2DLFH

High resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 6.75
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
EVKLEESGGGLVQPGGSMKLSCATSGFTFSDAWMDWVRQSPEKGLEWVAEIRNKANNHATYYAESVKGRFTISRDDSKRRVYLQMNTLRAEDTGIYYCTGIYYHYPWFAYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The pH-dependent structural variation of complementarity-determining region H3 in the crystal structures of the Fv fragment from an anti-dansyl monoclonal antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)-KAPPA (LIGHT CH
total genus 28
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dlfH00
1V7ML 5IV2B 5ESQB 1HHJB 2VDOL 3SY0B 1CXEA 4APQC 2I9TA 2BSED 3KS0H 2HFGL 2XFXB 4X7TB 3ARSA 5TE4H 4N9OB 4YAQA 2APWA 3O3BB 4BKLB 5IG7B 3C8KA 1RZJL 3ULVC 4JFEE 4GSDL 4P5TB 4NHCL 2IGFL 4XPGL 2ICWB 1MFDH 3IDMA 3O8XA 4TNWK 4EEEA 3CMGA 2W91A 5LAXB 5C0CB 4JB9H 3WCYA 3TBYB 4U2ZA 3AREA 3BP5B 5L7XL 4AL8H 5D7KD 3CU7A 1MAJA 5DUBB 1IRAY 1LK3L 1U92B 3KYKL 1MHEB 4S1DC 4NCDA 2J8UB 4IIQB 2H2PD 5C0RL 1XIWD 5E6YA 5DMIH 1TJHH 4M62L 1ZT7B 3NCBB 4LQFH 4HWNA 2RQ8A 3ARFC 4ODHL 1M1SA 3BZ4B 2FB4H 4OKDA 2XWBB 4GKSB 4CVUA 3RWIB 1WAAE 3MLZH 4Y4KB 3RDTA 5KANG 5L8KB 2CK0L 2D31B 5LG1A 4EDWL 4F7EA 4F7CA 1XF5B 4FRWA 2XWTA 4KK6D 1NCAL 3NFNB 3WDJA 3HAEB 5IVXA 2VLKE 3P40A 1YN6B 4MCZA 4HMCA 4W81A 4PJ9D 5H37G 1AC6A 1QG3A 1S9WA 4U6VL 4Y1AD 2LAAA 1G7JB 3JWDL 3MJ9A 3DV4A 5EBMB 1F02I 3ULVD 1WC7B 1VFMA 1S5HA 1WQVT 1JGEA 4PJ8A 4HK0A 3TWCH 1KB9K 3U46A 4KDTA 3X3FH 4X5XB 3R06A 4ZUUA 1CIDA 5D5MF 1T22B 3CFJA 5J3HC 3K2UH 2HJKA 3H0TB 1V3LA 2X1OA 4EJ1C 2ZP0T 5TDPA 4QRRA 1I75A 1M7IA 2VDNH 5J89A 3VRIA 3TT1H 4H26A 4YAQB 4DK3A 3BP4A 1Q72H 4QCIA 5CP3H 4C55A 4KTDL 4WEUD 4ESKA 2Z31D 4YBLB 5JNYB 3ETBF 4PRBB 4JFFD 4EDXB 1NCBL 1R3LB 1X5JA 3H2WA 4ODTH 2NY3C 1BP3B 4NWUH 3TPUA 4HD9A 5GHWL 3TBYA 5J13B 2VZSA 2QQQA 2NY1D 2VITB 3F58L 4I77H 5CGYD 5DZLA 5E56A 5EUKA 3RX7A 3OSKA 3RY6C 2H2SD 1I8KA 2X5PA 2XPGB 1B90A 4YDIL 4G9FB 4HS6A 3VXNA 3SDCD 1D5IL 1KXTB 3DARA 4CVZA 3KG5A 2OL3H 1A47A 3DXAE 5BW7A 1T21B 1TTGA 3BKYL 5HXMA 5B8CB 2FCBA 1RZGB 3ARGA 4UDTA 4NQDA 4ZFGH 1TFHA 2V5YA 4G8IB 1H3PL 3QDAA 2LFGA 1MUJB 5I6XB 2WBKA 4O00A 2OR9H 2IANE 2YHGA 4XP5L 3QNZA 4JANB 3OQ3B 2EDBA 4KHXH 4HWUA 2BVOB 5EORH 2C4FT 1U8LB 2NY5L 4KRMB 5LBSH 3C8DA 4X80H 3PV7A 1VENA 4CW1A 4CVXB 3MJ8B 4XHQA 5F21B 1P4IH 5D7LB 3IDJA 3IFNL 1S3KH 2H8PB 4X5XA 4KUZL 4RAHA 4QTHA 4Y2DD 3OL2A 3Q2CA 4IRJC 5D96C 3VH8B 1HSAA 1FFOB 1VESA 4WTXA 2Y1VA 4O02H 5GZOC 2EE6A 3JUZA 5ENWA 5DFVC 4WCYL 1LE9B 4M7LT 4OD1L 4S1RH 4JDVB 1OB1B 4LLYB 3S4SG 1PZUB 5E6IA 4UTAL 3C5ZD 1T3FA 3PQYB 2AJUH 1P84J 3ZDZE 1QLRA 1ZSDA 2FBJH 3LH2L 3O9WD 3ULUF 3TBTB 1IGIH 4LF3B 4I2XA 3TO4A 3O2DL 1DBAH 1K3IA 2B8OT 3DX8B 2GJ6B 5F9JA 3GKZA 1ZGLP 5DEFB 5ALCL 3MLVH 5I66A 3H7BA 5A2JH 2ZUQB 3RY5A 4NKIH 5HYQA 4PJ7E 1GGTA 1WZ1H 4WO4A 4S1QH 3KDMA 1BFOA 4KJWD 2FD6H 4ZPTB 3SGDI 1G7LA 5JDSA 3M1BB 3CDYA 3VFVB 3NH7H 1PG7X 4MMXC 2R0KL 1AQDB 4Y4HD 5MERB 3KYAA 3U36B 4RWHA 4PV9A 1U8HA 3UBXG 4F2MA 5DHVB 1MCKA 4JHBA 4X6CA 2J5LC 3FQWA 4JN2B 3WUWA 1BQUA 4NT6A 4KUCD 1TZGL 3VD4A 1R24A 2OJEA 3JWDH 4Z7QE 1EJ6A 4GS7B 3HE7A 4R9HA 1RZIB 1J0JA 2ICCA 3R8QA 4P57B 4LPCA 1UXSA 4N0UE 4JO2L 4LVOC 4LSPL 3KAAA 3VFUA 1B0WA 1RIUH 4DW2L 4Z95H 1XGQB 3MMEB 1ZWIA 2PKDA 2R39A 5I76B 3U48A 4DGYH 1XGTA 4YDJB 2M8XA 1L9NA 1ND0A 1NBYB 4LVNB 3TNNB 4PLJC 4NQSB 1JRHH 2YD9A 2OZ4A 3OB0H 1IKFL 4DFIA 4KQ3L 1CDCA 4HKBA 1ZLSH 3QJFA 5ACZB 4LSVL 2GTZA 4F33B 3MXWH 5C3TA 2NYYD 3GJFH 2FX9L 4MMZC 4OCRL 1KB9J 5GGVH 4OZFB 1RAMA 2F5BL 3KPTA 5TQ2H 3FO9B 4I2XB 4QHMA 1S7TB 1FL5A 1NGQL 2FEDD 3QH3A 3VXRB 3RUGE 2GJ6D 2UWEF 3F7YA 1BEYL 4G42B 4JQXA 3F58H 5IB1A 5CD3A 4L4TD 3ZYZA 1T1ZA 1XZ0A 3L6FB 4CBPA 2NY7L 3O45B 1OWRM 3EO0B 4BELD 2P45B 3PHOA 2C1OA 4JPKL 1OM3L 3GK8H 1MHCB 4GOSA 2YPLE 4UNTA 1AXTL 3MBEA 1RZJC 1L7IL 1OCWH 5CEXA 5HHXL 1U6AL 1X7QA 5L8JB 3NOIA 4PV9B 1PEWA 4TQEH 3TT3H 3MLXL 3EGSA 3RA7H 1RZFL 4YHPB 3VXRE 4JZOA 4XVSH 3TCXA 1MCHA 1CT8B 2F8XC 4NHUA 4K7PX 3I6KB 1NFDF 3RWFB 3I02B 3TF7C 1LGVA 3SDDC 3ROLA 2ESVB 4PJXB 1MCSA 2NY5H 3HB3C 3OKEA 3RTQD 5DJ0A 3X12A 3BHBA 3PWJA 3F8UB 3FO2B 1BD2B 1LD9A 1QR4A 3QQNA 2L0DA 1AGEB 5E8OA 4TOYL 4XI5D 5CEZL 4PGEB 5FYJE 1WVZA 2X4NB 4PJCB 4C56B 4QWWC 4M6AA 2HAZA 1AGFA 1CDUA 2MFNA 5C70A 3QA3B 4KUCF 2EDXA 1YEEH 1ND0B 2QADD 5AAWA 5ITBL 2CKBA 1QRNE 3W0WA 3TGXA 3KPOA 2VXSH 2AERT 5D2NB 3BMWA 3QRGL 3QIUD 3RBSA 3TYFA 3OHXB 4XPFH 3ZYJA 1DQDL 1KB5A 4Z78A 1YYML 3OB8A 1OGAA 3QDGB 4OLVH 1FYTD 1DE4B 1I1AB 3B2UD 4I48B 2FHBA 3MRLA 3OR6A 2XV6B 5E03A 1KB5H 2VERN 2DQDL 2P8MA 3QHFL 1UJTA 1ZOXA 4G6ML 4RQQB 4XPTL 3WFBH 3F5WB 3SDCC 5I8OL 5TDOA 3QIBB 4IOFD 5CD3B 5T5FH 2V2WA 2WM0A 3S4SB 4GG6E 4KKLC 1XZ0B 2J3SA 2X42A 4K9EL 5GS1C 3CSGA 3W9EB 1T2JA 2WWKO 4Z7VE 1I9JL 1JNLH 1S9KC 3P11H 3X17A 3MLYH 4HHAB 4Y7MA 3IJYB 1IQDA 3BD5A 5FKPB 4PB9H 5JW5A 5FCUL 3N85H 3QCUL 3LZFL 2IFGA 3KXFE 5IWLC 4XX1E 5FHBL 1XF3A 3A6OA 4L9LB 5FGCE 3F6LA 3NFNA 2VIRA 4NQXA 1JCKA 3HAEA 5BVJB 2ERJC 2EIDA 4POUB 4JZJC 4YHLL 1MAML 1X5ZA 3D85B 3HZMB 4FS0A 3QUZC 1N4XL 1L7TH 1L6ZA 4OI8A 4QRPD 3ZE0E 4Y5YA 1J9CT 3D3VD 3STLA 4DN3H 5IT2L 3RVUC 2VDML 3E6HB 1J0IA 1HQ4B 1IAOA 3MBED 3V5DA 5HVFB 4PJEF 1FAIH 1IBGH 2NY3D 3N06B 3RL2B 4A2LA 4H8WH 5D7KE 4YHML 4X6BA 5I19H 3W2DH 1JN6B 2BSTA 4B0MM 1BQSA 4ZUTB 1CWVA 2DL2A 1RJZA 5HGDB 5C0AA 2IAND 5D2NA 4I1NB 5GGUA 1N8ZB 2EC9T 3BP6B 4DN4H 1Z6JT 3QFJB 1K9TA 3KYNB 4JFZH 2WINB 1P4BH 1TZIB 4RFOL 1KB5B 1OSPL 4F15B 4ORGB 3H6JA 1LO0L 1U91A 2RR3A 3GI8L 4FQCL 4OM0L 4HLJA 1EAJA 4OCRH 5C0IA 2CLVB 3ARTA 4J3VA 3LKPB 5CS7A 2G75A 2NNAB 3O0RL 1G7QA 2XYCA 1PLGH 2WAHA 3OKMA 4I48A 5KVEL 2D7TH 4Y19D 4Z7NF 4QTIL 3IDGA 3MV8A 4H0HB 5KS9A 1MVFA 1KIUA 1UACH 2E9WA 1KCKA 3UBXB 2ITCB 4NNXB 4I8DA 3QI9D 4YHNA 5IBTL 3FONB 3HFML 4P5TD 3GSOB 5FYJH 4HUKB 1X5AA 1OSZB 5D4QA 1FVEB 4HH8A 2DIBA 5E8PA 2FO4B 1PDKA 1FP5A 3HNTH 1JBJA 4Q9RL 3D0VB 2FL5B 5EUOF 3FFCA 3OG6B 3B8SA 4KKBD 1CDJA 5DRZB 5FECA 4HJ0C 1RK0B 4NRXA 5IJVA 3RNKA 1ZE3C 1RZFH 4OCXL 2VIRB 1BWMA 4LU5H 2EDOA 3DOSA 4AK1A 4GRWH 1LNUB 3GM8A 1PKOA 1IGYA 3LKRB 1G7MB 2DLEA 1J0KA 2M26A 1BZ9A 4TTGA 3HUJF 3G5VB 3ARRA 4RMSA 1KULA 4ZNEE 3MJ9H 1KT2A 2BNRD 2OMBA 3HMWL 2W38A 2UZXB 5INCB 4L8DA 3B5TA 3UTTD 4R96A 3FFCD 3DSNA 4MXVF 5HGBA 2DQEH 3BGFB 1F90H 3GJEA 1CD1A 2AABL 2IG2H 2MQ0A 4TOYH 5CEZH 3DX7A 2X4QB 3OAUL 3Q5OA 4ZUSA 4M4RA 4F57L 1R6VA 5JW4R 1RJYB 3BEVB 1X5LA 1SYSB 3VRJA 3MRIB 1UB6B 1E0OB 5ITBH 5HGDA 5C0AB 2P7TB 3PABA 4QHLA 1BF2A 4FQLH 2I25N 1Q9OA 5EN2B 2IAMC 4P4KD 1IMHC 4LKCA 5LWYL 1FRGL 2HRPH 4TNVF 1U91B 5D7SH 3VXUE 4I2XE 2AJSH 2HLFC 4LLDA 4Y19A 3OV6A 3T2QA 3DXAA 3NA9H 4Z7UE 3ARGC 1PZ5B 4OFYD 5BZWB 3KPRD 4NRYB 1O7VA 1J05B 3EOAB 4JO4L 4O2FB 4XC3H 2DQDH 3QHFH 5DFTA 4P9HC 3MRCB 2PXYD 5I8OH 2DWEA 2VSCA 3LV3A 3WS3B 1JHLH 4QRTA 3AC0A 2VR5A 1AKJB 2DQTH 4D3CL 4RIRA 3B2VH 3I6LE 4LPWA 1MI5E 2DQUH 3ARBA 1RHHB 3ARED 5AUMB 1BFOB 1UJ3B 2Q8BH 3MRRA 2BDNL 5DHYB 4JKMA 2DQJH 5FM5M 4ZD3H 3TEUA 2IQAB 4M4PA 1Y6NR 4E5XB 3JSSA 1Y6KR 4IJ3C 3SHSA 1EVUA 5L2KD 4CJ1A 1RUKH 4UTBH 5HY9A 3SE9H 1WZMA 3HB3D 3DO7A 4R90L 4NZDA 1N64L 1RURL 4KU1A 3FB8A 1AJ7L 1A9EA 4YHLH 5IROA 4J23A 2WP3O 4M5YL 5IUSA 2QSVA 4Q6IB 2DF3A 5EO1A 4XVJH 3PGCB 2DM4A 2B4CC 3P0GB 1D5ZA 4YX2H 4NKQB 1FGNH 3DMMB 4Y4KC 1V3MA 2EIEA 4OQ1A 2AS5M 3QPXH 3MRMA 3DROB 3JV4B 2A9ML 4GKNB 1YJDH 2AEWA 5HJ3A 1OQOA 4M1CD 4HFUH 3RPKA 4JRYE 1II4E 4PRAA 2DQFA 4G8FA 4DEPB 2OK0H 1DTUA 1Q8MA 2R0ZH 4GBXA 1FH5L 4FQJH 4U6YB 4XZUA 3HC4H 2BSSA 4TRPH 2BRQA 4JFZL 5C07E 4ZSOB 4PJCE 4C56E 3AXLA 4LLVA 3QIWD 4OCMC 1NMAH 3GB7B 1H15B 3A6BL 1LO0H 3GI8H 4R7NA 5JXEA 1KLGA 4QRQA 4LARL 3CFDA 3MUGB 2H1PL 2D9QB 1MY7A 3LEXB 3U9UA 2FRGP 4HV8B 4OZFA 1CFTB 3ARZA 2LTQC 4BFGA 5T1KB 4NQVB 1G6RB 3C6LD 4JVWA 5D1XC 1P4LB 4HXAL 3VFOB 4BM7A 1JGVL 5IBTH 4F7MA 5CILL 4D0BA 1IT9H 5CD5D 1MCBA 2K1MA 5I18L 2WBJD 4PRHE 4KK9D 3WN5A 3IU3B 4G3YL 5IK3A 2NXYB 1ZLVK 3G6DL 1K8IA 3B4NA 5IFHL 1RHHA 1J1XH 1DBJH 1FL3A 3CVHH 4J6RL 3MNWA 5K59E 1OD9A 2JIXB 2MCG1 3BEWB 1NFIA 5ESAA 4XP9H 2PO6D 4EBQH 1VADB 2ZSVA 3QQ3A 5HDQL 1PFCA 1X7QB 2ATKA 2CDEB 2R4SL 4G5ZH 4XNQB 2IBZX 4FMFA 3EGSB 4JREB 5EU6B 3QDMB 1IFHL 5DQDH 3QQ4B 2GHWB 3TO4D 3FQUB 3MJ7A 3LMJL 3MGTA 5HHQA 3MBEC 2HMID 4I0PB 5IHZA 3NAAL 4IS6B 1UM5L 5DJ0B 5FGCB 1J0YA 1R0AH 3PWJB 1DBBH 5ICZA 3BVNA 5KSAC 3QEQA 4PB0H 1D6VH 3VCLB 3MNZA 1DR9A 1OTTD 5CJOH 4PREB 4K3DL 4APQB 1BGXL 1JGLL 4F15C 4YEFA 2R2HA 4PIRF 5BZDB 3MCG1 3I50H 5F8QC 3DUUB 4PJ5E 2UVEA 5GSRA 4EUPG 3ZYIA 4X9BA 5SWZE 3W9DA 3L5XL 3FOMA 4AT6A 3QHZH 1FZJB 2R4RL 2EYTB 4R7NB 1OGTB 4Y8DC 1G6RH 5J13C 4PTTB 5K93A 3WFDL 1B88A 4Y4FD 3RI5F 3QDGA 1NMBL 1BBJB 4QRSB 3D25B 3QFJE 2W92A 5C09B 2UZYB 4XNXL 3JUYA 4BQ8A 5CJ5A 4XC3L 4L5FH 3BN9D 4MLSA 4ZTPL 4WDIA 5CZVH 2Q8AH 3R1GL 4ODWB 1TQCB 3QUZB 3ZT5A 4JRYD 4DOHE 4U1KA 5DLML 4L3CA 4ELKB 4WUUA 3ROOB 4UT7H 1ZHNB 3VGAB 3OGCB 2FWOB 1WJ3A 3P77B 4RISL 1A6WL 2BFVL 1EMTH 4QXUH 1YECH 1D7FA 1S8DB 2YK1L 1K8IB 1MCPL 1TETH 1I3GL 3O8XC 1FL3B 4U7KA 2DMKA 5D8JL 1PGRB 3EYQD 4HSQA 3RWJB 2XKNA 4RRPG 1N6QL 5IW1A 4HUVA 4PG2C 1CGSH 1L0XA 4P4KA 4G43B 4YPGA 1EZVX 2AJ3A 3MA9H 4XXCA 4KJYA 4G6AD 3O2VL 5J6HB 4I77L 3BDYH 1F4AA 1R3JA 2EIBA 1A7RL 2QHRH 3EAKA 3UTSE 5T3XL 4PJFB 5A16B 1CR9L 2QQLL 2AEPL 4RBPH 3UTTA 3GI9L 5IWLA 1MCWM 1BIHA 4QGTA 4OQTH 2AV1A 4LKXA 5DXWA 4FZ8H 4QOKB 1I7TB 4AIOA 3KPSD 3T0ED 1OGAE 3V5DB 4Y4FB 1NAMH 4FFZH 5T1DL 4ONHA 1JF5A 1JNHA 5JMOC 1QHPA 1ZLUH 1T04B 4ODUB 2BSTB 4XWOC 4PJAF 1FH5H 1FG9C 3DVFA 5DO2C 1RK1A 3O3DB 2ADFH 3HC4L 5MEQB 4JY4A 1U8NB 1BBDL 4DKEL 4J3OC 1NL0L 5C6TH 4U0RC 1HHJA 4JFED 5D5ME 3MRNA 5TPWH 1JNJA 1FV1A 4R2GD 3GSQB 3RWEB 1MRCL 1AP2B 4N5ED 4KVNL 1LO5B 2J2ZA 3V0WH 5HDBE 5FGRA 1TITA 5HYJD 4LAQL 3L3JB 5I1DB 3K4DA 5IW6B 5FUCC 5AEAA 2PW2A 3ILPA 1I9IL 4N0UB 4WUUD 2VQTA 4WI3A 5K9OB 1XGRB 1F8TL 4JZJA 3G6AA 2X41A 3MOQA 1FO0L 3QUZA 3PE9A 4JQIL 3HR6A 3NCJH 3QUXA 5F3BB 1Y0LA 5FKAB 4LCCB 4XMKH 4ODSH 3FFCE 5KVMC 2H26B 3G6DH 5FK9A 2VXTL 3KLHC 3P4MA 2VXUL 3S35L 3BD4A 4AM0B 4JG1H 2VJXA 1ZT7A 1GGUA 3VFTB 3ULVL 2EC9U 3BGAA 3IDNA 1SBBA 4M5ZL 1VGEH 4QY8A 5LJYH 1I8IB 1VFUA 1FHGA 2G5BA 1I8MB 1OTUD 4UT6L 3VXSD 1U58B 5C6PB 3BPOC 4K71C 1K6QH 5MP6L 1CFQA 1WK0A 4NFBA 5TGBA 1MCWW 3JXAA 3DHMA 4OZGA 5T1KD 1REIA 1QEWA 4PYGA 1WZ1L 3V6OE 4X8XA 4TVPL 3NGBC 3EO9L 1OPGL 3E8UL 2ED7A 2FIKA 4XP6L 2NLJA 3QNYA 1UM4L 1A7PL 3AY4A 1JYXA 1DQQB 1CVRA 4TSBL 4YZFE 1JGEB 1P9MC 4X7FC 3MCKB 2HWZL 3G08A 3HNVH 1SYSA 3VRJB 5BQ7B 2LU4A 3O41B 1BVZA 1JPGB 1QNZH 5HHVH 5K59F 1PG7W 2E8YA 2XZCH 1M7IB 2OTUA 4NKOA 3TO4C 2JJTC 4Z7UF 2HKFH 1M7DA 2G2RB 3TBSA 3B83A 2J6EL 4KRLB 4BQ9A 1NMBH 3UTPE 3MUJA 4V2CB 4HKZA 3H3PL 3WV0A 4DGYL 3R4DA 3PQYD 4AMKH 3HNSL 5E00B 5F96H 2R2BA 7CGTA 4YFLI 4U1NA 1A6ZB 4ZO7A 5I9QB 1CYGA 15C8H 4H20H 2FYYB 1OAKH 4JFQA 3NFPB 1PKQB 3O6FD 3L5WB 4PRDA 3REWB 2YBRB 4LSVH 1LK3H 2BSRB 4K94L 3P4MB 2HMIC 1MCCA 4U0QB 4YFDB 1G7IA 4PR5B 1A1NB 2VAAA 2Q3AA 4MQXD 4UINL 4FQPA 1J11A 3CZFA 5D9SA 5HSFA 3IRPX 4X6DB 2CK0H 4G8IA 1WLHA 5I2IB 1CLOH 2NX5B 1WSST 2V2XB 1LO4L 2NY0C 2XNAA 1ZMYA 1U8QB 3REVA 3TFKC 4P2RD 3U0PB 4J1UA 1OM3H 5CCKL 3EYUL 4P2QD 2P49B 4GKSA 1D5ZB 5KAQF 4OQTL 3CXDL 2WBWB 4MQSB 4PJEE 3S6CA 5BCAA 4POZC 1NAML 2ZUSA 4FFZL 5T1DH 1RZKH 3SDAC 3VWJB 1LE5B 3VI4E 1HZHH 4HWZA 1UB5B 1BIIB 1K5NB 3HC3L 5T1LD 1QBML 1RZ8B 4LLAA 2HT2D 4HIIA 4KJQD 5FO8A 1NUGA 3ARVA 2DTSA 1J87A 3BH9B 3PJSB 5TQ0H 3Q6GH 4XPBL 5BMFH 3MC0A 4YPJA 3PQYE 4GAFB 5JORB 1IQWH 3P73B 3VFSB 3Q5TA 4MNGB 2OQJA 3VFRB 1PEZA 5SWSA 5EZJA 3S36L 2HJFA 3ARBD 4J8RB 1HEZB 3BX7C 4WGVB 5GS3A 4XPHL 1YYLL 2XZZA 5IMOB 1T7XA 5JZ7D 5KJRL 1G0XA 3L7FA 1NBQA 4URTB 1YEEL 5GS0C 2NY1C 1G6RA 2PUQT 4LBEB 4OZ4B 3VXUA 4KAQH 4H26B 1QVOB 4HKJB 1AIFA 5J57B 3RWIA 5DEFA 4P49A 1A6UL 3CGTA 5DMGC 1NLDL 4OLUH 4NO5A 1A02N 3TPKA 4ZUWA 5E99L 4TSAL 2EEDA 4S11A 1MJ7L 2B1AL 5E08H 5TH2A 4M93C 2NW3B 3NZHL 3FOLA 4GBXC 2ENSA 1MLCA 3VI3F 2WSKA 2YUXA 4ETQB 2ED9A 3FRPG 3BP7B 1CE6A 2ZCKH 5IB4B 3TNMA 5IQ9B 1BHGA 5MP6H 1OAZH 4KTYA 3IXTA 1XR9A 2PCPA 3V6BR 1OAXL 4NT6B 5SWSD 1D6EA 2NY2C 3PHQA 1MHHA 1A4JB 4HWBH 1FBIH 2OR9L 4OLYL 5I1JL 4MSWA 4OV5B 4NIKB 4PB9L 2WK2A 3CFJB 3HE7B 2DKMA 4K3EL 3I9GH 5EOTB 5L6YH 1NCCL 3JZ7A 4MA1B 4MNQA 2AXGA 4KY1H 1NJ9B 3MNZB 1UB5A 1YY8B 2ZUXA 5IEKB 1ED3B 4YHYC 4APQA 1JZ5A 4JHZA 3EDJA 2C7UB 4JKLA 4NPYB 1U8IB 3FT4B 4FQ2H 2ADIB 2N1KA 4NNPH 5JORA 1R3HB 2JK5A 3T4AA 4IRJB 5D96B 3UBXI 2AK4A 4CDHA 2LE9A 2A77H 4CW1B 2WQRA 1YEJH 2HKFL 3LAFA 5H35A 1CXLA 2DIJA 1FLRH 2H8PA 5CINH 1EERB 4DVRL 2A6DB 1S78D 1OLZA 1MWAL 4KZDL 2VOTA 3D25A 2HKHL 3G5XA 2X9XA 3WEXA 3DNKA 1EEZA 4Z7QF 3V95A 5HVHC 4GMSL 2FBJL 2KQNA 4E41E 2JB5L 4HXBL 5LAXA 5C0CA 3BKJL 4FXGB 5HHOA 2P1YA 1QVOA 3QDJD 2AJZA 3TZVA 2VLKB 1DLFL 3O9WA 3E6FA 2X7LB 3L6FA 1OSPH 4G8EB 3TYGH 2JCCA 3LCYA 3ZKQD 5I1AA 4M3JA 3S5LA 1MJJB 1QSEE 1FYTE 3BO8B 4LVHB 1IARB 5FA3B 2OS7A 1FNFA 1Q1JL 4XBPB 3ILQD 3FT3B 2GK0B 3BZ4A 4DWHA 2Z91B 1DSFL 5DA4A 4HUXB 3K7UA 5J6HA 1F6LL 3IDXH 5E0QA 2RGSA 5GGRB 1R5VA 4PG9A 3GHBL 2YXFA 4ETYA 3T4YA 3MLRL 1VPOL 1YQ2A 1CT8A 1YN6A 1U3HD 3VXOB 4AEIL 4CMMA 3EYUH 4ZPTA 4P3DB 3HAEG 5IKCA 4MAYD 3SDXF 3GMLB 3UJTH 1ZTXH 4WFHE 4HGMA 4ORZC 4FQXD 2B2XL 4PJ9C 5AZ2L 3MFFB 1A3LH 2AKRB 3ARDD 3EDDA 3BIKB 1QBMH 4PJ8B 5IEKA 2AJVH 2QQKL 2Q7NA 3T09A 2ESVE 1BFTA 4PJXE 2VLLA 5E6IB 2O5ZH 4MQ7A 1Z9LA 3R06B 1Z3GH 3QXDB 1BF8A 1UADC 4M6OH 5EIQA 1ZGLB 2OJEB 1R3HA 4U1HA 2Q76A 2GQHA 3U30C 4Y4FC 1T1YA 1S7VA 3IU4H 4Z0BL 1UA6L 1G7HA 1QQDB 3NACH 2IALA 1UXSB 2GITA 3RWCB 3FZUD 5E8EB 3GDBA 5GZND 5F9OL 5IFJA 3M17A 3Q1SH 1IKFH 4ACPA 3L7EA 1K8DA 4XB7A 5FYLH 2AQ2A 1C16A 4HPOL 4O4YL 1QRNB 4X7SL 1NFDE 4NN7C 1T20A 2PW2B 2HFFB 4WV1B 3RY6A 1CFBA 4J12A 1XGRA 4IRSA 2K9UA 1X44A 3GSNL 3CFBA 4KGLA 4GLRI 4JRYB 5E95B 3LHPH 1RUML 3MRBA 3DGGA 3QDGE 3EO1A 4RMVA 3RVUD 5D7SL 1T1WA 3RU8H 1FZOB 3GHEL 5IVXF 4XNUH 3QB7C 3SKNA 1ZGLM 1RU9H 5E9DD 4P5MA 3NCMA 1MJ7H 2B1AH 5E08L 4JN2A 5AAMA 3T3PF 3AMKA 4J2XA 4PJAE 2Z91A 3DI3B 2VLRD 4CMHB 4S1SH 5E6IC 2XN9A 3RP1A 1TVBA 4CUCA 1EHXA 1ZA3B 1L7IH 1OCWL 4BSVA 4X9IA 1LK2B 2DQGH 4PGCA 1OAZL 3EO0A 1V3JA 1FFQA 1N2RA 1A1OA 3HR5A 1OAXH 4OFIA 3RVTD 2Q1EA 4P2QA 2JE8A 1MCNA 4PPTA 3ZSTA 3WIHA 5D5MA 2DQUL 1A7OH 1H3VA 1FBIL 4OLYH 1MNUH 3QIUC 4ZOAA 4IBLT 3SKMA 4L8CB 1UGNA 3SGJC 1U8LA 4LAJH 2R29L 3I9GL 5L6YL 5DD1H 4EVNA 1FQ9C 1IZKA 3ET9F 3DVIA 3QG6B 4MJ6A 4KY1L 4YDVA 5F7HA 2D7NA 5GGSA 5HHME 1OAYH 5ESQA 4RSVA 4QWWD 3TH3T 2VAJA 1RIVH 4JM2D 4OLWL 1Z0NA 4BZ1L 4O58H 2VDKH 4NHUB 5BQ7A 4PJEB 4YGVA 3QDMD 2YUVA 2O5YL 1S9WB 3DYPA 1RULL 2I5YH 1Q9KB 1IM9D 4UV7L 3QDHA 3CX2A 3B9KD 1MFCH 3KYOA 4MHHI 4M00A 1FL5B 2FGWH 5J12B 1VA9A 5ACLA 4WEBL 4JFDB 2VLMD 2X9YA 5CINL 1K8DB 4P2CG 4F8QA 5D2LF 4HPYL 1FFNA 4XVUC 4JN1L 5HYSG 4U3XA 4JHWH 2NXYD 5C07D 5JW3L 3WBDA 1HKLH 3EYFA 2CIKA 3GMQB 2V5SA 3GSVB 5CGYC 2NW2B 1W2KT 1TQBB 5FUZH 4CDGC 4FP8L 1ZV5A 3KS0J 4UIKH 3DGGB 1HNFA 4U7MA 1OT2A 4G6MH 5DURB 4NZTL 3VWKD 5DK2A 35C8L 3TYGL 4Z78B 4K2UH 3MRGB 4F7CB 4V2BA 1AGDB 4Y4HB 4HWEH 4K9EH 4H1LB 4JPVL 4RMTA 4WJ5A 5EA0L 3OKDB 5DJ6A 3CVHB 1HN1A 5EU5B 2C3VB 2CO7B 4H88H 2B0SL 3X12B 3BI9X 4UNVA 1WT5A 2OCFD 3QEHB 1IT9L 3VGAC 3U2SA 1WUNT 3OPZL 1ORQA 5D5MB 1C5BL 1WBZA 2NY6D 2IPTH 1YEGL 1T0MA 3ELAT 1LILA 1FJ1B 4GUPA 1KJMB 3VXSA 1T22A 4KJPD 2Z31C 3PWVB 4I3SH 3DMMD 1G9NL 3DWTA 5TDPB 4ZO6A 1ADQH 2QQKH 4HAFA 1R5WA 4U3CA 5HI3D 2YEZB 3S5LG 5IIEB 1CTNA 1E4WL 5KTEL 4WHTA 4KV5E 1DVFB 1IBGL 1IFHH 4I9WE 3PXHA 1IGTA 1NAKL 1EX0A 5DRXB 1J5OH 4BQBA 3LEVL 2CD0A 3BH8A 5JO5B 3GIVA 2Y9RT 4JHAH 5FHAL 3DVNA 3TFKD 4LCIH 2YSSB 5F44A 1NC4A 5GRXG 1T66D 2QSTA 4WO4D 1QSFB 1D6VL 4GAYA 4TUJA 4DZ8A 1WAAF 1D5XA 1N6UA 4QHNA 4RFOH 4U1IA 3DX6A 4J3XA 3K4AA 3U6RB 3MO1B 3TA3B 3S96A 3FN0L 3T08A 1ERNA 1NGZA 3GSNH 2ZG2A 1PLGL 3KPLB 3LHPL 2YD1A 3GEWB 1X3DA 5FKPA 1VFAA 3FB7A 4M7LH 1N59B 3QO1A 4JFXB 1AGBB 3RKDC 4X6CF 2Y5EA 3HFMH 1D5BB 2DQCH 2VLRA 3OWEA 1BJ1H 5FYJL 4Y5VC 4YHZH 5C08E 2GSGB 1E6JL 4OIBA 5DT1H 1MHCA 2FJFB 4L5FL 1KNOB 3ZDXF 4S1SL 2C3VA 1FVCB 5CZVL 2BHZA 4X7EC 5D71L 1KJ3H 5JOFA 1ONQB 4HQQL 3ULSA 2DQGL 1MEXH 4KKBC 1SVZA 4PS4L 4D9QD 2YD2A 3VFWB 4U6XB 1MSPA 5BS0A 1K4DB 3MR9B 4OD3L 5DK0B 4QXUL 2CK2A 5D2NE 3FJTA 3KDMB 3EJYD 3E1F1 4UBDD 5HD8D 4IRSD 2CMRL 1JI1A 5FYKL 3AGVA 2PW1A 3QIWC 5DRZA 4X4YA 5E1AB 1OLLA 1KTKE 3QULA 3ULUH 1MCQA 5JR1H 1N8ZA 2DQHL 4TUOA 5DHVA 1IAIM 3BPOB 4ONGL 2DQEL 3LN5B 1KG0A 3U7YH 4ORGA 3T77A 5E8DL 5GGQH 1I7RB 4NPYA 2O5YH 3W11C 4XNZB 4Y19E 2AEPH 3OKMB 2R2CA 4MA8H 3IDIA 5DYOA 4X4MA 1R3KB 3MGOB 3D2UB 5HGBB 2BVQB 1QSFA 4GAYB 4DZ8B 3ARQA 1CG9A 3UYOD 5ERWA 6FABL 1KLUA 3P30L 3WIIH 5ICXB 4H0GA 4HIEB 3INUH 4HV8A 5IBLD 3WEXB 5D2LE 3EFDL 2I26N 3L3IA 3RL1A 2DQIL 3BJLA 3MYZA 4TVPE 3MGAA 4R26H 2NX5E 5TFSH 4NJAL 3VDAA 1S9VB 5TPWL 5I6XC 1TVDA 5ETUB 2CUIA 4PG2A 4W6XB 5B4MC 4MA3B 2N7AA 4KH2A 4Y19B 4LCUA 4D0CB 5EO9B 1QD0A 3EYVA 1YEKH 3U36A 1MREH 1Z9MA 4NRYA 2BNQE 4L4TA 1VSCA 4KK8C 5DJXB 5HHNA 3IJYA 3JWOH 4G8GA 3IVKB 3K8MA 2AJYL 2Y72A 4OD2A 4P3WA 1DN0A 4Y0GA 1ONQA 2Y36H 4NFCA 4ZD3L 4K3JH 2ATPA 1BPVA 1FSKB 2IANB 1CFNA 5F1KC 4N8CL 3ES6B 4UQ3B 5BOZG 4RIRB 1G9MC 5DMKA 5EFIB 2KL6A 2IPKA 2VXTH 4R90H 4NN5B 3UJJL 4QLRA 3I75A 2WWMC 2NY3B 1CFSB 5I76A 3RNQB 2H32B 4Y5YB 2WIIB 4YDLB 4YH6A 4UV4H 4MNHA 5T5NF 4P2OB 5IVZB 2AKRA 5C0BD 2Z0BA 4WUKH 4HX1B 3NCCB 3TNNA 3V0VA 4I18A 5D2NC 4FN0A 1DVFD 3HTLX 4X4ME 5IQ7H 3MV7D 3AREC 4HH9B 4LSTH 2NY0B 4NM4H 4FXKB 2GTZB 2ORBL 2GSIB 4LSQL 3RZCD 4NYLB 1W72A 4WFFE 1HOCA 1YNLH 1T2QL 2V5TA 2OI9B 4OM1H 1HIML 5ISZB 2A6JB 1JIBA 5EOCH 4L3ED 1G7HB 1QQDA 3RWCA 5FUOL 1KN4L 2E6QA 3P4OB 4U6TA 2WINA 5C09E 3CK0L 3Q6FB 1KLUB 3HG1D 5DC9B 1NDMA 2MQCA 1T66C 5I73B 2BVUA 1INQA 1T20B 3FN0H 2H1PH 4XPAL 1NEUA 4GRLB 1JK8A 3CVIH 4FFYH 1TQBC 5C0NC 3QIBD 1TLKA 3S88H 4MZ2A 4MWFA 2CLRA 4NNYB 3PL6D 5IMLB 4MA3A 2YMXL 3T8XB 2IQAA 2CJUL 2FWOA 3AAZA 5FM4A 4OZGE 2GFBA 1BFVH 1E28A 5I18H 4NZRH 5D7JB 4JDTL 5HHOE 5DURD 1S9YB 4PJXF 1CE1L 4QT5A 1AFVH 1J1XL 5FYKD 1TQCC 1WFTA 1BLNB 2E7HA 3QYCA 4X6FB 3RWFA 1GIGL 2Z35A 3FO1B 4YXHL 2NY6C 5EZIL 4ONFH 4I3GA 4PJFE 3KLSA 4HT1H 15C8L 2ZUTA 4ZQKB 3LB6D 1MIMH 3IU3A 1KV3A 1H9VA 4RAVA 2IQ9H 1EAPB 1LNUA 4KPHL 1DEDA 5KN5B 3LKRA 3C5ZA 1V7MH 3I6GA 3I75B 3Q3GA 4KJWC 4HUMB 3UX9B 2H32A 3VXMA 3QXUA 5C6WH 3D0LA 3SOBH 1BD2D 3LS5H 2KBGA 4XHJC 5JR1L 3WFEH 4OLZL 3QG7L 3EDKA 4MD4A 4WHYH 1MLBA 5DHVH 3DV6B 4S1DD 5EU6A 3UTZB 3PL6C 4NQXB 4R0LC 3FAXA 1EXUB 1DBML 3MJGX 4JM2B 4ZFZA 5IM7A 4O51B 2GSIA 4YHKL 3VFMB 4GXUM 3MV9E 2Y06H 1F6AA 4JB9L 3KHQA 5I30L 2IH3B 5C0FB 1N5AB 1OGAB 3LB6C 3CSPA 5H94A 3QEQB 3KYKH 2WV3A 4N5UA 2WBJC 3B5HA 5MENB 4U7SA 1EGJL 1W0WB 1I3RB 2DYPD 3WS6A 1TENA 3LEYH 1EEYA 4DCQA 4D0BB 1HQRB 1KCSL 3L1OH 1TJHL 4KRNA 5EZOH 3INUL 5GJSL 2H45A 1S7SA 1MCEA 1SY6L 2Z4QB 2ZUUA 4JZJB 3JV6A 5EBLA 1C5CL 4AT6B 4OUUB 1FZJA 3KYNA 3D87B 1N3NB 2OTWB 4NN7B 4PRPE 1EUTA 5IBUB 2GFBB 2C1PA 1C7SA 3U82B 3SE4C 2G75B 2EH8L 1TZHB 1LHZA 3NABL 4Z7OF 2BFVH 5IHLB 4G80A 2A2QT 1ZS8B 4QNPF 2ICWA 3O8XB 2W59A 5D8JH 1ORSA 5DJ6B 5IROC 3AVEA 2DLGA 1F3JA 5L2JB 2MPAH 2ZUYA 1DANU 2ITCA 4NNXA 1KTDB 5H8DA 5GRWA 3CCHB 4UAOB 5C08B 2J8UA 3C9NA 3MYJB 3MNVA 1JV5A 1JZ2A 3GMMB 1WBZB 5JHDD 3I6GB 1TPXC 4YJZL 1BOGA 5KANI 2B4CL 5DA0B 1EJOH 1Q0YL 2F15A 1A7RH 4X6BB 5IW1B 4HUVB 5E99H 1CDHA 3N1MC 4GUPB 2BNUA 5D6CB 2QQLH 5F6HJ 2GI7A 4N68A 3UAJD 2W9LA 5F88A 1Q72L 4Y16A 1VEPA 2IJ0C 3SE8L 5GGSY 3DV6A 3UTZA 3KR3H 3BP6A 4ZDHB 2ZCKL 1DJSA 4Z7WA 1FC1A 3JVGC 5D1ZD 3MRPB 2J5LB 1IGJB 1OT1A 2J8HA 4MAUH 1OGTA 1JFQL 2GT9B 3GBML 4PJ8D 1JMXA 2DM7A 5JXAL 5IMMB 5E8NA 3HZKA 1HIMH 4QHKJ 3QISA 1JGUL 1U8PA 4GBXD 4MJID 4PRHB 3DV4B 5KOVC 1P7KA 1CK0H 1BBDH 5MENA 1YEDB 3AXLB 4LLVB 5IESL 1NCCH 3GB7A 2APVA 1A22B 1L0QA 3F7QA 3MLUH 2B5IC 3FO0H 4WI9A 1A21A 1G7PB 5CP7A 4JQVA 4NWTL 3GJFK 1WT5C 2CKBH 3TA3A 1HILA 3U9UB 4FQQA 3SDDA 3WN5C 4TN9A 5GGTA 4FQ2L 4BSWB 2R2BB 2JJSC 4NNPL 2EYSA 1CXKA 4U2YA 4YXLL 2R0LL 2EDWA 3CX5J 2VDOH 5EU7E 4PJBE 4YC2B 4LLDB 2Z8VC 4G43A 1X4XA 4Y16C 2BSRA 3ISWA 4XP5H 2HFGH 3GO1L 4XVTL 3A67H 2DJUA 1A3RH 4WFEE 3HUJB 4BQCA 4RAUB 1HDMA 5DQ9A 2HKHH 3PGDB 2PN5A 5HHMB 4JJ5A 4GSDH 4L4VD 2ARJB 3RPIB 3U83A 3B9EA 1F00I 4XCEA 2F53B 4NSKA 3MLTB 3LY6A 1N5YL 1KENL 5M95B 3CCHA 4XMLH 5DRNB 1DLFH 3OTTA 4GRWE 3EYSL 2MKWA 3VD5A 3GMMA 3X11A 1EHLL 1QR1B 1KPUA 4X6DF 2HVKB 5B39B 2BJML 3ZKNC 4KROC 2A1WL 1TVHA 1UKSA 2VKXA 2CIIA 3HUJE 4OCLC 5JOPD 2AI0H 4G9FE 3HAEH 4ODBD 3V9FA 5J11B 5GS1A 1VEMA 2VISA 2ZWLT 1RZ8A 4F7TA 3LN5A 4E41D 3VRIB 1LEKB 1U3YA 2Y06L 5D1ZA 2BVEA 4O5LL 2QSCH 1AO7B 5JA8B 3THMH 2EXWC 4PRBA 3S97C 3GJFA 1R3LA 3H9SA 5HGAA 5L0QB 1MJ8H 1T7VA 3CMOH 4AQ1B 3MRCA 5I15L 2EDFA 5SWSB 2HT2C 3LEYL 2XZCL 4X99A 4A2MA 2AXFA 2BC4B 3RVWD 1HEZA 2DS4A 4JO3L 1GH7A 3L9RB 3QCVL 1HILB 1ETZA 3O9WC 5DVLA 1CXIA 2JLLA 4QTHB 2FD6L 1OWWA 3BZFB 4QRSA 5EIIB 5H2BA 2XY2A 4BKLA 2ZOKB 5JDJA 5I1GL 5KBNC 3ZHKA 5LGJA 4A6YL 4CADB 2NY1B 3SCMD 2W0FB 4JDVA 3RAJL 5GJTH 3PXJA 1WBYB 1RD6A 2YUZA 2CUHA 3AROA 3DI2B 3BKMH 3IDYB 5B8CA 3PQYA 1OAKL 5ADPH 1QLEL 4MJ5A 1U92A 2X9WA 4JY6B 5KW9H 4K23H 2OLDA 1ZSDB 5HY9B 5KSBA 5DDHA 2IBGA 1H8NA 4G6JH 5IVNA 2HG5A 4XCEB 5GSVB 2FLRT 1EDQA 2FH8A 1QFOA 1ZA6B 5GHWH 1M4KA 3DRTB 4Z7WF 4JEGB 4R3SA 1I1CA 4K7PL 2MCPL 1PG7H 5F1IA 3O3UN 3QCTH 5J0BA 5GRJL 4OZFH 5CEZD 3U7WH 3PHQB 2X4UA 3IDJB 2IADB 4Z7NE 1D5IH 2CIIB 1XF2A 3ARDA 2OL3L 4ZAKB 1SMOA 3DMMC 3KPQB 4QOKA 3SDXE 1G1CA 3CFCH 5F3HB 5D7IA 5HBBA 1U95A 2YC1A 3RQ3A 2CDGB 5FAAA 4N90D 4MAUL 5CGTA 5GGVL 4IOIB 1JNHB 1ACYL 1KCRH 2R1WA 5BO1H 5K9KB 4DUXA 3G9VA 4FQHB 4XAKD 3ZL4H 5ICYA 4ALAH 1JGUH 3STZA 4X7DC 1JWUB 1BEYH 3MRJB 4IJ3B 4K3GA 1AI1H 1GAFL 3DVGB 2AK4B 5TQ0L 3Q6GL 4I4WB 3RGVA 3HG1E 2F54E 2W0PA 4XBGB 1NC2B 5DO2D 4LF3A 1JHTB 3DX8A 3WLBA 1OAYL 1UZ8B 4P0DA 4XCFL 1JPFA 3O3EB 3J8F7 1T6WA 1AY1H 3WSQL 3S37H 1RI8A 5DJDB 1ITCA 5SX4H 3M8OH 3MXVH 1F3DH 3E2HB 1FZMB 2FLBT 2Z93B 1FFRA 1BAFL 4KKCC 5EO0B 5I74C 1GZPA 4WO4B 4MXVE 5IMLA 1GPOL 4F58L 1NSNL 4KJQC 4LRNL 3UJIH 3TESA 4M61A 5C0CD 4LASL 4XVTH 3OR7B 4JY6A 3WD5L 2DLIA 2AK4E 2K3TA 5I2IA 4AM0A 3EZ8A 4PJHE 1XAUA 5I1LB 1NLDH 4OLUL 4WDIB 4WRLA 3IDNB 5GRUH 5I9QC 1N5YH 3IAQA 4WFGD 3IFLL 4AIXA 4KDVA 2V9QA 5FUZL 1HHGB 1Q9WA 4L3CB 2EXYC 4R3SB 3OF6D 4I0CC 3RX5A 3LRHA 5GISH 3FRUB 3CX5K 5CSZB 1S7RB 1CICD 5JQ6L 3OJDA 1XCTB 3T2NL 4CMMB 5BW7C 2JF1A 5CFHA 4JCLA 1QKZL 1XGQA 3MMEA 1HHHA 1F2QA 3SCMC 3D0LB 4GAGH 1AD9B 1I3UA 2ZOLA 5TE6H 1MCFA 32C2B 5D72L 4R7DA 4XPFL 4IMLA 1NCWL 4Q0XL 1BWWA 4MD4B 1F45A 1U95B 2YC1B 2I60L 4NC2B 1WZKA 3ULVF 4L9LC 1WTGT 3OAYK 1XR9B 2WUBH 5IOPA 4PP1C 1FNAA 3G08B 1A4JA 4K3HA 4M7ZB 5JIPA 5EC1B 5I73C 4BQ6A 5IG7A 1YEGH 2NXZD 3S35X 4HJ0D 1MIEL 3AU1A 3LIZL 2P8LA 1ZEAL 2A38A 1MJUH 2DM2A 1NFDB 4PLNC 4ONHB 1JTTA 4E41A 2F19H 2VZOA 3F7RA 1ED3A 4CKVX 4PGEA 1X6LA 4HKZB 1AGFB 4R97B 4IIQA 1EEUA 1U8NA 2RHEA 2AEQL 1IKNC 1NCDH 3IT8D 4ZO9A 1ADQA 2D0GA 4QRRB 3LEVH 4C54A 1S7UA 2VZTA 2ICWJ 1CU4H 2R0WH 3PDDA 2OTWA 1B4RA 3B9KB 1UKTA 4ZOEA 5T3ZH 2A9NL 5KW9L 2AJ3B 2QV2A 3WXWL 4K8RH 3QZWA 2ZJSL 1N4XH 2DLFL 4YK4B 2FGZA 4HC1L 4L9DA 5DD5H 1QPXA 1ORSB 4MVBD 2R1XB 3WJJC 3TPUB 2P24A 5JPNB 2YS4A 1O7SA 3DLQR 4PJIE 5C86A 5IW3A 3O8XD 1YN7A 1Q38A 4P59H 1LO2L 5B21A 4P2OC 5DUML 5I19L 4CRPA 3HRZB 2MCPH 3BHBB 3WKMH 3V4UL 3C60B 4AH2B 4BH7A 5IF0B 4GQPH 2W65A 1S7RA 1I1FB 5HYJB 3HI1A 1K2DB 2HT4D 3LRSB 4D9RE 4WO4C 5F7WC 1U41A 2P5EA 2Q7YB 1IQDB 3SKJH 3QUMB 2H32H 4LL9A 5D6CA 1MFAH 5D1XD 4V1DE 3PWPB 3BW9B 4PRNA 4P5KA 1AXTH 1I8IA 4UAOC 1T89A 2P5WD 2P42B 3O0RH 3PWPD 2CLZB 3MRPA 1GSMA 3O4LB 1TTUA 2DKUA 4OD3H 3X3GL 1H8OA 3KPSB 3T0EB 1ZXQA 2P47B 3ECBA 1J1OL 1S78C 4XC1L 1YZZA 1YEDA 4WEMB 4DAGH 4JFYB 4LQ1A 3G6AB 3ULUL 3HMXL 4HC1A 2DQHH 1XGUA 2YRLA 3L5HA 3QXDA 2BVYA 3M8OL 4FQQB 3SDDB 2WUCL 4YR6B 5DD3H 3IRZA 1DBKL 4LHUB 4I9WD 3GNML 2D7PA 3QEUA 1KF9B 1FZKA 3AB0B 5JIHA 3KWWB 4XH2A 5E8EA 3UJIL 3Q48A 1TNMA 3QRGH 4HKJA 3F7YB 1RUMH 4QRRD 3U1SH 1B6UA 3QHTC 2OXGA 1MPAH 2BHUA 2FECI 3KNBA 1G7QB 4MYWB 3RU8L 4NO5B 3SQOL 4TNVK 1JPSH 3RPIA 3TCLB 2NW3A 5KSVA 4JM2C 4KI1A 1B2WL 3UBXA 1P2CB 2G9HB 4WTWA 5GISL 4FOMA 1LP9E 2HA1A 1YA5A 5I66B 2NXZB 1WF5A 2PYED 1IAOB 1OW0C 2B7DT 3RVVC 5CBAB 1UCBL 1P6FA 4HCRL 4JZOB 5FCSH 1I9JH 1URLA 1JL8A 1X4YA 3TP4A 2X4SB 1FN4B 1TVHB 4BZ2H 1KJMA 2HRPL 4WWID 5HI5D 2I60H 3SDYH 3LQAL 5TDNA 1JHKH 2WANA 5I8CA 4WHTB 4W70A 5SV4A 1TZIA 4KK8D 1U8QA 1IC5L 2HH0H 4O2EA 1BZ9B 2FX7H 3REVB 4W6YB 5DD0L 3WIFB 3DUSB 3OJVC 3V0AC 2IAMD 4P4KC 1W0YT 2JK5B 4M7JH 3T4AB 1E4XL 1FL6B 2N56A 4HJJH 4Z7WE 2A6IA 2BOCB 4WUKL 2OP4H 3MV8B 4U1NB 5I74B 1INEL 5TE7L 2PYEB 1FAIL 1Q0XL 3NPZB 5EU6D 2ADJB 4LOUC 3RUGB 1DL7H 2V5RA 4QGYA 3E2HC 5E7FA 3P3YA 5FIEA 3PJSA 3OG4B 1NBYA 4CADA 4POYA 3MROA 1MHPL 3DURB 3WLWC 2J88L 4UTBL 5FV2A 2NR6D 1WBYA 4JFDA 3PIQB 5LQBL 1N59A 5T3ZL 4P23C 1MWAB 4NZTH 1UH3A 4NDMA 4NOFA 4OFDA 1J1PH 3SO5A 3NPSC 1NBZA 4MJIA 4GQ9H 2XQYG 2OSLB 4OM0H 4HBQA 2FATH 3BAEL 4WI5A 2XQBL 5F8RC 3WUZA 3GSNA 2Y6SD 2BOBA 1CGTA 5BV7H 2G9HA 4Z8FH 4HFUL 1AIFB 3UTOA 4KI5C 2RJMA 2MSPA 5C2UB 3BQUD 5LCVL 3HA0A 4PJHB 3V4UH 4F80A 2KDGA 2O5XL 2VLJA 3CSYA 4EQ3A 2JJVA 1JE6A 4FQJL 4MXQD 4UT9H 4PJ5A 3F12B 1XGYL 3W39A 4DUVA 1MUJA 5AUMA 4LPUA 3BD3A 4DQOH 1AFVL 3SJVA 5IKCB 1NMAL 1DQML 3HNTL 3HC0A 3QAZC 3LD8C 1N6VA 2YN5A 3BSZH 4WW2C 1KBGH 1GC1L 4HT1L 5DMJB 4OJFH 4YHPA 1MY5A 1ORQB 4LCYA 2R8SH 3HG1A 1W8NA 4RGMB 4RZCA 4E42B 4KPHH 4MQ7B 5B8CC 3UMTA 1T4KA 3ARDC 4U1LA 1NAKH 3GRWL 3VGBA 4ZMAT 3IDIB 5DYOB 1TJIL 4XBGA 5DRWA 2MTPA 3IGAA 3U9PH 3QH3B 2M2DA 5BXFA 1T1XB 1JF1A 1DBJL 4XXDA 3BWUC 3WDIA 5EBGA 1RVFH 1UXWB 2Q86A 4NKDB 2NY4D 1DBKH 1KUMA 3DTXA 5HDQH 4HF5L 2BERA 1CXFA 1UWXH 4HS3A 5J1SC 3GZKA 3C08H 2RFXB 4OB5L 4ISVA 5F6IC 5HYEA 2YSSA 3C8HA 3OKDA 3PIQA 3EO1B 4S2SA 4U31A 1UJ3C 2QQNL 4KROB 4QXWA 4NDMB 2X4PB 1A0QH 3BP7A 4KKNA 4Y2DA 1VDGA 1JPSL 3VGEA 3FB8B 4JR9L 4PB0L 5DVMA 4TSCH 4LCWB 1B2WH 4OD2B 3TN0B 2AJZB 1VFAB 1MH5A 1DEEB 1H5BA 1MCIA 2IANA 1CICC 3ESVF 3PGCA 4K3DH 1KJ3L 1JHLL 5FECB 2F54D 1C5DA 1RK0A 4NRXB 3W9EA 1NJ9A 4PJ5B 4PS4H 4RGOH 4ODXA 3VXMD 2VZ1A 4XBPA 2YPLA 4LHJB 4EOWL 1RFDL 5FOBB 2C3XA 3I6LD 1MRFL 4PRAB 2UUDK 3QHZL 1C08B 5E2WH 2CMRH 2NTFA 1IGCH 2KPNA 3QA3A 1INDH 4KK9C 4C59B 4XP1L 4IRJA 3BIBX 2ID5A 4WV1C 3VXQA 4PLOB 1KGCE 5BV7B 1NC4B 1BM3H 3PP3H 5E5MB 1AR2A 1QSFD 3MFGB 3WLWD 1N64H 1RURH 4KQ4L 4H8WC 3DO3A 5F89B 5EPMA 5ISZA 3MO1A 1CFTA 1NFDA 3O4LE 3SQBA 4YE4H 2P7TA 1UH2A 2D03L 2XZAH 5SX5K 5LVEA 3JTSB 4D9RD 4LPVA 1Q9OB 5EN2A 3M45A 5EOCJ 2PO6A 4LSUH 5D1QA 3VI3E 2D9CA 1WWBX 1IM3A 3NIGF 3WN5B 4EI5D 3MZGB 1JK8B 5BZWA 1SM3L 2Z31A 1JMZA 3QUYB 4RGND 1BQHA 2QLVB 1Q9LB 4OFKA 3SCMA 3RX8A 3C6LA 3VXRA 3B2UC 4PJ7A 3G5YB 3ABZA 5DK2B 3OKYA 1NEZG 3L7EB 1NCBH 1NGYA 1A2YA 1WTLA 5T3XH 4QRUB 4G6FB 1AE6H 4FQ1H 3FO0L 3QNXB 4NWTH 3VJ6B 1IKNA 4H1LA 3WFHB 2HFFA 4WV1A 1MREL 3C09B 4U6XA 1KPRB 3C6SB 5FGBA 4JFDE 3RKPA 3HPJA 3U4BL 4YXKH 4Z7VF 4LCWA 1J8HD 4Z8FL 3RVVD 1UWGH 1JNNH 3EBAA 5CZXD 4P46C 2V7HA 3QEHA 3EYVB 2Y36L 1HHIB 1EBAA 4ZFFB 1FZOA 4NZUL 5IFAL 2XRAL 4ZS6C 4F3FB 4WY7H 1BX2B 5E8PB 4XRCA 3HI5L 5T3XE 1Z0MA 3W0WE 4I0PC 3T77B 3CVHL 3L3OB 4J6RH 4KVNH 1QSFE 4TVSa 3D39E 3VA2C 3U7AA 1F3RB 1FG2A 1C8PA 3NIDE 2H9GA 3NCFB 3PWUA 4XMLL 2R4SH 3MRMB 1NDGA 5D2LA 3IS0X 1RPQA 5EFIA 3H9SE 4G7YL 1WCBB 2VNCA 1CD0A 3P4NA 4X0KA 1OF2A 1NANI 5ANMB 2OM5A 4OIIH 4LPXA 5F9WC 4AEHL 5E2TL 4PJFF 5TE4L 3BH8B 5JO5A 4OCYL 2UY7A 4ODSL 1ZLUK 3GSXA 3P9LB 2PNDA 1KN4H 5D1QB 3DX7B 3VXSE 2VXQH 4M6ML 3TYFB 3FFDB 3ULVH 4WUUB 3KLDA 3QXAB 4O02L 5CJOL 2BP3A 5F1NB 1V3KA 4XGZB 4D9LL 3SKNB 3LEXA 5HGHA 4E9LA 4S1RL 5MENE 5I17A 3MBXH 4WFED 4F9PC 5C0DA 2BXZA 2QJDA 5CUSH 3RWGA 1ROWA 1AP2A 1CLZL 5HYSB 1S7XA 2FECL 4L1DA 4UDUB 5FYJU 3VFOA 2V9RA 2Y6SC 2G60L 2ATPB 2YMXH 5FXCH 1ZA3A 4LQFL 5INDB 3O3AB 4U0RB 5BVPL 3QCVH 4PGCB 2FX8H 2X1XR 1OTSC 1BFVL 4ZYKB 4OFYA 3EO9H 2FEEI 3ILPB 3P4LA 1D5MB 3K0WA 2HFEB 1E4XI 5T3XD 3T1WA 4XNXH 4TSCL 4QXTA 4P23D 1I9RH 4WUUE 4Y5XA 5F7DB 2MHAB 2GKIA 3MLVL 3K1KC 4C58B 1CFSA 5MEND 5DJZB 1I8LC 2H26A 4F3FA 1OQXA 1M05B 1JF6A 4R96B 3NBNA 1A6WH 4U6VH 2EDLA 5FDWA 1C12A 3QUMH 1CD1B 3VMNA 4HH9A 3RZWA 3VFTA 3QIUB 3QQ4A 4PRID 4FXKA 5KG9B 3MRRB 3QQ9C 2VZVA 8CGTA 4ODUA 4G7VH 3TZVC 1N6QH 5DJYA 5JTWA 4LPYA 5CSBA 4NN6C 2A6JA 2J6EH 3WYRA 5HVHB 3RIAK 3ZKXB 1XF1A 3D69B 5MEOB 1BM3L 3T65A 1TXKA 3O2VH 4KMLB 2UZIL 4Z7OE 4AMKL 5FYLE 3HNSH 4KQ4H 4H5SB 4QRRE 3RWHA 1HINH 1LDSA 4HW6A 2QHRL 3V4PL 2EECA 4LSSL 1U8PB 5DFVD 1CR9H 4H20L 3TT1L 1KCVL 1CF8H 3V7MA 4MX7A 3EYFB 2VL5B 3GMQA 4N0UA 4ZUTA 3W9DB 2C3WA 4JM2A 2HT3C 4Z0XA 3VE0B 4O2CB 2OZ4L 4O51A 5E94A 2ADJA 3QIBC 4QO1A 4MS8D 3O41A 1SEBB 1SM3H 4XMPH 1MVUB 2D0FA 5I17B 1EUUA 1AXSB 3ZE0F 1FNEA 5C9JA 5JHLL 3VG0L 4PJ9A 3SBWA 2OTUB 3MV8D 4QF1A 3V6FB 1MRCH 1U3HB 1XCQA 4YO0A 5TJWK 4NP4L 4ODWA 4KXZI 1QBAA 4TULH 5DVNA 1UWEL 5DUBA 5KSAA 4UB0L 1IEAB 2F53E 3CXHK 1A1MB 2YD3A 4NQUA 1B4JL 2Y5TB 1XH3A 1KEGH 1AR1D 1IGML 1CFQB 2G5RA 4NQVA 1RZKL 5DJCA 1P4LA 1FFPA 1AR1C 3RWJA 3AFLA 1A8JH 1T0MB 1NKRA 1AQKL 1PQZA 4M8QB 4OQTA 2Y7QB 4LRNH 2QTEA 4H0IA 4WU5B 3DMMA 3NCJL 2SEBB 3VDCA 5L88H 3WD5H 4KHXL 2K7PA 1YPZB 4XPBH 3HI5H 1R5WB 4H25A 1KPUB 1YEIL 3GBNL 5FO9A 1IGYB 1G7MA 3TT3L 4GMTH 3RA7L 1MFBL 4GBXB 5GGVY 3LS4L 2A0LC 1PX3A 1VCAA 4HX1A 1AO7E 1K3ZA 2BSSB 1EFQA 2V2XA 43C9B 1RZ7H 1T4KB 1A6VL 1K6QL 2YWYA 3U0PA 1JFQH 1GZQB 4U1GC 4WCYH 2X4QA 1CDYA 2PTTB 5ECJE 5IJKA 5EBWA 4JY5L 1P7QA 4NQDD 1S7SB 3ARGD 3LKQB 1ZLWH 1NMCB 1VERA 5B39G 5HYJE 1C1EL 3MSPA 4OLXL 1NCWH 5C2BH 3PF2A 3DHJA 25C8H 2O26U 4V1DB 3AS0A 4JFQB 2Q86B 4DVBB 4XP4H 4JFXA 1I7RA 4W6WB 1NGWB 3T0XA 4XXCC 2R9HD 4D9LH 3ZE2E 4L8BA 3L3JA 5CWSA 4DTGL 3RBGA 2ZCHH 1EO8L 1QPPA 1AHWA 3MRQB 4ZPVB 2FJFA 3QXVA 1U3ZA 2MWCA 3QIWB 3RY4A 1K85A 1L0YA 2ZCLL 3K1DA 1LQSR 3CFIC 2BK8A 4PY7A 4S1QL 1AKJA 1IM9A 5I1JH 1KPVA 5C09A 1RZKC 1NANH 1RUQH 4XHJD 3L3IB 3RL1B 1UKQA 2AEQH 3FZUC 5DHXB 5DJCB 5D70H 3TN0A 1S9VA 4CVZB 3MGTB 4WHYG 1UJ3A 3SDAD 4GAJL 5DHYA 2P5WB 4LMQE 2Y7QA 3P0YH 2IEPA 1HHKA 3D18B 3H42L 1MOEA 1TZGH 4YHOL 4EI5B 3NGBB 1Z5LA 3MLYL 1E27A 5I8KH 1YPZA 2GTWB 3CH1B 4Z7WB 1LE5A 4ENEC 3BUYB 3N85L 2IADA 4ZOBA 5IMMA 3N1QC 2Z9TA 5TGBB 3PWNA 3C60D 4FQIL 4YPGB 2VUOA 4F37K 4ZXBB 5D7IB 3VGHA 1MAMH 1D9KD 2XXCB 5IEHA 1A7BA 2IGFH 4ODVL 1CG9B 5ABDE 2P5WE 4PJFA 1LO4H 5B39A 4ZFOB 5A16A 5D7LA 4JVPA 2Q6WA 2PR4L 1LP9B 4O5LH 4POZD 4ERSH 1YMHB 4AL8L 3MX0A 4U6YA 4OSUH 4MNQB 3RDTD 4BSWA 5HPMA 2NY4C 2DM3A 2UYLA 3TBVA 5ANME 3RWDB 5ENWB 1UZ6E 3QP3A 3LN4A 4NQEE 4RDQG 4D94A 2V17H 5T1LB 4MJ2A 2FJHB 4DVBA 2GIYA 5L2KE 5B22A 3CFKB 2F54B 3FQNA 5B3NA 1DSFH 5CWSB 4P5TC 2BNQD 3MRKA 4LMQI 5I1EH 4RA0C 3CD4A 1F3DJ 5HGAB 4OUUA 2E7BA 5TH2B 3X13B 5GS2D 1KIRA 3MLRH 3RAJH 1UG9A 3KGRA 2I27N 3UZEA 3D48R 1SEQL 2CXGA 3CDGB 2X89D 4UI2A 2IF7A 3BKCH 2ZOKA 4BUGA 3BPCB 1UC6A 5IQ9A 1P7QD 4K23L 3C6SA 1ZHBB 3O6FC 5HHXH 3MV8E 1LEGA 1A3LL 1A1NA 1F3JB 1J8HB 1M6OB 5L2JA 3VU2A 4JCMA 1ZT4B 1YEFH 4IHOA 1D9KC 4JAMA 2VH5L 4TTDC 2CRYA 2O5ZL 4G8EA 3V8OA 2BNRB 3CZFB 3C9NB 3MYJA 1VEOA 4IDJL 7FABH 4WGWB 2PF6A 4I18B 3ZKXC 5T3ZE 4M8VA 1I1RA 3SQOH 4YDKL 3CXHJ 1BECA 1PYWB 3GMNA 4ZSOE 3HS0B 3PV6A 4R97C 2DWDA 5CIPA 3PWNB 1KACB 5C0JB 1UCTA 2YZ8A 2XACC 1QSEB 3NZHH 4PJDB 5DJ8A 3H3BC 2GW5A 2NZIA 4LDEB 2RCSH 1OF2B 5B4MD 1A6VH 3UPRB 5E2JA 4I13B 1BIIA 1K5NA 1ACYH 1KCRL 1HH9A 4YBHA 1INQB 3KPQA 5HI5C 4Y1AB 1F2XK 2IG2L 1VKXA 4YIQA 1MAKA 4NBXB 1YYMH 2CUMA 2JJSA 2GCYB 2R69L 3X14B 5GGTH 2EDDA 4EXKA 3BOVA 4R0LB 5FV1L 3UEZA 4CVWA 4LCWE 1IE5A 5BRZD 5KVGL 1IC5H 4UNUA 4XPTH 1J7VR 1MF2L 1MJJA 3MJ6A 1ZVYA 4KKLD 3BN3B 4U3HA 3L3GB 5I16A 5CLTA 3NA9L 4P2YA 2ZCLH 1TPXB 5C71A 4ELMB 1YEJL 4AJ0A 2RBLA 1C16B 3FQRB 3KLHD 2AK4D 4L8SA 1FLRL 1BVLB 5SWQA 2G5BB 2MNUA 1G0DA 3JV6B 4KK5C 5EBLB 2EKSA 4KFZC 3NCYP 1J8HA 1M6OA 4NO2B 4LCWD 4G6KL 2EYRB 3L5JA 5GRUL 2VRAA 3DETC 3FMGH 5TF0A 3WO4C 4OLWH 3MQIA 3I2CL 4MNQD 4TYUA 3RDTB 1A6AA 2W65B 1FNSL 2DOCA 1K2DA 5FDWB 1UFUA 3OX8B 4PR5A 3RGHA 4Y2OA 2EO1A 4JM4L 3DSFH 1RV6X 5IVXB 3T2NH 2C26A 1D6EB 1FGVL 2W07A 1NUDA 1Q9WB 3BW9A 4PRNB 4MSWB 4YHMH 5D72H 4MDJA 5MI0C 3H7LA 5LCVH 5CSZA 1A1OB 5SWZA 4ODVH 4DZBB 4ZODA 4PJAB 2IFFL 4GG8B 1IL1B 1QRKA 3PWPE 5HHPA 4YX2L 4NJ9L 2J4WL 1XGYH 4J1UB 4M7ZC 1DBAL 5DJDA 4O9HH 3FL7A 1H8SA 4KTEL 4YIQB 4K2UL 5CKAA 5B3JE 2HJKB 3H0TA 2VKWA 3C09C 3LIZH 3N1FC 4JRXD 2IH1B 1GC1H 1KJVB 2V17L 1QSZA 4OJFL 4HIIB 1M7XA 2FR4B 3HZKB 3CU1A 3HCVA 1Z9SA 4EXPX 5J3HD 4NM8L 2JJWA 1BQLL 4LHUA 3MA7A 2V5MA 4X4XB 4GKOA 5E70A 2P8LB 4MAYA 1HCFX 2C4XA 5SX4I 1OP5K 1ZHLA 3BIAX 4GKZA 4NN5C 4LLWA 2NY2B 4LARH 4QF1B 2VDQH 2VL4A 5F7MC 5HHOB 3DX9A 5DR5H 2EICA 1J18A 1C5BH 2FSEB 2D7QA 2QADB 3QUXB 4X6DA 1Y0LB 5FKAA 2XA8H 4JREC 5AYUH 5LGHL 1GGYA 1IEHA 2F8VA 3TCLA 3KLAB 2HG5B 5GSVA 5DJ2A 1AD0B 2FEEL 3K4ZA 4ENED 4G3YH 4LVEA 1FVDA 3IDYC 1VGKB 4DW2H 1SQ2N 4Z95L 4IRZL 4AEFA 2LVCA 3GIZH 2O61B 4GRMA 2HTLC 1TCRA 1I8MA 3ZE2F 5DQ9B 1CLYL 1JUFA 3GHEH 4OBSA 3PGDA 4OGZA 4Y89A 3QEGL 1FAKT 3TM6A 1DQJB 5FO8B 4JKPH 3DUHA 1K4CA 1XF2B 3MLTA 3HZMA 3FOLB 3V2AR 1A9BB 1W72L 4HIXH 4HUUB 4OF8A 1CE6B 2YD6A 4QHUB 4KJPC 5DC0A 2BY2A 3TH2T 3QNYB 5IF0A 4NUGH 3V52L 1WZLA 1A7NH 1KGCD 2EDTA 3V7AG 1PJ9A 2F5BH 5FB8B 4L4VB 4TUKH 4FFWC 1EBPA 1B6DA 4HUWB 9CGTA 4J3TA 1KFAH 1H3GA 1OTSD 3B6SB 2R29H 2DBJA 4Z7UB 5DTFB 1INDL 2EKJA 4HJGB 2BHYA 2CLZA 5JW4N 4FABH 4MB5A 1LE9A 2XFXA 4JPKH 3HMXH 1PSKH 4YHZL 2EDRA 2P44B 3ESUF 2C7UA 2D3VA 5M7QA 4MNQE 3O2WL 2VDKL 4U1SB 4WFFD 2P4AB 4X4XA 3AM8C 1YUHB 5F7FA 3H9SB 3RUGF 1EHNA 2DQTL 4D3CH 4I0PD 3VGFA 2FDBP 3DX9B 1G1YA 3UXFA 1GXEA 5ADOH 3CVHA 4NSKB 5KS9B 1X6NA 2A6DA 4PY7B 5IR1B 1KJ2A 1JTOA 4MJIB 1DQTA 2OXHA 3O6KH 4K7PY 1KC5H 3LPGA 2VC2H 4U05A 3KLAA 3T2PA 4PJ8C 3ZDYE 5BRZE 4LNRB 2VUYA 3WE6A 3BYYA 5D93B 3ZTNH 4RISH 1TJGH 5DMYA 2HVJB 4WI2A 1QYGL 1CI5A 3T3PE 4WENB 3M1BA 1TETL 1I3GH 1LO3H 4Q74A 4F7PA 1I7ZB 4YNYA 1T7WA 4IRJD 3WL9B 1TVBB 35C8H 2AV7B 5I1AB 2HN7B 2QHLA 5KVDL 2AXGB 3TBWB 1J8HE 4JM4H 1EZVY 1UENA 2YEZA 5KZCB 3TIEB 5HI4D 4JFDD 2X2YA 4XBEL 2P8PA 4PRPA 4PTUB 3SJVB 1FGVH 1KNOA 1IGTB 4U4BA 4LGRB 3CFEB 2A9MH 4UZGA 1FIEA 4OZFG 1X5FA 4R7DB 1FIGL 2V9TA 4OGYH 2KZWA 3P30H 2ADIA 5F7NC 3H9HB 1U8JA 4H88L 3WNMA 4KKAC 1RIHL 4PGBB 5BRZB 4LEXL 3VW3L 2R0ZL 4JGUA 2XRAH 5GIRB 1NEZB 2J4WH 2EO9A 2JJTA 1MCLA 3K8LA 4FZ8L 4KTEH 4N1EA 2H41A 3TLRA 3NVQA 3OKOB 4G6FD 3MFFA 1Q9KA 2V2TB 5MEPB 2IBBA 3TN0C 1E4KC 2VXVH 4Q9QL 4HKBB 4G7YH 4P23B 3GBLA 1RJCA 1INEH 4J4PC 1AGBA 4GRWF 5C0EA 4X83A 4HIJB 1PZ5A 3HLAB 3VD7A 3EDEA 3MRKB 1QSED 5F72S 4YBLC 1F4WH 5KSAD 2HLFD 2A6IB 4YBQC 3BO8A 3CDCA 1S7VB 1D5BA 2VLRB 3ALPA 3HE7C 2DKSA 5EIVA 1X5XA 2W60B 4L29A 5D6DA 2F5AH 3QDJA 5F6IB 1DZBA 2O93L 5E2VH 4LAQH 3HE6A 2YN3A 3NZ8B 4JFPA 5C92A 1X4ZA 5JOPE 1R3IH 3LV3B 1I9IH 3JWDC 12E8H 4JFEA 4WNQA 3EOYG 3C5SA 4OZIA 3ULUC 2E5EA 4HLZH 1FO0A 4JQIH 3IFOA 4P48A 5E5UB 4WHDA 5EO0A 4MQXC 3QI9C 2LV4A 4MCYB 4EN3C 1FN4A 3P9WB 2VZ3A 1UM6H 1X5GA 3HRZA 3OR7A 4M43H 3ZT7A 3WL9A 3HMXA 4U1GB 3W2DL 1YDPA 1XGPA 2WBJA 4PUBH 4M1GH 5MI0B 2HTKC 4KRPC 2VLME 1GC1C 5BVPH 4NQED 2VYRE 5L7XH 4PTUA 3GMNB 1HH6B 2PCPB 5FUOH 4IDLA 4DN4L 4FQHA 5EC2A 2WQ8A 3KHOA 2FHCA 4Q6IA 1HHGA 4PJ5D 5IB5A 4YUEH 5IHUH 2BNQB 3OJ2C 3KPRB 1BGXH 1JGLH 1T1YB 1R3KA 3MGOA 1WIOA 4AY0A 1QO3B 1AC0A 2R2EA 4P2QB 2GY5A 4PJIB 4TVPH 3WLBB 4TUKL 4FFYL 1W8OA 3LSOB 5HYFA 2DDQH 3ARXA 4G9FD 4HIEA 4GXVL 3U0TA 5I0ZA 5IHBA 1A4KA 4LLQB 5C0BA 1GHFL 1FFOA 1OVZA 1JYNA 3UCRA 3CNKA 3JTSA 4NZRL 4KROD 1FYHB 3JWOC 1FNGA 3MRHB 3K80A 1QFWH 2ILLA 5EWIH 2UZIH 3BT2L 5JUEL 4YGVB 2ZUWA 3N9GL 2EDNA 3MREA 3CFDB 1KTLA 4Q9BA 2Z31B 5CEYB 3U6RA 2ICES 3ZLQC 1SBSL 3R8BB 4HF5H 2XTLA 1KEMH 3TJEH 1JRHI 3DPBA 3X3FL 5F9JB 1F97A 2ZUVA 1NGXB 4QRUA 5AWNH 5E6ZA 4W68A 5DGQA 6FABH 5F96L 3MLWL 3WIIL 3ES6A 1LK2A 4FTVE 2UWEA 1BZ7A 1KPRA 3SOBL 4LK4A 4QXGH 2IPKB 3SDAB 3SKMB 4ZO8A 4KTDH 4X9FA 1NAMB 2OR7A 4RWYL 1FVCA 4Z7VB 5MERA 5IB2A 4HKXA 1B0GA 3GGWA 1H3TA 3MCLL 2HP4A 4UB0H 4N0RA 2YR3A 2ERJB 1TCMA 3HN3A 3SDXB 4Y8AA 3CJJA 1VACB 5AD0A 4BFIB 3FQUA 4L3AA 1FRGH 1XFPA 2Z35B 3TA3C 3WHE1 4N8VB 3ZKMC 1RZIA 1MQKH 3V7AE 1QLFA 4HK3N 3E6HA 2R2EB 1SY6H 5CGMA 1IL1A 5E5RB 5HHPB 4E41B 1EFXA 4V1DD 5CAYB 1CN4A 3FQTA 4R2GC 3LPWA 3CLEL 4P3CH 3UJJH 1U8OB 2X4TB 4NO0A 1W0VA 1S7QA 3HC3H 2Q76B 3S98A 3LKNA 3GSXB 3VXQB 3NABH 4OBRA 2UY6A 1QFWM 4PY8J 3TN0D 3FQXA 5IFJB 5IQ7L 4K55A 3QUKA 3RUGA 4JFOB 2IH3A 2GUOA 3ECBB 1GGBH 3MA7B 4HIHB 1AGDA 1BBJA 3ZE1E 5J06A 3SE3C 3FO9A 2VQ1B 3IETB 1S7TA 2F53D 2PXYC 5HYSA 1S5IL 3MV9A 5E2VL 5EOCL 2QR0A 3EFFB 4UU9B 3D9AL 4G42A 1DUZA 1XGUB 1BZQK 1QSVA 2VXUH 3S35H 4M3KB 4AG4H 4QHNB 4U1IB 3TO2B 1NBZB 4GJTB 5JZ7C 2OSLA 3UO1L 4M5ZH 5GS0L 2EDKA 1ZT1A 2N7BA 2AK1L 2N4IA 2OJZH 3QDJE 2BVTA 3SBWC 4XWGL 3LRSA 5AZEH 3VG9B 2A74A 4C57C 3VFPA 1HYSD 2HT3D 4AENA 3KPNB 3MRFA 2MOVA 3BDBA 3G5YA 1I85C 3ALWA 1DN0B 5T3ZD 2D31A 4PV8B 1F4YH 2Y07L 4M1GL 4YGAB 1M05A 1IGIL 3G5ZB 4WW2A 3WFHA 5F7LB 4NZUH 4D0DA 1D3CA 1ZS8A 1KIPA 5E5MA 4TRPL 4OKVB 3IJSA 1SJHA 2P48B 3M07A 3GUTA 5ID0A 3MLUL 1EEQA 4DGVH 4PJBF 1GIGH 3FTGB 5C08A 1JZ6A 4NRZB 5IVZA 2AV1B 4LKXB 4HDIA 1I7TA 1MIML 3QZWG 4OF6A 4E0RB 4RZCB 4E42A 1T5XA 4XRCB 2D4DA 3ZDYF 4PJCA 4C56A 2ZKHL 3ORJA 3MACH 5CILH 1RK1B 3O3DA 3KPLA 3QEUB 1U9KA 3BQUB 5D2LB 4HZAA 4PGZA 3WFEL 4C56D 1QFWL 5EWIL 2A83A 3HZVA 2DIAA 3WIFA 3MRDB 4YHKH 4EBQL 1GOHA 3HPLA 3DTXB 5HDBF 5BOPA 4GW5B 5JNYA 4PJGF 1AXSA 4HEME 2X6MA 2VQ1A 4ERSL 4G80B 4FG6D 2ESVD 3EOAA 1XR8B 3VFGL 2WZPD 2APTA 4OI7A 3QUZD 3MOAL 1FE8H 3RVWC 1CLZH 5HHOD 5AG8A 5DQDL 4KRPD 4MJ4A 5ICXA 1KJ2B 3LMJH 4M1DH 2A1WH 4LEOA 2B39A 4D8PA 3MR9A 3MROB 3IF1B 1HXYB 2FIRT 4XNYL 5CHNA 4WJ5B 4KDTC 3O6ML 1OTUC 5JA9A 5D7JC 1MWAA 3T2OA 5DZNA 3PWUB 1NGQH 4ZXBC 2BVPA 3EYOA 5D1XB 2NXYC 1WCBA 2QL1A 4APQD 1QOKA 4OF5A 4NKMA 5I15H 2F53A 2MHAA 4QEGA 2NY7H 4G7VL 3WFZA 2CGRL 1T2XA 5J56B 1U8JB 4N0YL 2VB5A 3JTTA 3EDFA 3AMLA 4CVXA 3F6IA 5DMKB 2W9EL 1NEZA 5I1GH 1ZTXL 3UZVB 1CFVH 1HXMA 3DRQA 3QIUA 1IQWL 2B20A 2VTFA 3QWQB 1IAKA 3MOBH 1DVFA 2MMXA 1CCZA 2DN7A 4YDKH 5F1NA 2IPUG 4MXQC 4NOBA 5CJBA 4NGHL 2Y4SA 5DRXA 4P2OA 3TWCL 1CF8L 5C0DB 1X5IA 3QFJA 4MXWH 1IC4H 1IGFL 4LNVA 4M1CC 1MCPH 2GJZB 2XA3A 4FZEH 3FRPA 4Q97A 2VDRL 2JIXD 2RCSL 2ZG1A 3MRDA 3NMEA 2F74B 4U1LB 1HQRA 3HPLB 4D0CA 3PDOB 2FZ3A 2VO5A 1S7WA 3U4EA 4OAWA 1IILE 4ZTOL 3C5ZC 3GJFB 1HI6B 2Q87A 1T6VN 1EHAA 5FGBC 1E4KA 1V7NH 3QCTL 3IVKA 1DQLL 5GGTL 1H3XA 5JW4Q 1I7UB 3UO1H 1IM9B 3C5SB 4RGNE 4TULL 4DEPC 1UWEH 4UQ3A 3CH8A 4ZOCA 4BUHA 4GRLA 3ZHLA 5HYQB 1B9ZA 2P43B 5CZXC 4ISVB 4PJBA 3KPPA 3BWAA 3MV11 5D93C 3L3KB 3UTSA 4OLVL 3QPQD 4S0TD 4GRLD 3AUVA 4YDIH 1T03L 4XCNB 4UUJA 2IAMA 2GTWA 3CH1A 1WEJL 1YEHL 4K3EH 3ARWA 1KCUL 4P9ML 4P9HH 2E6JA 1NBVH 1T0NA 2HLAB 3O4LD 1MH5B 4DGVL 1FDLL 4RGNB 1HOCB 1H3PH 1ZVHA 3VGDA 3V0WL 2YPKB 4XCFH 5K9QG 2YKLH 4NO3A 5IBUG 5JOEA 3VRLE 5ELIA 5F1IB 4CAGA 3IGAB 4KV5F 1HXMB 1FNSH 3Q6FA 2FO1A 4MGXA 1UXWA 3F62A 1MFEH 3SE4A 1DN2A 3BZFA 2X1QA 4G6AC 4JG0L 3S34H 1RIVL 3UC0H 1OAUH 4PJ7F 1MWAH 1MLBB 3V5HB 1UQSB 3CUPA 3JVGA 1KTRL 5ITFB 4OLEA 4S2SB 4F33A 1X9QA 3QXAA 4HXBH 4RMRA 1ZANL 4J8RA 3GMPA 5T33L 1O0VA 3STZB 3FB5A 4X6EA 1EH9A 5CEYA 1P7QB 4CU8A 5K9JH 5JW4M 4I4WA 3R0NA 4NQCA 1MCJA 4LDOB 5I1HH 2OL3A 1S7XB 1T5WA 3KPMB 3NN8B 1EO8H 4JDZB 1KOAA 3WS3A 5JW3H 5ETUA 4HZLA 4LIQL 1Q1JH 2X4OB 1I7UA 4BFBD 2OMNA 3DRTA 2PYFA 1A6TB 4ZYKA 4GLRH 3SKOB 2F8OA 4WWKC 1ZLVH 5KN5A 1BQLH 1NUFA 2YD4A 3PGFL 5CEZE 4JJ5B 4FQCH 5FA4B 5D70L 4WW2F 4WIQA 3ARDB 2VDQL 4P4KB 5IB2B 4Z77B 5DR5L 3P0VH 5DRNA 1GGIH 3V6OA 3DO7B 3BXNA 3G9AB 3OXSB 4FFVC 4MD0B 3S3JA 2EH7H 5K9KA 3PV6B 3OB0K 4JQVC 5DD6B 5C0JA 4N0YH 3WUWG 4JFFB 3UTTB 4PGDA 4MNHB 3FO2A 1QLFB 2FNBA 2E8ZA 4DUWA 5IGXL 1CFVL 5K9QI 3VFNB 4PJDF 2AAVA 1I3RA 1U8KB 1GCFA 2FH6A 2NPLX 5I75C 1XIWA 2ADGB 2VDNL 1F6FB 1FG2B 4NUJB 5GZOD 5L2KA 2H9GB 1KIQA 1E4WH 5MEQA 2A9NH 3BQUC 4HPOH 1UQSA 3CUPB 3WHXB 3X14A 3RZCB 3CFCL 1H15A 4FZEL 1SJEA 3P4NB 4X0KB 1HSBA 4M61B 4C83B 1A2YB 5JQHC 3AS2A 4YBQD 3EJJX 1DE4A 3WXVL 3QUYC 3OR6B 5FUCE 1KFAL 5I1EL 3ZZ1A 4WU7A 1T5WB 3NN8A 1YPZE 4PRPD 1PX4A 2FX9H 1RU9L 3WKNA 5DEGB 1HWGB 1Y18B 2LU3A 1L9MA 1IEAA 5SWQB 1A6TA 3AAZB 1MFAL 4MJ5B 3WSQH 1XH3B 1M71A 3O2WH 3F7PC 4Y4KD 3S5LB 2VSDA 1V5JA 3FAWA 1MQ8A 1S9YA 2CSPA 5EU6E 5ILTL 3MRFB 3LKSB 1OP5H 1HHHB 4UDUA 3QFJD 1T80A 3FO1A 2DQCL 2WW8A 3GSWB 1MNUL 3HE7D 1WEJH 1PAMA 3OXSA 5GGRY 3OX8A 7FABL 5J8OA 4PYHA 1P1ZB 5DD1L 4PLKC 5KSUB 2GT9A 3IJSB 3BPNC 4DAGL 4XTRD 1AHWC 1U8MB 2AEIT 1WBXA 1CQYA 1QEWB 2YKLL 4RBPK 4X4ZA 5IJKC 3IFLH 1QP1A 4XVSL 4BZ1H 2BNRA 4JM2F 1HQ4A 1SJVA 3ZTJG 1LO3L 2WUCH 4RNRB 2Q8BL 4QRPB 4OGXL 4PBXA 5IVXE 4E0RA 5CJXC 1MFNA 3VFNA 1QR1A 4GG8A 2OBGA 4H1LG 2CO6B 4J3UA 1DLHB 4OTXL 1RMFL 1P7HL 5F1OB 5T1LA 4GG6F 3HS0A 2DICA 4XBEH 2FGWL 5SWSE 4K8RC 4OD1H 5DGRA 1OAUL 1FIGH 4KKAD 4HGWB 5CJQH 4XI5C 2AP2A 2K7QA 4JPIB 3V5KB 3WMSA 2I9TB 2I9LB 3QWOB 1KIRB 4XVJL 3H9YA 3A0OA 4MA8L 1EEYB 4IOSD 1AO7A 4CNIB 3B9KC 1QRNA 4LLUA 5K9JL 2ICEB 2EIZA 2A6KA 1LEGB 1DQDH 1AHWB 2EDYA 3P2TA 2P24B 5JPNA 4I3RL 2AXFB 2BC4A 3BGMA 4JPVH 4ELKA 3MRBB 5FM8A 2F19L 1MHEA 4PRHD 5J6GB 1I1AD 2WIMA 1AKJD 4NJAH 5TFSL 5JLZA 3QDGD 1XF4A 5EH1A 4LLMA 2CPCA 5LGJB 2FJGB 1F4WL 5I16B 3DJ9A 4PLKD 1YNKH 3LKSA 1YEKL 3QUMA 2F5AL 4BYHA 4RDQF 1DCLA 4OGAD 3VWJD 3P0VL 2R0WL 1DFBL 1GOGA 4NQTA