2DLBA

X-ray crystal structure of protein yopt from bacillus subtilis. northeast structural genomics consortium target sr412
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
b'AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords yopT
publication title X-ray structure of hypothetical protein from Bacillus subtilis O34498 at the resolution of 1.2A. NESG target SR412
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09467 Yopt Hypothetical protein Yopt
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.330 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2dlbA00
2DLBA
chains in the Genus database with same CATH superfamily
3ZNZB 1PDXA 1ESFA 3K9OB 2J0JA 4MJSB 4DXGA 1SSNA 1P1AA 4X57B 2D10A 1WZ3A 2IGHA 3SHQA 2WLBA 2CU3A 4GSWA 5AEKB 4II3B 4TMAB 4JLCA 2EMTA 4B0MA 2QDFA 1I7HA 4JX1C 4MSQB 3ECIA 3RMKC 2H89B 3Q6BA 3TEXA 2LGXA 2DAFA 1WZ0A 1K50A 3M95A 2MP2A 3B1LX 2BGFA 1XLPA 5H8YE 2D2QA 1EO6A 3DPDA 3V6CB 2JRHA 4I6PA 3ZO5B 1XQQA 1D3ZA 2LEKA 2M1MA 2LVQA 5C23A 2I38A 3VR8B 1NVID 1E9MA 3X0WA 2I2YA 5IP4D 4ARIA 4A3PA 1A5RA 1I4XA 3OWEB 4FHJA 5BMIA 4XE0A 2BW2A 2WQYB 5BO4B 2R2QA 1F0ZA 1T0RC 5G2NA 4CHKA 1WMHA 2KZRA 3T3OA 3I3TB 4HWIB 4NAWB 4IWPA 1GC6A 3A9JB 3S2AA 2C60A 4BAXA 1AN8A 1K51A 2N7JA 3N1ZC 1PGBA 1TYGB 2A4ZA 2DYBA 1E7PB 3AECB 3BK1A 4A90A 4K7WA 2ZW0A 2L0FA 2K0PA 2NMQA 4LNOA 2R2OA 3P1MA 4LDTD 3AE6B 4HKQA 1QKZA 2MJEA 1EWYC 1I4RA 1UELA 2D5GA 2N9XA 4ICVA 1YJJA 2JRIB 2DZJA 2VRRB 3WALA 4MM3B 2JT4B 3L4PA 3TIXA 3P2BA 3QA8A 1P9DU 5JHAA 4K3BA 3A1QA 2LVOA 3Q8FA 3JW0X 1U4AA 4WURA 4BKSA 4WWMA 3RZWC 4KGSA 4IDIA 4MH0E 4AP4C 2LGDA 1HXYD 2BYFA 4ARCA 3UQAA 3ZNGC 3QIJA 3NVWA 3SFEB 3RN9C 3EECA 2K3UA 3VUYA 3ZNHB 4KIKB 5HHDG 1YN5A 5CX3A 2W82A 1GG3A 1N63A 2O2VA 3AULA 3N20C 3P42A 3K9PB 1T0SC 1V86A 3UGBB 5J2RA 1IGCA 5C3JB 4WAAA 4DWFA 4US9A 4ANVA 3N1XC 2LXAA 3R3MA 3CMMB 1EWCA 5KHQA 1JW9D 2FUHB 3HVZA 2BBCA 2DZIA 2EKEC 4IM0A 1HA5A 2C7HA 3Q69A 1D5ZC 2W9NA 1ZUD2 3MP9A 2DNFA 3L13A 2FNJB 5FK9C 2JYTA 2KDFB 1SJED 3ZYYX 3ZTCA 4WJNA 4DBGA 3DOWA 3JYUA 3HVDA 3ZLZA 4LJOB 1YMHE 3ALBA 2JY6A 3IXSA 1CMXB 4WJOA 3C0RB 2JZPA 2WX0A 4CQNA 2W3SA 2L00B 3SFDB 2KOXA 4YTPB 1R4MI 4W9FA 2KACA 4WQOB 3MTNB 1BMLC 2NTTA 3Q3MC 1WXSA 2ON8A 1SXTA 4F1SA 3Q3OC 4GB9A 2K6QA 3DBRI 5CTRC 3M3JA 1FRDA 1K8RB 1C79A 4TUUA 3ZTDA 2KWCA 4F7ZA 4HLEA 4CYEA 2JPHA 4JL9A 1T6BX 1KF6B 2KK8A 2HTHA 3SR6A 1T5XD 3DDCB 1OFFA 1HTOA 2I1KA 4AS1A 4HEA1 1JRUA 2KDBA 1OEYA 4GXBA 3KQ4A 2DYOA 4BBNC 1CJEA 2KQ4X 1WSPA 2BF8B 4KDIC 2MA9B 3X23A 2DZMA 4WQMA 2GBRA 1F52A 5BYQA 4OHJA 4G0NB 2BS4B 2RGFA 3BY4B 4IKGA 3EFCA 4RM9A 1WM2A 3AE8B 3BYYB 2WX1A 3NS8A 1I4QA 2LFIA 3WA0A 3U2SC 1WY8A 3M63B 4YL8A 2HDEA 2PJHA 1RRBA 1PQSA 2MBEA 3V6EB 2A5UA 2BPSA 3NRZA 4JGHB 2AL3A 4YSYB 1IUEA 1GPXA 3NVYA 3NS1A 1WRDB 1J7BA 3U30A 3W1SA 2VZKB 2LGIA 4PT5A 1F9JA 4B6WA 4RGTA 3ZRFA 3WANA 1NI2A 3R66C 4KVGB 3NY5A 1YIWA 2MRPA 1C4PA 4K81A 1R4NI 2LJ5A 4OVUA 3AN1A 3RCZA 1TKEA 2AQ1B 2CU1A 4TSSA 3HRDD 1L0YB 3VFKA 3PREA 2BS3B 2OHFA 4IM2A 2N9PC 2Y3AA 3Q14C 4IW0A 4A6QA 1Y56A 4I6NB 3B2GA 5J18A 3JSVA 4K1RB 2QSDA 3APFA 3IAM1 3ZDTA 1WXAA 2DHZA 2LD9A 1I4PA 2BWFA 2WHIA 1NBFC 1UH6A 2TSSA 2MJDA 2KX0A 5E6NA 2O6VA 4LTUA 1J7AA 1UNSA 2LJIA 2M4NA 3LYYA 4ACFA 3AU5A 1P98A 5DPTA 1WJ6A 2D3AA 1E6EB 2RPVA 3R8BA 2NR2A 2XK5A 1WWTA 3AMZA 4P6VF 3VQIA 4IUMB 1TY0A 2WP9B 1I4HA 1OQYA 2RMMA 1YN3A 4DHZE 1RAXA 2PKOA 3PZ7A 1GJZA 1C76A 1HE8A 2WXLA 2PVOD 3EUB2 3L08A 2KJRA 4ASWC 1VLBA 2V4LA 3CSFA 3Q8AA 5FR6A 2HJ1A 3UIPB 4D2KA 2J0KA 2LWPA 1DOYA 3A4RA 3RUIB 3CF6E 3TUOA 3U8ZA 2GI9A 4C4VA 3C19A 2IZVB 4J3OD 1D5XC 4USAA 2E6XA 1KRHA 4MGKE 2IO1B 2K8BA 1V1OA 2L83A 3BK2A 1TKYA 2K9XA 1QZEA 1YNTE 1GUAB 5AZHA 3P63A 2LGSA 3QCAA 4XDDA 1N5WA 4H2AA 2INPE 2KMCA 3T3NA 1JWSD 1HZ5A 2PE9A 3HM3A 2VZKD 3SDLC 2BT6A 1KFYB 2V3PA 2PIAA 1WE6A 4XX5A 2GLSA 3SEBA 1SE4A 3N9YC 3L17A 3VVWB 1FM0D 5DPRA 3PTFC 4A55A 1TBEA 3IHPC 4KDLB 2QILA 3Q2AC 4ZRPA 1V5OA 1T3QA 2X8XX 3RFZB 2KJ6A 2J4XA 5CHWA 4MEMA 5D3DA 4A8XC 3C8YA 1MJDA 4OZBA 4BVUC 3ML9A 1L0XB 2PMVA 3RZFA 2RDHA 2IJ0A 3Q3FA 1ZKHA 2DENB 4C00A 1R4MB 3RNGC 1V5TA 5L95C 2I1JA 1YQ3B 4JIOU 3QARA 1C4AA 1HZ6A 1C4CA 3URYA 4FLHA 1IBXB 1XLNA 2DBYA 1P7FA 4R3DA 2GMIC 1E8WA 2FCMA 3VRAB 1NYQA 2N9KA 2GBKA 1SJHD 5T8IA 1AARA 2ONQA 4S17A 4RFBA 1ENFA 4P1BC 3FILB 3BYTB 5HG2A 3PPAA 5IO9A 2KKCA 2JXXA 3TJPA 1VRAB 2D07B 1AYFA 4MGYE 2N7DA 3PSEB 1L5PA 4RNAA 3V05A 2WU5B 3VRBB 2Z8LA 2INCC 4YTNB 3I9V1 4WWPA 1Q10A 2YEPB 1WX8A 1ET6A 4AUQC 1TKGA 4BOSC 2GRIA 4GMVA 1EF1A 1YX6B 4PK1A 4DDID 1KM7A 1M4VA 2CR5A 4IM3A 1P0RA 1WYWB 2KWDA 1NENB 1IP9A 2OEDA 3PLVA 4M8NA 2QMTA 1V1PA 3RNBC 3IT4B 2IO3B 2BKRB 1WXVA 3AE3B 1V49A 2LUEA 2L7RA 5TSSA 4GDLA 1I4GA 2BQQA 5D3IB 2IDYA 4NJ7A 4YSZB 4KV2A 4GU2A 2AL6A 1GNUA 1EM7A 2GB1A 4B0EA 2L8JA 1NEKB 2BTEA 1N6ZA 2KT7A 2KLGA 1R4NB 2KDIA 5IAAC 1SIFA 4ZRJA 2ZZPB 3PZ8A 3NJTA 2N4FA 4PS7A 2NCNA 1Q1OA 2PTLA 4E3CA 3RT3B 2Q5WD 4G50A 1T0YA 2DAJA 2G4SA 4IWQA 2WXHA 4MELA 1VDVA 4ZOHC 1NI3A 3R2TA 5DPSA 3QAQA 1WGGA 1FCLA 4FJZA 3PV1A 4L23A 3MHZA 4AWJA 5BYRA 3DHHC 1DYQA 1UD7A 1OQRA 2WNMA 4XYCA 3DQVA 4M0WA 1Y8RC 1L6UA 3ENEA 4ZYSA 2KFKB 2UWQA 3A9KB 1L6VA 4RCOA 1QQRA 3PRZA 4C7YA 2EMSA 3ZIMA 4JPSA 3RI7C 3DCGA 4LNFA 2C5LC 2X38A 2EKIA 4ICUA 2LI5A 2KXJA 2RSUA 1EUVB 2NTSA 3OLMD 4JQWC 2INDC 5G5HA 3VTWA 3BZDB 3L10B 2N9LA 1SF0A 2MBOA 2W54A 3AI5A 4W9EA 3HIZA 1FEHA 4HROA 2D3GA 2KMAA 4TQ1A 1I42A 2XN9C 4REZA 2KN5A 1BT0A 3SU8X 3EGRA 1WR6E 3J9CA 4KSKC 3AEEB 5BMGA 3ZQ4A 3VUWA 2KTFA 5MPOA 4IWOA 1L0VB 2BB5A 4EKUA 2E3TA 1XD3B 2KFJA 1ZGUB 2V3SA 2FCNA 1TS5A 2RPQA 4ZDVA 2WU2B 1MHXA 3MJ5A 3T8MA 2RR9A 2QJLA 4II2B 2MX2A 1JWBD 3PRPB 1PFDA 3TEZA 2FCSA 2G1EA 3QQ8B 1LXDA 4RF1A 2NPTB 3NG0A 3U7ZA 3ZJVA 2MHJA 3H7PB 4AJWA 3B2FA 1PYWD 3QX1A 2N1VA 2ZW1A 4BBNF 1C1YB 3PVLA 4OZAA 3RULA 4TV3A 2KLCA 3W1YA 1GAQB 5LXHA 3U7DA 1XF5L 3R7QA 3O13A 1P7EA 5GMVA 3AEAB 4XGAB 2V1YA 1WH3A 3NOBA 4MJSA 2KO3A 4KGTA 1E10A 3AE2B 3UQBA 4RH6A 3Q8CA 4LNKA 1CQVA 2ZCBA 2JVCA 3PS6A 2BVCA 2WGSA 2XBBC 2HTME 1VD2A 1IYFA 4GN1A 5JXVA 1DOIA 3AEFB 1AWDA 1YX5B 4NAMA 3I63C 3PHXB 4L2YA 1ZP0B 2KQSA 3GE3C 3U4EG 1XT9B 5EE0A 1JWAD 1MG4A 1VJKA 1ZW7A 4N9F4 1WI0A 1TS3A 2QEJC 3R7RA 1M94A 2KQ7A 4TKNA 1TGZB 2JXTA 1RFAA 4CO7A 4OVVA 1VZ6A 3TEYA 1FMAD 4NAWA 3A9JA 2INNE 4HJKA 1E8XA 2N1WA 2WXOA 2AYOB 1FIQA 1UF0A 1OGWA 1ZDXA 4GOCA 3ZNID 2ZNVB 2WXIA 2HE7A 2KC2A 4MGIE 3H9DA 1XCTL 3ZXRA 4E74A 1YQ4B 3MC9A 1HTQA 4MH8A 4RGNA 2WXFA 3PHWB 2DWQA 3N1YC 1TS2A 4C7ZA 2IGDA 3DWGC 3U52E 4W9HA 3P4SB 2L32A 4W9DA 2PE6B 1MG8A 4KZ0A 5D7GA 4A20A 4FBJB 4LNNA 2B76B 4GLSC 2MEKA 2MQJA 4MM3A 1MHHE 5L83A 3UINB 1J19A 3NVVA 1Z2MA 4ZHPA 1VZ8A 5D94A 1YN4A 2IY0B 1G6JA 5AUKA 2K25A 1J7CA 1KJTA 4ANXA 3KUDB 3ONSA 4IG7B 4AQ7A 4MACA 2CS4A 4RGOS 1L4DB 2MBQA 2MJ3A 2KMMA 4YXDB 4UDUC 2UU7A 1B1ZA 4W9CA 3N3KB 2ZCCA 4NZLB 4W9JA 3WAOA 4P16A 2RD0A 5AZFA 1H4RA 1V6EA 1FFVA 3V60A 1TY2A 2LRUA 4KIKA 3L16A 3GS2A 2LHEA 4PYUA 1WYGA 2XEWA 5E6JA 3MHSD 1V2YA 1RWSA 2JWUA 3PT2B 2DX5B 2GBMA 3OG5A 3VH4B 1E5WA 1S1QB 2KTRB 4W9LA 2PEAA 1XLOA 1SB3C 1NYRA 1WJUA 3HK0A 1UBQA 2KWVB 4ZRKA 3WAPA 3DVNV 5HFYA 2J42A 1WM3A 4PS8A 3QHTA 3EA6A 3V3XA 2KDEB 3BIID 3H7SA 4EE2A 3PO0A 2LXCA 2IBIB 2WXGA 4FULA 2NBWB 2L52A 1SE9A 2AWTA 3AB5A 4XDCA 5HKHA 1KLUD 2BB6A 3KLSX 4EZJA 2ICIA 1L4ZB 1XXGA 3NZSA 2SEBD 2MP2B 2KJHB 3TSSA 1FNUA 1SGHA 1DGJA 3UF8A 2CHXA 4NJCA 4J6IA 2J7QB 1J8CA 1WGDA 3IBEA 5EE1A 3M62B 2N9EB 1H8CA 2FE8A 1TT5B 4HVBA 3GZNB 4HCPB 3RNCC 2JYEA 3KYCD 2K6DB 3R2IA 2IO2B 2KNBA 2FAZA 4PYZA 2ZPNA 3ZDMC 2KC1A 1OTRB 2NVUI 2Y5BB 2D3CA 4YTMB 1HQRD 3AE5B 1WMHB 3AXCA 5IOIA 2AQ2B 1WFYA 3TCAA 4ITKA 2OJRA 2Z0EB 4HJGE 4KGRA 2PPHA 4EZLA 3OJ4B 5FKAC 1WX9A 2LRWA 2M17A 1JMLA 5I4DA 2FUG1 1GOZA 2VH2A 3H6NA 1XEEA 3UIOB 1V81A 1SE2A 1F77A 1D6EC 3NZ3A 1E7UA 1LFDA 3AH7A 3ZKJC 4I6LB 2FIDA 3LJ3A 1J0GA 2REXA 2MCNB 1LM8B 1K52A 3LB8C 3FAHA 3B9JA 1ZPSA 1WXQA 4XC2A 1LQBA 2V3NA 3KUCB 3PZDA 1WX7A 5BYSA 1VCBA 2L0TA 2WXPA 4WJQA 3P4QB 4WAFA 4B95A 3A1QB 5LLIA 1UWMA 3VTUA 3TMPB 1QLBB 1JALA 4W9IA 4RF0A 2KX3A 4GIVA 2K1FA 4K7UA 4N58A 2JZZA 1ZXIA 5AZGA 4O1NA 2B3AA 2WDTB 4FHKA 1YD8U 1IPGA 3AE1B 3MJWA 2MSED 5EE9A 3IT6B 4MT5A 1MVKA 3IG3A 1TS4A 2J52A 3BVZA 3DVGY 4BKTA 4GDKB 2HD5B 1V8CA 3CWIA 2O2VB 2KD0A 3IFWB 3LXFA 2G4DB 3DHIC 1P3QU 2KTRA 4DXFA 5JHBA 3TEWA 3NVZA 2PLPA 1T0QC 2RDBC 3QC8B 3H8HA 4RMAA 2NBVB 1DOXA 4TQ0A 5HI1A 4AJYB 4DK5A 1N5XA 1QF6A 1L2NA 3EHVA 3V62A 2WXRA 4EOYA 1E90A 3WIMA 2M0XA 2MH7A 1Q0WB 3N32A 3BVGA 2IGGA 4BZAA 3AE4B 1YOVB 3QWZB 3DBLI 2JWZA 4NJ6A 4L1BA 5BMHA 1XO3A 2D3BA 1QT9A 2ZNVC 2CKHB 3MC8A 2D11A 4YT0B 2KYWA 5G55A 1KLVA 3RYTA 4EEWA 1ET9A 2N7EA 2QC8A 3VR9B 1X1MA 1V80A 4WH4A 2WXKA 3T9LA 3MC0B 4YWGG 4C80A 3KWVA 3HHMA 1HEZE 4G3XB 2KHWB 2BYVE 4YSXB 3N30A 4KZCA 2IPKD 1EU4A 4M02A 3DWMA 2QHOA 2WDQB 4LJPB 2L05A 1C77A 1YQBA 3GB1A 4BKSD 3VHTC 4DDGD 3I57A 1E7VA 1ZOYB 3B0AA 4HCNB 1TIFA 5E6PA 3ZXVA 2QIEB 4FJYA 3I5JC 2M8SA 4ANWA 3DBSA 1C3TA 4W9KA 3GOEA 1WF9A 2MLBA 3H1UA 1PGAA 2KWUB 3IVFA 2G9HD 3MFGA 2K39A 3ZUNA 1E0ZA 1PGXA 3KW5B 4URKA 4EZKA 2K8CA 2DZKA 1FFUA 2W55A 5IKCM 2ZEQA 2V9HA 2XNAC 1NDDA 4ANUA 1V9JA 1FXIA 3FC4A 4OZCA 2GOWA 1IBXA 4FA6A 4M00A 2RDGA 4MDKE 2EELA 5LXIB 1C78A 5FR3A 5D2MB 2LVPA 1MFWA 1MI0A 3FILA 2LUMA 3L0WB 3LDZE 2C7MB 4LCDE 3GZNI 3D32A 3NHEB 2WXQA 5LNK1 5H92C 4A9AA 4MGZE 3HM6X 4M01A 1E8ZA 2LZ6A 3GP7A 2VH1A 4B9KA 1UGJA 3JSVB 3DBHB 4GDKA 1RLFA 3WAMA 1FXTB 1E8YA 2JX5A 3WCQA 5JH5C 3DHGC 1TZOA 1K53A 1KTKA 3NZUA 2O6VB 3AU4A 1ZE3D 3SD5A 5DCNA 1QILA 2KVZA 3KVFB 1D4BA 4FJVB 1STEA 1WXMA 4NQKE 3ZJTA 1A70A 3RNAC 4IOIE 3CIRB 2XK5B 1WIAA 3OAWA 2CJOA 2L76A 1BUIC 2OJWA 4F8CB 1JCKB 2DLBA 2WS3B 2YEPF 2BYTA 3RPFC 2BWES 1WR1A 1ISNA 2YVCA 2NS5A 3V61A 5CHFA 3VAWA 2OOBB 1N62A 3VH3B 2KVRA 1RFKA 2ZJDA 2IY1B 4HXDA 4KX6B 2M56B 4C4VB 3ZRCA 2JSVX 3EFUA 2C7NB 5IN7A 1KH0A 4EUTA 1IGDA 3QJZA 4ZRIA 2C9WB 2MBBB 1Z5SB 4FN2A 3KYDD 4LNIA 4NNJB 4DHJB 1ZDVA 3E56A 5IA7A 5CHVC 3RNEC 2WDRB 4NY0A 4Q2JA 3AEDB 2ZPYA 3RNFC 2HJ8A 3ABVB 1WJNA 2M0AA 4KKJA 3NUHB 2PVGC 4S0RA 3VDZA 2JF5A 3O65B 5C1ZA 2FCQA 3PGEA 3OJ3A 3QK0A 3W2DA 2BKFA 2G45B 5EE3A 2KFKA 3A9KA 1RYJA 1UGMA 1WE7A 4HPLB 1SEBD 3VUXA 3ZVVA 1QOAA 4WIPA 4JWUC 3DBLB 5DPWA 3AV8A 1CZPA 2WWZA 4LLGM 3DVGX 1SBBB 3AE9B 2LASA 3B08A 5D6JB 1SE3A 4G11A 4RGMA 1VR9A 2N0SB 2AX5A 3FKYA 3KWLA 1JWUD 1TTNA 2O6VD 2IO0B 1UWXA 4GGQA 4FADA 1F1HA 2CHZA 3Q3JA 1GC7A 4DHZB 2WXNA 1JROA 2NBUA 4NQLB 4HK2A 4XWTA 1WGHA 4K7SA 1GB1A 1FD6A 2MW5A 4JE3B 2Z59B 4IC7B 2JU6X 1F2RI 1WJ4A 1FCCC 2WDVB 3TBLD 2NPTA 4XWWA 4KKIA 2JQRB 1D5MC 4JWSC 3BINA 3PRMB 4AOFA 3H7PA 4EFOA 2J0MA 3ZGZA 2UYZB 3P4PB 1EF5A 2L1AA 1BXTA 2ZVOA 4BKGA 2YLMA 2JUOA 2Y5PA 3VTVA 1F2RC 1VZ7A 3KH0A 5EDSA 1ZXHA 3APCA 3BWUD 1TZ1A 3HUIA 2GBNA 3P4RB 4DHJD 4DXAB 1ROEA 1TJEA 1LO5D 2LHDA 4C56C 1V1PB 4HRSA 5JZEB 2W3RA 4GDLB 4FXCA 1WGKA 2J53A 4N6EB 2FBWB 4E71A 4HDOA 3BVMA 5E6OA 1WGRA 4LK0M 1QOBA 3AM9A 3A4SC 4DQOC 3KUZA 2ACZB 2KDMA 5KHOA 2Y5CA 2Z0DB 1FRRA 3CSTA 1B9RA 3W9CB 4BOZB 2H88B 2CHWA 2JZ3B 1R7SA 1KOTA 4HPMB 2DYMA 4ZHOA 3EC8A 4HKZE 3AE7B 4K3CA 5G5GA 1Q5WB 3AEBB 1LGRA 5J17A 2FIFA 2WYQA 3Q3NC 1XLQA 1ACCA 4P7IA 1CK1A 5TR5A 2GBJA 1L7YA 3DBHI 3W1SC 1JRPA 2IYDB 4P1CC 1OQQA 1FPYA 3DVNU 1EU3A 2MBHA 1WGYA 3ETRA 4XZ4A 2CJNA 1QOFA 4HPPA 3AEGB 2SAKA 1RM6C 4M0WB 3TL5A 2KAJA 2PW9A 2K8HA 1YJ1A 2MWSB 3APDA 4ZRQA 1FNWA 2QCZA 2AEHA 2R61A 4WWOA 1OEYJ 3L54A 4W9GA 4OVZA 1KLGD 1UZXB 3Q8EA 5C2TB 5AUIA 3W5UB 2G3QB 4M8MA 2ASQA 1GB4A 2K22A 3JVZX 2LMCA 4N59A 4PS3A 1FXAA 3UI3A 1JWMD 2KANA 2ZVNA 2V0GA 3IAS1 4ZYNA 5GXGB 3DBRB 4A3OA 4NPNA 1QOGA 4OW0A 4HDQA 4LDTB 1XCQL 4US8A 3ML8A 3PLUA 2L3ZA 1PUTA 1V97A 3ZJUA 2WXJA 1UUPA 1WRIA 2K5PA 4RM8A 1S3SG 3W5VB 3A33B 4QAYA 1C9FA 1N60A 1I35A 1FNVA 3ZW3A 1AW7A 3Q8BA 4MSMB 4BFRA 2BYEA 1FO4A 3E9SA 1YJIA 4KSLC 2AQ3B 1JQ4A 1N61A 3GE8C 2LGYA 3RD2A 4WJPA 3VXWA 2KN4A 2WXMA 1UBIA 2BS2B 2V4IB 4WWNA 2M19A 1MPEA 1SIJA
chains in the Genus database with same CATH topology
4USAA 2E6XA 1KRHA 4C7ZA 2IGDA 3DWGC 3U52E 1PDXA 1ESFA 4GDKB 1V1OA 2L83A 3BK2A 3P4SB 2L32A 1TKYA 2K9XA 1MI0A 5D7GA 4DXGA 3FILA 1SSNA 2LUMA 2IGHA 1YNTE 2B76B 2WLBA 4GLSC 3P63A 2CU3A 4XDDA 2MEKA 1N5WA 4H2AA 2INPE 3T3NA 1MHHE 1JWSD 4TMAB 2WXQA 3NVVA 5LNK1 4B0MA 5H92C 1HZ5A 4A9AA 4ZHPA 1VZ8A 1YN4A 1I7HA 2VZKD 4JX1C 5AUKA 1J7CA 2H89B 3GP7A 2BT6A 1UGJA 3TEXA 1KFYB 2V3PA 1K50A 2PIAA 1XLPA 4AQ7A 4MACA 2JX5A 5H8YE 1SE4A 3N9YC 3SEBA 4RGOS 1L4DB 3WCQA 2MJ3A 2KMMA 1FM0D 4YXDB 4A55A 1TZOA 4UDUC 1K53A 1KTKA 2LEKA 1B1ZA 2QILA 2I38A 1ZE3D 1NVID 3VR8B 4ZRPA 1E9MA 4NZLB 1QILA 1T3QA 2I2YA 1D4BA 4P16A 4ARIA 1STEA 3RFZB 1I4XA 1A70A 3OWEB 3ZJTA 5BMIA 4IOIE 2J4XA 1FFVA 3CIRB 4XE0A 2BW2A 2WQYB 5D3DA 4A8XC 1TY2A 3C8YA 1F0ZA 2CJOA 3GS2A 4OZBA 1BUIC 1L0XB 2PMVA 2RDHA 1JCKB 2DLBA 2WS3B 2LHEA 2IJ0A 1WYGA 3T3OA 5E6JA 2YEPF 4NAWB 1RWSA 2JWUA 2BYTA 3RPFC 1YQ3B 1AN8A 1K51A 1XLOA 2N7JA 1SB3C 1NYRA 1PGBA 1TYGB 1C4AA 1E7PB 3AECB 3BK1A 1HZ6A 4A90A 1C4CA 1N62A 3URYA 5HFYA 2J42A 2ZW0A 1IBXB 1RFKA 1XLNA 2DBYA 2K0PA 2NMQA 1P7FA 4R3DA 4KX6B 3P1MA 2M56B 3AE6B 3EA6A 1QKZA 4HKQA 3V3XA 2MJEA 1EWYC 2JSVX 1I4RA 3VRAB 1NYQA 2N9KA 3BIID 1SJHD 4EE2A 2D5GA 5T8IA 3PO0A 2ONQA 1KH0A 4RFBA 1YJJA 1ENFA 3FILB 3BYTB 5HG2A 2WXGA 1IGDA 2L52A 1VRAB 1AYFA 4MM3B 3AB5A 1L5PA 4RNAA 4XDCA 3V05A 2WU5B 3L4PA 3VRBB 1ZDVA 2Z8LA 4YTNB 3E56A 3I9V1 1KLUD 2BB6A 3KLSX 1Q10A 2YEPB 2ICIA 1L4ZB 1XXGA 2WDRB 4Q2JA 3AEDB 2SEBD 3Q8FA 1ET6A 1TKGA 3TSSA 1FNUA 3ABVB 4KKJA 2M0AA 3NUHB 2PVGC 1DGJA 4WURA 2GRIA 4WWMA 4NJCA 3W2DA 5EE3A 4KGSA 4IDIA 1RYJA 1HXYD 5EE1A 1M4VA 4ARCA 1SEBD 2FE8A 3NVWA 3SFEB 1QOAA 2KWDA 1NENB 4WIPA 4JWUC 2OEDA 3AV8A 2JYEA 2K3UA 3R2IA 2QMTA 5HHDG 1YN5A 1CZPA 1V1PA 4LLGM 3IT4B 3AE3B 1SBBB 3AE9B 2W82A 5TSSA 4YTMB 1HQRD 1N63A 1SE3A 3AE5B 3P42A 1I4GA 4RGMA 2AQ2B 1VR9A 5D3IB 2IDYA 4ITKA 2N0SB 2AX5A 4KGRA 1IGCA 4HJGE 4YSZB 5C3JB 3KWLA 5FKAC 4US9A 1JWUD 1EM7A 1JMLA 5I4DA 2GB1A 2FUG1 1EWCA 1GOZA 1UWXA 4B0EA 1JW9D 1NEKB 2BTEA 3HVZA 1XEEA 2BBCA 1SE2A 1F77A 1D6EC 2WXNA 1JROA 3NZ3A 1HA5A 3Q69A 1D5ZC 3AH7A 3PZ8A 4XWTA 1ZUD2 3MP9A 1GB1A 1FD6A 4JE3B 2PTLA 2JU6X 2Q5WD 1F2RI 1K52A 3LB8C 2JYTA 5FK9C 1SJED 3ZYYX 3FAHA 1FCCC 2WDVB 3HVDA 1MPEA 1YMHE 3B9JA 1ZPSA 4XWWA 1WXQA 3IXSA 4KKIA 2JQRB 2V3NA 2WXHA 1D5MC 4JWSC 1VDVA 5BYSA 4ZOHC 2JZPA 1NI3A 2WXPA 3R2TA 4CQNA 3P4QB 4WAFA 2W3SA 3SFDB 3ZGZA 1FCLA 4L23A 3MHZA 5BYRA 4YTPB 1UWMA 2KACA 3P4PB 1DYQA 1BMLC 1QLBB 1JALA 2NTTA 2L1AA 1OQRA 2WNMA 4RF0A 1BXTA 2ON8A 1SXTA 4M0WA 1L6UA 2Y5PA 4N58A 4ZYSA 1ZXIA 4RCOA 1L6VA 1QQRA 4O1NA 1FRDA 1C79A 1F2RC 1VZ7A 4C7YA 1ZXHA 3BWUD 3AE1B 3HUIA 4JPSA 5EE9A 3IT6B 3P4RB 4MT5A 2X38A 1ROEA 1TJEA 1MVKA 2EKIA 1LO5D 2LHDA 2NTSA 1TS4A 2J52A 4C56C 1V1PB 3BVZA 4HRSA 1T6BX 5G5HA 1KF6B 3BZDB 3SR6A 1T5XD 2N9LA 1SF0A 1V8CA 2W3RA 2W54A 3CWIA 1OFFA 1WGKA 2J53A 4FXCA 4N6EB 2FBWB 1FEHA 4HROA 3LXFA 3BVMA 4AS1A 4HEA1 4TQ1A 2XN9C 4REZA 4LK0M 1QOBA 3KQ4A 2DYOA 3AM9A 1CJEA 3EGRA 2KQ4X 3J9CA 1WSPA 3AEEB 5BMGA 4DXFA 3ZQ4A 4DQOC 2ACZB 5MPOA 1L0VB 2BB5A 2KDMA 2E3TA 2Y5CA 4WQMA 3TEWA 1FRRA 5BYQA 3NVZA 1B9RA 2PLPA 4OHJA 3W9CB 2BS4B 1TS5A 2H88B 3H8HA 4GDLB 4IKGA 1R7SA 1DOXA 4TQ0A 3AE8B 2WU2B 1MHXA 3MJ5A 5HI1A 2DYMA 3BYYB 4ZHOA 1N5XA 1QF6A 2QJLA 2WXRA 1I4QA 4HKZE 2LFIA 1JWBD 3AE7B 1PFDA 2MH7A 5G5GA 3U2SC 3TEZA 3AEBB 3BVGA 2HDEA 2IGGA 2G1EA 4RF1A 3AE4B 3U7ZA 1XLQA 1ACCA 3NRZA 4L1BA 1CK1A 5BMHA 3ZJVA 4YSYB 1IUEA 1XO3A 3B2FA 1PYWD 1GPXA 3NVYA 3NS1A 1J7BA 1QT9A 2ZW1A 3W1SA 2VZKB 4OZAA 1JRPA 2LGIA 4YT0B 1GAQB 4PT5A 1OQQA 1XF5L 4RGTA 3O13A 1EU3A 3ETRA 1P7EA 2CJNA 1QOFA 3AEAB 3AEGB 2SAKA 1RM6C 1ET9A 3VR9B 1C4PA 2KAJA 2PW9A 4WH4A 2WXKA 3MC0B 3AN1A 4KGTA 1E10A 1TKEA 3AE2B 4YWGG 2AQ1B 4TSSA 4ZRQA 1FNWA 4C80A 3HRDD 4RH6A 3KWVA 1L0YB 3Q8CA 2R61A 1HEZE 2BS3B 2OHFA 2Y3AA 1CQVA 4YSXB 4A6QA 1Y56A 2IPKD 3B2GA 4OVZA 1EU4A 1KLGD 3Q8EA 2HTME 5C2TB 5AUIA 3W5UB 3DWMA 2QSDA 2WDQB 3IAM1 1GB4A 5JXVA 2K22A 4N59A 2LMCA 1C77A 1FXAA 3UI3A 1DOIA 1I4PA 2M19A 3AEFB 1AWDA 3GB1A 1JWMD 3I57A 1ZOYB 4NAMA 2TSSA 2V0GA 3IAS1 2MJDA 5GXGB 4L2YA 4LTUA 1ZP0B 1J7AA 1UNSA 2LJIA 3LYYA 3U4EG 2QIEB 5EE0A 1JWAD 1QOGA 4OW0A 1VJKA 1E6EB 1TS3A 1XCQL 2RPVA 2QEJC 3R8BA 4US8A 1PGAA 1WWTA 3AMZA 2G9HD 4P6VF 3VQIA 1PUTA 1V97A 2JXTA 1TY0A 3ZJUA 2WP9B 3MFGA 1I4HA 2WXJA 2RMMA 1UUPA 1WRIA 1YN3A 2K5PA 1E0ZA 1PGXA 3W5VB 2PKOA 3PZ7A 1VZ6A 3TEYA 1FMAD 1C76A 1C9FA 1FFUA 2WXLA 1N60A 2PVOD 3EUB2 2W55A 1VLBA 1FNVA 2INNE 1AW7A 3Q8BA 3Q8AA 1FO4A 3E9SA 2WXOA 1YJIA 2XNAC 1FIQA 1ZDXA 2AQ3B 1JQ4A 1N61A 2WXIA 1FXIA 3FC4A 4OZCA 4D2KA 1IBXA 1DOYA 3TUOA 1XCTL 2RDGA 2KN4A 2WXMA 1YQ4B 2GI9A 2BS2B 4MH8A 2V4IB 4J3OD 2EELA 2WXFA 4RGNA 1D5XC 1C78A 2DWQA 5FR3A 1SIJA 1TS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLB A; 
#chains in the Genus database with same CATH topology
 3ZNZ B;  1PDX A;  1ESF A;  3K9O B;  2J0J A;  4MJS B;  4DXG A;  1SSN A;  1P1A A;  4X57 B;  2D10 A;  1WZ3 A;  2IGH A;  3SHQ A;  2WLB A;  2CU3 A;  4GSW A;  5AEK B;  4II3 B;  4TMA B;  4JLC A;  2EMT A;  4B0M A;  2QDF A;  1I7H A;  4JX1 C;  4MSQ B;  3ECI A;  3RMK C;  2H89 B;  3Q6B A;  3TEX A;  2LGX A;  2DAF A;  1WZ0 A;  1K50 A;  3M95 A;  2MP2 A;  3B1L X;  2BGF A;  1XLP A;  5H8Y E;  2D2Q A;  1EO6 A;  3DPD A;  3V6C B;  2JRH A;  4I6P A;  3ZO5 B;  1XQQ A;  1D3Z A;  2LEK A;  2M1M A;  2LVQ A;  5C23 A;  2I38 A;  3VR8 B;  1NVI D;  1E9M A;  3X0W A;  2I2Y A;  5IP4 D;  4ARI A;  4A3P A;  1A5R A;  1I4X A;  3OWE B;  4FHJ A;  5BMI A;  4XE0 A;  2BW2 A;  2WQY B;  5BO4 B;  2R2Q A;  1F0Z A;  1T0R C;  5G2N A;  4CHK A;  1WMH A;  2KZR A;  3T3O A;  3I3T B;  4HWI B;  4NAW B;  4IWP A;  1GC6 A;  3A9J B;  3S2A A;  2C60 A;  4BAX A;  1AN8 A;  1K51 A;  2N7J A;  3N1Z C;  1PGB A;  1TYG B;  2A4Z A;  2DYB A;  1E7P B;  3AEC B;  3BK1 A;  4A90 A;  4K7W A;  2ZW0 A;  2L0F A;  2K0P A;  2NMQ A;  4LNO A;  2R2O A;  3P1M A;  4LDT D;  3AE6 B;  4HKQ A;  1QKZ A;  2MJE A;  1EWY C;  1I4R A;  1UEL A;  2D5G A;  2N9X A;  4ICV A;  1YJJ A;  2JRI B;  2DZJ A;  2VRR B;  3WAL A;  4MM3 B;  2JT4 B;  3L4P A;  3TIX A;  3P2B A;  3QA8 A;  1P9D U;  5JHA A;  4K3B A;  3A1Q A;  2LVO A;  3Q8F A;  3JW0 X;  1U4A A;  4WUR A;  4BKS A;  4WWM A;  3RZW C;  4KGS A;  4IDI A;  4MH0 E;  4AP4 C;  2LGD A;  1HXY D;  2BYF A;  4ARC A;  3UQA A;  3ZNG C;  3QIJ A;  3NVW A;  3SFE B;  3RN9 C;  3EEC A;  2K3U A;  3VUY A;  3ZNH B;  4KIK B;  5HHD G;  1YN5 A;  5CX3 A;  2W82 A;  1GG3 A;  1N63 A;  2O2V A;  3AUL A;  3N20 C;  3P42 A;  3K9P B;  1T0S C;  1V86 A;  3UGB B;  5J2R A;  1IGC A;  5C3J B;  4WAA A;  4DWF A;  4US9 A;  4ANV A;  3N1X C;  2LXA A;  3R3M A;  3CMM B;  1EWC A;  5KHQ A;  1JW9 D;  2FUH B;  3HVZ A;  2BBC A;  2DZI A;  2EKE C;  4IM0 A;  1HA5 A;  2C7H A;  3Q69 A;  1D5Z C;  2W9N A;  1ZUD 2;  3MP9 A;  2DNF A;  3L13 A;  2FNJ B;  5FK9 C;  2JYT A;  2KDF B;  1SJE D;  3ZYY X;  3ZTC A;  4WJN A;  4DBG A;  3DOW A;  3JYU A;  3HVD A;  3ZLZ A;  4LJO B;  1YMH E;  3ALB A;  2JY6 A;  3IXS A;  1CMX B;  4WJO A;  3C0R B;  2JZP A;  2WX0 A;  4CQN A;  2W3S A;  2L00 B;  3SFD B;  2KOX A;  4YTP B;  1R4M I;  4W9F A;  2KAC A;  4WQO B;  3MTN B;  1BML C;  2NTT A;  3Q3M C;  1WXS A;  2ON8 A;  1SXT A;  4F1S A;  3Q3O C;  4GB9 A;  2K6Q A;  3DBR I;  5CTR C;  3M3J A;  1FRD A;  1K8R B;  1C79 A;  4TUU A;  3ZTD A;  2KWC A;  4F7Z A;  4HLE A;  4CYE A;  2JPH A;  4JL9 A;  1T6B X;  1KF6 B;  2KK8 A;  2HTH A;  3SR6 A;  1T5X D;  3DDC B;  1OFF A;  1HTO A;  2I1K A;  4AS1 A;  4HEA 1;  1JRU A;  2KDB A;  1OEY A;  4GXB A;  3KQ4 A;  2DYO A;  4BBN C;  1CJE A;  2KQ4 X;  1WSP A;  2BF8 B;  4KDI C;  2MA9 B;  3X23 A;  2DZM A;  4WQM A;  2GBR A;  1F52 A;  5BYQ A;  4OHJ A;  4G0N B;  2BS4 B;  2RGF A;  3BY4 B;  4IKG A;  3EFC A;  4RM9 A;  1WM2 A;  3AE8 B;  3BYY B;  2WX1 A;  3NS8 A;  1I4Q A;  2LFI A;  3WA0 A;  3U2S C;  1WY8 A;  3M63 B;  4YL8 A;  2HDE A;  2PJH A;  1RRB A;  1PQS A;  2MBE A;  3V6E B;  2A5U A;  2BPS A;  3NRZ A;  4JGH B;  2AL3 A;  4YSY B;  1IUE A;  1GPX A;  3NVY A;  3NS1 A;  1WRD B;  1J7B A;  3U30 A;  3W1S A;  2VZK B;  2LGI A;  4PT5 A;  1F9J A;  4B6W A;  4RGT A;  3ZRF A;  3WAN A;  1NI2 A;  3R66 C;  4KVG B;  3NY5 A;  1YIW A;  2MRP A;  1C4P A;  4K81 A;  1R4N I;  2LJ5 A;  4OVU A;  3AN1 A;  3RCZ A;  1TKE A;  2AQ1 B;  2CU1 A;  4TSS A;  3HRD D;  1L0Y B;  3VFK A;  3PRE A;  2BS3 B;  2OHF A;  4IM2 A;  2N9P C;  2Y3A A;  3Q14 C;  4IW0 A;  4A6Q A;  1Y56 A;  4I6N B;  3B2G A;  5J18 A;  3JSV A;  4K1R B;  2QSD A;  3APF A;  3IAM 1;  3ZDT A;  1WXA A;  2DHZ A;  2LD9 A;  1I4P A;  2BWF A;  2WHI A;  1NBF C;  1UH6 A;  2TSS A;  2MJD A;  2KX0 A;  5E6N A;  2O6V A;  4LTU A;  1J7A A;  1UNS A;  2LJI A;  2M4N A;  3LYY A;  4ACF A;  3AU5 A;  1P98 A;  5DPT A;  1WJ6 A;  2D3A A;  1E6E B;  2RPV A;  3R8B A;  2NR2 A;  2XK5 A;  1WWT A;  3AMZ A;  4P6V F;  3VQI A;  4IUM B;  1TY0 A;  2WP9 B;  1I4H A;  1OQY A;  2RMM A;  1YN3 A;  4DHZ E;  1RAX A;  2PKO A;  3PZ7 A;  1GJZ A;  1C76 A;  1HE8 A;  2WXL A;  2PVO D;  3EUB 2;  3L08 A;  2KJR A;  4ASW C;  1VLB A;  2V4L A;  3CSF A;  3Q8A A;  5FR6 A;  2HJ1 A;  3UIP B;  4D2K A;  2J0K A;  2LWP A;  1DOY A;  3A4R A;  3RUI B;  3CF6 E;  3TUO A;  3U8Z A;  2GI9 A;  4C4V A;  3C19 A;  2IZV B;  4J3O D;  1D5X C;  4USA A;  2E6X A;  1KRH A;  4MGK E;  2IO1 B;  2K8B A;  1V1O A;  2L83 A;  3BK2 A;  1TKY A;  2K9X A;  1QZE A;  1YNT E;  1GUA B;  5AZH A;  3P63 A;  2LGS A;  3QCA A;  4XDD A;  1N5W A;  4H2A A;  2INP E;  2KMC A;  3T3N A;  1JWS D;  1HZ5 A;  2PE9 A;  3HM3 A;  2VZK D;  3SDL C;  2BT6 A;  1KFY B;  2V3P A;  2PIA A;  1WE6 A;  4XX5 A;  2GLS A;  3SEB A;  1SE4 A;  3N9Y C;  3L17 A;  3VVW B;  1FM0 D;  5DPR A;  3PTF C;  4A55 A;  1TBE A;  3IHP C;  4KDL B;  2QIL A;  3Q2A C;  4ZRP A;  1V5O A;  1T3Q A;  2X8X X;  3RFZ B;  2KJ6 A;  2J4X A;  5CHW A;  4MEM A;  5D3D A;  4A8X C;  3C8Y A;  1MJD A;  4OZB A;  4BVU C;  3ML9 A;  1L0X B;  2PMV A;  3RZF A;  2RDH A;  2IJ0 A;  3Q3F A;  1ZKH A;  2DEN B;  4C00 A;  1R4M B;  3RNG C;  1V5T A;  5L95 C;  2I1J A;  1YQ3 B;  4JIO U;  3QAR A;  1C4A A;  1HZ6 A;  1C4C A;  3URY A;  4FLH A;  1IBX B;  1XLN A;  2DBY A;  1P7F A;  4R3D A;  2GMI C;  1E8W A;  2FCM A;  3VRA B;  1NYQ A;  2N9K A;  2GBK A;  1SJH D;  5T8I A;  1AAR A;  2ONQ A;  4S17 A;  4RFB A;  1ENF A;  4P1B C;  3FIL B;  3BYT B;  5HG2 A;  3PPA A;  5IO9 A;  2KKC A;  2JXX A;  3TJP A;  1VRA B;  2D07 B;  1AYF A;  4MGY E;  2N7D A;  3PSE B;  1L5P A;  4RNA A;  3V05 A;  2WU5 B;  3VRB B;  2Z8L A;  2INC C;  4YTN B;  3I9V 1;  4WWP A;  1Q10 A;  2YEP B;  1WX8 A;  1ET6 A;  4AUQ C;  1TKG A;  4BOS C;  2GRI A;  4GMV A;  1EF1 A;  1YX6 B;  4PK1 A;  4DDI D;  1KM7 A;  1M4V A;  2CR5 A;  4IM3 A;  1P0R A;  1WYW B;  2KWD A;  1NEN B;  1IP9 A;  2OED A;  3PLV A;  4M8N A;  2QMT A;  1V1P A;  3RNB C;  3IT4 B;  2IO3 B;  2BKR B;  1WXV A;  3AE3 B;  1V49 A;  2LUE A;  2L7R A;  5TSS A;  4GDL A;  1I4G A;  2BQQ A;  5D3I B;  2IDY A;  4NJ7 A;  4YSZ B;  4KV2 A;  4GU2 A;  2AL6 A;  1GNU A;  1EM7 A;  2GB1 A;  4B0E A;  2L8J A;  1NEK B;  2BTE A;  1N6Z A;  2KT7 A;  2KLG A;  1R4N B;  2KDI A;  5IAA C;  1SIF A;  4ZRJ A;  2ZZP B;  3PZ8 A;  3NJT A;  2N4F A;  4PS7 A;  2NCN A;  1Q1O A;  2PTL A;  4E3C A;  3RT3 B;  2Q5W D;  4G50 A;  1T0Y A;  2DAJ A;  2G4S A;  4IWQ A;  2WXH A;  4MEL A;  1VDV A;  4ZOH C;  1NI3 A;  3R2T A;  5DPS A;  3QAQ A;  1WGG A;  1FCL A;  4FJZ A;  3PV1 A;  4L23 A;  3MHZ A;  4AWJ A;  5BYR A;  3DHH C;  1DYQ A;  1UD7 A;  1OQR A;  2WNM A;  4XYC A;  3DQV A;  4M0W A;  1Y8R C;  1L6U A;  3ENE A;  4ZYS A;  2KFK B;  2UWQ A;  3A9K B;  1L6V A;  4RCO A;  1QQR A;  3PRZ A;  4C7Y A;  2EMS A;  3ZIM A;  4JPS A;  3RI7 C;  3DCG A;  4LNF A;  2C5L C;  2X38 A;  2EKI A;  4ICU A;  2LI5 A;  2KXJ A;  2RSU A;  1EUV B;  2NTS A;  3OLM D;  4JQW C;  2IND C;  5G5H A;  3VTW A;  3BZD B;  3L10 B;  2N9L A;  1SF0 A;  2MBO A;  2W54 A;  3AI5 A;  4W9E A;  3HIZ A;  1FEH A;  4HRO A;  2D3G A;  2KMA A;  4TQ1 A;  1I42 A;  2XN9 C;  4REZ A;  2KN5 A;  1BT0 A;  3SU8 X;  3EGR A;  1WR6 E;  3J9C A;  4KSK C;  3AEE B;  5BMG A;  3ZQ4 A;  3VUW A;  2KTF A;  5MPO A;  4IWO A;  1L0V B;  2BB5 A;  4EKU A;  2E3T A;  1XD3 B;  2KFJ A;  1ZGU B;  2V3S A;  2FCN A;  1TS5 A;  2RPQ A;  4ZDV A;  2WU2 B;  1MHX A;  3MJ5 A;  3T8M A;  2RR9 A;  2QJL A;  4II2 B;  2MX2 A;  1JWB D;  3PRP B;  1PFD A;  3TEZ A;  2FCS A;  2G1E A;  3QQ8 B;  1LXD A;  4RF1 A;  2NPT B;  3NG0 A;  3U7Z A;  3ZJV A;  2MHJ A;  3H7P B;  4AJW A;  3B2F A;  1PYW D;  3QX1 A;  2N1V A;  2ZW1 A;  4BBN F;  1C1Y B;  3PVL A;  4OZA A;  3RUL A;  4TV3 A;  2KLC A;  3W1Y A;  1GAQ B;  5LXH A;  3U7D A;  1XF5 L;  3R7Q A;  3O13 A;  1P7E A;  5GMV A;  3AEA B;  4XGA B;  2V1Y A;  1WH3 A;  3NOB A;  4MJS A;  2KO3 A;  4KGT A;  1E10 A;  3AE2 B;  3UQB A;  4RH6 A;  3Q8C A;  4LNK A;  1CQV A;  2ZCB A;  2JVC A;  3PS6 A;  2BVC A;  2WGS A;  2XBB C;  2HTM E;  1VD2 A;  1IYF A;  4GN1 A;  5JXV A;  1DOI A;  3AEF B;  1AWD A;  1YX5 B;  4NAM A;  3I63 C;  3PHX B;  4L2Y A;  1ZP0 B;  2KQS A;  3GE3 C;  3U4E G;  1XT9 B;  5EE0 A;  1JWA D;  1MG4 A;  1VJK A;  1ZW7 A;  4N9F 4;  1WI0 A;  1TS3 A;  2QEJ C;  3R7R A;  1M94 A;  2KQ7 A;  4TKN A;  1TGZ B;  2JXT A;  1RFA A;  4CO7 A;  4OVV A;  1VZ6 A;  3TEY A;  1FMA D;  4NAW A;  3A9J A;  2INN E;  4HJK A;  1E8X A;  2N1W A;  2WXO A;  2AYO B;  1FIQ A;  1UF0 A;  1OGW A;  1ZDX A;  4GOC A;  3ZNI D;  2ZNV B;  2WXI A;  2HE7 A;  2KC2 A;  4MGI E;  3H9D A;  1XCT L;  3ZXR A;  4E74 A;  1YQ4 B;  3MC9 A;  1HTQ A;  4MH8 A;  4RGN A;  2WXF A;  3PHW B;  2DWQ A;  3N1Y C;  1TS2 A;  4C7Z A;  2IGD A;  3DWG C;  3U52 E;  4W9H A;  3P4S B;  2L32 A;  4W9D A;  2PE6 B;  1MG8 A;  4KZ0 A;  5D7G A;  4A20 A;  4FBJ B;  4LNN A;  2B76 B;  4GLS C;  2MEK A;  2MQJ A;  4MM3 A;  1MHH E;  5L83 A;  3UIN B;  1J19 A;  3NVV A;  1Z2M A;  4ZHP A;  1VZ8 A;  5D94 A;  1YN4 A;  2IY0 B;  1G6J A;  5AUK A;  2K25 A;  1J7C A;  1KJT A;  4ANX A;  3KUD B;  3ONS A;  4IG7 B;  4AQ7 A;  4MAC A;  2CS4 A;  4RGO S;  1L4D B;  2MBQ A;  2MJ3 A;  2KMM A;  4YXD B;  4UDU C;  2UU7 A;  1B1Z A;  4W9C A;  3N3K B;  2ZCC A;  4NZL B;  4W9J A;  3WAO A;  4P16 A;  2RD0 A;  5AZF A;  1H4R A;  1V6E A;  1FFV A;  3V60 A;  1TY2 A;  2LRU A;  4KIK A;  3L16 A;  3GS2 A;  2LHE A;  4PYU A;  1WYG A;  2XEW A;  5E6J A;  3MHS D;  1V2Y A;  1RWS A;  2JWU A;  3PT2 B;  2DX5 B;  2GBM A;  3OG5 A;  3VH4 B;  1E5W A;  1S1Q B;  2KTR B;  4W9L A;  2PEA A;  1XLO A;  1SB3 C;  1NYR A;  1WJU A;  3HK0 A;  1UBQ A;  2KWV B;  4ZRK A;  3WAP A;  3DVN V;  5HFY A;  2J42 A;  1WM3 A;  4PS8 A;  3QHT A;  3EA6 A;  3V3X A;  2KDE B;  3BII D;  3H7S A;  4EE2 A;  3PO0 A;  2LXC A;  2IBI B;  2WXG A;  4FUL A;  2NBW B;  2L52 A;  1SE9 A;  2AWT A;  3AB5 A;  4XDC A;  5HKH A;  1KLU D;  2BB6 A;  3KLS X;  4EZJ A;  2ICI A;  1L4Z B;  1XXG A;  3NZS A;  2SEB D;  2MP2 B;  2KJH B;  3TSS A;  1FNU A;  1SGH A;  1DGJ A;  3UF8 A;  2CHX A;  4NJC A;  4J6I A;  2J7Q B;  1J8C A;  1WGD A;  3IBE A;  5EE1 A;  3M62 B;  2N9E B;  1H8C A;  2FE8 A;  1TT5 B;  4HVB A;  3GZN B;  4HCP B;  3RNC C;  2JYE A;  3KYC D;  2K6D B;  3R2I A;  2IO2 B;  2KNB A;  2FAZ A;  4PYZ A;  2ZPN A;  3ZDM C;  2KC1 A;  1OTR B;  2NVU I;  2Y5B B;  2D3C A;  4YTM B;  1HQR D;  3AE5 B;  1WMH B;  3AXC A;  5IOI A;  2AQ2 B;  1WFY A;  3TCA A;  4ITK A;  2OJR A;  2Z0E B;  4HJG E;  4KGR A;  2PPH A;  4EZL A;  3OJ4 B;  5FKA C;  1WX9 A;  2LRW A;  2M17 A;  1JML A;  5I4D A;  2FUG 1;  1GOZ A;  2VH2 A;  3H6N A;  1XEE A;  3UIO B;  1V81 A;  1SE2 A;  1F77 A;  1D6E C;  3NZ3 A;  1E7U A;  1LFD A;  3AH7 A;  3ZKJ C;  4I6L B;  2FID A;  3LJ3 A;  1J0G A;  2REX A;  2MCN B;  1LM8 B;  1K52 A;  3LB8 C;  3FAH A;  3B9J A;  1ZPS A;  1WXQ A;  4XC2 A;  1LQB A;  2V3N A;  3KUC B;  3PZD A;  1WX7 A;  5BYS A;  1VCB A;  2L0T A;  2WXP A;  4WJQ A;  3P4Q B;  4WAF A;  4B95 A;  3A1Q B;  5LLI A;  1UWM A;  3VTU A;  3TMP B;  1QLB B;  1JAL A;  4W9I A;  4RF0 A;  2KX3 A;  4GIV A;  2K1F A;  4K7U A;  4N58 A;  2JZZ A;  1ZXI A;  5AZG A;  4O1N A;  2B3A A;  2WDT B;  4FHK A;  1YD8 U;  1IPG A;  3AE1 B;  3MJW A;  2MSE D;  5EE9 A;  3IT6 B;  4MT5 A;  1MVK A;  3IG3 A;  1TS4 A;  2J52 A;  3BVZ A;  3DVG Y;  4BKT A;  4GDK B;  2HD5 B;  1V8C A;  3CWI A;  2O2V B;  2KD0 A;  3IFW B;  3LXF A;  2G4D B;  3DHI C;  1P3Q U;  2KTR A;  4DXF A;  5JHB A;  3TEW A;  3NVZ A;  2PLP A;  1T0Q C;  2RDB C;  3QC8 B;  3H8H A;  4RMA A;  2NBV B;  1DOX A;  4TQ0 A;  5HI1 A;  4AJY B;  4DK5 A;  1N5X A;  1QF6 A;  1L2N A;  3EHV A;  3V62 A;  2WXR A;  4EOY A;  1E90 A;  3WIM A;  2M0X A;  2MH7 A;  1Q0W B;  3N32 A;  3BVG A;  2IGG A;  4BZA A;  3AE4 B;  1YOV B;  3QWZ B;  3DBL I;  2JWZ A;  4NJ6 A;  4L1B A;  5BMH A;  1XO3 A;  2D3B A;  1QT9 A;  2ZNV C;  2CKH B;  3MC8 A;  2D11 A;  4YT0 B;  2KYW A;  5G55 A;  1KLV A;  3RYT A;  4EEW A;  1ET9 A;  2N7E A;  2QC8 A;  3VR9 B;  1X1M A;  1V80 A;  4WH4 A;  2WXK A;  3T9L A;  3MC0 B;  4YWG G;  4C80 A;  3KWV A;  3HHM A;  1HEZ E;  4G3X B;  2KHW B;  2BYV E;  4YSX B;  3N30 A;  4KZC A;  2IPK D;  1EU4 A;  4M02 A;  3DWM A;  2QHO A;  2WDQ B;  4LJP B;  2L05 A;  1C77 A;  1YQB A;  3GB1 A;  4BKS D;  3VHT C;  4DDG D;  3I57 A;  1E7V A;  1ZOY B;  3B0A A;  4HCN B;  1TIF A;  5E6P A;  3ZXV A;  2QIE B;  4FJY A;  3I5J C;  2M8S A;  4ANW A;  3DBS A;  1C3T A;  4W9K A;  3GOE A;  1WF9 A;  2MLB A;  3H1U A;  1PGA A;  2KWU B;  3IVF A;  2G9H D;  3MFG A;  2K39 A;  3ZUN A;  1E0Z A;  1PGX A;  3KW5 B;  4URK A;  4EZK A;  2K8C A;  2DZK A;  1FFU A;  2W55 A;  5IKC M;  2ZEQ A;  2V9H A;  2XNA C;  1NDD A;  4ANU A;  1V9J A;  1FXI A;  3FC4 A;  4OZC A;  2GOW A;  1IBX A;  4FA6 A;  4M00 A;  2RDG A;  4MDK E;  2EEL A;  5LXI B;  1C78 A;  5FR3 A;  5D2M B;  2LVP A;  1MFW A;  1MI0 A;  3FIL A;  2LUM A;  3L0W B;  3LDZ E;  2C7M B;  4LCD E;  3GZN I;  3D32 A;  3NHE B;  2WXQ A;  5LNK 1;  5H92 C;  4A9A A;  4MGZ E;  3HM6 X;  4M01 A;  1E8Z A;  2LZ6 A;  3GP7 A;  2VH1 A;  4B9K A;  1UGJ A;  3JSV B;  3DBH B;  4GDK A;  1RLF A;  3WAM A;  1FXT B;  1E8Y A;  2JX5 A;  3WCQ A;  5JH5 C;  3DHG C;  1TZO A;  1K53 A;  1KTK A;  3NZU A;  2O6V B;  3AU4 A;  1ZE3 D;  3SD5 A;  5DCN A;  1QIL A;  2KVZ A;  3KVF B;  1D4B A;  4FJV B;  1STE A;  1WXM A;  4NQK E;  3ZJT A;  1A70 A;  3RNA C;  4IOI E;  3CIR B;  2XK5 B;  1WIA A;  3OAW A;  2CJO A;  2L76 A;  1BUI C;  2OJW A;  4F8C B;  1JCK B;  2DLB A;  2WS3 B;  2YEP F;  2BYT A;  3RPF C;  2BWE S;  1WR1 A;  1ISN A;  2YVC A;  2NS5 A;  3V61 A;  5CHF A;  3VAW A;  2OOB B;  1N62 A;  3VH3 B;  2KVR A;  1RFK A;  2ZJD A;  2IY1 B;  4HXD A;  4KX6 B;  2M56 B;  4C4V B;  3ZRC A;  2JSV X;  3EFU A;  2C7N B;  5IN7 A;  1KH0 A;  4EUT A;  1IGD A;  3QJZ A;  4ZRI A;  2C9W B;  2MBB B;  1Z5S B;  4FN2 A;  3KYD D;  4LNI A;  4NNJ B;  4DHJ B;  1ZDV A;  3E56 A;  5IA7 A;  5CHV C;  3RNE C;  2WDR B;  4NY0 A;  4Q2J A;  3AED B;  2ZPY A;  3RNF C;  2HJ8 A;  3ABV B;  1WJN A;  2M0A A;  4KKJ A;  3NUH B;  2PVG C;  4S0R A;  3VDZ A;  2JF5 A;  3O65 B;  5C1Z A;  2FCQ A;  3PGE A;  3OJ3 A;  3QK0 A;  3W2D A;  2BKF A;  2G45 B;  5EE3 A;  2KFK A;  3A9K A;  1RYJ A;  1UGM A;  1WE7 A;  4HPL B;  1SEB D;  3VUX A;  3ZVV A;  1QOA A;  4WIP A;  4JWU C;  3DBL B;  5DPW A;  3AV8 A;  1CZP A;  2WWZ A;  4LLG M;  3DVG X;  1SBB B;  3AE9 B;  2LAS A;  3B08 A;  5D6J B;  1SE3 A;  4G11 A;  4RGM A;  1VR9 A;  2N0S B;  2AX5 A;  3FKY A;  3KWL A;  1JWU D;  1TTN A;  2O6V D;  2IO0 B;  1UWX A;  4GGQ A;  4FAD A;  1F1H A;  2CHZ A;  3Q3J A;  1GC7 A;  4DHZ B;  2WXN A;  1JRO A;  2NBU A;  4NQL B;  4HK2 A;  4XWT A;  1WGH A;  4K7S A;  1GB1 A;  1FD6 A;  2MW5 A;  4JE3 B;  2Z59 B;  4IC7 B;  2JU6 X;  1F2R I;  1WJ4 A;  1FCC C;  2WDV B;  3TBL D;  2NPT A;  4XWW A;  4KKI A;  2JQR B;  1D5M C;  4JWS C;  3BIN A;  3PRM B;  4AOF A;  3H7P A;  4EFO A;  2J0M A;  3ZGZ A;  2UYZ B;  3P4P B;  1EF5 A;  2L1A A;  1BXT A;  2ZVO A;  4BKG A;  2YLM A;  2JUO A;  2Y5P A;  3VTV A;  1F2R C;  1VZ7 A;  3KH0 A;  5EDS A;  1ZXH A;  3APC A;  3BWU D;  1TZ1 A;  3HUI A;  2GBN A;  3P4R B;  4DHJ D;  4DXA B;  1ROE A;  1TJE A;  1LO5 D;  2LHD A;  4C56 C;  1V1P B;  4HRS A;  5JZE B;  2W3R A;  4GDL B;  4FXC A;  1WGK A;  2J53 A;  4N6E B;  2FBW B;  4E71 A;  4HDO A;  3BVM A;  5E6O A;  1WGR A;  4LK0 M;  1QOB A;  3AM9 A;  3A4S C;  4DQO C;  3KUZ A;  2ACZ B;  2KDM A;  5KHO A;  2Y5C A;  2Z0D B;  1FRR A;  3CST A;  1B9R A;  3W9C B;  4BOZ B;  2H88 B;  2CHW A;  2JZ3 B;  1R7S A;  1KOT A;  4HPM B;  2DYM A;  4ZHO A;  3EC8 A;  4HKZ E;  3AE7 B;  4K3C A;  5G5G A;  1Q5W B;  3AEB B;  1LGR A;  5J17 A;  2FIF A;  2WYQ A;  3Q3N C;  1XLQ A;  1ACC A;  4P7I A;  1CK1 A;  5TR5 A;  2GBJ A;  1L7Y A;  3DBH I;  3W1S C;  1JRP A;  2IYD B;  4P1C C;  1OQQ A;  1FPY A;  3DVN U;  1EU3 A;  2MBH A;  1WGY A;  3ETR A;  4XZ4 A;  2CJN A;  1QOF A;  4HPP A;  3AEG B;  2SAK A;  1RM6 C;  4M0W B;  3TL5 A;  2KAJ A;  2PW9 A;  2K8H A;  1YJ1 A;  2MWS B;  3APD A;  4ZRQ A;  1FNW A;  2QCZ A;  2AEH A;  2R61 A;  4WWO A;  1OEY J;  3L54 A;  4W9G A;  4OVZ A;  1KLG D;  1UZX B;  3Q8E A;  5C2T B;  5AUI A;  3W5U B;  2G3Q B;  4M8M A;  2ASQ A;  1GB4 A;  2K22 A;  3JVZ X;  2LMC A;  4N59 A;  4PS3 A;  1FXA A;  3UI3 A;  1JWM D;  2KAN A;  2ZVN A;  2V0G A;  3IAS 1;  4ZYN A;  5GXG B;  3DBR B;  4A3O A;  4NPN A;  1QOG A;  4OW0 A;  4HDQ A;  4LDT B;  1XCQ L;  4US8 A;  3ML8 A;  3PLU A;  2L3Z A;  1PUT A;  1V97 A;  3ZJU A;  2WXJ A;  1UUP A;  1WRI A;  2K5P A;  4RM8 A;  1S3S G;  3W5V B;  3A33 B;  4QAY A;  1C9F A;  1N60 A;  1I35 A;  1FNV A;  3ZW3 A;  1AW7 A;  3Q8B A;  4MSM B;  4BFR A;  2BYE A;  1FO4 A;  3E9S A;  1YJI A;  4KSL C;  2AQ3 B;  1JQ4 A;  1N61 A;  3GE8 C;  2LGY A;  3RD2 A;  4WJP A;  3VXW A;  2KN4 A;  2WXM A;  1UBI A;  2BS2 B;  2V4I B;  4WWN A;  2M19 A;  1MPE A;  1SIJ A; 
#chains in the Genus database with same CATH homology
 4USA A;  2E6X A;  1KRH A;  4C7Z A;  2IGD A;  3DWG C;  3U52 E;  1PDX A;  1ESF A;  4GDK B;  1V1O A;  2L83 A;  3BK2 A;  3P4S B;  2L32 A;  1TKY A;  2K9X A;  1MI0 A;  5D7G A;  4DXG A;  3FIL A;  1SSN A;  2LUM A;  2IGH A;  1YNT E;  2B76 B;  2WLB A;  4GLS C;  3P63 A;  2CU3 A;  4XDD A;  2MEK A;  1N5W A;  4H2A A;  2INP E;  3T3N A;  1MHH E;  1JWS D;  4TMA B;  2WXQ A;  3NVV A;  5LNK 1;  4B0M A;  5H92 C;  1HZ5 A;  4A9A A;  4ZHP A;  1VZ8 A;  1YN4 A;  1I7H A;  2VZK D;  4JX1 C;  5AUK A;  1J7C A;  2H89 B;  3GP7 A;  2BT6 A;  1UGJ A;  3TEX A;  1KFY B;  2V3P A;  1K50 A;  2PIA A;  1XLP A;  4AQ7 A;  4MAC A;  2JX5 A;  5H8Y E;  1SE4 A;  3N9Y C;  3SEB A;  4RGO S;  1L4D B;  3WCQ A;  2MJ3 A;  2KMM A;  1FM0 D;  4YXD B;  4A55 A;  1TZO A;  4UDU C;  1K53 A;  1KTK A;  2LEK A;  1B1Z A;  2QIL A;  2I38 A;  1ZE3 D;  1NVI D;  3VR8 B;  4ZRP A;  1E9M A;  4NZL B;  1QIL A;  1T3Q A;  2I2Y A;  1D4B A;  4P16 A;  4ARI A;  1STE A;  3RFZ B;  1I4X A;  1A70 A;  3OWE B;  3ZJT A;  5BMI A;  4IOI E;  2J4X A;  1FFV A;  3CIR B;  4XE0 A;  2BW2 A;  2WQY B;  5D3D A;  4A8X C;  1TY2 A;  3C8Y A;  1F0Z A;  2CJO A;  3GS2 A;  4OZB A;  1BUI C;  1L0X B;  2PMV A;  2RDH A;  1JCK B;  2DLB A;  2WS3 B;  2LHE A;  2IJ0 A;  1WYG A;  3T3O A;  5E6J A;  2YEP F;  4NAW B;  1RWS A;  2JWU A;  2BYT A;  3RPF C;  1YQ3 B;  1AN8 A;  1K51 A;  1XLO A;  2N7J A;  1SB3 C;  1NYR A;  1PGB A;  1TYG B;  1C4A A;  1E7P B;  3AEC B;  3BK1 A;  1HZ6 A;  4A90 A;  1C4C A;  1N62 A;  3URY A;  5HFY A;  2J42 A;  2ZW0 A;  1IBX B;  1RFK A;  1XLN A;  2DBY A;  2K0P A;  2NMQ A;  1P7F A;  4R3D A;  4KX6 B;  3P1M A;  2M56 B;  3AE6 B;  3EA6 A;  1QKZ A;  4HKQ A;  3V3X A;  2MJE A;  1EWY C;  2JSV X;  1I4R A;  3VRA B;  1NYQ A;  2N9K A;  3BII D;  1SJH D;  4EE2 A;  2D5G A;  5T8I A;  3PO0 A;  2ONQ A;  1KH0 A;  4RFB A;  1YJJ A;  1ENF A;  3FIL B;  3BYT B;  5HG2 A;  2WXG A;  1IGD A;  2L52 A;  1VRA B;  1AYF A;  4MM3 B;  3AB5 A;  1L5P A;  4RNA A;  4XDC A;  3V05 A;  2WU5 B;  3L4P A;  3VRB B;  1ZDV A;  2Z8L A;  4YTN B;  3E56 A;  3I9V 1;  1KLU D;  2BB6 A;  3KLS X;  1Q10 A;  2YEP B;  2ICI A;  1L4Z B;  1XXG A;  2WDR B;  4Q2J A;  3AED B;  2SEB D;  3Q8F A;  1ET6 A;  1TKG A;  3TSS A;  1FNU A;  3ABV B;  4KKJ A;  2M0A A;  3NUH B;  2PVG C;  1DGJ A;  4WUR A;  2GRI A;  4WWM A;  4NJC A;  3W2D A;  5EE3 A;  4KGS A;  4IDI A;  1RYJ A;  1HXY D;  5EE1 A;  1M4V A;  4ARC A;  1SEB D;  2FE8 A;  3NVW A;  3SFE B;  1QOA A;  2KWD A;  1NEN B;  4WIP A;  4JWU C;  2OED A;  3AV8 A;  2JYE A;  2K3U A;  3R2I A;  2QMT A;  5HHD G;  1YN5 A;  1CZP A;  1V1P A;  4LLG M;  3IT4 B;  3AE3 B;  1SBB B;  3AE9 B;  2W82 A;  5TSS A;  4YTM B;  1HQR D;  1N63 A;  1SE3 A;  3AE5 B;  3P42 A;  1I4G A;  4RGM A;  2AQ2 B;  1VR9 A;  5D3I B;  2IDY A;  4ITK A;  2N0S B;  2AX5 A;  4KGR A;  1IGC A;  4HJG E;  4YSZ B;  5C3J B;  3KWL A;  5FKA C;  4US9 A;  1JWU D;  1EM7 A;  1JML A;  5I4D A;  2GB1 A;  2FUG 1;  1EWC A;  1GOZ A;  1UWX A;  4B0E A;  1JW9 D;  1NEK B;  2BTE A;  3HVZ A;  1XEE A;  2BBC A;  1SE2 A;  1F77 A;  1D6E C;  2WXN A;  1JRO A;  3NZ3 A;  1HA5 A;  3Q69 A;  1D5Z C;  3AH7 A;  3PZ8 A;  4XWT A;  1ZUD 2;  3MP9 A;  1GB1 A;  1FD6 A;  4JE3 B;  2PTL A;  2JU6 X;  2Q5W D;  1F2R I;  1K52 A;  3LB8 C;  2JYT A;  5FK9 C;  1SJE D;  3ZYY X;  3FAH A;  1FCC C;  2WDV B;  3HVD A;  1MPE A;  1YMH E;  3B9J A;  1ZPS A;  4XWW A;  1WXQ A;  3IXS A;  4KKI A;  2JQR B;  2V3N A;  2WXH A;  1D5M C;  4JWS C;  1VDV A;  5BYS A;  4ZOH C;  2JZP A;  1NI3 A;  2WXP A;  3R2T A;  4CQN A;  3P4Q B;  4WAF A;  2W3S A;  3SFD B;  3ZGZ A;  1FCL A;  4L23 A;  3MHZ A;  5BYR A;  4YTP B;  1UWM A;  2KAC A;  3P4P B;  1DYQ A;  1BML C;  1QLB B;  1JAL A;  2NTT A;  2L1A A;  1OQR A;  2WNM A;  4RF0 A;  1BXT A;  2ON8 A;  1SXT A;  4M0W A;  1L6U A;  2Y5P A;  4N58 A;  4ZYS A;  1ZXI A;  4RCO A;  1L6V A;  1QQR A;  4O1N A;  1FRD A;  1C79 A;  1F2R C;  1VZ7 A;  4C7Y A;  1ZXH A;  3BWU D;  3AE1 B;  3HUI A;  4JPS A;  5EE9 A;  3IT6 B;  3P4R B;  4MT5 A;  2X38 A;  1ROE A;  1TJE A;  1MVK A;  2EKI A;  1LO5 D;  2LHD A;  2NTS A;  1TS4 A;  2J52 A;  4C56 C;  1V1P B;  3BVZ A;  4HRS A;  1T6B X;  5G5H A;  1KF6 B;  3BZD B;  3SR6 A;  1T5X D;  2N9L A;  1SF0 A;  1V8C A;  2W3R A;  2W54 A;  3CWI A;  1OFF A;  1WGK A;  2J53 A;  4FXC A;  4N6E B;  2FBW B;  1FEH A;  4HRO A;  3LXF A;  3BVM A;  4AS1 A;  4HEA 1;  4TQ1 A;  2XN9 C;  4REZ A;  4LK0 M;  1QOB A;  3KQ4 A;  2DYO A;  3AM9 A;  1CJE A;  3EGR A;  2KQ4 X;  3J9C A;  1WSP A;  3AEE B;  5BMG A;  4DXF A;  3ZQ4 A;  4DQO C;  2ACZ B;  5MPO A;  1L0V B;  2BB5 A;  2KDM A;  2E3T A;  2Y5C A;  4WQM A;  3TEW A;  1FRR A;  5BYQ A;  3NVZ A;  1B9R A;  2PLP A;  4OHJ A;  3W9C B;  2BS4 B;  1TS5 A;  2H88 B;  3H8H A;  4GDL B;  4IKG A;  1R7S A;  1DOX A;  4TQ0 A;  3AE8 B;  2WU2 B;  1MHX A;  3MJ5 A;  5HI1 A;  2DYM A;  3BYY B;  4ZHO A;  1N5X A;  1QF6 A;  2QJL A;  2WXR A;  1I4Q A;  4HKZ E;  2LFI A;  1JWB D;  3AE7 B;  1PFD A;  2MH7 A;  5G5G A;  3U2S C;  3TEZ A;  3AEB B;  3BVG A;  2HDE A;  2IGG A;  2G1E A;  4RF1 A;  3AE4 B;  3U7Z A;  1XLQ A;  1ACC A;  3NRZ A;  4L1B A;  1CK1 A;  5BMH A;  3ZJV A;  4YSY B;  1IUE A;  1XO3 A;  3B2F A;  1PYW D;  1GPX A;  3NVY A;  3NS1 A;  1J7B A;  1QT9 A;  2ZW1 A;  3W1S A;  2VZK B;  4OZA A;  1JRP A;  2LGI A;  4YT0 B;  1GAQ B;  4PT5 A;  1OQQ A;  1XF5 L;  4RGT A;  3O13 A;  1EU3 A;  3ETR A;  1P7E A;  2CJN A;  1QOF A;  3AEA B;  3AEG B;  2SAK A;  1RM6 C;  1ET9 A;  3VR9 B;  1C4P A;  2KAJ A;  2PW9 A;  4WH4 A;  2WXK A;  3MC0 B;  3AN1 A;  4KGT A;  1E10 A;  1TKE A;  3AE2 B;  4YWG G;  2AQ1 B;  4TSS A;  4ZRQ A;  1FNW A;  4C80 A;  3HRD D;  4RH6 A;  3KWV A;  1L0Y B;  3Q8C A;  2R61 A;  1HEZ E;  2BS3 B;  2OHF A;  2Y3A A;  1CQV A;  4YSX B;  4A6Q A;  1Y56 A;  2IPK D;  3B2G A;  4OVZ A;  1EU4 A;  1KLG D;  3Q8E A;  2HTM E;  5C2T B;  5AUI A;  3W5U B;  3DWM A;  2QSD A;  2WDQ B;  3IAM 1;  1GB4 A;  5JXV A;  2K22 A;  4N59 A;  2LMC A;  1C77 A;  1FXA A;  3UI3 A;  1DOI A;  1I4P A;  2M19 A;  3AEF B;  1AWD A;  3GB1 A;  1JWM D;  3I57 A;  1ZOY B;  4NAM A;  2TSS A;  2V0G A;  3IAS 1;  2MJD A;  5GXG B;  4L2Y A;  4LTU A;  1ZP0 B;  1J7A A;  1UNS A;  2LJI A;  3LYY A;  3U4E G;  2QIE B;  5EE0 A;  1JWA D;  1QOG A;  4OW0 A;  1VJK A;  1E6E B;  1TS3 A;  1XCQ L;  2RPV A;  2QEJ C;  3R8B A;  4US8 A;  1PGA A;  1WWT A;  3AMZ A;  2G9H D;  4P6V F;  3VQI A;  1PUT A;  1V97 A;  2JXT A;  1TY0 A;  3ZJU A;  2WP9 B;  3MFG A;  1I4H A;  2WXJ A;  2RMM A;  1UUP A;  1WRI A;  1YN3 A;  2K5P A;  1E0Z A;  1PGX A;  3W5V B;  2PKO A;  3PZ7 A;  1VZ6 A;  3TEY A;  1FMA D;  1C76 A;  1C9F A;  1FFU A;  2WXL A;  1N60 A;  2PVO D;  3EUB 2;  2W55 A;  1VLB A;  1FNV A;  2INN E;  1AW7 A;  3Q8B A;  3Q8A A;  1FO4 A;  3E9S A;  2WXO A;  1YJI A;  2XNA C;  1FIQ A;  1ZDX A;  2AQ3 B;  1JQ4 A;  1N61 A;  2WXI A;  1FXI A;  3FC4 A;  4OZC A;  4D2K A;  1IBX A;  1DOY A;  3TUO A;  1XCT L;  2RDG A;  2KN4 A;  2WXM A;  1YQ4 B;  2GI9 A;  2BS2 B;  4MH8 A;  2V4I B;  4J3O D;  2EEL A;  2WXF A;  4RGN A;  1D5X C;  1C78 A;  2DWQ A;  5FR3 A;  1SIJ A;  1TS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...