2DLDA

D-lactate dehydrogenase complexed with nadh and oxamate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
337
structure length
337
Chain Sequence
MTKVFAYAIRKDEEPFLNEWKEAHKDIDVDYTDKLLTPETAKLAKGADGVVVYQQLDYTADTLQALADAGVTKMSLRNVGVDNIDMDKAKELGFQITNVPVYSPNAIAEHAAIQAARVLRQDKRMDEKMAKRDLRWAPTIGREVRDQVVGVVGTGHIGQVFMRIMEGFGAKVIAYDIFKNPELEKKGYYVDSLDDLYKQADVISLHVPDVPANVHMINDKSIAEMKDGVVIVNCSRGRLVDTDAVIRGLDSGKIFGFVMDTYEDEVGVFNKDWEGKEFPDKRLADLIDRPNVLVTPHTAFYTTHAVRNMVVKAFNNNLKLINGEKPDSPVALNKNKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dehydrogenases Engineering to Correct Substrate Inhibition in a Commercial Dehydrogenase
rcsb
molecule tags Oxidoreductase (choh(d)-nad+(a))
molecule keywords D-LACTATE DEHYDROGENASE
total genus 105
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 1.1.1.28: D-lactate dehydrogenase.
pdb deposition date 1995-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2dldA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2dldA01
5GZ3A 2O2YA 3GFBA 4EYEA 3PWSA 5JC1A 3VAZA 3RCBA 5FYDA 4JXKA 5ILGA 3VTZA 3JQ6A 3BMCA 2GUGA 4XYLA 4I8XA 2VRCA 4WNIA 1BVUA 3UH1A 4BVAA 3PQFA 3LC7O 3PFWO 4CV1A 1JVBA 1XIVA 1FDUA 2ZYAA 2AEJA 1HZZA 4W7HA 1QSGA 2EXXA 3CPSA 3UW3A 3IJRA 1S6YA 4GLLA 1QYVA 2IEDA 2QYTA 3E8XA 5T8KC 5B1YA 4GAEA 3GG2A 3VDQA 1YGYA 4UVGA 5J23A 1LXCA 1WDKA 1DC3A 3OSUA 3ZHZA 1XWFA 4BO5A 1NQAO 3ZCXA 3SEFA 4W6ZA 4B3IA 5EIOA 3BTOA 5A05A 1ZSVA 4FR5A 2P68A 3BMNB 4W4TA 3HZZA 5LC1A 3VOSA 5IZCA 4CL3A 2VT2A 2Q1SA 4R5MA 4KQWA 4RPLA 2Y1FA 4ALJA 4CMAA 4HADA 3RI3A 4CMCA 3KETA 3V1UA 2WM3A 1EDZA 1TEHA 3O03A 4LRSB 2UUPA 4UEKA 1IY8A 3DZGA 3SXPA 3T7EA 1QORA 1MXFA 1U1IA 1M75A 2DVMA 3QE3A 3ZU4A 3DONA 1A7AA 1U5AA 1UXJA 4DLBA 4JJFA 4KDEA 1DBVO 1QYCA 4DA9A 4II2A 5A9TA 5A4DA 3GY0A 4YR9A 4QFDA 4AVYA 1OAAA 4JJGA 1ISGA 1YL6A 3RFVA 4IMPA 4BNXA 1YRLA 5G4KB 2OL4A 2VYVA 1M2WA 2POQX 4ALKA 4AJHA 1HYGA 4NQZA 5ADHA 1ZK3A 3W8DA 3HB5X 2UAGA 2NTVA 3E9MA 4L9RA 2IZ1A 3DTTA 4MVJA 1ZNQO 4BO9A 3WOHA 2GSDA 2WE8A 1K6IA 1EUZA 1D1TA 3WGZA 5JDCC 5L4SA 5KJ6A 1BGVA 2Y05A 3IUPA 1XLTA 2B37A 1JN0A 3ASUA 4BKUA 1FDVA 1GCUA 1TXGA 1B15A 1G6KA 1VJTA 3G0OA 3O8QB 3RVDA 5KVCA 4OKNA 2AG8A 3OM9A 5CDGA 1VPDA 1H6BA 1YBMA 1X1TA 2ZB7A 1K6XA 1RJWA 3RUIA 1RM0A 2DUWA 4NBRA 3B1KA 4MINA 4MJLA 1SBYA 4BKQA 1PJLA 1W8DA 3D3WB 2J3KA 1CIVA 4BNMA 3H5NA 4EDFA 5DCUA 4ZRNA 4EEZA 2QZ9A 2VQ3A 2YHIA 3ENKA 2R2GA 1ADFA 1IL0A 3VZSA 1F8GA 2D0IA 3TZ6A 3K6JA 1SEVA 1VL0A 1ZH8A 3FPLA 3H2ZA 3S2GA 4BV9A 3IKTA 2HJSA 4MKZA 5DCWA 2PD4A 1YXMA 4GWGA 1PWZA 4FS3A 4XDYA 4B3JA 4OIMA 4M55A 4TZTA 1A5ZA 4E5MA 3LF2A 4CM7A 5CHEA 1AGNA 2X5KO 3I4CA 3ZH2A 2O3UA 3QLJA 3GVIA 1YJQA 2O3QA 4FOOA 4ROSA 2BRUA 4NBTA 4B79A 1R12A 1W6UA 4QQRA 3SBOA 2FR1A 1A7KA 4O1MA 2PY6A 4YCAA 4ND1A 1Y9EA 3I9NA 1P33A 3I4FA 5KJFA 3OHSX 1PQUA 3VZQA 5F1PA 1D3AA 4GMFA 4YA6A 4L76A 3LT1A 3QWBA 3V2GA 4BNNA 4M89A 5DF1A 1K3TA 3HFGA 4FC6A 1QG6A 2HK7A 4H16A 1XU9A 3LT4A 2PGLA 1BVRA 1JTVA 2B4TO 4ALLA 1HF3A 3PK0A 1ISIA 3KRTA 5A04A 2Y68A 1NXQA 4JIGA 4IXWA 5JCXA 1Z75A 1E3LA 3RC2A 5KOIA 1GEEA 3K96A 1U2GA 4CMIA 4A26A 3JQEA 4JGBA 4BMNA 4P38A 1MG5A 5C7OO 3IP1A 4GX2A 5DOZA 1BTOA 1Z74A 1J6UA 1PJ4A 2CDBA 3F4BA 3OEYA 5EJ2A 4ALNA 5IN4A 1U8XX 3DBLA 3BHIA 3EK2A 5ENDA 3KUXA 5L45A 1E3WB 1ENPA 1WW8A 3HQ4O 3PI7A 4NK5A 2JCXA 3JQBC 1BW9A 2O7QA 3PIIA 5TJ9A 1LU9A 2DAPA 3GT0A 4ZQGA 3LYLA 2ZTLA 3EZYA 1I3MA 2AQIA 3PJFA 2BELA 2NUAA 5HS6A 1HZJA 1EUCA 1HLPA 1CEQA 1NQTA 1PJ2A 5F3RA 3W4IA 2D5CA 4IS3A 2O3TA 3EUWA 1GUYA 2YV2A 3IMFA 2Y0CA 2B36A 4WLEA 3S1LA 3U4CA 1CQIA 1WAMA 3TN7A 1Y9AA 1AE1A 2NVUA 3ANLA 4ID9A 1QXSA 4J43A 1SNYA 3WBBA 2H1SA 5B4TA 1NAIA 3PWZA 1YOVA 3KYDB 1SOWA 3MJTA 3VZPA 5L4NA 1NWHA 2AHRA 2VHYA 4WGGA 4OJNA 3HDQA 2PH5A 5CDYA 1XQ1A 2PZKA 3JQ7B 4M8SA 4ZQBA 2A35A 2W2KB 5IG2A 2QZZA 3EC7A 2CDCA 3CTMA 4E31A 2B69A 2ZIZA 4J1SA 4R68A 5AOVA 4D79A 4UVDA 1PGOA 3L6DA 3O4RA 3FTPA 1NAHA 1XGKA 4UEOA 3IKVA 4BMVA 1J5PA 3DHEA 2QW8A 3QW2A 1BHSA 5HRUA 4WKGA 4BGUA 3TOXA 4IMRA 1PGQA 2P5YA 4F6LA 4DRYA 1EQUA 1I3NA 3CSDA 4DL9A 4H3VA 2HRZA 3Q11A 4CMEA 2CVZA 4BO4A 1LLUA 3WTCA 2WE7A 3ICPA 3OIDA 3ZWCA 3OIFA 4FJ0A 1EFKA 4FCCA 5U4QA 4BNGA 4CMHA 1DOHA 3GQVA 4LSMA 4I1IA 1T2CA 4DLLA 1HDRA 3C8MA 1KBZA 2NQTA 1DXYA 3DFZA 3INGA 4P4GA 2NVBA 1T2FA 4XCVA 4EJ6A 5CDTA 5JMWA 1QRRA 1SEPA 1EEHA 3G3EA 1YVEI 2NWQA 4IZIA 3ZZNA 3X2EA 2P91A 1DPGA 5JYEA 2BH9A 2CVQA 4OXNA 2FZWA 2E37A 3FWZA 2B83A 2YJZA 5L3ZA 4DVJA 4QTZA 1GYQA 5FEUA 3HG7A 1O89A 4KMSA 4Y9DA 3ANNA 3K2BA 3EY4A 1FDTA 3JQ8B 4PVDA 4TKMA 4NBWA 1LRJA 1Q7CA 4RGBA 1HT0A 5F5NA 1UZLA 3ZV5A 1ZEMA 1LDNA 1UP4A 5A5FA 3LK7A 4JP3A 2JD1A 4RZHA 1O94A 4MOWA 3PZBA 3MJCA 3X2FA 5JNLA 2UVDA 4HWKA 1UZNA 4ZRMA 4ZU3A 3MZ0A 4FN4A 4HXYA 1ZK0A 3NEPX 2AXQA 4I9NA 4Y8VA 4YVFA 1B8VA 5JC8A 1BXKA 4CM9D 2NVWA 5F1KA 1P1JA 4CJXA 1HSZA 3BTVA 1TT7A 4WCDA 5TIIA 4MIOA 3H3FA 3ETGA 3JQ7A 1E6EA 1CF2O 1ONOA 1I32A 3QWHA 3WYBA 2E49A 5DN9A 1I30A 3VH1A 2JHFA 3CINA 3ONFA 4PCVA 2PWZA 1V3UA 4WLNA 1EVIA 4EUEA 5GY7A 3PJDA 1PJCA 4NJMA 3RWBA 5JO0A 3DZIA 5ICMA 5CFZA 1ZMOA 1LTHR 3JQAB 2ZATA 4NI5A 1GZ3A 1MFZA 1GDHA 2PKQO 3K30A 1HE4A 1PGPA 3BMQA 2GASA 1VRWA 2VTEA 2C29D 3GGGA 2BFMA 1CJCA 3KB6A 2DLDA 2YFHA 4CM8B 2GCGA 4XD2A 4C4OA 3D4PA 4IS2A 5L95A 2Y1DA 2QRJA 1JLLA 1XHLA 3RQSA 1K0UA 2V6BA 1L7DA 1DAOA 3RIHA 4BNVA 4XYEA 9LDBA 4E32A 3T4XA 1GEGA 1JQBA 1Q1NA 1OC4A 4R01A 3I9KA 5L40A 1E6WA 4XIJA 1ZZEA 3DFUA 2BD0A 4CV0A 3PJGA 4HFRA 3UAGA 1ZK4A 4U5QA 4JBIA 2ZYGA 3PLRA 3QHAA 4PG4A 5COBA 2X9GA 5HWSA 2VHZA 3ROKA 1GAEO 3RBXA 3K92A 3AUSA 3AW9A 1MGOA 1Y7TA 1KVSA 3CEAA 3ORFA 4E5KA 2GNAA 3F1LA 1HDCA 1GD1O 2GYYA 1X7DA 2P9GA 3OA2A 3K73O 3GNSA 1N7GA 5LDHA 4J1NA 1N92A 4M49A 5H82A 2W98A 3V8BA 1EE9A 3VPXA 4FJ2A 4ITUA 2DTXA 2G5CA 1LNQA 2Y0EA 3E18A 1UUFA 5KWEA 2BHLA 3ZI0A 5HTOA 4E2WA 1A4IA 3DR3A 3G17A 4BO6A 4XJSA 2DBVO 3OBBA 4HFNA 3F3SA 3AWDA 1BXZA 1RM4A 1NVTA 1F8FA 2HUNA 3NAQA 2OOSA 4RF3A 2EKLA 4IDFA 3DOOA 4GBJA 1UXGA 3GMDA 5CPBA 2PTGA 3M6IA 3QWFA 5A1TA 3Q3CA 1P3DA 4UVEA 2X0IA 4FPXA 1XELA 1T24A 1YDEA 2CF5A 3U5TA 5C5IA 2DFVA 2I67A 3RFTA 2I3AA 4BO7A 3I9JA 5F5LA 1ZVMA 2X8LA 2C7VA 4JROA 4XA8A 4CR8A 3QVTA 2YDYA 3LDHA 1LSOA 2WYVA 4DMMA 2DQ4A 1K6JA 3ADPA 1TA4A 1Y8QA 1EDOA 2NNLD 1VM6A 1H6CA 2O23A 3Q9NA 2Z1MA 4R1TA 1SPXA 2EKQA 1D4FA 5B37A 1JAYA 2HQ1A 3H6KA 1HRDA 5EQDA 2VTDA 2GZ1A 3AFMA 3H8VA 1U5CA 2OORA 4CQMD 4J9VA 3I9MA 1GV0A 1F06A 1Q0HA 4YAIA 5BSFA 3BYZA 3DMTC 2DM6A 4JQCA 1Z45A 4L4RA 4QFCA 5JS6A 5AVOA 3K9QO 4GX0A 1IPEA 2H9IA 1MB4A 2O4CA 4H15A 3MWDB 3TFQA 4DUPA 5TRTA 5L9AA 5G0SA 4YDRA 4JN6B 3GUYA 4PG7A 5BSHA 1XR3A 4R9RA 4I5GA 4D45A 2CZCA 2W4QA 3V1TC 1WLYA 3RASA 3S2EA 1ZCJA 4G65A 1R0LA 1EMDA 4MIYA 1JWAB 3WR5A 2JD0A 3RU9A 4I08A 4BNZA 1GU7A 3QA9A 4TWRA 3ST7A 4CR6A 3TOZA 4XWYA 3Q0EA 1VC2A 3H9JA 3HN7A 5K0ZA 2AEMA 3ZWPA 3AK4A 5JAZA 1EVYA 2D5AA 3GR6A 1Q7GA 3WGHA 1X7GA 4YJFA 3ZNOA 3ZWBA 4Z0HO 3V2HA 1EVZA 4PIVA 3JCZA 5JE8A 4ALIA 2RAFA 3GDFA 3R3SA 3ZWWA 4RJTA 2RH8A 4YTEA 5KKAA 3WQSB 3MTJA 3MJ4A 1EK5A 3IC5A 4HNHA 4PLCA 3NTOA 1C3VA 1PQWA 1RKXA 4ZQHA 1KOLA 2DKNA 3U49A 2J3HA 1N1EA 4ZQFA 1ML3A 1YB1A 4RV9A 1GQ2A 5BSEA 1LSSA 3HUDA 3KSUA 3PYLA 4JLWA 2JFHA 2EHDA 2IZZA 3E9QA 1HEUA 1OC2A 2PD3A 3AOEA 3F46A 1C0KA 3CMCO 5JCJA 5CP8A 4K6FA 4HP8A 3ZU2A 2ZTUA 3LLSA 4LSWA 2HCTA 4AG3A 5IZ4A 4KUGA 4IDCA 3I5MA 2P4HX 2NU7A 4OGWA 1HWYA 3OJLA 3PQDA 4QUKA 3NGLA 1GUFA 4NFHA 5TS3A 3RAJA 2W8ZA 3MCVA 4MP3A 4NJMB 4YB8A 3WMWA 1NFRA 2OZPA 4A10A 3OIGA 4QO8A 2WDZA 1OZAA 3GVCA 3UCXA 3ROQA 2DPGA 3S2FA 3ZDFA 3OJ0A 3EVNA 1LRKA 1T2AA 2B4QA 2VWPA 3IJPA 1PX0A 3R1IA 4Y6RA 3BHMA 2IYOA 3H9QA 2CFCA 3O8QA 4Q9NA 4XEHA 4XRRA 1YBVA 5HS4A 4CLXA 5TLSA 3WDSA 3KXDA 4XX0A 1DC4A 1E7QA 2IE0A 1D7OA 4CLRA 3FNGA 4IY1A 4IBOA 4BNWA 4E6PA 2NU9A 4P4LA 4GI2A 4IQ8A 2ILTA 4R51A 2AQ8A 8LDHA 5CG1A 3PDJA 1SZJG 2X0NA 3PRJA 3INTA 1SOVA 3C85A 5JY6A 2HSDA 4A73A 1E6UA 5IDQA 4AJKA 1ISMA 2PZJA 3L07A 4MDHA 4S1VA 4E2XA 2X7HA 4PRLA 1DFIA 4R4JA 3RFXA 4NBVA 5KJCA 1Z6ZA 2TMGA 5ITWA 3AU8A 2X58A 2VZ8A 3E03A 3P7MA 3W8EA 2DUUA 2C0CA 3PXXA 1LEHA 4DBVO 3MWEB 3E48A 5I8WA 3OJOA 1UP7A 3HDJA 3TPCA 4UUOA 4CMGA 1OMOA 2O7SA 3OA0A 1DC5A 1YE3A 2NACA 3ENNA 3O38A 4UVIA 2OUIA 4DREA 4E2YA 1UAYA 3OICA 4L0QA 1LDEA 1E77A 2IXAA 1DRUA 1C0IA 2NV6A 1HYEA 3NRCA 2EP5A 2OP1A 4Z9XA 1U7HA 1P1FA 3GFGA 2BFOA 2VHWA 3LSYA 1DJNA 3A1NA 2PNFA 4HFJA 4BNIA 4BNLA 4DPLA 1C1XB 3O9ZA 1DIRA 4AJIA 2O3JA 4RQTA 5JW6A 4CMBA 4DQXA 3E82A 4Z0TA 3UF0A 4XDZA 3VPGA 3AM4A 3RU7A 2E6UX 5G4KA 1VSUA 1ENZA 4YWJA 5JDCA 3D0OA 1Y5MA 4OHUA 3V2UA 3GHYA 4RVUA 4CPDA 1SC6A 4O63O 1ENOA 3M1AA 3BMOB 3BAZA 1QLJA 2YV1A 1PL6A 4WK6A 2FP4A 1BDMA 3BTUA 3V1YA 2B5WA 1RM3A 4D42A 2R6JA 4WASA 3GZNB 2EW2A 1ISFA 1H6AA 2AW5A 1WWKA 2IXBA 3DMYA 3M2TA 4CMJA 3DBLB 2ZJ1A 1P1KA 3M1LA 1BG6A 1HETA 4LMPA 3WXBA 1WPQA 4XGKA 1DFHA 1M66A 2A94A 3WJ7A 4DIOA 1LQUA 1T4BA 4CM1A 1I0ZA 3DBHB 2QX7A 5A03A 3SC6A 2PZMA 3QJ5A 1VKOA 1XG5A 3WSWA 2VT3A 3L0DA 4ZQEA 1EFLA 2VUSA 1ARZA 4U6SA 1ZIDA 1DFGA 3JYNA 4PLGA 3RKRA 4K28A 5LDGA 1EVJA 1LC0A 4CM4A 3JQCA 3DZFA 1PZFA 4J6FA 7MDHA 4MO2A 4R1SA 2JL1A 3OETA 3W8FA 1ORRA 3JQFC 4Z0PA 1Y8RB 3PHHA 4MP8A 4PZCA 4U0JA 4GX1A 2UDPA 4I9UA 5DULA 2Q2QA 4RLSA 5GZ1A 5TGDA 3D7LA 4XKJA 3M2PA 2O48X 4BO3A 3F5SA 1KY4A 4YPOA 3MOIA 1B2LA 2V6GA 4BKPA 4YAJA 3I6IA 2EJWA 4IJUA 1I33A 2VHVA 3FPCA 2PGJA 4R3WA 2BGLA 4IM7A 4RL6A 2B4RO 3L77A 5A5EA 3A4VA 3BHJA 3WSVA 1PSDA 2FMUA 5AXCA 3ONDA 4XYBA 4XQ9A 3DL2A 3RC7A 2P9CA 3WB9A 3GAFA 2FR8A 4II3A 1YKFA 3PHLA 4CQLA 1K2WA 1PJ3A 4FQ8A 3TL2A 4Z6KA 1NFFA 4KWHA 4X54A 1B16A 2GD1O 1E5LA 3GC6A 3JQ9C 2O2SA 5IAAA 3RJ5A 4AJOA 3ZV4A 4IDEA 4XYMA 4E2ZA 4NIMA 2BFAA 2Y1GA 4KTTE 1DAPA 5BNIA 4TVOA 3ZN2A 3JQGB 4A0SA 1R4MA 1GYRA 4CM9A 2VRCD 1Q0LA 1Z7BA 2XXBA 3DQPA 3TF5A 2F00A 5EERA 2H5LA 4IQ0A 2OMEA 4Q3EA 3TRIA 4WUVA 1F0YA 4ZA2A 3NDJA 3MJEA 3JYOA 2X9VA 1LSUA 2LDXA 1ZSYA 2QRKA 1W4ZA 4H7PA 3HADA 4AJ4A 5IF3A 3MJVA 4OOFA 1PZHA 4O0LA 1LQTA 1NQOA 1KYQA 3FNFA 3KHUA 3RBVA 4B3HA 2B35A 4BMSA 5BR7A 3QQPA 3BMOA 1U3TA 2WD8A 4UAGA 4YJGB 2X5JO 3AFNA 4DIBA 3KO8A 2HO5A 1GQYA 3S55A 1ZUD1 4BL5A 4HFMA 4IIVA 1HDZA 4E5NA 4IJWA 3FWNA 4NHEA 4XGNA 4WCFB 3TNLA 2Q50A 3DHYA 3E6AA 2P5UA 1PZGA 2X1HA 3JD4A 3ICCA 2JFFA 1YBAA 2Q4BA 1ENYA 4IDDA 3JQ8A 2G82A 1N2SA 4NK4A 3GRPA 1Q0QA 3SJUA 4J0FA 1Y6JA 1FMCA 1U4SA 4BO2A 2W2LD 3I9OA 3BZUA 4NH4A 3WGYA 3EZLA 5I9NA 4RF4A 3FF4A 4GH5A 4RORA 5DBFA 1KVQA 2BI7A 1NTOA 1S7CA 4S3MA 5KIAA 1E7WA 3BMCB 4JNKA 4MVJH 3S8MA 3RD5A 3F4LA 2Y93A 4JJIA 1AXEA 1ID1A 4MP6A 2DT5A 1LDYA 2C59A 2C5AA 1O5IA 5IDYA 3C7AA 3ZNPA 1KS9A 1KVTA 3FHLA 4WLFA 3A06A 1SCUA 5TT1A 1GPJA 4NR0A 4DYDA 2NM0A 3L9XA 4GSKA 3ULKA 1CQJA 5DBIA 7ADHA 4Z3KA 4R1UA 2BI8A 1ZW1A 1V0JA 3RBZA 3VH4A 5DT9A 4BNKA 4KQXA 2IEBA 1MX3A 3D4OA 4MVJD 2O4UX 4N7RA 4TZKA 3TZCA 4RLHA 3GH3A 3I1JA 5HA5A 3N74A 5AXBA 1X1EA 4YRDA 1RYDA 4IDBA 5MGBA 4YT4A 4RZIA 3UXYA 5IN5A 2VZ9A 1U9JA 5T8KA 1MLDA 4Q3AA 3PHJA 5JXWA 4Z3DA 2GERA 4Q3BA 4DWVA 4YJGA 3JQDA 2GN9A 4JX8A 3GEGA 3KSDO 1DIBA 1HE5A 1MP0A 4L73A 2DTEA 5AXAA 3UCEA 3F9IA 2C7GA 4BGEA 3GN1A 4R41A 4D41A 2R00C 2RIRA 5THKA 4Q3DA 3RUCA 1XKQA 1C1DB 2I65A 1LX6A 4DGSA 2NSDA 2WD7A 4KUEA 4QSMA 1EUDA 4NU6A 1P0FA 5IZCC 3P2YA 4XIYA 5TF4A 3I3OA 2ZB8A 4EW6A 1NPTO 1P9LA 3ZNQA 1PU2A 1UR5A 2EGHA 4C7KA 4WE3A 1YDWA 4F6CA 2EW8A 1IYZA 3HFSA 3WYEA 1AXGA 5A9SA 1GFSA 3TDKA 3PWKA 1MC5A 1IZ0A 1SO8A 4GLOA 5T5QA 4EUHA 4KP7A 1XA0A 1UXHA 1YQGA 4BKRA 3D4NA 1P1RA 5T57A 4WLVA 5C7IO 1PIWA 5TJHA 4AJPA 1NX6A 4CV2A 4EEXA 2HMUA 3KYDA 2X0JA 1CETA 1TI7A 2C2XA 3HJAA 3E5MA 2GN8A 3V5NA 1KVRA 3FCOA 4R69A 3CE6A 4XYGA 4Y6PA 4IUYA 2PD6A 5CG2A 6LDHA 1DO8A 1NFQA 1V35A 1U3UA 2ZQYA 2QRLA 2D59A 2EGGA 2XOXA 3QIVA 4B4WA 3PGJA 2FOIA 1LLQA 3CIFA 4GSLA 2GDZA 4I9HA 3WJAA 4AJ2A 2WYUA 3DBVO 1ADGA 3GNTA 5T67A 3QVWA 3TJRA 4YT2A 1FDSA 1K5HA 4IGEA 1GYPA 1PEDA 3JD2A 5BQFA 1GR0A 1NQ5A 1W73A 2WYWA 2X4GA 3W1VA 1LSJA 3ZHYA 1QV7A 1Y5RA 3KYCA 1L1FA 1PJQA 3UKOA 3K31A 4MVJI 1GL3A 2WTBA 1GZ6A 3JQGA 2UV8A 4D3SA 1IB6A 1VI2A 1DJQA 4BQRA 3PYXA 4QECA 4BNUA 2YYYA 3VHRA 1OI7A 1QMGA 4QO7A 3ZWOA 3OQBA 4BGIA 2X9NA 4CODB 1BMDA 1GCOA 3PTZA 4A2CA 2DU8A 1X7HA 3H9GA 3H9UA 5I9LA 1NWCA 2YFQA 4OSOA 1F17A 5I8ZA 2JCVA 5DNAA 1OBFO 1DEHA 2X5OA 3GVPA 4HX5A 4IXTA 1P45A 5TNXA 2D4AA 2GO1A 2WSBA 1CERA 3RSHA 4YXFA 4TRRA 1V6AA 3GEDA 3TZKA 1LA2A 4FSHA 3WGTA 4EJMA 1U3WA 1Z7EA 4Y67A 2RH4A 2AQKA 3KEOA 2HKIA 3N7UA 4DBZA 4RPGA 4JCOA 4BNTA 3JQFA 1V8BA 4K9DA 4YJFB 1RYEA 1YL5A 3DB2A 4E5YA 5K6AC 1G1AA 2D8AA 4FFPA 2Z5LA 3AOEC 4YJHB 4U7WA 2B5VA 1I5RA 5EN4A 3ADOA 2H6EA 3O26A 1GTMA 1D1SA 3ZV6A 4YRAA 4OAQA 4OKIA 2CUKA 2G0TA 3GUCA 4CMIB 4J90A 4N18A 1I3LA 2I5PO 3KLMX 1P0CA 4N54A 1DLJA 1RWBA 3IIEA 5EL0A 2CD9A 5THQA 3Q1LA 2Q1TA 3VZRA 3WYCA 1ISJA 1UDAA 1ZEJA 3N58A 4MVJP 4B4OA 3NDRA 3GHHA 3OF2A 2VUUA 4IDAA 5AYVA 4CMKA 3D64A 4GX5A 3DO5A 4PLFA 4RPHA 4YAEA 2VWGA 3PPIA 4R3NA 3QSGA 1E3EA 2ZYDA 3KBOA 4B4VA 4FFNA 2QQ5A 4OO3A 2PFGA 4CV3A 3JQAD 4L75A 2FHSA 1B3BA 2X6TA 3U09A 1ZMTA 4PG5A 1ZKMA 4TMFA 4IPTA 3P5SA 2C54A 3S2IA 3JQBA 4L4XA 4ZN6A 1B7GO 4E21A 1E7SA 4BHTA 5KVVA 2A9FA 1HE2A 2GN4A 1YO6A 3KTDA 4OQZA 4BIIA 1O8CA 2EJVA 3STHA 1NHGA 2PA3A 1FDWA 3Q6IA 4W9NC 3DZJA 4M86A 2JD2A 3K5PA 4PZDA 4W9NA 3C3XA 3GVHA 2VNAA 2OXIA 3DOCA 2CSUA 4M87A 1ONNA 2J5RA 3EVTA 1Y1PA 3WNQA 1AN9A 1CDOA 1IHXA 2QG4A 4J16A 4D43A 3G79A 1DSSG 1X14A 3AM5A 3L4BA 3OH8A 2NU8A 2J5KA 4N5LA 2CY0A 1VL6A 3PDUA 1ZXLA 3GZ4A 3VDRA 3LZ6A 2WWRA 3PIDA 4WNCA 4CUKA 4CR7A 5B12A 2OP0A 5JDIA 2JCYA 3VKVA 1XCBA 1MFPA 1VL8A 3C7CB 4MIEA 3IAHA 3PHGA 2YHUA 2RBEA 3PJEA 4EJ0A 1PL7A 3PEFA 1PGJA 2CMDA 2NVUB 4B8ZA 2EKPA 4EITA 2DBRA 4DPKA 3U4IA 2WEKA 4KOAA 3BXXA 1JWBB 4GQAA 4XB2A 3PLNA 3LLVA 3HE3A 4ALMA 5L7YA 2HJRA 2I6TA 1U28A 1P44A 5EESA 4JBGA 3PGXA 4HUJA 5CAEA 5COAA 4J4HA 5JYDA 4NBUA 2DPHA 5G0VA 1EZ4A 3LC2O 3F1KA 2EEZA 1B8UA 1R66A 1P74A 3GLQA 1I10A 4WECA 4PG8A 5I7EA 4WJZA 2V6FA 1F14A 4AJJA 1ULUA 1R6DA 1WZEA 5CEFA 2V65A 1ZBQA 1ZFNA 2GLXA 1XYGA 3E9NA 4ZICA 2IDZA 3SVTA 3TFOA 1JKIA 4XR4A 4DQUA 4KZPA 1PL8A 1X13A 5JBIA 2FZEA 3H4VA 3OECA 4B7UA 5DZSA 1P77A 2FPIA 5A06A 2VYVD 1W0CA 3WWZA 3HSKA 4URFA 4BO8A 1UP6A 3GZNA 4J1QA 2QHXA 4D46A 1LUAA 1D8AA 2XXJA 2R00A 4FDAA 4YJDA 3VTFA 1QR6A 3ETDA 5JAQA 3DWFA 1DRVA 5C7LO 1YOVB 3SJ7A 2Z95A 3I9LA 3WS7A 3DOJA 4XQGA 3RUFA 4EUFA 4DMLA 2O3SA 4XQEA 5DCYA 1A9YA 1C0PA 8ADHA 5ES3A 1GUZA 3KEQA 4YACA 4YYZA 3HDYA 1H2HA 3I52A 1PWXA 2IRWA 3W4KA 4CM3A 5A9RA 4CM8A 4PLVA 2I76A 4W7IA 3ZGYA 5CDSA 1DIHA 1LLDA 2A92A 2C20A 4BNYA 4BS9A 1CYDA 2X86A 4AFNA 2Q99A 1M67A 4J49A 4JP2A 5TT0A 5JSFA 1HDGO 4DC1A 2P4QA 4K1LA 3RJ9A 1BWSA 1KETA 2I9PA 2HAEA 3FBTA 3D3WA 5DOVA 1E1NA 3GVXA 4MVJF 4LVUA 1R4NA 4BQPA 3GNQA 4R9SA 3ZU5A 4RVFA 4RF5A 5B4UA 4ESOA 2NLOA 3OP4A 1E5QA 4FGWA 1HXHA 1TB4A 1NPDA 3H7AA 4CL8A 4UVHA 3IS3A 4E30A 3C1OA 5IXYA 5JMPA 3AY6A 3PVZA 1ZXBA 2BGMA 2UUOA 3ITKA 1QV6A 1E3JA 4B7CA 3CUKA 1DLIA 5KVSA 5BSGA 3ASVA 4OOEA 5DBGA 3RUAA 1VE9A 1E92A 3SLGA 4OSPA 1UH5A 2ZKLA 3U62A 1JW9B 2VZ0A 1YQXA 2YQ4A 4ONEA 3WQRA 4DLAA 4IJKA 3ROPA 1A9ZA 4CM5A 3WLFA 1PJTA 5G0UA 1QKIA 2XAAA 1IHYA 3DDNA 3PYMA 4PLHA 1N1GA 9LDTA 3P19A 4EI2A 2I66A 3QVSA 1LLCA 2G76A 3UOGA 1BXGA 3AUUA 2FWMX 1UDCA 2VNSA 4PVCA 4E5PA 1QLHA 3QP9A 1HDXA 4U8GA 3AY7A 3AI2A 2C07A 4RVHA 4YEDA 3JYPA 4P8RA 3DZKA 4OQYA 2LDBA 5A02A 1VKNA 4CUJA 3AI3A 1T26A 5ILOA 5FI5A 2AMFA 3AUTA 1HTBA 4RPKA 5ENVA 1XSEA 3WIDA 1T1SA 2Y1EA 1PS0A 1QYXA 2EF1A 4NFYA 1A27A 6ADHA 4QX6A 4E33A 2OGUA 2HU2A 2O3RA 1EQ2A 3GN2A 4LMRA 3C24A 1IULA 1N9GB 2Q49A 3QWIA 1PR3A 1HE3A 1ZJZA 2FY8A 3NJ8A 1E1MA 1V3VA 3GDOA 3RROA 4TSKA 2Y99A 3E5RA 2HMVA 5C37A 3LT2A 2DBQA 5FI3A 1U3VA 2P9EA 4L74A 1KC3A 1PJSA 4A5OA 2Q2VA 5ICSA 1MUUA 1LBEA 1E3SA 4CQLB 5BNTA 2PGDA 1BXGB 2WMDA 2YV3A 4G81A 3DXFA 4PLZA 3OJEA 3NV9A 5L7TA 1AUPA 2W90A 3ROMA 3ZWYA 3QVOA 1YH3A 4NG5A 1GADO 2C5EA 4OM8A 3D3EA 4P22A 4EBFA 1N8KA 1DHRA 4TROA 3WWYA 4WCFA 5IXSA 4NMHA 1V9LA 3MTGA 3GDGA 5TX7A 3VPSA 3BMQB 3FTNA 4YAGA 3JYQA 4AL4A 1VJ0A 4IQGA 3W6UA 2TMDA 3FR7A 4NJOA 4TRMA 1WXDA 4PRKA 2FR0A 2O50A 2VOEA 1LRLA 2UYYA 3DZBA 3HWRA 3NT2A 2JJYA 3WBFA 3ZWMA 3WGOA 3LF1A 3FD8A 3VPFA 4NNJA 2YW9A 1U8FO 1GZ4A 1UZMA 3GRKA 2Q1WA 2Q46A 5G2OA 3OEWA 2J3IA 1I2BA 4PLPA 3KVOA 4DC0A 5FFFA 3NKLA 5JY1A 1IE3A 3H65A 1R37A 1XU7A 4UREA 4E13A 2EWMA 1RPNA 2BLLA 1EBFA 4CLHA 5JCJD 4J1TA 5JLAA 1B14A 4B8WA 2J6IA 4E4YA 3WFIA 3JV7A 3RUDA 3WICA 4A27A 1MG0A 4FB5A 2V7PA 1R0SA 1NPYA 3RC9A 4E12A 3L4BC 5DDIP 3AJRA 5TSDA 5IDWA 3MOGA 4QXMA 3DAFA 2EIHA 1WZIA 3L4SO 1U2DA 3LC1O 3G49A 3CZRA 1C1XA 1IPFA 3U3XA 3A14A 1H93A 2CNBA 2BKAA 1UXKA 3B6ZA 3LT0A 4FIZA 2HDHA 2A4KA 1A71A 2AG5A 3A9WA 3ZU3A 3FSRA 4LRTB 4AJLA 4LN1A 5HBRA 1G0OA 4FBGA 4RVGA 3UUWA 1YS4A 1AHIA 4G5HA 3SC4A 3KV3O 4BNJA 4RVDA 5KKCA 2HK9A 4XJTA 2HMSA 5DP1A 1MA0A 3TZHA 3VVBA 1Q7BA 1I3KA 3ZWAA 4BB5A 2Y66A 2DBZA 4OMUA 3WIEA 4DQVA 1JKFA 2Z1NA 3NTRA 3PP8A 3T7CA 3WLEA 1KC1A 4ND4A 3H3JA 3MJSA 2NQ8A 3TL3A 3BIOA 4CMEC 3AY3A 4JK3A 1PZEA 3NDIA 4RPJA 3LQFA 4BNFA 2DTDA 3ITDA 4F45A 3PQEA 3BTSA 3TWOA 3L6EA 4F3YA 2JFGA 5IFLA 3TZQA 3B1JA 5F1OA 4MVJG 3U9LA 1KERA 5CPFA 2QYSA 3Q9UA 3GA0A 1Z82A 3I83A 2IZ0A 1VJ1A 1M6HA 4LK3A 1T25A 1WNTA 2VRBA 3FI9A 3NX4A 4BUCA 5KTKA 4GKVA 4ND2A 3B70A 2IODA 1E7RA 2E82A 1DIAA 1QYDA 3K2EA 2YQ5A 4WPGA 4XB1A 1H2BA 1DDOA 1O6ZA 1I2ZA 4Z9YA 4ILKA 4D7AA 4NFSA 1MXHA 4RCVA 4YQZA 4L4SA 5KJEA 1UDBA 2SCUA 4XQCA 1UAGA 4GVXA 3UN1A 3ZWXA 1WMBA 4J3FA 4M1QA 2D1YA 2JAPA 1JU9A 1NP3A 1SMKA 1V3TA 1RM5A 3GF4A 4KTVE 3F5QA 1IZ9A 3COSA 1P31A 2PR2A 4RQUA 2AA3A 4ND5A 4W82A 1JKJA 3IL2A 4GL4A 2VCYA 5CEJA 1T1RA 4AJ1A 5A9SB 4PLYA 1LDBA 4LVCA 2D2IA 2RHCA 3WNVA 4GPD1 3CH6A 4LISA 3UCFA 1FF9A 4G2NA 3INRA 5G0TA 4PG6A 3T4EA 1Y8QB 1R4MB 1ZO8A 1GQQA 2PZLA 1HKUA 2Q3EA 2F1KA 3EW7A 1B8PA 3FBGA 3OQ6A 1I24A 4WOKA 1NVMB 4C7JA 2OFPA 1DHTA 3NJ4A 5TC4A 1HLDA 3IDSA 4XRGA 2BGKA 4TQGA 4LW8A 3DBRB 2JHGA 3U4DA 5MDHA 4J2HA 1KIFA 1P1IA 2VHXA 2EP7A 4HNGA 2OBYA 2I3GA 4LCJA 4UUNA 2Y0DA 1GY8A 3WMXA 2H63A 4EZBA 1J4AA 3VPHA 3UGKA 4DTIA 4LCEA 3QVXA 4KWIA 4AJEA 3VH3A 2NTNA 3JD0A 5H81A 2GRAA 5AQ1A 2I99A 4FC7A 5CDUA 4RO0A 1I2CA 2W2KA 1TLTA 3UVEA 4CQMB 1E1KA 1E0DA 1MC4A 1N7HA 4DIFA 1HSOA 3KZVA 2VWQA 5GZ6A 1C0LA 4YJHA 4CM6A 1LJ8A 3JQAA 3HB4X 4J7UA 4YBZA 4N5MA 1UJMA 1K89A 2J8ZA 4MPDA 1B0AA 3NYWA 2G17A 4EGFA 5IDXA 4B7XA 2GZ2A 3I23A 3R6DA 3WFJA 2OHXA 1WDLA 3KSZO 2FSSA 1ADBA 2HLPA 3LU1A 2AE1A 3BA1A 2B0JA 2PKRA 1XEAA 1NVGA 3WGQA 2YUTA 3W6ZA 3CKYA 2FSVA 4GGOA 1TT5B 5EQFA 1ZSNA 2Q1UA 3EYWA 1WDMA 4FJ1A 1G0NA 3E1KA 3AU9A 5I7SA 2X0RA 1H9BA 3IOYA 3CZMA 4QEDA 2PKQP 4OXKA 3PFFA 3ABIA 3SLKA 3KYBA 1TT5A 3C7DB 4GVLA 2CVOA 4FGSA 4R5HA 4CLDA 2EG9A 5EPOA 3GMSA 5L53A 1H5QA 3DAPA 5L4LA 3DEYX 5HM8A 4J7XA 2PV7A 3FRJA 4FFMA 3R0IA 1LI4A 4IIUA 5GMOA 4IJVA 4I5EA 3WTBA 4U6QA 4BKOA 2DC1A 4NDNE 2AQHA 2W2LA 3DHNA 3EGOA 3ONEA 4ND3A 1A4UA 4LGVA 3GPIA 4GWKA 3ZW9A 3K8ZA 1C14A 1PTJA 2HK8A 1U7TA 4A03A 3VH2A 3U0BA 2VYND 4W99A 3Q2IA 5LCXA 1CRWG 3PZRA 3Q2KA 3G1TA 1H9AA 1B3RA 2GF2A 4CLRB 3TSCA 3WX0A 2Q2WA 3QRWA 3RUEA 1YB5A 3UHAA 1JDJA 3DBHA 5C3MA 1SB8A 4INAA 2PLAA 1ONPA 2ZCVA 5G4LA 3WGIA 4R54A 3U4HA 1N9GA 4CLOA 3JD1A 5EMHA 4FOSA 5K9ZA 5H83A 3UICA 4CQMA 1X15A 3ZV3A 3FNEA 2VUTA 4DPMA 1PGNA 2J5QA 4J0EA 2DFDA 4WLUA 2GR9A 3KM0A 1T4DA 4NPCA 5B4VA 1DRWA 2FRDA 4FFOA 5F21A 1YJ8A 4M54A 3NT4A 1M6WA 4ZHSA 4PFJA 3WGGA 5CEEA 4Q39A 3JSAA 1LDGA 4PGFA 2FN7A 4FFLA 2Q4EA 1E7YA 5FWNA 1T2EA 3ANMA 4YRBA 2YDXA 3C1AA 3GPDG 3QWAA 1YB4A 3ZWNA 4ZD6A 1F12A 2CF6A 3L9WA 4R1NA 2OBNA 3HN2A 2NTJA 4FFRA 4D3DA 1FJHA 2GZ3A 4XZ3A 3PHIA 3AUAA 3GGPA 2VWHA 1I8TA 1ULSA 1O95A 4N5NA 4OH1A 4CLOB 1O0SA 2C2YA 1Y81A 4BNHA 2EERA 1KY5A 1VSVA 3JD3A 1NR1A 4Q3CA 5A3JA 4D3FA 1YONA 5T64A 1X0XA 5IJZA 4DXHA 2JKVA 4HV4A 2FPPA 1IUKA 1NYTA 3KLPX 1I01A 4PZEA 1BRMA 3NT5A 1OOEA 1PQPA 3H2SA 3HHPA 2GGSA 1N5DA 3VC7A 1JAXA 1PS8A 3I6QA 3DAGA 4K26A 4D0SA 4O5OA 3ETEA 4B4UA 4IDGA 1KEPA 1T2DA 3B1FA 1O9BA 4RDIA 4AJNA 3H5AA 3FNHA 4O6VA 4UULA 2ZJ0A 2X22A 1HYHA 4IINA 5BT9A 4BO1A 5I7FA 3GOHA 3C1TA 5EINA 5BNFA 5COQA 3EAGA 4YT5A 3ZW8A 1UXIA 4TRJA 4J9UE 5JAIA 3F6YA 1OFGA 1WVGA 2J3JA 4PLWA 4D0RA 1NM5A 3DC2A 1SB9A 1X0VA 2V6MA 3ZNNA 1GV1A 4BOYA 1YQDA 3NTQA 1JVSA 1LDMA 2CDAA 5ER6A 4ZJUA 3GAZA 4IZHA 1NNUA 1CWUA 4UUMA 4OL9A 1HDYA 4CUZA 1DIGA 1VLLA 2BFPA 1E3IA 1I36A 1BW9B 4WEOA 5ITVA 2BF7A 3EMKA 2AE2A 2FPGA 3GK3A 3IUSA 1XQ6A 4UUPA 2GN6A 1NR7A 1WP4A 1Y8RA 5I7VA 1FXSA 1ISHA 3D5QA 1C1DA 1PS9A 1U4OA 5KCZA 2X23A 3WG9A 4I5DA 2C82A 3LVFO 2ZTMA 2OO5A 1XDWA 4OXYA 2GPTA 4NZ9A 4F46A 1MV8A 1H94A 1EBUA 3EHEA 2YZ7A 3QV1A 1L7EA 3GG9A 3WQQA 5JPIA 1B26A 4HY3A 4I5FA 2PH3A 1KVUA 2YY7A 3OFSA 4JBHA 4BO0A 5U9CA 3NUGA 1ZK2A 1TVEA 5JFOA 4PLTA 3CXRA 1R15A 3RC1A 2Y1CA 5TQVA 3ZHBA 4GMGA 5AXDA 4ZGWA 1YWGO 4P4NA 4O59O 2VOJA 1ZK1A 2ZCUA 3P2OA 4KUHA 2XPCA 5I9MA 4PN3A 2HMWA 5ER9A 3BMNA 4J2OA 3AI1A 3A28A 2D3TA 5L51A 2Q45A 2G1UA 1JA9A 1AHHA 5FF9A 1SAYA 3DTYA 4OYRA 1IOLA 4WLOA 1ZJYA 2HRBA 3R3JA 2WJPA 2YHIB 1EE2A 2NADA 4RVSA 1E3WA 3GGOA 4AICA 3TQHA 4Y98A 1ADCA 1H0KA 3H5RA 4J7CA 3RKUA 1BDBA 3H9EO 4XGIA 4R16A 3DMTA 2ZB4A 4Y6SA 4K6CA 1Z73A 4ZVVA 2NU6A 3IQDB 5A3VA 3D5TA 4FD3A 3JQ9A 5JO9A 3MEQA 1J0XO 1M76A 4BGVA 3ZWVA 2QIOA 1FK8A 2ZK7A 1Q2XA 3DZHA 4J4TA 5DP2A 4FW8A 1KEWA 4MKXA 2RCYA 4E3ZA 1NASA 4NU5A 5T6BA 3DBRA 4YT8A 5L7WA 1R16A 4RDHA 2PK3A 3L6OO 3VKUA 4A7PA 4WCFC 2Y1OA 3B20A 2EV9A 4L8VA 3OQ1A 4J4BA 2XF8A 3EDMA 1A72A 4BB6A 3HNPA 3KYCB 4UEJA 3ON5A 1QYWA 1J49A 1R4NB 4U0KA 4TVBA 4TRNA 1DC6A 2AEFA 3CMMA 3JTMA 3IP3A 3OMLA 3W4JA 3D1LA 4YQYA 4GGPA 2VN8A 3AOGA 1KEVA 3QY9A 4WEQA 4BV8A 2RHRA 4DYVA 3RUHA 3KOUA 2ZB3A 4MVJM 1GPDG 4HBGA 4GKBA 1WMAA 2BMAA 4KDFA 2VYNA 1E1LA 1KEUA 3G1UA 2Y67A 1LC3A 1EK6A 2JAHA 4WOJA 4YAKA 5JAMA 5KJ1A 3FN4A 2ZTVA 4TKLA 1PR9A 3AM3A 4E0BA 4RF2A 1PJBA 2P2SA 1H6DA 3F47A 3UFXA 4CLEA 1E7MA 4HKTA 2ZQZA 3NGXA 3JYLA 3OJFA 4XR9A 3HDHA 3SX2A 4Q3NA 4MVJE 5G0WA 5U1PA 4IGFA 4J91A 4CM4B 1NHWA 1HL3A 1HDOA 1R0KA 2ET6A 3VVCA 5K6AA 1DB3A 1BSVA 2E48A 4Z9FA 2IYPA 1QP8A 3GEMA 4D44A 4MKRA 5JDIC 5KNLA 2E4AA 3FR8A 1NBOA 2WD7B 1YL7A 3ZHXA 4QT0A 2HMTA 1P1HA 5KVQA
chains in the Genus database with same CATH superfamily
1PK7A 5FBKA 4DSNA 4DOMA 2I1QA 1URPA 3W3AD 2IPXA 4BJ5A 5C5CA 5ICCA 1RBQA 4D5GA 5K01A 5FYDA 5BURA 1LV7A 4D92A 5ILGA 1U99A 3FMGA 1QCZA 5GADl 4JYAB 1EB9A 2GUGA 3FOWA 3IQHX 4I8XA 2I2XB 2VRCA 1NVWQ 4TV9F 5FQOA 2ECQA 2Q62A 4UKDA 5ALHA 1YHYA 3R6WA 3ETJA 3UH1A 3AL2A 3PQFA 1LJUA 4AU1A 1KWGA 2K2QB 4H1UA 3W5UA 2ANBA 5EZYB 4BE9A 2ZIXA 1FDUA 1KO1A 1RAEA 2ZYAA 4E5VA 3H1BA 4JD5A 4NENA 4FHZA 4IZOA 4RJTA 3IPRA 5G1PA 1IEQA 1BDIA 1BYUA 3M6WA 3HJFA 3GRFA 1J8YF 1FOEB 2ZR0A 4GLLA 3TE6A 3DEHA 1P2GA 4NMMA 3ZCSA 3E8XA 5L6MB 4A8JC 2AR0A 3VKHA 4NABA 2FWAA 2C2GA 4I1YA 4GAEA 1P2TA 1L4LA 3A1TA 3GG2A 1KDZA 4YP1A 4FILA 1WDKA 4HLCA 1Z25A 5H8WA 1A2KC 1ZC4A 4DMFA 2ERYA 4LY0A 1IEXA 4LXHA 2CXOA 2DCMA 3ZCXA 1NP6A 4DAOA 3QY0A 3ZDRA 2EFEB 2HTFA 3C3YA 1J2UA 2W2TA 4OREX 1JXQA 4QU8A 4YP9A 2XQVA 2P68A 3BMNB 5KX5F 2H4ZA 2FP4B 3L8GA 4X90A 3A6HA 3SE0A 2VT2A 3BRWD 4R8RA 2E21A 4KQWA 4GFDA 2Y1FA 4CZ2A 3KETA 2WM3A 1RZVA 1CT9A 2XWQA 3O03A 4LRSB 4BFVA 4BAGA 3T3MB 1IY8A 2PMCA 3DZGA 3KHSA 3ZQ4A 3TGLA 2DKOA 4Q03A 3T3HA 5ICEA 4UBJA 3C74A 3BSWA 3TQCA 3UYLA 1L5FA 1ZAYA 1M75A 1AKYA 2BCEA 3T54A 3U13A 2DVMA 1UMCB 1V6SA 3QE3A 3QVUA 3ZU4A 4EPXA 4RBNA 4XFKA 1SC4A 3CKKA 5DN6D 1SQGA 1ECJA 1F48A 1UXJA 4DLBA 3H5OA 1O94D 4GDMA 2VH2A 3F96A 3FZGA 4KDEA 4P08A 5JNWA 4TMWA 2A0WA 2VP5A 5A9TA 2PMEA 3B2EA 5A4DA 3GY0A 2ZB2A 1PW5A 3GROA 4YLGA 4AVYA 3FNBA 1YL6A 3RFVA 3G1WA 5IWAB 3LPAA 2GCPA 4JC8A 1YRLA 5F2NA 3KEMA 1E2BA 4ZWNA 5G4KB 3G0GA 1U7UA 4H60A 3D6HA 2IW3A 4ALKA 2YWJA 1ZK3A 3W8DA 1XMXA 3MRVA 4OHVA 3HB5X 2VL7A 2FQYA 2XX3A 1BJRE 3BWDD 3IAM6 1SN7A 3DAOA 4L6AA 3BPSA 3OKAA 4L9RA 4B87A 4OV6B 4C2BA 3S0JA 1FA9A 2PCJA 3DCJA 4KYVA 3NVDA 2COUA 5CA1A 2H4HA 4LJ8A 1F3OA 2QTBA 4MVJA 4RNDB 4BO9A 1HFKA 3SKXA 5CFNA 3PFNA 1II8B 4ZARA 4KO2S 3H4TA 1XLTA 4BWVA 1JN0A 1FB5A 3T3EA 3ZPXA 2C7PA 1GCUA 1TXGA 1B15A 1LPMA 1H66A 4IYJA 3RVDA 4OKNA 1W25A 5AJYA 3TO5A 1Q11A 1IBSA 1SU6A 1GNQA 1T9GR 1VPDA 4DLWA 1H6BA 3I73A 3Q0IA 1X1TA 1DCKA 1K6XA 2C8JA 2O57A 2XRMA 3COVA 4ZYLA 5L4SA 3T1YB 3D6UA 3RUIA 2HA6A 5AVYA 1AXRA 5LZ9A 1P3Y1 4MINA 1SBYA 3BL6A 2H07A 1TTQB 5L3VA 3IRVA 2CDRA 2JGAA 1CIVA 1QKJA 2IE8A 4ZAWA 2OOKA 2QSUA 1NRJB 2WIKA 1Z28A 3H5NA 3ORRA 3RS0A 3TNDA 1AZSC 2VQ3A 5LB4A 4FFVA 3ZX4A 3O3CA 4Z2YA 3L04A 2ZJOA 2FUEA 4UCFA 2IOYA 4N6OA 1LF5A 3J7TA 5DYYA 1Z8FA 3K6JA 1QHIA 5EY5B 3UJDA 4FUTA 3HLTA 3PENA 3H2ZA 3ODPA 4DA0A 5JNSA 5EHGA 4MKZA 1BA2A 1QGUB 2PD4A 5AVVA 1L5OA 1PWZA 2I6GA 2JBWA 1X7YA 1BFKA 3FXAA 3ITNA 4GWGA 2BOVA 4M55A 1A5ZA 3L7YA 2CMKA 4JYCA 3X1DA 4DNPA 1I13A 4P84A 1IN8A 1UK9A 5FWXA 5M2QA 3U3MA 5H3LA 5K3BA 6Q21A 1COWA 1RMTA 3HGMA 2X5KO 4D8TA 1JAIA 1UIRA 1VIAA 3JZFA 1Z0IA 3LUGA 4LJAA 2O3QA 1N33B 5KU1A 2H2IA 1E2QA 4FOOA 5CCEA 2M1XA 1ISSA 4NBTA 1EFHA 2HX1A 2JLWA 4RA6B 1CUCA 1JEDA 2AMJA 2X1VA 1QX3A 2ILVA 1CY8A 4HATA 4ND1A 2ZZMA 1P33A 1KZGB 4AG5A 4QGSA 3I4FA 4KN9S 2CJWB 5KJFA 2DR0A 3OHSX 3H5VA 3VZQA 2ZREA 3U7QA 1W9MA 3DTVB 3ZOZA 4N9QA 5BN4A 1Q57A 4DV7B 1CQXA 1YQEA 2YN4A 3SQXA 4GMFA 1GAXA 3DT6A 1LNSA 2G7ZA 4L76A 3VYVA 3CX3A 5DF1A 3ZIDA 3VFDA 3PC7A 4GI7A 3OOEA 2EG5A 3DP9A 3R6LA 3LT4A 3PQ6A 3PFGA 1GAWA 1YFKA 3LV8A 4HNAB 4L3OA 4LFAB 2B4TO 4P4UA 4QM7A 1HF3A 1ISIA 5A04A 1OR8A 1YJBA 1NXQA 2Y68A 2ZGVA 4JIGA 4X95A 4IXWA 4ZI7F 1CFJA 1TUEA 1U2GA 4CQNA 5BUCA 3DLBA 3JARB 5FR2A 4JGBA 1LK7A 1MG5A 1H5UA 3QU9A 3WGLA 5C7OO 1EGAA 2PS1A 3B5EA 4GHWA 2ZRAA 3R5HA 5IH7A 2CDBA 4HEA6 1C7IA 3OEYA 3SJBA 2CLHB 2WT4A 1GTSA 2BGNA 2AR7A 4PXYA 4CIDA 1NU8A 4RZ2A 3HO1A 5ENDA 3BE8A 2QSJA 1N5OX 1M2EA 1ENPA 3HQ4O 4ESEA 3CNHA 1KRXA 2JCXA 2XMDA 1BC5A 3Q7TA 4AUNA 3GU3A 1B2RA 4DBZA 1LU9A 3GT0A 3HMQA 3QF7A 2VUHB 3KKPA 1Y3DE 2FP3A 2MHCA 3NEYA 4XSHA 3CVYA 4NCKA 4OX9Y 2IQ5A 2NUAA 3W4IA 1HZJA 1PJ2A 1T3GA 5F3RA 1UBNA 2C2KA 5D3KA 1Z0UA 3NQ41 1O9GA 3KKKA 2Q7DA 3THOA 2YV2A 3WRXC 3IMFA 3S1LA 2B36A 2OHFA 4C0HA 1A8QA 3TN7A 4ID9A 4ZP1A 1TYEB 4KVGA 4LYGA 1NAIA 1UEIA 3MJTA 3PWZA 1NY5A 4OMCA 3RWOA 3SDSA 2C92A 5J2TF 2XCTB 4U7PB 1ZRSA 2ID8A 4LJKA 3HXTA 5K4GA 4TZ6A 4L5IA 4M8SA 2PG3A 4KGXA 1FEZA 2HPAA 5IHXA 5H16A 2I6XA 2PO5A 2FEPA 4D96A 1DUIA 1O97D 1TCBA 2QMEA 2Z9CA 4KRFA 5AKGA 4GR9A 5ESDA 1XL1A 4O4IB 5BN3B 2AZXA 4QVIA 2ZIZA 4J1SA 4MZDA 2ZITA 4HB4A 4I55B 5A6VA 5BV0A 1WUJS 1K7XB 1EK1A 5DBHX 2DWPA 3UANA 2YV4A 2GJ8A 5BQXA 3FTPA 2QV7A 3HKBB 4JYMA 4UEOA 1PR5A 3WHIA 1GVNB 3OX2A 4BMVA 2HFKA 3R2JA 5AVZA 1XJ5A 2YVQA 3EEBA 3K8YA 2QW8A 2R47A 1T4CA 3QW2A 5KOHB 2XUZA 4G4SO 1N6LA 4AC9A 2AG6A 3S4YA 2VEDA 3O1IC 4N47A 5ALUA 3TOXA 1YCFA 3SF8A 3MUNA 1EQUA 2QQ0A 1NRXA 3HEBA 3CSDA 1C80A 5H70A 1EVQA 3PFKA 4H3VA 4ZVQA 3Q11A 3RVPA 9GPBA 1Y6GA 5FOWA 1YE8A 1LLUA 1X77A 5LQCA 2EATA 3ICPA 3ZWCA 1TZCA 4HDKB 4KQ1A 4BP3A 4CKYA 1S9DA 4IH4A 4DG9A 3HGQA 4FCCA 3W6NA 3CSUA 4CMHA 3P0EA 1DOHA 1XZEA 3CUEF 3GQVA 4DR6B 1PVOA 1W59A 4MV9A 2MOKA 4L0MA 5IBCA 4BZXA 1HDRA 2W7TA 3C8MA 1WMFA 1DXYA 2JFPA 3PFIA 3ZCRA 3O3MB 5KNCH 5KVAA 5LOVF 4U8HA 5F9MA 3N2GB 7MHTA 2NVBA 2OD7A 2WUVA 4XCVA 4EJ6A 1M7HA 1VIYA 4FGZA 3NONA 4AF6A 3R44A 5KWSA 3E8SA 1EEHA 3C45A 3G3EA 2GTIA 2NWQA 2C7BA 4ILEA 3KWLA 4JL5A 2V1XA 2FMIA 5EE3A 2W5UA 4HDAA 3TW8B 5FNVA 3X2EA 1DPGA 3UT6A 3T1OA 5DM60 2OORC 4WK2B 2FZWA 3K2IA 2F3TA 1KJZA 1GLVA 3LPDA 4KWEA 3UHJA 2HL6A 1TC1A 4DVJA 2FW7A 3VV3A 1WETA 1QGZA 2ZUSA 3GMTA 3TZLA 4KMSA 3W8RA 2EQAA 4Y9DA 3ANNA 3CNOA 1KXZA 3EY4A 1FDTA 5CRIA 4TKMA 1K2VN 2GA8A 5AMXA 1LRJA 1VB3A 4M9ZA 4P35A 4RGBA 2ZS8A 5EHQA 5BOSB 3ZV5A 4C43A 1S1CA 5FWXB 3UJAA 2XCSB 3LK7A 1JJIA 4JP3A 4IHQA 4G8CA 4MOWA 5JCOA 4YCLA 5KDOA 1PG0A 3HUFA 1UZNA 4ZOAA 4ZRMA 3P26A 2VAMA 4QNRA 5A62A 3X1ZA 3V48A 2IPOA 1T9BA 2C57A 1PT7A 1QG2A 1B8VA 1U6JA 3I28A 5T6MA 2OC9A 5SZHB 1GUDA 5JC8A 5JS7A 2OR3A 3FWKA 1E2PA 1QNFA 3KQSA 3LLMA 5B7NA 3PGLA 5F1KA 3AUKA 1J7JA 1N5JA 1ODCA 1HSZA 2BE9A 4CJXA 1K7CA 1XXHB 2WB2A 1RFLA 4I1UA 5FA6A 2R62A 1RPTA 3ETGA 3JQ7A 3OEHA 5DNCA 1CF2O 1H4VB 1ONOA 3LW7A 4NPHA 3Q7EA 4YAOA 3WYBA 4R0MA 1DG1G 4JA2A 1DV1A 1Z5VA 5H02A 1NI4A 5B1SA 4DHWA 3P4UA 4DWOA 1NV8A 2I29A 3ONFA 5FBZA 2J08A 1EVIA 1SCDA 2QLBA 2BC9A 1TD9A 3PJDA 1J0CA 4IXDA 1L8QA 4PYRA 4XIFA 2IIPA 3AR2A 4BC1A 2RGAA 1ZMOA 3K0AA 1SXJA 4MS3A 3D0RA 5G1OA 4NI5A 2WDPA 4ZO9A 1MFZA 2IYXA 1GDHA 2J0UA 1VRVA 2PKQO 1HE4A 4CIWA 1JYEA 2GASA 1VRWA 4NFLA 4DLPA 1KBOA 3GGGA 5JNRA 2XUQA 3DDHA 4BMCA 1XDZA 2DLDA 4S2EA 2F3SA 3DT8A 4GPIB 3ZCTA 4C4OA 3D4PA 1C1HA 1SCJA 4IS2A 2A1TS 1F8UA 2PZ8A 2ZFUA 3GEEA 4UQLA 2GX6A 4JSYA 1JLLA 5B1DA 3WGKA 1WHSA 4J0CA 2B61A 5C0OE 1K0UA 3VJLA 1LS6A 3WI7A 4MPTA 1Q83A 4BNVA 2ZVQX 4XYEA 5JR3A 3MQFA 4N7MA 4E32A 5EWJA 4CTMA 4OI0A 3HCCA 4V0ME 1ZL2A 3ENWA 1OC4A 5DYTA 4FGUA 1D8TA 5IUKC 4D8VA 3L0PA 3ZE1B 3DFUA 2NUAB 1J21A 1JRLA 4U7HA 2ZI4A 4KQIA 4HFRA 4CV0A 3UAGA 4U5QA 1TKAA 4M60A 4DYHA 4WV3A 5COBA 4KLAA 2D1RA 3HLYA 4OJQA 5GJCA 5HWSA 5JZSA 3GRZA 4EYOA 4A0QA 1RYNA 3QVLA 1GU0A 2LD4A 5HCIA 5HF9A 3HR4A 1IM2A 3OD1A 3K92A 1JZTA 4YRTA 2VPYA 4L27A 4OB8A 4QELA 4B6PA 5A1JA 4G9EA 4S1TA 4HR7A 2D62A 2PIDA 3B1YA 1HDCA 1GD1O 5EP1A 4YUVA 3PDCA 3NEAA 4Y9RA 4TMXA 3FZNA 1SXPA 3ID6C 1TYCA 3CZ5A 4G5XA 1Z2OX 3DLAA 1CUSA 3ISJA 4KWTA 4LKOA 5K5EA 4OATA 3DE5X 2Z4RA 4M49A 5H82A 4OGFA 4RIGA 3N53A 4JVMA 3MWDA 3PSHA 1BMFD 4KRXA 3PE3A 1U0SY 1WO8A 4O1HA 3T99A 1AV7A 4OX9B 1CS0B 2DTXA 1WL8A 2Y0EA 1MQAA 3QXXA 4QVKA 3D8RA 3ZI0A 2GB4A 4BQSA 4EKYA 1D4OA 2BY4A 4I46A 4M37A 4XJSA 2J30A 2OT3B 4BTLA 4ZYXA 3CF6R 3OTWA 3ZY4A 4RYDA 1M2GA 2NXCA 3QELB 1NN1A 4IDFA 3DOOA 4GBJA 1AC5A 3RF7A 3X0DA 2WWVD 2RGEA 1IM5A 1IXKA 2H2HA 2IOHA 5HIKA 3TDMA 4EFMA 5A1TA 5KOJB 4LWOA 4C6SA 2PL3A 1XMJA 1XELA 1E4YA 3AF0A 1YDEA 4ARVA 3WK7A 1TGVA 3NHMA 2DFVA 3RFTA 4BO7A 5CVUA 4LDRA 4K87A 5AI4A 3C16C 2ZWAA 3N5CA 3N6VA 1J1IA 1MRZA 1ODIA 2OV1A 3IBCA 2E4UA 3D2LA 2XKJE 4B82A 2IYFA 4MK4A 3NHJA 4JROA 1QIDA 1J9ZA 1RCTE 5FPSA 3UWPA 1PLLA 4OK6A 4BX2A 1MD9A 2ZXUA 5KHLB 1WE2A 3RAFC 3LDHA 2WYVA 4DMMA 3DLTA 1L7QA 4KKVA 2IYTA 3VSAA 3ESQA 3PR1A 3BK7A 2ZBVA 1BS9A 4F3NA 3K9NA 4FSXA 1LGYA 1QHHA 1EEXB 2BW0A 2YBEA 5AKXA 2F43B 4XB6B 4TXNA 1D4FA 4A92A 4UUQA 1C81A 2JIMA 2XGSA 4DA7A 4WK0B 5AP9A 2O0JA 4F6RA 5EQDA 1GAJA 5JECA 3TW0A 1H3EA 1JIKA 5K8IA 1TM5E 4HDQB 2GZ1A 1TZBA 5D7NA 4MQMA 3RSCA 1JLMA 3RYTC 4EGCB 3I9MA 1Z68A 3NG1A 1Z2CA 1U2GC 3LDUA 1KAHA 1Q0HA 5BSFA 4G0NA 2LTAA 5A2QA 1S2OA 2HJ9A 2WJJA 3BYZA 4E0BA 3AY0A 4I0WB 3KQLA 1BE8A 1OUMA 1T5DX 3T6KA 2DM6A 2OZLA 4JQCA 1Z45A 2Y4OA 1NN0A 3GLKA 5CX1B 4F1WA 1U8CB 5HQTA 4BB0A 1S3GA 2O0KA 4L4RA 1DXOA 4CKCB 3EXHA 4HXEB 2NP7A 1AKMA 3SFTA 3B3GA 3WDLA 3TFQA 3FGNA 2G88A 1QLWA 1AK1A 5G0SA 5EWJB 4YDRA 1WCV1 3GUYA 3CZ9A 4GF5A 5BSHA 5TDHA 1DJLA 3QNMA 3A7DA 5EUQB 1GILA 4URXR 2W4QA 3V1TC 4OBEA 4TMVA 3T3OA 1WLYA 2FUCA 3RASA 3S2EA 3WIBA 1D2AA 4M8IA 4PV7A 1M2VA 4G65A 4NZPA 4L7VA 4MIYA 3WR5A 1T29A 3QLEA 2HYDA 3QLUC 4BNZA 1GU7A 2VSOA 3QA9A 4Q37A 4TWRA 1D6MA 1R6UA 7ABPA 4HGPA 5DEIA 5JU6A 1MABB 1FRFS 3ICQB 3Q0EA 3H9JA 4G1EB 3AXTA 2GKSA 3AEUB 2BMFA 3PE4A 1VSBA 1EVYA 5MFZA 1CUVA 2D2FA 3L1VA 3ZNOA 1X7GA 2ZI7A 4NDZA 3ZWBA 4CU5A 3B5IA 2QX4A 4Z0HO 1EVZA 2WFLB 4G0VA 3V4SA 3EUAA 4BQQA 2VDPB 3LHFA 4OXRA 6NULA 5LD2B 5KKAA 2YS6A 3MJ4A 1CS0A 1RS0A 2HCBA 4HNHA 5HCUA 1T43A 4YCNA 4KXUA 4PLCA 1C3VA 2WM2A 3WHPA 3KKQA 4WVLA 4B85A 2XKKA 4QPZA 3ZI4A 5CFLA 3G02A 2NZ8A 4KX5A 5H68A 1CRPA 1SIBE 4DBLC 4JKYA 3RRMA 5B3JA 1FMTA 1AB5A 4LSGA 4N48A 4RV9A 3BT7A 4CEJB 1OHHA 3KHTA 1M8JA 3P52A 3ZLTA 4AUKA 4BPRA 3KSUA 1BU8A 4JBXA 2ATEA 4JLWA 3E9QA 2Z8XA 4LZOA 1Y89A 3AOEA 4EG4A 3AR9A 3TD6A 4G86A 3HC7A 1P2DA 1FSFA 3BK1A 1XLTC 2JAXA 2HMYB 3HVJA 5J3JA 2NU7A 1W7AA 4UE3S 4XPIB 1C3OB 2VAWA 2KB0A 3PQDA 4QUKA 1E2FA 3ODGA 1GUFA 4DR3B 5P21A 1SULA 2YC4C 2IS2A 2W8ZA 4XX1A 4NJMB 3EW9A 5DSZA 1GTL1 2H3HA 3FJYA 4K6OA 3LCMA 4L28A 4R0VA 3NEJA 1JP7A 3AX6A 2WDZA 1OZAA 2XBMA 4YIHA 3UCXA 2ODNA 4DR1B 2EFHB 1VSTA 1NF3A 2WJAA 3VR0A 4OK5A 3S2FA 3OJ0A 2NXJA 1BVYF 4EF5A 4QUEA 2ONCA 2NU9B 1XXHE 3D3JA 2PKYX 1Y9DA 3BKXA 4TM7A 1VCOA 3TVTA 2P2ZA 3AERA 1U6KA 1PX0A 3R1IA 4J03A 3ND7A 2WKWA 4ER3A 2QT0A 4Y6RA 4UXJA 3UG6A 4HBZA 1S8FA 2H08A 2VCHA 3BH7A 3H9QA 2FWJA 2IYZA 3O9VA 3R3WA 5F2OA 3T12A 3GCWA 4DIDA 3F73A 1UKCA 1EWKA 1FNMA 1CSEE 3K7EA 3WDSA 4CLXA 5BYAA 5HS4A 5LN1A 3K09A 4ODIA 3SQLA 1BE6A 1LX7A 2IE0A 3ETLA 4M88A 1ZWLA 2CCKA 1LTKA 3FNGA 1U63A 1EP1B 2GQ0A 2WZQA 4L08A 3EFOA 4V0RA 5DIFA 5E4TA 3VBEA 3W2FA 5I4CA 3FOFC 5AJVB 3OTIA 4P4LA 3E9ZA 4R51A 4O4JA 1PNTA 4W5TA 1A9XA 3PDJA 1SZJG 4QBHA 3WXMA 2YJ4A 2FVYA 5AK6A 4XUCA 3KZOA 1RU3A 3C85A 2A1IA 5CB4F 5IVHA 3R9KA 4S12A 2OGZA 2VJDA 4NJEA 5JMTA 1HO3A 4K0RA 2UUBB 8ATCA 2HSWA 4A73A 5A4FS 3I62A 1E6UA 5IDQA 4AJKA 3GA5A 4LJRA 3JALB 4RCYA 4UQPA 2XUFA 4B2IA 2V0CA 1AUVA 3TRFA 4R4JA 1XFDA 2ASVA 2O8CA 3AU8A 4WA7A 4FZVA 2YJGA 5JQWA 2C0CA 1AGPA 1T4CB 1LEHA 1D4ZA 2WJWA 1W44A 2ONKA 3E48A 4C05A 3OJOA 4UHHA 3TPCA 1OMOA 2XUOA 3O47A 1DC5A 5A5GA 1NSFA 1OFUA 3O38A 3ZY5A 4E2YA 3OICA 2XD4A 4KR7A 1LDEA 2C9YA 3G0IA 2PS0A 1DRUA 2HU5A 4Q7KA 1OBCA 4J2TA 5IAJA 2R86A 1XCJA 4DNXA 2BFOA 1JH8A 2EL9A 3EY9A 2ZUBA 4LJ6A 1KY2A 3CR7A 3O9ZA 3K70C 4UOQA 2NQ2C 3QYPA 2X42A 2GVNA 4ZPJA 4G2TA 1CUJA 4BZPA 3GBVA 3VPGA 1E0JA 4WKPA 5DX0A 1YC2A 1FNCA 3GUVA 1XZLA 3C6XA 3ZW7A 1ENZA 1PWHA 3KB1A 2HIMA 3D0OA 2CCJA 4MAAA 3NLLA 4IO1A 3Q85A 4OCZA 5HX7A 3V2UA 5K8VA 4CPDA 3FVQA 5JYBA 3BH6A 5KYUB 1MA3A 4Q4HB 4KFUA 1QLJA 2QL6A 2GBLC 4LQCA 5AJHA 4WK6A 3U80A 2FMXA 5EGSA 4RK5A 4D0LB 2GYWA 2FP4A 1KOFA 3OQHA 4CGYA 1XLVA 1FYFA 3EGDB 3V1YA 1G3MA 2VG8A 4IKEA 2B5WA 2AK2A 3KQOA 4J1TC 3CONA 1FSZA 2EAUA 1Z4KA 2QTHA 4WASA 4D42A 4E22A 3WRXA 3A11A 1EJ0A 3ROTA 3A4TA 1ISFA 3OUTA 3IAAA 2IXBA 3PD1A 4ZEOA 1WUHS 5A6SA 3E5HA 4HHEA 1XAIA 2LPMA 1P1KA 3M1LA 4BYMA 3PWTA 2G40A 5ES4B 1AU9A 3HKBA 3CLTC 5EWMB 1J8QA 2RHTA 3WIOA 1DFHA 4LECA 1K75A 5CB4B 5C52B 1IZZA 3U60B 1NXSA 2DY0A 4HMPA 2VZEA 2RB5A 1NUAA 1OYVA 2ZTHA 3AB3A 3DBHB 4OJMX 3WE7A 3THXA 3PR3A 2PZMA 4Z1MD 3QJ5A 1VKOA 5EA2A 4HD8A 1ICEA 2VT3A 3VRHA 3L0DA 4YDSA 4ME6A 1QVVA 4KACA 3T3GA 3P97A 3CNLA 2NAFA 2RGYA 2UZ3A 5EZYA 1SQSA 2PL1A 5E2BA 4ZVSA 1NJ2A 4PLGA 1ZI8A 2ZJ6A 2XYRA 3WYNA 2QZJA 2J9FB 3PNKA 4RJJA 3SYMA 5HYVA 1DQPA 1BX0A 3KSAC 2G5PA 4YRMA 3M1YA 1OV4A 3DQQA 3QENA 3CISA 2QVZX 1U1FA 3BKWA 1THZA 3LQKA 4QA9A 1ITZA 2XHZA 1H8ED 3PHHA 4MP8A 2XUAA 5AM5A 1D6JA 1VE3A 2NU7B 2PZAA 2XNJA 2ZR8A 4I9UA 5DULA 1CJMA 1WB9A 4QHTA 4OH7A 2DBYA 2AJ8A 1X1QA 3PEWA 3EVFA 5JSYA 1OD6A 1SBQA 4HGZA 4AKEA 5GJBA 2GBIA 3KLNA 1NRIA 3MYRA 5D3QA 1SWWA 1T5OA 1I33A 2XT9A 4EM6A 1AQLA 5T4FA 2B4RO 4HQNA 5KTPA 2QRPA 3U7GA 3IBTA 4LVOA 1OU4A 3UMYA 4RADA 2FMUA 4XYBA 2DR2A 1CZKA 2P9CA 2O06A 2FR8A 1YKFA 2XKBA 1NXPA 1PJ3A 1G6HA 4CCWA 1QYIA 1D0IA 4FQ8A 4OHOA 4RGYA 3TX6A 2DR3A 3LP8A 1NFFA 4X54A 4BFXA 5I8PA 2Q5IA 2XUIA 5CTJA 4P0TA 4ZO8A 2I91A 3VKGA 1Y1LA 1G4HA 1XQVA 2WA1A 3NFRA 2ZSBA 1SGWA 1PFQA 1ZN9A 2O07A 3GC6A 4GYJA 4NV0A 1EZZA 4IHJF 5CVVA 1VGQA 4BECA 1K6MA 3FSGD 1R00A 1U0LA 2AYYA 2HSZA 4EUKA 5KC8A 1ATIA 2P6OA 3FNQA 4F3KA 3DC7A 2H4WA 3HY4A 2FHPA 1DAPA 1E62A 1Z56C 4A0SA 1FS6A 2E9SA 3OQJA 5JQGF 2J41A 1J2RA 2GNPA 2VRCD 2XXBA 1TX4B 4HC4A 3E0QA 2BMJA 2F00A 3GPCA 4UCXA 1IG0A 1SUDA 2OMEA 1DDIA 5EERA 4EMBA 1G8FA 1LVUA 4ZA2A 3MJEA 2X9VA 2OEPA 4DCVA 1W4ZA 4H7PA 4EARA 2DEUA 4NZMA 4AJ4A 1TJNA 2CXRA 4JJAA 3WVNA 3WLKX 4FZ3A 5JXIA 1B23P 3U37A 4B3HA 1C9DB 3CCBA 4GGMX 4N0EA 2DMRA 3OZBA 1CXZA 1HK7A 5ALRA 3RVMA 1I4EB 1YDHA 4AZTA 1VDZA 4CVNA 2XBUA 1OYWA 1Q6YA 4YGXB 1SCKA 4BMZA 1G2PA 5IEJA 2RE8A 1H0HA 1U2ZA 5FNZA 1JTFA 4BL5A 4MCJA 1WCXA 2F48A 1Z6GA 4L2IA 1PJZA 1L2TA 4OFXA 1QZXA 2VLIA 2CMFA 3CO5A 1XDSA 4IJWA 3MAAC 1FSGA 3IB3A 4REOA 4I3HA 2QM3A 3QFRA 2DPXA 2GWRA 4KI7A 3DHYA 2X1HA 3JD4A 1CC1S 2JFFA 5JWHA 2F1JA 3C8DA 3DG9A 1XKLA 3ZGOA 3VYWA 4URHA 3OAAA 2H3EA 2QR2A 2TMKA 4KU4A 1GPKA 4J0FA 4QYSA 5KNCA 1FMCA 5HXAA 4D26A 3KUUA 4Q6BA 3LYAA 3CM0A 3I9OA 4MRRA 4NH4A 2ZVJA 2XRFA 3JW8A 1KQFA 4D0NA 3GRUA 1N6KA 4LVNA 5DBFA 2BGJA 1NTOA 1W8IA 4JJKA 2IP2A 3OURA 4S3MA 1OYYA 3HDGA 4JNKA 1ODJA 4UOEA 1KIAA 5FUVA 1CK4A 3DE4X 2VQ6A 2PUEA 3TNFA 3EQ2A 4MP6A 2WVJA 4B46A 1AKTA 2C59A 4LA4A 2C2ZA 2C5AA 4ED9A 2D7DA 5AT1A 3LH5A 1KS9A 1KTIA 3FHLA 3TPFA 1TU4A 3DZCA 3DFMA 4JKOA 5TT1A 2ZZNA 4UBMA 2PUGA 1XPUA 1RZ3A 3A1WA 3FLBA 4CHTA 2V7QD 1XWWA 4X1KB 4M99A 4B0OA 1CQJA 4I99A 3ME5A 2WWTA 1TIKA 1ZW1A 2BI8A 2MSCB 1YIAA 3HYRA 3MS4A 2ZKIA 4BNKA 5JLJA 3CF4G 3QEJA 3PDWA 3WK6A 2WVGA 3STXA 3GJ4A 2IZOA 2O4UX 3M8KA 3ZDXB 4EY3A 2XWSA 3QHQA 1VJ5A 1U9YA 4IIGA 1U7OA 5BUSA 2MIIA 5BSVA 1ZRNA 1QDEA 1C3OA 3C8ZA 3ENZA 2WZDA 4EEKA 4X45A 1X1EA 4YRDA 1Z0SA 1SVNA 4AI6A 3AEXA 4B3BA 3UXYA 1YCGA 2YZNA 3G2MA 2CHFA 2ODEA 3SXUA 4YT4A 3R9XB 1U9JA 2D8MA 5DHPA 1KDPA 3NDPA 2IHNA 3MOSA 3B38A 4XWGA 3IAM1 3N2ZB 4X7BA 1E20A 2H1IA 4IVQA 4BDTA 4F4DA 4LOHA 2GN9A 3GUZA 2CDNA 2PN1A 3GEGA 1NUSA 4L73A 5D8DA 1O0BA 2DTEA 4JP1A 1JEYB 3FYUB 1UBLS 4JS0A 1Q16A 2AFIE 3L7OA 1UWCA 2X0FA 2R00C 5EMJA 2O5EA 5ALPA 3QE9Y 2VBFA 2YNMA 1VQ1A 2CC2A 2WD7A 3IH5A 4KUEA 3SVLA 4PO3X 2HU7A 4EFNA 3OIWA 3LCUA 3P2YA 4XIYA 4U2CA 2VKQA 4EA8A 4E6EA 1NW5A 1NPTO 1P9LA 1E6LA 3VI4B 1U7ZA 5DPMA 1UR5A 4KNVA 4C7KA 2KI5A 4LF6B 3QLVA 3BULA 4UZEA 1GFSA 1ESNA 1HNNA 1W4LA 3WNZA 1U3FA 4I4TB 4NCAA 1M2NA 1IZ0A 1SO8A 3N0WA 1J33A 2B3DA 3OTOB 4KP7A 3ZJ5A 5KMGB 3ZVNA 1M1ZA 3B2QA 1KI2A 3OF5A 1ZI6A 3RS5A 1V45E 4BVFA 1KEZA 4BKRA 1P1RA 1WBJB 4S0ZA 1PR1A 5T57A 1DAMA 3FHCB 3OZDA 1TVCA 3BM5A 4AJPA 2OBMA 3WP0A 1NX6A 3KB2A 4CV2A 2DH6A 2O2IA 2HMUA 1JQ5A 4G4IA 1FZQA 2C2XA 2GN8A 1T9DA 3V5NA 3BCRA 2PBZA 3FCOA 3JTEA 1VE7A 3O8BA 4C08A 3BIJA 3WB2A 4D56A 4QJ3A 4Q16A 1NFQA 4EB8A 1V35A 1U3UA 1NZFA 1A9SA 2A5FA 1J2JA 2ISQA 2VXOA 3MK31 1MORA 3WYDA 4Y18A 1QYRA 1A4XA 2V59A 3N8HA 4JBWA 3FCYA 3IP5A 2ZJ5A 3MS7A 3WJAA 1CKEA 1TO6A 1IUNA 2WYUA 3GNTA 3QVGA 4M4SA 1H2ZA 4NX2A 4YT2A 1QTQA 3VR6A 5KSYA 2XTZA 4RD6A 4QUJA 1W75A 2BJWA 2AI2A 4IGEA 2G9ZA 1TKCA 1UMBA 3M34A 4JEMA 2I1WA 3FVTA 2J1LA 4XVQA 1GR0A 3UXMA 1W73A 3OZIA 1C50A 3CX7A 5TMDA 1VCMA 2O05A 1L3IA 3F6SA 2K5UA 5EZ5A 1P8AA 3FA2A 4I66A 3WMGA 1LK0A 4D3SA 1KZ6A 1IB6A 3ABOB 3OZAA 2R7AA 3PYXA 3AETA 3LQ4A 3OPVA 1C4XA 2YYYA 2YZMA 1A9OA 1HTTA 1QGAA 1AZWA 3DVLA 1ZD8A 4JVOA 3VHRA 4F04A 4E94A 4NDAA 4BGIA 1TCUA 3WAJA 3B1VA 4CODB 5J4LA 4QQKA 2ZJAA 5C18A 1AB6A 3U5ZB 1N3BA 3IDZA 1HRKA 2QUBA 3H9GA 1U8EA 1CBUA 3KZKA 1QVZA 5I9LA 2Y1LA 5KYGA 3AKZA 5I8ZA 1C3XA 1XRMA 2JCVA 5DNAA 1OBFO 1V7CA 1OFTA 4IXTA 1P45A 3ZGLA 3SZOA 4JJ8A 2GO1A 2WSBA 5GVRA 3P9YA 5I4BA 5JQGA 1JHMA 1ONSA 3GEDA 4R9NA 4WK4B 5CHYA 5MN6A 3TQIA 1LA2A 1MB3A 3KVVA 3UMFA 4EJMA 3L8HA 3OCUA 5JSQA 2E87A 4X62B 2Z4SA 2IHUA 1ESZA 4B73A 2VJLA 1NXXA 4K6HA 1O6BA 4H3HB 4RPGA 4P32A 4KYTA 2I62A 3TLAA 1WPRA 3U4QB 3VKFA 3WK4A 4QJ4A 4CFYA 4EJFA 1IBKB 4K9DA 3UTCA 3GAMA 1RYEA 4YJFB 3DB2A 3GH1A 4Y30A 4BAUA 5DEOA 1XRQA 3BXFA 2Z5LA 4FFPA 4WDRA 3U44B 4YJHB 1YCHA 2IDMA 5H4HA 4G1VA 1RPAA 1UF9A 3ADOA 2FOXA 2VDLB 3A27A 5DYNA 2XXAB 4RETA 5EKUA 1ZD9A 3TCXB 3U4GA 3DYIA 2QR5A 4OKIA 5TQ2B 1MJGA 1ZRHA 3BILA 3L41A 2J0SA 2H29A 4QGBA 4GLBA 1I3LA 1EWTA 1W85B 2FRVA 4PS1A 3VO1A 3ZE8A 5A4KA 2R8YA 2VA8A 1L9XA 1JR4A 5AI8A 2WZBA 5THQA 3COPA 4EHBA 5IM5A 2HLDA 4HQ0A 3OM8A 1ISJA 4ZCQA 3T9DA 5BVGB 2XADA 2XZOA 3OLQA 1K7EB 3EASA 1ZJWA 4IDAA 2PUAA 3PNVA 3K2QA 1ZUNA 2RC6A 1Z18A 3AP3A 2LRHA 4D6YA 2FSPA 3PPIA 1TQDA 1ST2A 3F90A 1RQXA 2XQGA 2G1PA 2ZYDA 3UW1A 3C98A 1QS0A 2P7HA 4MHOA 1QP0A 1XEFA 3GRCA 3AESA 3JQAD 4L75A 2FXVA 2Q0SA 5CM8B 4CF3A 4ENVA 3KJHA 5IRCD 2WSMA 5AW2A 3MERA 5E8RA 3LGXA 3P5SA 3RRXA 1Q1AA 2FLVA 1U7WA 2WJIA 4WXRA 1N2ZA 3S2IA 1ZR2A 3MQ4A 3JQBA 4L4XA 4ZN6A 2W6IA 1B7GO 1NE2A 2ZJYA 1E7SA 2Q4OA 2QJTA 1B0ZA 3E3AA 3O3OB 4OXIA 4JYZA 2A9FA 4IFIA 2BFCA 1CQZA 1HE2A 3SN6A 1YO6A 2C3MA 4LJ4A 2P65A 1NHGA 2PR7A 1FDWA 2XDYA 4QJ5A 4CEIA 4IF6A 3B8EA 2PUDA 2XE8A 4X65B 1LVHA 3R7DA 1H0RA 4RMIA 4WZZA 2VNAA 4M87A 4NCBA 2CJPA 2IPMA 1QONA 3EVTA 4RD2A 1Y1PA 1DP4A 1KKMA 1CDOA 1IHXA 2QG4A 3DMNA 3R3YA 4HNVA 5GOZA 2QU8A 1X14A 1K0FA 4HJRA 2PRSA 3BBLA 1VL6A 2YIJA 3PDUA 4Z86A 3KVYA 3MMZA 3ZJ4A 3ZS9A 4C4ZA 2R3SA 1L8AA 4QBFA 4RLQA 2WWRA 1SXJC 2Z98A 4WNCA 3TIIA 1PZNA 6REQB 2ZOSA 2H7YA 4CR7A 4RTNA 2OP0A 1GKYA 1XTPA 3R8XA 2JCYA 2JS7A 3G2NA 1QFSA 3CNEA 4UE2A 3OU7A 3SF8B 4TL7A 4U7TB 4YHHB 1FXUA 3PJEA 1AQIA 5HJ2A 2LE0A 1XZCA 3GJ6A 1PGJA 4U2BA 2NVUB 4B8ZA 2P75A 3I45A 3PC2A 3WA6A 1PEAA 4DPKA 3HCDA 2FWIA 1RXSA 1TUIA 2B21A 2ACKA 1HYQA 2GKOA 3LECA 2I6TA 3E1SA 3T7JA 2BBOA 3KKZA 5CCDA 4D9IA 1Z12A 3SEQA 4J4HA 2QY6A 2WQ6A 4IJ5A 4CDGA 5I7RA 3ZUGA 5DLQC 2EX1A 3ZHUA 5KQSA 3U7EB 4NBUA 3RTDA 3CVUA 2MINB 1I6KA 5BPHA 5M3BA 3F1KA 3T5CA 1IK4A 1KDOA 3Q3VA 3A36A 4MW4A 3GLQA 3ICWA 3PQ4A 2F8LA 4A9AA 2OCXA 1YKSA 4RV5A 2PYZA 4RZXA 1E9FA 1Q0TA 1IJKA 2V6FA 1VKJA 1POXA 2FG7C 3NKFA 1RRCA 2HWXA 3BORA 1ULUA 3HMKA 3KBBA 4KE6A 3WL6A 3RAEC 2FFQA 4MVWA 2GLXA 2RGDA 2GJAA 2O6LA 3B78A 3MELA 4KYIB 2YHBA 4MUAA 4Y1EA 4AS3A 1UPTA 1Y8CA 1XD8A 3S99A 4TV8A 4BE7B 3FSGA 3SFZA 5KOJA 4DV2B 1C7EA 2JFNA 1V8ZA 1T8YA 2IYUA 4WKOA 5BVHA 1W5SA 4KZPA 1PL8A 5CCBA 4J0QA 4D6PA 1QG4A 1ZD3A 5B30A 4C4RA 2B2XA 1P77A 1SVLA 2I78A 4A8PA 2FUKA 4JX9A 2XD9A 1RQGA 1TVKB 2HQRA 1XKTA 1PV4A 1DWUA 1XZKA 3PEVA 3A9SA 3M6LA 3GXOA 3N7AA 3DL7A 5TGZA 1CUXA 3FHOA 1Y80A 1RWXA 2QZ4A 4WY8A 1AKWA 3NHZA 2MDTA 2NN3C 1WXGA 3DULA 3ETDA 5JAQA 3SYKA 2FWPA 5C7LO 1DBRA 4JYPA 4CEJA 3T35A 2XVMA 3EA5A 5ECYA 4ZEXA 5J2UB 2Z95A 3I9LA 4OLJA 3O8LA 4Q18A 4EUFA 1EGMB 4S1NA 4XQEA 1IEWA 2QX8A 4ZCSA 2N3ZA 2NVOA 3FYUA 5EMNA 1QGED 1RHQA 1WY5A 2B7CA 3R7BA 1JHXA 2P9ZA 4MUIA 2YV5A 3IDAA 1RQLA 4PC6A 3I52A 3T5AA 1HDEA 2QE7D