2DLGA

Solution structure of the 20th filamin domain from human filamin-b
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
102
structure length
102
Chain Sequence
GSSGSSGRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-B
publication title Solution structure of the 20th Filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 5
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dlgA01
5GQBA 5DQDH 4JPIA 3Q1SH 4H25A 4WHDA 2XKNA 1EGJL 4U1HB 3C60A 5HHXH 4WO4B 2YN5A 3HS0B 4X98A 4YHML 2EH8L 3WNKA 1NAMH 5HYFA 1L9NA 4XPTH 1NFDB 4Z0XA 4LAJH 3G9AB 1CZ8L 2MQ0A 1HHJB 2H6PB 1DP0A 2GJZB 4X6CF 3UJJL 5KG9B 3EGSA 3O2DL 3PDOA 3JWDL 2H41A 3EOTH 2I60H 4YAQB 5KANG 3UDWA 3PGCB 3ARGA 1HKLL 4GKSB 5KZCD 1YJDH 1UM4H 4OSUH 4OTXL 2EDEA 3IFPA 2YEZB 4HQQH 4NBXB 5HGDA 4KKAD 5EU6D 4YEFA 1ZHLA 3JWDC 1DQDL 5F9DC 5IB3B 4I4WA 5JA8B 4Q9RL 4EBQH 1URLA 2YHGA 4IHOA 1KTDA 1UWGH 4C59B 1T7YA 4TUJA 1YEFH 2EIDA 1VSCA 3WS6A 4OGXL 3WLBA 4PJEB 3VFOB 1JI1A 1NCTA 2AGJL 5I8OH 5E7BA 1FE8L 4GRWE 4YXLH 3TO4D 2VAAA 2DN7A 4K3DH 4BK5A 1BGXH 1BFVH 4ZFFA 3B83A 4XC1L 1XGTB 3RHWK 1IM9A 2HFTA 2YRLA 4GRMB 3TJEL 1S7RA 2C4FU 2D0FA 4EI5B 2HKFL 4NO3A 4ZAKD 7FABH 1N2RA 4YJZL 2Y9RT 1CTNA 4FQIH 1KENH 3WNPA 3BP5B 5HJ3B 5ESQB 1BZ7B 4IJ3C 1J0ZA 1INEL 1FDLL 3O3AB 1MCDA 4CU6A 3MRDA 4NKOA 1PSKL 4OLWL 4PJ8C 3OF6A 1MFEL 3QDHA 3EYFB 3VXMB 5CBAA 5IGXL 4JO2H 4JR9H 3RGVA 4APQC 4OJFH 4LVNB 1J1XL 4MMZC 4YBHA 2Q20A 5IWLA 5EB9A 1J0HA 4JANA 3AB0C 4YR6B 4X6CE 4RMWA 3D0VA 1JPTH 4K7PY 5F1SA 5I8CB 4I13B 4TUOA 4G8FB 5CS7A 5JZ7D 4S1DC 4OBRA 2BCKA 3VFMB 4ZQKB 3KNBB 4EN3A 1WWCA 5DUMH 4PP2A 3RX5A 3T04D 2F53B 1WFTA 5I16A 1WQVT 2W0KA 3DRQA 2WINB 1FPTL 5DD5L 3D18A 4DVRL 2GSGB 1V7ML 3ARGD 1A21A 2R1XA 4WHYH 4E5XB 3HB3D 3IDJB 3F7VA 4NO2B 1FH5L 1G0XA 4ODUB 2P1YA 3FJTA 2X6MA 1J1OH 2VLJE 4PY7B 1J05A 1S7WB 1IAIL 3PV7A 5KS9F 4EEEA 1UM6H 1QSEA 1IKNC 4ODTH 5IVZB 4LIQE 4M62H 5JIPA 5DZLA 1MF2H 4GRLC 4U1HA 4OCWL 4WO4A 1EBPA 1IM9D 2BNQE 3HS0A 2B8OT 4JFEA 1LK3H 1NFDA 4KHTH 2PYED 1OTSD 2FEDC 2H6PA 4JPVL 1NBZB 2GJZA 3KLDA 4ZUUB 5JUEL 3QP3A 5JHLH 1NL0L 1FGNH 2APXA 1TLKA 4YAQA 4N0CC 3PGCA 1U8QB 4I3RH 1TNNA 4ACPA 2LABA 4GKSA 1S9KC 3EHBC 4QTIL 4PJGB 1RPQA 1NAKL 2YEZA 4LEOB 3JWOC 4PGBB 3GJFB 3KLSA 3OF6D 1PG7L 4MVBD 4HDIA 4HKJB 4D0BB 3RGVD 3LS4L 5IB3A 5EC1A 3LKNB 3F7PC 3C09C 2EYRB 1X3DA 4RFOL 3BZDA 3WBDA 4ODWB 4N90E 5I1IH 3HI5L 1CDYA 1IKFL 4PJEA 1BFSA 5EUKB 3VFOA 4O4YL 2EDQA 2Z8RA 4HT1H 2HN7B 3S3PA 2W07A 1TJIH 4IRSC 4EN3D 2VH5L 2W91A 3KLAB 1XGTA 1MWAB 1QRKA 3MUY1 4ZPTB 3NZ8B 4GRMA 1NLBH 4JFPB 4NWUH 1IAMA 3J8F7 4EI5A 3ZYOA 5C2UB 2VWEE 3NCCB 5CP7B 1IC4L 4NC1E 4NC2B 1J7VR 5C7XH 1YQVL 3BP5A 4G7YH 2VMFA 3QHFH 5ESQA 5KS9E 1BZ7A 3I85A 3B5HA 4OFKA 4MNGE 5KVDH 2AXFB 5MHSD 1FJ1A 3WO3B 2I9LB 1JMZA 3H9SB 2GAZB 1QSED 1S7UB 3EYFA 4HPOH 4MD0B 3VXMA 1J8HA 5C07E 1EO8H 3QXAB 5IW6B 5J1SC 3HKFA 3VWJB 2EXYD 4WO4D 3CCHB 2NY0C 4JFED 1I9RL 4YR6A 3SCMB 1IGJB 5I8CA 1VFUA 3QSKB 4WFFE 1U91B 4G8FA 4YNYB 3VFMA 4ZQKA 3KNBA 3OXSB 1C5BL 1HHHB 3SDCB 2WINA 4NJ9H 2Y6SD 4QRQB 2GSGA 3IT8D 4JDTL 4OLYH 4H26B 1GIGL 2Q8AL 4E5XA 4NO2A 1M7IB 4ODUA 5GSRB 3PABB 4NQXB 3VG9C 4PY7A 4QXUL 4JG0H 3V4VL 5CILL 1F6FB 2Q3ZA 3U4EB 1AR1C 1ES0B 2QHRH 5DS8B 3TT3L 3AVEA 3K8LA 4IOSD 4DJMA 1XF3B 5GGTA 3S4SB 2R23B 2CSPA 3QCTL 2CIKA 5ACZA 1OWWA 1MELA 1IT9L 1NCUA 2PNDA 5C8JB 4EI5D 4KXZH 3V5HB 1RUML 4MA8H 1JF1A 1CDIA 1NBZA 4M8QA 4ZUUA 2VDQH 1CYGA 3QZWB 4PJAB 3AS2A 4R3SB 1U8QA 4ONGL 2GKIA 3P0YH 2F74A 4PJGA 5C0FB 1AI1L 4LEOA 3GJFA 3HUJA 3VXMD 4ZO7A 1J8HD 2Y25A 4HKJA 4D0BA 1CLYL 3HMXL 1A6UL 4NFBA 3LKNA 4OIAA 1NDGB 2EYRA 4FS0A 3ZKMC 5DD1L 1NCCL 4OD3L 5T33L 3L5HA 4JM4H 4ODWA 1CXKA 3TN0C 2P5EE 4J7RA 3QNYB 4NGHL 5DJDA 2VZUA 2RR3A 5B38B 3VFSB 3QEGL 2HN7A 4KKBC 3KPNB 1I3GH 4OKVB 4ZOAA 5JPMB 4ZPTA 3NZ8A 3INUL 4JFPA 1INDH 1GZPB 2I5YH 3UCRA 5CP7A 1C08B 4KJWD 1QFOA 2J8HA 4JPKH 5F7EH 4KRLB 5GS0D 1JMXA 1NCWH 4ZTPL 4Z6AT 2OR8A 4M3KB 5SWZE 1IQWH 5I30L 2AXFA 2ILLA 1PX3A 1S7UA 4MD0A 3SDYH 2NW2B 3CUPB 4YZFF 4WHTB 2GCYA 3KXFD 4HS3B 3CCHA 1AE6H 1RZJL 2IBZY 5GRXG 5EOQH 2VRAA 3SCMA 4HMDA 4P4KC 1V7NL 3UJIL 1GAFH 3RHWF 4D9QE 5MERB 1U91A 3UTPE 2ICES 5EFIB 4OFVA 4NUGH 3RL1B 4F58L 1UCBL 3OXSA 1TPXC 1HHHA 3SDCA 1RZJC 4LSSL 5E8NB 12E8H 1N6VA 5BXFB 3MLUH 3QYCA 4H26A 2NZIA 2VZOA 2DLGA 2D4FA 2WUCL 5IHUL 3CNKA 1AJ7L 3ZTJG 5GS2D 5GSRA 2B4CH 1XGQB 3PABA 1TQCB 1GGBL 2HKHL 3MLYL 4NQXA 3DTXA 5DK0B 4KJPD 4M02A 4ONFH 5HGAB 3FFCE 2XT1B 4KKAC 3EDEA 2QQQA 3U4EA 6CGTA 1ES0A 4WEUD 3A6BL 1JV5B 5FGCE 1HN1A 4NQDE 2J8UF 4Q9QH 1B0RB 5J8OA 3PDGA 2PTUA 1OVZA 2R23A 3S4SA 4JKMA 5F9OH 1XF1A 2EDJA 3S3JA 2MQ3A 2MCPL 4PS4L 1Z9SA 3V5HA 1UZ8B 3RJDA 1T20B 2A74B 4CKVX 4RRPG 2VO5A 2MFNA 4MJ5B 4ODBD 3QZWA 1IGML 8FABB 4PJAA 3H42H 5C0RH 1YEHH 4XTRC 2MHAA 3V4UH 3VXRD 2AKRB 4YZFE 1EH9A 1EUTA 3K1KC 5C0FA 1IGIL 1UH3A 1JYVA 1NMAL 3TVMB 5DEGB 3NIGF 4F3FB 3WFHB 4F9LC 1NDGA 1EGJH 2MPAH 3QRGH 1OTTD 4ODVH 2ZUWA 1CD8A 1YEEL 3SCMD 3V5KB 3QNYA 1N8ZB 1KTKE 5B38A 5DF0A 3C60C 1JPST 3VFSA 1F5WA 4AENB 5I75C 3TWCL 2NY2C 1KPUB 3KPNA 3RWIB 4Y19E 2NX5A 3SKJL 3UJJH 3SDCD 2K7PA 4OKVA 2X9YA 4ORGB 5JPMA 1GZPA 1JNJA 3LS5H 4P46D 5KSBF 1T0MB 1HKLH 3BW9B 1DUYB 1C08A 2RBLA 2YD2A 4J23A 5EZJB 4UNVA 5B38G 3UDWC 4NQEA 2XXMB 2NY3B 1Z9LA 5C0BA 2J8UE 4PB9H 4ZO6A 2ADGB 1UQSB 1YC7A 1QFWM 4UT9L 4NHUB 2YZ1A 3PGFH 3QEQE 3IFOB 4G6ML 4NQCE 1B90A 1YPZA 2NW2A 3CUPA 3U9UB 2ADJB 4U3HA 3WS6C 4TULL 4HS3A 3PJSA 5I17B 5C0CB 1KG0B 1A9BB 2YBRB 3T0AA 5MERA 2DIBA 5EFIA 4QHNB 5GRWA 4ZD3L 5TPWL 5LJYH 1CF8L 3RL1A 5E8NA 1J12A 2BZDA 3I50L 4JHZA 1AKJB 5BXFA 1INEH 1DBML 2W59A 2ZCKL 3NIGE 3S37L 4RGNB 5HY9A 3VFPA 3QWQB 1WZKA 4X7SH 4JAMB 1MFEH 3BOVA 2WUBL 1WICA 5DK0A 3B3IA 2ID5A 4NZRL 3GMMB 4NSKB 5HHVL 3CFJB 4OCXH 1JV5A 2BRRL 5LXGL 3MJ8B 3WFBL 4OM0H 1NCBH 2R2BB 5DA0B 2NX5D 5KSBE 1D5ZA 1FYHB 1OGAA 5E4EC 3BKYH 1QYGL 1FPTH 3T4YB 5DD5H 4JRWA 1ORSB 3SKNB 3T09A 1UZ8A 3HZYA 1T20A 5BVPH 3ULVC 2Q7NA 3VDAA 4FFVC 3TV3L 4NQED 4QXWA 5F88B 4YDIH 8FABA 2YWYA 1Z5LB 3PDDA 4QRPB 3VFGL 5C0BD 4CN6A 1T1XB 2AKRA 3V5DB 4PRIB 3VDBA 3FZUD 1IAIH 2DB8A 4U6XB 3ZE0F 5DEGA 4LSUL 3VGFA 2ZPKH 1WAAA 4F3FA 5CD5D 5M95B 1JGEB 5EO0B 4OCWH 5LBSH 2AJUL 4N5EC 1OB1B 3F12A 4U1LB 3V5KA 2E27H 1N8ZA 1QHOA 1FL3B 2UYLB 2EXYC 4WO4C 4KZDH 4NP4L 2XQYG 3RWIA 3ALPA 5JUEH 2K1MA 3JVGA 1NL0H 4XAKE 4ORGA 1A6TB 3MGTB 1JP5A 1GVIA 1GGUA 1T0MA 4JRXA 5B3NA 4DKEL 3BW9A 4LVHB 4JGJA 1FZMB 1DUYA 2J4WL 3FQNB 5EZJA 4LLQB 1NAKH 2YUZA 1A5FL 3H3PH 3ZKSD 1PG7H 3PG2A 4MQXD 2ZCHL 3LS4H 1ITCA 2YUWA 5ANMB 4BZ1L 2ADGA 5H37H 4XNXL 1QG3A 3T3MF 5DK2A 2IBBA 4NHUA 5ADPL 4OV6F 5EO1B 4O4YH 1OWRM 3U9UA 2ADJA 2VH5H 1OGAD 2UZXB 5I17A 2XKUA 3MUZ1 4KDVA 1KIUA 2KQMA 4YBQD 5ICZB 1A9BA 2YBRA 3E2HB 3MRQB 3T2QA 4HLZH 3PP4H 3BAEL 4QHNA 4C4KT 2UUDK 1BEYL 5CZVL 1L7TL 4PJIB 2DTMH 1AKJA 3ZE0E 2VDKL 3UTQB 4OI9A 4HS8L 1PEZA 4JKWA 3WE6B 4JAMA 1WTGT 3EO9L 4XXDB 2NY7H 5ESVB 1HSBB 1FNAA 4QT5B 4W81A 5CWSA 2BNRE 4NSKA 4GSDH 5JDSB 1I9RH 1QLRB 3CFJA 4LLUB 3MJ8A 1QRND 4RNRB 2D0GA 5ISZE 4K7PL 2UVEA 2R2BA 5F71A 4GG8B 4EXPX 4X6FB 3T4YA 3SKNA 4OV5B 3GI9L 1LO5B 4JHWL 1OARH 4JRXD 4V2CB 1GIGH 5D96B 2Q8AH 1KC5H 5GS0L 3ILQC 3MFFA 3PWUB 3GDBA 4WWKD 5F88A 2L7JA 3SHSA 1NGPH 2NY3D 2YD6A 3T3ME 1X5YA 4A6YH 1ZS8B 3BO8B 5IOPB 3L3HB 3RIFK 1G7MB 4QRPA 2NY6B 4QXUH 5BW7C 3V5DA 3MNWB 4GBXB 4PRIA 5IFHL 3V4VH 5CILH 5C09B 5JW5B 4Z8FL 2V2TB 2YA1A 4U6XA 1IC1A 3FT2B 5GGTL 5HHNB 5DSCB 4MNHB 3TT3H 3AMLA 1D9KA 4AEHL 5J9PB 1JGEA 1JWMB 1Q0XL 5EO0A 4ODXB 2AEQH 2F58H 4NM8L 3V6ZB 2VSCA 4K23L 2EDTA 1OB1A 4U1LA 3BWUC 1FL3A 2D31B 2P8PB 4JKKA 2BVEA 1BM3L 3RP1A 2GJJA 1VERA 2LV4A 3BN3B 5HTSA 4MAUL 1T80A 1AKJD 1A6TA 4HC1A 3NCYS 4WIQA 3MGTA 1LDSA 1RMFL 1FZMA 3FQNA 4LLQA 1AI1H 1TVBB 5D70L 4LSRL 4LPXA 5FUOL 4M3JA 4R9HA 4PJBE 4LFHG 1CLYH 4JN1L 3HMXH 2BOCB 2FL5B 1CLZH 1HE7A 1A6UH 5ANMA 3LRSB 1NCCH 4OD3H 5T33H 3W0WD 1TQBB 3SO5A 3JBG7 5FM5M 1EHNA 3SKMB 1WITA 4DW2L 3QEGH 1DVFD 4MXWH 1PEWA 4X9GA 3WEXB 3ZYJA 4Z7WF 5ICZA 3INUH 1SJXA 5I8EB 5FA4B 1X5KA 4EIGB 1MCPL 3QJFB 4P9HH 4PJIA 1T2JA 3TA3B 5IJKA 4JJ5B 2DQDH 3SY0B 3RJQB 2NYYD 3UTQA 5F7DB 2YD8A 3IYLW 4ZTPH 3NCJH 3C5ZB 3BP7B 3MRJB 3WE6A 3QUMH 1H3GA 3B6SB 1JF5A 4XXDA 5E08H 5ESVA 1D9KD 2IH3B 1HSBA 3LKRB 4QT5A 1I1AC 4OCSL 5FKPB 2EC9T 2AEIT 1CFSB 2CRYA 5JDSA 1A3RH 4V1DE 5IBUG 5FYKE 3UMTA 3TFKD 3L3GA 1QLRA 1AR2A 3R8QA 3VWJC 4LLUA 1V7NH 3UJIH 5JIKA 4RNRA 1IARB 3AM8A 1YEGL 4LFHD 4LRIC 5ETUA 1V5JA 1RUPH 3X17A 5L2JB 1JBJA 4GG8A 4JQVA 4AK1A 2WP3O 2LU7A 5EBMB 2AJVL 4X6FA 1T21B 4LSSH 3NAAL 4UILL 1N6UA 3MZGB 4OV5A 1LO5A 3VXSD 1HCVA 5BOPA 4CUCA 5FAAA 5IHUH 1QQDB 5FGSA 1AJ7H 3LEVH 4AH2B 1DQJA 1ZS8A 3BO8A 5IOPA 5CINL 3GRWA 3L3HA 1G7MA 4NZDA 4KKLD 3MNWA 3R1GH 5GRYA 2EO1A 5C09A 5JW5A 3LQAC 3DARA 2X05A 4UDTA 2V2TA 1KBGL 5DSCA 4MNHA 4Z7WE 3BP6B 2YD3A 5J9PA 1JWMA 3V6ZA 3BPCB 3UBXG 4OD2B 5C92A 4LPVA 1VGKB 2MCPH 1WIUA 5HYJB 4HIEB 1U8PB 2D31A 2P8PA 2R29H 4G80B 5A2LH 1FZJB 4LBEB 1IGMH 2M1KA 4HF5L 3N85L 5DVOA 3QWRD 2C3VB 1AO7E 5CBEA 1SEBB 3FONB 3K0WA 1HINL 4XBEL 4XXCA 1TVBA 1L0XA 5BO1L 5DJ8B 3OAZK 1NMAH 1S8DB 5E99L 3NABL 1D5XB 2BOCA 2FL5A 4HHAB 1P6AB 1Q94B 5LGHH 4MHHG 2ORBL 5LAXB 3LRSA 4KMTL 5ITBH 5BS0B 1OTUC 2UUDH 1YEEH 3P4OB 3LEYL 5DJAB 2MJWA 1BOYA 3SKMA 3EJZC 3TWCH 1T6WA 4S10A 2P24B 5I1JL 2QQLH 4XX1E 3SKJH 2OI9C 3VGBA 4OCYL 5TQ2H 3WUWB 3EOAB 2WM0A 3GNML 5I8EA 4G6AD 4R96A 4HMCA 5FA4A 1M4KA 2F54B 2QV2A 3QJFA 1FV1B 1IL1B 3TA3A 2H2SC 4R4FL 4DKDC 4JJ5A 3OAYK 3STLA 2NY6D 3SY0A 1G7JB 1G6RB 1OAZH 2DQJH 5F7DA 4HJJH 4XWGL 1YC8A 3C5ZA 4YC2B 5EZOH 2JB6A 3MRJA 4WI8A 3B6SA 1BJ1H 1XGRB 2YRZA 5IUSA 4XI5D 3GBLA 4G6MH 5D5MB 2IH3A 1KPVB 1TJGL 2B0SL 3LKRA 4X4XB 3KPQB 4TULH 5FKPA 1CFSA 2ERJC 3CVHH 4Y2OA 4FMKA 4HBCH 5EA0H 1IE5A 4AIZB 5L2JA 1JK8A 5TPWH 4WI4A 5EBMA 1WT5A 1T21A 3I50H 4LKCB 5D1ZC 1NKRA 1QSZA 3I6GB 1QQDA 4G8IB 4LKXB 4AH2A 4EOWL 5IESL 3ARBC 5DTFA 2WUBH 4A2LA 5CEZE 3E3QE 4NZRH 1U8OB 2CO6B 1TQCC 5HHVH 1QZ1A 4UINL 3F6LA 5LXGH 2NLJB 3GFUA 3T1WA 3LD8B 5C0NC 3BPCA 5BVJA 1SBSL 4OD2A 2HT3D 2VDPL 2HFFB 3NVQA 1W72H 3CDGB 1VGKA 4X4ME 4Y1AE 3ARQA 5HYJA 4HIEA 4Q9BA 2XA3A 3D25B 5I71C 1PKOA 1U8PA 4G80A 3B9AA 5EIIB 1GOFA 3HZMB 5J6HA 3OKYA 4YBQC 1FZJA 2ITCB 3QUYC 5JIHA 4M7ZB 1DQML 1CIDA 1EJ6A 2P43B 3UJTL 4GMSL 4ZUTB 1T1ZB 3HTLX 1SEBA 2B2XL 2O5XL 3C5ZD 3FONA 3PF2A 1JE6A 5DUBA 4ZXBB 3RIFF 5DJ8A 4PJCB 1AHWA 1S8DA 4LSUH 4HHAA 1EHXA 2QJDA 4P2OD 1XR8B 3AMKA 4U1KB 5LAXA 3TVMC 5BS0A 1J18A 3BSZL 5IBTH 1ZLVK 2DM4A 3P4OA 3KYNA 5GGVL 1PJ9A 3PL6C 3U0TB 1P84J 3HPLA 2B5IB 1T03L 2ITDB 1M05B 4OQTA 2P24A 4NP4H 4NPYB 1ZGLM 3GKZA 2OR9H 5JORB 3WUWA 3EOAA 2I26N 1F4WL 3S36X 2F54A 1A5FH 4F7PB 4QXGH 2ED9A 4OZHB 4JQIH 1FV1A 3P30H 1OAKL 1IL1A 2PKDA 2AP2A 3EYOB 5C2BL 5J13B 1G7JA 5TGBB 1JRHL 1X6NA 3WUWG 4AG4L 4BZ1H 3WKNA 4XNXH 4ELKB 2NY3C 2IF7A 4LLWB 1CLOH 1CE1L 1P5VA 4LLVA 1XGRA 2IPUK 5D5MA 4TTDD 3VXNB 1KPVA 4X4XA 3O3EB 5D2NA 1QP1A 3UTSB 2JF1A 3CC5B 5J11B 4UB0H 3UPAA 1UWEL 2PYEE 5D1XB 2X09A 4NT6B 4AIZA 3MRNB 1YNKL 5CZVH 3BYYA 1UVQB 2XY2A 4DOHE 1L7TH 4LRNL 5EPMA 4UOW1 4K94L 2HMID 4LKCA 2ZUUA 4L8DB 1Z6JT 5FDYA 1F00I 4U7MA 2WW8A 3I6GA 4HS8H 2BVPB 4XP9L 5KSVB 1HWGB 4LKXA 3B2VH 3TJHD 1WBXB 1PLGL 4PD4J 4RGNC 4I0CC 1U8OA 3BPLC 3C6SB 3WS3B 4N0FA 1NEUA 5BS0D 5HHOA 2EEAA 5CJXA 3D39E 1NBVL 3BRFA 1CXLA 1WCBA 5AG8A 5GRVK 4X80L 3L95B 2NLJA 4WFHE 4RFEB 1D6EB 4HV8A 1NCDL 3CFCL 4L4TA 2HFFA 4MJ6B 1Q1JH 3CDGA 1PZ5B 3DO7B 3GI9H 3OAZH 4JHWH 3D25A 2EDRA 2F54D 5GS0H 5EIIA 1WC7B 2ITCA 1X5AA 5K9JH 2JIXB 1WZ1L 2H2PD 3HG1B 4J1UB 4ZUTA 5I15L 1T1ZA 2AK4B 4P48A 4DUXA 4D0DB 5IFHH 3EYQD 2AVGA 4FQXC 3L5WB 4JFDE 4ZXBA 4XAWL 4Z8FH 5BRZB 5FGRA 4PJCA 1UG9A 1FAIL 5GRZA 3U9PL 2DQEL 4Y2DB 4AEHH 3CFBB 3DVFA 1HXYB 1S7SB 1XR8A 5LQBL 1MI5B 2X70B 1RULL 4NM8H 1BIIB 2F9BT 4K23H 3FAXA 1HDMB 3MNVA 4OGYH 3U0TA 2E7LA 1CLCA 1M05A 4DQOL 4NPYA 4HC1L 3F5WB 4RX4A 3G6DH 1EIBA 5JORA 2XG4A 2XZCL 3GIZL 3P0VL 1CGSL 4LSQL 5GS2H 5DJCB 2O5ZL 4LSRH 4F7PA 1W2KT 4XPAL 5AZEL 1Y18A 1MFBL 4HUWB 2EDBA 4JN1H 4LVHC 3EYOA 5B21A 1K6QL 5TGBA 4XVUD 5KAQG 2CDEB 5HDLA 5HHOD 3UZVB 5JMRA 4LLWA 4POUB 3W81A 5JO5B 5FM8A 1FLTX 1SMAA 1KJVB 2WANA 4OCMC 3ZDXF 4BQBA 5I74C 3VXNA 4X0KB 4DW2H 1CGWA 1IEBB 5C0GB 3UTSA 3UTOA 4L3ED 4L4TD 4U1MB 3Q6GH 4UQ2B 1BBDL 1FSKB 3U7AA 4GFTB 5IKCB 2VABB 3CC5A 2X4QB 3C08L 5D1XA 3UBXI 2BY1A 4ZOCA 4NT6A 4BYHA 4XP1L 3V7AE 3E2HC 3DROB 1UVQA 2A0LC 2O5YH 5F70A 3EIFA 1P1ZB 4L8DA 4CRPA 3REVB 2VUOA 4ZXBD 5KVEL 2BVPA 3ALXA 5KSVA 1WBXA 5C08A 5GISL 1I8IB 5DUPL 2GJ6B 4F57L 4OCSH 3WS3A 3V6FB 2DYPB 2NXYB 3QUXA 2Z91B 4P4RB 4TPRH 3ZTJH 5E0QA 1T5WB 3TGXA 1IGTB 5HDOA 2DKSA 5HI3C 5IJVB 1YEGH 3K2UL 4RFEA 4RX4D 5E95B 1D6EA 2BVQB 3W82A 1RZ7H 3VA2C 2AJVH 3AM8C 2AJYL 3NAAH 1XIWD 4UILH 1PZ5A 1FVEB 1MCQA 3GMQA 3DO7A 1WCQA 1WWBX 4KK8D 4XGZB 1IBGL 4OKDA 4Y4HB 4NKDB 3X3FL 2COQA 3DVGB 3QI9A 3KHOA 1WC7A 4CMMA 3GRWL 2B1AH 4ZFGH 5D96C 3MBXL 3VXPB 3HG1A 4J1UA 2IPTH 4PGDB 3ZDXE 1A2YB 2AK4A 1ACYL 2GFBB 3IVKB 4GXVL 3L5WA 4AM0A 5BRZA 4AL8L 3BZ4B 1KBGH 3UZEA 2E9JA 2Y07L 4B7IA 4GBXC 1I4FB 3GHBH 4PRHA 1YN7B 4Y2DA 3ZE2F 4L8CB 3CFBA 1HXYA 1S7SA 3UTSD 3HE6B 1MI5A 3KXFE 4OLXL 4N0UE 1BIIA 3QO0B 3KS0J 4I18B 2Z9TA 5D1XD 1Z9MA 1PFCA 1HDMA 4F15C 4TTGA 1UACL 3T1FB 1P9MA 1TZGH 3F5WA 1LEIA 5KOMC 2EIEA 2XV6B 4HIHB 4Y88A 3MLZL 4QRUB 3N85H 1AQDA 1JCKA 3U7YL 5DJCA 5BQ7B 1HINH 4XBEH 2HRPH 4HBQA 5BO1H 3QULB 1T0PB 1JTOA 1FZKB 5E99H 4HUWA 5C08D 2VTFA 3NABH 4UBDC 5CUSL 3QUXD 4OUOA 3NA9L 4KMTH 4OD1H 1IEAB 2M2DA 3RDTB 3DWTA 3WJJA 3UX9B 4JE4B 5FDWB 5DDHA 2Y23A 5L88H 3IGAB 5HPMB 1BJMA 2DQCH 1A7OL 1IEBA 4X0KA 5C0GA 4HUKB 4JM2B 1F3DJ 4JZJB 5ALBL 4U1MA 4UQ2A 5IKCA 2VABA 1FC2D 1GPOH 2X4QA 2XZAL 5GS1B 5K9QI 5IB1B 3GNMH 3U30B 2X5PA 4QLRA 5C6TL 1Q72H 3QI9D 5DJXB 2V9RA 4OB5H 5T5FL 5DXWA 4WFGD 5IQ7H 3B9KB 2AK4D 4L1HA 3U2SB 3REVA 3VXRE 4XWGH 4PJ5B 1M1SA 4I48B 3ZE2E 3FKUS 4ZOEA 1ONQB 3FAWA 5BRZD 4JHAL 3TA3C 1JGDB 2OBGA 3ME0A 1AY1L 1ZLSH 4PRHD 3CDCA 1TJGH 3EFDL 2PTVA 4NFDA 1I8IA 2AAVA 4U6YB 2GJ6A 2DYPA 5CMAB 2Z91A 4ONHB 4P4RA 1MRDH 4OAWB 4HUVB 1T5WA 4P3CL 1IGTA 1T2QH 1FYTE 4PJDB 5IJVA 1A22B 3HI6L 2ARJQ 4YHYB 4OUUA 2BVQA 4O58L 4CDGC 5AG9A 1MVUA 2JJSA 5IEHB 1FVEA 1VENA 4IOIB 4OCRL 1QPXA 4K9EL 2R0WH 3WIIL 4Y4HA 2AEPH 1WT5C 1B6DA 3ZHLA 1TCRB 4EOWH 5A2JH 4I3GA 5IESH 1IAIM 3VXPA 2PW2B 1N6QL 1CICC 1FVDA 4ONOA 4PGDA 3ORJA 4K9EC 1A2YA 2GFBA 4LF3B 3IVKA 3VXQB 4UINH 1TMCB 1IGYB 3BZ4A 5FHBL 3I6KA 1I4FA 3V4PL 1YN7A 4L8CA 3HE6A 2FCBA 1KCSH 1CQYA 1BVZA 1SBSH 2HVJA 4QHKJ 2VDPH 3WXWL 3QO0A 3I3EA 4CJ1A 5I0DA 4ZTOL 2KZ1B 4I18A 2C4FT 4LASH 5IBLD 1MY5A 5FXCH 3T1FA 3X13B 1GXEA 4U7SA 2WMPA 3BUYB 4HIHA 3GHEL 1DQMH 3UJTH 4GXUN 4QRUA 3U83A 3HZVB 3JZ7A 4Q6IC 5IT2L 2O5XH 4MS8D 1LE5B 3LKOB 5CSBA 3QBTB 3S36L 3QULA 1GL4B 1PQZB 2HMIC 1FZKA 2GK0B 4LNRA 4NCC1 5B4MD 2GJ6D 1XEDA 3FN9A 2H9GB 5SWSE 4E0RB 2DYPD 1AH1A 1I8KB 3TJHC 2DD8L 1IEAA 3A6CL 2F5BL 3BSZH 5DURD 4OQTL 4ALAH 5FDWA 1ZK9A 4BKLB 4H8WL 5GGVH 3HFML 3IGAA 5HPMA 1CVSC 2J6EA 3C2SA 1OY3B 4JM2A 1UB5A 4JZJA 2VDOH 4FZ8L 1OP3H 1T6VN 1IM3A 3U1SH 4U2ZA 5GS1A 1EFQA 5HHQB 5IB2B 5IB1A 4H8WC 1OT1A 4Y4HD 1P4BL 1F4WH 4FABL 3DX8B 2PTTB 1E4KC 2WBWB 2CLRB 4JO4L 4FQJH 2VLMD 3SDDB 1Q0YH 1G6RL 2VN4A 3GSNB 1XGYH 4QYOB 5F6IC 3B9KA 1MNUL 2Z92B 4OZGB 5C2BH 3U2SA 3LQMA 4AG4H 4I48A 5F3HB 1MCWW 2H2PC 1CE1H 1JGDA 1MFDL 4GRWB 4IRZL 5JXAL 2E3VA 5C0IB 3EYQC 4OFYA 3HE6D 3IKKA 3HLAB 4D3CL 1ZHBB 3SBWC 2L0DA 1BJ8A 5CMAA 4ONHA 4OAWA 5KVFL 4MQTB 5JW4R 3RWFB 2EC8A 3UO1L 4HUVA 1F6LL 3B4NA 3VI4F 4PJDA 5I6XB 3V8CA 3UC0H 3QIUB 2QADB 2W9EL 1JFQL 5IEHA 4IOIA 4K94H 2XOTA 3BPNB 4N8VB 3NPZB 4GG6F 4OGAC 1TCRA 4YQXH 3OG4B 1DLFH 1PLGH 2MKLC 2PW2A 3H3KA 1HH6B 4Y89A 1OP5K 4G6KL 4LF3A 2EDHA 4X6CB 1W0YT 4FTVE 5DEFB 3VXQA 2IQAB 3NN8A 5CZXD 1IGYA 3HA0A 4X80H 5FGBA 5DQ9B 3JTSB 4JM2D 5T5NG 5D1QB 1OGAE 1BVLB 1HWHB 2OTWA 3CFCH 4AIOA 1B2WH 1XR9B 4HD9A 4UIMB 1F90L 4RAUB 2AK1H 5AUMB 3X13A 2R4RL 5TE7L 2JJWA 1MIEL 1QFHA 2ZUQB 3CAFA 4KUCD 5DRZB 1UXSB 1WZ1H 4ZOBA 4DTGL 1QLEL 3HZVA 4K3GA 4KK6C 4YDLB 1LE5A 3LKOA 4M7ZC 2Y1VA 2DQUL 4MDJB 1JGUL 3K8KA 4XAWH 4Y7MA 4PV8B 1PQZA 1I7UB 1FAIH 3RTQD 2GK0A 2DQEH 1I7RB 4OFYD 3OKDB 4ZXBC 3VI4E 3FFDB 5GGUA 4E0RA 1TTFA 4LAQL 4QRTA 4OM1L 4RCAA 1I8KA 1RULH 4NCDA 1EZVY 2OMBA 2EEBA 4WI6A 3ZLQC 1NAMB 4BKLA 5T1LD 1BF8A 1QRNE 3EAKA 3GK8L 4R4BB 4GMTL 5I8KH 1OPGH 1KIRB 1JZ4A 4QGYA 2XTJD 3RQ3A 1BREA 2G5BB 4R90L 4S0SD 4GG6E 5D7SL 1N26A 1CQKA 3D9AL 3P0VH 2DI7A 1NUDA 5IW3A 3GO1H 2PTTA 3F58L 4YWGH 3SDDA 2PYFB 4XPAH 4JVPA 3GSNA 1CDUA 2Z92A 5F3HA 1EMTL 1MAJA 4YHLL 5J13C 5FK9B 1BZQK 4XMPH 2X1PA 3O2VL 5C0IA 4N5UA 5HBBA 2JB5H 3OB8A 4Y5VB 1N3NB 2NTFB 5JQHC 3P40A 4HUNB 4R6UA 1BBDH 3ABZA 1BD2E 2AXJA 2X2YA 4U3CA 2KUTA 1HNFA 2XRAL 4G6JH 4U6HB 4XP1H 3G6AB 1OGTB 5KS9B 5J11C 4YXHH 3RY4A 4MNGB 43CAB 3WLWD 1A3QA 1EAPB 3Q5YA 5E6IC 4OGZA 1LO4L 3Q5TA 1U0QA 4GAYB 1MFNA 1U3ZA 5KVEH 1RI8A 1RZGB 5E9DE 4KJQC 1FO0A 1HH6A 2HTKC 5DUPH 3NACH 4F57H 2VJXA 4X6CA 4P59L 1E6JL 4XC3H 2Q87A 3Q6FB 1CD1B 3W0WE 5ESAB 1X5IA 3EJYD 2IGFL 2IQAA 1R5IB 5F7FA 1KT2B 4I77H 5DQ9A 3JTSA 5EU7C 2X4UB 3K2UH 5D1QA 1G7QB 2APBA 4MJIE 3D5OF 1BVLA 2FEEI 2QKIB 2E8ZA 3QIWB 3TCLB 1XR9A 4M5ZL 4HH9A 5F7LB 4RAUA 5CEXB 5AUMA 2VZ3A 4LSPH 4WCYL 3SDDD 3GRWH 3OJMB 5DRZA 1UXSA 1G6VK 2VLJA 1CR9L 4JEGB 4ESKA 1OQXA 2EDNA 3MBXH 3NPSB 4I8DA 1I1CA 1JF6A 1MCBA 4YE4L 4KH2A 1TIUA 3ZSSA 4GXVH 4MDJA 4HPYL 4I5BA 2D03L 5ACMA 5JW4Q 4AL8H 4PV8A 4N0RA 1JZ6A 2Y07H 4LHUB 1Z0NA 1I7RA 2BNQA 3T65B 3MUGB 3FFDA 3B8SA 3L6FB 1SJEB 3LQZA 5DT1H 4OLXH 3FB6A 4K71C 5IR1B 2IWGA 5L8KB 4Y2DC 5EU3B 3G5YB 1QKZL 1M7XA 1FRGH 3WFCL 4R4BA 4MZ3A 1HYSC 1UACH 2LAGB 2OK0H 3MLXH 1KIRA 1ZEAH 3BKCL 2G5BA 4XNZB 1JHLL 2OS7A 1P9MC 4QRRD 3MLZH 3I6LD 4URTB 4JRYE 3VXSE 4HWBH 3H2WA 1A7NL 1KJ3L 3D0LB 2PYFA 3DXAD 4AEIH 4KTDL 5FO9B 4PRPD 4S2SB 1G7LA 5CUSH 5DWUL 2P5EB 1TZIB 1DLHB 2ESVE 2BHZA 5E8DH 4PLOB 1FNEB 4CMHB 1A7OH 4Y5VA 2NTFA 5ALBH 1I9IL 1PG7W 2XZAH 1TJHL 4U6HA 4HJGA 4MCYB 1FSKC 5MP6L 4R4ND 5E5MB 3G6AA 1OGTA 5KS9A 1CBVL 3MZTA 1MCOH 2VLJD 3EDFA 4MNGA 5FUCC 4MXVF 5T5FH 43CAA 3B2UD 5SWZB 4NWTH 1RJCA 1OP9A 4Z7VF 3O45B 1Q9OB 4GAYA 2UZIL 4JHAH 4MB4A 3PHOB 5C07A 2PO6B 1QFWL 4OZIF 4HJ0D 2V5MA 2IADB 2BNQD 4AY0A 3EFDH 1XAUA 2CRZA 1B4RA 5ICXB 3NH7H 1GCFA 3O6ML 2E6JA 3P73B 3Q6FA 5DFVC 1CD1A 2XYCA 5ESAA 4WEBL 2A38A 4P3CH 2JJUA 4PBWD 4TYUA 4PLKD 1QSFE 3T0XA 3S88H 1KT2A 2NXYC 4CGTA 2X4UA 3HI6H 4QHUA 1T5XB 4LCWD 1G7QA 4O58H 2QKIA 1S9VB 4EXKA 4C56D 2I07B 3QIWA 3TCLA 5DD0H 4OCRH 3CFKA 2KBGA 1GYAA 5CEXA 2EZ0C 3QIBB 2JJSC 1FLRH 3D85B 4YDVA 1K4DB 3FFCB 5JPNB 4Y4HC 1N6QH 3LEXB 4N90D 2Q8BL 4HKBB 1DANU 5I1CL 5FGCB 1CIUA 4Y4KC 3O0RL 4NQDB 4G6FD 1X5ZA 4OLZL 4POYA 3BN9C 4NN6B 5FHBH 4LHUA 2OYPA 5INDB 1GC1C 1V3MA 1LO0L 3T65A 3MUGA 5E00B 5AEAA 3L6FA 1SJEA 1FG9C 3RBGA 5L7XH 3LH2L 2LTQC 5IR1A 3FOMB 4ZTOH 3VFTB 4WWID 3G5YA 2EXWD 4MXVE 5E2TL 3AFLA 4HFWB 2EKJA 4Z7VE 5ALCH 4I18C 4RAHA 4UV4L 4XMKL 2XI9A 2V2XA 4OZIE 1FFOB 5CFHA 4GJTB 5IT2H 5C07D 4M1CC 3D0LA 3S36H 2IPKB 2XTLA 2R4SH 4D9RE 1JPFB 3E0GA 1AXSB 3PE9A 2Q7YB 4J3VA 5FO9A 4S2SA 3P11L 3CLEL 1QBBA 2EIZB 2P5EA 1TZIA 4XP5H 3A6CH 2X1QA 1DLHA 6FABL 1O5DT 4OQTH 2IALB 3CFIC 1R3IL 1NFIB 2FX8H 4Y19B 1FNEA 3RDTC 1R24B 2YS4A 3L5IA 3W5MA 4IOFD 1DQQB 4FZ8H 3U79A 3TNNA 5FCSH 1FN4B 4LSVL 1S9XB 4JM2C 3KJ6H 4JZJC 2FATL 1TZHB 2IANE 2NY4B 4MCYA 4PP1D 5E5MA 3QUKB 1DCLA 3BQUB 5GS1C 4JO4H 5KOVC 1OSPL 3U30C 2J8UB 5SWZA 1I1FB 4IRJB 5D6DA 4QY8B 1A7PL 3GSWA 3P2TA 2W1NA 1D5MA 1Q9OA 4NQCB 2DAVA 3V7MA 5CGTA 2PO6A 3B9KC 5JXAH 4J3SA 2IADA 4R0LA 4XCYB 2HT2C 5ICXA 2R39A 4Y4FA 4D3CH 4EVNB 5AZ2L 4MD4B 1DSFL 1OAXL 1IZJA 1GGTA 1I1RA 4P5KB 3L1OH 2PF6A 3MV7D 3NTCL 1B4JL 5T3XE 4XWOD 4OIIH 1T5XA 2CO7B 5GZOD 2VDRH 3Q2CA 5DK3A 1IGFH 5J3HD 1S9VA 3IXAB 2H1PL 2W9DH 2I07A 3BYTA 1JFQH 2CGRH 3DO3A 3H9YA 4XCEA 4PJFF 2APWA 3QIBA 3D6GA 3D85A 2HVKB 4WGVB 3D3VE 1K4DA 3FFCA 1QR4A 1VADB 3LEXA 1LK2B 2VYRE 5SX4I 3MA7B 2DIJA 2FH8A 4HKBA 2P5ED 4NKQB 1CFBA 4NQDA 4XB7A 2W65B 4JVUA 5KSBB 5INDA 2BY2A 2CR3A 4Y5XB 2HLAB 4CW1B 2R15A 5E00A 2PXYB 1I1YB 2H32H 4KZEL 4KWUA 3LSOB 3ULSB 5KSUB 3FOMA 3ZKXB 4GXUM 3VFTA 4HMEA 4PRDB 1WGOA 4HCRA 2BSED 2C5DC 5TE7H 4HFWA 5GJTL 3OR6B 1KF9B 4DVBB 5SWZD 1WUNT 1R5WB 4M6OL 1QLEH 4LOUC 3HC0B 4G8GD 1MUJB 1JGUH 3RWGA 2IPKA 2WAHA 4NM4L 4DZBB 1VPOL 3UTTD 1JPFA 3C9NB 1AXSA 2J5LB 2Q7YA 2B1HL 4Y4FD 2EIZA 3GJEB 4D9QD 4P2RE 3UTPD 3QPQC 4TOYL 3O6FB 3B5GA 2IALA 3ZE1F 2AXHA 1NFIA 1IQDB 5HI5D 1CFQB 4GMTH 1OAUH 3SE8L 4KROD 1R24A 4G5ZL 2P7TB 4PJFE 4R90H 1VB9A 2KDGA 1FN4A 2R2CA 4CL7A 5D7SH 1S9XA 1UJ3B 3M07A 4L5FL 3D9AH 3MC0A 3IFNL 3QUZB 1TZHA 2DKMA 3QIBD 4ZG1A 4H5SA 1MHHB 3GSNL 3QUKA 4I3SH 1NGZB 1E0OB 3D85D 3L3DB 1AXIB 4CU8A 2J8UA 4IMKC 3ULVF 4QY8A 5B39B 3LN4B 2DICA 1FCGA 3SDDC 3ARUA 3AGVA 3QEQA 2DQTL 4NQCA 4NQDD 4FQLL 5KW9L 1EMTH 4YHLH 1G7PA 2R1WB 3DUSA 4P23B 3O2VH 1CU4H 4XCYA 5D2NE 5B8CB 3RZCB 3FHQA 25C8H 3MV01 4HLJA 4MD4A 3QHZH 3RRQA 3ULUD 2VDML 5IMMB 3GKWL 1E4XI 1FGVL 3OPZL 4ENEC 2YPVH 1JHTB 2Y4SA 5DQJB 3WSQL 3S96B 3IXAA 4HWEL 1EVUA 5I6XC 1ZTXL 2BSSB 3O6KL 4D8PB 1N64L 5I1AB 1YYLH 3LHPH 3QIUC 1LO4H 2QADC 1NBYB 1FO0L 5F6HI 5KAQF 1DL7L 1OW0C 1W0WB 2HVKA 5C0EB 3BPNC 1VADA 2BNRB 3BH8A 4RQQB 1LK2A 3RAJL 1K8DB 3MA7A 3ZE1E 5TDNB 3RI5K 5IF0B 2HRLA 4P59H 1C12B 2CLVB 4F2MB 1VFBB 1P53A 4KK9D 5ISZB 2Z31B 4M1DL 2W65A 2YMXL 1QHPA 2DOCA 5KSBA 4X5WA 4TQEL 1RHFA 2BJMH 2P5WD 2Y36L 4Y5XA 2HLAA 2FHBA 5JXEC 2BHYA 1OD7A 5D72L 1I1YA 1OF2B 1J0IA 4L3EE 4DN3H 5BMFL 3BMWA 4LHJB 3ULSA 5KSUA 4M5ZH 4PRDA 4OLEA 4JFFE 1JTTA 5D1QC 4P0DA 2NY4D 1M7DB 3ULVE 4K8RC 4KI5C 3OR6A 5T3ZE 2OP4L 4XHJC 2HTLC 2GUOB 3DRTB 4ZFOB 4DVBA 4WI3A 2AXGA 5DJ6B 4X5XB 4FMFA 1R5WA 3DIFB 2ZUQC 3CSBA 3HC0A 4LIQL 1S3KL 3QEQD 4ZS6C 9CGTA 2R2EB 3VGDA 1MSPA 4HPYH 2D03H 4K2UH 5E1HB 3C6LB 3BD5A 4DZBA 2LFGA 2FZ3A 3C9NA 4YDLC 1T83C 4XPTL 2YXMA 3GJEA 3ZO0A 4QCIB 3O6FA 4KKNA 1FG2B 3SDAC 4F33B 1R0AH 1QKZH 2VDNL 4U1NB 1IQDA 1CFQA 3LRHA 3Q5OA 2I60L 2WBJB 3BKCH 1VACA 1F45A 4BH8B 5F93C 4TUKH 4PLKC 2R1YB 1P7HL 1KULA 1UM4L 5TDOB 2G9HB 1UJ3A 2JELH 2C3HA 3HR5B 3QUZA 3L7FA 1A7NH 2NY1C 1MHHA 5J7CC 1NGZA 1LP9F 5TF1L 3L3DA 4N0YL 1KJ3H 3MBEB 3S5LB 2VQ1B 2ZP0T 4PPTA 1N59B 5IM7A 1YJDC 4JHBA 4KTDH 4C57C 3IXTB 3RWDB 3LN4A 4GKOA 3FRPA 4M6MH 2D3VA 3RUGF 4YXLL 4K3DL 3THMH 1BGXL 1YMHB 1BFVL 2R1WA 1RIUL 4HWUA 4L9LB 3QWOB 5B8CA 3RZCA 3LIZL 4H88H 4MZ2A 3AXLB 4U0RB 1L0QA 2O26U 3LMJL 3GZKA 1I9IH 7FABL 3QPXH 5IMMA 1AC0A 3FRPG 3HNVL 4KGLA 1TJHH 1KENL 4Y5VC 1G9NH 2BXZA 5DQJA 3LAFA 2VWEC 1J8KA 2XWBB 4S1SH 1CBVH 1S5HB 3S96A 4NC1C 3CDYA 3C2AL 5JW4N 4PJHF 1S5IH 5DJ0A 2CJUH 5I1AA 4NNXB 4JFHD 1NBYA 4OJFL 1W0WA 2UZIH 3ARVA 2AJSH 4KKCD 5C0EA 2BNRA 2HFGH 5FYJU 1X5FA 1H3PH 4V1DB 5AAMA 5TDNA 5IF0A 5HHME 1JPTL 1C12A 2CLVA 3O6MH 4F2MA 1VFBA 4NOBA 5TJWK 3VFNB 2I27N 4I2XE 5E2UH 5ISZA 2Z31A 4MAYD 4M9PA 1F4AA 3NIDF 4PGEB 4Z76B 5DUML 4WFEE 4BQ8A 4FFYL 4XAKD 2KZWA 1A3LL 4OF8A 3F65A 1OF2A 1FNSH 3U4BH 5CIPH 4AQOA 3L5XL 1LP9E 1CWVA 3QUZD 4P5TA 1M7DA 2F53E 3NFSH 4OLUL 3QIWC 2GUOA 2D9QB 3DRTA 4ZFOA 5I1DA 5DJ6A 4A6YB 3RUGE 2A83A 2Q8BH 4RFNB 4MYWB 2R2EA 1EFXB 3NPSC 3O0RH 4Z7WB 3C6LA 3U4AA 1O7SA 4Y5YC 2XN9D 2DQIH 1CFNA 1YYML 1B3JA 2AV1B 3LH2H 4QCIA 3LKPB 1FG2A 1A9EB 1YECL 5J0BA 4F33A 5E2WH 5CEYB 2Z8WC 4U1NA 4IMLB 4PJHE 4FXLA 3ARDD 1FGNL 2WBJA 1F2XK 5HYQB 4I3RL 4UV4H 4YHNB 5EBLB 4BH8A 1AO7B 2R1YA 4MLSA 4O9HL 4IIQB 2G9HA 5FF6B 1I7TB 3QXDB 3HR5A 4KVNL 5A2FA 4XNZC 3O9WC 4PJBA 5E70A 1JZ3A 4WVRA 2N4IA 1UEMA 1C5CL 3MBEA 3S5LA 2VQ1A 5FYJD 1N59A 2BNRD 2X4TB 3KJ4C 3IXTA 3RWDA 1FORH 5I1IL 3NIDE 2P4AB 1CTOA 1XGUB 3TH4T 1QBLL 3ET9F 1SVCP 3MNZB 5ISZD 2Z31D 3IDMB 1SJVA 1IAKB 1BZ9A 4HT1L 2J6EH 1YMHA 3MOBH 3QWOA 3S5LG 1JYXA 4FNLL 5IVXF 1NLBL 1D5BB 5F7KC 1HH9B 3V6OC 4CMHC 4YX2L 4G7VL 5C7XL 1MLBB 4P5TD 1WBZB 4YIQB 2FATH 5ID0B 3WMSA 2XWBA 3NIFF 1S5HA 1CGUA 1OSPH 1YMMB 2ZKHL 4XNQB 5KVDL 2X1WL 3FT3B 2W0PA 1A7PH 4NNXA 4PY8I 2DMKA 2OXHA 1HZHL 1N4XH 2ZJSL 5JHDD 3C6LD 3QUMB 3MCKB 3VJ6B 2CD0A 5EDXA 5IW1B 4WI5A 4HXBH 3DGCR 4QWWC 4V1DA 3H9SE 2PO6C 5FYKU 3F7QA 1DSFH 1OAXH 4YEEA 3VFNA 4P3DB 4X7DC 3MRIB 2RAMA 5C3LD 1H3XA 1GGYA 4PGEA 1U8NB 4Z76A 1G7IB 1OOAA 1IC7L 3CMOH 3LZFL 4GW5B 1NCNA 2WBJD 3CXDL 4GO6B 5FO7B 4OLYL 1TENA 4X9HA 3BKML 3UAJD 2OMNA 2WLYA 5DC4B 4Z7QF 1RJZB 1YY9C 3CD4A 4M1GH 1T4KB 1HILB 3MBED 4P49A 5DLMH 4MDIB 1ORQB 4JG0L 4A6YA 2B7DT 3AS3A 2VIRB 1CDCA 3O41B 3T0DA 2QHRL 5IVXE 4Z7WA 1F8TL 4ZUWB 3RI5F 3QQ9C 4UQ3B 5F1OB 3TO4B 4E41E 4N1EA 5K9OB 4N9OB 4NN6C 4KTEH 4TSAH 2AV1A 4GKNB 5SV3A 4ZAKB 3LKPA 3NIFE 4KUZL 2EECA 3K46A 1P69B 4PTUB 5I9QB 2VDQL 4IMLA 1B88A 5LGKA 4JFQA 1N5YH 5FA3B 3KPSD 4U1GB 5EG6C 5GJTH 5HYQA 4YHNA 5EBLA 1AO7A 4M93B 4IIQA 5FF6A 1I7TA 1I7ZB 3QXDA 4CN4A 5IMLB 3NGBB 1EHLH 5KSAB 4GW1A 4CN1A 1HK6A 1GOGA 1VPOH 2X4TA 4X98B 3BXNA 4V1DD 5FYKD 2B1HH 2M8XA 1XGUA 2JKXA 4Z0XB 3QFJE 4TOYH 1IAKA 1PAMA 3EGSB 1I3GL 2R0KH 4Z7QE 1YA5A 3U7WH 3N9GH 3V0AC 3IDUA 1D5BA 3VG0H 3L3KB 4EQ3A 4G5ZH 5E2VH 4KVCH 3ARGB 3MGAA 4YPGB 4JGMA 1HH9A 1RHHB 5I1GH 1MLBA 4NQVB 1WBZA 4YIQA 4J4PA 1BMGA 3IFNH 1ZLWK 5ID0A 3GSNH 4I4WB 4XX1G 3WO4C 3SE3A 1MHPH 2EDWA 4IHOB 1KTDB 2Q86B 1IQWL 3QDMD 3BQUC 1CXEA 3DSFL 4O5LL 4P9MH 2ZNWA 3CX5K 2DQTH 3T2NL 1HYRC 4IRJC 2V5YA 3VJ6A 2DTSA 2VAAB 2NXZB 3HE7A 5IW1A 4RBPK 1N0XH 3RVVD 3AY4C 5EOQL 2PYEB 1RJYB 5DC9B 4P3DA 1DFBH 3DHMA 3MRIA 3CVHB 3GKWH 1N2RB 5IMKA 4NUGL 1U8NA 3OKMA 1G7IA 1UENA 3QDJE 4XVJL 4GW5A 3QNXB 1AGFB 3LB6D 4DOHB 2FECL 5FO7A 3WSQH 1A0QL 1AO7D 2O93L 2ZUSA 4YO0B 4R26H 1RJZA 3MODL 1ZTXH 3MRDB 2Q6WB 4DK3A 4M7KL 2B4CL 1FO0H 1HILA 1DL7H 1H15B 2FX9L 3RIAK 4MDIA 1ORQA 4J3UA 4HK0B 3FMGH 3RAJH 5IQ9B 2VIRA 3D39B 3O41A 4BQ9A 4CBPA 2BRQA 2B4CC 1UFUA 5F89B 3DMMB 1CDBA 1BFTA 1NUNB 3MJ6A 1ND0A 5CJBA 4ZUWA 4M1DH 4EN3B 5DMGC 5AAWA 4TQEH 3V8OA 1KGCE 5F7UA 5I16B 3OKKA 5K9OA 5E8OB 2QL1A 3D18B 4X4MA 4Y1AA 4GKNA 5BMFH 4X9FA 2HLFD 1W72B 2QTEA 4Y5XC 1LHZA 1MCLA 5DD6B 4PTUA 4J4PD 2PXYC 3IJYB 2KQNA 3H42L 3ZKXC 1Q38A 1E4XH 3BMVA 4NZJA 3NA4A 3W11C 1AGDB 2V5RA 4KRPD 3BRGC 4HUXB 1SBBA 1I7ZA 5IMLA 4LIQH 1S3KH 1F3DH 1QSEB 5KSAA 4XBPB 1N7ML 2WP3T 2NTSP 2MPAL 3HE7D 3QRGL 1OHQA 3P0GB 4ODVL 3VGGA 4O02H 4JFEB 3RVXC 2QLVB 1KUMA 4ISVA 4P99A 5EH1A 3TEUA 2OZ4H 2J5LC 5BOZG 1MHCB 2DQHL 5SX5K 4ETQA 2VDNH 5F7YC 2CMRH 4YFEA 3G08A 3ZTNH 5DFWH 3O6FC 3L3KA 4DAGL 1LO2H 1AFVH 3LS5L 4GAFB 1T66D 4YPGA 3IAGC 1RHHA 5IP4A 1TVHB 4NQVA 1AGBB 4Y0GA 1A6WH 4HDIB 1C7TA 5EC1B 5CEZD 5TF1H 4N0YH 1UJ3C 5L0QC 1U3YA 4LQFL 2Q86A 4PB9L 4YH6A 3ECBB 1ACZA 4Z5RB 2EO9A 3PGFL 3RVTD 4BH7B 1MJUL 2ZUVA 1U9KA 1RIUH 1JNHB 3LIZH 4M6NL 4Y1AD 4WU7B 3LMJH 2PYEA 1RJYA 4P23C 5I18H 5B8CC 3RZCC 3CVHA 3VD9A 3HNVH 4L9DA 3QNXA 4WUKL 1AGFA 2E9BA 3A67L 4M7JH 5C0CE 2R56L 2MCG1 5AYUH 3C2AH 3OKOA 4YO0A 4XPGL 4QRRE 2Q76A 3LN5A 3I6LE 3LV3B 1FJ1B 2Q6WA 1UGNA 4X7SL 4TNWK 5KSAD 1J8HB 3WNLA 4XB8A 1H15A 1KJMA 5C9KA 1WEJH 3DXAE 4HK0A 1CGVA 5IQ9A 1KEMH 3D39A 4PRPE 4FFWD 4OCXL 3B9EA 5E2JA 5F89A 3DMMA 5EZIH 4OM0L 1NCBL 2FJHB 4G42B 2O61A 2AQ1A 3BKYL 3H9HA 3PP3K 4FFYH 4YFDB 1A3LH 5E8OA 5BV7L 1JYWA 2Z31C 2X1OA 2WWMC 5H2BA 1W72A 5BVPL 2VLLB 3L5XH 5DD6A 2C1PB 4ZFOL 3EOBA 4YDIL 3TC9A 3IJYA 4P2QD 4OLUH 4FFZH 4Z7UF 3MPCA 1AGDA 4Z0BH 3PWJB 1S9WB 4HUXA 4JFDA 4PG2A 2QEJA 4HZLB 2H3NB 2RFXB 3E8UH 4XBPA 2ZPKL 5JLZA 1HHIB 2NXZD 4RISL 2AS5M 5LBSL 3FO9B 3KXFB 4HW6A 1IMHC 4N0UB 2CIKB 3MLSH 4C55A 5ACZB 4KK5C 2IJ0C 3GI8H 2E27L 1YYMH 4QOKE 1T1YB 3MOAL 1ZLWH 4BFIB 1MHCA 4KZDL 1JF1B 1YECH 3WD5L 1X6LA 2D7MA 4M8QB 1LMKA 1Z3GH 3U6RB 1LE9A 2E5EA 4XP4H 1ZMYA 4LSTH 2CXGA 3V0WH 4LCWE 1FVCA 2LE9A 4U0QB 1CI5A 3BIKA 3CIQA 2R9HD 1CL7I 3VFWA 4C56E 3PWVA 5F7HA 2F74B 4O9HH 1TVHA 3T77B 1QBAA 3H3PL 4XCNB 1AGBA 3HUJB 5EIVA 4KVNH 3ZKND 5EBWB 3OHXB 2VL4A 1JNNL 1C5CH 1QR1B 3D39D 4GAGL 2ATPB 3ECBA 2HP4A 4NKIL 2VC2L 5CGYD 4LGRB 4Z5RA 5D7IF 1L6XA 3MBEC 3DMMD 1QBLH 3AREA 1OAYH 4GLRI 5DJDB 4POZD 4WFHD 3FTGA 4BH7A 4PGCB 4UT7L 1BF2A 1RZKH 3LKSB 1CXFA 1JNHA 4M7LH 3RY6C 4FNLH 4WU7A 1S7QB 4NQUA 3PWNA 2JJTC 3PP4L 5JW4M 3L3OB 4L9LC 4Z7UE 3MJ7B 3PXHA 4U0RC 4YX2H 5JOPE 4G7VH 4MJ4A 5D93B 2DTML 2WWKO 4KDWA 3QCVL 3IAPA 4NIKB 2ZKHH 3VXRB 3QDGE 3MV11 4JFDD 3LV3A 3S34H 5HYEA 3TCXA 1BHGA 5HSFA 2CXKA 2NY7L 1HZHH 5EIQA 4N1HB 2ZJSH 1R3KB 3V7AG 5CLTA 3O8XC 3NBNA 2GCYB 2VZVA 3GSQB 4GSDL 3QXVA 4TRPH 4F80A 3KYAA 3RL2B 1FYTB 1YEIL 4RAVB 2A6KB 2FJHA 3B9VA 3JV0A 4G42A 3IS1X 5DO2D 1IC7H 3LZFH 4I9WE 3CXDH 1OARL 2ZSWB 1GZQB 3T0EC 3BKMH 4P46B 2VLLA 1KC5L 3ZYZA 3B5TA 2C1PA 4P2YA 1NGPL 3KWWB 3MRMB 4NRXB 3P9LB 4A6YL 4M61B 3DTXB 5A2IH 5D7IE 2VR4A 5A3ID 1XF2B 1VA9A 2VLRD 5FYLE 3PWJA 1S9WA 3RIAF 3ARED 1NGYB 2P46B 4HZLA 1L7IH 2H3NA 2ZOKA 1Q9WA 2RFXA 1F4YH 1HHIA 1F8TH 4RSVA 3STZB 2ZCLH 4RFNC 5EOCH 2AEQL 2F58L 3FO9A 3KXFA 3V52L 4N0UA 4YHIB 3ULUH 1D6VH 2C3XA 3SGEI 1T1YA 3ZHKA 4BFIA 1TCMA 3RU8L 3VW3L 4HCRH 1UC6A 4KUZH 4KDTA 4X83A 1B0GB 3U6RA 4G8EA 3CPLA 4B7LA 1EV2E 3MV7E 1YEJH 1Q9KB 5MI0B 3W5NA 4ZPVA 2MHAB 3VFUB 3T77A 4XCNA 3WYRA 5EBWA 3OHXA 3MACL 1CLZL 5LWYL 3U0WL 2EDDA 4LQ1A 2XKSA 5F44A 2DJUA 5CCKL 1QR1A 3VD4A 2EDYA 2ATPA 4PJ9B 3HRZB 3ES6B 3UYPA 1AGEB 2R2HB 2YXFA 4C58B 1QPPA 3X12A 4PGCA 2A6IB 1AD0B 3HN3A 4JY5H 1KB5H 4MXWL 2NX5B 2HJKA 3LKSA 1MREL 4MD5A 5C6PB 1S7QA 4PYGA 4PRNB 4Q74A 2DM2A 3L3OA 3K1DA 3MJ7A 4NBZB 4NQEB 2AABH 2FNBA 4LMQI 4P9HL 3ULUF 2DQDL 2V6HA 2BSTB 3ARTA 3EDJA 5C0BB 3VI3F 1RK0B 3VXRA 3NCJL 3D2UB 5BZDB 3S35X 3QUML 1P4LB 3DSFH 4O5LH 4P9HC 5E08L 3CXHK 3PP3H 4G8GE 1JVKA 1YPZB 1R3KA 4AYFA 1FP5A 3T2NH 3P77B 1YN6A 1YNLH 3UTTE 3PJSB 1T22B 2JE8A 3GSQA 1A3RL 1XMWA 3AU1B 2DL2A 1EK3A 4EDWH 3RL2A 1FYTA 4LPWA 4RAVA 2A6KA 1RUPL 4LCCC 4NN7C 3SGKA 5IMOA 5I1EL 2CK2A 4XVJH 1I85A 4HX1B 3IDIA 1MFCH 3TH2T 4KQ4H 1A0QH 1GZQA 2ZSWA 5DEZA 4P46A 1KEGH 4TSCH 3DETD 2J7LA 3MODH 1WSST 3TBWB 5HY9B 3VFPB 3SGJC 5CEZL 3LEVL 5IHZB 5IHBA 5D7JD 4M7KH 3M8OH 3KWWA 3MRMA 4NRXA 2EDKA 3P9LA 1X5JA 3BUTA 4M61A 3B3IB 2FX9H 2G5RA 4TNWF 4XBGB 1BX2B 4NFCA 1XF2A 1KCRH 3QXUA 4FQ1L 3R1GL 4HSQA 1QNZL 3BIAX 1C16B 4WUUE 4FTVB 4LVEA 1NGYA 3ARFB 4OZFG 4RRPA 3E3QC 2FBJL 1QVOB 3SE4A 3STZA 3IDXH 1W8NA 5JNYB 5AYQA 1D5ZB 1CDJA 1EPFA 1E28A 1OGAB 3VRJB 3FQXA 1A6PA 4YHIA 4UDUB 5CJQL 3TO4C 3HZYB 3MRCB 3ULUE 2R29L 2UV3A 2UZYB 3WNNA 1B0GA 1WTLA 3QCUL 3VI3E 5IB5B 4K7FB 4U05A 3BDBA 2KPNA 1Q9KA 4ZAKC 2NW3B 4ZO9A 3GUTB 1EJOH 3CSGA 3VFUA 3ZHDA 3VE0B 4U1GC 3MSPA 4HKXA 5GPRA 2XWTB 3PIQA 1KCVL 5LGHL 2EDOA 1N7MH 5SWSA 4L8BA 1NANH 5ITBL 1RZFH 2DL9A 2VXVH 3KR3L 1E4WL 4PJ9A 5GGVY 3HRZA 3F12B 3ES6A 1Q8MA 1AGEA 2R2HA 3KG5A 5H35B 1FYTD 1SJHB 1QRNB 1YUHB 2Z4QB 2BP3A 2IPUG 2DQHH 2A6IA 1AD0A 2QQLL 4PRBB 1EEUA 2P5WE 3U82B 5TQ2L 4E42B 1CD9B 5JZ7C 4DAGH 4PRNA 4JRXB 5EOTB 1T2XA 4KGJA 4WWKB 2P44B 3ARGC 3BPOB 5EWIL 1A7QH 3HB3C 1OAZL 3MXVH 2BSTA 2DQJL 3IU4L 4HJJL 5J4MA 1RK0A 2YUXA 4K07A 4LQFH 4F7CB 4D94A 3D2UA 3P9MB 5BZDA 5EZOL 2DM7A 3TIDB 5DK2B 1P4LA 2R0ZH 4K3EL 5HI4D 3H7BB 4YFLI 3P77A 5C9JB 1NLDH 1MJUH 4KC3B 1T22A 5DRWB 3AU1A 5HPOA 1BD2B 4WW2F 4M6NH 3CVHL 2F19L 2NXZC 4MWFB 3K4ZA 2XZZA 3OR7B 5EA0L 4HBCL 4UZGA 4DUWA 3QRFM 3CFEA 3G9VA 3MCLH 4WUKH 2PETA 5F3BB 4F7MB 5FHAL 3A67H 1OTSC 4HX1A 1DZBA 5JW3H 2R56H 4Y8AA 4ZSOE 5D7KE 3OZ9H 4HWZB 5F7WC 1HXMB 4XPGH 3TBWA 4UNTA 5IHZA 5E9DB 4W4OA 5EUOF 2V17H 5FYJH 2KL6A 5SWSD 4XBGA 1BX2A 5CWSB 4YK4B 3ZZ1A 4PJ9D 4MVBC 2MWCA 3RGVC 1C16A 1CS6A 2FX7H 3W0WB 1FC1A 4FTVA 3ARFA 4HEME 1QVOA 5IWLC 1WF5A 1HIMH 5JNYA 4FQHB 5CGYC 1DVFB 4YGAB 1MQKH 4FQPA 5LVEA 4MJIB 4RDQG 4OZHF 3VRJA 1Q9LA 1PD6A 1W72L 4HIJB 1O7VA 2FIRT 2WZPD 4UDUA 5BV7H 5DRNB 1D5IH 4UAOC 4EN3C 3MRCA 1C8PA 2YKLL 1UWXK 1I9JH 5EU4B 1ZKAA 3MFFB 5IB5A 4K7FA 2WIMA 3K8MA 1C1EH 1PDKA 2NW3A 2J88L 4LL9A 4TVPD 3GUTA 1FIGH 2FB4H 1B9ZA 3D2UD 3VE0A 3V95A 4AIXA 1QSVA 5ERWB 2D7OA 3FQRB 4JFHE 3QXTA 2V7NB 2XNAB 2XWTA 1D9KB 2ICWI 5K9KB 2UWEF 4RISH 4GRLB 4PG2C 1X5XA 4PV9B 5IBTL 5H35A 1JN6B 3MOAH 1SJHA 1QRNA 1WVZA 1A64A 1YUHA 2Z4QA 3WD5H 3C8KB 4PRBA 3R0MA 2OR9L 4E42A 4J12A 4GG6A 4F8QA 3H0TB 4PBVC 5EUOE 4JRYB 3VXSB 5EOTA 2APFA 2FH6A 2R8SH 1ZANH 3S3SA 1BBJB 2Y6SC 4QXGL 1NKOA 4JO1H 4WWKA 2P8LB 4JQIL 3OMZA 3P30L 4XPBH 3GMPB 3TYFA 1S7TB 4BZYA 4JZOB 1JNNH 2ARJB 4F7CA 4LDOB 3P9MA 1MCHA 4GAGH 1CLOL 3TIDA 4NKIH 2VC2H 4FTVD 2ESVB 3ARFD 5IB4B 2Y06H 4OZHE 1DANT 1A6ZB 3H7BA 5C9JA 4UT7H 1NCAL 3CZJA 4IRSB 5CD3B 2XN9E 1P7QB 1X9QA 5DRWA 1U8IB 4QGTA 4P5MA 1U8LB 5DGQA 4F37K 1BD2A 4P2CG 4UB0L 4MWFA 3OR7A 5DMKB 3HMWH 4LLYB 1X4ZA 4OIBA 4EI5C 5F3BA 1H0DB 4F7MA 3T0WA 4NUJB 2Z0BA 4JG1H 3GSVB 2WBKA 3QCVH 5IBUB 2N1KA 5DMIL 4HWZA 1HXMA 4JKLA 2UWEE 2VLKD 1CL7H 4PJ8A 1NEZG 3B2VL 3GSUB 5E9DA 1KIPB 3DX7B 4OLVH 5FYKH 5FYJE 1YZZA 2NY0B 4PJBF 4XNYH 2QHLA 3L3GB 4LVNC 3W0WA 2C7UB 3S9DB 3ARXA 3IKCB 1QSFB 1YEIH 1ZT7A 3NZHH 2IG2H 4RMQA 5ETUB 4FQHA 1DVFA 4HS6B 2VKXA 4MJIA 3UZQA 4HIJA 1CK0L 1Q1JL 5DRNA 3FB8B 3BDXA 2BY3A 5EU4A 3VWKB 2X9WA 5K9JL 1UM5L 3PWPD 1CT8B 3B43A 5AWNL 1DQJB 3K4DA 3UBXB 3D48R 3GMLB 3VG9B 5D2LF 4KJWC 1F4XH 3KDMB 4MX7B 5GS0C 3PWLA 1LD9B 1TTGA 5DVKA 4UDTB 4CJ0A 5ERWA 2Z35B 3FQRA 2V7NA 2XNAA 3WHE0 4GS7B 5JHDE 5K9KA 1QFPA 3H8NA 4GRLA 1OM3L 2F8XC 2VISB 3V52H 4PV9A 4CVUA 2HAZA 1BD2D 4AJ0A 5DMJB 5CSGA 4M48L 4OGYL 1JN6A 5GRUL 3RU8H 3VW3H 3RWJB 5KJRL 1G9MH 4O00A 3C8KA 4Z7VB 1ZWIB 3G6DL 4RA3A 3T3PF 3EKCA 2RGSA 4IDLA 3H0TA 3T8XB 4KDTC 4OZIB 5EULV 4JRYA 3VXSA 5CBEB 2AJ3B 1H8NA 4PJ8D 1BBJA 2DLFL 5E9DD 5DJYB 2P8LA 1RIHL 3RWHB 3GMPA 4BK4A 3MACH 1S7TA 4XCFL 5LWYH 4JZOA 2ARJA 5E03A 3KPMB 5CCKH 4ZUSB 2B39A 4KFZC 2ESVA 3S35L 4KJPC 5IB4A 3TN0B 3QDAA 3SDXF 1I8LA 3SE9L 1A6ZA 2ADFH 4IRSA 5CD3A 4MJID 1P7QA 4W6WB 3QAZB 4C54A 1ZGLP 3Q6GL 1U8IA 1MREH 1U8LA 1U92B 3RPKA 2OJEA 4R96B 5DMKA 2IANB 2P48B 4LLYA 5D2LE 3SGEH 2WNGA 2YRPA 3IDNB 4X6DF 1H0DA 2O5YL 3KPSE 4NUJA 3QB7C 1T89A 3GSVA 3STLB 1G0DA 3QWRA 5D93C 5LG1A 1SM3H 1JHKL 2JB6B 3N1FC 3GSUA 4N1CA 1ZT4B 5DR5L 1U6AH 1KIPA 2CKNA 5I1KL 4GRLD 3DX7A 4P2OB 3TO2A 4TPRL 4YUEH 4IM8A 4KV5F 2DI8A 5EO9B 2C7UA 3I2CH 5D9SB 3IKCA 3T3PE 2JJVA 1QSFA 4MQ7B 5FECB 1OTTC 1JK8B 5I1EH 4HS6A 3SCMC 1Z9OA 5M7QA 5EU5B 4L3AA 1RZ7L 3PXJA 4IBLT 3U36A 4N0CD 4JFZH 3SGKC 3FB8A 2BDNH 4JRYD 3F7YB 2ZZUT 3EHBD 3SDCC 4NKMB 3VWKA 1MH5B 5CEZH 2B1AL 3L7EA 1CT8A 2MKWA 4ZFGL 1C5DA 5DTFB 4P46C 3UBXA 3PQYD 2IPTL 3EO0B 3GMLA 1BQHB 3I3BA 3SDXE 3KDMA 4FQ1H 2LAAA 3QDME 4MX7A 1QNZH 2ESVD 1LD9A 4N8PA 4WGWB 1AQKL 2Z35A 2FBJH 1X5HA 1RV6X 3GHBL 3EYUL 4IRSD 1OT2A 1P7QD 2VISA 3ZL4L 4R7DB 4J2XA 5BVJB 1SYVB 1MEXL 4I0KA 4LCIH 4XPFH 5L9DL 3SE4C 5CJQH 4X6DE 3P9WB 3QJHB 3RWJA 1TZGL 3ROOB 3RVUD 1J9CT 4Z7VA 3QCUH 5J6HB 1P6FA 1ZWIA 3A6OA 2DMBA 3RNQB 4X7TB 3NFPB 3T8XA 4OZIA 5JOFB 4FA8A 2AJ3A 3SGDI 2HRPL 5MI0C 5DUBB 4HWBA 5DJYA 1AHWB 3RWHA 3O4OB 1EERB 4KV5E 1KCVH 4OF0A 1JTPA 3KPMA 5C0AE 2NY0D 4OD1L 4ZUSA 3KR3H 1E4WH 4P2RB 5SWQB 3KGRA 3TN0A 3KYNB 1QSFD 2DI9A 1GGCL 3MTRA 5L88L 3HPLB 2DQCL 5DJ2B 2NY2B 4NO0D 2A9ML 5A43C 3V0VB 4PJFB 5DMYA 3GIVA 4KTYA 4G9FE 1GPOL 4Z95H 1U92A 2XACC 1A02N 1Q72L 3PHQB 2IANA 3VWKD 4OB5L 3OQ3B 3ZT7A 2XA8H 4GKZB 3IDNA 2OL3B 5EWIH 5IQ7L 3MRFB 5GRVL 2H8PB 3IU4H 3S98A 4LLVB 1RVFL 4K3EH 1ZT4A 1ZLSL 1RSFA 1B0WA 32C2A 3FZUC 1BWWA 3OKEB 5D2NB 5FKAB 4P2OA 2OTUB 3TIEB 1I75A 4PJ5E 1MRDL 1NUFA 3O3BB 3PNWB 2P8MB 5EO9A 2F19H 1T2QL 4P4KA 5F97E 5D9SA 5CD5C 4MQ7A 5A16B 4F37F 4EKXA 5EBGA 5FECA 5GGSB 2N7BA 5EU5A 5HGGS 1VHPA 3BDYH 5EPMB 5FHAH 2Y5TA 1KLGB 4XCCH 3UEZA 2R0WL 5C0DA 3F7YA 2AEPL 3QISA 3BP4B 4NKMA 1MH5A 2DWEB 3SO3B 4D9RD 1FHGA 3D3VA 3CZFB 3EO0A 1BQHA 2HWZL 3ARSA 3ZKMD 4N0FB 3K7UA 5HHOB 2BERA 5C86A 2WIIB 3RKPA 4LMQE 4MQXC 1WCBB 3TN0D 4UUJB 1RAMA 5HHPB 4HEPG 4GT7A 1FFPA 1LEGB 3NFNB 4KKBD 3RVWD 5K9QG 4NC0B 2DF3A 4JFOB 1KCSL 4R7DA 4HV8B 1EEZA 1SEQH 1SYVA 1NMBL 3ARFC 4L3EB 5E4EB 5E5UB 5ADOH 4L4TB 1KN4H 1BQHG 4FZEL 2ADIA 3X3GH 2H32B 3DPBA 4OZGF 4LASL 3VGEA 4JFFB 2CKBA 3QJHA 2IAND 2H26B 2YKLH 1UXWB 1A6AB 3ROOA 5M94B 1FZOA 4OCLC 5TDPB 5TQ0H 4X7TA 3RNQA 3NFPA 2J88H 4D9LH 2BVTA 5JOFA 5J57B 3ESUF 3LVEA 3Q48A 3M1BA 4OQ1A 2YD7A 4Q7DA 2A1WL 3ALWA 3UXFA 4F9LA 2NNAB 3H9ZA 4FQ2L 5SWQA 4P2RA 2NZ9D 4ALAL 4LDLB 4P4KD 3MNVB 3SJVD 5T3XD 4P3WA 3OJ2C 5DJ2A 4DWHA 1VFAB 2GTZB 1CFTB 4BJLA 2VDOL 3V0VA 4ELMF 4PJFA 1KCUH 3U1SL 3UTZB 1IJ9A 4M43H 4MB3A 4X4YB 3DNKA 1QFUH 1XIWB 2RQ8A 3PHQA 4TSBL 3JVGC 4TVSa 1OCWH 4FQJL 1Q0YL 4GKZA 4YFLF 1Y18B 1S7VB 1YNTA 3D3VD 4P2QE 1XGYL 2OL3A 4HKZB 4BUGA 3MRFA 2H8PA 4B50A 2X7LB 4WWKC 4CVZB 4WY7L 3BPOC 4KI5F 4XNUL 5J89A 3G5ZB 1AC6A 3BJ91 3GMNB 2YA0A 1DBJH 3OKEA 4OZGE 5FKAA 1NCAH 5FOBB 2OTUA 1BLNB 3TIEA 3O3BA 3PNWA 2P8MA 3VXUD 2ZG1A 1MAKA 2VXQL 5A16A 2EE2A 1A14L 3OG6B 5GGSA 1T04A 3UC0L 4M5YH 1KB9K 3VMOA 1GGIH 4XTRD 3QT2A 3KPOB 1KLGA 5GJSH 5DMIH 4Q6YA 3BP4A 1A4KB 1IAII 2DWEA 4JKPL 4L3CB 4YQXL 1KLUB 1DBKL 1DLFL 3CZFA 5C08B 2N56A 2WQ8A 4K94C 2YA2A 3OAUL 5HHMB 3QUXB 1LGVA 4P2RD 2WIIA 4UUJA 4DK6A 4I2XB 4ELME 5HHPA 4YK4C 3C60D 4FXKB 1G1YA 4LHQB 1LEGA 3NFNA 2NY2D 4H1LH 2GY5A 1NMCB 4AMKH 4JFOA 3JUYA 1CG9B 4L3EA 3I02B 3BKJH 4LCUB 1B2WL 1CK0H 1P4IL 3RA7H 3SEPA 1LP9B 2H32A 3GMQB 3W2DL 4JFFA 1DVFC 2AK1L 2H26A 1UXWA 1A6AA 3QI9B 2VE6B 4CMMB 2CDGB 1NQBA 1UM5H 4OT1H 3MV9E 5AWNH 5TDPA 4KI5E 3S37X 4HUUB 4MB5A 3RUGB 1HI6B 3QHTC 1QA9B 3C8DA 4AM0B 2IH1B 5I73B 2NYYC 4PRHB 3Q0HA 4W6YB 2FBOJ 1OM3H 3EDKA 3RWCB 2NNAA 1PY4A 4X7EC 1D9KC 4OF7A 5D8JL 4M48H 1MCWM 5T1DL 4DGYH 5GRUH 4PJHB 5I8KL 5KJRH 1OPGL 1VFAA 2GTZA 3OAYH 1CFTA 3TFKC 1LEIB 3I3DA 3UTZA 2EE6A 1DQLL 2WK2A 4PJXF 4X4YA 1HHJA 4YHZH 1XIWA 2ZUYA 3ARPA 3D87B 1AQDB 3JWOL 4X99B 5F8RC 5H94B 5T1KB 5JA9A 1SMOA 3B8YA 5KG9A 2EEDA 2BVOB 1EVTC 3GO1L 3WIFB 3T4AB 1SVZA 4JDZB 2DLFH 4YWGL 1RIHH 1S7VA 3WJLA 1RUKH 3DGGB 4HKZA 4XCFH 5K93A 3BEVB 3CMGA 2VLRE 2X7LA 4CVZA 1KNOB 4BFBD 2EH7L 3G5ZA 3S35H 3BX7C 3GMNA 5DDHB 1CGTA 1IGCH 4XMPL 3SE9H 4KKLC 3UYRL 1AXTH 4ZO8A 5GHWL 2JB5L 5FOBA 1BLNA 4WI2A 1I8LC 4EI6B 4DGVH 1ZV5A 2VSDA 4JFFD 3OXRB 4G6JL 5HVFB 4XRCB 1RIVH 4PLNC 3ULVD 4FFVD 5T3ZD 5E5RB 4YXHL 1JL8A 1MVFA 1PZUB 1RU9H 1SYSB 3KPOA 4UU9B 3RVUC 4KRNA 3KYKL 5HJ3A 1JHKH 1A4KA 5IJKC 1T89C 4L3CA 1KLUA 4F8TA 5DR5H 3O3AA 3V6BR 5I1KH 1I1AB 3Q3GB 3NACL 4XC3L 1KYOK 3S7GA 4N5ED 2E9WA 4I2XA 5DURB 1YEKL 4FXKA 4I77L 4PJXE 3SQOH 4MA1B 1LEKB 2QSCH 4OUUB 1CG9A 3I02A 2VQTA 4LCUA 4FHBD 4XT1C 1FBIH 2RJMA 1MVUB 3IRPX 1LP9A 2QBWA 3BISA 4OZFH 2DLHA 1SQ2N 3KVQA 5H8DA 5CIPB 4JQVC 4LSPL 2F53A 2VE6A 2CDGA 2IAMB 3HNSH 5K59F 4G6AC 1ZLVH 4HUUA 3IDJA 1FVDB 5GZND 3RUGA 3LPWA 5HVGB 3VWKC 1HI6A 5BW7A 1QA9A 3RBSA 4DFIA 1GHFH 5IVXB 3EJJX 2AJXH 2IH1A 1AQKH 2NY6C 3V9FA 3BESR 1S7WA 4E41B 3I6KB 2E7HA 5F21B 4LLAA 3EYUH 4R2GB 2MOVA 5J1TC 2EIBA 5DT1L 3RWCA 3ZL4H 3KPPB 2HVJB 3JUZA 4XI5C 5IROA 1MEXH 4K7PX 4GS7C 5IVZA 5L9DH 1FRGL 4MXQD 3TBTB 4PJHA 2OK0L 3MLXL 1ZEAL 5KTEL 1BAFH 2X4RB 1XZ0B 3NCYP 3QEUB 4LEXH 5CKGA 5H94A 5T1KA 4X99A 4HWBL 3GMOB 5F9WB 1D3CA 3O4LE 4EQ2A 2BVOA 3FOLB 2VNCA 3T4AA 3WIFA 1F58H 4JDZA 4MCZB 4ERSH 2RHEA 5IV2B 3MUJA 3DGGA 4LNRB 4AEIL 4XXCC 3BEVA 5T1MB 4PGBA 2OR7A 3VGHA 5HHMD 3AROA 1XT5A 4PUBH 4AZ8A 1KNOA 3O11B 3QFJB 2NY5H 3QA3B 1TFHA 5E8DL 2QR0B 4W70A 1UYWL 4WFED 1GGCH 5F96H 1KOAA 1TQBC 2A9MH 1UB5B 2OI9B 1IM3B 1E27B 5EUKA 4EI6A 5F6HJ 1NDMB 3OXRA 5K59E 3RVWC 1YEDB 3VXOB 4XRCA 3KLAA 3QAZC 3V6OE 1XCTB 2F53D 1MWAA 2HT3C 3ILQD 3FB7B 3AUVA 2X9XA 1MCOL 4LLDB 2QSQA 4TVPH 1I3UA 1SYSA 2ENSA 4NWTL 3KPRE 4UU9A 1X7QB 1P2CB 2BSRB 3CK0L 2QQNH 5DHVB 1RVFH 1G84A 3P4MB 3SGDH 4HG4K 5ITFB 3RTQB 3C5ZC 1I1AA 3Q3GA 1UZ6F 3NH7L 5I0ZA 3GEWB 2I9LA 3H9SA 2GAZA 4G9DB 2ERJB 5F72S 2YK1H 5DHYB 2WLZA 3QXAA 5IW6A 5T3XL 3VWJA 3EOYG 4P2OC 5T1LB 3MX0A 3S88L 1J0KA 3UROR 3QDJB 1LEKA 4LRIA 4ZODA 5L2KE 1EX0A 1U42A 2NZ9C 1IGJA 2XTJB 1A4JB 3MCG1 2DQGH 4JDVB 5F8QC 2VB5A 4YNYA 5T1KD 2LU3A 4MNQE 5DD0L 5CIPA 3IJSB 5D1ZB 1RQ5A 1FLRL 1PGRB 4QRQA 2IAMA 3BD4A 3ARBB 2IBGA 3WIHA 5KANI 1M7IA 3DBXB 2HWZH 1ZVYA 3CVIH 4OI8A 3VU2A 4PGZA 5IVXA 3CU1A 5B3JF 1QACA 2ZUXA 3NN8B 4E41A 1J0JA 3BJLA 3DHJA 3KYOB 5L7XL 3KPPA 1NMBH 2OTWB 2CKBL 5DS8A 4FZEH 2BY0A 4BM7A 4TTDC 1XF3A 3I75B 1WIOA 5IVNA 3TBTA 5I71B 1OSZB 3TF7C 5ALCL 2AERT 4H20H 1PYWB 5C8JA 2X4RA 1XZ0A 3QUYB 1J11A 2X44D 4O2EB 3QEUA 1VKXB 4R8WL 2XZQH 4JFXB 5ICYB 4OBSA 3I9GH 1G7HB 2XFXB 3GMOA 4OF3A 1BWMA 3FOLA 2R69H 1UZ6E 5C70A 4R3SA 1WFNA 3S4SG 4MCZA 2R4SL 4HGKC 5IV2A 4MQSB 3U0WH 2A1WH 1AD9B 1I1AD 3S8WA 5T1MA 3H9SD 5GGUB 4QRTB 4OFPA 5TH2B 1AHWC 4XP5L 2ZG3A 3MRLB 5IEKB 3O11A 3QFJA 4FQ2H 3O4OC 3QA3A 1I9EA 4NNYB 4RDQF 3VWJD 2QR0A 3QZWG 1E6OL 2FX8L 1PKQE 3PL6B 2MSPA 3V79C 4YHMH 2EH8H 1KACB 4BQ6A 1E27A 5C1MB 2LVEA 1A7BA 1CZ8H 2UVFA 2XIDA 1NDMA 3H3BC 3KJ6L 1YEDA 3VXOA 1BECA 3ARYA 3MRKB 1XCTA 1CXHA 3O2DH 4TSBH 3JWDH 2OL3L 3FB7A 3MR9B 2IAMD 2X4PB 2ZOLB 1L0YA 4LLDA 4RGOL 5B3JE 4OTXH 4TVPE 1X7QA 1IC5L 1P2CA 2BSRA 5FV1L 4ZNEE 1IZKA 2GI7A 1DQDH 4WY7H 4XNUH 4Q9RH 5DHVA 3P4MA 3CX5J 4E41D 5ITFA 3K3QA 3RTQA 2E8YA 4YC2C 4XVSL 4R2GD 5E7FA 4OGXH 4G9DA 2YC1B 5DHYA 3TPKA 3DYPA 4WHTA 2AGJH 5D2NC 3L1OL 1FE8H 4PJ7F 5T1LA 3QDJA 2VXQH 4XC1H 1A14H 5HYSB 4OIIL 2VDRL 3TJEH 1IGFL 3JV5A 1A4JA 2HKFH 2W9DL 3VXTB 2HJLB 4JDVA