  1W09 A;  2WP9 A;  4H9R C;  3R6N A;  5CA0 E;  1WRD A;  3OYX A;  2YU2 A;  2VUR A;  3ZLI A;  5JDL A;  2B1E A;  2X9H A;  4HKA A;  2LSK A;  1D0Z A;  3LFM A;  4LML A;  1VCS A;  4BJN A;  3L3P A;  4YFS A;  5JH7 E;  2G0U A;  2VQE T;  4PJN A;  5AQT B;  4AIS A;  4LFB T;  1YKE B;  5AQH B;  3ZMU B;  2CHN A;  4CI2 B;  4QHO A;  3HL6 A;  4YLH A;  2CHO A;  4QH4 A;  2XAF B;  3ZN0 B;  1HF8 A;  4DR1 T;  2Z6E A;  1OED C;  1X9B A;  2KZ7 B;  4U2Z A;  4QX8 B;  1YD8 G;  5AFU L;  2D2S A;  1B7T A;  1T8B A;  2LRL A;  2YK0 A;  5FKY A;  2QGS A;  4NXN T;  4O2B E;  1SHZ C;  5LA6 E;  4U72 A;  3FZH B;  3PUG A;  2DWK A;  2NP9 A;  2ACZ A;  2X0Y A;  3ETU A;  4DMW A;  3UUB A;  3BQK A;  3HR0 A;  3RIU A;  3PUX F;  2JMH A;  2W0G A;  4QWN B;  2XPK A;  2ES0 A;  5EK2 A;  3LBX B;  1HNW T;  2ZMA A;  3C4W A;  4I43 B;  4JEU B;  5HCJ A;  2V5C A;  2Q9Q C;  3AEC A;  1UX4 A;  2BG9 B;  3GWH A;  3FB2 A;  4EAH A;  3UQ7 A;  5HEU A;  4WYV A;  4UEM A;  5HEJ A;  4ERR A;  3I0O A;  4ZI2 D;  5HAX A;  2W66 A;  3VKG A;  2WMN A;  2BS3 A;  2YOE A;  4AQG A;  3ANW B;  3T1Y T;  4PJM A;  3UU3 A;  4CN4 A;  3AE4 A;  3V5S A;  4B6X A;  1BR0 A;  3LG7 A;  2CBJ A;  2LT3 A;  3A5X A;  4PK5 A;  4ZZB A;  2ODV A;  1IZN B;  4TWH A;  4DV7 T;  2YDQ A;  3WAJ A;  3AVR A;  3FHN A;  3AE7 A;  4HFB A;  1MND A;  3S4U A;  3KDS E;  2JQK A;  1T7S A;  1X79 A;  2XSA A;  2LEH A;  3UUL A;  3EDU A;  3EVY A;  3P4W A;  1HCI A;  3AA0 B;  1QUU A;  3SS1 A;  1Y64 B;  5JDG A;  2LHN A;  4ILB A;  3HI2 A;  2WZH A;  2X9W A;  4ZI3 C;  3WI3 A;  2BVM A;  1G8X A;  1KF6 A;  3UU8 A;  2V8S V;  4AKG A;  4NXM T;  4DR4 T;  3QNU A;  4H9N C;  2UUC T;  1ZKE A;  3EUH A;  3U3I A;  2PG8 A;  3UFE A;  3KV5 A;  2RP4 A;  3OKQ A;  3ZJ2 A;  4G63 A;  4EYU A;  4X66 T;  2CM0 A;  3WAK A;  2E9X C;  1DU2 A;  2BDE A;  3BQI A;  4ILA A;  1HTJ F;  4XBF B;  5AQM B;  1N36 T;  2XJ7 A;  4DUZ T;  2XAH B;  4OYK A;  2VKO A;  5JR9 A;  4CXY A;  2BZB A;  2CLY C;  2BKO A;  4EZ4 A;  4COF A;  2NWB A;  1HX8 A;  2A9U A;  3MAC A;  2X9X A;  2AXD S;  5ABG A;  1FMW A;  3TLV A;  4ZHQ E;  2DCF A;  4ZOL E;  3LK3 B;  1FMV A;  1XWM A;  4UF0 A;  4KBM B;  3Q5W A;  4HN9 A;  5EK4 A;  3EAB A;  3M3Z B;  3NBX X;  4O4I E;  4JI3 T;  2QVA A;  2M67 A;  5FYM A;  2VK9 A;  5L3D B;  3L8R A;  5JDF A;  3ZYM A;  4L0R A;  5ADX L;  3LDQ B;  3FXD B;  4P09 A;  2WS3 A;  3NRX A;  2CCQ A;  1Y01 A;  4UV9 B;  3RC8 A;  3PJA J;  4H9S E;  2X66 A;  2PFV A;  3J9X 1;  2K48 A;  3GN5 A;  2DNX A;  2VL8 A;  4HEA A;  2V7K A;  4KUM B;  4YTP A;  4AKL A;  3ONL C;  3J7Y q;  3ONJ A;  4AI6 A;  2N2N A;  4PJL A;  3CQG B;  3N9O A;  1IAP A;  2LOS A;  3MXZ A;  2V7L A;  4U31 A;  1O3X A;  3X1D A;  2E9X A;  5HXR A;  3FBZ A;  2MOZ A;  2B76 A;  3PJA A;  2CRB A;  4XAX B;  4K0U A;  1KNZ A;  3JC6 D;  4TNW A;  3ONX A;  3CIR A;  3N2G E;  3G06 A;  5KDM C;  4P0B A;  4O8S A;  5LNK A;  5DJQ C;  1VRB A;  2LM9 A;  2C5J A;  4DO0 A;  3ABV A;  3E0Z A;  2W4X A;  4UR9 A;  4DR5 T;  3P4P A;  3UT5 E;  2IIU A;  3AA1 B;  5FMN A;  4DV5 T;  3RKG A;  4X1Y E;  4QX7 B;  3ZSS A;  4K0K T;  4MFR A;  4A98 A;  2UXX B;  4TWF A;  3RQW A;  1ZOY A;  1KFY A;  2QYW A;  4AKH A;  3NZP A;  5IHY A;  3CQC B;  5JR9 B;  2WCA A;  4DR6 T;  1LVF A;  3C64 A;  4Z90 A;  2YU1 A;  3IF8 B;  3N2K E;  3K3N A;  1UX5 A;  4EB6 E;  4OK0 A;  4H9Q C;  4BAY B;  3N9L A;  4UF0 B;  4U74 A;  4GYS A;  4AIU A;  2WY2 A;  4NUV A;  2FBW A;  4YSY A;  3MK7 C;  4X20 E;  2ZM8 A;  5H6Q B;  5HWX A;  4EYY R;  2XAG B;  4Z8X A;  2HHH T;  2R6G F;  4HFC A;  4C91 A;  2HPJ A;  5LJM A;  2Y48 B;  1M62 A;  3F31 A;  4U33 A;  3Q9D A;  5DQW A;  2W63 A;  3TLT A;  3ETV A;  1J5W A;  3FZM B;  3W15 B;  3ZT7 A;  4DV1 T;  3FBL A;  2HPL A;  1S35 A;  3GN5 B;  2K5B B;  3FXE B;  2JRK A;  2CEA A;  4JI7 T;  4GOU A;  2HH7 A;  3AE9 A;  3ZKR A;  4JBW F;  1ZEE A;  4TV9 E;  3QK6 A;  5FY7 A;  3MKD A;  3UUM A;  3PE0 A;  4NPP A;  4HWC A;  2NW8 A;  1HNZ T;  2E9X B;  2FJB A;  2KWH A;  4DBQ A;  3BK9 A;  3O1H A;  4I0U A;  5CJ5 A;  1UUS A;  2YKS A;  3AEE A;  1KK7 A;  5JTG A;  3ZJ1 A;  4JLE A;  4CN1 A;  5AQL B;  4L9I A;  4DR2 T;  5KMG P;  5DQV A;  3KVB A;  3AE5 A;  2SPC A;  4IRE A;  4IL9 A;  2E5L T;  3MJX A;  5BMV E;  1UK5 A;  1T98 A;  1NEN A;  5FP3 A;  4GK5 E;  5ABE A;  5L3C B;  5HEG A;  3PUS A;  3LK4 2;  4X62 T;  3PDY A;  4PNI A;  3RYH E;  2X51 A;  5JDM A;  5LCY A;  4BJM A;  5JRC A;  5IUX A;  3PUZ F;  3ZYL A;  3B13 A;  5J0Z A;  2JMK A;  1FJG T;  4MBQ A;  2XUE A;  5ETW A; 
#chains in the Genus database with same CATH homology
 1WR0 A;  2CRB A;  4IT4 A;  1WFD A;  2DL1 A;  2WY2 A;  4U2Y A;  3ZT7 A;  2V6X A;  5LB7 B;  5CJ5 A;  2LRL A;  2V6Y A;  4A5X A;  1WCR A;  2RPA A;  4U7I A;  2JQH A;  2K3W A;  2V6Y B;  4U3C A;  2W2U A;  2A9U A;  4CN1 A;  5FVK A;  2CPT A;  5FVL A;  3ZST A;  4P1N A;  4CN4 A;  2JQ9 A;  2XZE A;  5CGM A;  4U31 A;  4CN6 A;  3ZSS A;  3K1S A;  4U2Z A;  4WZX A;  3ZT5 A;  4NIQ A;  4U33 A;  4U7Y A;  3ZT6 A;  2WWV A;  1YXR A;  4ZEY A;  3EAB A;  2LRK A;  2MPK A;  2JQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...