2DLFH

High resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 6.75
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
EVKLEESGGGLVQPGGSMKLSCATSGFTFSDAWMDWVRQSPEKGLEWVAEIRNKANNHATYYAESVKGRFTISRDDSKRRVYLQMNTLRAEDTGIYYCTGIYYHYPWFAYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The pH-dependent structural variation of complementarity-determining region H3 in the crystal structures of the Fv fragment from an anti-dansyl monoclonal antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)-KAPPA (LIGHT CH
total genus 28
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dlfH00
4XC1L 2JCCB 1WBXB 1NAML 3OX8B 5D1XB 4PJBB 1LE9A 1VGEL 2NXZC 1NAKH 3TPUB 3KNBA 3OKEA 3OHXA 5HTSA 4Y19A 4MNGA 4HKZB 3QIWC 1A6PA 2DWDA 5TF1L 3IDNB 4M5YL 2VZOA 1U8MB 2ITCB 4I13B 4PRPA 1G9MH 2J5LB 3GBML 5ERWA 5MENA 4NN5C 3WJJA 1IAKA 3BQUC 1CBVH 1A5FH 4X80H 3U4EB 2G5BB 3WLWC 4Y5XC 1XF1A 1JYXA 2AEPL 4Z78B 1W0VB 5TF0A 1JRHI 1IBGH 2AK4E 4DKEH 1NFDA 5E08H 1Q1JL 1FZOA 1RIHL 1UM6H 3EJZD 4MQ7A 4JDVB 1R3HA 4KJQC 2YUVA 4PJIE 3ARXA 1AXIB 5IW3A 3V5DB 1BFSA 3UXFA 5I71B 1A47A 4U6VL 3GKWL 3JZ7A 3WFCH 2IPTH 2WP3T 4P2RA 5B8CC 3N0PB 1ZS8A 2F58L 2VXVL 1YEKH 3FOLA 4G9FB 4Z7WA 5E7BA 4KTYA 3FO0L 5E5MB 2QR0A 4Y4HC 4G9DB 2FJFB 4YXKL 1UM5H 1DQDH 2E9WA 3Q3GB 2V5MA 3CIQA 2ORBH 1CXEA 1U8HA 3HNTL 43CAB 1PX4A 4N1CA 5JPMA 3C6SB 1ZS8B 3BPOC 2HVJA 1HHIA 3S9DB 2CSPA 3QJFB 2AGJL 3OJDB 3MV8D 1KUMA 4UTAH 4QWWD 1D5MA 4Z7VA 4OZHF 4GMTH 4U1NA 2HFFB 1SBSL 1FE8H 3DURA 3MRLA 3NTCH 2VLLB 4XHJC 1T22B 1WZLA 5IVXB 4UOW1 1YEHL 4J4PD 4XBPB 1KCRH 1A6UL 2VDLL 3EO0A 4NJ9H 5FOJA 2CUIA 4UZGA 1LK3L 3WXWL 3B2VL 4HWZB 3V0AC 4OLZL 5KVDH 1WF5A 1DZBA 2YA0A 3CFDB 3MLTA 5DLMH 3T0VA 1HN1A 5TE4H 4XCYB 1A7QH 1IGFH 4XRCA 4QRRE 4TOYL 1JNNH 3DHJA 4I4WA 4X6DB 5DRNB 5KSAB 3ARGC 5HHPA 4GW5B 1IZJA 2KBGA 3CC5B 4OLVH 1F4XL 5D2NC 4NUJB 1F45A 4HPOH 4LK4A 4H88L 5ILTL 3UTZB 4KKNA 1G7PA 1LO2L 2P49B 3G5XB 2OMBA 4LLUA 3WDIA 2CJUH 2AV1B 4OB5H 2DBLH 3FB8B 1MNUH 3NZ8A 4FFZL 3QHTC 1OP3K 1VACA 3VWKC 2VXTH 3MXVL 2UYLB 4DZ8A 3M1BB 4KTEH 2QQNH 3UYPA 1N6QL 1EX0A 3BPCA 3ARWA 4RFNC 2XFXA 5IM7A 1XGUA 4JRXD 4DOHB 4Y16B 4XC1H 1RAMA 3X3GH 1AFVL 5I16B 1BVLA 4E5XB 2RCSH 3FT3B 4LQFH 4XMKL 4OCXL 3TVMD 3MRPA 4KDWA 1RUML 2JJSA 5CINL 1DQLH 5DD5L 4LSUL 5CGYC 3WUWA 5I1HH 1D5MB 2CDEB 5ICYB 2FR4A 2YPLE 2Y5TA 1F58H 3DUSB 4XMPL 3BGFC 5CMAA 3RDTD 3UAJC 3PXHA 4PJIB 3QXAB 5KOVC 3WIHH 4YHIB 1QNZH 2AABL 4ODWA 1BIIB 1XFPA 2NNAB 1INEH 2NMSA 1CDYA 4X99A 4JQXC 4OGAD 4OZFB 4QF1B 4DKEL 1YN6B 4ZTOL 1WFNA 1T1ZA 5E08L 1MJUH 5D96C 3BZEA 1FO0A 3G6DL 3ILPB 1ZHNA 3BXNB 3BVNA 1B4RA 4KI5C 3RPIB 2WBJA 3O0RL 3L3GA 3NCYP 4KKAC 5TE4L 4W81A 4JCLA 1KEML 4XX1E 1T04A 4HMDA 1XZ0A 3MV7E 4UUJA 2PCPB 3U82B 1R3JB 2DS4A 3GSXB 4OBRA 3U9UA 4POZC 4FHBD 5SV4A 1U8HB 4D2NA 5JXED 3G08A 4ZODA 4KAQH 2IMNA 3HTLX 4JFFB 2HTLC 4RZCA 1OWWA 4NHCH 2DLEA 3CFKA 1E6OL 3I3EA 1XGRB 2XG5A 3TVMB 3ULUE 3RVUD 3LD8B 1RUAH 3VFRB 4TQEL 4NQVB 5T1DL 1ZGLP 4PRPB 1KPRB 1MPAL 5SX4I 5D1ZC 5E2UL 2MCPH 1SBSH 3VFPA 1FC1A 1ZT1B 3WN5A 2DTMH 4QOKD 4GLRH 2D7OA 1B6UA 4RZCB 5K59E 3DO3A 3RVWC 3QUYC 3EO0B 3X11B 1A1NB 4Q2ZB 5EA0H 3B9KD 1IQWL 1PG7H 1BQHG 1AGFA 4KY1L 4PYHA 4G8IB 1ZANL 3T8XA 4PGBB 3GSRA 3RWJB 5HVHB 3L3OB 1J1PL 2VXQL 4X0KA 2NY7H 2DQFB 2E9BA 3GI8H 2P8LA 5ESQA 3MZTA 3IDUA 1DE4B 4ODBD 5B39B 4L8SB 3KPPA 1N59A 4L4VB 4PJ5A 5LG1A 4WFFD 1OQXA 2FATH 2WWMD 3WIHL 4JQVA 3WDHA 1NAMA 4TPRH 4KRMB 4TUJA 1LO2H 2EDOA 2ZUXA 3P30H 4ZNEE 4OGXH 4DZBB 1U8OB 5C09A 2FRGP 2HT3C 4OB5L 2YA2A 3SGDI 5E99H 5A2LH 1OTSD 3DX6A 4CN4A 2L4OA 2MJWA 2DQIH 4CMMA 1X4YA 4LSQH 4FN0A 3RX8A 1ZAGA 2GT9A 2QQNL 2UY7A 4PRBB 1N6QH 5IMLB 1AJ7H 4L4TE 4RFOH 1W0WB 3ARGA 1ORQB 4L29A 2QQLH 2LU4A 4IRJC 4NQXB 1DBAH 1J0KA 5F8QC 4KRPC 4ZG1A 4NKMA 3RDTA 2D03L 1HEZA 2IC2A 2YUXA 4OM0H 2FYYA 1FYTD 2PYFA 3T2QA 3DOSA 5HVGB 4P57A 2B8OT 4JPIB 4OIBA 3EO1B 1YPZB 2X7LB 4O2FB 4YHMH 5E7FA 4ZFZB 1CD0A 1OAXL 1P1ZB 4NQCD 1U92A 2VLRB 4EQ2A 1MFAH 2FO4A 2OJEB 3X12A 4XMPH 4P2OA 1QBBA 1OGAA 3C6LB 4PV9A 4WFHD 5IG7A 1I9RL 2KUTA 3R06B 2O5ZL 1CFVL 3UO1L 4X99B 1VSCA 1NBZB 3OKKB 3LRSB 4TNVK 3FT4A 1T1ZB 4RFEB 4A6YL 4XZUA 1RJYA 1A3RH 1LQSR 4JPWL 1ZLSL 3OF6D 3MV7B 4H0GA 3QDAA 5L2JB 3QULA 3IU3B 1QBAA 3KYOB 5D96B 1I8MA 1JHLH 2DM7A 1U93B 4LSSH 5HHXL 3C5ZB 1M6OA 4G7YL 1L0YA 1OCWH 4FMKA 4J3SA 4NQDE 2R4RL 1DJSA 2R0KH 3RAJH 2GTWB 2HLFD 4ZO6A 3REWA 4ODSL 1Y18A 4PRDA 1YYML 5JORB 4Z7OE 3KGRA 1OY3B 5I8OH 1GGIH 5K9QI 4R26L 4AY0A 2VLKB 4QKXB 5T1MB 2XWJB 2IAND 4LCYB 1MWAH 1WBYA 5KANG 4W70A 1NCUA 2R56H 4WI6A 4UV7L 1G7LB 1QFWH 12E8L 3DX9B 4NQEB 4XNMA 5I71C 5EO0A 2EXYD 2YWYA 5I1IH 3GMRA 1RD6A 2HKHL 4B41A 3KXFB 1MFBL 1JVKA 3EZ8A 3HLAB 2J6EA 3AFLA 5CEYB 2HFGH 5EBWB 4HFWB 3DIFA 2IAMC 4KK8C 3SO3B 5C6WH 9CGTA 1I1FA 5SX4H 4CNIA 3KYNA 3NZHL 4HIHB 2EYRB 4WCYH 5FXCH 2JTDA 2BJML 5EIVA 3UTSD 2W0KA 4GQPH 3TZVC 1YQVL 3PL6A 2H8PB 2C3VA 3SGEI 3QJFA 3KG5A 4QXGH 4MCZA 3HPLA 5IHZB 5DYOA 1MAML 1M05B 3CLFL 5GS1C 4L5FL 2X1PA 3ZL4H 4MDIB 3TYFA 4ZS6D 1NLBL 1RVFL 2XRAL 2NTSP 4HS8H 1IGYA 1AR1D 1T22A 1AGEB 2M8XA 4FQXC 3DWTA 4JQIL 2DMCA 3QUZB 2BC4B 3HI5L 5GS0C 1RJZA 4JG1L 4NO5A 2EKJA 4C56E 3N06B 2XQYG 4Z7VB 3PNWA 5E8EA 1OTTD 2D4DA 5L8KB 1XR8A 3MLRH 2MQ0A 4RGNC 2JJWA 4OCRL 1K3IA 2Z9TA 4WUUE 4TULH 4F9LA 1AGBA 1DUZA 5D5MA 4U1MB 4P23D 3ZDXF 4POZD 4DUVA 1QLEH 3HR5B 5GSVB 3G04B 2FX8H 4LLYA 2DLGA 5JXAH 5CD3B 4YNYB 3WN5C 4LKXA 4RSVA 3BN9C 5CAYB 4X6DA 4K9EH 1TPXB 2BMKA 4KI1A 3TO4D 4F7PB 5I1EH 2XYCA 1IL1B 4PJFE 2VJXA 1BLNB 3D85D 2XKUA 1FO0L 5B21A 1TQCC 2ZSWB 3CLEL 4M03A 1UXWA 5BO1L 2DJSA 4OF3A 2ATKA 5EWIH 5D7LB 2PW1A 5KTEH 1KJ2H 5D7SH 5HDOA 4JFFA 4K8RD 5EU4A 5LVEA 4JPWH 5IVNA 3UTPD 1NBQA 4HZLB 3EGSB 3V52L 4WUUD 5E0QA 1R5IB 2B20A 4MJ6A 2BHYA 4HIJA 4PGEA 2CDFA 4BH8A 5GGVY 3B3IA 4HGWB 2Y07H 1S9WB 4LSSL 1TTGA 1EO5A 4MXWH 4MD4B 2HT4C 3TO2B 5IMLA 3VE0B 3UYOD 2IALB 4MSWA 3BIKA 1DL7L 1NBVH 1PG7X 3ETBF 3SGJA 5C08A 4PJCA 4QRQA 1DUYA 4OUUB 1DQJB 3Q2CA 5GGVH 3TPUA 2VXSL 3KR3L 2XRAH 4O2EB 1OHQA 3W11D 4FQ1H 4C83A 1T2XA 5I1AA 1OTTC 1N5AA 2V7NA 3ZHLA 3H6JA 3LAFA 1I1AD 1MHCB 1NANI 1CCZA 5EZIL 5EBGA 4K3HA 3O6KH 1JZ3A 4ZSOB 1N59B 4L4VA 4JY4B 2VMFA 2Y1VA 3LOWA 5C09E 4U2ZA 3R4DA 3QG6B 4PRIB 2GQHA 3EDJA 1K3ZA 3P40A 1CL7H 1HQ4B 4MNHA 1DN0B 4U1KA 4BFBD 4GKSB 1YN6A 1MRFL 1WAAE 1CLCA 5FKPA 5E94A 5JXEA 1WCQA 4X6CB 4JO4H 1G0DA 4MNQB 2CR3A 4M48H 4JRYA 4X7EC 2IAMB 2VO5A 1LO3H 4X7CC 5GRUL 4KJWC 2R1WB 3WO4C 1HHKB 3BP5B 5DD0L 2GCYB 2GHWB 5KG9A 3S37X 3L7FA 2OP4H 1P4BH 1SYVB 3INUH 3TH3T 3ROLA 5H94A 3G5YB 4HUUB 4Y1AE 3CFKB 4OM1H 2Q86A 2X4QB 2V9RA 4PBVC 1KCLA 3ARBA 3Q5OA 1R6VA 2ICWI 3DHMA 1INQB 4D9LH 1WWBX 1KIQA 1WAAF 3I6LE 4HWBL 3PV6B 5DD6A 1AXTL 3EFDH 3DX9A 2ADFH 4XI5D 3QHFH 4FFVD 4L8DB 4P4KB 4YHZL 4OF6A 1MLCA 5K93A 4L8CA 3RTQA 5E6IA 3VWJB 5IJVA 3VRLE 3DBXB 1U8KA 2EEBA 4D0DA 3O4LD 3IDJA 5ITBL 5JXAL 4LIQH 3ZYJA 2F54E 4XVJL 2P24B 3JWOL 5TDOB 3MRCA 5F6HI 2CGRH 1U93A 1ERNA 5DJ6B 4NJAL 3VXQA 3RIAK 2X05A 1JMXA 3R1GH 2FECL 2XTJB 2CLZA 5FYJL 2LQRA 5F96H 5H37G 2H2SD 2EC9T 2P5EA 4JRXB 5L0QB 4HT1L 4JFXA 2FB4L 3NFSH 1LP9F 5HHMB 2HTKD 3HB3D 5GSRB 2A6JB 1RK1B 3VMOA 4HUXA 1DVFB 3LEYL 5FHBH 4XPAL 4UDUB 4NSKB 4E0RB 4X5LA 4U6YB 4Q9BA 2BNRA 3HMXL 3N85H 4HJJL 3JWNC 3EYFA 4XAWL 2FX7H 2ILLA 1AD9B 2OBGA 5J7CC 4OFIA 1P7KA 4GSDL 3STBA 3OR7A 3B9VA 3UJJH 2KQMA 5BS0E 3TA3A 1UFUA 3ARBB 2RGSA 3UDWC 4J23A 4P23B 3BIAX 2PR4L 1GC1L 2VDQL 3FHQA 4MS8C 5J9PA 3TT3H 4RMUA 2I9TB 5MI0B 3KPOB 4WEUD 3O9WB 4OTXL 1ORQA 1S8DA 4XCYA 2XI9A 4Z6AT 1O7SA 4JY4A 3KPRD 3ARTA 4CDGC 5GS2H 1CICD 4AQ1B 3BKML 1X5KA 4GRWB 4GT7A 3OAYK 2OM5A 4YHLL 3GEWB 1A6WH 4OLXH 5FAAA 1R3HB 4HWNA 4PUBH 1Z6JT 4NBZB 2YXMA 5CKGA 1CDGA 2Z91A 3GSOB 4HUWA 3VGFA 5KS9E 3AUVA 4IRSB 4UTBL 1JWMB 4YBLC 2D0GA 2NY2C 3QIUB 1ZVSA 3UDWA 5DJZB 4MGXA 2YZ8A 2AJXH 3PP4L 5FA3B 4D3CL 4Z7QE 5L6YH 4EOWL 3A6OA 2C1OA 4AL8H 1DSFH 3CZJA 5MEPB 1FAIH 1AP2A 3INUL 1FL3A 4OFYD 1J05B 43CAA 1CQKA 4QHNA 2NX5E 3TBYA 3VXRE 4N8VA 4K7PY 3IS0X 3VJ6B 1MQKL 5IB4B 4TNWK 4XTRC 3A0OA 3CDCA 4ZD3H 3ARQA 1JF1A 2ZPKH 4I8DA 3VFUA 1U95A 4I4WB 5KSAA 5T1KD 3VW3H 5D72L 4WW2F 1LP9B 5FKAA 5MHSD 1FJ1B 5GS2D 1P2CB 5CBAB 5EU6A 3WFHA 4IJ3C 4F9LC 3VWKA 5K9OA 1OSPL 4GQ9L 1Z3GL 2B2XH 4YHKH 4X7SH 2IFFL 2A2QT 3KYMA 1ADQH 1AQKL 2YPLA 4HJ0C 1X4XA 4NKIL 4YWGH 3PWUA 35C8L 2A74A 1Q0XL 4D8PB 2ICES 3U46B 1XF5B 1OP5H 1VFAB 3OQ3B 1V3KA 3LQAH 5F9AC 5DK2B 4OLUH 1FG9C 3BGFB 2DQGL 4ZDHB 5EU6E 1FNSL 5EZOH 1XH3A 1JV5B 3OV6A 5CP3A 3CCHB 3MRFA 1IAIH 3X17A 1IEBB 1RK1A 4CGTA 1CR9L 3HR5A 3I6GA 3T3PF 3QUMH 3CDGA 3RNQA 4PR5B 3IRPX 3IJYB 5DA4A 4D0CA 2BOCB 3D5OF 4XPTL 2DI9A 1S78D 1FG2B 5JR1L 5IVOA 4GRWF 5LCVL 2C3HA 2AP2A 1T03H 5CMAB 1JK8B 2UVEA 1TJHH 1CXLA 4OCSL 2ZSVB 2H9GA 2HFEB 1UCTA 3IXAA 3SN6N 1AI1L 2Z4QA 4OLYH 2OJZH 4M8QA 1A6AB 1UWXH 4WDIB 3KPOA 3W81A 2NXYB 3QPXL 2YN5A 4GRLC 4JHZA 5HHVL 5KANI 4N0YL 4DVBB 2VNCA 2YD7A 4NO3A 4YFDB 2BOBA 3GMRB 2OXGA 4XNXH 4NQDD 3KS0H 4H20L 4I3SL 1EBAA 1RU9H 5FM5O 3SDAB 4X7DC 2BDNH 1LD9B 4X8XA 5F1OB 5KS9A 3CVIH 3KPMB 5DK0B 4N68A 4JY5H 4J1UA 1UACL 1YDPB 3ILPA 1PKQE 1LO0L 3NZ8B 2YKLL 4G8GB 2UV3A 4DVBA 1RHHA 1GIGH 4LOUD 1TZHB 1XCQB 1S7RA 4U33A 2VL4A 3BN3B 3AXLA 2VDLH 1MCPH 2EDEA 4N5ED 3VFMB 5T3ZL 2H1PH 5DURB 2VZTA 3OAZH 1NCBH 3MJ8A 4U0QB 1O7VA 1VFAA 1FVDA 4NM4L 4AL8L 4TVPE 3WE6A 3C60B 1UVQA 3CDYA 3V6FB 2Z8WC 1PDKA 3HMWH 2DTSA 4UNVA 4X6EB 1UZ6E 4DAGL 4G7VH 4O02H 4LSTH 4J3XA 3HUJE 4LSVH 3G5ZA 1XGYL 1NCNA 1NUFA 1YECL 3I6KB 3QWQB 3ZKQD 1U3HB 3SE4A 3BQUA 5C07E 3NACL 4FFZH 4P2OB 3BEWA 5DR5H 2DQCH 3S5LA 4NRZB 2XKSA 2I07A 4JAMA 4LVEA 4M6MH 4EXKA 2F53A 4PREB 5ISZB 5JHLL 1J8HD 3NFNB 1ZLVH 2P5EE 3WKNA 1IGCL 3WNOA 3PWPD 1I1FB 5C09B 1WWAX 2DBJA 5IHUL 3KYMB 3WEXA 2E27L 1M1SA 2X4QA 2VISB 4JO2H 3QJHB 1ZGLA 3DV4A 4LMQI 2EDNA 5DWUH 1CE6B 4M61B 1RUPH 5ETUA 1LO5B 1XF5A 1JPGA 2XZQL 4OFVA 3TYGH 4J8RA 1P4IL 1YYLL 1A7QL 4JGUA 1IM3B 5FGBA 3DV6B 5E1AA 5F7UA 1ZT4A 3P4NA 5C86A 3QNXB 4S0SD 5D1QC 3IDGA 2R0WL 1FIEA 2PETA 5IBTH 3W5MA 1J8HE 4PRHD 3BOVA 1U3ZA 3GJFK 3MMEA 5DJYB 4E42A 1GGCH 2ED9A 5DVKA 2CJUL 1TPXC 4EEEA 3C09B 3EO9L 5EULV 3GDBA 1XF3A 3TCLB 3HC0A 1EEQA 5JHDD 2Z31A 3SDDC 4NN6C 2XN9A 1FNEB 1XGTB 3VMNA 4CVZA 1E4XH 3O45A 4LKCB 5I30H 1Q72H 4YHOH 1LEIB 5JQ6H 1KPUA 2ARJA 2Q3AA 5KSUA 5SWSD 4ZTPH 2OTPA 5GZOC 4LCWE 2NY4C 4HQQL 2DYPD 3R06A 1BJMA 5DT1L 3BT2L 2VRAA 2NLJA 4JO1H 5HPMB 4FZEH 3MRKB 3AS3A 4BQCA 2AJ3A 3CVIL 4PP2B 2NTFA 5BXFB 5JQHC 4JGMA 2NZ9C 2YMXH 3VCLB 1UJTA 3VXSA 4WFEE 1R5WB 4ZYKA 1IKFL 4KK9C 3TNNB 4G3YL 3MUZ1 3HFML 4HZLA 3SO3C 1JPFA 5BCAA 5EZJA 2EE3A 2VQUA 3MRBB 4R90H 1VDGA 3CVHH 4Y5YB 5GS3A 2VDKH 2O61A 1V3JA 4DK6A 3HZKA 5LQBH 2R1XA 5D6DC 5IWLC 4OQTA 5C0AE 5BW7A 3FMGL 1T1WA 4Q9RH 4DAGH 3HE7C 4JR9H 1I3RA 1H3UA 3LHPH 4TTDC 3P2TA 4NO0A 2QKIA 4LSTL 5C0BE 4CNIB 1RQ5A 3QRGL 5F93C 1D5BA 3HS0B 3RWHA 4Y4FC 5KAQF 1F02I 2F5AL 4BZ1L 3H3KA 3LSOA 1PG7W 3QXAA 1W72B 4HMCA 1MLCB 4FG6C 5DK3A 5E9DB 4R8WH 1QUNA 3HNSH 3STZB 2R0LL 4GLRI 3FQWA 3C9NA 4OZGB 5FECB 4PREA 5JHDB 2B0SH 4GG8B 5EOQH 1IKNC 1ZT7A 2IANB 1RZJC 1S9XA 4XH2A 1KB5B 2C3WA 3LS5L 1MEXH 2HWZL 4FFWD 3ECBB 3QEUA 2D7PA 2BRQA 4P2QE 4CN6A 2N1KA 1X7QB 4L3EA 3MRNB 4ELMB 2IMMA 4J3OC 3ZKMC 1IGTA 1EAPA 1QACA 5I1GL 1NAKL 4ODUB 3UTQB 5ESVB 4IMKC 3CMOL 1U6AH 3QXUA 4BK4A 1S7TB 1KELL 3AC0A 4X7TA 4YDVA 3X13B 3C60A 4WTZG 3WIFA 1A7BA 4JN1H 1YEDB 2AJZA 3BYTA 1VACB 4GG6F 1OARL 2FSEA 1NC2D 1I75A 4X80L 3M07A 4LLMA 1IKFH 1INQA 2DD8H 4U1SB 3UO1H 5IEKB 2AEPH 3BPNB 4HUNB 4LLWA 1JHKL 4X9FA 3PWPA 3STLA 5MEQA 2VDML 3QDGD 4JANA 2VKWA 2VLLA 2DDQL 2NXYD 3V6OE 4JFZH 1KBGH 3OR7B 3NIGF 2EH7L 3O11A 1PSKH 1JHLL 3C5ZD 5ISZD 2QSCL 2ZKHL 2XIDA 2XWJA 4JFHE 4LCYA 2J7LA 1E4XL 2VUYA 4WHCA 5ID1B 2J6EH 4ZO8A 3ARDD 5CGTA 2DQJH 2EDTA 3SKMA 1HH6B 4YPGA 5I0DA 4M43H 1NJ9B 1SHMA 2VABA 3RUGF 4HUVB 2FGZA 3KLSA 5DJ8A 3DSNA 4QYOB 3ESVF 1E4XI 1S9VB 3KWWB 3AVEA 2DKSA 4PP2A 1UCBL 3MRDA 5HHOA 1TNMA 2VLRD 1MHHB 5JPMB 1YEEL 4NHUB 5F7EH 1FE8L 1TVHA 3MOBH 3FJTA 1XF2A 1WZMA 1CIDA 1UB6A 3RNQB 3MRBA 3TV3H 4KROC 2LABA 5DFVC 3BDXA 4UT6L 4Y2OA 1FC2D 2O61B 1HHHB 2FCBA 2HFFA 3EOAA 5DC0A 3BH9A 1DTUA 1RUMH 2P48B 3FO1B 2WUCL 4KV5E 4ZSOA 5D1ZB 3VRJB 4NZDA 5A40E 5IBUB 1EO7A 1KELH 2ITDB 3HZMB 4KUCF 3V4PL 1JFQH 1MY5A 3LRGA 4YZFE 2XPGB 5C92A 4R7DB 3U4AA 1MVFA 5D2LB 1KLFA 4Q6YA 4TSCH 5D71H 3F7RA 4Y0GA 1FSKB 2NY3B 4CJ1A 1A7PH 3HS0A 3KDMA 4HSQA 4U1LA 1IZKA 4K3JL 2VB5A 3KJ6H 1H3WM 1ZVHA 5BJTB 1FZKB 4NUJA 2DBLL 2Z31C 3SDDA 3JVGA 3DO7B 2QR0B 1A6ZA 1VPOL 3PHQA 2UZIH 4H26A 1ZOXA 4M1CC 5E00B 2B0SL 1FPTL 1Q9OA 4WW2C 4JJHA 3RWEB 1NC4B 3WHXA 1U91B 4LKXB 3DGGB 2WIIA 5IVZA 4HIJB 5CBEA 3LKPA 2IH3A 3MRJA 1KEGH 4KGLA 2FEDC 3JV6A 3M17A 5H2BB 1NC2A 1Q9LB 4M7JL 5DVMA 3HZYB 4AEHH 1NKRA 3ZTJG 3U4EA 2DQUL 2XZAL 3PDOA 3O6LH 1BZ9B 3N1QC 1U8NA 4Q9QH 4J2XA 1NSNL 4MJIE 4NCC2 4NZTL 1JWUB 4JKKA 4AIZB 2JLLA 1YEEH 4HKZA 3JVGC 3ES6A 3D2UA 1BFVH 4JFQB 3EOAB 3I50L 3BMWA 3A6BL 2Z92B 4DGYH 1OLLA 5EA0L 1OTUD 4PGDA 3QUXA 4XB7A 4OUUA 3ARDA 2ESVD 2WUCH 1M05A 3G5VB 2R4SL 4G8FB 4DTGL 5BOPA 1CGSH 2RAMA 3JV4A 4DEPC 3RGHA 2BY2A 4I77H 3SDXE 4BUGA 4KUCD 1NBVL 4EQ3A 4ONFL 4X6CF 3MNZB 2DQEH 3AB0C 3LKNA 4ODTH 1HH6A 4YPGB 4YBQD 2FHCA 4PJ5E 3LN5B 3MMEB 1MCKA 2JE8A 5F71A 1C8PA 5IB3A 4PB9H 4ZAKD 4MMZC 2JELL 4MDIA 3ZT6A 4K3EH 1X9QA 4OQTL 3T3PE 3BUYA 1F3JA 2Y72A 3G6AB 3V95A 3OKNB 3L3KB 4P2RD 5D4QA 3T65B 4FS0A 3R0NA 3VFNB 1IRAY 2VQ1B 5J3HD 1CE6A 4FXLA 5I9QB 4L4TD 4LLYB 4MA8H 5F6HJ 3MRGA 4YBLB 3QUYB 2JIXB 1AGDB 2ZCKL 2GTZA 3CFEB 1FYTA 3QI9A 2GTWA 2RFXB 3JWDH 3ZT5A 4WFHE 4I3RL 1L7IL 4HWUA 1T7VA 2CK2A 3MV8E 3T65A 1KN4L 3B83A 4HUKB 4RWHA 4POYA 2F74B 4Y5VB 1ZHKB 3T3ME 1JFQL 5AUMB 2HG5A 2W1NA 4N5UA 1SJVA 4MWFA 1BBDL 3EO1A 2EYTA 4O2FA 5B22A 2HJFB 4P46C 3DMMD 5D7KE 2P24A 1HKLH 5D5ME 3FZUC 1V7NH 4I18B 2FL5B 2W65A 2ZUQC 7CGTA 3QUMA 5DJXA 1OAKH 2ENYA 4G5ZH 3VI4F 2XT1B 5IB5A 4YDKH 1Z0NA 4YHPB 5DURD 3W2DL 1PJ9A 1NBZA 1CICC 3LRSA 4S2SB 5GRVL 1K6QH 5IJVB 4P48A 4FTVA 5JW4M 1KJVA 3LH2H 1PY4A 5I19H 2EYTB 5FCSH 1MFCH 2Q8AH 5C0CB 2ADFL 1WLHA 3HUJF 4LEXL 3DXAA 1ZEAH 1AGCA 1KC5H 3DX7B 2HRLA 4KVNH 3ZDZE 2HAZA 2IPUG 4OD3L 1P5VA 5GJTH 4ONHA 2BOCA 2VOTA 1NGZA 1G6RA 1K5NB 2QHRH 4G80B 3PHOA 1TTFA 4HEME 2X4PB 2VAAB 3UPCA 4M48L 2XNAA 3QCVH 5BZWB 2FGWH 4P2QD 2J4WL 2C4XA 1U8NB 1CI5A 1KJ3H 3NAAH 1MFAL 2XTJD 3EBAA 2APWA 2C1PB 2OP4L 3H3PL 4ALAH 1DBML 4PY8J 4NYLA 4PJXE 2D0HA 4F3FA 3IRZA 5KSBB 5AYUL 5C0EA 2Z35A 3UBXB 2Y7QA 4BUHA 1HSBB 1TZGL 1QBMH 1ITCA 2X4NA 3P73B 4XPAH 1QFHA 1IAIM 3L7EA 4C56A 3NIDE 3L3HA 3MYJB 2RR3A 2CLRA 4P2QB 1ZA6A 4OZGE 1JZ5A 3QIWD 4OF0A 5T33H 3O6FC 3MLWH 2DB8A 1V7NL 2DM2A 4FQCL 2XN9D 3LDBC 4OFKA 1LEGB 3O6ML 3OX8A 5C0FA 4PB9L 3RIFF 1MJ7H 2XZCH 1ZT1A 4OTXH 4AT6B 4PJCB 3L5IA 5F7NC 3T77B 1QZ1A 4HV8B 2CLRB 2DKUA 4HPYL 2XTJE 5D7IE 4M93C 1EFQA 3MUJA 1U2CA 3NFPB 2Q8AL 3T8XB 2DIBA 3NIDF 5TPWL 1E27B 2DQFA 4KHXL 2DI7A 3VXNB 1VFUA 2PF6A 1B2WH 2FLBT 4POUB 5FGCB 4Z76A 3MJ7B 3C2SA 4MNQD 3G08B 1LEKB 1PQZB 2NW2B 5BJTA 4BFIB 1XGPA 4DUXA 5L8JB 4WEBL 4KROD 2OSLB 3QCVL 3W0WD 1EZVY 3D39B 5CIPH 2DLFH 1LE5A 4NQVA 1CIUA 1JGUL 1T1XB 2FR4B 2WBJC 5I6XC 3D18B 3GMOB 3PL6B 2ICCA 1FGVH 1UWEL 3CLEH 5DTFA 1NKOA 2CR6A 4HGKC 5MEOB 3QUYD 5FUCE 3WCYA 2P42B 4L4TA 4XP9H 2AV7A 1SJEA 4X4XA 1E4JA 3LH2L 3MGOA 3SDCC 2UZXB 2YUZA 3ZTNH 1FFOB 3OGOE 4LASL 4BM7A 5C0CA 5SWZD 2ZG1A 1HSAB 4L8SA 5DVLA 2AI0H 3Q6GH 4YHLH 4LGRB 3GMMA 1YEIL 5T1MA 2K1MA 3GFUA 1GPOH 3O9WA 5GJTL 1GYAA 1MCHA 1DFBH 1XCTA 2GITA 4X4YA 4MJIA 5DGQA 2QHRL 3OKDB 3FFDA 1I8KA 4PG2A 3SJVD 1X5ZA 4NQCE 3TN0D 4P5TA 2AJUL 4FQLL 4NZRL 4X8JB 3PXJA 4X6EA 3WHE0 1QVOA 2ZOKB 4NHUA 35C8H 5HJ3B 4MD0A 5BQ7A 3GIZL 5FCUL 4ELKB 2BZDA 1F00I 2J1KA 5DVNA 1P84K 4K8RC 4APQA 3VXMB 1G7MA 3S5LG 2OI9C 5TGBB 1QRND 1NDGA 5TDOA 4PJDA 1KIUA 1WSST 1A3LL 4NPYA 1S7UA 1ZA3B 1I3GH 4M6NH 4XGZA 1HDMA 2F53E 1G7PB 5E6IB 3LIZH 2W9LA 4EI5A 3GMPB 3PJSA 4GKZA 4O5LL 1MI5B 3LEXB 4HH8A 1EJ6A 1MCBA 4UT9H 5CS7A 1NEZG 3MJ9H 3L3KA 5J1AA 3WL9A 3LKSB 3T1FB 3C6SA 2D0FA 3MFGB 2OTUB 2UYLA 2Q76B 1BGXL 4YX2L 1EAPB 3AREC 4RNRB 2WLYA 4LPVA 4XP6H 5DRZA 3RZCB 4GG6E 4CADB 4LLQA 5I74C 4NQSB 2W07A 4FQXB 1RZKC 4WI9A 5HHVH 3V7AE 4KWUA 5LGJB 5C2UB 3QDJE 1KSRA 2NX5B 1CLYL 5HI4C 4U6HA 4JJ5A 1FBIH 4E41A 5IQ9B 1KOAA 4WHDA 2VZ3A 3ME0A 5ICYA 1A9BB 4BKLA 2J8UF 4MJ5A 3O2WH 3ULVF 4YHZH 2DQTL 2DQGH 3SE3C 2VXUL 1E6JH 4KH2A 5D7JD 4HIXH 5FEBA 1UB5A 1GIGL 3QUML 4ZPVA 5IFHL 1FIGH 2FECI 4ODVL 3D25B 1H3VA 3O3BA 1FNEA 5GRZA 2NTFB 1SBBA 5E4EB 1WK0A 4M1DH 1OSZB 1F3RB 4QTHB 5SWSB 4C59B 1JNLL 3GSVB 1CTOA 3A6CL 4GH7B 4Q7DA 2WBKA 1TXKA 3QISA 2AJSH 1NCDH 1G7HB 3SCMA 3Q6FB 5HD8C 4R0LA 2JIXD 2OCFD 1CD1A 4ELMF 3HZKB 3HNVL 1FL6B 3QZWA 3L3DA 4GS7C 3TLRA 3P4OA 5B8CA 1I9IL 5FYJD 1QR4A 3QFJE 3GJEA 4ZFOL 1QHOA 1HIMH 3G6JF 3P9MA 3B43A 2NZ9D 3K3QA 3VXME 2VSCA 5JDJA 3SDDD 1MHPH 4FZ8H 1ACYL 3IETB 4YDIH 5IEHA 3DNKA 1UACH 3HC4L 5C0IA 4TVPH 2A6DA 1SM3H 4J3UA 2IBBA 3CJJA 1HKFA 4OJFL 3SGEH 3BP7A 3OR6B 5LWYH 1D9KB 1E0OB 3P4NB 4MA7H 3JSSA 3PF2A 4MS8D 1HXYB 4P9HH 4GW4A 1J1OL 5IJKA 1HQ4A 4MNHB 4NQDB 4MZ2A 2AJYH 3U6RB 2F5BL 4JY6A 1A7OL 4R7DA 1B4JH 2W91A 5HY9B 5MENB 2YD1A 3T1WA 1H15A 1IC5L 1MLBB 1MREH 1MCFA 2E6JA 2GEEA 2BMKB 3FQUB 1F90H 1D5IL 1CFSA 4PJBF 1FVEB 1K9TA 4XBGB 2D9QB 3I9GH 3WS3A 1LEGA 1CVSC 1HHGB 1XGYH 3AB0B 3DSFL 2D7QA 2OR7A 1T1YB 3MODH 2PYEB 4JPVL 1DUYB 3ESUF 4XPHL 1TVBA 1FH5H 5JUEH 1EK3A 2X09A 4TVSa 2CK0H 3D0VB 3PWPE 3HMXH 4MYWB 3MCLL 3GMLA 5C0DA 1QR1A 2BY0A 3B3IB 2A1WH 2EC9U 3TJHC 4R7NA 4XI5C 5SWQA 2M1KA 2P1YA 3NA4A 1OQOA 1JGLL 3QZWB 2BP3A 5C8JB 4H5SB 4YXKH 4QRRD 1DQDL 5FM8A 5KBNC 3MBED 1RMFH 4O2CA 3DRTA 4UU9B 2J8OA 4WI4A 2FBJL 3GB7B 1ES0A 4OT1L 3E3QE 2ADIA 5GS0L 3KPLB 5HVWA 1OGTA 4PRNA 5D2NA 4BQ6A 1UM4L 4R2GC 2Z31D 4X6CE 4Y16D 4PJXB 4UV4H 1U8MA 2ICWB 2HT3D 1I7ZA 4EIZC 1KB5H 1NCAL 1A5FL 1U3HA 1K8IB 1RUKH 4XVSL 2E7CA 3VXSE 2YPVL 3ULUF 1QA9B 3VG0H 1JN6B 1JGEB 4KJWD 1K8DB 4ODVH 3F6LA 1A6AA 4WDIA 4TUOB 4JRXA 3R0MA 3LKRB 1BZ7B 1J0YA 4M1DL 4C58B 2OL3A 2IGFH 2ZUVA 4CN1A 5DRNA 5CHNB 1VCAA 1RIVH 3LKQB 5EUOB 1NGWA 1Q94A 3RY5A 3OB0H 1U8IA 4BH7B 4R96B 3HI1B 4H1LA 3RQ3A 1NCDL 3LMJL 4WV1C 4L9LC 4FTVB 5KSVB 3CH1B 4FNLH 1F4HA 4ZO9A 1CLZH 2G2RA 4Q6IA 3IGAA 3FQRA 3UPRB 1X5IA 3U4BL 3FFDB 4G8GA 3UTSB 1MCSA 3DVNB 4DQOH 1Y6MR 5DS8B 4Z7QF 1UJ3B 3RTQB 1A6TA 3WLBB 5HGBA 5AAWA 3P9LA 4M93B 4M3JA 2ED7A 1ACYH 3B9KB 1MCDA 1TJHL 4YDIL 2YMXL 4L1HA 2BNRD 2CMRH 4ZFZA 4GRWH 4NC2B 1M7DA 3HRPA 1WC7A 5JLZB 5C0JB 4X7SL 1D9KA 1S5IL 3ARDB 1RY7B 3QHZH 1S7UB 1ZA3A 1IC4H 5D93C 4M1GL 5E2WH 3TBWA 2HMID 1ZGLM 1EHXA 1I1AB 4PRPD 1J1OH 1LK3H 3QDJA 3GI9L 3GMNB 5D7LD 5J0BA 4CL7A 3LQZB 4IRJA 3KJ4B 1B4JL 2MKLC 3GMOA 3MROB 4XNXL 5DD5H 3TH4T 4NN7C 2JK5A 2A83A 2GSGB 2J12B 1T5XA 5HDQL 2BY1A 3KYOA 3VG9B 4TOYH 2AEQH 5FUZL 2EDFA 1KCUH 4OZFG 5EBMA 3KYAA 3HG1E 3DO7A 5E8PB 1T0MA 4XVSH 2H3NA 1YEFH 3RDTC 2BNRE 4X4YB 1INEL 1F8TL 1RFDL 2A6KB 3RUGB 4OZHA 2EYSB 4XPHH 3PP3K 5IMOA 3UJIH 4PJXF 3BO8A 3L3JB 5IVZB 5CBEB 5LCVH 1LWRA 3IFOA 4S1DC 1F13A 2IGFL 5C0DB 1CZ8L 2QSTA 4XPBL 3LS5H 3WNLA 4BA8A 1NEUA 3FO1A 3I75A 1RZIA 5CIPA 4DZBA 4X4ZA 4LARH 3OB0K 4WHTB 4LHJB 4NQCB 3GB7A 5C08D 1YNLH 2X10A 1AD0A 1U3HD 3DRTB 4RWYL 3U4BH 3VXPB 4JFEA 3FT4B 1UB6B 1P2CA 1AO7A 1X3DA 3GSQB 5D1QA 1G6VK 3QYCA 4PRBA 5FGSA 5EIIA 3AM8A 5A2KH 4RDQG 1I7RA 5DA0B 4UAOC 3WFCL 1U8JB 3SDCA 1INDH 3VRJA 1HILB 3RX5A 1KXVC 1QNZL 2AABH 4Z7OF 3PHQB 4H26B 4Q2ZA 3AU1B 2X4NB 4AEIH 3MFFB 1DQMH 2VDNH 5KW9L 4L4VE 4X83A 2E27H 5DUML 1BZQK 2VDRH 5D7LA 2YRLA 4X7FC 5JNYB 3G6DH 2Z91B 1U41A 5DWUL 5DD1L 3V7AG 4BJLA 5FDWA 2UUDK 4HJGA 4E9LA 3V5KB 5F7YC 2C4FT 3ULSB 4ZOCA 4UMGA 1LO5A 3F58L 4O58H 1KCUL 5FV1L 3SDAD 5FA3A 2NW3A 4DN3L 1CLZL 4PTTB 1J0HA 3ZYZA 4HW6A 1K85A 4QCIA 3WFEH 3NH7L 4GAGH 4PJ8D 4RAUB 1CXHA 2YK1H 4XVTL 1ONQB 3OAYH 3KJ6L 1DUZB 5D5MB 4U1MA 4O51A 2LE9A 5CEXB 4JRYE 4QY8B 4G6AC 4MJ5B 1MSPA 3C5JA 4OZIB 1UCBH 4WY7H 3OF6A 3BIBX 1FGNL 3ZE1E 3D2UD 3VXUB 4JREB 3SE3A 1PKQA 2PW2A 3ULUC 5ENWA 3S35L 4MAUL 3P9WB 2KH2B 1KJ2B 2WINA 2B4CC 4S2SA 3WSQH 5C0CE 1KEGL 2Q7YA 1AHWB 5LAXB 4G42B 5KVEL 3VI3E 1HE7A 4Y5XB 4OFDA 1KFAH 4TUKL 2R0ZH 1RURL 3MXWH 4NN5B 2GFBB 5BRZB 5DEFB 5A16A 5EBMB 4Y4HD 4Q9QL 3JBG7 3LPFA 3QWRD 3JV5A 4PJEA 3SBWA 4HUVA 1DLHB 1SY6A 3FN0H 3VWJD 3M45A 1XIWD 2BY3A 3RWIA 2DWEA 3BPLB 3T4AB 1DANT 1KCSH 2BVYA 2P8PA 2ZUSA 4YGAB 3OPZL 3CVHL 1AFVH 5F9DC 2JCCF 4E5XA 1A3RL 5D1XD 1KCVL 3MRNA 4YIQB 3WXWH 5EUKA 1VPOH 2X70B 1OAQH 4XPBH 2FEDD 1EUTA 1IARB 4NC0B 4HS6B 1X4ZA 1EJOH 3LZFL 1JNNL 3EDFA 2O93L 4WGWB 4C4KO 3VXRA 5ID0B 3QUKB 4ODTL 2A9NL 4X98B 3LS4H 3ISWA 3WD5L 5LBSL 3NN8B 4D0DB 5D70H 4WW1A 3SCMD 2QLVB 3H9HB 3VXTA 1HHJB 1S7XA 4R26H 3HN3A 2PO6C 4APQB 4RGOL 1QSEE 5K9QG 4L8BB 2JCCE 5CHNA 5CJQH 1JK8A 4KQ3L 1IKNA 1P84J 4PJ9D 3ZTJH 1ZK9A 5J11B 4OZGA 4M62H 4NDMA 4MXVF 1IAOB 4K8RH 5HDLA 1DQML 3WBDA 3V8OA 3BSZL 3SE9H 2NY6D 3BKCL 1R3LA 4EUPH 3RRQA 1QRKA 2JB5L 3JWDL 1RJLA 4HH9B 1R0AL 1PLGH 3MV01 3U0WH 4JQVC 3FOLB 1BVZA 2O5XH 3K80A 3ULSA 3GO1H 2BCKB 1IGIL 1I7TA 2FEEI 3HUJB 3D3VD 3SKUD 3W9EA 4ERSH 1JL8A 1I7ZB 4WGVB 3U0TB 3EOTH 3ULUH 4QEGA 2PYED 4LOUC 1PW3A 5HYQB 3CLFH 3CZFB 5D6DA 3BD4A 4HPOL 4H88H 4Q6IC 3S34H 4JDTL 1HEZB 3RWCB 2D3VA 3LN9A 3T2OA 1KCVH 1E27A 2PN5A 5E4IA 3MUY1 4R8WL 1KBGL 4NP4L 4Z95L 2P46B 5ERWB 4Z7NF 4NWTH 4LCIL 2AEWA 4WW2A 3HE6D 1UQSB 5F72S 3DVFA 1MFCL 4ZUSA 3W0WA 1YEJL 1P53A 4AM0A 3VH8A 3C8HA 3G6JE 1TENA 4BQ8A 4MXQC 1Z9OA 5BV7C 1BF8A 1FZOB 1YN7A 3Q5TA 4G6MH 4V2CB 3QEHA 1L6ZA 4NRYB 3V0WH 4RBPK 4YDJA 3SGJC 5FGRA 4U6XB 3D9AL 3T2PA 4WUKL 3IDGB 4X5XA 4O4YL 5FYKL 1M7IA 4YFEA 1CFSB 3KPSA 4U1IB 3S3SA 5CUSL 3JTTB 1SMOA 1T0NA 4AENA 3ARFB 4W4OA 1DBJL 1F4WL 4IMLB 5ANMA 3FN0L 5E8DL 2H2PD 4AT6A 4OI8A 4HWBA 4NRYA 1EH9A 5B3NA 1UJ3A 4OCYL 3QUZA 3TV3L 4NNPH 3DUUB 4UIKH 3X11A 1N2RB 4ZTOH 2IH3B 3MRJB 1IQWH 1PG7L 2JB5H 3ZMRA 4F9PC 1G9NC 1XGTA 3TVMC 4CVZB 3O6FA 2EH7H 2VXQH 3DMMA 2YEZA 4X6FA 4JPKL 2YC1B 4HC1H 1VFBA 1PD6A 3AM8C 4PG9A 3V4PH 5DZNA 4R4FH 3K1DA 1JHTA 1JRHL 3O41B 4HXAH 5T5NG 4Z7UF 4ZXBD 2VL5A 4PY7A 3MLWL 2B1HL 3MLUH 1A2YA 2BERA 4KMQA 2VWEC 4XXCC 1JYVA 3C6LD 1TCRA 5J6HA 2JKXA 3DIFB 5DJYA 4JDTH 4JHAH 2DQHL 1QPPA 3G04A 4NHCL 4XNQB 1T2QL 3ARUA 1B88A 3TESA 3VGBA 2YD4A 2XQBH 1QSFD 5T1LB 3F7PC 2UZIL 1WVZA 2OTUA 3QIUD 5GRWA 4ISVA 4HPYH 4YC2C 4NRZA 3CNKA 2D31A 5CP7B 5HHME 2CO7B 5EIQA 1DBMH 2FO1A 1X5XA 1EEZA 1L0QA 3G6JA 5DHVH 3MRIB 3MLSH 4I2XB 2YD8A 4XP4H 1EGJH 3VFWA 3DI3B 3TZVA 3MOAH 3NA9L 4KK9D 1AE6L 3RUGE 1AGEA 4RISL 5D7SL 5L7XH 5HHOE 3CK0H 3FFCE 2P7TA 3MGAA 5L88H 4ZFGL 1XF2B 2WW8A 2GJ6B 2DYPB 5HYJB 2JB6A 1AC0A 1TNNA 4Q9CA 1MF2L 4K7PL 3BHBA 1S7VA 2XWBA 1A9BA 2O5XL 4OLEA 1KTDA 3FRUA 3PL6C 1FVDB 1YMHA 4WFED 4JZJA 1CU4H 3O9WD 1KN2L 1I9JH 5KVGH 4LFHG 5BV7H 3UZVB 1CE1L 5DZLA 2EDXA 5HYJA 1AHWA 2V9QA 5LAXA 4XZUB 2PO6D 4KDTA 5FV2A 2A77H 1ZLSH 4XNZB 2QV2A 5KVMC 1EZVX 2F9BT 3ROOB 1GOGA 4AMKH 3UYRL 3ZLQC 3H7BA 5EH1A 1NH6A 1A3QA 5KS9B 4R4FL 4LNVA 5HYSB 3SDAA 5I76B 1EUUA 3RGVB 3BGAA 2NY0C 3MC0A 2BXYA 1RJYB 3BH8B 1MI5A 3EJYC 3LEXA 5IP4A 4TUOA 3HB3C 5C9JA 3KS0J 3GUTB 3GSWB 1TZHA 4OM0L 2W9EH 4JB9H 4WV1A 4FQLH 4GUPB 4NZRH 4FQJL 2DN7A 4RGNE 5BMFL 3IETA 5IEHB 1JGUH 3L7FB 4GXUN 4U1GC 4XCFH 1U8PA 1WEJL 5J1TC 4IIQC 4QTIH 2ZJSL 5EOCJ 3K1KC 2O5ZH 3MV7A 1YJDH 1MCOL 5J12B 3IU3A 3ARSA 4IOFD 1ES0B 5HHQA 2GJ6A 5IMMB 3QEQA 1LO4H 4MA3B 4CJ0A 3TH2T 4OAWB 2D7TL 4S1RL 3MRGB 1W0WA 4LVOB 1EERB 4I2XE 3AS1A 2ZP0T 2G5RA 4R97C 1S7QB 2VLJB 1A4JB 4GAYB 5IBLD 5FYKD 4D8PA 4OZIE 4EI5C 5CJ5A 5CEXA 2AK4B 5FB8B 3D39E 3ZL4L 1EVTC 1AGFB 1CE1H 4OF5A 2NXZD 4GRWE 1C7TA 2B4CL 2F8VA 3Q1SH 2ARJB 5DJ2A 5FF6B 3VGGA 5JTWA 3TT3L 4Y4FA 4JFOA 2I5YH 1F6LL 1CFTA 1RZ8A 5E03A 4G9FA 5B38G 3QCTL 4FXGA 4Z5RB 4NCDA 5H35B 2OTWA 2X4RA 4ODXA 2BNQD 3MO1B 1HOCA 5DMJB 1TVBB 2M26A 4M00A 3BDYH 2XXCB 3IB4A 3OGCA 1H3GA 4WI3A 4LL9A 3JWDC 4ORGB 1J1XH 5ELIA 4PLKC 1N2RA 4L4JA 2NR6D 5IFHH 3E8UL 4EBQL 2EDRA 4APQD 1JGDA 1VFOA 3PUCA 5DEZA 4CVWA 3GRWA 5FYLE 4WVRA 3NAAL 2XG4A 5L6YL 1IL1A 3E6HB 1HINH 4HV8A 2H26A 3MV8B 3NPSC 5F6IC 2ZJSH 1NL0L 1YQ2A 4DGIL 5CEZH 3WHE1 5EO1A 5F9OL 4EI5B 1QSEA 4QF1A 1CL7L 2C7UA 3SQOH 1U58A 1TJIH 4JQIH 4KZDH 1RZKL 3MJGX 3AS2A 1JWSB 4LKCA 4KC3B 3BZ4B 5E8OB 1A0QL 1BPVA 2OS7A 4PJIA 2WIIB 2VITA 3WMSA 1OF2B 1OVZA 5GRYA 2Y07L 4FABL 2LU7A 2D9CA 1MELA 5D8JL 3MUGB 3DYMA 4HBQA 4S1QL 2J2ZA 3BD5A 3OKOA 4LEXH 2NY5C 5T1KA 1FO0B 2VXUH 1E6JL 1NFKA 1LNUA 4XPGH 4RGNB 4TULL 2OR9H 3VD4A 2FJGA 5T3ZE 1OW0C 5GGUB 5HI5D 3R8BB 4QXTA 1QLEL 2NXYC 5HDBE 2CQVA 5JW3H 2FZ3A 4XB8A 4WNQB 3NIFE 4NUGL 1FZMB 4MA7L 4OI9A 4QT5A 5GGRA 3C8KA 5JPNB 2PKDA 2BVPA 4FQJH 4I5BB 1HWHB 4PJAE 1Q0XH 3GSXA 4LCUA 5F89B 4MAYD 5D7JA 4LMQE 3K8MA 2BSSB 4XXDB 4KI5D 3PWLB 4N8VG 3SJVA 3TN0A 4WUUB 4LLDB 3IFLL 5TPWH 3QHFL 3VI3F 3RGVC 1TFHA 4W6YB 3CX5K 4DFIA 1JTPA 5EU7C 3PDDA 3AXLB 4S1SL 5IEKA 1GZPA 3EDDA 1N0LA 2CRMA 4KI5E 4S1RH 2QKIB 4FA8A 4JFDA 5KSBE 4Y16A 2BVQA 1I8IA 3IDYB 4AIXA 4XVJH 4YHIA 4NQEA 4W68A 5JUEL 3THML 4MXWL 3VMPA 1N4XL 4S10A 4NRXA 5F9JB 5CP7A 2CGRL 2B5IC 4IOIB 5BQ7B 3KPNB 1ZLVK 3HI6H 6FABL 3O3DA 3LY6A 5GJSH 4I48B 3CSYB 5D7LE 1MCWW 5E2JA 3GMPA 3PJSB 3VXTB 4JFDB 1QLFB 4A6YB 4HT1H 1FL5B 3L5XL 1JPFB 1L9MA 5GS1A 4P3CH 1YMMA 2N7AA 1N6VA 2VUOA 4TTDD 3QCTH 1S7WA 3AGVA 2NY6B 1GJIA 1KTRL 3FO9A 1SYSB 5DDHB 5T1KB 4EN3D 1DBKL 2X44D 2AK1H 1VFBB 4YDVB 1HNFA 2BDNL 2XWTB 2GKIA 3DVGB 1S7TA 1SEQH 4RMSA 3U7YL 4WRLA 2V2XB 4KFZC 4UQ3B 4QRSA 1ONQA 1YEGL 4QHLA 4JFEB 3OXRA 4PLKD 4V2BA 3RVTC 1MCCA 4F15C 1R3KA 2HRPH 2NYYC 3B5GA 4PGCA 1IJ9A 5IGXH 1LO3L 1WTLA 3HRZA 3ALWA 4XRCB 3KPRE 3E6HA 4IBLT 3ARFC 1F3JB 3OB8A 4OCSH 5FM4A 5E1HB 3AAZB 5CEZL 3L7EB 5F96L 2OJZL 3MPCA 4FOMA 5FUOH 4JDVA 3MV9B 4PD4J 1R3IH 2E7LC 2VIRA 4WENB 3TIEA 4KZDL 4IS6B 3WFZA 5ISZE 3TNNA 1YNKH 4GRLA 3MBEB 3LIZL 3UP1A 1V05A 4HWBH 4L9LA 1CT8B 5GRJH 2BHUA 4R2GB 5CP3H 4H20H 4I3SH 2IEPA 5DSCA 1H5BC 4YJZL 3MUGA 3Q6GL 4H0HB 4QHMA 4WI7A 4HCRL 3LQZA 4IRJB 3V5DA 3CAFA 4BQBA 3TWCL 2OR9L 4LRIA 2V2TB 4X4MA 3DX6B 5J13B 5IESH 1KGCD 1T7WA 1RUQH 4O51B 2H32B 4M8VA 3QXDB 5E5MA 5C3TA 1Z5LA 1VGEH 2ED8A 2FWOA 2MHAA 3DRQB 5I66A 3PHSA 3QO0A 5EC2A 4F57L 1ED3B 3VE0A 1RZIB 5CIPB 1B0GB 5F7LB 1MCNA 1FBIL 2ZG2A 5BVPL 1QRNB 2A9MH 2C3GA 2ITDA 4M5YH 3CU1A 1ULVA 5BV7B 1A6WL 2CKBB 5F97E 4JY6B 5EORH 3C08H 2KDGA 4LFHD 2ESVE 4IRJD 2QBWA 4FFVC 4LCCC 2A6DB 2P8MA 2NY0D 5JZ7D 5CGMA 4IDJL 4WEMB 3UBXA 3I02B 4M7KH 1M7XA 3UJIL 3QIBC 4ZUSB 3RIAF 4I1NB 3OSKA 3WV0A 1OPGL 2ESVA 1I8LC 4XP1L 4YC2B 1DSFL 5J89A 1J7VR 3MLVL 2I24N 5DJ8B 2AERT 4FQPA 3ZSSA 3T77A 2AJSL 3TBVA 4D0BA 3VRIA 1KCKA 3L95A 4DN4H 1RJZB 5EUOE 1KYOK 3DV4B 5I75C 4JVPA 2WAHA 5K9JL 2APBA 3DUHA 4RWYH 1KTLA 1YUHB 3KLDA 3RFZC 1ZLUK 3GI9H 5I76A 1N64H 2BRRL 2HLAA 2WSKA 5ALBH 4IMLA 5AZEL 1UJ3C 4JZNA 1IM3A 5L9DL 2Q1EA 3P0VH 3G6AA 1AKJD 3I2CH 3LB6D 3O2WL 2HVKA 3O11B 4U0RC 3S96A 3SPVB 3PV7A 5E2TH 2YBRA 3SQBA 4WV1B 5ADOH 2OR8A 1BEYH 5D9SA 3QDJD 1Z5LB 3IU4L 4YHKL 4OJFH 3RKDD 3B6SA 4Y2DC 1S7SB 4Y4FB 1F6AA 1RIHH 1FSKC 5MP6L 4N1HB 4P9HL 5DI8B 4DCQA 3RVXD 3QDHA 2APXA 2Z93A 3GSNA 3MA9L 3A6CH 2R69H 2QSQA 4GKNA 1IGFL 1BQHB 2QQKL 1FHGA 3KWWA 3KYNB 1WBYB 1I85C 3FO0H 3F7YB 5TFSH 4Z7WE 1D5IH 1BZ7A 5INDB 4JR9L 3T0EE 1B90A 3RL1A 3NCMA 2YK1L 5SX5K 4RAVA 4XVTH 5CSZB 1QA9A 3ZYIA 4YO0A 4M7KL 4P59L 2AQ1A 4XPFL 3T0AA 4GKNB 2H6PB 3QFJB 3TIDB 3WE6B 1YY8B 3W9DA 1NMAH 3GRWH 5EBLA 4YIQA 3E1F1 3PGDB 4TVPL 1OM3L 4RFNB 4OLYL 2QHLA 3HFMH 4HUXB 4AEIL 5TDNA 2DYPA 1S78C 1R24A 5DQDL 1E4KA 2GI7A 1T7ZA 1RHFA 2BVTA 2JIXA 5T5FH 5SWQB 5D7IB 4YUEL 2HA1A 3GBNL 4NT6B 3RWIB 1KXQE 4LCWA 4P46A 4UILL 3B2UD 3CMOH 1KFAL 4PJDB 4TUKH 5AG9A 3QZWG 4PV9B 5I1HL 2MWCA 4JE4B 1I4FB 3IVKA 2ADJA 4JFHD 5DJDA 1E28A 1MHEB 1F58L 4KRNA 5F88A 4D0CB 1LO0H 3C08L 5FO8A 5JNYA 3KYKL 4WWKB 3WFEL 1ZMYA 4JEGB 4RGND 5DJCA 2R1YB 3HE6B 1J88A 3OPZH 3MNWB 2YWZA 3QEQD 4WU7A 4NNXA 3KXFE 4JFPA 1NFDE 1T0NB 4AENB 5J56B 2VXTL 5HI5C 5BXFA 1BM3H 4XNUH 1KB5A 1MUJA 4Z0XA 4FG6D 4FQHA 1X5LA 2E7HA 2VKXA 3ZDXE 5C0NC 5IB2A 4ZOAA 1AR1C 1T2JA 4KVCH 1CFTB 2BOBB 2YOCA 3WXVL 2ARJQ 5GGRB 3QEGL 1JNJA 4HFUH 1P4LB 1QLRA 4JO3L 3S4SB 2AV7B 4EI6A 3V4UL 4LHUA 4Y4KA 1RURH 4L29B 4Y2DD 4LLDA 4GXVL 3UPAA 1MCEA 4F33B 5SWZE 5BS0D 1MFEH 3O81A 2NQCA 1OGTB 3IFOB 4FP8H 4PRNB 4XP5H 4E41B 5JHLH 5JOPE 3ZE0F 2CDFB 2VH5L 4BH8B 5EOTA 4M62L 2FYYB 1WUNT 4I5BA 1CGYA 2Q20A 2PYEE 1K4DA 1IGCH 1X5AA 2XA3A 2XY2A 4IS6A 5E70A 2EXYC 3MJ7A 1NAMH 2Y7QB 2E9JA 4U1HB 2Z35B 1PQZA 2NW2A 4LCWD 4NQXA 3RL2B 5T3ZH 4P9HC 5IQ7L 4UILH 4HQQH 4Y5YC 3VH8G 1F2XK 4AIOA 4J8RB 1RV6X 3QFDA 3LB6C 3MROA 4ZUVB 2EKSA 5E9DE 5IW1B 2F54D 4JFDE 4UTAL 1FV1B 2LTQB 3BMVA 1S5HB 4LIQE 1ZGLB 3BZDA 2J5LC 5CWSB 1JF5A 3O3EA 4RMRA 3FB5B 4PJDF 1GGCL 1VADB 4EUPA 4R90L 1SEBA 1GHFL 5C0IB 3L3IB 4QRPB 4DKDC 2NW3B 3O4LE 5EU7E 5KSAC 4UINH 4K3DL 5I18L 3WHXB 5T1DH 3KPQA 5KZCD 3QXVA 5JA9A 3QDMB 4Y19D 1ITBB 1Q9WB 5HYIA 3FOMB 4P3WA 1FFQA 3D1MC 3QP3A 5DC4B 3EFFB 5HGHA 5TQ2H 1Q0YL 3NN8A 4NZUH 3CVHA 1MFDH 5EU6D 3Q48A 4HGMA 4EI6B 1HHHA 1DBAL 1BQLL 4H1LG 4BSVB 5C0RL 2E6PA 4MJIB 1FN4A 5ECJE 5KSBA 1NCTA 5D1QD 2V5TA 4MB3A 3V0WL 4ZFFA 4OCWH 1NDMB 3FN9A 2ADJB 1BP3B 4Z0BL 3GIVB 1T66C 5HDQH 4GG8A 4PJ7F 1L9NA 4MD5B 1E28B 1MHEA 3UTTB 1A9EA 4QHMB 3CUPB 2G9HB 4N0UA 2EIDA 1INDL 1A6VL 1A7RL 5IBTL 5JOEA 1P7QA 4ZO7A 1RJLB 2RFXA 1A7PL 1LGVA 4NNPL 2BSTA 1C5CH 1YEHH 1LILA 3AROA 3HLAA 2AXGB 2H3NB 1VEMA 4PJEB 5C09D 2MTPA 2W60A 2BSRB 3TIDA 4FQHB 4X7TB 3NIFF 1N7MH 3MRDB 3U1SH 3CH8A 1YEDA 2AJZB 4H0IA 4UOW0 4ZS7H 5CZKA 3WFBH 2LVEA 5BRZA 4GBXA 3OWEA 5EUKB 2FZ3B 2KZ1B 4RIRB 2UUDH 1YNLL 1P4LA 2GITB 1F4YL 4LLWB 3STLB 1G6RH 2EH8H 1JGVH 3O4OC 2GIYA 4WFFE 1JIBA 2WV3A 4OIAA 1BAFL 5GISH 3VXSB 3WIHA 4QNPE 1I1YB 3O6LL 3RPKA 4JFZL 4UQ3A 3RVTD 4UINL 3O3AA 1YMMD 3C9NB 3MXVH 4CMHB 1MFEL 4HKJA 3VGAC 4UV7H 1QSZA 2IANA 5GRVK 5C08E 4GMTL 1NGQL 1VENA 3NABL 1I9RH 3LKRA 4OZIA 2IQAA 3F12B 1KEMH 2OQJA 5F1NB 4WWKD 2VDOH 4X9HA 3B9EA 3TGXA 2J6EL 3FTGB 3T4YB 1XMWA 3CK0L 1KULA 4XBPA 2X9WA 4NCC1 2RCSL 3R8QA 5I1GH 3F6IA 3T04D 4FTVE 3U36A 2F8OA 3MRMB 4HIIB 2ADGA 3CSYA 4JZNB 4MHHI 4NN7B 4WTWA 1UYWH 4JN1L 1TQBB 4IIQB 3ZE2F 3RX7A 1QFOA 4F37F 1JE6A 1D5ZB 4DVRL 4ONFH 3U30C 2NY0B 3M8OH 4TNWF 3BKYH 1I1AC 1JI2A 1FZMA 1RK0A 1YA5A 4ZXBC 5CJBA 2DQHH 1Q9LA 5D93B 5EC1A 4XBEH 2F5AH 4BZ1H 4CW1A 1EDQA 1KT2B 2DDQH 2DWEB 4LRIC 4RCAA 3P77A 4NOFA 3HNSL 2H9GB 4B53A 1J1PH 3N1MC 1Q94B 2DWDB 5ITFA 4ELKA 4MNGB 1CICA 1CD8A 5DMIH 1CK0H 2HKHH 3NA9H 4U7SA 5FK9B 5HSFA 2FX9H 5ICZB 2ZCKH 4TPRL 2VTFA 4U1LB 4FXKA 5EZLB 2R9HC 2DL2A 2AW2A 1KJ2A 1F3DJ 2A6IA 4RQQA 5IG7B 2FX8L 5CINH 2VL5B 4PY7B 3TM6A 1BFTA 4HXBH 1QPXA 4TSAH 4XNYH 4HMEA 4I2XA 5HYJE 2MPAH 5CZVL 1MAMH 1MI5D 4NFBA 4L3CA 4ZPTB 4ALAL 2ZZUT 3T0EB 4QTIL 3O2DA 1MCJA 5DI8A 1RZ8B 3BN9D 4JRYB 2MNUA 4DKFL 1L7TH 5H2BA 1C5CL 4UQ2A 1A1NA 2YR3A 3Q3GA 3WS3B 5E8PA 2EZ0D 4HAGA 3L5WB 2VR4A 4K94L 1EGJA 2CXGA 3T0DA 3QB7C 4HIEB 5IFJB 3DV6A 2NY7L 3D3VB 4LCCB 4BSWB 2WZPD 1MHHA 4LVNB 1EHAA 4L3CB 3VCLA 2X42A 1EJOL 3LZFH 4MXQD 4Y19B 4TTGA 1BQSA 2EXWC 3VFOA 1MIEH 3N1FC 4FXGB 4CUCA 2X1QA 3VD9A 4HDIA 4QRTA 1G6RB 1GAFL 5C0FB 4XCCH 2RB8A 4M1CD 5GS0D 1IQDB 3D87B 4U1HA 5T3XL 1JTTA 4M43L 5E4EC 5ID0A 4WHTA 1DQJA 1AO7D 1HILA 2XXMB 2FGWL 4U49A 2F54A 2W9DL 1HCFX 3AU1A 5F88B 1IE5A 1CICB 1JYWA 5EZIH 1A8JH 2C1PA 2P47B 3QH3B 1CDBA 3H9ZA 1NGQH 2V7HB 5HHXH 2R29L 4R3SA 5DEGA 5GZND 5M94B 4U31A 2BVQB 2PXYB 4WWKC 2P8MB 1WBZB 3FONB 3QJHA 4UDTB 4KGJA 3LN5A 1AR2A 4U7KA 1QLRB 2VR9A 1IAOA 2X4SA 1CD1B 4LU5L 3S36X 4BELD 1NCCL 3U0WL 1FRGL 3S35X 3RGVA 4CBPA 4UOJA 1B0WA 4WTXA 2XWTA 2V2WB 3DVGA 3F7YA 5C1MB 4BSJA 1BFOA 1DQTA 4RA3A 3O8XD 4XHJD 2A83B 3IF1A 4JJ5B 3NMEA 8FABA 5ANME 1OGAE 4WU7B 2C3XA 2BVPB 4KHTL 4X5WA 2R23B 1BFVL 1IM9B 3BHBB 5EU5B 4GAJL 4ODUA 1G7JA 5FDYA 1K5NA 1FFPA 3GK8L 5I1KL 4PTUB 1QRNE 2ERJB 1S3KH 4XP9L 1DBBL 32C2A 3NCJH 1KNOA 1P7KB 5I1DB 1PKOA 1C16A 1JWUA 4LCIH 1U9KA 5DUPL 4OLWH 2CLVB 2WUBH 3BUTA 3QQ9D 1YEJH 5DMIL 1CK0L 4QXGL 3MJ8B 2R2EA 1IGML 1HHJA 2EYRA 4F8QA 4JANB 1LHZA 3O4LB 3MLUL 3LPGA 3TO4A 5F7MC 2W92A 4YHPA 4ODWB 4YDKL 1F11A 5T3XH 1CGWA 4ZAKB 3U83A 3IDXH 3E2HB 4MQTB 1TCRB 4WUKH 5I8OL 5J6HB 3J8F7 4TSAL 3TA3C 3BH8A 5JOFA 3IFPB 2V7HA 3T0EC 1G7MB 1HINL 1G7LA 3OKNA 4IIQA 3EJYD 4JRWA 3RHWK 1FGVL 3CSGA 3D3VE 4OCYH 4GAFB 4M6OH 1T3FB 4DKFH 2Y23A 4HZAA 4B7LA 2CPCA 2DJUA 1BF2A 4G42A 1XGUB 3UTTE 4NKQB 4LVNC 2VSDA 3I3BA 3O8XC 1VKXA 1SJXA 3S97C 3MBXH 1HOCB 1R5WA 5KSAD 1FVCB 3EYVA 2E7LA 4O5LH 3IXAB 3SPVA 1CGSL 1UZ8A 1HSAA 4NC1E 2F74A 4Y5VA 3MCG1 1IAII 2NY5L 1J8HB 4XWGL 2HKFH 4LPTA 3MLXL 4N9GB 3DMMB 4X6FB 1KN2H 1KTDB 4XPGL 1FG2A 4PJEE 1OP3H 4Y8DC 2DQEL 4JFDD 3QI9B 3RWHB 2PO6A 3UTOA 5BO1H 3BGMB 4NKOB 3QQ4A 2NYYD 4JN2A 3OAUH 1AD0B 1T2QH 2BSTB 1SJHB 5HD8D 5CKAA 3WUWG 3HAEH 1GGIL 4AM0B 1WT5A 3K74B 5FKAB 4P5MA 4HEPG 3VFNA 1C12A 5J6GB 2Q3ZA 5FCUH 5JMRA 4M9PA 4EVNB 4JDZB 2CXKA 3RZWA 3EZJB 4NBXB 5JW4Q 4BFGA 1U92B 1BIHA 1CGTA 5T3XD 3TC9A 5KN5B 2QJDA 1A1MA 2YPKB 4ISVB 3BWUC 3RL2A 5GZNC 2VITB 2A74B 1NDMA 4PV8A 5J8OA 1A3LH 4BFEA 4P3DA 4ZXBA 5C6TL 3T0BA 5SWSE 2E8ZA 1MRDH 3V6ZA 1ZE3C 5BRZE 1TITA 2XY1A 3ZE0E 2G9HA 1X5GA 2V2TA 4CKVX 5ESAA 2GAZA 5DF0A 1MLBA 4QRRB 5HHNB 5I1EL 5EU3A 3VGAB 1WEJH 2ZCHL 2X41A 2EO1A 1ZVSB 4N0UE 1BHGA 1FO0H 4BZYA 4KHTH 2WWKO 2Y4SA 2YS4A 4HBCH 4X6DF 2YEZB 3LPWA 1HHGA 2WMPA 4H8WL 3ARVA 2XKNA 4PPTA 5EZLA 5DMGC 1T6WA 4Y2DA 2A77L 4CDHA 4MCYB 3VXPA 4ORGA 1KJMA 1ZHBA 3PGCA 4Z7VF 2ZNXA 3AS0A 5DQJB 1AGCB 4AMKL 3S98A 1ZSDB 2HT4D 2ZPKL 3QQNA 5IK3B 5IIEA 3U9PH 4CMHC 1HZHL 3DETD 4KJPC 1S9WA 1RSFA 1MOEA 4LQ1A 5EIIB 3I85A 2P8LB 3PABA 5ESQB 5GIRB 4K71C 3T09A 1WTGT 4LBEA 4LF3A 3KVQA 4OZ4A 3HCVA 2XTLA 2CRIA 1M7IB 1HNGA 3EYOA 3TPKA 5BZDB 1JZ2A 1YMMB 4YE4L 4GQ9H 1AHWC 4GW4B 5EC1B 5EO9A 1QSEB 4ZUWB 1CGVA 3H0TA 3IDXL 3MFFA 4PJCF 2IFGA 2AQ3A 3RNKA 1JNHB 1YY9D 3BWAB 1GZQA 2J4WH 2X4TA 4EDXB 1UA6H 3F12A 3HA0A 2HJFA 3QFDB 4C4KT 3MV11 1KXTB 1ZA6B 3O4OB 4OQ1A 3GSVA 4QTHA 1CDJA 2A73A 1JNLH 3CDFA 3FAWA 4CVXB 5ITFB 1AH1A 5E9DA 5IJKC 4ACPA 3H9SD 1MCOH 2EO9A 3DETC 4MB4A 1Q9KB 3U36B 1QP1A 3P73A 3H9YA 4YHNA 4PJAF 1CLOH 3LVEA 15C8L 1FL6A 1J1XL 3JUYA 4C56D 1XF4A 1QBML 5C0JA 4ZD3L 1RHHB 1HIML 1C5DA 5HHQB 5EBLB 3P11L 5C07A 4YQXH 4WI8A 5EOTB 1J8HA 2CRZA 3BP5A 3PNWB 1K4CB 4YBHA 1T4KB 2I26N 1A14H 2DICA 5JDSA 5TQ0H 4PGCB 2SEBA 3I6KA 3T0WA 4P46B 1BJ8A 4PJ7E 4GKOA 43C9B 1K2DA 1T6VN 1KTKE 2GW5A 3MRPB 4TNVF 5E95B 4JKLA 5C0AB 5CD5C 3QWOB 1WIPA 4G8EA 2W38A 1A2YB 3DBXA 4AG4L 1O5DT 2P5EB 5E8NA 4NO2A 1MUJB 3CUPA 2OQJB 4UAOB 3QPQC 4PG9B 1AXTH 2C3VB 3WL9B 5J1AB 3AY4A 1IC5H 1MREL 2XN9E 1AO7E 3DX8A 5C70A 3UJTL 4NNXB 1DLFL 2KPNA 1NJ9A 5GS1B 3BDYL 1YEIH 4MAYA 3HE7B 2XWBB 1OAZH 4KKLD 3RZCA 1U8KB 3OKDA 1T21A 1CDIA 2RQ8A 4FQXA 3TZVB 4J4PC 3PQYA 2WP3O 3MODL 4JPVH 4XNZC 4P4RA 2G75A 1YPZF 3W82A 2QSVA 2P5WE 4XCEB 2DLHA 1KACB 3DECA 3FOMA 1QTYT 3ELAT 3M1BA 1MRCH 3MA9H 4EI5D 1XEDA 1GOFA 1V8HA 1MQ8A 5KG9B 5B38A 3OG4B 2IH1A 1RJCA 1UWEH 3HRZB 1YNTB 2K3TA 4P5TB 2ATPB 4MCYA 1DEDA 5IVXA 1RMFL 4RBPH 5A3IC 3VFTA 5FYLL 4DW2H 4M8QB 1EIBA 1DN2A 4JRXE 5FO9A 1FIGL 2J8UE 5CZXC 4KK5D 4PGZA 1A9EB 5DEGB 5DR5L 4HS3A 5MEND 4JZJB 4HG4J 1KB5L 5E56A 3KJ4C 3LEVH 2D7MA 1OF2A 1NMAL 2X9YA 1GPOL 1J9CT 3TBTA 4JRYD 3U0PA 5D6CB 1K8DA 1L4IA 3G5XA 4X6CA 3H0TB 4PTUA 3RY6A 1E4WL 4MB5A 4OV5A 2NY3C 1MCPL 1QLFA 3CFJB 1WCBA 1UA6L 3TBYB 1MY7A 3JUZA 3VXUE 5KJRL 4ETYA 4HGWA 2BCKA 2YN3A 4PS4L 5F7HA 4F7CB 5HDBF 4F7MA 3DRQA 3HZYA 4I0PA 1VERA 4YK4C 3IS1X 2X40A 1ED3A 3A67L 2VLJD 1QOKA 1DEEA 4RMWA 3OKMB 5DUBB 4OZHB 1GH7A 1OOAA 3IDIA 2B2XL 3V2AR 3H42H 3PWNA 2UWEF 1FJ1A 1Q1JH 1UM6L 1T1WB 3EO9H 3ES6B 5EU6B 1EHLH 3HC3H 4YAQA 3ZYOA 2FX7L 2MSPA 2IPTL 5TQ0L 3TCLA 1ORSA 2GUOA 3PL6D 1N3NA 3LV3A 1NLDH 1Z9SA 3D85B 2NX5A 2E7MA 4F7EB 1OT1A 3ILQC 4PJGB 1BD2D 3TBWB 5KSBF 1F90L 4GRMA 3QEGH 5J9PB 2YSSA 1FNAA 3MV9A 4ODHH 1MCWM 4P2OC 3MO1A 1J5OH 3HNTH 5GRXG 2FJGB 2PTTA 1FFNA 3GNML 5DXWA 3VRIB 3T0EA 5KS9F 1G84A 1MH5A 1DE4A 1HI6A 5F7DA 1T5XB 4PJBE 2CK0L 4GAYA 2UWEE 3JTTA 3GBMH 1SEQL 4B7IA 1DQQA 4PIRF 4L9DA 4G8GE 5FIEA 5E8EB 4QRPA 5DFWH 2R8SL 5IESL 3L6FB 5HGAA 3BW9A 3UPRA 3QQ4B 4A2LA 4JM4L 4Z9KB 3GSWA 4Y2DB 2DRUA 3BP7B 3UTSA 1SJHA 4QRSB 2VDRL 1AGBB 1FP5A 3SKJH 1H5BB 5F3HB 2AJXL 3PP4H 4D3CH 4KRLB 3X3FH 3C5ZA 3H9SB 1DQLL 1BOGA 4LSUH 1U8PB 4RGMC 3U2SA 3IXTA 2WNGA 3KPRB 5LGJA 1JTOA 4LCWB 4FQ2L 3NCYS 5I1DA 3BP6A 3OKEB 4OLVL 3EYVB 5E6ID 2VN7A 4AYFA 5F1IA 4Q0XH 4FQIL 2FD6H 4G8EB 2HJKB 1BWMA 3G9AB 3MV9E 4OD2A 5HYJD 3MR9A 5DD3H 3N9GL 2VAJA 5DMKB 4LRNL 1N6UA 3O2DH 4FZ8L 2H2PC 3VXUA 3X12B 1Y6KR 1BJ1J 1J8KA 3TFKD 3VGHA 3CXHK 2Z93B 3TWCH 5HYSG 2LAGB 4YO0B 1C12B 5J6GA 2F8XC 2W60B 4PJHB 4HLZG 1JGLH 4X4XB 4WW1B 3RBSA 3WSQL 5C8JA 1AQKH 1T21B 5LWYL 3VXMD 4Q97A 3BEVA 1FCGA 3IT8D 5DJXB 3LKOA 2AJYL 2NZIA 1TVHB 1QR1B 1LDSA 4LAQL 3GNMH 5CCKL 5DLML 3SE8H 4UV4L 4TQEH 3BRDA 2CIKB 3MCKB 3RP1A 3VI4E 3F65A 2Y5TB 4Q9RL 5CLTA 2BSRA 3QFJA 2CMRL 5E2UH 4YXHL 4AH2B 3EHBC 2V17H 3EYSH 1XGPB 4PRHB 1KNOB 2W59A 4QXTB 3MRFB 4PB0L 5C7XH 4KROB 5IROA 4NO0D 5EO9B 3X14A 1GCFA 1URLA 4U1SA 1MNUL 2IQAB 5IR1A 3GSUA 4G43A 3IDYC 3E0GA 3HC3L 4N0FA 3V5HB 2XFXB 4R3SB 4WWID 3ZDYE 1BQUA 3ZT7A 1P1ZA 3MCLH 4NM4H 3I84A 3KPRA 5EOQL 3VWKD 3BI9X 5B39A 2A73B 2XZQH 1WZ1L 2YD6A 4P5TD 5K59F 3E6FA 4FQXD 5FOBA 5AD0B 3PQYE 1WFTA 1B9ZA 1Q0YH 3P4MB 1VADA 4LEOB 1ZLWH 3W39B 5I73B 1Q38A 5IB3B 4OGZA 3L5WA 5I1AB 4P49A 5C0RH 1U58B 4PJFB 1CYGA 3IAQA 4HUWB 1NCWH 1YMME 4DQOL 4Y1AB 1F8TH 5D70L 2Q86B 3DGGA 4NBYB 5INCB 5C0CD 3CC5A 4GBXD 2VQ1A 3W0WB 1U3YA 4NRXB 5F9JA 4MA1B 4P2OD 5HYFA 1XAUA 1G7IB 4LSQL 4KQ3H 4Z8FL 4JY5L 4N0CD 5JO5B 5EC2B 4QRPE 3L3IA 2PXYC 1FAKT 4PJ9A 2YPVH 2P8PB 2ERJC 3RU8L 4JM4H 4YDLC 2HT2C 3BSZH 4F15B 2GK2A 2GJ6D 1IEBA 4OGYH 5MP6H 1BD2B 2ORBL 3VJ6A 1WWWX 3S37H 1JYNA 1WGOA 1XZ0B 2NY2B 2FIKB 3UBXI 2GY7B 3MBEC 3ARFA 2P5WA 5TF1H 4XXDA 5GGTH 3MSPA 3O3UN 4QOKA 1TQBC 4FZEL 3IKCA 5ALCH 4Y88A 3SJVB 3TN0B 4KPHL 4ERSL 1AKJB 1JPTH 1BZ9A 4PJ7B 4V1DD 1Y0LB 3L9RB 3N1PC 1CT8A 1Q8MA 2FATL 4G7VL 3M8OL 1HXYA 5DC9B 1YEFL 3OXSB 4FQIH 5F6IB 1F4YH 5IBUG 1NGYA 4LSVL 3FQTB 1CXIA 4CRPA 5DJ2B 1UH2A 2VIRB 1QYGL 1LEIA 3SDXF 4IRSD 4LBEB 2PXYA 4LPYA 4KU1A 2Q8BH 1XIWC 4P2RB 2DQIL 4RGOH 5JA8B 5KN5A 5DD1H 4PJ7A 3DROA 3HHRB 4JFFE 5T5NF 4F7CA 2X1OA 3FFCB 3O6FD 3HMXA 1CFBA 1W8OA 5I66B 5JIHA 2IADA 4QYOA 1LK2A 3QO1A 3GSRB 3RWJA 5C9KA 4NQSA 4K71B 1IC4L 3GJEB 2P4AB 3LHPL 1R3LB 1KB9J 4G6ML 1OL0A 2Q76A 1UENA 2H32A 3UZEA 5I1LB 4H25A 1TETH 2CO6B 2ITCA 2VZVA 4N9GA 1YYLH 5FYKU 3NOIA 4HS3B 2AGJH 5A43C 2AJ3B 2R2HB 5IF0B 3VFUB 4BZ2L 5A3ID 4NGHH 5D1ZA 1G0XA 4PJCE 4ZFOA 1J10A 2Y9RT 4D94A 1E4KC 3I50H 3NCBB 4JFYB 3A6BH 4XBEL 3S36H 1A6UH 5E6ZA 1K4DB 2VE6A 5BW7C 4KMTH 3MGTB 1O0VA 2I9LA 1NFIA 2X4UA 4OLZH 1WC7B 1AD9A 1U6AL 3E6FB 4JPKH 3S5LB 2EDYA 1KLGB 3D69B 3S4SG 2YA1A 3MNVA 1MIEL 3EKCA 3GSNL 3QIBA 2H32H 4GKZB 4DN3H 3EOBA 4WTZA 5J12C 5F7WC 1IM9D 4L5FH 3WS6A 3FZUD 3CFJA 3PGFH 4LHUD 1OT2A 4PJFA 4Y4KD 1NFDF 4JHAL 2FJHB 2Y36L 5HHOD 1BVKA 3BDBA 3HE7D 3QQ3A 3IDMA 2IQ9H 3LDBB 1X7QA 4L3EB 5EN2B 3DX8B 1QYGH 1M71A 4JO1L 3TBTB 4R96A 4GXVH 4YXLL 5CUSH 4OQTH 5DQ9A 3TBSA 2CIKA 2EDHA 3MCKA 8CGTA 1UVQB 4OUOA 3VD5A 2R29H 3MLPA 1HK6A 2X2YA 3RVWD 1U8LB 2EYSA 5L2JA 3FB7A 3WDJA 2FJHA 2R39A 4U6HB 3MOAL 2D7NA 1IC1A 5J3HC 5C0AD 5DUMH 4X98A 2DI8A 2HFGL 3RWCA 5J1SC 3MV9D 2A9NH 5LQBL 5E24E 5EU5A 3RKPA 4I3RH 3D18A 3TT1L 4WWKA 1T4KA 3OMZA 1YQVH 3QEQE 5DO2D 5GHWH 2SEBB 3FQNA 1JRHH 4K2UH 1C16B 4DUWA 4MMXC 4NQDA 1GAFH 3NPSB 4LLUB 3GGWB 1WITA 2UY6A 5F8RC 1KJ2L 4EXPX 2VDPH 3GK8H 5GGUA 5I1KH 2HH0H 3VXRD 4F7TA 2EDLA 1FDLH 4OZGF 1MCRA 4DWHA 3F5WA 5TDNB 4CVXA 1OP5K 4H1LB 2HN7A 4YHYC 5DJ6A 4G6JL 2ESVB 5DHVB 1FZJA 1BOGB 3P4LA 1CXKA 3U2SB 1NBYA 5F89A 1KIPA 1QSFE 2DKMA 3OJVC 3OJ2C 2CKBH 2H6PA 1MCIA 3FB8A 4OCRH 3DVNA 4OZFH 4G6KL 1V3MA 2DQJL 3LS4L 4ZFGH 4C83B 1TJGL 3CVHB 3DXAE 1S9YA 1CDHA 3DLQR 3GMMB 4BSVA 2FJFA 4MXVE 2NY3D 1XIWB 4ODXB 4K9EL 2LFGA 5DD6B 4LF3B 3UTPE 1I9JL 2NY1D 3MA7A 4XCNA 4F80A 5CJ8A 2GJ6E 4K8RL 3CDGB 3HZVB 4IRSC 2PW1B 4J12A 5I15H 3HE6C 5EU4B 3PWVB 1FV1A 1EFXD 5ICZA 2AJVL 4LVOC 3FQUA 3LKPB 3D85A 4KDVA 4G9FE 1KV3A 5T3XE 1Z2KA 5DSCB 4MA1C 2IJ0C 3MRKA 1EEZB 1P5UA 3CFIC 3GSNH 3GMQA 4GW1A 2ICEB 3QNYA 3LRHA 3E3QC 2LTQC 2X9XA 3H3BC 1UWGL 1FFNB 3RUGA 2AQ2A 1EV2E 5LBSH 1BECA 3K8LA 5MI0C 5KAQG 4PLNC 3HAEG 4UIKL 2VDPL 1OLZA 4JFQA 2R23A 5BMFH 4PRIE 3W9EB 4HDIB 5CJQL 4MSWB 2VR5A 3OZ9H 4KKLC 3RWEA 1HYSD 3QI9C 5DJAA 1QRNA 4KKCC 2YRPA 3QXWA 2GK0B 1C1EH 5DQJA 5HGBB 3WLBA 3KAAA 3O3BB 5C6TH 3FQTA 3QEHB 4TVPD 3RJQB 3TIEB 1QQDB 3K4AA 4LAJH 1YZZA 1KPUB 4J3WA 1U8QA 4TSBH 1S5HA 3QUMB 2ARWA 2DIJA 3V4VL 1OAXH 4ZNEA 3MV8A 1MWAL 2CRYA 3FQNB 3MA7B 4XCNB 3PP3H 3WNPA 1I4FA 1S7WB 1SQ2N 5IW6B 2ZCHH 1DL7H 12E8H 4HIIA 4DVRH 3H9HA 3ARDC 5FYJH 1MI5E 4U1JB 3S34L 1CFVH 5CD3A 4N0FB 4FQCH 5IBLC 2C26A 3PQYB 4NC1C 4M7LT 4U6XA 3SQOL 3CPLB 2PUQT 3F62A 3WKMH 3E2HC 3DI2B 4H1LH 2G60L 3NZHH 1R3JA 1MF2H 2IH1B 5DHVA 1P6AB 3CD4A 1YMHB 5MEPA 2EIEA 2X1WL 2ENSA 3EYFB 1F2QA 3ZZ1A 1FFOA 4MDJB 1L0XA 1MRFH 5DHYA 2XTJC 1CDCA 4JVUA 3QBTB 4D9RE 1MIMH 4OIIL 1J18A 2DAVA 5ACLA 5BOZG 4NO0B 3PIQB 1DCLA 5AYQA 2W0PA 2R2EB 1QFUH 4O4YH 2DLIA 4DGVL 5FM5M 1NMCC 1EHNA 5CZVH