2DLBA

X-ray crystal structure of protein yopt from bacillus subtilis. northeast structural genomics consortium target sr412
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords yopT
publication title X-ray structure of hypothetical protein from Bacillus subtilis O34498 at the resolution of 1.2A. NESG target SR412
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09467 Yopt Hypothetical protein Yopt
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.330 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dlbA00
2DLBA
chains in the Genus database with same CATH superfamily
3MP9A 1IGDA 2E3TA 2DYMA 1WFYA 4EE2A 2XNAC 1M4VA 3AMZA 1K51A 1XO3A 4MDKE 2LRUA 1XEEA 1WGYA 4HDQA 2MSED 4FA6A 4JWUC 1FM0D 2ZVOA 4DWFA 4RGTA 3AU4A 1V97A 1UELA 1WF9A 3TMPB 3AXCA 5DPSA 5L95C 2O2VA 2RMMA 1D3ZA 2O2VB 1I4GA 4W9EA 4BKGA 2LASA 2KWUB 1E8ZA 3Q8EA 1TY0A 4GU2A 3R8BA 1KF6B 2KTRA 3QCAA 2KFKB 2KTRB 2BGFA 3KUZA 4AJWA 3BWUD 1HE8A 4EUTA 5FK9C 3NUHB 4I6PA 4LTUA 2MJEA 1YIWA 2KNBA 4K81A 2G4SA 3BY4B 4XC2A 4A8XC 2AL6A 1KM7A 2AQ1B 2L0TA 1PUTA 4DHJB 2PLPA 2MBEA 3PTFC 3AEDB 2V0GA 2LVOA 4P6VF 4EOYA 4X57B 2KFJA 1JRPA 3QA8A 2SAKA 3X0WA 2KDBA 1TZ1A 3DOWA 4OZBA 3S2AA 4OVZA 4IWPA 4J3OD 3HM6X 1TYGB 3HVDA 5IKCM 2KAJA 2Z0EB 4NAMA 2BWFA 2WHIA 1QZEA 2HJ1A 3FAHA 1I7HA 3JVZX 3IBEA 4ZHPA 1DOXA 2PPHA 4W9GA 2CU3A 3AU5A 2NBVB 1K53A 1AN8A 4AS1A 1WYGA 4KDIC 2JZ3B 1N60A 1ENFA 2JY6A 2DAJA 1KRHA 2D3BA 3WIMA 4ICVA 1UBQA 2L8JA 5IN7A 3CSTA 4CQNA 1WGRA 1OGWA 2MCNB 2NBWB 2R2OA 3AEFB 2JX5A 4WAAA 4RGMA 3VR8B 1UUPA 1GJZA 1D5MC 2W55A 1CJEA 4PYUA 1IYFA 3RFZB 1R4MI 4YSXB 3D32A 4GIVA 5G5HA 3VAWA 4YTPB 5FR3A 4WH4A 4JE3B 3AE1B 4ARCA 3VVWB 1DYQA 2ZCCA 2ON8A 2G9HD 2MQJA 2YVCA 3V60A 2GMIC 2LD9A 1E5WA 4P1CC 4BAXA 4OVVA 3NHEB 1HTQA 1YQBA 1XT9B 2WU5B 4LNIA 4II2B 3RNBC 4N9F4 4DK5A 1E7UA 2RDGA 5C1ZA 2DNFA 3LB8C 3WA0A 3EA6A 4HVBA 4GSWA 4BKTA 1I42A 4MH8A 3Q14C 4KIKA 1N62A 1MG4A 3TEYA 4KIKB 1V6EA 3P2BA 2WP9B 3QARA 3ZLZA 4GB9A 3LXFA 1ZGUB 5FR6A 3BZDB 4A20A 1YJIA 4FJYA 2LRWA 4RMAA 3B1LX 1XLQA 1N63A 4MGIE 3VH4B 2BYVE 3B2GA 3PPAA 3WALA 4US8A 1XLOA 4M0WA 1SE4A 1I4RA 4M0WB 3AEEB 4MGYE 2C7NB 1STEA 1PQSA 3TL5A 1Y56A 3BK1A 4WWPA 1L6UA 3AN1A 4AWJA 1UGJA 4IUMB 4KVGB 1RM6C 5G2NA 1YMHE 3T9LA 4HPMB 2ZNVC 4LJOB 1FNWA 1SE3A 5IO9A 1HQRD 4XX5A 1WY8A 2LGSA 5E6NA 3R2TA 3QJZA 3U52E 2JVCA 1EO6A 3ZGZA 4DXFA 1E8YA 3AE8B 1ESFA 4TUUA 2NS5A 1PDXA 2GBJA 1WXQA 2WDQB 2GBMA 3ZXVA 2N9KA 2O6VD 2HE7A 3ZYYX 3BYTB 1C4CA 3TSSA 3IXSA 1TS4A 1P7FA 2M8SA 1FRRA 1LO5D 3APDA 2C9WB 2JRHA 5KHQA 4BZAA 2BYTA 1VR9A 3H7PA 3GE3C 1DOYA 3PZ8A 3H7PB 2X38A 5BMHA 2LFIA 1ZDXA 4YXDB 3DWGC 3APFA 3MC0B 1Q10A 3SFEB 3B08A 2N7DA 4RNAA 3H1UA 1XLPA 4K7UA 3EFUA 3VH3B 2R61A 2NMQA 2XEWA 1VZ7A 5AUIA 2DENB 3ZDMC 3K9PB 4ACFA 3KH0A 2CJOA 1LXDA 2BWES 1QOAA 3AE4B 3L0WB 2LWPA 2JYTA 4YWGG 2Z59B 2WXMA 2NTTA 3P4PB 4E71A 2BQQA 2LGYA 3N20C 3ZUNA 4BKSD 2BKRB 3PRZA 2PE6B 4G11A 1WXAA 1T0YA 3Q3MC 1J19A 1UZXB 3ONSA 2VZKB 3GZNI 1SEBD 2A4ZA 4B0MA 2H89B 1RRBA 5CTRC 3VTUA 4ITKA 4OZAA 5LNK1 5H8YE 3ZRFA 1Y8RC 3IVFA 4W9CA 4AP4C 1JWUD 2PE9A 3NVVA 2GBKA 5E6OA 1EU3A 4TV3A 1SJHD 5IAAC 3I9V1 2KLCA 3PO0A 2FCQA 2KX0A 1GB4A 2CHXA 1QT9A 3Q3JA 1V9JA 2LVPA 1CZPA 2J0JA 2KOXA 3J9CA 2C60A 2L7RA 1GPXA 4GMVA 4XGAB 3Q8CA 3N9YC 3QAQA 5AZGA 2JYEA 4CYEA 3NG0A 3AB5A 2IGDA 1WE6A 3QC8B 2OEDA 3WANA 1TT5B 4C56C 4GLSC 3C8YA 2CU1A 2K3UA 4WWOA 2KLGA 1T0RC 5HG2A 1TY2A 3AE7B 2OJWA 3HIZA 4F7ZA 5BYSA 2WQYB 4C00A 2ZNVB 1P0RA 4W9JA 3KW5B 2E6XA 2N9LA 4PYZA 2LHEA 1NI3A 1P3QU 1Q0WB 4TSSA 4ANVA 1J7AA 1G6JA 2GLSA 3OLMD 1J7BA 3PGEA 1V5OA 3U7ZA 3VDZA 2N4FA 3NVYA 2FBWB 3H6NA 2BS3B 1SE9A 3AM9A 4K1RB 2K8BA 2PVOD 1WJ6A 4JWSC 3W1SA 4ANXA 1BUIC 3VRAB 2K0PA 3L16A 2KANA 4JQWC 4ZHOA 3Q8AA 2WGSA 4L23A 1J0GA 4MELA 2NBUA 5CHWA 2N0SB 1C4AA 4US9A 5CHFA 2DX5B 2WWZA 1AARA 4I6NB 2JQRB 1V2YA 1UF0A 3PVLA 4A9AA 1L4DB 4XWTA 4W9LA 3VTWA 1FPYA 2TSSA 1WGKA 5BMGA 4ARIA 1AYFA 2N9EB 1R4MB 3A4RA 3TEWA 3HHMA 4IWQA 3RD2A 3UI3A 3PZDA 4K3BA 3K9OB 4S0RA 5D94A 3UINB 2V4LA 1PFDA 1UGMA 2K8CA 3P4RB 4C4VA 3N32A 1YNTE 4C4VB 1YJ1A 3MHSD 2MHJA 1WXMA 4AOFA 3JSVB 4B9KA 4WJNA 1F52A 3AE9B 3DBHI 5TSSA 3VXWA 1D5XC 4CHKA 1JW9D 4IM3A 4M8NA 1DGJA 4WJPA 1FEHA 2CHWA 3KLSX 2C7MB 3P42A 5H92C 2LXCA 1GG3A 2LUMA 4HK2A 2MP2A 4A3PA 1FFUA 3CF6E 2MP2B 2IPKD 2N7EA 2D3GA 4ZRKA 3ZJTA 4B0EA 1ROEA 4ZYSA 2QIEB 1TGZB 2AWTA 2ZEQA 3HUIA 3IAM1 2RPQA 2UYZB 2ACZB 4FN2A 3R3MA 4GGQA 1V80A 2K25A 3TBLD 1V5TA 2BF8B 2G3QB 1XQQA 2GI9A 2I1JA 2QDFA 3NJTA 2KDIA 1BXTA 1WZ3A 2JUOA 4DBGA 3EGRA 4HCNB 1S3SG 2M56B 1YN4A 2RPVA 3DQVA 5E6PA 3OJ4B 1V86A 3A1QA 4WWNA 1V1PA 3VHTC 1WX9A 5LLIA 1V1PB 4HPLB 5IOIA 4DDID 2KXJA 2WXRA 3VUXA 4N58A 3PSEB 4RM8A 3A9JA 1XCTL 3A9JB 3M62B 1RFAA 4ZRIA 1QLBB 1ZXHA 1UBIA 3L54A 3V6CB 5DCNA 3AEBB 3LYYA 4CO7A 4DXAB 1VJKA 4M00A 4IW0A 3U30A 4A55A 1MG8A 2IY0B 3RMKC 4GDLA 2EKIA 4JPSA 4GDLB 1XF5L 2GOWA 3TEXA 1MFWA 2L05A 4YT0B 1E90A 3U8ZA 1UWXA 2WXQA 1P98A 3DDCB 5AZHA 2MEKA 4YTMB 3RZFA 2BT6A 2WS3B 1F2RI 2KD0A 3SHQA 1GOZA 5FKAC 3QX1A 3Q3NC 2M0XA 1V8CA 1AW7A 1ZP0B 1WI0A 3DPDA 4FBJB 3GB1A 1TZOA 2O6VA 2MBHA 1MHHE 2O6VB 1Z2MA 3RYTA 4MSQB 3AI5A 3Q3FA 1F0ZA 5GMVA 2KDFB 3MC9A 1MHXA 2D11A 2CJNA 2GB1A 1C77A 2IGGA 3PS6A 2WDRB 3E56A 3GP7A 2OOBB 4KKIA 2D2QA 4GXBA 2J0KA 4KGRA 1WRIA 1HA5A 2Y5PA 2G1EA 2W54A 3L10B 2XN9C 3HVZA 3ZO5B 2JWZA 1KOTA 2QEJC 3DBSA 1PGXA 1EWYC 3SU8X 2ZPNA 5DPWA 1N5WA 1WX7A 4KZ0A 1JCKB 1ISNA 1FNVA 1FXTB 1QOBA 2EELA 2WDVB 3HM3A 4A90A 4TKNA 2JXXA 2AEHA 1ET9A 1YJJA 5G55A 3GZNB 1QOGA 2KJHB 2BYEA 1L0XB 2D3CA 2OJRA 1V81A 2BW2A 2NTSA 4W9IA 2I38A 3NOBA 3DVGX 2WXLA 4DHJD 2XK5A 2L32A 2W82A 4H2AA 5EDSA 5HKHA 1WH3A 2Z0DB 4ZRPA 4ANWA 4BKSA 2BVCA 4NNJB 2KC2A 4G3XB 5D3DA 1C78A 2H88B 2DAFA 3VUYA 3Q6BA 2FIFA 3BINA 1KH0A 3ETRA 2KQ7A 1YQ3B 1ZOYB 3ML8A 1E8XA 1RYJA 3AE3B 3AE6B 2SEBD 4RGOS 4K3CA 3URYA 2JU6X 4G0NB 4A3OA 4EZJA 4MH0E 3SDLC 4KV2A 4P16A 2KWCA 1TKEA 2IO1B 3E9SA 1TBEA 3W1SC 3FKYA 1SE2A 4M02A 1WMHA 2WXHA 4W9FA 1WMHB 2J0MA 3PZ7A 4USAA 4IG7B 4FHKA 1L2NA 2EMTA 4MM3A 1GC6A 3DCGA 3MTNB 4MM3B 1IBXA 3FILA 1PGAA 2V3NA 3CSFA 1IBXB 3FILB 3ZNID 2Z8LA 4GN1A 1MJDA 4GDKA 1AWDA 1GNUA 3P1MA 4GDKB 1QILA 2LGDA 3ZVVA 3UGBB 4L2YA 2Y5CA 1BT0A 5EE0A 3PRMB 4PS8A 4S17A 1F9JA 1VRAB 3ZJVA 1PGBA 2ICIA 2N9PC 2PIAA 4ICUA 4PK1A 2G45B 2N1VA 2N1WA 3KWVA 1WGDA 2PJHA 2KACA 4LJPB 2QSDA 1KFYB 3GOEA 2R2QA 4LNOA 4MJSA 1WM3A 3NVWA 4MJSB 3RN9C 2FAZA 1CK1A 1X1MA 2KJRA 2WU2B 1HZ6A 5TR5A 2ZJDA 4L1BA 2V3SA 5JHAA 3Q3OC 4KGSA 3Q8FA 4KZCA 3KYCD 2MX2A 2YEPF 2KN4A 2DZJA 3A4SC 4KGTA 1SSNA 2OHFA 1JALA 2K6QA 1FCCC 4OHJA 4NJ7A 3AEAB 1D5ZC 2L76A 3ZXRA 2G4DB 2ZW0A 4IM2A 3KUCB 3MJWA 2DZMA 3HRDD 4JL9A 4HKZE 1ZE3D 3EHVA 1PYWD 1GAQB 3VQIA 3DBHB 3UIPB 2J52A 3W5VB 3Q8BA 4BFRA 2IY1B 1T5XD 1C9FA 4AJYB 2CS4A 3TJPA 1C4PA 1ACCA 2ZCBA 4YSZB 1WM2A 4DDGD 3MHZA 4HRSA 3NS8A 3P4QB 4BBNF 1E7PB 1VLBA 4FLHA 4FADA 2FUG1 2MWSB 4B6WA 1MPEA 4HEA1 1KLVA 4ANUA 3ZNGC 4REZA 1HXYD 1Q5WB 3VTVA 2L83A 1S1QB 2D5GA 4K7SA 1TS5A 3NVZA 1WSPA 1WZ0A 2JF5A 2AQ3B 3O13A 1YX5B 1UD7A 2KX3A 2HTHA 2JRIB 2K5PA 3ML9A 1U4AA 2FCSA 2INPE 2JPHA 4DQOC 4WJQA 1JMLA 4RF1A 4HDOA 2AX5A 1R7SA 1RWSA 4LCDE 4JX1C 2KMAA 3R2IA 1SB3C 1ZPSA 4OVUA 1HEZE 2WXNA 5T8IA 3RT3B 1JWBD 3IHPC 2PW9A 1IP9A 4ZRQA 4IC7B 2DYBA 3C0RB 2J4XA 4B95A 4BOSC 3AV8A 1WRDB 3PT2B 2LJIA 1D6EC 2YLMA 2L52A 5J18A 1V1OA 4LNKA 2FCNA 3VUWA 1YX6B 1WR6E 2QMTA 4F1SA 3AH7A 1WYWB 1KLUD 3PLUA 4LNFA 4TMAB 4PT5A 4EZLA 4W9HA 2PTLA 3N30A 3PHWB 3N1ZC 4RGNA 2IGHA 5L83A 4FHJA 2D10A 2WXPA 3DBRI 2M0AA 3RNFC 2EKEC 4EFOA 4N59A 2LGXA 3DHHC 5GXGB 3QQ8B 4HJKA 4RFBA 3A9KA 1FMAD 3EFCA 3A9KB 4TQ1A 3R66C 4K7WA 2LHDA 1QKZA 3DVNU 5IA7A 5JXVA 3ZNHB 2JT4B 2EMSA 2L1AA 2Y3AA 3AE2B 3KQ4A 2KT7A 2KYWA 2NPTA 2NPTB 2WXIA 1C79A 1WGGA 3RI7C 1K52A 4WJOA 3GS2A 5J2RA 1LGRA 3OAWA 1TTNA 2LVQA 3AEGB 1L7YA 3LDZE 4II3B 2KHWB 4PS7A 4IOIE 2VZKD 1WJ4A 4BBNC 4XWWA 3QK0A 2WX1A 1TKGA 1CQVA 3RCZA 5AEKB 5BYRA 1ZKHA 2MBOA 4NZLB 3M63B 4DXGA 1MI0A 2X8XX 2PKOA 1ZXIA 1FNUA 3RNGC 2MH7A 3WAOA 1JRUA 1FRDA 1H8CA 3W9CB 2Y5BB 1XLNA 4W9KA 3DBLI 1SJED 1FFVA 2GBNA 4XE0A 4XZ4A 2KVRA 3AECB 1R4NI 3DVGY 2M19A 4W9DA 4FJZA 3NS1A 2ZVNA 4Q2JA 2PEAA 1YN5A 1P7EA 3W5UB 1L4ZB 1NI2A 3CIRB 4LNNA 1WR1A 2KN5A 3IT4B 3BIID 3ZTCA 2MJ3A 2V9HA 2IZVB 3X23A 2N9XA 4OZCA 4C80A 3VFKA 2IO0B 2IO3B 2XBBC 4LDTD 3I5JC 3H7SA 1P1AA 4KDLB 4WQOB 3BK2A 1VD2A 5HFYA 3QWZB 2BKFA 1EF1A 3CMMB 4WAFA 2FUHB 4FJVB 2KFKA 4YL8A 2VRRB 1WJNA 1TIFA 1FIQA 3A1QB 4MGZE 1EWCA 2KQ4X 5J17A 3PRPB 4HROA 1KLGD 4QAYA 3RZWC 2ZZPB 1OEYA 2CHZA 2AYOB 2GRIA 3WCQA 2RR9A 4F8CB 2CR5A 2J53A 5G5GA 4WWMA 3N1YC 4FULA 2DBYA 2RGFA 4AUQC 2ZPYA 4NY0A 1JWMD 1L0YB 3H8HA 5IP4D 5AZFA 2KO3A 5C3JB 5HI1A 3WAMA 1E8WA 5CHVC 3U2SC 3BVGA 3ZQ4A 1TS3A 1I4PA 1EM7A 2MBBB 4I6LB 2LZ6A 2WNMA 2JZZA 4UDUC 1SF0A 2JZPA 3DVNV 1ZUD2 1LM8B 3TEZA 1SBBB 4ZRJA 2WXFA 3U7DA 4XDDA 1P9DU 4OW0A 1A70A 2KDMA 2RD0A 2JWUA 2YEPB 5AUKA 1T3QA 1FO4A 1RAXA 5D3IB 2AQ2B 3QIJA 2KMMA 1IUEA 1TKYA 1SIJA 3M95A 3T3OA 1NYQA 1M94A 2ZW1A 1I4XA 2IDYA 4TQ0A 4IDIA 4MGKE 1T0QC 3W1YA 4WIPA 4YSYB 4KKJA 1QQRA 2DZIA 3KVFB 4BOZB 4J6IA 4PS3A 1WJUA 3NRZA 5HHDG 3KUDB 2RDBC 3NZ3A 4FXCA 3RNCC 1QOFA 1C76A 4BVUC 5MPOA 1FXAA 1E7VA 4EEWA 1WX8A 2I1KA 3PHXB 1UWMA 2WLBA 4LLGM 1ET6A 3VRBB 2RSUA 2BS4B 4R3DA 4A6QA 1J7CA 1E9MA 3ENEA 3OG5A 3SD5A 2CKHB 2BBCA 5BMIA 1T6BX 2VH1A 2BYFA 2XK5B 3DWMA 1IPGA 2K6DB 2KDEB 4DHZE 1OFFA 1ZDVA 3ZJUA 3PREA 1WE7A 2D07B 1SIFA 3EECA 3UQAA 5BYQA 2KZRA 3C19A 3TIXA 3CWIA 5CX3A 4IM0A 3BYYB 2MLBA 1L0VB 2V4IB 5JHBA 2ONQA 3I57A 1E10A 2LMCA 3KYDD 3RPFC 2KMCA 2W3SA 2Q5WD 3NZSA 4MT5A 2LEKA 4RM9A 1WXVA 4NAWA 2IO2B 4NAWB 4KX6B 1YQ4B 1OQYA 2V3PA 3RULA 2DLBA 2WXOA 3RNEC 3L13A 3EC8A 3V62A 2L0FA 4IWOA 2RDHA 1F2RC 1K50A 3W2DA 3FC4A 1V49A 4MSMB 3OWEB 5DPTA 2AL3A 2MA9B 4HLEA 4IKGA 5JZEB 3T8MA 3LJ3A 2BTEA 2M17A 3SEBA 1OEYJ 3MC8A 3B9JA 2BB5A 3OJ3A 4HKQA 1E6EB 1IGCA 1CMXB 2L3ZA 3H9DA 1L6VA 3A33B 2BB6A 3IAS1 5D6JB 2ASQA 3L17A 3DBRB 1N61A 4MEMA 4P7IA 2DHZA 3GE8C 3JYUA 3V6EB 1VDVA 2REXA 3R7QA 5D7GA 4NPNA 2V1YA 4YTNB 1FXIA 3AE5B 2UWQA 3SFDB 2L00B 3AULA 4WQMA 4E74A 2GBRA 4EKUA 1BMLC 1VZ8A 2DZKA 3ABVB 4ZOHC 2C5LC 2FE8A 4HXDA 2HDEA 2NR2A 3SR6A 3B2FA 1GUAB 4JGHB 3ZTDA 3BVZA 2QC8A 4MACA 1UNSA 1WWTA 3ZKJC 4AQ7A 5I4DA 2PMVA 4RH6A 1VCBA 1B9RA 4JLCA 4NQLB 2LI5A 3MJ5A 3V61A 2BS2B 2K9XA 3RNAC 1OQRA 2IBIB 1MVKA 1N5XA 1WGHA 4URKA 1HTOA 1KJTA 2KWVB 2KK8A 1SXTA 1H4RA 2MRPA 3MFGA 2KJ6A 4ASWC 3UF8A 2WYQA 3IFWB 3QHTA 2B76B 5DPRA 4WURA 1WXSA 3WAPA 1LFDA 3ZRCA 1KTKA 1DOIA 2KWDA 1C3TA 4O1NA 4M8MA 4KSKC 2INCC 5C2TB 1VZ6A 4RF0A 5BO4B 1I35A 4D2KA 2WXKA 2N7JA 2J42A 2C7HA 3HK0A 1J8CA 3DBLB 3JW0X 1F1HA 2WDTB 1R4NB 3B0AA 3V05A 3APCA 1NVID 2A5UA 1UH6A 1GB1A 5E6JA 1A5RA 4ZDVA 2M1MA 1JWAD 1FD6A 4JIOU 1LQBA 3TCAA 3M3JA 3VR9B 2KQSA 3UIOB 3BVMA 1FCLA 2KTFA 4C7ZA 2K1FA 5JH5C 3IG3A 5EE9A 3T3NA 1YN3A 1XCQL 3V3XA 2D3AA 1OQQA 4RCOA 1NBFC 3DHIC 1N6ZA 4HCPB 3Q69A 2IYDB 2JSVX 4XYCA 4N6EB 1TJEA 2K39A 2FIDA 2QILA 2LUEA 3N3KB 2LJ5A 3PLVA 4HPPA 3L08A 4E3CA 2FNJB 4NJCA 1I4QA 2W3RA 4ZYNA 2WX0A 4M01A 3N1XC 2NVUI 4NJ6A 3U4EG 1JQ4A 5KHOA 3ZIMA 1NENB 2JXTA 1OTRB 3P63A 3TUOA 1B1ZA 3ZDTA 2IJ0A 2MJDA 2BPSA 4HJGE 5EE1A 2KVZA 4LDTB 3NZUA 2NCNA 3ALBA 1NEKB 2DWQA 1I4HA 2WXGA 1L5PA 1GC7A 2W9NA 1JROA 2HD5B 2M4NA 3O65B 1EUVB 4P1BC 2MBQA 2HTME 4EZKA 1K8RB 2DYOA 2HJ8A 1ZW7A 3P4SB 4HWIB 1E0ZA 3UQBA 3R7RA 2QCZA 1C1YB 4LK0M 4DHZB 1XXGA 2UU7A 2I2YA 1HZ5A 2INNE 2INDC 3ECIA 2PVGC 3PV1A 1YOVB 3ZW3A 2LXAA 3I63C 1TS2A 1EF5A 3I3TB 3RUIB 1SGHA 2K22A 4KSLC 4NQKE 4GOCA 2FCMA 1RFKA 2QHOA 2VH2A 3L4PA 1NYRA 1EU4A 1JWSD 5LXIB 3ZNZB 1D4BA 5LXHA 3IT6B 2K8HA 1Q1OA 1YD8U 1QF6A 1F77A 2KKCA 4XDCA 1T0SC 2QJLA 2MW5A 1XD3B 1WIAA 3KWLA 2B3AA 5EE3A 2LGIA 3Q2AC 3EUB2 1Z5SB 1NDDA 3DHGC 2WXJA 3JSVA 4G50A 5C23A 5D2MB 2KC1A 3NY5A 1RLFA 4C7YA 2J7QB
chains in the Genus database with same CATH topology
3MP9A 5D3IB 1IGDA 4MM3B 3FILA 1PGAA 2E3TA 1CZPA 2DYMA 2AQ2B 3J9CA 1IBXA 2KMMA 2V3NA 2XNAC 4EE2A 1M4VA 3FILB 3AMZA 1IBXB 1GPXA 1K51A 1XO3A 2Z8LA 3Q8CA 3N9YC 2JYEA 1IUEA 1TKYA 1SIJA 1XEEA 1AWDA 3P1MA 3AB5A 4JWUC 4GDKB 1FM0D 2IGDA 3T3OA 1NYQA 1QILA 2ZW1A 2OEDA 4RGTA 1V97A 4C56C 4GLSC 3C8YA 1I4XA 4L2YA 2IDYA 2Y5CA 4TQ0A 4IDIA 5EE0A 2K3UA 2RMMA 4WIPA 1VRAB 3ZJVA 1PGBA 2ICIA 2PIAA 5HG2A 1I4GA 1TY2A 4KKJA 4YSYB 3AE7B 1QQRA 5BYSA 2WQYB 3KWVA 2E6XA 2KACA 2N9LA 3Q8EA 2LHEA 1NI3A 1TY0A 2QSDA 1KFYB 3NRZA 5HHDG 3R8BA 3NZ3A 4FXCA 1KF6B 1QOFA 4TSSA 3NVWA 1C76A 5MPOA 1J7AA 1J7BA 1FXAA 3U7ZA 1CK1A 1UWMA 2WU2B 1HZ6A 2WLBA 4LLGM 3NVYA 1ET6A 4L1BA 2FBWB 3BWUD 4KGSA 5FK9C 3Q8FA 3VRBB 3NUHB 2BS3B 3AM9A 2YEPF 2BS4B 2KN4A 2MJEA 2PVOD 4LTUA 4R3DA 4A6QA 4JWSC 3W1SA 1J7CA 1E9MA 1BUIC 4A8XC 2AQ1B 4KGTA 1PUTA 2PLPA 3VRAB 1SSNA 2OHFA 1JALA 2BBCA 2K0PA 5BMIA 1T6BX 3AEDB 2V0GA 1FCCC 4OHJA 4ZHOA 3Q8AA 3AEAB 3DWMA 1D5ZC 4L23A 4P6VF 1OFFA 1ZDVA 3ZJUA 1JRPA 2ZW0A 2SAKA 2N0SB 1C4AA 4US9A 3HRDD 4HKZE 1ZE3D 4OZBA 5BYQA 1PYWD 1GAQB 4OVZA 3CWIA 3VQIA 2JQRB 4A9AA 4J3OD 3BYYB 1L4DB 4XWTA 1L0VB 2J52A 1TYGB 2V4IB 2ONQA 3HVDA 3I57A 3Q8BA 3W5VB 1E10A 1T5XD 1C9FA 2LMCA 2KAJA 2TSSA 1WGKA 4NAMA 3RPFC 1C4PA 1ACCA 2W3SA 2Q5WD 4MT5A 4YSZB 2LEKA 5BMGA 4ARIA 3MHZA 1AYFA 3FAHA 1I7HA 4ZHPA 4HRSA 1DOXA 3TEWA 3P4QB 4NAWB 4KX6B 2CU3A 1E7PB 3UI3A 1VLBA 1YQ4B 2V3PA 2FUG1 2DLBA 1K53A 2WXOA 1PFDA 1AN8A 3P4RB 4AS1A 1WYGA 1YNTE 1N60A 1MPEA 1ENFA 1KRHA 4HEA1 4REZA 1HXYD 2RDHA 1F2RC 1K50A 3W2DA 3FC4A 4CQNA 2L83A 2D5GA 1TS5A 3NVZA 1WSPA 3OWEB 4IKGA 2AQ3B 3O13A 3AEFB 2JX5A 2BTEA 3AE9B 3SEBA 5TSSA 4RGMA 3B9JA 2BB5A 2K5PA 1D5XC 4HKQA 1E6EB 1IGCA 3VR8B 1UUPA 1L6VA 1D5MC 1JW9D 2BB6A 2W55A 1CJEA 1DGJA 2INPE 4DQOC 3RFZB 3IAS1 1JMLA 4RF1A 1FEHA 3KLSX 2AX5A 1R7SA 1RWSA 3P42A 4YSXB 4JX1C 3R2IA 1N61A 5G5HA 4YTPB 5H92C 1SB3C 5FR3A 4WH4A 4JE3B 1ZPSA 3AE1B 1VDVA 1HEZE 2LUMA 2WXNA 4ARCA 1DYQA 5D7GA 5T8IA 1FFUA 4YTNB 1FXIA 2IPKD 2ON8A 3AE5B 2G9HD 1JWBD 3ZJTA 4B0EA 3SFDB 2PW9A 4WQMA 4ZRQA 1ROEA 4ZYSA 1BMLC 2J4XA 2QIEB 1VZ8A 3AV8A 2LJIA 3HUIA 1D6EC 2L52A 3IAM1 1V1OA 3ABVB 2WU5B 2ACZB 4ZOHC 2FE8A 2QMTA 2HDEA 3AH7A 1KLUD 3SR6A 3B2FA 4TMAB 4PT5A 2RDGA 3BVZA 4MACA 3LB8C 1UNSA 3EA6A 1WWTA 2PTLA 2GI9A 4AQ7A 5I4DA 2PMVA 4RGNA 2IGHA 4RH6A 1BXTA 1B9RA 3EGRA 4MH8A 2WXPA 2M56B 1N62A 1YN4A 2RPVA 3TEYA 2M0AA 3MJ5A 4N59A 2WP9B 2BS2B 2K9XA 1V1PA 1OQRA 3LXFA 1MVKA 1N5XA 5GXGB 3BZDB 1V1PB 4RFBA 1SXTA 1YJIA 1FMAD 2WXRA 3MFGA 4TQ1A 4N58A 1XLQA 1N63A 2B76B 2LHDA 4WURA 4US8A 3B2GA 1QKZA 1XLOA 1XCTL 4M0WA 1SE4A 1KTKA 1DOIA 2KWDA 1QLBB 5JXVA 1I4RA 1ZXHA 4O1NA 2L1AA 3AEEB 2Y3AA 5C2TB 1VZ6A 3AE2B 3AEBB 3KQ4A 4RF0A 3LYYA 1STEA 1VJKA 1Y56A 2WXKA 2N7JA 4D2KA 2J42A 3BK1A 1L6UA 4A55A 2WXIA 1C79A 3AN1A 1K52A 1UGJA 3GS2A 2EKIA 4JPSA 4GDLB 1XF5L 1RM6C 3V05A 1YMHE 3TEXA 1NVID 4YT0B 1UWXA 2WXQA 1GB1A 5E6JA 3AEGB 1FNWA 1SE3A 2MEKA 4YTMB 1JWAD 1FD6A 1HQRD 2BT6A 2WS3B 1F2RI 2VZKD 4IOIE 3VR9B 3BVMA 3R2TA 1FCLA 1GOZA 4XWWA 4C7ZA 5FKAC 1TKGA 1CQVA 3U52E 3ZGZA 1V8CA 5BYRA 5EE9A 4DXFA 1AW7A 3T3NA 1ZP0B 1YN3A 1XCQL 4NZLB 3AE8B 1ESFA 3V3XA 4DXGA 1MI0A 2PKOA 1ZXIA 1OQQA 4RCOA 1FNUA 1PDXA 2MH7A 3GB1A 3Q69A 1WXQA 2JSVX 1FRDA 1TZOA 1TJEA 4N6EB 3W9CB 2WDQB 1MHHE 1XLNA 2N9KA 1SJED 2QILA 3ZYYX 3BYTB 1FFVA 4XE0A 1C4CA 3TSSA 3AECB 3IXSA 1TS4A 2M19A 1F0ZA 1P7FA 1FRRA 1LO5D 3NS1A 1I4QA 4NJCA 1MHXA 4Q2JA 2CJNA 2GB1A 2W3RA 1C77A 1YN5A 2BYTA 2IGGA 2WDRB 3E56A 1VR9A 1P7EA 3GP7A 3U4EG 3W5UB 1L4ZB 1JQ4A 1DOYA 4KKIA 3CIRB 3PZ8A 2X38A 5BMHA 2LFIA 3IT4B 4KGRA 1ZDXA 1WRIA 4YXDB 1HA5A 3BIID 2Y5PA 1NENB 2G1EA 2JXTA 2MJ3A 3DWGC 2W54A 3P63A 3TUOA 2XN9C 1B1ZA 3HVZA 3MC0B 1Q10A 2IJ0A 3SFEB 2MJDA 2QEJC 4HJGE 4RNAA 5EE1A 1PGXA 1XLPA 4OZCA 4C80A 2R61A 2NMQA 1EWYC 1NEKB 2DWQA 1I4HA 1VZ7A 2WXGA 1L5PA 1N5WA 3BK2A 5AUIA 5HFYA 1JCKB 1FNVA 1JROA 1QOBA 4WAFA 2EELA 2WDVB 4A90A 2HTME 1ET9A 2DYOA 1YJJA 2CJOA 3P4SB 1FIQA 1QOGA 1EWCA 1L0XB 2KQ4X 1E0ZA 1QOAA 4HROA 3AE4B 1KLGD 2JYTA 2BW2A 4YWGG 4LK0M 1XXGA 2NTSA 2WXMA 2GRIA 2I38A 2NTTA 3WCQA 2I2YA 1HZ5A 3P4PB 2WXLA 2INNE 2J53A 2L32A 2W82A 4H2AA 5G5GA 4ZRPA 2PVGC 4WWMA 2DBYA 1TS2A 5D3DA 1C78A 2H88B 2K22A 1JWMD 1L0YB 3H8HA 1RFKA 3L4PA 1KH0A 1NYRA 1EU4A 1JWSD 3ETRA 5C3JB 1YQ3B 1ZOYB 1D4BA 5HI1A 1RYJA 2VZKB 3IT6B 3AE3B 3U2SC 1SEBD 2SEBD 3AE6B 4RGOS 3BVGA 4B0MA 2H89B 3ZQ4A 1TS3A 1I4PA 4ITKA 4OZAA 1EM7A 5LNK1 1QF6A 3URYA 1F77A 2JU6X 4XDCA 5H8YE 2WNMA 2QJLA 4UDUC 1SF0A 1JWUD 2JZPA 3NVVA 3KWLA 4P16A 1TKEA 1EU3A 1ZUD2 3TEZA 3E9SA 2LGIA 5EE3A 1SBBB 1SJHD 3EUB2 1SE2A 3I9V1 2WXFA 2WXHA 3PO0A 4XDDA 4OW0A 3PZ7A 1A70A 2KDMA 2WXJA 4USAA 2JWUA 2YEPB 1GB4A 4C7YA 5AUKA 1QT9A 1T3QA 1FO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLB A; 
#chains in the Genus database with same CATH topology
 3MP9 A;  1IGD A;  2E3T A;  2DYM A;  1WFY A;  4EE2 A;  2XNA C;  1M4V A;  3AMZ A;  1K51 A;  1XO3 A;  4MDK E;  2LRU A;  1XEE A;  1WGY A;  4HDQ A;  2MSE D;  4FA6 A;  4JWU C;  1FM0 D;  2ZVO A;  4DWF A;  4RGT A;  3AU4 A;  1V97 A;  1UEL A;  1WF9 A;  3TMP B;  3AXC A;  5DPS A;  5L95 C;  2O2V A;  2RMM A;  1D3Z A;  2O2V B;  1I4G A;  4W9E A;  4BKG A;  2LAS A;  2KWU B;  1E8Z A;  3Q8E A;  1TY0 A;  4GU2 A;  3R8B A;  1KF6 B;  2KTR A;  3QCA A;  2KFK B;  2KTR B;  2BGF A;  3KUZ A;  4AJW A;  3BWU D;  1HE8 A;  4EUT A;  5FK9 C;  3NUH B;  4I6P A;  4LTU A;  2MJE A;  1YIW A;  2KNB A;  4K81 A;  2G4S A;  3BY4 B;  4XC2 A;  4A8X C;  2AL6 A;  1KM7 A;  2AQ1 B;  2L0T A;  1PUT A;  4DHJ B;  2PLP A;  2MBE A;  3PTF C;  3AED B;  2V0G A;  2LVO A;  4P6V F;  4EOY A;  4X57 B;  2KFJ A;  1JRP A;  3QA8 A;  2SAK A;  3X0W A;  2KDB A;  1TZ1 A;  3DOW A;  4OZB A;  3S2A A;  4OVZ A;  4IWP A;  4J3O D;  3HM6 X;  1TYG B;  3HVD A;  5IKC M;  2KAJ A;  2Z0E B;  4NAM A;  2BWF A;  2WHI A;  1QZE A;  2HJ1 A;  3FAH A;  1I7H A;  3JVZ X;  3IBE A;  4ZHP A;  1DOX A;  2PPH A;  4W9G A;  2CU3 A;  3AU5 A;  2NBV B;  1K53 A;  1AN8 A;  4AS1 A;  1WYG A;  4KDI C;  2JZ3 B;  1N60 A;  1ENF A;  2JY6 A;  2DAJ A;  1KRH A;  2D3B A;  3WIM A;  4ICV A;  1UBQ A;  2L8J A;  5IN7 A;  3CST A;  4CQN A;  1WGR A;  1OGW A;  2MCN B;  2NBW B;  2R2O A;  3AEF B;  2JX5 A;  4WAA A;  4RGM A;  3VR8 B;  1UUP A;  1GJZ A;  1D5M C;  2W55 A;  1CJE A;  4PYU A;  1IYF A;  3RFZ B;  1R4M I;  4YSX B;  3D32 A;  4GIV A;  5G5H A;  3VAW A;  4YTP B;  5FR3 A;  4WH4 A;  4JE3 B;  3AE1 B;  4ARC A;  3VVW B;  1DYQ A;  2ZCC A;  2ON8 A;  2G9H D;  2MQJ A;  2YVC A;  3V60 A;  2GMI C;  2LD9 A;  1E5W A;  4P1C C;  4BAX A;  4OVV A;  3NHE B;  1HTQ A;  1YQB A;  1XT9 B;  2WU5 B;  4LNI A;  4II2 B;  3RNB C;  4N9F 4;  4DK5 A;  1E7U A;  2RDG A;  5C1Z A;  2DNF A;  3LB8 C;  3WA0 A;  3EA6 A;  4HVB A;  4GSW A;  4BKT A;  1I42 A;  4MH8 A;  3Q14 C;  4KIK A;  1N62 A;  1MG4 A;  3TEY A;  4KIK B;  1V6E A;  3P2B A;  2WP9 B;  3QAR A;  3ZLZ A;  4GB9 A;  3LXF A;  1ZGU B;  5FR6 A;  3BZD B;  4A20 A;  1YJI A;  4FJY A;  2LRW A;  4RMA A;  3B1L X;  1XLQ A;  1N63 A;  4MGI E;  3VH4 B;  2BYV E;  3B2G A;  3PPA A;  3WAL A;  4US8 A;  1XLO A;  4M0W A;  1SE4 A;  1I4R A;  4M0W B;  3AEE B;  4MGY E;  2C7N B;  1STE A;  1PQS A;  3TL5 A;  1Y56 A;  3BK1 A;  4WWP A;  1L6U A;  3AN1 A;  4AWJ A;  1UGJ A;  4IUM B;  4KVG B;  1RM6 C;  5G2N A;  1YMH E;  3T9L A;  4HPM B;  2ZNV C;  4LJO B;  1FNW A;  1SE3 A;  5IO9 A;  1HQR D;  4XX5 A;  1WY8 A;  2LGS A;  5E6N A;  3R2T A;  3QJZ A;  3U52 E;  2JVC A;  1EO6 A;  3ZGZ A;  4DXF A;  1E8Y A;  3AE8 B;  1ESF A;  4TUU A;  2NS5 A;  1PDX A;  2GBJ A;  1WXQ A;  2WDQ B;  2GBM A;  3ZXV A;  2N9K A;  2O6V D;  2HE7 A;  3ZYY X;  3BYT B;  1C4C A;  3TSS A;  3IXS A;  1TS4 A;  1P7F A;  2M8S A;  1FRR A;  1LO5 D;  3APD A;  2C9W B;  2JRH A;  5KHQ A;  4BZA A;  2BYT A;  1VR9 A;  3H7P A;  3GE3 C;  1DOY A;  3PZ8 A;  3H7P B;  2X38 A;  5BMH A;  2LFI A;  1ZDX A;  4YXD B;  3DWG C;  3APF A;  3MC0 B;  1Q10 A;  3SFE B;  3B08 A;  2N7D A;  4RNA A;  3H1U A;  1XLP A;  4K7U A;  3EFU A;  3VH3 B;  2R61 A;  2NMQ A;  2XEW A;  1VZ7 A;  5AUI A;  2DEN B;  3ZDM C;  3K9P B;  4ACF A;  3KH0 A;  2CJO A;  1LXD A;  2BWE S;  1QOA A;  3AE4 B;  3L0W B;  2LWP A;  2JYT A;  4YWG G;  2Z59 B;  2WXM A;  2NTT A;  3P4P B;  4E71 A;  2BQQ A;  2LGY A;  3N20 C;  3ZUN A;  4BKS D;  2BKR B;  3PRZ A;  2PE6 B;  4G11 A;  1WXA A;  1T0Y A;  3Q3M C;  1J19 A;  1UZX B;  3ONS A;  2VZK B;  3GZN I;  1SEB D;  2A4Z A;  4B0M A;  2H89 B;  1RRB A;  5CTR C;  3VTU A;  4ITK A;  4OZA A;  5LNK 1;  5H8Y E;  3ZRF A;  1Y8R C;  3IVF A;  4W9C A;  4AP4 C;  1JWU D;  2PE9 A;  3NVV A;  2GBK A;  5E6O A;  1EU3 A;  4TV3 A;  1SJH D;  5IAA C;  3I9V 1;  2KLC A;  3PO0 A;  2FCQ A;  2KX0 A;  1GB4 A;  2CHX A;  1QT9 A;  3Q3J A;  1V9J A;  2LVP A;  1CZP A;  2J0J A;  2KOX A;  3J9C A;  2C60 A;  2L7R A;  1GPX A;  4GMV A;  4XGA B;  3Q8C A;  3N9Y C;  3QAQ A;  5AZG A;  2JYE A;  4CYE A;  3NG0 A;  3AB5 A;  2IGD A;  1WE6 A;  3QC8 B;  2OED A;  3WAN A;  1TT5 B;  4C56 C;  4GLS C;  3C8Y A;  2CU1 A;  2K3U A;  4WWO A;  2KLG A;  1T0R C;  5HG2 A;  1TY2 A;  3AE7 B;  2OJW A;  3HIZ A;  4F7Z A;  5BYS A;  2WQY B;  4C00 A;  2ZNV B;  1P0R A;  4W9J A;  3KW5 B;  2E6X A;  2N9L A;  4PYZ A;  2LHE A;  1NI3 A;  1P3Q U;  1Q0W B;  4TSS A;  4ANV A;  1J7A A;  1G6J A;  2GLS A;  3OLM D;  1J7B A;  3PGE A;  1V5O A;  3U7Z A;  3VDZ A;  2N4F A;  3NVY A;  2FBW B;  3H6N A;  2BS3 B;  1SE9 A;  3AM9 A;  4K1R B;  2K8B A;  2PVO D;  1WJ6 A;  4JWS C;  3W1S A;  4ANX A;  1BUI C;  3VRA B;  2K0P A;  3L16 A;  2KAN A;  4JQW C;  4ZHO A;  3Q8A A;  2WGS A;  4L23 A;  1J0G A;  4MEL A;  2NBU A;  5CHW A;  2N0S B;  1C4A A;  4US9 A;  5CHF A;  2DX5 B;  2WWZ A;  1AAR A;  4I6N B;  2JQR B;  1V2Y A;  1UF0 A;  3PVL A;  4A9A A;  1L4D B;  4XWT A;  4W9L A;  3VTW A;  1FPY A;  2TSS A;  1WGK A;  5BMG A;  4ARI A;  1AYF A;  2N9E B;  1R4M B;  3A4R A;  3TEW A;  3HHM A;  4IWQ A;  3RD2 A;  3UI3 A;  3PZD A;  4K3B A;  3K9O B;  4S0R A;  5D94 A;  3UIN B;  2V4L A;  1PFD A;  1UGM A;  2K8C A;  3P4R B;  4C4V A;  3N32 A;  1YNT E;  4C4V B;  1YJ1 A;  3MHS D;  2MHJ A;  1WXM A;  4AOF A;  3JSV B;  4B9K A;  4WJN A;  1F52 A;  3AE9 B;  3DBH I;  5TSS A;  3VXW A;  1D5X C;  4CHK A;  1JW9 D;  4IM3 A;  4M8N A;  1DGJ A;  4WJP A;  1FEH A;  2CHW A;  3KLS X;  2C7M B;  3P42 A;  5H92 C;  2LXC A;  1GG3 A;  2LUM A;  4HK2 A;  2MP2 A;  4A3P A;  1FFU A;  3CF6 E;  2MP2 B;  2IPK D;  2N7E A;  2D3G A;  4ZRK A;  3ZJT A;  4B0E A;  1ROE A;  4ZYS A;  2QIE B;  1TGZ B;  2AWT A;  2ZEQ A;  3HUI A;  3IAM 1;  2RPQ A;  2UYZ B;  2ACZ B;  4FN2 A;  3R3M A;  4GGQ A;  1V80 A;  2K25 A;  3TBL D;  1V5T A;  2BF8 B;  2G3Q B;  1XQQ A;  2GI9 A;  2I1J A;  2QDF A;  3NJT A;  2KDI A;  1BXT A;  1WZ3 A;  2JUO A;  4DBG A;  3EGR A;  4HCN B;  1S3S G;  2M56 B;  1YN4 A;  2RPV A;  3DQV A;  5E6P A;  3OJ4 B;  1V86 A;  3A1Q A;  4WWN A;  1V1P A;  3VHT C;  1WX9 A;  5LLI A;  1V1P B;  4HPL B;  5IOI A;  4DDI D;  2KXJ A;  2WXR A;  3VUX A;  4N58 A;  3PSE B;  4RM8 A;  3A9J A;  1XCT L;  3A9J B;  3M62 B;  1RFA A;  4ZRI A;  1QLB B;  1ZXH A;  1UBI A;  3L54 A;  3V6C B;  5DCN A;  3AEB B;  3LYY A;  4CO7 A;  4DXA B;  1VJK A;  4M00 A;  4IW0 A;  3U30 A;  4A55 A;  1MG8 A;  2IY0 B;  3RMK C;  4GDL A;  2EKI A;  4JPS A;  4GDL B;  1XF5 L;  2GOW A;  3TEX A;  1MFW A;  2L05 A;  4YT0 B;  1E90 A;  3U8Z A;  1UWX A;  2WXQ A;  1P98 A;  3DDC B;  5AZH A;  2MEK A;  4YTM B;  3RZF A;  2BT6 A;  2WS3 B;  1F2R I;  2KD0 A;  3SHQ A;  1GOZ A;  5FKA C;  3QX1 A;  3Q3N C;  2M0X A;  1V8C A;  1AW7 A;  1ZP0 B;  1WI0 A;  3DPD A;  4FBJ B;  3GB1 A;  1TZO A;  2O6V A;  2MBH A;  1MHH E;  2O6V B;  1Z2M A;  3RYT A;  4MSQ B;  3AI5 A;  3Q3F A;  1F0Z A;  5GMV A;  2KDF B;  3MC9 A;  1MHX A;  2D11 A;  2CJN A;  2GB1 A;  1C77 A;  2IGG A;  3PS6 A;  2WDR B;  3E56 A;  3GP7 A;  2OOB B;  4KKI A;  2D2Q A;  4GXB A;  2J0K A;  4KGR A;  1WRI A;  1HA5 A;  2Y5P A;  2G1E A;  2W54 A;  3L10 B;  2XN9 C;  3HVZ A;  3ZO5 B;  2JWZ A;  1KOT A;  2QEJ C;  3DBS A;  1PGX A;  1EWY C;  3SU8 X;  2ZPN A;  5DPW A;  1N5W A;  1WX7 A;  4KZ0 A;  1JCK B;  1ISN A;  1FNV A;  1FXT B;  1QOB A;  2EEL A;  2WDV B;  3HM3 A;  4A90 A;  4TKN A;  2JXX A;  2AEH A;  1ET9 A;  1YJJ A;  5G55 A;  3GZN B;  1QOG A;  2KJH B;  2BYE A;  1L0X B;  2D3C A;  2OJR A;  1V81 A;  2BW2 A;  2NTS A;  4W9I A;  2I38 A;  3NOB A;  3DVG X;  2WXL A;  4DHJ D;  2XK5 A;  2L32 A;  2W82 A;  4H2A A;  5EDS A;  5HKH A;  1WH3 A;  2Z0D B;  4ZRP A;  4ANW A;  4BKS A;  2BVC A;  4NNJ B;  2KC2 A;  4G3X B;  5D3D A;  1C78 A;  2H88 B;  2DAF A;  3VUY A;  3Q6B A;  2FIF A;  3BIN A;  1KH0 A;  3ETR A;  2KQ7 A;  1YQ3 B;  1ZOY B;  3ML8 A;  1E8X A;  1RYJ A;  3AE3 B;  3AE6 B;  2SEB D;  4RGO S;  4K3C A;  3URY A;  2JU6 X;  4G0N B;  4A3O A;  4EZJ A;  4MH0 E;  3SDL C;  4KV2 A;  4P16 A;  2KWC A;  1TKE A;  2IO1 B;  3E9S A;  1TBE A;  3W1S C;  3FKY A;  1SE2 A;  4M02 A;  1WMH A;  2WXH A;  4W9F A;  1WMH B;  2J0M A;  3PZ7 A;  4USA A;  4IG7 B;  4FHK A;  1L2N A;  2EMT A;  4MM3 A;  1GC6 A;  3DCG A;  3MTN B;  4MM3 B;  1IBX A;  3FIL A;  1PGA A;  2V3N A;  3CSF A;  1IBX B;  3FIL B;  3ZNI D;  2Z8L A;  4GN1 A;  1MJD A;  4GDK A;  1AWD A;  1GNU A;  3P1M A;  4GDK B;  1QIL A;  2LGD A;  3ZVV A;  3UGB B;  4L2Y A;  2Y5C A;  1BT0 A;  5EE0 A;  3PRM B;  4PS8 A;  4S17 A;  1F9J A;  1VRA B;  3ZJV A;  1PGB A;  2ICI A;  2N9P C;  2PIA A;  4ICU A;  4PK1 A;  2G45 B;  2N1V A;  2N1W A;  3KWV A;  1WGD A;  2PJH A;  2KAC A;  4LJP B;  2QSD A;  1KFY B;  3GOE A;  2R2Q A;  4LNO A;  4MJS A;  1WM3 A;  3NVW A;  4MJS B;  3RN9 C;  2FAZ A;  1CK1 A;  1X1M A;  2KJR A;  2WU2 B;  1HZ6 A;  5TR5 A;  2ZJD A;  4L1B A;  2V3S A;  5JHA A;  3Q3O C;  4KGS A;  3Q8F A;  4KZC A;  3KYC D;  2MX2 A;  2YEP F;  2KN4 A;  2DZJ A;  3A4S C;  4KGT A;  1SSN A;  2OHF A;  1JAL A;  2K6Q A;  1FCC C;  4OHJ A;  4NJ7 A;  3AEA B;  1D5Z C;  2L76 A;  3ZXR A;  2G4D B;  2ZW0 A;  4IM2 A;  3KUC B;  3MJW A;  2DZM A;  3HRD D;  4JL9 A;  4HKZ E;  1ZE3 D;  3EHV A;  1PYW D;  1GAQ B;  3VQI A;  3DBH B;  3UIP B;  2J52 A;  3W5V B;  3Q8B A;  4BFR A;  2IY1 B;  1T5X D;  1C9F A;  4AJY B;  2CS4 A;  3TJP A;  1C4P A;  1ACC A;  2ZCB A;  4YSZ B;  1WM2 A;  4DDG D;  3MHZ A;  4HRS A;  3NS8 A;  3P4Q B;  4BBN F;  1E7P B;  1VLB A;  4FLH A;  4FAD A;  2FUG 1;  2MWS B;  4B6W A;  1MPE A;  4HEA 1;  1KLV A;  4ANU A;  3ZNG C;  4REZ A;  1HXY D;  1Q5W B;  3VTV A;  2L83 A;  1S1Q B;  2D5G A;  4K7S A;  1TS5 A;  3NVZ A;  1WSP A;  1WZ0 A;  2JF5 A;  2AQ3 B;  3O13 A;  1YX5 B;  1UD7 A;  2KX3 A;  2HTH A;  2JRI B;  2K5P A;  3ML9 A;  1U4A A;  2FCS A;  2INP E;  2JPH A;  4DQO C;  4WJQ A;  1JML A;  4RF1 A;  4HDO A;  2AX5 A;  1R7S A;  1RWS A;  4LCD E;  4JX1 C;  2KMA A;  3R2I A;  1SB3 C;  1ZPS A;  4OVU A;  1HEZ E;  2WXN A;  5T8I A;  3RT3 B;  1JWB D;  3IHP C;  2PW9 A;  1IP9 A;  4ZRQ A;  4IC7 B;  2DYB A;  3C0R B;  2J4X A;  4B95 A;  4BOS C;  3AV8 A;  1WRD B;  3PT2 B;  2LJI A;  1D6E C;  2YLM A;  2L52 A;  5J18 A;  1V1O A;  4LNK A;  2FCN A;  3VUW A;  1YX6 B;  1WR6 E;  2QMT A;  4F1S A;  3AH7 A;  1WYW B;  1KLU D;  3PLU A;  4LNF A;  4TMA B;  4PT5 A;  4EZL A;  4W9H A;  2PTL A;  3N30 A;  3PHW B;  3N1Z C;  4RGN A;  2IGH A;  5L83 A;  4FHJ A;  2D10 A;  2WXP A;  3DBR I;  2M0A A;  3RNF C;  2EKE C;  4EFO A;  4N59 A;  2LGX A;  3DHH C;  5GXG B;  3QQ8 B;  4HJK A;  4RFB A;  3A9K A;  1FMA D;  3EFC A;  3A9K B;  4TQ1 A;  3R66 C;  4K7W A;  2LHD A;  1QKZ A;  3DVN U;  5IA7 A;  5JXV A;  3ZNH B;  2JT4 B;  2EMS A;  2L1A A;  2Y3A A;  3AE2 B;  3KQ4 A;  2KT7 A;  2KYW A;  2NPT A;  2NPT B;  2WXI A;  1C79 A;  1WGG A;  3RI7 C;  1K52 A;  4WJO A;  3GS2 A;  5J2R A;  1LGR A;  3OAW A;  1TTN A;  2LVQ A;  3AEG B;  1L7Y A;  3LDZ E;  4II3 B;  2KHW B;  4PS7 A;  4IOI E;  2VZK D;  1WJ4 A;  4BBN C;  4XWW A;  3QK0 A;  2WX1 A;  1TKG A;  1CQV A;  3RCZ A;  5AEK B;  5BYR A;  1ZKH A;  2MBO A;  4NZL B;  3M63 B;  4DXG A;  1MI0 A;  2X8X X;  2PKO A;  1ZXI A;  1FNU A;  3RNG C;  2MH7 A;  3WAO A;  1JRU A;  1FRD A;  1H8C A;  3W9C B;  2Y5B B;  1XLN A;  4W9K A;  3DBL I;  1SJE D;  1FFV A;  2GBN A;  4XE0 A;  4XZ4 A;  2KVR A;  3AEC B;  1R4N I;  3DVG Y;  2M19 A;  4W9D A;  4FJZ A;  3NS1 A;  2ZVN A;  4Q2J A;  2PEA A;  1YN5 A;  1P7E A;  3W5U B;  1L4Z B;  1NI2 A;  3CIR B;  4LNN A;  1WR1 A;  2KN5 A;  3IT4 B;  3BII D;  3ZTC A;  2MJ3 A;  2V9H A;  2IZV B;  3X23 A;  2N9X A;  4OZC A;  4C80 A;  3VFK A;  2IO0 B;  2IO3 B;  2XBB C;  4LDT D;  3I5J C;  3H7S A;  1P1A A;  4KDL B;  4WQO B;  3BK2 A;  1VD2 A;  5HFY A;  3QWZ B;  2BKF A;  1EF1 A;  3CMM B;  4WAF A;  2FUH B;  4FJV B;  2KFK A;  4YL8 A;  2VRR B;  1WJN A;  1TIF A;  1FIQ A;  3A1Q B;  4MGZ E;  1EWC A;  2KQ4 X;  5J17 A;  3PRP B;  4HRO A;  1KLG D;  4QAY A;  3RZW C;  2ZZP B;  1OEY A;  2CHZ A;  2AYO B;  2GRI A;  3WCQ A;  2RR9 A;  4F8C B;  2CR5 A;  2J53 A;  5G5G A;  4WWM A;  3N1Y C;  4FUL A;  2DBY A;  2RGF A;  4AUQ C;  2ZPY A;  4NY0 A;  1JWM D;  1L0Y B;  3H8H A;  5IP4 D;  5AZF A;  2KO3 A;  5C3J B;  5HI1 A;  3WAM A;  1E8W A;  5CHV C;  3U2S C;  3BVG A;  3ZQ4 A;  1TS3 A;  1I4P A;  1EM7 A;  2MBB B;  4I6L B;  2LZ6 A;  2WNM A;  2JZZ A;  4UDU C;  1SF0 A;  2JZP A;  3DVN V;  1ZUD 2;  1LM8 B;  3TEZ A;  1SBB B;  4ZRJ A;  2WXF A;  3U7D A;  4XDD A;  1P9D U;  4OW0 A;  1A70 A;  2KDM A;  2RD0 A;  2JWU A;  2YEP B;  5AUK A;  1T3Q A;  1FO4 A;  1RAX A;  5D3I B;  2AQ2 B;  3QIJ A;  2KMM A;  1IUE A;  1TKY A;  1SIJ A;  3M95 A;  3T3O A;  1NYQ A;  1M94 A;  2ZW1 A;  1I4X A;  2IDY A;  4TQ0 A;  4IDI A;  4MGK E;  1T0Q C;  3W1Y A;  4WIP A;  4YSY B;  4KKJ A;  1QQR A;  2DZI A;  3KVF B;  4BOZ B;  4J6I A;  4PS3 A;  1WJU A;  3NRZ A;  5HHD G;  3KUD B;  2RDB C;  3NZ3 A;  4FXC A;  3RNC C;  1QOF A;  1C76 A;  4BVU C;  5MPO A;  1FXA A;  1E7V A;  4EEW A;  1WX8 A;  2I1K A;  3PHX B;  1UWM A;  2WLB A;  4LLG M;  1ET6 A;  3VRB B;  2RSU A;  2BS4 B;  4R3D A;  4A6Q A;  1J7C A;  1E9M A;  3ENE A;  3OG5 A;  3SD5 A;  2CKH B;  2BBC A;  5BMI A;  1T6B X;  2VH1 A;  2BYF A;  2XK5 B;  3DWM A;  1IPG A;  2K6D B;  2KDE B;  4DHZ E;  1OFF A;  1ZDV A;  3ZJU A;  3PRE A;  1WE7 A;  2D07 B;  1SIF A;  3EEC A;  3UQA A;  5BYQ A;  2KZR A;  3C19 A;  3TIX A;  3CWI A;  5CX3 A;  4IM0 A;  3BYY B;  2MLB A;  1L0V B;  2V4I B;  5JHB A;  2ONQ A;  3I57 A;  1E10 A;  2LMC A;  3KYD D;  3RPF C;  2KMC A;  2W3S A;  2Q5W D;  3NZS A;  4MT5 A;  2LEK A;  4RM9 A;  1WXV A;  4NAW A;  2IO2 B;  4NAW B;  4KX6 B;  1YQ4 B;  1OQY A;  2V3P A;  3RUL A;  2DLB A;  2WXO A;  3RNE C;  3L13 A;  3EC8 A;  3V62 A;  2L0F A;  4IWO A;  2RDH A;  1F2R C;  1K50 A;  3W2D A;  3FC4 A;  1V49 A;  4MSM B;  3OWE B;  5DPT A;  2AL3 A;  2MA9 B;  4HLE A;  4IKG A;  5JZE B;  3T8M A;  3LJ3 A;  2BTE A;  2M17 A;  3SEB A;  1OEY J;  3MC8 A;  3B9J A;  2BB5 A;  3OJ3 A;  4HKQ A;  1E6E B;  1IGC A;  1CMX B;  2L3Z A;  3H9D A;  1L6V A;  3A33 B;  2BB6 A;  3IAS 1;  5D6J B;  2ASQ A;  3L17 A;  3DBR B;  1N61 A;  4MEM A;  4P7I A;  2DHZ A;  3GE8 C;  3JYU A;  3V6E B;  1VDV A;  2REX A;  3R7Q A;  5D7G A;  4NPN A;  2V1Y A;  4YTN B;  1FXI A;  3AE5 B;  2UWQ A;  3SFD B;  2L00 B;  3AUL A;  4WQM A;  4E74 A;  2GBR A;  4EKU A;  1BML C;  1VZ8 A;  2DZK A;  3ABV B;  4ZOH C;  2C5L C;  2FE8 A;  4HXD A;  2HDE A;  2NR2 A;  3SR6 A;  3B2F A;  1GUA B;  4JGH B;  3ZTD A;  3BVZ A;  2QC8 A;  4MAC A;  1UNS A;  1WWT A;  3ZKJ C;  4AQ7 A;  5I4D A;  2PMV A;  4RH6 A;  1VCB A;  1B9R A;  4JLC A;  4NQL B;  2LI5 A;  3MJ5 A;  3V61 A;  2BS2 B;  2K9X A;  3RNA C;  1OQR A;  2IBI B;  1MVK A;  1N5X A;  1WGH A;  4URK A;  1HTO A;  1KJT A;  2KWV B;  2KK8 A;  1SXT A;  1H4R A;  2MRP A;  3MFG A;  2KJ6 A;  4ASW C;  3UF8 A;  2WYQ A;  3IFW B;  3QHT A;  2B76 B;  5DPR A;  4WUR A;  1WXS A;  3WAP A;  1LFD A;  3ZRC A;  1KTK A;  1DOI A;  2KWD A;  1C3T A;  4O1N A;  4M8M A;  4KSK C;  2INC C;  5C2T B;  1VZ6 A;  4RF0 A;  5BO4 B;  1I35 A;  4D2K A;  2WXK A;  2N7J A;  2J42 A;  2C7H A;  3HK0 A;  1J8C A;  3DBL B;  3JW0 X;  1F1H A;  2WDT B;  1R4N B;  3B0A A;  3V05 A;  3APC A;  1NVI D;  2A5U A;  1UH6 A;  1GB1 A;  5E6J A;  1A5R A;  4ZDV A;  2M1M A;  1JWA D;  1FD6 A;  4JIO U;  1LQB A;  3TCA A;  3M3J A;  3VR9 B;  2KQS A;  3UIO B;  3BVM A;  1FCL A;  2KTF A;  4C7Z A;  2K1F A;  5JH5 C;  3IG3 A;  5EE9 A;  3T3N A;  1YN3 A;  1XCQ L;  3V3X A;  2D3A A;  1OQQ A;  4RCO A;  1NBF C;  3DHI C;  1N6Z A;  4HCP B;  3Q69 A;  2IYD B;  2JSV X;  4XYC A;  4N6E B;  1TJE A;  2K39 A;  2FID A;  2QIL A;  2LUE A;  3N3K B;  2LJ5 A;  3PLV A;  4HPP A;  3L08 A;  4E3C A;  2FNJ B;  4NJC A;  1I4Q A;  2W3R A;  4ZYN A;  2WX0 A;  4M01 A;  3N1X C;  2NVU I;  4NJ6 A;  3U4E G;  1JQ4 A;  5KHO A;  3ZIM A;  1NEN B;  2JXT A;  1OTR B;  3P63 A;  3TUO A;  1B1Z A;  3ZDT A;  2IJ0 A;  2MJD A;  2BPS A;  4HJG E;  5EE1 A;  2KVZ A;  4LDT B;  3NZU A;  2NCN A;  3ALB A;  1NEK B;  2DWQ A;  1I4H A;  2WXG A;  1L5P A;  1GC7 A;  2W9N A;  1JRO A;  2HD5 B;  2M4N A;  3O65 B;  1EUV B;  4P1B C;  2MBQ A;  2HTM E;  4EZK A;  1K8R B;  2DYO A;  2HJ8 A;  1ZW7 A;  3P4S B;  4HWI B;  1E0Z A;  3UQB A;  3R7R A;  2QCZ A;  1C1Y B;  4LK0 M;  4DHZ B;  1XXG A;  2UU7 A;  2I2Y A;  1HZ5 A;  2INN E;  2IND C;  3ECI A;  2PVG C;  3PV1 A;  1YOV B;  3ZW3 A;  2LXA A;  3I63 C;  1TS2 A;  1EF5 A;  3I3T B;  3RUI B;  1SGH A;  2K22 A;  4KSL C;  4NQK E;  4GOC A;  2FCM A;  1RFK A;  2QHO A;  2VH2 A;  3L4P A;  1NYR A;  1EU4 A;  1JWS D;  5LXI B;  3ZNZ B;  1D4B A;  5LXH A;  3IT6 B;  2K8H A;  1Q1O A;  1YD8 U;  1QF6 A;  1F77 A;  2KKC A;  4XDC A;  1T0S C;  2QJL A;  2MW5 A;  1XD3 B;  1WIA A;  3KWL A;  2B3A A;  5EE3 A;  2LGI A;  3Q2A C;  3EUB 2;  1Z5S B;  1NDD A;  3DHG C;  2WXJ A;  3JSV A;  4G50 A;  5C23 A;  5D2M B;  2KC1 A;  3NY5 A;  1RLF A;  4C7Y A;  2J7Q B; 
#chains in the Genus database with same CATH homology
 3MP9 A;  5D3I B;  1IGD A;  4MM3 B;  3FIL A;  1PGA A;  2E3T A;  1CZP A;  2DYM A;  2AQ2 B;  3J9C A;  1IBX A;  2KMM A;  2V3N A;  2XNA C;  4EE2 A;  1M4V A;  3FIL B;  3AMZ A;  1IBX B;  1GPX A;  1K51 A;  1XO3 A;  2Z8L A;  3Q8C A;  3N9Y C;  2JYE A;  1IUE A;  1TKY A;  1SIJ A;  1XEE A;  1AWD A;  3P1M A;  3AB5 A;  4JWU C;  4GDK B;  1FM0 D;  2IGD A;  3T3O A;  1NYQ A;  1QIL A;  2ZW1 A;  2OED A;  4RGT A;  1V97 A;  4C56 C;  4GLS C;  3C8Y A;  1I4X A;  4L2Y A;  2IDY A;  2Y5C A;  4TQ0 A;  4IDI A;  5EE0 A;  2K3U A;  2RMM A;  4WIP A;  1VRA B;  3ZJV A;  1PGB A;  2ICI A;  2PIA A;  5HG2 A;  1I4G A;  1TY2 A;  4KKJ A;  4YSY B;  3AE7 B;  1QQR A;  5BYS A;  2WQY B;  3KWV A;  2E6X A;  2KAC A;  2N9L A;  3Q8E A;  2LHE A;  1NI3 A;  1TY0 A;  2QSD A;  1KFY B;  3NRZ A;  5HHD G;  3R8B A;  3NZ3 A;  4FXC A;  1KF6 B;  1QOF A;  4TSS A;  3NVW A;  1C76 A;  5MPO A;  1J7A A;  1J7B A;  1FXA A;  3U7Z A;  1CK1 A;  1UWM A;  2WU2 B;  1HZ6 A;  2WLB A;  4LLG M;  3NVY A;  1ET6 A;  4L1B A;  2FBW B;  3BWU D;  4KGS A;  5FK9 C;  3Q8F A;  3VRB B;  3NUH B;  2BS3 B;  3AM9 A;  2YEP F;  2BS4 B;  2KN4 A;  2MJE A;  2PVO D;  4LTU A;  4R3D A;  4A6Q A;  4JWS C;  3W1S A;  1J7C A;  1E9M A;  1BUI C;  4A8X C;  2AQ1 B;  4KGT A;  1PUT A;  2PLP A;  3VRA B;  1SSN A;  2OHF A;  1JAL A;  2BBC A;  2K0P A;  5BMI A;  1T6B X;  3AED B;  2V0G A;  1FCC C;  4OHJ A;  4ZHO A;  3Q8A A;  3AEA B;  3DWM A;  1D5Z C;  4L23 A;  4P6V F;  1OFF A;  1ZDV A;  3ZJU A;  1JRP A;  2ZW0 A;  2SAK A;  2N0S B;  1C4A A;  4US9 A;  3HRD D;  4HKZ E;  1ZE3 D;  4OZB A;  5BYQ A;  1PYW D;  1GAQ B;  4OVZ A;  3CWI A;  3VQI A;  2JQR B;  4A9A A;  4J3O D;  3BYY B;  1L4D B;  4XWT A;  1L0V B;  2J52 A;  1TYG B;  2V4I B;  2ONQ A;  3HVD A;  3I57 A;  3Q8B A;  3W5V B;  1E10 A;  1T5X D;  1C9F A;  2LMC A;  2KAJ A;  2TSS A;  1WGK A;  4NAM A;  3RPF C;  1C4P A;  1ACC A;  2W3S A;  2Q5W D;  4MT5 A;  4YSZ B;  2LEK A;  5BMG A;  4ARI A;  3MHZ A;  1AYF A;  3FAH A;  1I7H A;  4ZHP A;  4HRS A;  1DOX A;  3TEW A;  3P4Q B;  4NAW B;  4KX6 B;  2CU3 A;  1E7P B;  3UI3 A;  1VLB A;  1YQ4 B;  2V3P A;  2FUG 1;  2DLB A;  1K53 A;  2WXO A;  1PFD A;  1AN8 A;  3P4R B;  4AS1 A;  1WYG A;  1YNT E;  1N60 A;  1MPE A;  1ENF A;  1KRH A;  4HEA 1;  4REZ A;  1HXY D;  2RDH A;  1F2R C;  1K50 A;  3W2D A;  3FC4 A;  4CQN A;  2L83 A;  2D5G A;  1TS5 A;  3NVZ A;  1WSP A;  3OWE B;  4IKG A;  2AQ3 B;  3O13 A;  3AEF B;  2JX5 A;  2BTE A;  3AE9 B;  3SEB A;  5TSS A;  4RGM A;  3B9J A;  2BB5 A;  2K5P A;  1D5X C;  4HKQ A;  1E6E B;  1IGC A;  3VR8 B;  1UUP A;  1L6V A;  1D5M C;  1JW9 D;  2BB6 A;  2W55 A;  1CJE A;  1DGJ A;  2INP E;  4DQO C;  3RFZ B;  3IAS 1;  1JML A;  4RF1 A;  1FEH A;  3KLS X;  2AX5 A;  1R7S A;  1RWS A;  3P42 A;  4YSX B;  4JX1 C;  3R2I A;  1N61 A;  5G5H A;  4YTP B;  5H92 C;  1SB3 C;  5FR3 A;  4WH4 A;  4JE3 B;  1ZPS A;  3AE1 B;  1VDV A;  1HEZ E;  2LUM A;  2WXN A;  4ARC A;  1DYQ A;  5D7G A;  5T8I A;  1FFU A;  4YTN B;  1FXI A;  2IPK D;  2ON8 A;  3AE5 B;  2G9H D;  1JWB D;  3ZJT A;  4B0E A;  3SFD B;  2PW9 A;  4WQM A;  4ZRQ A;  1ROE A;  4ZYS A;  1BML C;  2J4X A;  2QIE B;  1VZ8 A;  3AV8 A;  2LJI A;  3HUI A;  1D6E C;  2L52 A;  3IAM 1;  1V1O A;  3ABV B;  2WU5 B;  2ACZ B;  4ZOH C;  2FE8 A;  2QMT A;  2HDE A;  3AH7 A;  1KLU D;  3SR6 A;  3B2F A;  4TMA B;  4PT5 A;  2RDG A;  3BVZ A;  4MAC A;  3LB8 C;  1UNS A;  3EA6 A;  1WWT A;  2PTL A;  2GI9 A;  4AQ7 A;  5I4D A;  2PMV A;  4RGN A;  2IGH A;  4RH6 A;  1BXT A;  1B9R A;  3EGR A;  4MH8 A;  2WXP A;  2M56 B;  1N62 A;  1YN4 A;  2RPV A;  3TEY A;  2M0A A;  3MJ5 A;  4N59 A;  2WP9 B;  2BS2 B;  2K9X A;  1V1P A;  1OQR A;  3LXF A;  1MVK A;  1N5X A;  5GXG B;  3BZD B;  1V1P B;  4RFB A;  1SXT A;  1YJI A;  1FMA D;  2WXR A;  3MFG A;  4TQ1 A;  4N58 A;  1XLQ A;  1N63 A;  2B76 B;  2LHD A;  4WUR A;  4US8 A;  3B2G A;  1QKZ A;  1XLO A;  1XCT L;  4M0W A;  1SE4 A;  1KTK A;  1DOI A;  2KWD A;  1QLB B;  5JXV A;  1I4R A;  1ZXH A;  4O1N A;  2L1A A;  3AEE B;  2Y3A A;  5C2T B;  1VZ6 A;  3AE2 B;  3AEB B;  3KQ4 A;  4RF0 A;  3LYY A;  1STE A;  1VJK A;  1Y56 A;  2WXK A;  2N7J A;  4D2K A;  2J42 A;  3BK1 A;  1L6U A;  4A55 A;  2WXI A;  1C79 A;  3AN1 A;  1K52 A;  1UGJ A;  3GS2 A;  2EKI A;  4JPS A;  4GDL B;  1XF5 L;  1RM6 C;  3V05 A;  1YMH E;  3TEX A;  1NVI D;  4YT0 B;  1UWX A;  2WXQ A;  1GB1 A;  5E6J A;  3AEG B;  1FNW A;  1SE3 A;  2MEK A;  4YTM B;  1JWA D;  1FD6 A;  1HQR D;  2BT6 A;  2WS3 B;  1F2R I;  2VZK D;  4IOI E;  3VR9 B;  3BVM A;  3R2T A;  1FCL A;  1GOZ A;  4XWW A;  4C7Z A;  5FKA C;  1TKG A;  1CQV A;  3U52 E;  3ZGZ A;  1V8C A;  5BYR A;  5EE9 A;  4DXF A;  1AW7 A;  3T3N A;  1ZP0 B;  1YN3 A;  1XCQ L;  4NZL B;  3AE8 B;  1ESF A;  3V3X A;  4DXG A;  1MI0 A;  2PKO A;  1ZXI A;  1OQQ A;  4RCO A;  1FNU A;  1PDX A;  2MH7 A;  3GB1 A;  3Q69 A;  1WXQ A;  2JSV X;  1FRD A;  1TZO A;  1TJE A;  4N6E B;  3W9C B;  2WDQ B;  1MHH E;  1XLN A;  2N9K A;  1SJE D;  2QIL A;  3ZYY X;  3BYT B;  1FFV A;  4XE0 A;  1C4C A;  3TSS A;  3AEC B;  3IXS A;  1TS4 A;  2M19 A;  1F0Z A;  1P7F A;  1FRR A;  1LO5 D;  3NS1 A;  1I4Q A;  4NJC A;  1MHX A;  4Q2J A;  2CJN A;  2GB1 A;  2W3R A;  1C77 A;  1YN5 A;  2BYT A;  2IGG A;  2WDR B;  3E56 A;  1VR9 A;  1P7E A;  3GP7 A;  3U4E G;  3W5U B;  1L4Z B;  1JQ4 A;  1DOY A;  4KKI A;  3CIR B;  3PZ8 A;  2X38 A;  5BMH A;  2LFI A;  3IT4 B;  4KGR A;  1ZDX A;  1WRI A;  4YXD B;  1HA5 A;  3BII D;  2Y5P A;  1NEN B;  2G1E A;  2JXT A;  2MJ3 A;  3DWG C;  2W54 A;  3P63 A;  3TUO A;  2XN9 C;  1B1Z A;  3HVZ A;  3MC0 B;  1Q10 A;  2IJ0 A;  3SFE B;  2MJD A;  2QEJ C;  4HJG E;  4RNA A;  5EE1 A;  1PGX A;  1XLP A;  4OZC A;  4C80 A;  2R61 A;  2NMQ A;  1EWY C;  1NEK B;  2DWQ A;  1I4H A;  1VZ7 A;  2WXG A;  1L5P A;  1N5W A;  3BK2 A;  5AUI A;  5HFY A;  1JCK B;  1FNV A;  1JRO A;  1QOB A;  4WAF A;  2EEL A;  2WDV B;  4A90 A;  2HTM E;  1ET9 A;  2DYO A;  1YJJ A;  2CJO A;  3P4S B;  1FIQ A;  1QOG A;  1EWC A;  1L0X B;  2KQ4 X;  1E0Z A;  1QOA A;  4HRO A;  3AE4 B;  1KLG D;  2JYT A;  2BW2 A;  4YWG G;  4LK0 M;  1XXG A;  2NTS A;  2WXM A;  2GRI A;  2I38 A;  2NTT A;  3WCQ A;  2I2Y A;  1HZ5 A;  3P4P B;  2WXL A;  2INN E;  2J53 A;  2L32 A;  2W82 A;  4H2A A;  5G5G A;  4ZRP A;  2PVG C;  4WWM A;  2DBY A;  1TS2 A;  5D3D A;  1C78 A;  2H88 B;  2K22 A;  1JWM D;  1L0Y B;  3H8H A;  1RFK A;  3L4P A;  1KH0 A;  1NYR A;  1EU4 A;  1JWS D;  3ETR A;  5C3J B;  1YQ3 B;  1ZOY B;  1D4B A;  5HI1 A;  1RYJ A;  2VZK B;  3IT6 B;  3AE3 B;  3U2S C;  1SEB D;  2SEB D;  3AE6 B;  4RGO S;  3BVG A;  4B0M A;  2H89 B;  3ZQ4 A;  1TS3 A;  1I4P A;  4ITK A;  4OZA A;  1EM7 A;  5LNK 1;  1QF6 A;  3URY A;  1F77 A;  2JU6 X;  4XDC A;  5H8Y E;  2WNM A;  2QJL A;  4UDU C;  1SF0 A;  1JWU D;  2JZP A;  3NVV A;  3KWL A;  4P16 A;  1TKE A;  1EU3 A;  1ZUD 2;  3TEZ A;  3E9S A;  2LGI A;  5EE3 A;  1SBB B;  1SJH D;  3EUB 2;  1SE2 A;  3I9V 1;  2WXF A;  2WXH A;  3PO0 A;  4XDD A;  4OW0 A;  3PZ7 A;  1A70 A;  2KDM A;  2WXJ A;  4USA A;  2JWU A;  2YEP B;  1GB4 A;  4C7Y A;  5AUK A;  1QT9 A;  1T3Q A;  1FO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...