2DLBA

X-ray crystal structure of protein yopt from bacillus subtilis. northeast structural genomics consortium target sr412
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of hypothetical protein from Bacillus subtilis O34498 at the resolution of 1.2A. NESG target SR412
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords yopT
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09467 Yopt Hypothetical protein Yopt
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.330 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dlbA00
2DLBA
chains in the Genus database with same CATH superfamily
2INNE 2VH2A 2FCMA 3QCAA 5D3IB 2BWFA 4ZOHC 2AEHA 3VDZA 4A55A 2K1FA 3L08A 3RNEC 5HFYA 1DOYA 3EC8A 3H7PB 3SFEB 3TJPA 3UI3A 5BO4B 3OJ4B 4N9F4 3L13A 4XE0A 3IVFA 1KJTA 2IJ0A 2V1YA 2NBUA 4US9A 3ECIA 1SE2A 4RGOS 3RNFC 2D2QA 1E90A 5EE0A 1T6BX 5TSSA 2CJOA 4NJCA 2KC2A 2Z59B 3DVGX 1R4NB 1I4GA 2LD9A 1HXYD 1FXTB 4IW0A 1TY2A 1L6VA 4RH6A 3RZFA 2AQ2B 4CHKA 4RF1A 3LDZE 2Z0EB 4IM2A 2GRIA 2LZ6A 3RULA 4LNOA 3A4RA 1LO5D 4ZRIA 3PZDA 1JMLA 1VRAB 1K50A 3MP9A 3N1YC 4ZRKA 1TJEA 1TS4A 4GGQA 5AUKA 2IZVB 4WIPA 1JWBD 4HDOA 2HTHA 2KZRA 2INPE 2TSSA 3ZVVA 3Q8FA 1TYGB 1T0RC 4TQ0A 2SAKA 2BKRB 4CYEA 1VCBA 1WZ0A 3CSFA 3PRZA 1RAXA 3GS2A 1GUAB 1L4ZB 1SE3A 4C56C 2AL3A 1WM3A 1L6UA 3WANA 1VZ6A 5IKCM 1JRPA 2BYTA 3ZRCA 5IA7A 2KQSA 2L32A 3AEEB 3M3JA 3ZJTA 3N3KB 2JPHA 3QX1A 2L83A 3RT3B 1ZPSA 4RGNA 2KWVB 2KN4A 2KJHB 3DBHB 4RM8A 3AE1B 3DOWA 2J0JA 2IYDB 5H8YE 1WIAA 1GB4A 3W5VB 4W9DA 2BYFA 4MSMB 5LXHA 1SIFA 2WDVB 3UQAA 4AQ7A 1ISNA 4KSKC 1N62A 1I4XA 4J6IA 2K8CA 3AEBB 1UGMA 3WAMA 1JWSD 2WDQB 1S3SG 1NENB 1N61A 2KAJA 1C1YB 3VRAB 3BZDB 4OVZA 2Y3AA 3GZNB 2LHDA 1I42A 1P98A 2BYEA 2EMTA 3ZDTA 1QILA 3BY4B 4KZ0A 2LVPA 4KGRA 4OVUA 1RM6C 2VRRB 2J4XA 3IBEA 2V0GA 2WU5B 2WNMA 3SD5A 2XK5B 1WGHA 3LXFA 1B1ZA 4KIKA 1HE8A 3KWVA 1JCKB 1E7UA 1WRIA 4P7IA 2DENB 3Q2AC 4W9HA 3I63C 4I6LB 2J53A 4MDKE 3RUIB 2A5UA 3ZTDA 2REXA 2C7MB 3ALBA 1JRUA 5BYQA 1TS2A 2HJ1A 1QZEA 2J52A 1SE9A 3DVGY 2BVCA 4NAMA 2NVUI 1WGYA 3B08A 3PLVA 2AL6A 4LNIA 3QK0A 1L0VB 2QIEB 1E10A 2WWZA 3NZ3A 4MGZE 4EZLA 2G9HD 1FRRA 2PPHA 2ZPNA 5J18A 1FO4A 4US8A 2I1KA 3ZNZB 4XDDA 4EZKA 1EO6A 2RR9A 3J9CA 3EFUA 1VJKA 1UUPA 4OZBA 2G45B 1IGCA 2J42A 2M56B 5HG2A 4MGKE 2LI5A 2DYOA 2RDHA 1ZW7A 5LLIA 3HM6X 4G11A 4KIKB 1D4BA 4W9FA 1V8CA 2N9KA 1XCTL 4IDIA 2DAJA 3QA8A 5BMIA 2CU1A 2MH7A 2NBWB 2NCNA 2D07B 4DBGA 4II2B 4YTPB 1E9MA 4NY0A 5GXGB 2FUG1 3A9JB 1ET6A 1L7YA 4ICUA 3UIPB 5HHDG 3RD2A 4E3CA 3VH4B 3P1MA 1D5MC 3A1QB 4H2AA 1V1PA 4P16A 5TR5A 3GP7A 4WWOA 2LRWA 1SB3C 2LJIA 2WXFA 1AYFA 1D6EC 3IAM1 3GE3C 2KXJA 2ZW1A 1LXDA 2KX0A 3VQIA 1Q5WB 1MHHE 2CHXA 2KDBA 2N9PC 2KMCA 5EDSA 4M00A 4KKIA 1B9RA 1T5XD 1ZDXA 2AQ1B 2G1EA 4WWMA 1C77A 1NYQA 2DHZA 2LUEA 4AJYB 1TTNA 2MP2B 1UH6A 3UQBA 4WJPA 3H7SA 2MSED 4IM3A 2KHWB 2J7QB 1SBBB 5CHFA 3VTUA 1XLPA 3OG5A 1RFKA 3DHIC 3O13A 3ZIMA 2EMSA 3X0WA 2KWUB 5JZEB 3I3TB 3MC9A 1EU4A 2BS4B 1QOGA 1SJED 4PYUA 2QSDA 3KWLA 3IAS1 1E0ZA 3KUDB 3VVWB 3RNCC 2ONQA 4LK0M 4KSLC 4L2YA 4KZCA 1AWDA 3AXCA 3PRMB 1EF5A 2WGSA 4HJGE 3AU4A 3UF8A 4DHZE 2K6QA 4RNAA 1GOZA 3Q3MC 2HE7A 1S1QB 3N1ZC 3W9CB 3U7DA 1NI3A 2JRHA 4A9AA 4HLEA 3GOEA 2KNBA 3QWZB 1P9DU 4K7WA 3V6CB 1MPEA 2ZPYA 5DCNA 5AUIA 1MI0A 3LJ3A 4C80A 4FBJB 4M02A 3N9YC 2PE9A 3APCA 4XDCA 1XLQA 2NPTB 2O2VB 3UGBB 1AN8A 3P4QB 3I5JC 3VFKA 4WH4A 1V97A 1QF6A 3PHWB 1FIQA 1EM7A 3AN1A 3DBSA 3IXSA 4ITKA 1I4PA 3L17A 1T0QC 2IDYA 1FCLA 4M8NA 2XNAC 3T9LA 3L0WB 4AP4C 2L00B 2L3ZA 3SFDB 2D5GA 2KT7A 2DZJA 5FR6A 1YN4A 4PT5A 1XEEA 1XT9B 3R7RA 4MACA 1CQVA 2MA9B 2D11A 2L0TA 4DXFA 4A8XC 1IBXB 4XYCA 3TUOA 3H1UA 1G6JA 4PYZA 2FCSA 4MGYE 3PLUA 1VZ8A 3IFWB 2RMMA 3A1QA 3TEWA 3QJZA 3AH7A 2Z0DB 2W3RA 2RPVA 3PVLA 1E8WA 2JF5A 4FLHA 4ICVA 1YX6B 3W5UB 4BKSA 4EUTA 1HZ6A 4YWGG 3U2SC 3NS8A 1OGWA 2ZW0A 1WY8A 1YX5B 4MH0E 1ZKHA 1JALA 3Q3OC 2WXQA 3D32A 3NY5A 3V62A 3QIJA 3WAPA 3AE8B 3L4PA 1L2NA 2FIDA 3WCQA 5LNK1 2N7EA 3DVNU 1P7FA 2NTTA 1XD3B 3N30A 3KUCB 3P4PB 4YTMB 2KX3A 1R7SA 2HTME 4OZCA 1WJNA 4BKSD 2ZVOA 2WDRB 1J8CA 2ZNVB 3AMZA 4B0MA 2XN9C 3ONSA 3LYYA 3NHEB 5KHQA 1J19A 2JZPA 4ZHPA 4IC7B 2LMCA 1K8RB 3T3NA 2OEDA 2YLMA 2R2QA 3DBLI 3PTFC 1N60A 2IO0B 1SJHD 2INCC 3A33B 1PGAA 3AE6B 2JZ3B 2KTRB 2KJRA 2Z8LA 4OZAA 4EZJA 2L8JA 2FBWB 4JE3B 3ZXVA 2M0XA 2MX2A 2LJ5A 1HZ5A 2BS2B 2N4FA 3IG3A 5FKAC 3E56A 1V80A 4GB9A 3DDCB 4LLGM 4GLSC 2KDEB 3APFA 3Q69A 1NYRA 5D2MB 3EA6A 2W54A 4Q2JA 5FR3A 5AEKB 4FHKA 2NPTA 1XLOA 2VZKB 1FNVA 2LVQA 1NEKB 2PVGC 1QKZA 2MWSB 3ETRA 3M62B 4IKGA 4EE2A 3HVZA 4S0RA 1WXSA 1FMAD 1KM7A 2IGHA 4LNKA 4TMAB 1VLBA 2ACZB 5HI1A 3IHPC 3RNAC 4HXDA 3T3OA 1V1OA 4LJOB 1WX8A 4GMVA 1WRDB 1UBIA 2M19A 2V4IB 4IWPA 1NI2A 1E8ZA 3K9OB 1L0XB 1DYQA 2KK8A 1JWUD 5KHOA 3VTWA 2QDFA 2WXMA 3ABVB 2K25A 3UIOB 2L05A 1HEZE 4TUUA 2LUMA 3ZDMC 1SF0A 2LASA 2ZCCA 5C23A 1I35A 4WWPA 2ZVNA 4GIVA 2FUHB 3O65B 1SEBD 2ASQA 2IGGA 3V60A 3DPDA 2LVOA 2X8XX 1OTRB 2Y5PA 2DBYA 3TIXA 3MHSD 1VD2A 5J17A 3B1LX 1PQSA 2JXXA 1OEYJ 5IN7A 1T3QA 2LXAA 2KDFB 5JHAA 1GPXA 2BF8B 5I4DA 2UYZB 1R4NI 2WS3B 3RNGC 4MM3A 1J7CA 5MPOA 4LJPB 3KH0A 2KMAA 1RLFA 3PPAA 1V5OA 3HK0A 4II3B 1IP9A 2MLBA 1TIFA 1SIJA 4NJ6A 2QJLA 3HUIA 3RN9C 4JWUC 4BBNF 2CHWA 2MBHA 3B0AA 1XO3A 4FJZA 2WYQA 1V81A 2PIAA 4JWSC 2X38A 4RM9A 2JRIB 1TZOA 2N1VA 3VHTC 3DHGC 4F1SA 2V3NA 1IYFA 2VZKD 4A3PA 3WA0A 2FCNA 3B2GA 4FXCA 3AEFB 4DK5A 1WF9A 4ZYNA 3KVFB 1KFYB 4XWTA 2DZMA 2K0PA 2FNJB 4ZRQA 3NZSA 4IUMB 3AB5A 2ON8A 3VRBB 1OQRA 2CS4A 3GB1A 3JVZX 5AZFA 3KYDD 4G0NB 1D5ZC 4BOZB 1XF5L 2LEKA 2GBNA 2GB1A 3DBRB 4ANXA 2KWDA 3V3XA 3IT4B 5IAAC 3ZYYX 2WXRA 4XZ4A 1EF1A 1TS5A 1PDXA 2XEWA 3RZWC 4I6PA 4FJYA 2PW9A 3FKYA 1DOIA 3K9PB 4I6NB 3VUWA 2KD0A 2SEBD 1L0YB 3QC8B 2AYOB 4DDID 2ZCBA 1QLBB 1YN3A 1WMHA 3P4RB 4NQKE 3EFCA 4L23A 1QT9A 4DDGD 2BB6A 5GMVA 2IPKD 4L1BA 4JX1C 3Q3JA 1FM0D 5CTRC 4UDUC 3RPFC 1MG4A 2M4NA 2JWZA 1LM8B 1FFUA 1ZXHA 2K39A 3KUZA 2MCNB 2KACA 1YQ3B 2LGDA 3VR9B 5IO9A 2WXOA 3ZW3A 4A20A 5D3DA 1JROA 5BYRA 4RFBA 4HCPB 1JWMD 3VXWA 3ZKJC 2YEPB 4WJQA 2RDGA 3U30A 5LXIB 1KLVA 1LFDA 4ASWC 5C2TB 2MJEA 2EELA 1ROEA 5L83A 2L76A 2AX5A 3ZJVA 4MELA 2WDTB 3R3MA 3N1XC 3NS1A 1Z2MA 2N9LA 3NUHB 5C1ZA 5E6PA 2MP2A 2GMIC 4YSYB 2FIFA 3T8MA 3H9DA 2K6DB 2B76B 2ICIA 4KGTA 2MJ3A 3APDA 4ZRJA 4IOIE 4GU2A 4J3OD 1ACCA 1KRHA 1MVKA 1UGJA 2WP9B 4OW0A 2NR2A 3V61A 1E5WA 4HKQA 1RWSA 2DZIA 1UD7A 2LWPA 5D7GA 4FHJA 3BVMA 2AQ3B 3EGRA 4JLCA 2K8HA 2BW2A 3GE8C 3V6EB 3MTNB 1CJEA 3MC0B 1QOAA 2JXTA 4EKUA 2CHZA 1Q10A 4X57B 3NVYA 1H4RA 4W9LA 4B9KA 4ZDVA 2MBEA 2LGYA 4GXBA 1EWCA 1TGZB 3R7QA 1YNTE 2DNFA 3DHHC 2MJDA 3JYUA 1OFFA 2K3UA 2DZKA 3SDLC 3A4SC 1TS3A 5JH5C 2W82A 3OWEB 3PSEB 4IWOA 1HQRD 2GBJA 2N7JA 2V3SA 2MRPA 4DWFA 4PS3A 2OJRA 3R2TA 4WJOA 2YVCA 3R2IA 4AWJA 3Q8CA 2PKOA 5EE1A 2ZEQA 2YEPF 4MM3B 2WXLA 1TZ1A 2DLBA 2IO1B 4RCOA 4HKZE 3NVWA 1Q0WB 4G50A 5HKHA 1NBFC 1E8YA 1YJIA 3ZJUA 2BQQA 1F1HA 3AEAB 4IM0A 3HRDD 1UF0A 3RMKC 2R2OA 2WXHA 2W9NA 2K22A 2J0MA 2WLBA 4PS7A 4O1NA 5D94A 1GJZA 4DHZB 1WJ6A 4YL8A 1FD6A 2D3BA 2KN5A 3AEDB 3P2BA 1BMLC 5E6JA 4M8MA 2DYMA 4RGMA 3L10B 2KJ6A 3QARA 1XQQA 2PMVA 2M8SA 1FNUA 1SGHA 3PRPB 3DWGC 4OHJA 3V05A 4YSXB 2D3GA 1WZ3A 2MW5A 1KLUD 1UZXB 1XXGA 2GBMA 4P6VF 2MBOA 1MHXA 3QHTA 4BFRA 4TV3A 5DPRA 1RFAA 3U52E 1T0SC 1YD8U 4W9CA 4K7SA 3ZNID 3SU8X 1WI0A 2IO2B 4QAYA 4XX5A 4KKJA 1WH3A 1WXQA 5EE9A 2WU2B 2PTLA 1GC6A 3DCGA 2JZZA 5FK9C 1T0YA 2K8BA 3Q3FA 2N1WA 4ARCA 4AOFA 3FAHA 1JQ4A 4NNJB 3ZLZA 1ESFA 1PYWD 2I38A 2O6VB 3R66C 2Y5BB 1C3TA 2BS3B 4FN2A 2Q5WD 2M1MA 2WXPA 3Q14C 4EFOA 3ZXRA 4YXDB 2PEAA 1OEYA 2BWES 4WWNA 5D6JB 1GNUA 1XCQL 2ZNVC 2EKEC 3ZNHB 4A6QA 4AUQC 1I4RA 3EUB2 1NVID 2I2YA 4BKGA 1ZE3D 1TKGA 5G5GA 3QAQA 1WSPA 3ML9A 1V6EA 3SEBA 1WXAA 3AULA 1IUEA 4BKTA 2HJ8A 1CMXB 4E71A 2JUOA 4ARIA 2G3QB 1E8XA 4BAXA 1N63A 3L54A 3CWIA 4REZA 1WE6A 4KV2A 3MFGA 1N5WA 4TQ1A 4KGSA 4HVBA 4ACFA 1C79A 3ML8A 1BUIC 2JU6X 1NDDA 4P1BC 1I4QA 1SE4A 4AS1A 5DPTA 1XLNA 1L5PA 1CK1A 3P4SB 4M0WB 3U8ZA 5CX3A 1VR9A 2H89B 3Q6BA 5H92C 1F2RI 4USAA 2KOXA 2PLPA 4HJKA 2WXGA 3P63A 1A70A 2LHEA 2PE6B 2UU7A 1F0ZA 4RMAA 3U4EG 3RFZB 1ZOYB 4CQNA 1WR6E 4DQOC 3VR8B 2MBBB 3QQ8B 1J7BA 4F7ZA 4JL9A 4PK1A 1KLGD 2BGFA 3AE5B 1FRDA 1ET9A 3L16A 2LFIA 1FCCC 4IWQA 1GAQB 3AV8A 4NAWB 3BK1A 4FJVB 1I7HA 1OQYA 2V9HA 2BYVE 4MT5A 1UELA 2AWTA 2VH1A 3W2DA 3S2AA 2KTFA 1C4PA 2ZZPB 3EHVA 3RI7C 4C7YA 2FE8A 1YQ4B 2WX0A 2KFKB 2KQ7A 3PS6A 2NMQA 4BZAA 4PS8A 1AW7A 4HPPA 2GBKA 1WGRA 3TEZA 2Y5CA 1SSNA 2EKIA 3DWMA 3Q8AA 2ZJDA 1HTQA 4WJNA 4BVUC 1C9FA 2HDEA 2QHOA 3P42A 1WM2A 1C76A 4DXAB 3R8BA 2BPSA 4OVVA 1EWYC 2XBBC 1LGRA 2QCZA 1YQBA 1WXMA 1F2RC 2KC1A 3BWUD 4LCDE 4WAFA 1H8CA 2NS5A 2QC8A 3OAWA 1Y8RC 1OQQA 1YOVB 2KYWA 3ZNGC 4C00A 2D3CA 4MH8A 4K81A 4KDIC 1C78A 3FILB 3WAOA 5IP4D 2BB5A 1R4MI 2JY6A 1WJUA 3DBHI 3PZ7A 3KYCD 3WIMA 1D5XC 1V86A 4M01A 4HK2A 2R61A 3AECB 2WHIA 4MGIE 2C60A 3PZ8A 4G3XB 3BVZA 1V1PB 2K5PA 1TKYA 2MQJA 5T8IA 4ANWA 3C0RB 1YJJA 1FPYA 2JX5A 4K3BA 3N32A 1TKEA 4C4VA 2WQYB 1WX9A 4ZRPA 3PO0A 4W9IA 2KWCA 3AEGB 3I9V1 2XK5A 1TY0A 4ZHOA 3AE7B 2FAZA 5E6NA 2JSVX 1ZXIA 4A90A 3CSTA 4RF0A 1E6EB 4GDLB 2L0FA 2O2VA 2GBRA 3TEXA 1R4MB 4GDKA 1HA5A 1WWTA 1Z5SB 3DBLB 2I1JA 1WGKA 4W9GA 4MEMA 3M95A 1MJDA 3RNBC 2L7RA 3I57A 1EU3A 2KLGA 2KFKA 2DYBA 2JQRB 1WGGA 3H6NA 1J7AA 4FADA 1ZUD2 4NZLB 3EECA 3NG0A 3LB8C 1KH0A 4YSZB 3H7PA 1V2YA 4E74A 2JWUA 3MJ5A 3PGEA 4TSSA 4YTNB 4BBNC 3TCAA 1ENFA 1QQRA 4N59A 5G55A 2NBVB 3IT6B 5AZGA 4NQLB 2L1AA 1MG8A 3VUYA 3FC4A 1E7VA 5AZHA 3Q8BA 2CKHB 1BT0A 3PREA 1C4CA 1WFYA 4URKA 3TBLD 2LGXA 5JHBA 1DGJA 4W9JA 5L95C 1FXIA 4JQWC 1VDVA 3MC8A 2OOBB 2GLSA 1FNWA 1WXVA 2OHFA 2QEJC 1PFDA 3AE9B 4DHJB 1F9JA 2IGDA 3A9JA 2V4LA 3MJWA 1GB1A 2RPQA 1X1MA 2RGFA 1FEHA 3NVVA 4K1RB 5EE3A 4HEA1 4IG7B 3TSSA 4P1CC 3NOBA 4CO7A 4JGHB 2NTSA 1WYGA 2KDMA 2PJHA 2KDIA 4XC2A 1KTKA 1U4AA 2GI9A 2LXCA 2BBCA 2WXIA 4XWWA 2C7NB 4WURA 1WX7A 4HRSA 4HPMB 3MHZA 2BKFA 2KTRA 2E3TA 3AE2B 1M4VA 1CZPA 1FFVA 3CMMB 2GOWA 4B0EA 3B2FA 4B6WA 2G4DB 4GDKB 1PUTA 3B9JA 2PVOD 1YJ1A 3URYA 2E6XA 2INDC 2JVCA 5BYSA 3Q3NC 1RYJA 4K7UA 1LQBA 4DXGA 2LRUA 2C9WB 3UINB 2WX1A 1K53A 1J0GA 2KMMA 2DAFA 4F8CB 4YT0B 2K9XA 2UWQA 2JYTA 5DPWA 2QMTA 5J2RA 1M94A 1FXAA 2RD0A 4KDLB 1Q1OA 2MHJA 2BT6A 4GN1A 1D3ZA 2LGSA 3AE3B 3GZNI 4RGTA 1L4DB 3KQ4A 1DOXA 3FILA 1RRBA 4EEWA 4NJ7A 3JSVA 2IO3B 4MJSA 3PHXB 1UWMA 1E7PB 3VH3B 1QOBA 4S17A 2HD5B 4ZYSA 2CU3A 4N6EB 3SHQA 1ZGUB 2W55A 3HIZA 4EOYA 5G2NA 1MFWA 1ZDVA 1TT5B 1ZP0B 3BYYB 3DBRI 2C7HA 3KW5B 5C3JB 4C4VB 2WXNA 2MEKA 2DWQA 3AE4B 3DQVA 4JPSA 3VUXA 2IY0B 4A3OA 4AJWA 3ZO5B 4LNFA 3H8HA 1WJ4A 4N58A 4KVGB 2D10A 2IY1B 4HPLB 2H88B 3JW0X 5BMGA 3PV1A 4GDLA 3AI5A 3SR6A 5CHWA 4LNNA 1UBQA 1V49A 1KOTA 2CJNA 2KANA 1V5TA 2N9EB 4NAWA 1QOFA 1GC7A 3RCZA 2KO3A 5DPSA 1VZ7A 3WALA 1P1AA 1WE7A 1PGXA 2L52A 3VAWA 2JT4B 1IBXA 1Y56A 4M0WA 2MBQA 4LDTB 2DX5B 3A9KA 4JIOU 4TKNA 3W1SC 2OJWA 3OJ3A 1WMHB 2B3AA 2N7DA 5E6OA 1YIWA 4GOCA 4XGAB 1BXTA 4R3DA 1P3QU 3ZTCA 1GG3A 2KQ4X 4ANVA 3ZUNA 1JWAD 3W1YA 3Q8EA 1V9JA 2J0KA 4FULA 2KFJA 1SXTA 1N5XA 1P0RA 3BK2A 4WAAA 4ANUA 1F52A 4WQMA 3AU5A 1KF6B 3U7ZA 3CF6E 3TEYA 3KLSX 4BOSC 2RSUA 2FCQA 4K3CA 4MSQB 2M17A 1K52A 3M63B 2RDBC 3BINA 3DVNV 3PT2B 3X23A 1C4AA 1JW9D 3ENEA 2C5LC 3NJTA 3JSVB 1UNSA 4MJSB 2A4ZA 3AM9A 2V3PA 1N6ZA 4B95A 2KVZA 4LTUA 1I4HA 4HDQA 3VTVA 3ZGZA 3A9KB 3HHMA 2D3AA 5IOIA 4W9KA 1IPGA 2BTEA 1F77A 4KX6B 2WXJA 4C7ZA 1P7EA 1UWXA 1EUVB 2W3SA 2M0AA 1PGBA 3RYTA 2CR5A 5BMHA 3NVZA 3BVGA 4HWIB 2N0SB 3BIID 3ZRFA 1YN5A 2KVRA 2O6VA 2QILA 4FA6A 3W1SA 3BYTB 4WQOB 3OLMD 1IGDA 4GSWA 2G4SA 2N9XA 1A5RA 3CIRB 2KLCA 5G5HA 4HROA 1WYWB 3NRZA 1AARA 4W9EA 2JYEA 3C8YA 5JXVA 3TL5A 1WGDA 4DHJD 3HVDA 2IBIB 1TBEA 1STEA 1K51A 2O6VD 3ZQ4A 1HTOA 1YMHE 4HCNB 4LDTD 3N20C 2LGIA 2KKCA 4NPNA 3E9SA 3HM3A 4D2KA 5CHVC 3C19A 2WXKA 3TMPB 1WR1A 3NZUA
chains in the Genus database with same CATH topology
2INNE 1HA5A 1FIQA 1EM7A 1WWTA 3AN1A 3IXSA 4ITKA 2B76B 1I4PA 2ICIA 4KGTA 5D3IB 2MJ3A 1WGKA 2IDYA 1FCLA 4IOIE 4J3OD 1ACCA 2XNAC 4ZOHC 1KRHA 1MVKA 4A55A 1UGJA 3I57A 2WP9B 1EU3A 4OW0A 5HFYA 1DOYA 3SFDB 2D5GA 2JQRB 4HKQA 1RWSA 3SFEB 1J7AA 1YN4A 1ZUD2 4NZLB 1XEEA 4PT5A 3UI3A 4MACA 5D7GA 3LB8C 1CQVA 1KH0A 4YSZB 3BVMA 4DXFA 4A8XC 2AQ3B 2JWUA 3MJ5A 3EGRA 4TSSA 4YTNB 1IBXB 2BW2A 3TUOA 1ENFA 1QQRA 4XE0A 4N59A 1CJEA 3MC0B 1QOAA 2JXTA 2IJ0A 4US9A 1SE2A 1VZ8A 1Q10A 3IT6B 3NVYA 2RMMA 3TEWA 2L1AA 4RGOS 1EWCA 3AH7A 1YNTE 3FC4A 2W3RA 5EE0A 2MJDA 2RPVA 3Q8BA 1T6BX 5TSSA 2CJOA 4NJCA 3W5UB 1HZ6A 4YWGG 1C4CA 3U2SC 1I4GA 1OFFA 2ZW0A 2K3UA 1HXYD 1DGJA 1JALA 2WXQA 1TS3A 1TY2A 1L6VA 4RH6A 2W82A 1FXIA 3OWEB 1VDVA 2AQ2B 1FNWA 2OHFA 4RF1A 1HQRD 3AE8B 3L4PA 2N7JA 3WCQA 2GRIA 2QEJC 1PFDA 3AE9B 5LNK1 1LO5D 1JMLA 1P7FA 1VRAB 2NTTA 1K50A 3MP9A 3P4PB 4YTMB 3R2TA 1R7SA 2IGDA 2HTME 4OZCA 3R2IA 1TJEA 1TS4A 3Q8CA 5AUKA 4WIPA 2PKOA 1GB1A 1JWBD 5EE1A 2WDRB 1FEHA 3NVVA 3AMZA 5EE3A 4HEA1 2INPE 2TSSA 2YEPF 4B0MA 3Q8FA 4MM3B 2WXLA 2DLBA 3TSSA 1TYGB 2XN9C 3LYYA 4RCOA 4TQ0A 4HKZE 3NVWA 2JZPA 2SAKA 4ZHPA 2NTSA 1WYGA 2LMCA 1YJIA 2KDMA 3T3NA 3ZJUA 3GS2A 2OEDA 3AEAB 3HRDD 1L4ZB 1SE3A 1KTKA 1QF6A 2GI9A 1N60A 2WXHA 4C56C 1SJHD 1PGAA 2BBCA 2WXIA 4XWWA 3AE6B 1L6UA 2K22A 2Z8LA 1VZ6A 2WLBA 4WURA 4OZAA 4HRSA 1JRPA 3MHZA 4O1NA 2FBWB 2BYTA 4JE3B 1FD6A 2E3TA 3AEDB 2L32A 3AEEB 1HZ5A 2BS2B 1BMLC 3AE2B 3ZJTA 1M4VA 5E6JA 1CZPA 1FFVA 2DYMA 4RGMA 5FKAC 3E56A 4LLGM 4B0EA 3B2FA 2PMVA 4GLSC 2L83A 1FNUA 4OHJA 3DWGC 3Q69A 4GDKB 3V05A 1NYRA 4YSXB 1ZPSA 1KLUD 3EA6A 2W54A 1PUTA 4Q2JA 4RGNA 1XXGA 3B9JA 2PVOD 5FR3A 3URYA 4P6VF 2KN4A 2E6XA 5BYSA 1RYJA 1XLOA 2VZKB 4DXGA 1FNVA 1MHXA 1NEKB 3AE1B 2PVGC 1QKZA 1K53A 3U52E 2KMMA 3ETRA 5H8YE 4IKGA 4EE2A 1GB4A 3HVZA 3W5VB 4YT0B 2K9XA 2JYTA 2WDVB 2QMTA 4AQ7A 1FMAD 2IGHA 4KKJA 1WXQA 4TMAB 1N62A 1FXAA 5EE9A 1VLBA 2ACZB 2WU2B 1I4XA 2PTLA 2BT6A 5HI1A 3T3OA 3AE3B 5FK9C 3AEBB 4RGTA 1JWSD 2WDQB 1L4DB 1V1OA 3KQ4A 2KAJA 1NENB 1N61A 1DOXA 3FILA 3VRAB 2M19A 4ARCA 3BZDB 4OVZA 2Y3AA 2V4IB 2LHDA 3FAHA 1UWMA 1E7PB 1JQ4A 1ESFA 1PYWD 2I38A 1QILA 1L0XB 1DYQA 1QOBA 1JWUD 2BS3B 4KGRA 2Q5WD 2WXPA 4ZYSA 1RM6C 2WXMA 2J4XA 2CU3A 3ABVB 4N6EB 2W55A 1HEZE 2LUMA 2V0GA 4YXDB 1SF0A 2WU5B 1ZDVA 2WNMA 1XCQL 1ZP0B 3BYYB 5C3JB 3LXFA 1B1ZA 1SEBD 2IGGA 3KWVA 2WXNA 2MEKA 2DWQA 3AE4B 4JPSA 4A6QA 1JCKB 2Y5PA 1I4RA 2DBYA 3EUB2 1NVID 2I2YA 3H8HA 1WRIA 1ZE3D 1TKGA 1T3QA 4N58A 5G5GA 2J53A 1WSPA 1GPXA 5I4DA 3SEBA 2H88B 5BYQA 2WS3B 5BMGA 1TS2A 1IUEA 1J7CA 2J52A 5MPOA 3SR6A 4NAMA 2CJNA 4ARIA 1N63A 1QOFA 3CWIA 4REZA 1VZ7A 3MFGA 1N5WA 1L0VB 1SIJA 4TQ1A 2QJLA 3HUIA 2QIEB 4KGSA 1E10A 1C79A 1PGXA 4JWUC 2L52A 1BUIC 3NZ3A 1IBXA 2JU6X 1Y56A 1XO3A 4M0WA 2G9HD 1FRRA 2PIAA 1I4QA 1SE4A 1FO4A 4AS1A 4US8A 1XLNA 1L5PA 4XDDA 1CK1A 3P4SB 4JWSC 3J9CA 2X38A 1VR9A 2H89B 1VJKA 1TZOA 5H92C 1F2RI 4USAA 1UUPA 2PLPA 1BXTA 4R3DA 2WXGA 4OZBA 3P63A 2V3NA 1A70A 2LHEA 2VZKD 1IGCA 2J42A 2KQ4X 2M56B 5HG2A 2DYOA 1JWAD 1F0ZA 3Q8EA 2RDHA 3B2GA 4FXCA 3U4EG 1ZOYB 3AEFB 3RFZB 4CQNA 1D4BA 1SXTA 1V8CA 1N5XA 3VR8B 4DQOC 1J7BA 2N9KA 3BK2A 1XCTL 1KLGD 4WQMA 1KFYB 3AE5B 1KF6B 1FRDA 4IDIA 3U7ZA 1ET9A 4XWTA 2LFIA 2K0PA 1FCCC 1GAQB 5BMIA 4ZRQA 3TEYA 2MH7A 3KLSX 3AB5A 3AV8A 2ON8A 4NAWB 3BK1A 4YTPB 3VRBB 1I7HA 1OQRA 3GB1A 1E9MA 4MT5A 1K52A 5GXGB 2FUG1 1D5ZC 1XF5L 1ET6A 3W2DA 5HHDG 1C4PA 1C4AA 2LEKA 3P1MA 1D5MC 1JW9D 4C7YA 4H2AA 2GB1A 1V1PA 2FE8A 4P16A 3GP7A 1YQ4B 2KWDA 1UNSA 1SB3C 3V3XA 3AM9A 2V3PA 2LJIA 2WXFA 1AYFA 1D6EC 2NMQA 3IT4B 3IAM1 3ZYYX 2WXRA 2ZW1A 1TS5A 4LTUA 1I4HA 1PDXA 1AW7A 2PW9A 3TEZA 3VQIA 1DOIA 1SSNA 2EKIA 2Y5CA 1MHHE 3DWMA 3Q8AA 2SEBD 3ZGZA 4KKIA 1L0YB 1QLBB 1YN3A 1C9FA 2HDEA 1B9RA 1T5XD 3P4RB 1ZDXA 3P42A 2AQ1B 1C76A 2G1EA 3R8BA 4WWMA 2BTEA 4L23A 1F77A 1QT9A 4KX6B 1C77A 1NYQA 1EWYC 2WXJA 2BB6A 4C7ZA 2IPKD 1P7EA 1UWXA 4L1BA 1F2RC 1SBBB 4JX1C 3BWUD 1FM0D 2W3SA 2M0AA 1XLPA 4UDUC 4WAFA 3RPFC 1RFKA 1PGBA 3O13A 1OQQA 1FFUA 4MH8A 1C78A 1EU4A 1ZXHA 2BS4B 3FILB 5BMHA 3NVZA 3BVGA 1QOGA 2BB5A 2KACA 1YQ3B 1SJED 3VR9B 2QSDA 2WXOA 3KWLA 3IAS1 2N0SB 3BIID 3PZ7A 1E0ZA 1YN5A 1D5XC 5D3DA 2QILA 2ONQA 4LK0M 3W1SA 4L2YA 3BYTB 1AWDA 1JROA 5BYRA 2R61A 4RFBA 3AECB 1IGDA 4HJGE 3PZ8A 1JWMD 3BVZA 1V1PB 2K5PA 1TKYA 4RNAA 2YEPB 3CIRB 1GOZA 5T8IA 1YJJA 2RDGA 5G5HA 4HROA 3NRZA 3W9CB 2JX5A 2JYEA 1NI3A 1TKEA 3C8YA 5JXVA 4A9AA 2WQYB 5C2TB 2MJEA 2EELA 4ZRPA 3PO0A 1ROEA 3HVDA 1MPEA 2AX5A 1STEA 5AUIA 1K51A 1MI0A 3AEGB 3ZJVA 3ZQ4A 3I9V1 4C80A 1YMHE 3N9YC 1TY0A 3NS1A 4ZHOA 4XDCA 1XLQA 3AE7B 2LGIA 2N9LA 2JSVX 1AN8A 3NUHB 1ZXIA 4A90A 3E9SA 4RF0A 3P4QB 4YSYB 4D2KA 1E6EB 4GDLB 4WH4A 2WXKA 1V97A 3TEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLB A; 
#chains in the Genus database with same CATH topology
 2INN E;  2VH2 A;  2FCM A;  3QCA A;  5D3I B;  2BWF A;  4ZOH C;  2AEH A;  3VDZ A;  4A55 A;  2K1F A;  3L08 A;  3RNE C;  5HFY A;  1DOY A;  3EC8 A;  3H7P B;  3SFE B;  3TJP A;  3UI3 A;  5BO4 B;  3OJ4 B;  4N9F 4;  3L13 A;  4XE0 A;  3IVF A;  1KJT A;  2IJ0 A;  2V1Y A;  2NBU A;  4US9 A;  3ECI A;  1SE2 A;  4RGO S;  3RNF C;  2D2Q A;  1E90 A;  5EE0 A;  1T6B X;  5TSS A;  2CJO A;  4NJC A;  2KC2 A;  2Z59 B;  3DVG X;  1R4N B;  1I4G A;  2LD9 A;  1HXY D;  1FXT B;  4IW0 A;  1TY2 A;  1L6V A;  4RH6 A;  3RZF A;  2AQ2 B;  4CHK A;  4RF1 A;  3LDZ E;  2Z0E B;  4IM2 A;  2GRI A;  2LZ6 A;  3RUL A;  4LNO A;  3A4R A;  1LO5 D;  4ZRI A;  3PZD A;  1JML A;  1VRA B;  1K50 A;  3MP9 A;  3N1Y C;  4ZRK A;  1TJE A;  1TS4 A;  4GGQ A;  5AUK A;  2IZV B;  4WIP A;  1JWB D;  4HDO A;  2HTH A;  2KZR A;  2INP E;  2TSS A;  3ZVV A;  3Q8F A;  1TYG B;  1T0R C;  4TQ0 A;  2SAK A;  2BKR B;  4CYE A;  1VCB A;  1WZ0 A;  3CSF A;  3PRZ A;  1RAX A;  3GS2 A;  1GUA B;  1L4Z B;  1SE3 A;  4C56 C;  2AL3 A;  1WM3 A;  1L6U A;  3WAN A;  1VZ6 A;  5IKC M;  1JRP A;  2BYT A;  3ZRC A;  5IA7 A;  2KQS A;  2L32 A;  3AEE B;  3M3J A;  3ZJT A;  3N3K B;  2JPH A;  3QX1 A;  2L83 A;  3RT3 B;  1ZPS A;  4RGN A;  2KWV B;  2KN4 A;  2KJH B;  3DBH B;  4RM8 A;  3AE1 B;  3DOW A;  2J0J A;  2IYD B;  5H8Y E;  1WIA A;  1GB4 A;  3W5V B;  4W9D A;  2BYF A;  4MSM B;  5LXH A;  1SIF A;  2WDV B;  3UQA A;  4AQ7 A;  1ISN A;  4KSK C;  1N62 A;  1I4X A;  4J6I A;  2K8C A;  3AEB B;  1UGM A;  3WAM A;  1JWS D;  2WDQ B;  1S3S G;  1NEN B;  1N61 A;  2KAJ A;  1C1Y B;  3VRA B;  3BZD B;  4OVZ A;  2Y3A A;  3GZN B;  2LHD A;  1I42 A;  1P98 A;  2BYE A;  2EMT A;  3ZDT A;  1QIL A;  3BY4 B;  4KZ0 A;  2LVP A;  4KGR A;  4OVU A;  1RM6 C;  2VRR B;  2J4X A;  3IBE A;  2V0G A;  2WU5 B;  2WNM A;  3SD5 A;  2XK5 B;  1WGH A;  3LXF A;  1B1Z A;  4KIK A;  1HE8 A;  3KWV A;  1JCK B;  1E7U A;  1WRI A;  4P7I A;  2DEN B;  3Q2A C;  4W9H A;  3I63 C;  4I6L B;  2J53 A;  4MDK E;  3RUI B;  2A5U A;  3ZTD A;  2REX A;  2C7M B;  3ALB A;  1JRU A;  5BYQ A;  1TS2 A;  2HJ1 A;  1QZE A;  2J52 A;  1SE9 A;  3DVG Y;  2BVC A;  4NAM A;  2NVU I;  1WGY A;  3B08 A;  3PLV A;  2AL6 A;  4LNI A;  3QK0 A;  1L0V B;  2QIE B;  1E10 A;  2WWZ A;  3NZ3 A;  4MGZ E;  4EZL A;  2G9H D;  1FRR A;  2PPH A;  2ZPN A;  5J18 A;  1FO4 A;  4US8 A;  2I1K A;  3ZNZ B;  4XDD A;  4EZK A;  1EO6 A;  2RR9 A;  3J9C A;  3EFU A;  1VJK A;  1UUP A;  4OZB A;  2G45 B;  1IGC A;  2J42 A;  2M56 B;  5HG2 A;  4MGK E;  2LI5 A;  2DYO A;  2RDH A;  1ZW7 A;  5LLI A;  3HM6 X;  4G11 A;  4KIK B;  1D4B A;  4W9F A;  1V8C A;  2N9K A;  1XCT L;  4IDI A;  2DAJ A;  3QA8 A;  5BMI A;  2CU1 A;  2MH7 A;  2NBW B;  2NCN A;  2D07 B;  4DBG A;  4II2 B;  4YTP B;  1E9M A;  4NY0 A;  5GXG B;  2FUG 1;  3A9J B;  1ET6 A;  1L7Y A;  4ICU A;  3UIP B;  5HHD G;  3RD2 A;  4E3C A;  3VH4 B;  3P1M A;  1D5M C;  3A1Q B;  4H2A A;  1V1P A;  4P16 A;  5TR5 A;  3GP7 A;  4WWO A;  2LRW A;  1SB3 C;  2LJI A;  2WXF A;  1AYF A;  1D6E C;  3IAM 1;  3GE3 C;  2KXJ A;  2ZW1 A;  1LXD A;  2KX0 A;  3VQI A;  1Q5W B;  1MHH E;  2CHX A;  2KDB A;  2N9P C;  2KMC A;  5EDS A;  4M00 A;  4KKI A;  1B9R A;  1T5X D;  1ZDX A;  2AQ1 B;  2G1E A;  4WWM A;  1C77 A;  1NYQ A;  2DHZ A;  2LUE A;  4AJY B;  1TTN A;  2MP2 B;  1UH6 A;  3UQB A;  4WJP A;  3H7S A;  2MSE D;  4IM3 A;  2KHW B;  2J7Q B;  1SBB B;  5CHF A;  3VTU A;  1XLP A;  3OG5 A;  1RFK A;  3DHI C;  3O13 A;  3ZIM A;  2EMS A;  3X0W A;  2KWU B;  5JZE B;  3I3T B;  3MC9 A;  1EU4 A;  2BS4 B;  1QOG A;  1SJE D;  4PYU A;  2QSD A;  3KWL A;  3IAS 1;  1E0Z A;  3KUD B;  3VVW B;  3RNC C;  2ONQ A;  4LK0 M;  4KSL C;  4L2Y A;  4KZC A;  1AWD A;  3AXC A;  3PRM B;  1EF5 A;  2WGS A;  4HJG E;  3AU4 A;  3UF8 A;  4DHZ E;  2K6Q A;  4RNA A;  1GOZ A;  3Q3M C;  2HE7 A;  1S1Q B;  3N1Z C;  3W9C B;  3U7D A;  1NI3 A;  2JRH A;  4A9A A;  4HLE A;  3GOE A;  2KNB A;  3QWZ B;  1P9D U;  4K7W A;  3V6C B;  1MPE A;  2ZPY A;  5DCN A;  5AUI A;  1MI0 A;  3LJ3 A;  4C80 A;  4FBJ B;  4M02 A;  3N9Y C;  2PE9 A;  3APC A;  4XDC A;  1XLQ A;  2NPT B;  2O2V B;  3UGB B;  1AN8 A;  3P4Q B;  3I5J C;  3VFK A;  4WH4 A;  1V97 A;  1QF6 A;  3PHW B;  1FIQ A;  1EM7 A;  3AN1 A;  3DBS A;  3IXS A;  4ITK A;  1I4P A;  3L17 A;  1T0Q C;  2IDY A;  1FCL A;  4M8N A;  2XNA C;  3T9L A;  3L0W B;  4AP4 C;  2L00 B;  2L3Z A;  3SFD B;  2D5G A;  2KT7 A;  2DZJ A;  5FR6 A;  1YN4 A;  4PT5 A;  1XEE A;  1XT9 B;  3R7R A;  4MAC A;  1CQV A;  2MA9 B;  2D11 A;  2L0T A;  4DXF A;  4A8X C;  1IBX B;  4XYC A;  3TUO A;  3H1U A;  1G6J A;  4PYZ A;  2FCS A;  4MGY E;  3PLU A;  1VZ8 A;  3IFW B;  2RMM A;  3A1Q A;  3TEW A;  3QJZ A;  3AH7 A;  2Z0D B;  2W3R A;  2RPV A;  3PVL A;  1E8W A;  2JF5 A;  4FLH A;  4ICV A;  1YX6 B;  3W5U B;  4BKS A;  4EUT A;  1HZ6 A;  4YWG G;  3U2S C;  3NS8 A;  1OGW A;  2ZW0 A;  1WY8 A;  1YX5 B;  4MH0 E;  1ZKH A;  1JAL A;  3Q3O C;  2WXQ A;  3D32 A;  3NY5 A;  3V62 A;  3QIJ A;  3WAP A;  3AE8 B;  3L4P A;  1L2N A;  2FID A;  3WCQ A;  5LNK 1;  2N7E A;  3DVN U;  1P7F A;  2NTT A;  1XD3 B;  3N30 A;  3KUC B;  3P4P B;  4YTM B;  2KX3 A;  1R7S A;  2HTM E;  4OZC A;  1WJN A;  4BKS D;  2ZVO A;  2WDR B;  1J8C A;  2ZNV B;  3AMZ A;  4B0M A;  2XN9 C;  3ONS A;  3LYY A;  3NHE B;  5KHQ A;  1J19 A;  2JZP A;  4ZHP A;  4IC7 B;  2LMC A;  1K8R B;  3T3N A;  2OED A;  2YLM A;  2R2Q A;  3DBL I;  3PTF C;  1N60 A;  2IO0 B;  1SJH D;  2INC C;  3A33 B;  1PGA A;  3AE6 B;  2JZ3 B;  2KTR B;  2KJR A;  2Z8L A;  4OZA A;  4EZJ A;  2L8J A;  2FBW B;  4JE3 B;  3ZXV A;  2M0X A;  2MX2 A;  2LJ5 A;  1HZ5 A;  2BS2 B;  2N4F A;  3IG3 A;  5FKA C;  3E56 A;  1V80 A;  4GB9 A;  3DDC B;  4LLG M;  4GLS C;  2KDE B;  3APF A;  3Q69 A;  1NYR A;  5D2M B;  3EA6 A;  2W54 A;  4Q2J A;  5FR3 A;  5AEK B;  4FHK A;  2NPT A;  1XLO A;  2VZK B;  1FNV A;  2LVQ A;  1NEK B;  2PVG C;  1QKZ A;  2MWS B;  3ETR A;  3M62 B;  4IKG A;  4EE2 A;  3HVZ A;  4S0R A;  1WXS A;  1FMA D;  1KM7 A;  2IGH A;  4LNK A;  4TMA B;  1VLB A;  2ACZ B;  5HI1 A;  3IHP C;  3RNA C;  4HXD A;  3T3O A;  1V1O A;  4LJO B;  1WX8 A;  4GMV A;  1WRD B;  1UBI A;  2M19 A;  2V4I B;  4IWP A;  1NI2 A;  1E8Z A;  3K9O B;  1L0X B;  1DYQ A;  2KK8 A;  1JWU D;  5KHO A;  3VTW A;  2QDF A;  2WXM A;  3ABV B;  2K25 A;  3UIO B;  2L05 A;  1HEZ E;  4TUU A;  2LUM A;  3ZDM C;  1SF0 A;  2LAS A;  2ZCC A;  5C23 A;  1I35 A;  4WWP A;  2ZVN A;  4GIV A;  2FUH B;  3O65 B;  1SEB D;  2ASQ A;  2IGG A;  3V60 A;  3DPD A;  2LVO A;  2X8X X;  1OTR B;  2Y5P A;  2DBY A;  3TIX A;  3MHS D;  1VD2 A;  5J17 A;  3B1L X;  1PQS A;  2JXX A;  1OEY J;  5IN7 A;  1T3Q A;  2LXA A;  2KDF B;  5JHA A;  1GPX A;  2BF8 B;  5I4D A;  2UYZ B;  1R4N I;  2WS3 B;  3RNG C;  4MM3 A;  1J7C A;  5MPO A;  4LJP B;  3KH0 A;  2KMA A;  1RLF A;  3PPA A;  1V5O A;  3HK0 A;  4II3 B;  1IP9 A;  2MLB A;  1TIF A;  1SIJ A;  4NJ6 A;  2QJL A;  3HUI A;  3RN9 C;  4JWU C;  4BBN F;  2CHW A;  2MBH A;  3B0A A;  1XO3 A;  4FJZ A;  2WYQ A;  1V81 A;  2PIA A;  4JWS C;  2X38 A;  4RM9 A;  2JRI B;  1TZO A;  2N1V A;  3VHT C;  3DHG C;  4F1S A;  2V3N A;  1IYF A;  2VZK D;  4A3P A;  3WA0 A;  2FCN A;  3B2G A;  4FXC A;  3AEF B;  4DK5 A;  1WF9 A;  4ZYN A;  3KVF B;  1KFY B;  4XWT A;  2DZM A;  2K0P A;  2FNJ B;  4ZRQ A;  3NZS A;  4IUM B;  3AB5 A;  2ON8 A;  3VRB B;  1OQR A;  2CS4 A;  3GB1 A;  3JVZ X;  5AZF A;  3KYD D;  4G0N B;  1D5Z C;  4BOZ B;  1XF5 L;  2LEK A;  2GBN A;  2GB1 A;  3DBR B;  4ANX A;  2KWD A;  3V3X A;  3IT4 B;  5IAA C;  3ZYY X;  2WXR A;  4XZ4 A;  1EF1 A;  1TS5 A;  1PDX A;  2XEW A;  3RZW C;  4I6P A;  4FJY A;  2PW9 A;  3FKY A;  1DOI A;  3K9P B;  4I6N B;  3VUW A;  2KD0 A;  2SEB D;  1L0Y B;  3QC8 B;  2AYO B;  4DDI D;  2ZCB A;  1QLB B;  1YN3 A;  1WMH A;  3P4R B;  4NQK E;  3EFC A;  4L23 A;  1QT9 A;  4DDG D;  2BB6 A;  5GMV A;  2IPK D;  4L1B A;  4JX1 C;  3Q3J A;  1FM0 D;  5CTR C;  4UDU C;  3RPF C;  1MG4 A;  2M4N A;  2JWZ A;  1LM8 B;  1FFU A;  1ZXH A;  2K39 A;  3KUZ A;  2MCN B;  2KAC A;  1YQ3 B;  2LGD A;  3VR9 B;  5IO9 A;  2WXO A;  3ZW3 A;  4A20 A;  5D3D A;  1JRO A;  5BYR A;  4RFB A;  4HCP B;  1JWM D;  3VXW A;  3ZKJ C;  2YEP B;  4WJQ A;  2RDG A;  3U30 A;  5LXI B;  1KLV A;  1LFD A;  4ASW C;  5C2T B;  2MJE A;  2EEL A;  1ROE A;  5L83 A;  2L76 A;  2AX5 A;  3ZJV A;  4MEL A;  2WDT B;  3R3M A;  3N1X C;  3NS1 A;  1Z2M A;  2N9L A;  3NUH B;  5C1Z A;  5E6P A;  2MP2 A;  2GMI C;  4YSY B;  2FIF A;  3T8M A;  3H9D A;  2K6D B;  2B76 B;  2ICI A;  4KGT A;  2MJ3 A;  3APD A;  4ZRJ A;  4IOI E;  4GU2 A;  4J3O D;  1ACC A;  1KRH A;  1MVK A;  1UGJ A;  2WP9 B;  4OW0 A;  2NR2 A;  3V61 A;  1E5W A;  4HKQ A;  1RWS A;  2DZI A;  1UD7 A;  2LWP A;  5D7G A;  4FHJ A;  3BVM A;  2AQ3 B;  3EGR A;  4JLC A;  2K8H A;  2BW2 A;  3GE8 C;  3V6E B;  3MTN B;  1CJE A;  3MC0 B;  1QOA A;  2JXT A;  4EKU A;  2CHZ A;  1Q10 A;  4X57 B;  3NVY A;  1H4R A;  4W9L A;  4B9K A;  4ZDV A;  2MBE A;  2LGY A;  4GXB A;  1EWC A;  1TGZ B;  3R7Q A;  1YNT E;  2DNF A;  3DHH C;  2MJD A;  3JYU A;  1OFF A;  2K3U A;  2DZK A;  3SDL C;  3A4S C;  1TS3 A;  5JH5 C;  2W82 A;  3OWE B;  3PSE B;  4IWO A;  1HQR D;  2GBJ A;  2N7J A;  2V3S A;  2MRP A;  4DWF A;  4PS3 A;  2OJR A;  3R2T A;  4WJO A;  2YVC A;  3R2I A;  4AWJ A;  3Q8C A;  2PKO A;  5EE1 A;  2ZEQ A;  2YEP F;  4MM3 B;  2WXL A;  1TZ1 A;  2DLB A;  2IO1 B;  4RCO A;  4HKZ E;  3NVW A;  1Q0W B;  4G50 A;  5HKH A;  1NBF C;  1E8Y A;  1YJI A;  3ZJU A;  2BQQ A;  1F1H A;  3AEA B;  4IM0 A;  3HRD D;  1UF0 A;  3RMK C;  2R2O A;  2WXH A;  2W9N A;  2K22 A;  2J0M A;  2WLB A;  4PS7 A;  4O1N A;  5D94 A;  1GJZ A;  4DHZ B;  1WJ6 A;  4YL8 A;  1FD6 A;  2D3B A;  2KN5 A;  3AED B;  3P2B A;  1BML C;  5E6J A;  4M8M A;  2DYM A;  4RGM A;  3L10 B;  2KJ6 A;  3QAR A;  1XQQ A;  2PMV A;  2M8S A;  1FNU A;  1SGH A;  3PRP B;  3DWG C;  4OHJ A;  3V05 A;  4YSX B;  2D3G A;  1WZ3 A;  2MW5 A;  1KLU D;  1UZX B;  1XXG A;  2GBM A;  4P6V F;  2MBO A;  1MHX A;  3QHT A;  4BFR A;  4TV3 A;  5DPR A;  1RFA A;  3U52 E;  1T0S C;  1YD8 U;  4W9C A;  4K7S A;  3ZNI D;  3SU8 X;  1WI0 A;  2IO2 B;  4QAY A;  4XX5 A;  4KKJ A;  1WH3 A;  1WXQ A;  5EE9 A;  2WU2 B;  2PTL A;  1GC6 A;  3DCG A;  2JZZ A;  5FK9 C;  1T0Y A;  2K8B A;  3Q3F A;  2N1W A;  4ARC A;  4AOF A;  3FAH A;  1JQ4 A;  4NNJ B;  3ZLZ A;  1ESF A;  1PYW D;  2I38 A;  2O6V B;  3R66 C;  2Y5B B;  1C3T A;  2BS3 B;  4FN2 A;  2Q5W D;  2M1M A;  2WXP A;  3Q14 C;  4EFO A;  3ZXR A;  4YXD B;  2PEA A;  1OEY A;  2BWE S;  4WWN A;  5D6J B;  1GNU A;  1XCQ L;  2ZNV C;  2EKE C;  3ZNH B;  4A6Q A;  4AUQ C;  1I4R A;  3EUB 2;  1NVI D;  2I2Y A;  4BKG A;  1ZE3 D;  1TKG A;  5G5G A;  3QAQ A;  1WSP A;  3ML9 A;  1V6E A;  3SEB A;  1WXA A;  3AUL A;  1IUE A;  4BKT A;  2HJ8 A;  1CMX B;  4E71 A;  2JUO A;  4ARI A;  2G3Q B;  1E8X A;  4BAX A;  1N63 A;  3L54 A;  3CWI A;  4REZ A;  1WE6 A;  4KV2 A;  3MFG A;  1N5W A;  4TQ1 A;  4KGS A;  4HVB A;  4ACF A;  1C79 A;  3ML8 A;  1BUI C;  2JU6 X;  1NDD A;  4P1B C;  1I4Q A;  1SE4 A;  4AS1 A;  5DPT A;  1XLN A;  1L5P A;  1CK1 A;  3P4S B;  4M0W B;  3U8Z A;  5CX3 A;  1VR9 A;  2H89 B;  3Q6B A;  5H92 C;  1F2R I;  4USA A;  2KOX A;  2PLP A;  4HJK A;  2WXG A;  3P63 A;  1A70 A;  2LHE A;  2PE6 B;  2UU7 A;  1F0Z A;  4RMA A;  3U4E G;  3RFZ B;  1ZOY B;  4CQN A;  1WR6 E;  4DQO C;  3VR8 B;  2MBB B;  3QQ8 B;  1J7B A;  4F7Z A;  4JL9 A;  4PK1 A;  1KLG D;  2BGF A;  3AE5 B;  1FRD A;  1ET9 A;  3L16 A;  2LFI A;  1FCC C;  4IWQ A;  1GAQ B;  3AV8 A;  4NAW B;  3BK1 A;  4FJV B;  1I7H A;  1OQY A;  2V9H A;  2BYV E;  4MT5 A;  1UEL A;  2AWT A;  2VH1 A;  3W2D A;  3S2A A;  2KTF A;  1C4P A;  2ZZP B;  3EHV A;  3RI7 C;  4C7Y A;  2FE8 A;  1YQ4 B;  2WX0 A;  2KFK B;  2KQ7 A;  3PS6 A;  2NMQ A;  4BZA A;  4PS8 A;  1AW7 A;  4HPP A;  2GBK A;  1WGR A;  3TEZ A;  2Y5C A;  1SSN A;  2EKI A;  3DWM A;  3Q8A A;  2ZJD A;  1HTQ A;  4WJN A;  4BVU C;  1C9F A;  2HDE A;  2QHO A;  3P42 A;  1WM2 A;  1C76 A;  4DXA B;  3R8B A;  2BPS A;  4OVV A;  1EWY C;  2XBB C;  1LGR A;  2QCZ A;  1YQB A;  1WXM A;  1F2R C;  2KC1 A;  3BWU D;  4LCD E;  4WAF A;  1H8C A;  2NS5 A;  2QC8 A;  3OAW A;  1Y8R C;  1OQQ A;  1YOV B;  2KYW A;  3ZNG C;  4C00 A;  2D3C A;  4MH8 A;  4K81 A;  4KDI C;  1C78 A;  3FIL B;  3WAO A;  5IP4 D;  2BB5 A;  1R4M I;  2JY6 A;  1WJU A;  3DBH I;  3PZ7 A;  3KYC D;  3WIM A;  1D5X C;  1V86 A;  4M01 A;  4HK2 A;  2R61 A;  3AEC B;  2WHI A;  4MGI E;  2C60 A;  3PZ8 A;  4G3X B;  3BVZ A;  1V1P B;  2K5P A;  1TKY A;  2MQJ A;  5T8I A;  4ANW A;  3C0R B;  1YJJ A;  1FPY A;  2JX5 A;  4K3B A;  3N32 A;  1TKE A;  4C4V A;  2WQY B;  1WX9 A;  4ZRP A;  3PO0 A;  4W9I A;  2KWC A;  3AEG B;  3I9V 1;  2XK5 A;  1TY0 A;  4ZHO A;  3AE7 B;  2FAZ A;  5E6N A;  2JSV X;  1ZXI A;  4A90 A;  3CST A;  4RF0 A;  1E6E B;  4GDL B;  2L0F A;  2O2V A;  2GBR A;  3TEX A;  1R4M B;  4GDK A;  1HA5 A;  1WWT A;  1Z5S B;  3DBL B;  2I1J A;  1WGK A;  4W9G A;  4MEM A;  3M95 A;  1MJD A;  3RNB C;  2L7R A;  3I57 A;  1EU3 A;  2KLG A;  2KFK A;  2DYB A;  2JQR B;  1WGG A;  3H6N A;  1J7A A;  4FAD A;  1ZUD 2;  4NZL B;  3EEC A;  3NG0 A;  3LB8 C;  1KH0 A;  4YSZ B;  3H7P A;  1V2Y A;  4E74 A;  2JWU A;  3MJ5 A;  3PGE A;  4TSS A;  4YTN B;  4BBN C;  3TCA A;  1ENF A;  1QQR A;  4N59 A;  5G55 A;  2NBV B;  3IT6 B;  5AZG A;  4NQL B;  2L1A A;  1MG8 A;  3VUY A;  3FC4 A;  1E7V A;  5AZH A;  3Q8B A;  2CKH B;  1BT0 A;  3PRE A;  1C4C A;  1WFY A;  4URK A;  3TBL D;  2LGX A;  5JHB A;  1DGJ A;  4W9J A;  5L95 C;  1FXI A;  4JQW C;  1VDV A;  3MC8 A;  2OOB B;  2GLS A;  1FNW A;  1WXV A;  2OHF A;  2QEJ C;  1PFD A;  3AE9 B;  4DHJ B;  1F9J A;  2IGD A;  3A9J A;  2V4L A;  3MJW A;  1GB1 A;  2RPQ A;  1X1M A;  2RGF A;  1FEH A;  3NVV A;  4K1R B;  5EE3 A;  4HEA 1;  4IG7 B;  3TSS A;  4P1C C;  3NOB A;  4CO7 A;  4JGH B;  2NTS A;  1WYG A;  2KDM A;  2PJH A;  2KDI A;  4XC2 A;  1KTK A;  1U4A A;  2GI9 A;  2LXC A;  2BBC A;  2WXI A;  4XWW A;  2C7N B;  4WUR A;  1WX7 A;  4HRS A;  4HPM B;  3MHZ A;  2BKF A;  2KTR A;  2E3T A;  3AE2 B;  1M4V A;  1CZP A;  1FFV A;  3CMM B;  2GOW A;  4B0E A;  3B2F A;  4B6W A;  2G4D B;  4GDK B;  1PUT A;  3B9J A;  2PVO D;  1YJ1 A;  3URY A;  2E6X A;  2IND C;  2JVC A;  5BYS A;  3Q3N C;  1RYJ A;  4K7U A;  1LQB A;  4DXG A;  2LRU A;  2C9W B;  3UIN B;  2WX1 A;  1K53 A;  1J0G A;  2KMM A;  2DAF A;  4F8C B;  4YT0 B;  2K9X A;  2UWQ A;  2JYT A;  5DPW A;  2QMT A;  5J2R A;  1M94 A;  1FXA A;  2RD0 A;  4KDL B;  1Q1O A;  2MHJ A;  2BT6 A;  4GN1 A;  1D3Z A;  2LGS A;  3AE3 B;  3GZN I;  4RGT A;  1L4D B;  3KQ4 A;  1DOX A;  3FIL A;  1RRB A;  4EEW A;  4NJ7 A;  3JSV A;  2IO3 B;  4MJS A;  3PHX B;  1UWM A;  1E7P B;  3VH3 B;  1QOB A;  4S17 A;  2HD5 B;  4ZYS A;  2CU3 A;  4N6E B;  3SHQ A;  1ZGU B;  2W55 A;  3HIZ A;  4EOY A;  5G2N A;  1MFW A;  1ZDV A;  1TT5 B;  1ZP0 B;  3BYY B;  3DBR I;  2C7H A;  3KW5 B;  5C3J B;  4C4V B;  2WXN A;  2MEK A;  2DWQ A;  3AE4 B;  3DQV A;  4JPS A;  3VUX A;  2IY0 B;  4A3O A;  4AJW A;  3ZO5 B;  4LNF A;  3H8H A;  1WJ4 A;  4N58 A;  4KVG B;  2D10 A;  2IY1 B;  4HPL B;  2H88 B;  3JW0 X;  5BMG A;  3PV1 A;  4GDL A;  3AI5 A;  3SR6 A;  5CHW A;  4LNN A;  1UBQ A;  1V49 A;  1KOT A;  2CJN A;  2KAN A;  1V5T A;  2N9E B;  4NAW A;  1QOF A;  1GC7 A;  3RCZ A;  2KO3 A;  5DPS A;  1VZ7 A;  3WAL A;  1P1A A;  1WE7 A;  1PGX A;  2L52 A;  3VAW A;  2JT4 B;  1IBX A;  1Y56 A;  4M0W A;  2MBQ A;  4LDT B;  2DX5 B;  3A9K A;  4JIO U;  4TKN A;  3W1S C;  2OJW A;  3OJ3 A;  1WMH B;  2B3A A;  2N7D A;  5E6O A;  1YIW A;  4GOC A;  4XGA B;  1BXT A;  4R3D A;  1P3Q U;  3ZTC A;  1GG3 A;  2KQ4 X;  4ANV A;  3ZUN A;  1JWA D;  3W1Y A;  3Q8E A;  1V9J A;  2J0K A;  4FUL A;  2KFJ A;  1SXT A;  1N5X A;  1P0R A;  3BK2 A;  4WAA A;  4ANU A;  1F52 A;  4WQM A;  3AU5 A;  1KF6 B;  3U7Z A;  3CF6 E;  3TEY A;  3KLS X;  4BOS C;  2RSU A;  2FCQ A;  4K3C A;  4MSQ B;  2M17 A;  1K52 A;  3M63 B;  2RDB C;  3BIN A;  3DVN V;  3PT2 B;  3X23 A;  1C4A A;  1JW9 D;  3ENE A;  2C5L C;  3NJT A;  3JSV B;  1UNS A;  4MJS B;  2A4Z A;  3AM9 A;  2V3P A;  1N6Z A;  4B95 A;  2KVZ A;  4LTU A;  1I4H A;  4HDQ A;  3VTV A;  3ZGZ A;  3A9K B;  3HHM A;  2D3A A;  5IOI A;  4W9K A;  1IPG A;  2BTE A;  1F77 A;  4KX6 B;  2WXJ A;  4C7Z A;  1P7E A;  1UWX A;  1EUV B;  2W3S A;  2M0A A;  1PGB A;  3RYT A;  2CR5 A;  5BMH A;  3NVZ A;  3BVG A;  4HWI B;  2N0S B;  3BII D;  3ZRF A;  1YN5 A;  2KVR A;  2O6V A;  2QIL A;  4FA6 A;  3W1S A;  3BYT B;  4WQO B;  3OLM D;  1IGD A;  4GSW A;  2G4S A;  2N9X A;  1A5R A;  3CIR B;  2KLC A;  5G5H A;  4HRO A;  1WYW B;  3NRZ A;  1AAR A;  4W9E A;  2JYE A;  3C8Y A;  5JXV A;  3TL5 A;  1WGD A;  4DHJ D;  3HVD A;  2IBI B;  1TBE A;  1STE A;  1K51 A;  2O6V D;  3ZQ4 A;  1HTO A;  1YMH E;  4HCN B;  4LDT D;  3N20 C;  2LGI A;  2KKC A;  4NPN A;  3E9S A;  3HM3 A;  4D2K A;  5CHV C;  3C19 A;  2WXK A;  3TMP B;  1WR1 A;  3NZU A; 
#chains in the Genus database with same CATH homology
 2INN E;  1HA5 A;  1FIQ A;  1EM7 A;  1WWT A;  3AN1 A;  3IXS A;  4ITK A;  2B76 B;  1I4P A;  2ICI A;  4KGT A;  5D3I B;  2MJ3 A;  1WGK A;  2IDY A;  1FCL A;  4IOI E;  4J3O D;  1ACC A;  2XNA C;  4ZOH C;  1KRH A;  1MVK A;  4A55 A;  1UGJ A;  3I57 A;  2WP9 B;  1EU3 A;  4OW0 A;  5HFY A;  1DOY A;  3SFD B;  2D5G A;  2JQR B;  4HKQ A;  1RWS A;  3SFE B;  1J7A A;  1YN4 A;  1ZUD 2;  4NZL B;  1XEE A;  4PT5 A;  3UI3 A;  4MAC A;  5D7G A;  3LB8 C;  1CQV A;  1KH0 A;  4YSZ B;  3BVM A;  4DXF A;  4A8X C;  2AQ3 B;  2JWU A;  3MJ5 A;  3EGR A;  4TSS A;  4YTN B;  1IBX B;  2BW2 A;  3TUO A;  1ENF A;  1QQR A;  4XE0 A;  4N59 A;  1CJE A;  3MC0 B;  1QOA A;  2JXT A;  2IJ0 A;  4US9 A;  1SE2 A;  1VZ8 A;  1Q10 A;  3IT6 B;  3NVY A;  2RMM A;  3TEW A;  2L1A A;  4RGO S;  1EWC A;  3AH7 A;  1YNT E;  3FC4 A;  2W3R A;  5EE0 A;  2MJD A;  2RPV A;  3Q8B A;  1T6B X;  5TSS A;  2CJO A;  4NJC A;  3W5U B;  1HZ6 A;  4YWG G;  1C4C A;  3U2S C;  1I4G A;  1OFF A;  2ZW0 A;  2K3U A;  1HXY D;  1DGJ A;  1JAL A;  2WXQ A;  1TS3 A;  1TY2 A;  1L6V A;  4RH6 A;  2W82 A;  1FXI A;  3OWE B;  1VDV A;  2AQ2 B;  1FNW A;  2OHF A;  4RF1 A;  1HQR D;  3AE8 B;  3L4P A;  2N7J A;  3WCQ A;  2GRI A;  2QEJ C;  1PFD A;  3AE9 B;  5LNK 1;  1LO5 D;  1JML A;  1P7F A;  1VRA B;  2NTT A;  1K50 A;  3MP9 A;  3P4P B;  4YTM B;  3R2T A;  1R7S A;  2IGD A;  2HTM E;  4OZC A;  3R2I A;  1TJE A;  1TS4 A;  3Q8C A;  5AUK A;  4WIP A;  2PKO A;  1GB1 A;  1JWB D;  5EE1 A;  2WDR B;  1FEH A;  3NVV A;  3AMZ A;  5EE3 A;  4HEA 1;  2INP E;  2TSS A;  2YEP F;  4B0M A;  3Q8F A;  4MM3 B;  2WXL A;  2DLB A;  3TSS A;  1TYG B;  2XN9 C;  3LYY A;  4RCO A;  4TQ0 A;  4HKZ E;  3NVW A;  2JZP A;  2SAK A;  4ZHP A;  2NTS A;  1WYG A;  2LMC A;  1YJI A;  2KDM A;  3T3N A;  3ZJU A;  3GS2 A;  2OED A;  3AEA B;  3HRD D;  1L4Z B;  1SE3 A;  1KTK A;  1QF6 A;  2GI9 A;  1N60 A;  2WXH A;  4C56 C;  1SJH D;  1PGA A;  2BBC A;  2WXI A;  4XWW A;  3AE6 B;  1L6U A;  2K22 A;  2Z8L A;  1VZ6 A;  2WLB A;  4WUR A;  4OZA A;  4HRS A;  1JRP A;  3MHZ A;  4O1N A;  2FBW B;  2BYT A;  4JE3 B;  1FD6 A;  2E3T A;  3AED B;  2L32 A;  3AEE B;  1HZ5 A;  2BS2 B;  1BML C;  3AE2 B;  3ZJT A;  1M4V A;  5E6J A;  1CZP A;  1FFV A;  2DYM A;  4RGM A;  5FKA C;  3E56 A;  4LLG M;  4B0E A;  3B2F A;  2PMV A;  4GLS C;  2L83 A;  1FNU A;  4OHJ A;  3DWG C;  3Q69 A;  4GDK B;  3V05 A;  1NYR A;  4YSX B;  1ZPS A;  1KLU D;  3EA6 A;  2W54 A;  1PUT A;  4Q2J A;  4RGN A;  1XXG A;  3B9J A;  2PVO D;  5FR3 A;  3URY A;  4P6V F;  2KN4 A;  2E6X A;  5BYS A;  1RYJ A;  1XLO A;  2VZK B;  4DXG A;  1FNV A;  1MHX A;  1NEK B;  3AE1 B;  2PVG C;  1QKZ A;  1K53 A;  3U52 E;  2KMM A;  3ETR A;  5H8Y E;  4IKG A;  4EE2 A;  1GB4 A;  3HVZ A;  3W5V B;  4YT0 B;  2K9X A;  2JYT A;  2WDV B;  2QMT A;  4AQ7 A;  1FMA D;  2IGH A;  4KKJ A;  1WXQ A;  4TMA B;  1N62 A;  1FXA A;  5EE9 A;  1VLB A;  2ACZ B;  2WU2 B;  1I4X A;  2PTL A;  2BT6 A;  5HI1 A;  3T3O A;  3AE3 B;  5FK9 C;  3AEB B;  4RGT A;  1JWS D;  2WDQ B;  1L4D B;  1V1O A;  3KQ4 A;  2KAJ A;  1NEN B;  1N61 A;  1DOX A;  3FIL A;  3VRA B;  2M19 A;  4ARC A;  3BZD B;  4OVZ A;  2Y3A A;  2V4I B;  2LHD A;  3FAH A;  1UWM A;  1E7P B;  1JQ4 A;  1ESF A;  1PYW D;  2I38 A;  1QIL A;  1L0X B;  1DYQ A;  1QOB A;  1JWU D;  2BS3 B;  4KGR A;  2Q5W D;  2WXP A;  4ZYS A;  1RM6 C;  2WXM A;  2J4X A;  2CU3 A;  3ABV B;  4N6E B;  2W55 A;  1HEZ E;  2LUM A;  2V0G A;  4YXD B;  1SF0 A;  2WU5 B;  1ZDV A;  2WNM A;  1XCQ L;  1ZP0 B;  3BYY B;  5C3J B;  3LXF A;  1B1Z A;  1SEB D;  2IGG A;  3KWV A;  2WXN A;  2MEK A;  2DWQ A;  3AE4 B;  4JPS A;  4A6Q A;  1JCK B;  2Y5P A;  1I4R A;  2DBY A;  3EUB 2;  1NVI D;  2I2Y A;  3H8H A;  1WRI A;  1ZE3 D;  1TKG A;  1T3Q A;  4N58 A;  5G5G A;  2J53 A;  1WSP A;  1GPX A;  5I4D A;  3SEB A;  2H88 B;  5BYQ A;  2WS3 B;  5BMG A;  1TS2 A;  1IUE A;  1J7C A;  2J52 A;  5MPO A;  3SR6 A;  4NAM A;  2CJN A;  4ARI A;  1N63 A;  1QOF A;  3CWI A;  4REZ A;  1VZ7 A;  3MFG A;  1N5W A;  1L0V B;  1SIJ A;  4TQ1 A;  2QJL A;  3HUI A;  2QIE B;  4KGS A;  1E10 A;  1C79 A;  1PGX A;  4JWU C;  2L52 A;  1BUI C;  3NZ3 A;  1IBX A;  2JU6 X;  1Y56 A;  1XO3 A;  4M0W A;  2G9H D;  1FRR A;  2PIA A;  1I4Q A;  1SE4 A;  1FO4 A;  4AS1 A;  4US8 A;  1XLN A;  1L5P A;  4XDD A;  1CK1 A;  3P4S B;  4JWS C;  3J9C A;  2X38 A;  1VR9 A;  2H89 B;  1VJK A;  1TZO A;  5H92 C;  1F2R I;  4USA A;  1UUP A;  2PLP A;  1BXT A;  4R3D A;  2WXG A;  4OZB A;  3P63 A;  2V3N A;  1A70 A;  2LHE A;  2VZK D;  1IGC A;  2J42 A;  2KQ4 X;  2M56 B;  5HG2 A;  2DYO A;  1JWA D;  1F0Z A;  3Q8E A;  2RDH A;  3B2G A;  4FXC A;  3U4E G;  1ZOY B;  3AEF B;  3RFZ B;  4CQN A;  1D4B A;  1SXT A;  1V8C A;  1N5X A;  3VR8 B;  4DQO C;  1J7B A;  2N9K A;  3BK2 A;  1XCT L;  1KLG D;  4WQM A;  1KFY B;  3AE5 B;  1KF6 B;  1FRD A;  4IDI A;  3U7Z A;  1ET9 A;  4XWT A;  2LFI A;  2K0P A;  1FCC C;  1GAQ B;  5BMI A;  4ZRQ A;  3TEY A;  2MH7 A;  3KLS X;  3AB5 A;  3AV8 A;  2ON8 A;  4NAW B;  3BK1 A;  4YTP B;  3VRB B;  1I7H A;  1OQR A;  3GB1 A;  1E9M A;  4MT5 A;  1K52 A;  5GXG B;  2FUG 1;  1D5Z C;  1XF5 L;  1ET6 A;  3W2D A;  5HHD G;  1C4P A;  1C4A A;  2LEK A;  3P1M A;  1D5M C;  1JW9 D;  4C7Y A;  4H2A A;  2GB1 A;  1V1P A;  2FE8 A;  4P16 A;  3GP7 A;  1YQ4 B;  2KWD A;  1UNS A;  1SB3 C;  3V3X A;  3AM9 A;  2V3P A;  2LJI A;  2WXF A;  1AYF A;  1D6E C;  2NMQ A;  3IT4 B;  3IAM 1;  3ZYY X;  2WXR A;  2ZW1 A;  1TS5 A;  4LTU A;  1I4H A;  1PDX A;  1AW7 A;  2PW9 A;  3TEZ A;  3VQI A;  1DOI A;  1SSN A;  2EKI A;  2Y5C A;  1MHH E;  3DWM A;  3Q8A A;  2SEB D;  3ZGZ A;  4KKI A;  1L0Y B;  1QLB B;  1YN3 A;  1C9F A;  2HDE A;  1B9R A;  1T5X D;  3P4R B;  1ZDX A;  3P42 A;  2AQ1 B;  1C76 A;  2G1E A;  3R8B A;  4WWM A;  2BTE A;  4L23 A;  1F77 A;  1QT9 A;  4KX6 B;  1C77 A;  1NYQ A;  1EWY C;  2WXJ A;  2BB6 A;  4C7Z A;  2IPK D;  1P7E A;  1UWX A;  4L1B A;  1F2R C;  1SBB B;  4JX1 C;  3BWU D;  1FM0 D;  2W3S A;  2M0A A;  1XLP A;  4UDU C;  4WAF A;  3RPF C;  1RFK A;  1PGB A;  3O13 A;  1OQQ A;  1FFU A;  4MH8 A;  1C78 A;  1EU4 A;  1ZXH A;  2BS4 B;  3FIL B;  5BMH A;  3NVZ A;  3BVG A;  1QOG A;  2BB5 A;  2KAC A;  1YQ3 B;  1SJE D;  3VR9 B;  2QSD A;  2WXO A;  3KWL A;  3IAS 1;  2N0S B;  3BII D;  3PZ7 A;  1E0Z A;  1YN5 A;  1D5X C;  5D3D A;  2QIL A;  2ONQ A;  4LK0 M;  3W1S A;  4L2Y A;  3BYT B;  1AWD A;  1JRO A;  5BYR A;  2R61 A;  4RFB A;  3AEC B;  1IGD A;  4HJG E;  3PZ8 A;  1JWM D;  3BVZ A;  1V1P B;  2K5P A;  1TKY A;  4RNA A;  2YEP B;  3CIR B;  1GOZ A;  5T8I A;  1YJJ A;  2RDG A;  5G5H A;  4HRO A;  3NRZ A;  3W9C B;  2JX5 A;  2JYE A;  1NI3 A;  1TKE A;  3C8Y A;  5JXV A;  4A9A A;  2WQY B;  5C2T B;  2MJE A;  2EEL A;  4ZRP A;  3PO0 A;  1ROE A;  3HVD A;  1MPE A;  2AX5 A;  1STE A;  5AUI A;  1K51 A;  1MI0 A;  3AEG B;  3ZJV A;  3ZQ4 A;  3I9V 1;  4C80 A;  1YMH E;  3N9Y C;  1TY0 A;  3NS1 A;  4ZHO A;  4XDC A;  1XLQ A;  3AE7 B;  2LGI A;  2N9L A;  2JSV X;  1AN8 A;  3NUH B;  1ZXI A;  4A90 A;  3E9S A;  4RF0 A;  3P4Q B;  4YSY B;  4D2K A;  1E6E B;  4GDL B;  4WH4 A;  2WXK A;  1V97 A;  3TEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...