2DLBA

X-ray crystal structure of protein yopt from bacillus subtilis. northeast structural genomics consortium target sr412
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of hypothetical protein from Bacillus subtilis O34498 at the resolution of 1.2A. NESG target SR412
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords yopT
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09467 Yopt Hypothetical protein Yopt
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.330 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dlbA00
2DLBA
chains in the Genus database with same CATH superfamily
3CWIA 3W1SA 1E7PB 1QKZA 4NAMA 3A1QB 1RFAA 2LGIA 1F52A 1HE8A 5AEKB 3AEAB 3TIXA 3ZJVA 1MFWA 1P9DU 1V80A 3WCQA 1FNUA 2QEJC 3QA8A 1D4BA 4AUQC 3RUIB 1WZ0A 3I5JC 2K39A 4MT5A 1V1OA 3AEBB 3R7RA 2EMSA 3GP7A 3ECIA 3U7DA 1IGCA 4WURA 4ZRKA 4F8CB 3UQAA 3X0WA 1TS4A 2WX0A 3AM9A 2JF5A 4GN1A 1CK1A 1WXSA 1SE4A 2K6QA 2KACA 4ANVA 3DDCB 2VZKD 3RULA 4DQOC 5FKAC 5J18A 3AU4A 3AEGB 1GUAB 2SAKA 1VR9A 1UD7A 2GBRA 1XXGA 1CJEA 2N9XA 1E90A 4YWGG 1C3TA 2KMMA 1ET6A 1UGJA 2ZPYA 2DYBA 2ZCCA 2JZZA 3Q8CA 1WY8A 2K3UA 3OWEB 1SJED 2J42A 2GRIA 1C4PA 5KHOA 4BVUC 2HE7A 2K8HA 1R4MB 1YQBA 1E8YA 4WJOA 2LXCA 1YJIA 3ZJTA 1WM3A 1J19A 1WJNA 1UWMA 4K81A 1ISNA 4N59A 3KQ4A 1MHXA 1NYQA 3HVZA 4KSLC 4BBNF 1KLGD 2C7MB 2UYZB 1Q10A 1UBQA 3DOWA 3DBHB 2R2QA 2KLCA 2KDBA 1ZOYB 2MBHA 4LNNA 4NNJB 3BK1A 3TEYA 2JX5A 4J3OD 3C0RB 2BS2B 2CHWA 2JWZA 4ZHPA 1Y56A 1Q5WB 2L7RA 5BMHA 1FRRA 4AP4C 1YN4A 5FR3A 3A9JB 4HJKA 1E9MA 1JWUD 5BYSA 2JY6A 4GU2A 3ZIMA 4C56C 4HDOA 1LM8B 3VUYA 2HJ8A 3IT6B 4KV2A 3KLSX 2GBNA 4OVUA 2IDYA 4K3BA 2IO2B 3LJ3A 1YMHE 3BVZA 2MSED 1UZXB 3LXFA 4WAAA 3A33B 5L83A 2WDQB 3AE7B 4M00A 3TBLD 2N4FA 2FCSA 3ZDMC 3ZVVA 2L8JA 1F0ZA 1RLFA 4H2AA 3D32A 3P4RB 1JWSD 4GMVA 2BS3B 1H8CA 2TSSA 3MC8A 1IPGA 1F1HA 2WXOA 3BY4B 1I42A 4JLCA 1WXQA 3ZNGC 2KQSA 2M4NA 3MP9A 3N3KB 3AB5A 2ZW1A 2AQ1B 2KQ7A 1L4DB 2DENB 2KZRA 4KKJA 4MM3B 4WJQA 5D94A 1CQVA 4OZBA 2LUEA 1I4PA 3U7ZA 3B0AA 2J7QB 1GNUA 2H89B 4FADA 3RZFA 4ZRPA 3VR9B 2K8CA 1R7SA 3CF6E 2WWZA 1VD2A 2KXJA 4RFBA 1FNWA 5BYQA 2OEDA 4HK2A 4TMAB 4B0EA 4C4VA 2MJ3A 1JQ4A 2KX0A 1WJUA 4AS1A 2J0KA 3VXWA 1JCKB 1XD3B 2QSDA 3KYDD 1YQ3B 5DCNA 2JQRB 3PSEB 3UINB 2M56B 3PT2B 3W1SC 2GB1A 3LDZE 1P0RA 1JROA 4RM8A 2WXQA 4FJYA 5G2NA 2IY1B 4KX6B 2J52A 3UQBA 1P7FA 1NEKB 2MLBA 3SD5A 1M94A 1K52A 1D5MC 3APFA 2W3SA 2WHIA 2PPHA 4NQKE 1DOYA 4ZRQA 4WIPA 2RR9A 2FCNA 1DOXA 1FNVA 3NVYA 3PGEA 1Y8RC 3RD2A 2INNE 1K8RB 4MSQB 1ZDVA 4HLEA 3VRBB 4WQMA 2X8XX 3T3NA 1FIQA 1NYRA 2FIFA 4WH4A 1I4QA 5D2MB 2LUMA 1VRAB 2AYOB 3H1UA 2ZW0A 2N1WA 1YX5B 4O1NA 2MRPA 3LB8C 5H8YE 4LDTB 3TEZA 3IAS1 1SIFA 1TTNA 4OVZA 2MX2A 2BW2A 4FHKA 2K5PA 2QJLA 5EE0A 1TKEA 1JW9D 2LVPA 1V9JA 5G55A 4MH8A 1N5XA 2MP2A 2FE8A 3VH3B 3V60A 1WXMA 2NBVB 3JSVA 1YD8U 1R4NB 2QCZA 4I6NB 3NJTA 2D07B 3ZGZA 3AE8B 3IXSA 3EFUA 1EWCA 2KTRB 2LASA 3AN1A 2AX5A 4HROA 3FC4A 1XEEA 4ZYNA 3ZQ4A 1S1QB 4XWTA 3DBSA 4GSWA 4EEWA 4HCNB 3NUHB 1V1PB 1VJKA 3A9JA 1WE6A 3HK0A 5C23A 2WXFA 2LGSA 2Y5BB 1F2RI 4L1BA 3ZXVA 3ZYYX 2Z0DB 3MHZA 3V3XA 1E5WA 3K9PB 3DBRB 4JWSC 3N32A 3SDLC 2KDEB 3DBHI 1GB4A 2QC8A 2K22A 3PLVA 3N30A 4EE2A 2DX5B 2DZMA 1I4RA 2XK5B 4YTPB 4W9LA 1AN8A 5AUIA 5CTRC 2CKHB 1Z5SB 5H92C 2BYFA 4KKIA 3AEDB 2K9XA 3AE9B 1G6JA 3DVNV 1XF5L 1DGJA 4LJOB 1QZEA 5D6JB 2M19A 4ARCA 3TL5A 4BKSA 1HZ6A 4GB9A 3FKYA 2LMCA 1WYWB 3QWZB 2I38A 2B76B 4GLSC 1ROEA 1VLBA 3R2IA 3VR8B 2RGFA 2RPQA 4HPMB 2JSVX 1QOGA 3APDA 2E3TA 2D3AA 3NOBA 2ZNVB 4TQ1A 2FCMA 4A9AA 4KZ0A 1WZ3A 3PREA 2LWPA 5IP4D 4NPNA 4W9FA 2KNBA 3N9YC 1PFDA 4JE3B 4IKGA 3KH0A 4PS3A 2BVCA 3QC8B 2Z59B 4LNFA 2PEAA 5IN7A 4HXDA 3VTWA 1D6EC 2CU1A 1WX7A 2XNAC 4W9KA 1T0RC 2KDMA 2IZVB 1WF9A 4KGTA 4LK0M 1V1PA 2KANA 4NJ7A 3H9DA 2PJHA 1FXIA 2I2YA 4ACFA 5CHFA 3R8BA 2V3NA 1QOBA 4RGMA 3NVWA 1IBXA 1XLOA 2G1EA 4B95A 2KMAA 5J17A 4C00A 2WGSA 2MEKA 4WJNA 4ZDVA 3NRZA 1GC7A 2LJ5A 2C5LC 3N20C 2BWES 3QARA 5JHBA 1TYGB 3I57A 2JYTA 2KC2A 4N9F4 4ZOHC 1WXAA 3PZDA 1C76A 1XLPA 2WXPA 2Z8LA 4QAYA 2LHEA 1Q0WB 3V05A 1WGDA 2O6VB 3DHGC 4DXGA 2CR5A 4ANXA 1FFVA 2V1YA 1XLQA 4GDKB 4BOZB 2DAFA 3VTVA 4TKNA 4W9EA 3EECA 2PMVA 1QOFA 1V5TA 3ZKJC 1V86A 2ZJDA 2L0TA 4US8A 2PVOD 4GDLB 2KTRA 4KGSA 1NENB 2GBMA 2INPE 2IGGA 2RPVA 3HRDD 2WX1A 3NVVA 4DXAB 3HVDA 3WAPA 5HFYA 1LO5D 1T6BX 3A4RA 4YSYB 5HG2A 1OEYA 1E7UA 3PZ8A 4P16A 2D3CA 4BBNC 1SB3C 2MBEA 4DDGD 4LDTD 1KOTA 1Z2MA 1ZKHA 3BVMA 2Y3AA 1KM7A 1EU4A 4IWOA 1MI0A 1JRUA 1XCQL 3V62A 2WXRA 3WIMA 2PTLA 1ENFA 3P4SB 1SXTA 4EFOA 4UDUC 4A6QA 2G4DB 1FXTB 2LVOA 2L52A 2WXKA 3V6EB 1E7VA 1SJHD 2EKIA 4PS8A 2N9LA 4M0WB 2N7DA 4K3CA 3UIOB 1P7EA 5EE9A 1FPYA 4MM3A 2JU6X 4BOSC 2MHJA 3L0WB 4RCOA 3KUDB 1TY2A 4M8MA 3BYYB 2LZ6A 2QIEB 4JIOU 2NTTA 1XLNA 2IO1B 4C80A 3V6CB 3MC9A 3NG0A 2MQJA 1K51A 4DK5A 2C7NB 2D11A 4RF0A 1WH3A 3ETRA 4BAXA 1K53A 1YN3A 3VTUA 4A3PA 1TIFA 1D3ZA 4D2KA 2BYTA 3M95A 2R61A 1C9FA 4DHZE 3L08A 2A4ZA 2J0JA 3AEFB 4HKQA 3GS2A 1J8CA 3EA6A 2LD9A 2NTSA 3WALA 1SSNA 2G45B 1ET9A 1MPEA 5TR5A 2GLSA 3ZXRA 3W1YA 3NZSA 2XEWA 3P4QB 2L1AA 1WWTA 4YXDB 1TY0A 2M8SA 3ZRFA 4IG7B 4US9A 1CZPA 3JYUA 2LJIA 1HA5A 1JWMD 2KFJA 3W2DA 4MELA 2KOXA 4AJYB 1AW7A 1K50A 2B3AA 3TEXA 1L7YA 5BMIA 3FAHA 1M4VA 2GOWA 3Q8BA 2IGDA 1SIJA 2R2OA 1NI2A 3UF8A 2M1MA 2VRRB 3ZRCA 1ZUD2 2MCNB 1QILA 5G5GA 1E0ZA 2INDC 2NBWB 1WM2A 5IOIA 5I4DA 3A9KB 3P4PB 3B2FA 1WR1A 2LGXA 4IUMB 2JXXA 3KWVA 1OQQA 2V4IB 3SR6A 3TSSA 4N6EB 4ARIA 1LFDA 3Q3FA 3N1YC 2CHXA 2O6VD 4P1CC 2DNFA 1DYQA 4EZJA 3WA0A 4S0RA 4FULA 2PE6B 2DYMA 2JXTA 4GIVA 2KVZA 1OEYJ 2ZVOA 4MACA 4RH6A 3WAOA 2L05A 5JXVA 1WSPA 1B1ZA 3B08A 1WGYA 3QCAA 4DDID 4DHJB 1J0GA 3GE3C 3TJPA 3L54A 2NR2A 3UI3A 4WJPA 2ASQA 3C8YA 4P6VF 3BZDB 3QHTA 2DBYA 3AE6B 3SHQA 3ZNZB 1TGZB 3PLUA 2G4SA 1LQBA 4WWOA 1XQQA 3HM3A 4CYEA 3E56A 3AE4B 2BPSA 2OJRA 4K7UA 3DQVA 2LRWA 2J4XA 2ZNVC 2KDIA 4AOFA 1ZW7A 3ZO5B 5AUKA 3B9JA 3T8MA 3TMPB 1IYFA 2D5GA 2WNMA 4LTUA 1YNTE 3A1QA 3DBRI 4I6LB 1BT0A 2WU2B 2G9HD 2KVRA 3VH4B 1AARA 2MP2B 2DHZA 3PVLA 4PK1A 4MH0E 2EELA 1RFKA 2MBOA 1ZXIA 4FN2A 3R3MA 5HI1A 2X38A 1EF1A 2ZZPB 2BT6A 4HVBA 2V3PA 1NI3A 1FM0D 4G11A 1V49A 2I1JA 3RT3B 1OQYA 4BFRA 4Q2JA 4JPSA 4NAWB 2KD0A 1CMXB 2CJOA 2HDEA 1KF6B 4E71A 3GOEA 4RGOS 4HPPA 1MJDA 1SBBB 3Q3MC 5DPWA 3VUXA 2JVCA 1WRIA 1MHHE 3S2AA 3B1LX 1R4NI 1L2NA 1SGHA 4YTNB 2KAJA 1WI0A 1KH0A 1FMAD 3KW5B 2MJDA 2W55A 5MPOA 2V9HA 4M01A 2K0PA 2WXLA 3MJWA 3VDZA 4FBJB 4C4VB 3BK2A 4WAFA 1FCCC 1QOAA 2AEHA 2NPTA 3N1ZC 2RDHA 1N62A 1IUEA 2W9NA 3MC0B 1L0YB 3AE1B 2FBWB 3DCGA 3AE2B 1I35A 1ZDXA 1WE7A 2C9WB 4MJSA 3PV1A 3CIRB 1L6UA 2JZ3B 2REXA 4ANWA 2W3RA 3ZTCA 1L6VA 4LLGM 3BIID 1WFYA 5C3JB 3DVNU 4MJSB 3VAWA 4DBGA 3PS6A 2KMCA 2BS4B 3DPDA 2O6VA 3SFEB 5JHAA 4DWFA 3ZUNA 1KLVA 2JUOA 4K7WA 1PDXA 1ZXHA 2KX3A 3Q8FA 2HTHA 2WXJA 1IP9A 4HJGE 1VDVA 4OW0A 3MJ5A 1JALA 4KVGB 2L83A 3QQ8B 4W9DA 2KDFB 2K25A 4JGHB 1YIWA 2L3ZA 1UNSA 4W9GA 2KFKB 4EKUA 2IO3B 2KT7A 4BKSD 4P7IA 3AV8A 2RDGA 4XDCA 3ZDTA 1V6EA 1XT9B 3GZNB 2OOBB 4A8XC 4XDDA 4ZRIA 1J7BA 2NVUI 1NBFC 3BYTB 4GDKA 3TUOA 2FUHB 1UELA 4JL9A 4LCDE 2N9PC 3VQIA 3W5VB 3W5UB 3L13A 4YT0B 1E10A 5HKHA 4HCPB 1IGDA 3L4PA 1S3SG 4RF1A 2WYQA 4KDLB 2V3SA 3N1XC 2J53A 3NZ3A 1TT5B 2JWUA 4ZRJA 2UU7A 1T0YA 2GBJA 2PLPA 4B9KA 4N58A 2LI5A 4OHJA 3V61A 1WGKA 5C1ZA 1C78A 1U4AA 2D10A 2AWTA 1QQRA 3AE5B 3VHTC 4XWWA 1ESFA 1JWAD 4F7ZA 4JX1C 2RSUA 2JRIB 5IA7A 1IBXB 3NS1A 1J7AA 1NDDA 3OAWA 3QK0A 1PGBA 2KJRA 1C79A 2XN9C 2IO0B 1D5ZC 1JMLA 4R3DA 2ZPNA 3H8HA 2VH2A 3IG3A 2BKRB 2QILA 5EE3A 4WWNA 2Z0EB 4C7ZA 1HZ5A 3FILA 4EZLA 4ZHOA 1YQ4B 2GI9A 4PS7A 1R4MI 4ITKA 4RGTA 1WR6E 1KRHA 2ZVNA 5J2RA 1I4HA 2ZEQA 2SEBD 3VUWA 4MGYE 3A4SC 3KUZA 2HJ1A 1P3QU 2BF8B 3DBLB 3DHIC 1N60A 5CHVC 2Q5WD 3Q3NC 1HXYD 2O2VA 1FD6A 4PYZA 3DBLI 1YN5A 1KTKA 1TZ1A 3OLMD 1N5WA 1PGXA 3R66C 4K7SA 3RMKC 4WWPA 3ZW3A 4FJVB 4C7YA 4K1RB 2Y5CA 1YJJA 3IVFA 2WP9B 5EE1A 3R7QA 1UUPA 3PHWB 2WXIA 4NZLB 3IT4B 2PW9A 2NCNA 2N0SB 3FILB 4A20A 2DZKA 2BWFA 3AE3B 3IFWB 1HQRD 2V4LA 3QJZA 2KO3A 3A9KA 5AZHA 3AXCA 2JRHA 1SF0A 2BKFA 2CS4A 1T5XD 4MGZE 1BXTA 4E74A 4PYUA 1OTRB 4M8NA 1YX6B 1YJ1A 1L0XB 5BYRA 4AWJA 4ICUA 1LGRA 2KWCA 2VH1A 1FRDA 1J7CA 3L17A 2MWSB 4F1SA 4G50A 1UH6A 3PRMB 1QT9A 5CX3A 3SFDB 2WLBA 3BINA 3ZJUA 1VCBA 4B0MA 4DHJD 3BWUD 3Q3OC 1Q1OA 1P1AA 3Q6BA 5D7GA 4GGQA 1AYFA 2QHOA 4FHJA 1BMLC 3AULA 1T0SC 3VRAB 3Q14C 3E9SA 1KLUD 2KK8A 1TKGA 3GE8C 1H4RA 1MG4A 3X23A 3L10B 3JSVB 2DWQA 2C60A 3NS8A 5D3DA 2ZCBA 2YEPB 1ZGUB 1PUTA 4BKTA 2BQQA 4S17A 3RZWC 1C77A 3ZNHB 5E6NA 5IAAC 2FIDA 2RMMA 2L76A 2L00B 4M02A 4CQNA 4A3OA 2EKEC 3H7PA 3KVFB 4OVVA 3L16A 2QDFA 4P1BC 4XC2A 3J9CA 4GXBA 1SE3A 1GAQB 1E8WA 1XO3A 5KHQA 2KWVB 1L4ZB 2INCC 2CHZA 3U30A 1D5XC 2V0GA 2JT4B 4M0WA 1TS3A 2BGFA 4KIKB 1T0QC 2KWDA 3P2BA 2IBIB 1X1MA 3T9LA 2PVGC 1RM6C 4KZCA 2N7JA 4KDIC 4IM2A 3Q2AC 3QIJA 4PT5A 1DOIA 3Q8AA 3C19A 1ZP0B 1T3QA 4XX5A 4KGRA 2WXNA 2D3BA 2J0MA 2I1KA 3IHPC 1RYJA 3U4EG 2IYDB 4W9IA 3JW0X 3QX1A 4YL8A 3PPAA 3HM6X 5AZGA 2LGYA 4LJPB 3O65B 4ANUA 1I4GA 3RN9C 2PIAA 3NZUA 3PTFC 2YVCA 1TS2A 2PKOA 2KKCA 4JQWC 2L0FA 2L32A 3ABVB 4CHKA 1FO4A 3PRZA 1HEZE 3NY5A 1EO6A 2LGDA 3MHSD 3EFCA 5LXHA 2GMIC 5BMGA 5HHDG 3AECB 3P42A 4IC7B 2DLBA 5LXIB 2AQ3B 3GZNI 3GB1A 4XE0A 2KHWB 1PYWD 3RYTA 1E6EB 3MTNB 1KFYB 4RM9A 5L95C 4I6PA 1RRBA 2FUG1 3OJ4B 3NVZA 1FCLA 2MBQA 2HD5B 2NBUA 4NAWA 4WQOB 4X57B 3ALBA 2KJHB 3EHVA 1L5PA 1N6ZA 2CJNA 4W9HA 4IW0A 1EM7A 2LRUA 2JPHA 4USAA 5AZFA 5FK9C 2BBCA 1UWXA 1F9JA 5CHWA 2KYWA 2XBBC 1P98A 3ZLZA 5D3IB 5JH5C 2MW5A 4FXCA 4IDIA 4YSXB 1TJEA 3TCAA 1MG8A 1TKYA 4URKA 4NJCA 2KN5A 3H7PB 4B6WA 2Y5PA 5DPTA 2CU3A 2WDTB 3I3TB 2N9KA 2EMTA 2G3QB 4II2B 4ZYSA 1GJZA 1PQSA 1WJ4A 3T3OA 2H88B 5E6PA 2AQ2B 4MGKE 1EF5A 3ZTDA 3RNCC 4IWPA 3RNBC 1PGAA 2AL3A 2W82A 2WXGA 1EUVB 2LHDA 1C4AA 1GPXA 4CO7A 4XZ4A 4L2YA 4WWMA 3AMZA 2BTEA 3U8ZA 1TS5A 1V8CA 3RI7C 3AEEB 1ZE3D 2DZIA 2YEPF 2VZKB 3DVGX 1WMHA 5EDSA 1L0VB 5GXGB 1GC6A 4FLHA 1B9RA 2DYOA 3K9OB 4HKZE 3DWMA 3M3JA 1FFUA 2KWUB 4IOIE 2O2VB 1STEA 1UBIA 3IAM1 1SE2A 2K1FA 2RDBC 1UF0A 3RCZA 5IKCM 3H7SA 3OG5A 1WMHB 2OHFA 2KN4A 2BB6A 2HTME 4MDKE 2KTFA 2BYEA 2RD0A 1RWSA 1WX8A 2MJEA 2XK5A 5T8IA 3KUCB 1YOVB 2PE9A 2N9EB 3ML9A 2MA9B 4LNOA 3URYA 1ACCA 4BZAA 1FEHA 1NVID 3CSFA 4RNAA 2UWQA 2KLGA 1TZOA 1F2RC 2D2QA 4A90A 4EUTA 2M0AA 4XYCA 3TEWA 4IM0A 2JZPA 2YLMA 4TV3A 4RMAA 1C4CA 4E3CA 4L23A 3KYCD 2N7EA 2WS3B 4EZKA 3Q69A 4DHZB 1QF6A 5C2TB 2W54A 4HWIB 1FXAA 2DAJA 3VFKA 4GOCA 3SEBA 3ONSA 2NMQA 3WANA 4FA6A 1SEBD 1VZ6A 1GOZA 2WXHA 4NQLB 3APCA 2WQYB 3RFZB 4AJWA 3RNEC 4BKGA 1RAXA 4LNKA 2IPKD 1OGWA 4A55A 2JYEA 5DPRA 2ACZB 2K6DB 2LVQA 4J6IA 3O13A 2GBKA 1V2YA 1E8ZA 3HHMA 5TSSA 3AU5A 3H6NA 3P1MA 3I9V1 3ENEA 4TUUA 4RGNA 2LEKA 4OZAA 3I63C 4MGIE 3CMMB 4OZCA 5E6JA 3Q3JA 2LXAA 2ICIA 1HTQA 1WXVA 2FAZA 1JRPA 4ICVA 3ZNID 1JWBD 2FCQA 4G3XB 1BUIC 3NHEB 4IM3A 1WYGA 3M63B 3ML8A 3PO0A 3RNFC 2OJWA 3B2GA 3DHHC 1EWYC 3P63A 2M17A 2ONQA 2AL6A 1WGHA 5E6OA 3SU8X 1E8XA 3QAQA 3UGBB 3M62B 3RNAC 1OFFA 5JZEB 1WIAA 4KIKA 5G5HA 3WAMA 2IJ0A 2D3GA 2WDVB 1V97A 2DZJA 3HUIA 4FJZA 4ASWC 3UIPB 4II3B 3JVZX 2MH7A 1V81A 3R2TA 2NS5A 4KSKC 2WU5B 1MVKA 2KFKA 1TBEA 3DWGC 1F77A 3IBEA 3U52E 2LFIA 3OJ3A 1V5OA 3VVWB 3BVGA 4YTMB 1UGMA 3EUB2 1WJ6A 4HEA1 2K8BA 5FR6A 3PHXB 3PZ7A 1VZ8A 2IY0B 4NY0A 3EC8A 1HTOA 1OQRA 1I7HA 5DPSA 2IGHA 3MFGA 4MSMB 1N63A 4G0NB 1LXDA 1VZ7A 2KQ4X 2C7HA 1WGGA 1ZPSA 1GB1A 4DXFA 3EGRA 1QLBB 2QMTA 3LYYA 2BB5A 1C1YB 4GDLA 2N1VA 4IWQA 3RPFC 2E6XA 1I4XA 4TSSA 4JWUC 1N61A 5BO4B 1SE9A 4W9JA 4XGAB 1AWDA 3Q8EA 4EOYA 2ON8A 3HIZA 4YSZB 3U2SC 4NJ6A 1KJTA 4HPLB 3DVGY 4W9CA 3CSTA 2WDRB 2MBBB 1A5RA 2NPTB 5GMVA 5LLIA 2BYVE 1WX9A 4AQ7A 3PRPB 2WXMA 1A70A 3AH7A 1GG3A 3RNGC 2KJ6A 4HDQA 3KWLA 2A5UA 2M0XA 1WGRA 4MEMA 4REZA 4TQ0A 5IO9A 3AI5A 1WRDB 1EU3A 5LNK1 1XCTL 2FNJB 4LNIA 4HRSA 2KC1A 3W9CB
chains in the Genus database with same CATH topology
3CWIA 1I4GA 3W1SA 1E7PB 2PIAA 1QKZA 1SBBB 4NAMA 1TS2A 2LGIA 2PKOA 3N9YC 1PFDA 2L32A 4JE3B 4IKGA 3ABVB 1FO4A 1HEZE 1WRIA 1MHHE 3AEAB 3ZJVA 1D6EC 3WCQA 1FNUA 2QEJC 1D4BA 4YTNB 2XNAC 2KAJA 1KH0A 2KDMA 1FMAD 5BMGA 4MT5A 4KGTA 4LK0M 1V1OA 3AEBB 1V1PA 5HHDG 3AECB 2MJDA 3P42A 2W55A 3GP7A 1FXIA 5MPOA 2I2YA 1IGCA 2DLBA 4WURA 2AQ3B 2K0PA 2WXLA 3R8BA 3GB1A 3BK2A 4XE0A 2V3NA 1QOBA 1TS4A 4RGMA 3NVWA 4WAFA 1IBXA 1PYWD 1XLOA 2G1EA 1E6EB 3AM9A 1CK1A 1FCCC 1QOAA 3MC0B 2RDHA 1N62A 1IUEA 1KFYB 1SE4A 1L0YB 3AE1B 2MEKA 2FBWB 2KACA 3AE2B 2FUG1 2VZKD 3NVZA 1FCLA 3NRZA 1ZDXA 4DQOC 3CIRB 5FKAC 1L6UA 2W3RA 1L6VA 3AEGB 2SAKA 1L5PA 4LLGM 1VR9A 3BIID 1TYGB 3I57A 2JYTA 1XXGA 1CJEA 5C3JB 2CJNA 4YWGG 4ZOHC 2KMMA 1ET6A 1UGJA 1EM7A 4USAA 1C76A 5FK9C 1XLPA 2BBCA 1UWXA 3Q8CA 2WXPA 2BS4B 2Z8LA 3SFEB 2LHEA 2K3UA 3OWEB 1SJED 2J42A 5D3IB 2GRIA 4FXCA 4IDIA 3V05A 4YSXB 1TJEA 1TKYA 1C4PA 1PDXA 4NJCA 1ZXHA 4DXGA 2Y5PA 3Q8FA 2WXJA 1FFVA 1YJIA 4HJGE 1VDVA 1XLQA 4GDKB 4OW0A 3ZJTA 2CU3A 2N9KA 1UWMA 3MJ5A 2PMVA 1QOFA 4ZYSA 4N59A 2H88B 3T3OA 3KQ4A 1MHXA 1JALA 2AQ2B 1NYQA 3HVZA 4US8A 2PVOD 4GDLB 1PGAA 2W82A 2L83A 2WXGA 4KGSA 1KLGD 1NENB 1Q10A 2INPE 2IGGA 1UNSA 1C4AA 2LHDA 2RPVA 3HRDD 3NVVA 1GPXA 4L2YA 4WWMA 3AMZA 3HVDA 2BTEA 1TS5A 1ZOYB 1V8CA 3AEEB 3AV8A 1ZE3D 5HFYA 1LO5D 2RDGA 3BK1A 1T6BX 2VZKB 2YEPF 2JX5A 4XDCA 1L0VB 5GXGB 4J3OD 3TEYA 2BS2B 4YSYB 5HG2A 1B9RA 2DYOA 4ZHPA 4A8XC 1Y56A 4HKZE 3DWMA 4XDDA 1FFUA 5BMHA 1FRRA 1J7BA 4IOIE 3BYTB 1YN4A 3PZ8A 5FR3A 4P16A 1SB3C 3TUOA 1STEA 3IAM1 1E9MA 1JWUD 3VQIA 5BYSA 3BVMA 1SE2A 2Y3AA 1EU4A 3W5VB 3W5UB 1MI0A 1XCQL 2WXRA 4YT0B 1E10A 1IGDA 3L4PA 2PTLA 4C56C 4RF1A 1ENFA 3P4SB 1SXTA 2OHFA 4UDUC 3IT6B 4A6QA 2KN4A 2BB6A 2HTME 3KLSX 2J53A 3NZ3A 2IDYA 2JWUA 2L52A 2WXKA 1SJHD 2EKIA 1YMHE 1RWSA 2PLPA 3BVZA 2MJEA 2N9LA 4N58A 3LXFA 5T8IA 4OHJA 1WGKA 2WDQB 1C78A 1P7EA 1QQRA 3AE7B 5EE9A 1ACCA 3URYA 3AE5B 1FEHA 1NVID 4XWWA 2JU6X 4RNAA 1ESFA 1F0ZA 4H2AA 1JWAD 4RCOA 1TY2A 3BYYB 3P4RB 2QIEB 1TZOA 4JX1C 2NTTA 1XLNA 1JWSD 4C80A 1F2RC 2BS3B 1IBXB 4A90A 2TSSA 3NS1A 1K51A 2WXOA 1J7AA 2M0AA 1PGBA 4RF0A 1C79A 2XN9C 1WXQA 3TEWA 3ETRA 2JZPA 1K53A 1YN3A 3MP9A 3AB5A 2ZW1A 2AQ1B 1C4CA 1L4DB 4D2KA 4KKJA 4MM3B 2BYTA 1CQVA 1D5ZC 2R61A 4OZBA 1C9FA 1JMLA 1I4PA 4L23A 4R3DA 3U7ZA 3H8HA 2WS3B 3Q69A 3AEFB 4HKQA 1QF6A 3GS2A 3EA6A 5C2TB 2H89B 2NTSA 2QILA 2W54A 5EE3A 4ZRPA 1FXAA 1SSNA 3VR9B 1ET9A 1MPEA 1HZ5A 1R7SA 3FILA 4C7ZA 3SEBA 2NMQA 4RFBA 4ZHOA 1YQ4B 2GI9A 1SEBD 1VZ6A 1GOZA 2WXHA 1FNWA 5BYQA 2OEDA 4ITKA 4RGTA 2WQYB 4TMAB 4B0EA 3RFZB 3P4QB 2MJ3A 2L1AA 1KRHA 1JQ4A 1I4HA 1WWTA 4YXDB 2SEBD 1TY0A 4AS1A 1JCKB 2QSDA 1YQ3B 2JQRB 4US9A 1CZPA 2IPKD 2LJIA 1HA5A 1JWMD 1N60A 3W2DA 2Q5WD 2JYEA 1HXYD 4A55A 2M56B 1FD6A 2GB1A 1AW7A 1JROA 1K50A 1YN5A 1KTKA 3TEXA 1N5WA 1PGXA 2WXQA 5BMIA 2ACZB 3FAHA 1M4VA 3Q8BA 2IGDA 4C7YA 1SIJA 4KX6B 2Y5CA 3O13A 1YJJA 2J52A 2WP9B 5EE1A 1UUPA 2WXIA 5TSSA 4NZLB 1P7FA 1NEKB 3IT4B 3P1MA 1K52A 3I9V1 1D5MC 2W3SA 1ZUD2 2PW9A 1QILA 2N0SB 1DOYA 5G5GA 1E0ZA 3FILB 4WIPA 4ZRQA 4RGNA 2LEKA 4OZAA 1DOXA 4OZCA 1FNVA 3NVYA 3AE3B 5E6JA 1HQRD 5I4DA 2INNE 3P4PB 2ICIA 1ZDVA 3B2FA 1JRPA 3VRBB 3KWVA 1OQQA 2V4IB 1SF0A 3SR6A 1JWBD 3TSSA 1BUIC 4WQMA 3T3NA 4N6EB 1FIQA 1WYGA 3PO0A 4ARIA 1T5XD 1NYRA 1BXTA 4WH4A 1I4QA 3B2GA 2LUMA 1VRAB 2ZW0A 1DYQA 1EWYC 4O1NA 3P63A 3LB8C 5H8YE 2ONQA 1L0XB 3TEZA 2DYMA 2JXTA 5BYRA 3IAS1 4MACA 1FRDA 4OVZA 4RH6A 1OFFA 2BW2A 1J7CA 2K5PA 1QT9A 2QJLA 3SFDB 5JXVA 5EE0A 1TKEA 1JW9D 1WSPA 2WLBA 3ZJUA 5G5HA 4B0MA 1B1ZA 2IJ0A 2WDVB 3BWUD 1V97A 3HUIA 4MH8A 1N5XA 5D7GA 1AYFA 2FE8A 2MH7A 1BMLC 3UI3A 3VRAB 3C8YA 3E9SA 3R2TA 4P6VF 3BZDB 2WU5B 1MVKA 1KLUD 1TKGA 2DBYA 3AE6B 3ZGZA 3AE8B 3DWGC 3IXSA 1F77A 1EWCA 3U52E 2LFIA 2DWQA 3AN1A 2AX5A 4HROA 3FC4A 1XEEA 3BVGA 4YTMB 5D3DA 3EUB2 3ZQ4A 3E56A 4HEA1 4XWTA 3AE4B 3PZ7A 2YEPB 1PUTA 1VZ8A 3NUHB 1C77A 1V1PB 1VJKA 1OQRA 2WXFA 2J4XA 2RMMA 1I7HA 1F2RI 4L1BA 4CQNA 3ZYYX 2IGHA 5AUKA 3MFGA 1N63A 3B9JA 3MHZA 3V3XA 1VZ7A 2D5GA 2KQ4X 2WNMA 3J9CA 4LTUA 1SE3A 1GAQB 1YNTE 4JWSC 1ZPSA 1GB1A 4DXFA 3EGRA 1XO3A 1QLBB 2QMTA 1GB4A 3LYYA 2BB5A 2K22A 1L4ZB 2WU2B 2G9HD 4EE2A 1D5XC 3RPFC 2E6XA 2V0GA 1I4XA 4TSSA 1I4RA 4JWUC 1N61A 2EELA 1RFKA 4M0WA 1TS3A 4YTPB 1AN8A 1AWDA 3Q8EA 2KWDA 2ON8A 5AUIA 4YSZB 3U2SC 2PVGC 1RM6C 5H92C 2N7JA 2WDRB 1ZXIA 4KKIA 5HI1A 4PT5A 3AEDB 1DOIA 3Q8AA 2X38A 2K9XA 1ZP0B 3AE9B 1T3QA 1XF5L 1DGJA 4AQ7A 2BT6A 2WXMA 1A70A 2M19A 3AH7A 4KGRA 2WXNA 4ARCA 2V3PA 1HZ6A 1NI3A 2LMCA 1FM0D 3KWLA 1RYJA 2I38A 4REZA 4TQ0A 2B76B 4GLSC 1ROEA 1VLBA 4Q2JA 3U4EG 3R2IA 3VR8B 4JPSA 1EU3A 5LNK1 2JSVX 1QOGA 1XCTL 4NAWB 2E3TA 2CJOA 2HDEA 4HRSA 1KF6B 4TQ1A 3W9CB 4RGOS 4A9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLB A; 
#chains in the Genus database with same CATH topology
 3CWI A;  3W1S A;  1E7P B;  1QKZ A;  4NAM A;  3A1Q B;  1RFA A;  2LGI A;  1F52 A;  1HE8 A;  5AEK B;  3AEA B;  3TIX A;  3ZJV A;  1MFW A;  1P9D U;  1V80 A;  3WCQ A;  1FNU A;  2QEJ C;  3QA8 A;  1D4B A;  4AUQ C;  3RUI B;  1WZ0 A;  3I5J C;  2K39 A;  4MT5 A;  1V1O A;  3AEB B;  3R7R A;  2EMS A;  3GP7 A;  3ECI A;  3U7D A;  1IGC A;  4WUR A;  4ZRK A;  4F8C B;  3UQA A;  3X0W A;  1TS4 A;  2WX0 A;  3AM9 A;  2JF5 A;  4GN1 A;  1CK1 A;  1WXS A;  1SE4 A;  2K6Q A;  2KAC A;  4ANV A;  3DDC B;  2VZK D;  3RUL A;  4DQO C;  5FKA C;  5J18 A;  3AU4 A;  3AEG B;  1GUA B;  2SAK A;  1VR9 A;  1UD7 A;  2GBR A;  1XXG A;  1CJE A;  2N9X A;  1E90 A;  4YWG G;  1C3T A;  2KMM A;  1ET6 A;  1UGJ A;  2ZPY A;  2DYB A;  2ZCC A;  2JZZ A;  3Q8C A;  1WY8 A;  2K3U A;  3OWE B;  1SJE D;  2J42 A;  2GRI A;  1C4P A;  5KHO A;  4BVU C;  2HE7 A;  2K8H A;  1R4M B;  1YQB A;  1E8Y A;  4WJO A;  2LXC A;  1YJI A;  3ZJT A;  1WM3 A;  1J19 A;  1WJN A;  1UWM A;  4K81 A;  1ISN A;  4N59 A;  3KQ4 A;  1MHX A;  1NYQ A;  3HVZ A;  4KSL C;  4BBN F;  1KLG D;  2C7M B;  2UYZ B;  1Q10 A;  1UBQ A;  3DOW A;  3DBH B;  2R2Q A;  2KLC A;  2KDB A;  1ZOY B;  2MBH A;  4LNN A;  4NNJ B;  3BK1 A;  3TEY A;  2JX5 A;  4J3O D;  3C0R B;  2BS2 B;  2CHW A;  2JWZ A;  4ZHP A;  1Y56 A;  1Q5W B;  2L7R A;  5BMH A;  1FRR A;  4AP4 C;  1YN4 A;  5FR3 A;  3A9J B;  4HJK A;  1E9M A;  1JWU D;  5BYS A;  2JY6 A;  4GU2 A;  3ZIM A;  4C56 C;  4HDO A;  1LM8 B;  3VUY A;  2HJ8 A;  3IT6 B;  4KV2 A;  3KLS X;  2GBN A;  4OVU A;  2IDY A;  4K3B A;  2IO2 B;  3LJ3 A;  1YMH E;  3BVZ A;  2MSE D;  1UZX B;  3LXF A;  4WAA A;  3A33 B;  5L83 A;  2WDQ B;  3AE7 B;  4M00 A;  3TBL D;  2N4F A;  2FCS A;  3ZDM C;  3ZVV A;  2L8J A;  1F0Z A;  1RLF A;  4H2A A;  3D32 A;  3P4R B;  1JWS D;  4GMV A;  2BS3 B;  1H8C A;  2TSS A;  3MC8 A;  1IPG A;  1F1H A;  2WXO A;  3BY4 B;  1I42 A;  4JLC A;  1WXQ A;  3ZNG C;  2KQS A;  2M4N A;  3MP9 A;  3N3K B;  3AB5 A;  2ZW1 A;  2AQ1 B;  2KQ7 A;  1L4D B;  2DEN B;  2KZR A;  4KKJ A;  4MM3 B;  4WJQ A;  5D94 A;  1CQV A;  4OZB A;  2LUE A;  1I4P A;  3U7Z A;  3B0A A;  2J7Q B;  1GNU A;  2H89 B;  4FAD A;  3RZF A;  4ZRP A;  3VR9 B;  2K8C A;  1R7S A;  3CF6 E;  2WWZ A;  1VD2 A;  2KXJ A;  4RFB A;  1FNW A;  5BYQ A;  2OED A;  4HK2 A;  4TMA B;  4B0E A;  4C4V A;  2MJ3 A;  1JQ4 A;  2KX0 A;  1WJU A;  4AS1 A;  2J0K A;  3VXW A;  1JCK B;  1XD3 B;  2QSD A;  3KYD D;  1YQ3 B;  5DCN A;  2JQR B;  3PSE B;  3UIN B;  2M56 B;  3PT2 B;  3W1S C;  2GB1 A;  3LDZ E;  1P0R A;  1JRO A;  4RM8 A;  2WXQ A;  4FJY A;  5G2N A;  2IY1 B;  4KX6 B;  2J52 A;  3UQB A;  1P7F A;  1NEK B;  2MLB A;  3SD5 A;  1M94 A;  1K52 A;  1D5M C;  3APF A;  2W3S A;  2WHI A;  2PPH A;  4NQK E;  1DOY A;  4ZRQ A;  4WIP A;  2RR9 A;  2FCN A;  1DOX A;  1FNV A;  3NVY A;  3PGE A;  1Y8R C;  3RD2 A;  2INN E;  1K8R B;  4MSQ B;  1ZDV A;  4HLE A;  3VRB B;  4WQM A;  2X8X X;  3T3N A;  1FIQ A;  1NYR A;  2FIF A;  4WH4 A;  1I4Q A;  5D2M B;  2LUM A;  1VRA B;  2AYO B;  3H1U A;  2ZW0 A;  2N1W A;  1YX5 B;  4O1N A;  2MRP A;  3LB8 C;  5H8Y E;  4LDT B;  3TEZ A;  3IAS 1;  1SIF A;  1TTN A;  4OVZ A;  2MX2 A;  2BW2 A;  4FHK A;  2K5P A;  2QJL A;  5EE0 A;  1TKE A;  1JW9 D;  2LVP A;  1V9J A;  5G55 A;  4MH8 A;  1N5X A;  2MP2 A;  2FE8 A;  3VH3 B;  3V60 A;  1WXM A;  2NBV B;  3JSV A;  1YD8 U;  1R4N B;  2QCZ A;  4I6N B;  3NJT A;  2D07 B;  3ZGZ A;  3AE8 B;  3IXS A;  3EFU A;  1EWC A;  2KTR B;  2LAS A;  3AN1 A;  2AX5 A;  4HRO A;  3FC4 A;  1XEE A;  4ZYN A;  3ZQ4 A;  1S1Q B;  4XWT A;  3DBS A;  4GSW A;  4EEW A;  4HCN B;  3NUH B;  1V1P B;  1VJK A;  3A9J A;  1WE6 A;  3HK0 A;  5C23 A;  2WXF A;  2LGS A;  2Y5B B;  1F2R I;  4L1B A;  3ZXV A;  3ZYY X;  2Z0D B;  3MHZ A;  3V3X A;  1E5W A;  3K9P B;  3DBR B;  4JWS C;  3N32 A;  3SDL C;  2KDE B;  3DBH I;  1GB4 A;  2QC8 A;  2K22 A;  3PLV A;  3N30 A;  4EE2 A;  2DX5 B;  2DZM A;  1I4R A;  2XK5 B;  4YTP B;  4W9L A;  1AN8 A;  5AUI A;  5CTR C;  2CKH B;  1Z5S B;  5H92 C;  2BYF A;  4KKI A;  3AED B;  2K9X A;  3AE9 B;  1G6J A;  3DVN V;  1XF5 L;  1DGJ A;  4LJO B;  1QZE A;  5D6J B;  2M19 A;  4ARC A;  3TL5 A;  4BKS A;  1HZ6 A;  4GB9 A;  3FKY A;  2LMC A;  1WYW B;  3QWZ B;  2I38 A;  2B76 B;  4GLS C;  1ROE A;  1VLB A;  3R2I A;  3VR8 B;  2RGF A;  2RPQ A;  4HPM B;  2JSV X;  1QOG A;  3APD A;  2E3T A;  2D3A A;  3NOB A;  2ZNV B;  4TQ1 A;  2FCM A;  4A9A A;  4KZ0 A;  1WZ3 A;  3PRE A;  2LWP A;  5IP4 D;  4NPN A;  4W9F A;  2KNB A;  3N9Y C;  1PFD A;  4JE3 B;  4IKG A;  3KH0 A;  4PS3 A;  2BVC A;  3QC8 B;  2Z59 B;  4LNF A;  2PEA A;  5IN7 A;  4HXD A;  3VTW A;  1D6E C;  2CU1 A;  1WX7 A;  2XNA C;  4W9K A;  1T0R C;  2KDM A;  2IZV B;  1WF9 A;  4KGT A;  4LK0 M;  1V1P A;  2KAN A;  4NJ7 A;  3H9D A;  2PJH A;  1FXI A;  2I2Y A;  4ACF A;  5CHF A;  3R8B A;  2V3N A;  1QOB A;  4RGM A;  3NVW A;  1IBX A;  1XLO A;  2G1E A;  4B95 A;  2KMA A;  5J17 A;  4C00 A;  2WGS A;  2MEK A;  4WJN A;  4ZDV A;  3NRZ A;  1GC7 A;  2LJ5 A;  2C5L C;  3N20 C;  2BWE S;  3QAR A;  5JHB A;  1TYG B;  3I57 A;  2JYT A;  2KC2 A;  4N9F 4;  4ZOH C;  1WXA A;  3PZD A;  1C76 A;  1XLP A;  2WXP A;  2Z8L A;  4QAY A;  2LHE A;  1Q0W B;  3V05 A;  1WGD A;  2O6V B;  3DHG C;  4DXG A;  2CR5 A;  4ANX A;  1FFV A;  2V1Y A;  1XLQ A;  4GDK B;  4BOZ B;  2DAF A;  3VTV A;  4TKN A;  4W9E A;  3EEC A;  2PMV A;  1QOF A;  1V5T A;  3ZKJ C;  1V86 A;  2ZJD A;  2L0T A;  4US8 A;  2PVO D;  4GDL B;  2KTR A;  4KGS A;  1NEN B;  2GBM A;  2INP E;  2IGG A;  2RPV A;  3HRD D;  2WX1 A;  3NVV A;  4DXA B;  3HVD A;  3WAP A;  5HFY A;  1LO5 D;  1T6B X;  3A4R A;  4YSY B;  5HG2 A;  1OEY A;  1E7U A;  3PZ8 A;  4P16 A;  2D3C A;  4BBN C;  1SB3 C;  2MBE A;  4DDG D;  4LDT D;  1KOT A;  1Z2M A;  1ZKH A;  3BVM A;  2Y3A A;  1KM7 A;  1EU4 A;  4IWO A;  1MI0 A;  1JRU A;  1XCQ L;  3V62 A;  2WXR A;  3WIM A;  2PTL A;  1ENF A;  3P4S B;  1SXT A;  4EFO A;  4UDU C;  4A6Q A;  2G4D B;  1FXT B;  2LVO A;  2L52 A;  2WXK A;  3V6E B;  1E7V A;  1SJH D;  2EKI A;  4PS8 A;  2N9L A;  4M0W B;  2N7D A;  4K3C A;  3UIO B;  1P7E A;  5EE9 A;  1FPY A;  4MM3 A;  2JU6 X;  4BOS C;  2MHJ A;  3L0W B;  4RCO A;  3KUD B;  1TY2 A;  4M8M A;  3BYY B;  2LZ6 A;  2QIE B;  4JIO U;  2NTT A;  1XLN A;  2IO1 B;  4C80 A;  3V6C B;  3MC9 A;  3NG0 A;  2MQJ A;  1K51 A;  4DK5 A;  2C7N B;  2D11 A;  4RF0 A;  1WH3 A;  3ETR A;  4BAX A;  1K53 A;  1YN3 A;  3VTU A;  4A3P A;  1TIF A;  1D3Z A;  4D2K A;  2BYT A;  3M95 A;  2R61 A;  1C9F A;  4DHZ E;  3L08 A;  2A4Z A;  2J0J A;  3AEF B;  4HKQ A;  3GS2 A;  1J8C A;  3EA6 A;  2LD9 A;  2NTS A;  3WAL A;  1SSN A;  2G45 B;  1ET9 A;  1MPE A;  5TR5 A;  2GLS A;  3ZXR A;  3W1Y A;  3NZS A;  2XEW A;  3P4Q B;  2L1A A;  1WWT A;  4YXD B;  1TY0 A;  2M8S A;  3ZRF A;  4IG7 B;  4US9 A;  1CZP A;  3JYU A;  2LJI A;  1HA5 A;  1JWM D;  2KFJ A;  3W2D A;  4MEL A;  2KOX A;  4AJY B;  1AW7 A;  1K50 A;  2B3A A;  3TEX A;  1L7Y A;  5BMI A;  3FAH A;  1M4V A;  2GOW A;  3Q8B A;  2IGD A;  1SIJ A;  2R2O A;  1NI2 A;  3UF8 A;  2M1M A;  2VRR B;  3ZRC A;  1ZUD 2;  2MCN B;  1QIL A;  5G5G A;  1E0Z A;  2IND C;  2NBW B;  1WM2 A;  5IOI A;  5I4D A;  3A9K B;  3P4P B;  3B2F A;  1WR1 A;  2LGX A;  4IUM B;  2JXX A;  3KWV A;  1OQQ A;  2V4I B;  3SR6 A;  3TSS A;  4N6E B;  4ARI A;  1LFD A;  3Q3F A;  3N1Y C;  2CHX A;  2O6V D;  4P1C C;  2DNF A;  1DYQ A;  4EZJ A;  3WA0 A;  4S0R A;  4FUL A;  2PE6 B;  2DYM A;  2JXT A;  4GIV A;  2KVZ A;  1OEY J;  2ZVO A;  4MAC A;  4RH6 A;  3WAO A;  2L05 A;  5JXV A;  1WSP A;  1B1Z A;  3B08 A;  1WGY A;  3QCA A;  4DDI D;  4DHJ B;  1J0G A;  3GE3 C;  3TJP A;  3L54 A;  2NR2 A;  3UI3 A;  4WJP A;  2ASQ A;  3C8Y A;  4P6V F;  3BZD B;  3QHT A;  2DBY A;  3AE6 B;  3SHQ A;  3ZNZ B;  1TGZ B;  3PLU A;  2G4S A;  1LQB A;  4WWO A;  1XQQ A;  3HM3 A;  4CYE A;  3E56 A;  3AE4 B;  2BPS A;  2OJR A;  4K7U A;  3DQV A;  2LRW A;  2J4X A;  2ZNV C;  2KDI A;  4AOF A;  1ZW7 A;  3ZO5 B;  5AUK A;  3B9J A;  3T8M A;  3TMP B;  1IYF A;  2D5G A;  2WNM A;  4LTU A;  1YNT E;  3A1Q A;  3DBR I;  4I6L B;  1BT0 A;  2WU2 B;  2G9H D;  2KVR A;  3VH4 B;  1AAR A;  2MP2 B;  2DHZ A;  3PVL A;  4PK1 A;  4MH0 E;  2EEL A;  1RFK A;  2MBO A;  1ZXI A;  4FN2 A;  3R3M A;  5HI1 A;  2X38 A;  1EF1 A;  2ZZP B;  2BT6 A;  4HVB A;  2V3P A;  1NI3 A;  1FM0 D;  4G11 A;  1V49 A;  2I1J A;  3RT3 B;  1OQY A;  4BFR A;  4Q2J A;  4JPS A;  4NAW B;  2KD0 A;  1CMX B;  2CJO A;  2HDE A;  1KF6 B;  4E71 A;  3GOE A;  4RGO S;  4HPP A;  1MJD A;  1SBB B;  3Q3M C;  5DPW A;  3VUX A;  2JVC A;  1WRI A;  1MHH E;  3S2A A;  3B1L X;  1R4N I;  1L2N A;  1SGH A;  4YTN B;  2KAJ A;  1WI0 A;  1KH0 A;  1FMA D;  3KW5 B;  2MJD A;  2W55 A;  5MPO A;  2V9H A;  4M01 A;  2K0P A;  2WXL A;  3MJW A;  3VDZ A;  4FBJ B;  4C4V B;  3BK2 A;  4WAF A;  1FCC C;  1QOA A;  2AEH A;  2NPT A;  3N1Z C;  2RDH A;  1N62 A;  1IUE A;  2W9N A;  3MC0 B;  1L0Y B;  3AE1 B;  2FBW B;  3DCG A;  3AE2 B;  1I35 A;  1ZDX A;  1WE7 A;  2C9W B;  4MJS A;  3PV1 A;  3CIR B;  1L6U A;  2JZ3 B;  2REX A;  4ANW A;  2W3R A;  3ZTC A;  1L6V A;  4LLG M;  3BII D;  1WFY A;  5C3J B;  3DVN U;  4MJS B;  3VAW A;  4DBG A;  3PS6 A;  2KMC A;  2BS4 B;  3DPD A;  2O6V A;  3SFE B;  5JHA A;  4DWF A;  3ZUN A;  1KLV A;  2JUO A;  4K7W A;  1PDX A;  1ZXH A;  2KX3 A;  3Q8F A;  2HTH A;  2WXJ A;  1IP9 A;  4HJG E;  1VDV A;  4OW0 A;  3MJ5 A;  1JAL A;  4KVG B;  2L83 A;  3QQ8 B;  4W9D A;  2KDF B;  2K25 A;  4JGH B;  1YIW A;  2L3Z A;  1UNS A;  4W9G A;  2KFK B;  4EKU A;  2IO3 B;  2KT7 A;  4BKS D;  4P7I A;  3AV8 A;  2RDG A;  4XDC A;  3ZDT A;  1V6E A;  1XT9 B;  3GZN B;  2OOB B;  4A8X C;  4XDD A;  4ZRI A;  1J7B A;  2NVU I;  1NBF C;  3BYT B;  4GDK A;  3TUO A;  2FUH B;  1UEL A;  4JL9 A;  4LCD E;  2N9P C;  3VQI A;  3W5V B;  3W5U B;  3L13 A;  4YT0 B;  1E10 A;  5HKH A;  4HCP B;  1IGD A;  3L4P A;  1S3S G;  4RF1 A;  2WYQ A;  4KDL B;  2V3S A;  3N1X C;  2J53 A;  3NZ3 A;  1TT5 B;  2JWU A;  4ZRJ A;  2UU7 A;  1T0Y A;  2GBJ A;  2PLP A;  4B9K A;  4N58 A;  2LI5 A;  4OHJ A;  3V61 A;  1WGK A;  5C1Z A;  1C78 A;  1U4A A;  2D10 A;  2AWT A;  1QQR A;  3AE5 B;  3VHT C;  4XWW A;  1ESF A;  1JWA D;  4F7Z A;  4JX1 C;  2RSU A;  2JRI B;  5IA7 A;  1IBX B;  3NS1 A;  1J7A A;  1NDD A;  3OAW A;  3QK0 A;  1PGB A;  2KJR A;  1C79 A;  2XN9 C;  2IO0 B;  1D5Z C;  1JML A;  4R3D A;  2ZPN A;  3H8H A;  2VH2 A;  3IG3 A;  2BKR B;  2QIL A;  5EE3 A;  4WWN A;  2Z0E B;  4C7Z A;  1HZ5 A;  3FIL A;  4EZL A;  4ZHO A;  1YQ4 B;  2GI9 A;  4PS7 A;  1R4M I;  4ITK A;  4RGT A;  1WR6 E;  1KRH A;  2ZVN A;  5J2R A;  1I4H A;  2ZEQ A;  2SEB D;  3VUW A;  4MGY E;  3A4S C;  3KUZ A;  2HJ1 A;  1P3Q U;  2BF8 B;  3DBL B;  3DHI C;  1N60 A;  5CHV C;  2Q5W D;  3Q3N C;  1HXY D;  2O2V A;  1FD6 A;  4PYZ A;  3DBL I;  1YN5 A;  1KTK A;  1TZ1 A;  3OLM D;  1N5W A;  1PGX A;  3R66 C;  4K7S A;  3RMK C;  4WWP A;  3ZW3 A;  4FJV B;  4C7Y A;  4K1R B;  2Y5C A;  1YJJ A;  3IVF A;  2WP9 B;  5EE1 A;  3R7Q A;  1UUP A;  3PHW B;  2WXI A;  4NZL B;  3IT4 B;  2PW9 A;  2NCN A;  2N0S B;  3FIL B;  4A20 A;  2DZK A;  2BWF A;  3AE3 B;  3IFW B;  1HQR D;  2V4L A;  3QJZ A;  2KO3 A;  3A9K A;  5AZH A;  3AXC A;  2JRH A;  1SF0 A;  2BKF A;  2CS4 A;  1T5X D;  4MGZ E;  1BXT A;  4E74 A;  4PYU A;  1OTR B;  4M8N A;  1YX6 B;  1YJ1 A;  1L0X B;  5BYR A;  4AWJ A;  4ICU A;  1LGR A;  2KWC A;  2VH1 A;  1FRD A;  1J7C A;  3L17 A;  2MWS B;  4F1S A;  4G50 A;  1UH6 A;  3PRM B;  1QT9 A;  5CX3 A;  3SFD B;  2WLB A;  3BIN A;  3ZJU A;  1VCB A;  4B0M A;  4DHJ D;  3BWU D;  3Q3O C;  1Q1O A;  1P1A A;  3Q6B A;  5D7G A;  4GGQ A;  1AYF A;  2QHO A;  4FHJ A;  1BML C;  3AUL A;  1T0S C;  3VRA B;  3Q14 C;  3E9S A;  1KLU D;  2KK8 A;  1TKG A;  3GE8 C;  1H4R A;  1MG4 A;  3X23 A;  3L10 B;  3JSV B;  2DWQ A;  2C60 A;  3NS8 A;  5D3D A;  2ZCB A;  2YEP B;  1ZGU B;  1PUT A;  4BKT A;  2BQQ A;  4S17 A;  3RZW C;  1C77 A;  3ZNH B;  5E6N A;  5IAA C;  2FID A;  2RMM A;  2L76 A;  2L00 B;  4M02 A;  4CQN A;  4A3O A;  2EKE C;  3H7P A;  3KVF B;  4OVV A;  3L16 A;  2QDF A;  4P1B C;  4XC2 A;  3J9C A;  4GXB A;  1SE3 A;  1GAQ B;  1E8W A;  1XO3 A;  5KHQ A;  2KWV B;  1L4Z B;  2INC C;  2CHZ A;  3U30 A;  1D5X C;  2V0G A;  2JT4 B;  4M0W A;  1TS3 A;  2BGF A;  4KIK B;  1T0Q C;  2KWD A;  3P2B A;  2IBI B;  1X1M A;  3T9L A;  2PVG C;  1RM6 C;  4KZC A;  2N7J A;  4KDI C;  4IM2 A;  3Q2A C;  3QIJ A;  4PT5 A;  1DOI A;  3Q8A A;  3C19 A;  1ZP0 B;  1T3Q A;  4XX5 A;  4KGR A;  2WXN A;  2D3B A;  2J0M A;  2I1K A;  3IHP C;  1RYJ A;  3U4E G;  2IYD B;  4W9I A;  3JW0 X;  3QX1 A;  4YL8 A;  3PPA A;  3HM6 X;  5AZG A;  2LGY A;  4LJP B;  3O65 B;  4ANU A;  1I4G A;  3RN9 C;  2PIA A;  3NZU A;  3PTF C;  2YVC A;  1TS2 A;  2PKO A;  2KKC A;  4JQW C;  2L0F A;  2L32 A;  3ABV B;  4CHK A;  1FO4 A;  3PRZ A;  1HEZ E;  3NY5 A;  1EO6 A;  2LGD A;  3MHS D;  3EFC A;  5LXH A;  2GMI C;  5BMG A;  5HHD G;  3AEC B;  3P42 A;  4IC7 B;  2DLB A;  5LXI B;  2AQ3 B;  3GZN I;  3GB1 A;  4XE0 A;  2KHW B;  1PYW D;  3RYT A;  1E6E B;  3MTN B;  1KFY B;  4RM9 A;  5L95 C;  4I6P A;  1RRB A;  2FUG 1;  3OJ4 B;  3NVZ A;  1FCL A;  2MBQ A;  2HD5 B;  2NBU A;  4NAW A;  4WQO B;  4X57 B;  3ALB A;  2KJH B;  3EHV A;  1L5P A;  1N6Z A;  2CJN A;  4W9H A;  4IW0 A;  1EM7 A;  2LRU A;  2JPH A;  4USA A;  5AZF A;  5FK9 C;  2BBC A;  1UWX A;  1F9J A;  5CHW A;  2KYW A;  2XBB C;  1P98 A;  3ZLZ A;  5D3I B;  5JH5 C;  2MW5 A;  4FXC A;  4IDI A;  4YSX B;  1TJE A;  3TCA A;  1MG8 A;  1TKY A;  4URK A;  4NJC A;  2KN5 A;  3H7P B;  4B6W A;  2Y5P A;  5DPT A;  2CU3 A;  2WDT B;  3I3T B;  2N9K A;  2EMT A;  2G3Q B;  4II2 B;  4ZYS A;  1GJZ A;  1PQS A;  1WJ4 A;  3T3O A;  2H88 B;  5E6P A;  2AQ2 B;  4MGK E;  1EF5 A;  3ZTD A;  3RNC C;  4IWP A;  3RNB C;  1PGA A;  2AL3 A;  2W82 A;  2WXG A;  1EUV B;  2LHD A;  1C4A A;  1GPX A;  4CO7 A;  4XZ4 A;  4L2Y A;  4WWM A;  3AMZ A;  2BTE A;  3U8Z A;  1TS5 A;  1V8C A;  3RI7 C;  3AEE B;  1ZE3 D;  2DZI A;  2YEP F;  2VZK B;  3DVG X;  1WMH A;  5EDS A;  1L0V B;  5GXG B;  1GC6 A;  4FLH A;  1B9R A;  2DYO A;  3K9O B;  4HKZ E;  3DWM A;  3M3J A;  1FFU A;  2KWU B;  4IOI E;  2O2V B;  1STE A;  1UBI A;  3IAM 1;  1SE2 A;  2K1F A;  2RDB C;  1UF0 A;  3RCZ A;  5IKC M;  3H7S A;  3OG5 A;  1WMH B;  2OHF A;  2KN4 A;  2BB6 A;  2HTM E;  4MDK E;  2KTF A;  2BYE A;  2RD0 A;  1RWS A;  1WX8 A;  2MJE A;  2XK5 A;  5T8I A;  3KUC B;  1YOV B;  2PE9 A;  2N9E B;  3ML9 A;  2MA9 B;  4LNO A;  3URY A;  1ACC A;  4BZA A;  1FEH A;  1NVI D;  3CSF A;  4RNA A;  2UWQ A;  2KLG A;  1TZO A;  1F2R C;  2D2Q A;  4A90 A;  4EUT A;  2M0A A;  4XYC A;  3TEW A;  4IM0 A;  2JZP A;  2YLM A;  4TV3 A;  4RMA A;  1C4C A;  4E3C A;  4L23 A;  3KYC D;  2N7E A;  2WS3 B;  4EZK A;  3Q69 A;  4DHZ B;  1QF6 A;  5C2T B;  2W54 A;  4HWI B;  1FXA A;  2DAJ A;  3VFK A;  4GOC A;  3SEB A;  3ONS A;  2NMQ A;  3WAN A;  4FA6 A;  1SEB D;  1VZ6 A;  1GOZ A;  2WXH A;  4NQL B;  3APC A;  2WQY B;  3RFZ B;  4AJW A;  3RNE C;  4BKG A;  1RAX A;  4LNK A;  2IPK D;  1OGW A;  4A55 A;  2JYE A;  5DPR A;  2ACZ B;  2K6D B;  2LVQ A;  4J6I A;  3O13 A;  2GBK A;  1V2Y A;  1E8Z A;  3HHM A;  5TSS A;  3AU5 A;  3H6N A;  3P1M A;  3I9V 1;  3ENE A;  4TUU A;  4RGN A;  2LEK A;  4OZA A;  3I63 C;  4MGI E;  3CMM B;  4OZC A;  5E6J A;  3Q3J A;  2LXA A;  2ICI A;  1HTQ A;  1WXV A;  2FAZ A;  1JRP A;  4ICV A;  3ZNI D;  1JWB D;  2FCQ A;  4G3X B;  1BUI C;  3NHE B;  4IM3 A;  1WYG A;  3M63 B;  3ML8 A;  3PO0 A;  3RNF C;  2OJW A;  3B2G A;  3DHH C;  1EWY C;  3P63 A;  2M17 A;  2ONQ A;  2AL6 A;  1WGH A;  5E6O A;  3SU8 X;  1E8X A;  3QAQ A;  3UGB B;  3M62 B;  3RNA C;  1OFF A;  5JZE B;  1WIA A;  4KIK A;  5G5H A;  3WAM A;  2IJ0 A;  2D3G A;  2WDV B;  1V97 A;  2DZJ A;  3HUI A;  4FJZ A;  4ASW C;  3UIP B;  4II3 B;  3JVZ X;  2MH7 A;  1V81 A;  3R2T A;  2NS5 A;  4KSK C;  2WU5 B;  1MVK A;  2KFK A;  1TBE A;  3DWG C;  1F77 A;  3IBE A;  3U52 E;  2LFI A;  3OJ3 A;  1V5O A;  3VVW B;  3BVG A;  4YTM B;  1UGM A;  3EUB 2;  1WJ6 A;  4HEA 1;  2K8B A;  5FR6 A;  3PHX B;  3PZ7 A;  1VZ8 A;  2IY0 B;  4NY0 A;  3EC8 A;  1HTO A;  1OQR A;  1I7H A;  5DPS A;  2IGH A;  3MFG A;  4MSM B;  1N63 A;  4G0N B;  1LXD A;  1VZ7 A;  2KQ4 X;  2C7H A;  1WGG A;  1ZPS A;  1GB1 A;  4DXF A;  3EGR A;  1QLB B;  2QMT A;  3LYY A;  2BB5 A;  1C1Y B;  4GDL A;  2N1V A;  4IWQ A;  3RPF C;  2E6X A;  1I4X A;  4TSS A;  4JWU C;  1N61 A;  5BO4 B;  1SE9 A;  4W9J A;  4XGA B;  1AWD A;  3Q8E A;  4EOY A;  2ON8 A;  3HIZ A;  4YSZ B;  3U2S C;  4NJ6 A;  1KJT A;  4HPL B;  3DVG Y;  4W9C A;  3CST A;  2WDR B;  2MBB B;  1A5R A;  2NPT B;  5GMV A;  5LLI A;  2BYV E;  1WX9 A;  4AQ7 A;  3PRP B;  2WXM A;  1A70 A;  3AH7 A;  1GG3 A;  3RNG C;  2KJ6 A;  4HDQ A;  3KWL A;  2A5U A;  2M0X A;  1WGR A;  4MEM A;  4REZ A;  4TQ0 A;  5IO9 A;  3AI5 A;  1WRD B;  1EU3 A;  5LNK 1;  1XCT L;  2FNJ B;  4LNI A;  4HRS A;  2KC1 A;  3W9C B; 
#chains in the Genus database with same CATH homology
 3CWI A;  1I4G A;  3W1S A;  1E7P B;  2PIA A;  1QKZ A;  1SBB B;  4NAM A;  1TS2 A;  2LGI A;  2PKO A;  3N9Y C;  1PFD A;  2L32 A;  4JE3 B;  4IKG A;  3ABV B;  1FO4 A;  1HEZ E;  1WRI A;  1MHH E;  3AEA B;  3ZJV A;  1D6E C;  3WCQ A;  1FNU A;  2QEJ C;  1D4B A;  4YTN B;  2XNA C;  2KAJ A;  1KH0 A;  2KDM A;  1FMA D;  5BMG A;  4MT5 A;  4KGT A;  4LK0 M;  1V1O A;  3AEB B;  1V1P A;  5HHD G;  3AEC B;  2MJD A;  3P42 A;  2W55 A;  3GP7 A;  1FXI A;  5MPO A;  2I2Y A;  1IGC A;  2DLB A;  4WUR A;  2AQ3 B;  2K0P A;  2WXL A;  3R8B A;  3GB1 A;  3BK2 A;  4XE0 A;  2V3N A;  1QOB A;  1TS4 A;  4RGM A;  3NVW A;  4WAF A;  1IBX A;  1PYW D;  1XLO A;  2G1E A;  1E6E B;  3AM9 A;  1CK1 A;  1FCC C;  1QOA A;  3MC0 B;  2RDH A;  1N62 A;  1IUE A;  1KFY B;  1SE4 A;  1L0Y B;  3AE1 B;  2MEK A;  2FBW B;  2KAC A;  3AE2 B;  2FUG 1;  2VZK D;  3NVZ A;  1FCL A;  3NRZ A;  1ZDX A;  4DQO C;  3CIR B;  5FKA C;  1L6U A;  2W3R A;  1L6V A;  3AEG B;  2SAK A;  1L5P A;  4LLG M;  1VR9 A;  3BII D;  1TYG B;  3I57 A;  2JYT A;  1XXG A;  1CJE A;  5C3J B;  2CJN A;  4YWG G;  4ZOH C;  2KMM A;  1ET6 A;  1UGJ A;  1EM7 A;  4USA A;  1C76 A;  5FK9 C;  1XLP A;  2BBC A;  1UWX A;  3Q8C A;  2WXP A;  2BS4 B;  2Z8L A;  3SFE B;  2LHE A;  2K3U A;  3OWE B;  1SJE D;  2J42 A;  5D3I B;  2GRI A;  4FXC A;  4IDI A;  3V05 A;  4YSX B;  1TJE A;  1TKY A;  1C4P A;  1PDX A;  4NJC A;  1ZXH A;  4DXG A;  2Y5P A;  3Q8F A;  2WXJ A;  1FFV A;  1YJI A;  4HJG E;  1VDV A;  1XLQ A;  4GDK B;  4OW0 A;  3ZJT A;  2CU3 A;  2N9K A;  1UWM A;  3MJ5 A;  2PMV A;  1QOF A;  4ZYS A;  4N59 A;  2H88 B;  3T3O A;  3KQ4 A;  1MHX A;  1JAL A;  2AQ2 B;  1NYQ A;  3HVZ A;  4US8 A;  2PVO D;  4GDL B;  1PGA A;  2W82 A;  2L83 A;  2WXG A;  4KGS A;  1KLG D;  1NEN B;  1Q10 A;  2INP E;  2IGG A;  1UNS A;  1C4A A;  2LHD A;  2RPV A;  3HRD D;  3NVV A;  1GPX A;  4L2Y A;  4WWM A;  3AMZ A;  3HVD A;  2BTE A;  1TS5 A;  1ZOY B;  1V8C A;  3AEE B;  3AV8 A;  1ZE3 D;  5HFY A;  1LO5 D;  2RDG A;  3BK1 A;  1T6B X;  2VZK B;  2YEP F;  2JX5 A;  4XDC A;  1L0V B;  5GXG B;  4J3O D;  3TEY A;  2BS2 B;  4YSY B;  5HG2 A;  1B9R A;  2DYO A;  4ZHP A;  4A8X C;  1Y56 A;  4HKZ E;  3DWM A;  4XDD A;  1FFU A;  5BMH A;  1FRR A;  1J7B A;  4IOI E;  3BYT B;  1YN4 A;  3PZ8 A;  5FR3 A;  4P16 A;  1SB3 C;  3TUO A;  1STE A;  3IAM 1;  1E9M A;  1JWU D;  3VQI A;  5BYS A;  3BVM A;  1SE2 A;  2Y3A A;  1EU4 A;  3W5V B;  3W5U B;  1MI0 A;  1XCQ L;  2WXR A;  4YT0 B;  1E10 A;  1IGD A;  3L4P A;  2PTL A;  4C56 C;  4RF1 A;  1ENF A;  3P4S B;  1SXT A;  2OHF A;  4UDU C;  3IT6 B;  4A6Q A;  2KN4 A;  2BB6 A;  2HTM E;  3KLS X;  2J53 A;  3NZ3 A;  2IDY A;  2JWU A;  2L52 A;  2WXK A;  1SJH D;  2EKI A;  1YMH E;  1RWS A;  2PLP A;  3BVZ A;  2MJE A;  2N9L A;  4N58 A;  3LXF A;  5T8I A;  4OHJ A;  1WGK A;  2WDQ B;  1C78 A;  1P7E A;  1QQR A;  3AE7 B;  5EE9 A;  1ACC A;  3URY A;  3AE5 B;  1FEH A;  1NVI D;  4XWW A;  2JU6 X;  4RNA A;  1ESF A;  1F0Z A;  4H2A A;  1JWA D;  4RCO A;  1TY2 A;  3BYY B;  3P4R B;  2QIE B;  1TZO A;  4JX1 C;  2NTT A;  1XLN A;  1JWS D;  4C80 A;  1F2R C;  2BS3 B;  1IBX B;  4A90 A;  2TSS A;  3NS1 A;  1K51 A;  2WXO A;  1J7A A;  2M0A A;  1PGB A;  4RF0 A;  1C79 A;  2XN9 C;  1WXQ A;  3TEW A;  3ETR A;  2JZP A;  1K53 A;  1YN3 A;  3MP9 A;  3AB5 A;  2ZW1 A;  2AQ1 B;  1C4C A;  1L4D B;  4D2K A;  4KKJ A;  4MM3 B;  2BYT A;  1CQV A;  1D5Z C;  2R61 A;  4OZB A;  1C9F A;  1JML A;  1I4P A;  4L23 A;  4R3D A;  3U7Z A;  3H8H A;  2WS3 B;  3Q69 A;  3AEF B;  4HKQ A;  1QF6 A;  3GS2 A;  3EA6 A;  5C2T B;  2H89 B;  2NTS A;  2QIL A;  2W54 A;  5EE3 A;  4ZRP A;  1FXA A;  1SSN A;  3VR9 B;  1ET9 A;  1MPE A;  1HZ5 A;  1R7S A;  3FIL A;  4C7Z A;  3SEB A;  2NMQ A;  4RFB A;  4ZHO A;  1YQ4 B;  2GI9 A;  1SEB D;  1VZ6 A;  1GOZ A;  2WXH A;  1FNW A;  5BYQ A;  2OED A;  4ITK A;  4RGT A;  2WQY B;  4TMA B;  4B0E A;  3RFZ B;  3P4Q B;  2MJ3 A;  2L1A A;  1KRH A;  1JQ4 A;  1I4H A;  1WWT A;  4YXD B;  2SEB D;  1TY0 A;  4AS1 A;  1JCK B;  2QSD A;  1YQ3 B;  2JQR B;  4US9 A;  1CZP A;  2IPK D;  2LJI A;  1HA5 A;  1JWM D;  1N60 A;  3W2D A;  2Q5W D;  2JYE A;  1HXY D;  4A55 A;  2M56 B;  1FD6 A;  2GB1 A;  1AW7 A;  1JRO A;  1K50 A;  1YN5 A;  1KTK A;  3TEX A;  1N5W A;  1PGX A;  2WXQ A;  5BMI A;  2ACZ B;  3FAH A;  1M4V A;  3Q8B A;  2IGD A;  4C7Y A;  1SIJ A;  4KX6 B;  2Y5C A;  3O13 A;  1YJJ A;  2J52 A;  2WP9 B;  5EE1 A;  1UUP A;  2WXI A;  5TSS A;  4NZL B;  1P7F A;  1NEK B;  3IT4 B;  3P1M A;  1K52 A;  3I9V 1;  1D5M C;  2W3S A;  1ZUD 2;  2PW9 A;  1QIL A;  2N0S B;  1DOY A;  5G5G A;  1E0Z A;  3FIL B;  4WIP A;  4ZRQ A;  4RGN A;  2LEK A;  4OZA A;  1DOX A;  4OZC A;  1FNV A;  3NVY A;  3AE3 B;  5E6J A;  1HQR D;  5I4D A;  2INN E;  3P4P B;  2ICI A;  1ZDV A;  3B2F A;  1JRP A;  3VRB B;  3KWV A;  1OQQ A;  2V4I B;  1SF0 A;  3SR6 A;  1JWB D;  3TSS A;  1BUI C;  4WQM A;  3T3N A;  4N6E B;  1FIQ A;  1WYG A;  3PO0 A;  4ARI A;  1T5X D;  1NYR A;  1BXT A;  4WH4 A;  1I4Q A;  3B2G A;  2LUM A;  1VRA B;  2ZW0 A;  1DYQ A;  1EWY C;  4O1N A;  3P63 A;  3LB8 C;  5H8Y E;  2ONQ A;  1L0X B;  3TEZ A;  2DYM A;  2JXT A;  5BYR A;  3IAS 1;  4MAC A;  1FRD A;  4OVZ A;  4RH6 A;  1OFF A;  2BW2 A;  1J7C A;  2K5P A;  1QT9 A;  2QJL A;  3SFD B;  5JXV A;  5EE0 A;  1TKE A;  1JW9 D;  1WSP A;  2WLB A;  3ZJU A;  5G5H A;  4B0M A;  1B1Z A;  2IJ0 A;  2WDV B;  3BWU D;  1V97 A;  3HUI A;  4MH8 A;  1N5X A;  5D7G A;  1AYF A;  2FE8 A;  2MH7 A;  1BML C;  3UI3 A;  3VRA B;  3C8Y A;  3E9S A;  3R2T A;  4P6V F;  3BZD B;  2WU5 B;  1MVK A;  1KLU D;  1TKG A;  2DBY A;  3AE6 B;  3ZGZ A;  3AE8 B;  3DWG C;  3IXS A;  1F77 A;  1EWC A;  3U52 E;  2LFI A;  2DWQ A;  3AN1 A;  2AX5 A;  4HRO A;  3FC4 A;  1XEE A;  3BVG A;  4YTM B;  5D3D A;  3EUB 2;  3ZQ4 A;  3E56 A;  4HEA 1;  4XWT A;  3AE4 B;  3PZ7 A;  2YEP B;  1PUT A;  1VZ8 A;  3NUH B;  1C77 A;  1V1P B;  1VJK A;  1OQR A;  2WXF A;  2J4X A;  2RMM A;  1I7H A;  1F2R I;  4L1B A;  4CQN A;  3ZYY X;  2IGH A;  5AUK A;  3MFG A;  1N63 A;  3B9J A;  3MHZ A;  3V3X A;  1VZ7 A;  2D5G A;  2KQ4 X;  2WNM A;  3J9C A;  4LTU A;  1SE3 A;  1GAQ B;  1YNT E;  4JWS C;  1ZPS A;  1GB1 A;  4DXF A;  3EGR A;  1XO3 A;  1QLB B;  2QMT A;  1GB4 A;  3LYY A;  2BB5 A;  2K22 A;  1L4Z B;  2WU2 B;  2G9H D;  4EE2 A;  1D5X C;  3RPF C;  2E6X A;  2V0G A;  1I4X A;  4TSS A;  1I4R A;  4JWU C;  1N61 A;  2EEL A;  1RFK A;  4M0W A;  1TS3 A;  4YTP B;  1AN8 A;  1AWD A;  3Q8E A;  2KWD A;  2ON8 A;  5AUI A;  4YSZ B;  3U2S C;  2PVG C;  1RM6 C;  5H92 C;  2N7J A;  2WDR B;  1ZXI A;  4KKI A;  5HI1 A;  4PT5 A;  3AED B;  1DOI A;  3Q8A A;  2X38 A;  2K9X A;  1ZP0 B;  3AE9 B;  1T3Q A;  1XF5 L;  1DGJ A;  4AQ7 A;  2BT6 A;  2WXM A;  1A70 A;  2M19 A;  3AH7 A;  4KGR A;  2WXN A;  4ARC A;  2V3P A;  1HZ6 A;  1NI3 A;  2LMC A;  1FM0 D;  3KWL A;  1RYJ A;  2I38 A;  4REZ A;  4TQ0 A;  2B76 B;  4GLS C;  1ROE A;  1VLB A;  4Q2J A;  3U4E G;  3R2I A;  3VR8 B;  4JPS A;  1EU3 A;  5LNK 1;  2JSV X;  1QOG A;  1XCT L;  4NAW B;  2E3T A;  2CJO A;  2HDE A;  4HRS A;  1KF6 B;  4TQ1 A;  3W9C B;  4RGO S;  4A9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...