2DLGA

Solution structure of the 20th filamin domain from human filamin-b
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
102
structure length
102
Chain Sequence
GSSGSSGRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-B
publication title Solution structure of the 20th Filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 5
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dlgA01
3H9SE 3KWWA 2OTWA 4NFDA 1EO7A 4B7LA 1INQA 4U0RB 4RA3A 3U6RB 1DLHA 2PUQT 3TA3D 2VXSL 1BWMA 4YIQA 1U2HA 1PKQA 5DR5L 1GOFA 3KPOB 2XG5A 1EFQA 4M62H 2PXYC 2YWZA 3C5ZD 1BQSA 2XA8L 4F3FB 5EC1B 1RUPH 2C3XA 4BM7A 1KIQA 4OCRH 4RIRB 2X5PA 5CP3A 3RWGA 1FFQA 2IBZY 4HUXB 2WWMC 4LSUL 3VXSB 3EYVA 3MRRB 1OF2B 3UTPD 1SEQH 1RUAH 1QFPA 1DBJL 1Y0LA 2Z8SA 1FLTX 1WT5A 1SEQL 4JFYB 1AQKH 4PLOB 5C0CA 1M7XA 4NOBA 4KKNA 5HVWA 3A6CL 5ITBH 1RZGB 5TH2A 3QPQD 4NM8H 3VCLA 1I7RB 1ZHKA 2ARJQ 2OP4H 5HHPB 2NY1C 4P5TD 2MCG1 5I1EH 2BNQE 3QIWA 1S9KC 3VG9C 4QXWA 1S9XA 3RJDA 5GGRA 2EEDA 2DM4A 2I60H 3HRZA 3MO1B 3MV7D 4NUJB 1EH9A 3KVQA 3MLXL 5D72L 4QWWC 1ND0B 3LV3B 4ONGH 1HXYA 3KDMB 1XGPA 3C60D 1ZMYA 2HT2D 4LPCA 3IAPA 4G42A 4K3GA 3EFFA 3FAWA 1BX2A 2BVYA 1YN7A 4L1DA 5K9KB 3QNYB 4K9EL 1IC7H 1R24B 3DETC 3G6JF 1ED3B 2HTKC 2AEPL 4WENB 4A6YA 3TNNA 3EIFA 3RZCC 4Z18A 5H94B 1MHCA 1NBZB 1RURH 2EXYC 3V7AE 1T0MB 2ITCB 5KAQG 1OP5H 3LPFA 1XH3A 1G0DA 1CQYA 2AS5M 3K8MA 4XH2A 5DSCB 2AK4D 2R29H 2AJSL 2KZWA 2OJEB 2Z8WC 4WJ5B 4K94C 4YXHL 1YPZF 1I3GH 3S8WA 5F7NC 4KUCF 1N64L 1EJ6A 3UTZB 3UTPE 2F53B 4OFPA 4OKDA 4U1NA 1XR8B 4N9GB 4IJ3C 3L3IA 1VEMA 3DLQR 4F9PC 4MQSB 2X89D 2P42B 2RGSA 2VDQH 2XXCB 1JGDB 2ICES 1EBAA 2ILLA 1FG2B 2BOCB 3FONB 4QTHA 2C4XA 2H6PB 1JYVA 4HJ0D 1L7IH 1ZA6B 2HFGH 3D39D 5I1LA 4S1DC 5DC0A 4MCYA 1A21A 1U8LB 3VGAC 4ZS6D 3QQ4B 4LHUA 4XWOC 1B0GA 3MV7E 4PJFF 2NY5H 3IU3A 5FDYA 3S3SA 4X99A 1FL6B 1OOAA 5IM7A 4HKJA 4XNUL 2VXTH 1LVEA 4LSPH 4R0LB 2ZNXA 4G43A 2ENSA 1JWSA 4X7EC 4AQ1B 5KN5B 1DBAL 5DK0A 1QACA 3IDGA 4YWGH 1LEIB 5IW6B 4U05A 2XY2A 2GQHA 5K9OA 3UTSD 3HMWH 2DWEB 3U1SL 3GJEA 4AEFA 4F7MA 2OR7A 3IDYC 3CSYB 5CWSB 3H0TB 4ZO6A 3IFPA 5C0EB 1QSFB 3OL2A 3S98A 1YJDC 1NSNL 5C3TA 4WI4A 4ZFOB 2IH1A 4XPGL 1I75A 5F6IC 3H42L 3ZE1F 2UUDK 3BI9X 1RK0B 3O8XC 4I3GA 2AK4E 5CSBA 1OGAD 3BP4A 4TUKH 3MRHB 1OT2A 1DZBA 2B0SH 1BEYL 1PLGL 5CEYB 4LPVA 1EUUA 1A4KA 4OJFL 5LVEA 2CLZB 3SDXE 5DJ0A 5FUCC 4OIIH 4NC2B 5JUEH 1CBVL 1TVBB 1CG9A 4JFQA 3BRFA 2VQUA 3T65B 2DQTH 1YYMH 4DK3A 2YD9A 4E42B 4NCC1 3DX6B 5KVMC 2QBWA 1EK3A 4LHQB 1K8IB 1UC6A 4XZUA 3GSXA 1F4WL 2WUBH 1YECL 4NNXB 3NABL 4CADB 1C7SA 1E0OB 5BMFH 4MJ2A 3D39E 3VGBA 5B4MC 3BRGC 3FOMA 1WIUA 1AXTH 3LPWA 2R2EB 2MPAH 4K71C 5FGCE 3EZJB 5IVXB 2XV6B 1A8JH 4R4BB 4HMCA 4HCRH 4I5BB 3DVIA 1WAAE 4NKMB 2NZ9D 4I3RH 3DVNB 3FRPG 1KYOK 3L3JB 5DUPL 5FO9A 3UTSE 1TETH 2VDLH 4KK9C 2PXYA 3LKQB 2GAZA 5IESH 1XF1A 3STZA 1HNGA 4FTVA 1V3MA 4JDVA 4XMLH 5KVDL 3V5KB 3PDOA 1U42A 5D2NB 3ZTJG 4C56D 4Z7NE 3QIUD 3FO9A 4G3YH 4MQXC 1A3RL 5MEPB 2QSCL 2UZIH 5I74C 5GS0H 3OXSA 3DVGB 4UDUA 1JHTA 3QH3B 2NY3D 4UUJA 3I02A 5DEFA 3PP3H 1AKJB 3IXAA 2X1WL 1P6FA 1OGAE 4X98B 1F4AA 4LRNL 2AJYL 5D2LB 3LB6D 2EIBA 1F2QA 2EH7H 1DQLH 4OZGA 3LKOA 2N4IA 5K9JH 3B2VL 4JY4B 4YBHA 5F1SA 1NCBL 3NACH 1DL7H 4Z5RB 3D25B 1PQZB 3SCMB 1PYWB 4LNVA 3RTQD 4XVUC 3W81A 5I1CH 2RR3A 3VMNA 3SKJH 2PW2B 4GG8B 4N8VA 4P5KB 1G9NL 2HP4A 3MREB 4WFFD 4ORZC 2NYYD 3MCLL 4PBXA 1FVEB 1NFDB 3UBXG 4I3SL 1IGTB 5L2JB 4MB3A 3PQYB 1TZIA 1YNKH 2X6MA 5F71A 2J7LA 4X6DA 4RWHA 4ZD3H 5J1AB 1OAYH 5FCUH 4KJPC 1V7NH 4PP2B 1OAYL 3WNLA 1MUJB 3QCUH 4ODVH 2CLVA 3V4UL 3ARSA 3GI8H 2VOTA 3B43A 1UZ8B 4PJHB 5C92A 1XMWA 5C0JA 1GGIH 3RZCA 3TYGL 2BRRH 2YBRB 3D9AL 2LVCA 4EZMA 3PWLA 4MXWH 4M61B 3ESUF 4U1KB 3ISWA 4OQTH 3OKMA 4ZXBB 3B8SA 5EC2B 1FNAA 5C2UB 1JNNH 5GGSY 1SMAA 2XIDA 1DQDL 3EYUL 5GIRB 3SO5A 1K6QL 5EU3B 3U4BH 3QFJA 1RHHA 2DQEH 5T3XL 3CVIL 2AKRB 1IAMA 1VFAB 2YD1A 4P23A 5SX4H 3NTCL 4D0DB 1P1ZA 2PO6B 3UBXI 5D6DC 3VXRA 5JMRA 2A77L 3I6LD 5IB4A 1YNLH 2NY7L 3BH8A 4KKAC 2A83B 5D9SB 5I8OL 3OF6A 5FO8B 2MTPA 2J5LC 1NGQL 2FIKA 2FSEA 1YMMB 1TJGH 1BFOA 3EDJA 4ZSOB 5I76A 1CD0A 1MFNA 2FJFB 3A6BH 1WUNT 1P6AB 5DTFB 2HT3D 1MAML 4PGDB 3QI9C 4YHLH 4JM2C 2D7TL 4PLKC 5F8RC 3TPKA 4JO3L 5L6YL 1ACYL 3PGCA 4WI9A 4G6JH 2O5ZL 1CD8A 2VXQH 3BZFB 1X5AA 3BWUC 3FKUS 3SDCB 4Y5YC 4WFFE 3MX0A 5F6HJ 1N3NA 3BGAA 4AEEA 1MLBB 3PHQB 3L95A 1J1OH 1F4XH 3DX7A 4Y19A 1KIRA 4U6HA 4WI3A 5MI0B 1IAIL 4HIXL 1FH5L 2CH8A 3RWDB 2QADD 1TDQA 2XQBL 1KG0A 2DQUL 2OMNA 4JFEB 3ZT5A 2WBJD 2QQQA 1MQKH 1Q9WB 1MWAH 2EDDA 4NWUH 5DJDB 1MQKL 4WUKH 1HI6A 5IFJA 1HHJA 4IRJC 1NGWA 1A0QH 1NGZA 4FFWD 3K80A 1NLBL 1RMFH 4IRSB 4N0YH 1AY1L 1UGNA 1XF2A 1LO4L 5EBLB 4OFYA 5B8CB 2ZZUT 5DFTA 1KJ2B 1INEL 4NWTH 4ODUB 4NBZB 2CSPA 4PB9L 3U7AA 1C16A 1S9VB 3SE9H 3H3BC 5J89A 3VFMA 1MRFH 1NCWH 4LLWB 4MZ2A 2RQ8A 4HK0B 4PGZA 2O5YH 5FAAA 4BSWA 2VQ1A 2W92A 3U2SA 2IG2L 4LLQA 5GHWH 3PL6C 2XY1A 5HD8C 1D9KB 1HKFA 5I9QC 4AIOA 2DDQH 3EGSB 4HLZG 3MACL 3DV6A 4HDIB 1KN2H 1I85C 8FABA 4MJ5A 5C2BL 3QPQC 2NXYD 1ES0B 3BKMH 4MD4B 5E24E 3ALXA 3RUGF 3CCHA 3HC0B 3BP5B 5TE4L 2DLFH 4Y2DB 4X4YA 4TSCH 2ZG1A 3OKLA 1JGLH 1JPSL 3AREC 5IIEB 4P46B 4H1LG 1TVHB 5D7IF 1JGLL 4UBDD 3U36A 4Z7UB 3CSGA 5I2IB 1QQDB 2VLRD 1R5WB 1FGVL 3EO0A 1LP9E 3TPUA 3MOBH 1MCSA 1EJOH 1U58B 7FABL 3MTRA 4IBLT 5E8NA 1NAKL 1CU4H 1DUYB 4KY1H 4O2CA 4XNMB 3QRFM 5HHXL 1F58H 3IJHA 1KCSH 5EUKB 4DTGH 3HG1A 2VLKB 2DBLH 4HKXA 3V4PH 5HY9B 3BN3B 5IB1B 4TVPD 1T7XA 1I1AD 2AQ2A 5H37H 5BV7H 3KXFD 3UTTD 4S1SH 3QB7C 2NR6D 4MAUL 5CBAA 4NO5A 3QG7L 4PRAA 4PRNA 5E5RB 1JPFA 1C5DB 3WN5B 2GKIA 1IILE 2YD7A 2KKQA 1L7TL 4XXCA 4JB9H 1JPGA 1JFQH 1VFBA 3EAKA 4LP5A 1EHLL 1WBXA 5ICXB 1JBJA 1M7IA 1NJ9B 3WIHL 3O3BB 3RFZC 1FNFA 1S7XA 4QNPE 1AGFA 3OKEA 2HG5A 1MCKA 1MVUA 4PG9B 3IJSA 4AEHL 2ZUVA 5IMKB 2VTFA 2H41A 1JWMA 5E9DE 2XKUA 5DDHA 5GGQL 5ADOH 3MA7B 1YEKL 3ARTA 3KJ4B 1M1SA 4LKCB 5E5UB 1QFUL 3DGCR 4MNQD 4XP1L 2NY5C 2IQ9L 2ORBH 1O5DT 1UXWA 5IMOA 1I9RH 4G8FA 4YC2B 3DI3B 1P2CA 4NKDB 3Q48A 1MLCA 3V5HA 2VLRE 1BVKA 4P9HL 3CMOH 2DI9A 5C0GA 3QQ3B 3VXNB 4UQ2B 3VRIA 3TVMD 2YC1B 1C08B 1FL3A 2FYYA 1C7TA 3SDDB 3VI3E 2WV3A 1QLEL 1AGEA 2BVQB 4HUKB 3CX2A 5I6XC 1MCPH 3KPPB 4PREA 5J1SC 2GJZB 1UCTA 3F65A 3HUJF 3W11C 1JPTH 1H15B 3F5WB 3T77A 5F89B 4U1GC 1ACZA 5IG7A 3VFNA 1KFAH 3D3VD 1NMAH 2FWOA 1T4KB 5E2WL 5C0FB 3VFWB 1A7OL 5MP6H 3PWPA 5HYSA 2IPKB 1CGWA 4TVPE 5A2FA 3MROB 4DKDC 1A6VL 5CBEA 4NNYB 5AYUH 3KXFE 3UTTE 3RGVB 1U8OA 3S35L 1AXSB 1IFHL 1BFVH 3E6HB 1CYGA 3TO2B 2BFVL 2PR4L 4DZBB 4OZIE 1MREH 3G04A 4K3JL 3B5TA 5CD5D 1CFTA 2VMFA 3QNXA 3VGHA 2EE3A 2OL3L 1CS6A 1JUFA 4U0QB 1A1NB 4KI5D 4ODHH 2H32B 2OTUA 2EICA 3UTQA 1I8KA 3KPSA 4M7ZC 5TF1L 3QI9A 3QA3B 4JM2A 5KSUB 4J6RL 5ETUB 1WZMA 5HGDB 3IXTB 3BPCA 3G6AA 3OJ2C 4NJAH 4Y5YA 3JWNC 3MGOB 1ORSA 4GQPH 3FB5A 5CLTA 3WHXA 3OWEA 4FTVE 1FNEB 2GTWB 4TRPH 3TA3B 4K3EL 1JIBA 3W39B 4YHKH 4X7SL 3DMMD 2OR9L 4MNQE 3M1BB 1UCBL 4G7VL 4UTBH 2N56A 3P9MB 1ZGLA 3FFCB 4AH2B 2BJMH 3SDYL 3WS6C 3PV7A 3P77B 2HAZA 2UY6A 5FECA 1R5VB 4LVEA 1II4E 3CLEH 1R3LB 5GSRB 5INCB 3LKRA 1CDYA 4IRJA 2D0GA 2VITB 5JOEA 4P57A 1UJ3B 3ALWA 5E6ID 1CF8H 4GAYB 4HQQH 4OCYL 3VXMA 4J1UA 3OAZK 2K3TA 3D3VE 2FHBA 3S36L 1KNOB 3D6GA 4MX7B 4WHTB 3OKKA 1FBIL 2E6QA 4M9OA 4JKWA 1F5WA 4PIRF 4XP5L 5ICYA 4P5TB 4V1DD 5JHDD 2WINB 2VZ3A 4BFBD 4CVXB 5JXAH 2PW1B 2Z9TA 2ZCLL 3B5HA 2RBLA 1N59A 4OLEA 1CDCA 2HWZH 3DXAB 4HWZB 1OW0A 1QRNA 3PL6A 4LSRH 4ZNEA 5KVFH 4KI5E 1QTYT 2GITB 3ALPA 5JNYA 1JGVH 2B5IB 5D7LA 1I85A 3ZKNC 4EBQH 1DN0A 1FZOB 4K07A 5HYFA 4IOIA 1N5YL 3O2WL 4R7NB 3SO3C 4S0TD 2X4OB 1T21B 3X13B 1HHHA 1ZHBB 5CJOH 1J05B 4FQLH 4S2SB 3RWCA 1A7PH 1EEQA 3AREA 5C08A 5JDJA 4FZ8L 4L4VA 5DD5L 4PJAE 43C9A 2CR6A 3CFDB 3CLFH 3SKNA 2FBOJ 2NYYC 3F6LA 35C8L 1URLA 7CGTA 1CTOA 3SDAC 1JZ6A 2PYFB 1QFWL 1T1WB 1ZEAH 4CGTA 1AD9A 4HIHA 3BIBX 2JCCA 5KS9F 4HKBA 5E08L 4F37K 5IFHH 3JV6A 5BJTA 4UIMB 4M1CD 3DUUA 4NHCH 2XNAA 1JF5A 3C2SA 4HWUA 3LEXB 4OV5B 4Z7OF 5I8CA 4GRMA 3DRTA 4QT5B 3BGMB 3KG5A 3KPRD 4X4ME 1MFDH 2W9EH 4XMKH 4YHIA 3HR6A 4XPTH 3RWHA 3SDXB 3VD3A 4RCAA 4XMKL 3KYNB 1I4FA 1N0XH 3B2UC 2ZJSH 3H2WA 5T1LB 3MJ8B 4OKVA 4XBEL 2KUTA 2BVPB 2R1WB 4HV8B 3U0PB 1VPOL 1MPAL 3VWKD 1AE6L 1RJYB 1OT1A 1IGCL 5BO1H 4DAGL 1NBQA 5AUMA 4ZPVA 4V1DE 1D5ZA 2XTJC 5JHDE 1J1PL 3KPLB 4WTXA 2W65B 1JZ8A 3D85B 4YPJA 5HHMD 4CRPA 6FABL 1T04A 1UQSA 1T0NA 1G7LB 1NUGA 4XC1L 4Y4KB 1CE1H 4OUUB 5FDWA 2ARJB 3IDXH 3QDJA 3VDCA 5I1AB 2RHEA 1QKZL 4XMPH 1Q9LA 2OQJA 3LSOA 1AQDA 2F54D 2X4UB 3ZYOA 4PJ7E 1M05A 3FCTA 3HAEA 2EKSB 5SWZD 4NN7B 1TQCB 3I75B 5T1MA 4OZHE 2XFXA 3H9YA 5D6CB 2CO6B 4X83A 2UYLB 5T1KD 3L9RB 3VG0L 1I9JH 1LK3H 3SJVA 4GKOA 5JZ7D 2DI7A 2YK1L 1V3JA 2G9HB 1FFOA 4OCSH 4Y16B 4Q9CA 3EDEA 4MD0A 1T22B 3CUPB 1DSFH 1A6TB 2A2QT 1NC4D 3V5DA 2ED7A 4WHCA 5SX5K 3HPLA 2IAMA 4TPRH 3KPTA 3TBVB 3FRUA 4MAYD 1T89C 4RX4D 3KJ6H 2GJ6A 2Z31B 1OGAB 2EKJA 3LQZA 3C6LD 2WBJC 5DGQA 2OBGA 1UA6H 5CJXA 3O41B 5CIPH 5F88A 5DWUH 1E4WH 1UEMA 3KPRE 4GLRI 3BEWB 1CGTA 5JTWA 1YYLL 3LN4B 5SWSA 3CK0H 5T3ZH 3CXDH 1H8OA 3LRSB 1QFOA 2NXZD 2P5EB 1AI1L 1IGFL 4PJ8B 1NAML 4OF8A 5IW1B 5GRJH 4Q9BA 1CICC 4LSSH 5E2TH 4Z77B 1WIPA 2FCBA 4L8BA 3LD8B 5JIKA 2F19L 2JE8A 3KYMA 1NL0H 4L5FH 2YRPA 5DD3L 5J9PB 1CK0L 3EBAA 4LBEB 3TV3L 3OJDB 1G9MH 1UM6H 5FYKL 3W9DB 3ULSA 5HHME 4MJIB 3J7HA 4K8RH 2J6EH 2DQJH 32C2B 2MQ3A 4NKIH 2RIKA 1EZVX 1IAIM 4APQB 2XWBB 2YPKA 3GMNB 4LGPB 3QUXC 4OLYH 2FLBT 4U4BA 4X4XB 5C09A 2F54E 4CNIB 3RIAK 5L7XH 4X7FC 1YEEL 3TIDA 1AO7D 4DFHA 1D5BA 3JUYA 3BDYL 5SWZE 1KIPB 1QNZL 4L8SA 3D2UA 2ZG2A 1OQOA 4KUCD 3IAGC 3SOBL 5GS2H 1K8DA 3CXHJ 1RIHL 3T0ED 1HYSD 4YHYB 3L7EA 5D1ZB 2A6KB 5LWYL 3FQRB 5IP4A 3WS6A 2FGZA 4OAWA 3ZDXF 2YPVH 2AJ3B 3BVNA 4UOJA 4YK4C 4HC1L 3GGWA 1I8IA 4HCRA 3CU1A 1TMCB 3CC5A 4QHLB 3DBXB 2HMID 1AFVH 3VXTA 1U8HB 5FHBL 1U2CA 3L7FA 4J3XA 2Y07H 3BP7B 2NY3B 2W9DH 3TN0C 2VIRA 4NNPH 3LH2H 3EJYD 2IFFH 4MA3B 1WBYB 1ZT7B 4M43L 3QZWB 3QT2A 3OAZH 4NRYA 4H5SB 4JG0H 5BV7C 5EO9A 1IGML 3B4NA 4ZUWA 4OTXH 3KWWB 1BF8A 1A14L 3IDIA 4R3SA 2VLJA 3UO1L 1XF3A 3HNSL 1INQB 4FQ2L 1Q0XL 5DRXA 4LIQL 2BHZA 1B4JH 1DLHB 3VU2A 2YN5A 4YIQB 2A9ML 4CMMA 1PKQB 4RISH 5E7FA 4UOW0 1GIGH 3G6JE 4Q0XL 2I5YH 1F6LL 2D0HA 4PJIA 2WZPD 3OKNB 3T1FA 2I5YL 2OTPA 3BKJH 2HTLC 1KPRA 3QXAA 4LCYA 5TGBA 1KIQB 1NCCL 4P4RA 4DUWA 4YHML 3B6SB 4X6CA 4KZEH 4PJXA 4ACPA 3C8KB 3RWGB 5EWIL 1I7ZA 1FVDB 5EZLA 1QYGH 4U1JA 4J3SA 3BAEH 5D8JL 3HNTH 4HGWA 5IFAH 1Y0LB 4S1RH 1AO7E 3ARBD 4P3CH 3OXRA 1N6VA 1YPZE 5C0CB 1OGTA 4I0PD 5B38A 4P3CL 3K4AA 4EQ2A 1A7RH 3SDAA 3C09B 1KACB 2P46B 3Q1SH 1CFQA 5EU6D 5EUOA 5TH2B 1FV1B 3VCLB 1ZHKB 1CR9H 3T0EE 1KCUH 2B4CC 5CILL 1MCQA 3ZTNL 1I8MA 4P2QA 4LEOA 2XZCH 3NIFF 1NC2A 5DA0B 3RIFK 4WUUA 5GGRB 2Q76A 4XCYA 5IUSA 1KJVA 3MLTA 1R3IH 3QO1A 1U3YA 4M7KH 2YN3A 1JMZA 4OQTA 4AEIL 4WW2C 1G7PA 4O5LH 4EUPG 1NDMB 1KBGL 1EIBA 1HXYB 3LS5L 2HFEB 5LBSL 3CFIC 2DLHA 5CJQH 3L5WA 4FOMA 3BPOB 1WFNA 4G42B 3EFFB 1TTUA 1LDPH 4LPWA 4PJFE 5D5MF 1YN7B 1BZ7A 5E03A 3AS1A 1S7SA 4UU9A 2V6HA 4JFOA 4YUEL 1FORL 4ZUSA 2X4TB 5CZVH 1MHCB 3IU4H 3S9DB 4JN1L 3W5MA 3MRMA 1E4XH 1K85A 4E0RB 4DVRL 2VKXA 5FA3A 1T83C 4TYUA 1XH3B 5H2BA 3V7MA 4FQQA 3QP3A 4XH2B 4ZFOL 1LP9B 3GSUA 3GBNL 3P4MA 5C0BA 1J5OH 2AP2A 1J0IA 3GSQA 3VW3L 4ZFFA 2ZP0T 1WBZA 1JI2A 3ZE1E 1YEGH 3CIQA 3ZHKA 4CDHA 3G6DH 5AWNL 3RNQA 3O4LA 4JHAL 4U1NB 3BISA 3V6ZB 2R69L 2BVOA 5HI5D 2A6JA 4HZLA 4NUGH 3L3IB 1FNLA 1CXKA 4YX2L 3MLWH 3QCVL 1JYXA 3HRPA 2WQ8A 5EU6E 3IVKA 1EGJH 5LGJA 1F4YL 1BGXH 3DMMC 4J7RA 3U7WH 1J0KA 3DSNA 1N7ML 4FNLL 4LVOB 4QTHB 4ZS7H 1T89A 3NIGF 1IC5H 4D9LL 3OKDA 3GHBL 3OKYA 1IE5A 3NN8A 3LQMA 4MCYB 1XZ0A 3AXLA 1U6AL 4R4ND 5DK3A 3GMMA 3PGDA 4LHUB 3MBEC 3BQUC 2MCPH 2YD6A 1NLDL 3MNZA 1RJZA 3IU3B 3G08A 4WFGD 4YDIL 5HYQA 5DMIH 3QDGD 2YUXA 5JHLH 5IM7B 1U8NA 5DMIL 1XGUA 2D7NA 5JHLL 3MJ9H 2EXWD 4HK3J 3N06B 4AMKH 4G43B 5A40E 1JWSB 5DURD 5DK0B 3IDGB 3UZQA 1CICA 5C0AD 3VGEA 5K9OB 4Y8DC 3EDKA 3JSSA 4M1DL 2XTLA 2EDTA 2A1WH 5E9DB 3GJEB 3FRPA 2QHLA 3S35X 4C59B 3DWTA 5D1XD 4WRLA 4F7MB 3PHOA 5TQ0H 3CFJA 1Z6JT 3IFPB 5MEND 1FNGA 2DYPA 3QIBD 4LFHG 2NPLX 3ECBB 5IQ9A 4GMSL 1OSPL 2O5XL 5HDQH 3ULVH 4GG6A 3QUXA 3MNVA 3RVWC 4CKVX 4KAQL 1IGIH 1LE9B 1PG7H 1JHLH 4I9WD 2ZUQB 1A4KB 1MJ8H 5A2IH 1KGCD 2ADIA 2VUOA 4ZTOL 1CDBA 1CG9B 4JFQB 5I18L 3DGGA 3TJHC 3WUZA 5M95B 2XYCA 4OGXH 1JZ3A 4UQ3A 2CMRH 5IJVB 5DJ8A 3JTSA 3QDMA 3K1KC 3ABZA 1WZ1H 2D7MA 4Y4HD 1VKXA 5E8EA 2ITDA 3UTTB 5DJYA 4XZUB 3GSXB 3MC0A 3O6ML 3TN0A 4I18B 3LEVL 4NSKA 4R4FH 4R26L 4BUGA 4L3ED 3Q6FA 4BK5A 3S34L 3FN3A 2VQTA 4M1CC 2NW3B 4JJHA 4WFGE 2XZAH 2ZOKB 2VISA 3QDGE 4PJ9D 3BZ4B 4NFCA 5DT1L 4YBQD 2YD2A 2HRPH 4Z8FH 2P48B 5C0AE 2AAVA 3FO0H 2Z4QA 3VWKC 5FO9B 3SPVA 1DVFC 3ZE0F 2PXYB 3STZB 4FTVB 4D2NA 4JDVB 1MFBL 3PDOB 1SEBB 1Q72H 2BXZA 3U4EA 3FO9B 4KDTC 5MENE 4GRLD 4OSUH 5F1NA 4PBVC 2R0WL 2CIIA 3OXSB 4UDUB 2UWEA 3MV9A 3NA9L 3I02B 4LCIL 4UUJB 2J4WH 5DEFB 5TFSL 3IXAB 4K23L 1IAII 4RMWA 43CAA 1J0YA 1T2JA 4HPOL 4P59H 4I9WE 3V52H 1BOGA 4WWID 4XTRC 2YUWA 3LKOB 2IQAB 4BZ2L 3MLVL 1KGCE 2CDFB 3NH7L 2NY1B 3F58H 1AR1C 1C5CH 2QQLH 4DGYL 3VG9B 3EOYG 2Q87A 3NCBB 3MCKA 5I1GH 4RGMB 1CLYH 2OSLA 2P24B 5JZ7C 25C8H 1QSEA 1K3IA 4N8VB 2WWKT 3ET9F 1VSCA 2DOCA 4YPGB 1AJ7H 4R90H 2YD5A 4KV5F 5HPOA 2NX5A 2EDHA 3NBNA 1JV5A 3QXVA 1RY7B 5GXBB 4HBCL 4L3EE 1FZMA 2HRLA 3HTLX 2BNUA 4GW5A 3P4OA 1HEZA 4JO4L 3BXNA 4I77L 3X11A 2H1PL 2CLVB 2FDBP 3OAYK 4UINH 2ZPKH 3ARDD 3IKKA 5E56A 5IVXF 2QJDA 2N1KA 3PWLB 1KUMA 2JJTC 3K0WA 1RUMH 5KSAD 1G9MC 5C3LD 1TJIL 1NEZA 3MRJA 4G8GD 1T83A 3MRNA 2DQHH 2E9JA 4PGEA 4P49A 3GSNH 3QFJB 1MF2H 1RHHB 3VXUD 1BD2D 4M48H 4P23B 2ZCKL 4CW1B 3V0VA 1KJ2L 1P1ZB 1WTGT 4NBYB 4Z9KB 4JQVC 4N1HB 3VXRB 1NUFA 1YEHL 3K4DA 4Z95L 3BH8B 4ZFZA 2F74A 3KPMA 5T3XD 1FNSL 2JELH 5JQ6H 4ZOBA 4IJ3B 3RIAF 1U41A 4LFHD 2FIKB 2FSEB 4YDVA 3CFBA 1BFOB 2XT1B 5F9AC 3X3FH 5E6IB 5I76B 1BMGA 3IT8D 3KR3H 3B3IB 3S4SA 3MLRL 1O0VA 2CJUL 1HYSC 1LO0L 5KJRH 4PLNC 4RGND 3PGCB 4AY0A 3WD5H 3EOAA 4X9FA 1INDH 4JO2L 4RMQA 3VGAB 3MBEA 3BQUA 3MRFB 1INDL 3ZKQD 1N3NB 1IMHC 3KHOA 3FL7A 3PF2A 4X5WA 5EO1A 3L95B 3RUGE 3WNNA 3DX7B 5BVJA 5HGGS 3T09A 1KIRB 4ISVA 4U6HB 4XP9L 4PRHD 5J13C 1NFDF 2Q7NA 3MXVL 4TTDC 4YDKL 5GRXG 3WJLA 1F13A 1I7UB 4PJXE 4NCC2 5HJ3A 5D7IE 2B1HL 3UP1A 3RWEA 1MIMH 1KG0B 2V7NA 1H3TA 2X09A 1UM5H 1X5XA 3S96A 1HI6B 2WUCH 4JEGB 5IFJB 5F70A 1S7RA 1HHJB 4OZHB 2BX5A 2VDRL 2BCKA 1NGWB 3TZVA 3VGFA 1NGZB 3EO9L 1KEGH 3UTOA 4PJHF 2GJJA 1IQWH 3SKMA 3V6FA 1XF2B 4MLSA 3TP4A 3RJQB 4G8GE 4DGIH 3VI4F 4UI2A 3L3GB 5AZ2H 2VKWA 2ZKHH 3VXUE 1BD2E 3EYSL 1C16B 1P4BL 4UAOC 3HC3H 5MHSD 2ADFL 4OD1L 4QYOA 4KHXH 4MDJA 5HGAB 4BSWB 5ITFA 5J4MA 5T33L 1G1CA 4S0SD 5T3XE 5HHQA 3U2SB 1OTUC 1Z0MA 4LASL 2EH8H 1YEJH 4RGOL 5HPMA 4PS4H 1AGDA 4XHJC 1T20A 5ECJE 3JWDH 2G60H 4KJQD 4PRPD 3A67H 1U8IA 3DV6B 5JW4Q 4W70A 8FABB 4MJ5B 1S5IH 3AB0B 2CXKA 1JP5A 3QG6A 5J12B 1MFAL 2LFGA 1TTGA 3CCHB 4RGNE 5DS8B 2B39A 5EORH 4X4YB 3G5YA 3GFUA 3OKLB 1LD9A 4K71B 3RIFF 2OZ4L 2NZIA 2V2WB 1DBKH 4U1HA 4E9LA 1I3UA 4DKEL 2GCYA 1KCVH 3EO0B 3QWRA 3TPUB 3MJ6A 4PRHE 4FQCL 5I1HH 4XVJH 5E8NB 1ZANL 1OD9A 2IPUK 4EN3C 3ARFC 4XPFL 4F58H 1DVFA 3L1OH 3O4LE 4O2CB 1W0VA 4X9HA 4U33A 3RWIA 1R5IB 3IJHB 1C1EH 3HI1A 4F58L 2B2XL 3HG1B 4JGMA 3NIDF 1WV7T 4HKXB 3P0VH 1NGPL 2WQRA 1Y6MR 4PUBH 1J7VR 3P0VL 4KDTA 2FJHB 3GI9L 3HUJE 5I74B 4K9EC 5CUSL 2EYSB 4HFWB 1QG3A 1KLFA 4IDJH 3VRJA 2J2ZA 3OPZL 3BFOA 3GHEL 3CH8A 1VACA 5CBAB 2BSED 2DM3A 2EDWA 5GGUA 1HH6B 4HJGA 4NO5B 4PRNB 1D5IH 5HTSA 3UZEA 3BD5A 3LN5A 1FO0H 4HXBH 1NC4B 1JPFB 3BJLA 5GSVA 3LQAH 1QUNA 3PABA 3UJTH 5MHSE 3I85A 4M7JL 4FP8H 1VFBB 4PB0H 5E8DH 3PP4L 4JHBA 1WBXB 4L9LB 1CLZH 4DKFL 4LSTH 3STLA 3P30L 1M7IB 2Y36H 3ORJA 2E7HA 5FFLA 1S7XB 4N90D 3OKEB 2HG5B 3QRGH 4PRPE 1MVUB 3IJSB 2EIEA 1B2WH 3RGHA 2NXZB 2ZCHL 2I26N 2E6PA 5EZJA 4G6FB 2CR3A 3P40A 5DDHB 3E8UL 1PX4A 3DI2B 3T4AA 1HKLH 4FG6D 5CIPA 4BH7A 4URTB 1MEXL 1B6UA 5GRYA 3UPAA 2JK5A 4M6AA 4D8PA 3AGVA 5IMOB 4GT7A 1IKNA 1P2CB 1TFHA 4R4NC 1MCOL 5HVFB 1MLCB 4HWNA 5IBLD 3V5HB 3AS0A 1BVKB 1FRGH 3MOAH 5C07A 4HT1L 1IGJA 3VRIB 1RZKL 1FL3B 5DQJA 1A6UL 1W72H 4Z7UF 2Z35A 3WE6A 3TBTA 4U2YA 5CCKL 3GBML 1L6ZA 2JJTA 1CGSH 2Y06H 1SY6H 1UH2A 4WGWB 1ADQL 2IADA 4KTEL 3T77B 3HFMH 3LRHA 3R0MA 2R8SH 3VFNB 1BFTA 5EFIB 2FWOB 3RDTC 2VXVH 4D3CH 5D7SL 5DD0H 1Z3GH 4FQ1L 3W2DL 5HYSB 4B53A 2YSSB 5CBEB 3QUZD 2VDKL 3HI6L 4JQVA 1U8OB 3QIBC 4DEPC 5C9JA 1FGNL 4LAQH 3MQIA 5FYKU 4JFZH 2J88H 4IRZL 1WWWX 4LAQL 2I9TA 1JGEA 3G04B 3O3UN 1VGEL 3NVQA 4NN6C 1QFWI 4R8WL 3QNXB 1HH9A 1MCNA 1JUFB 4RMUA 2OTUB 4MJ6A 4HIJA 4ALAL 3NCYS 5DMKB 3KPSB 5GS1C 3DV4A 1HQRA 3BWAA 3QI9B 1PEZA 3DX8B 1R3KB 3BPCB 3G6AB 2AJVL 4N90E 1BHGA 5HBBA 2R15A 1J8HA 1RUQH 4CMHC 4Y5YB 3RL2A 1E6OL 5DJ2B 1ORSB 3EYOB 5B21A 3FB5B 3WHXB 4RDQF 5JLZA 3WFCH 4KXZI 3I2CH 1JNLH 5D71L 2H9GA 3HE6D 1XGTA 2XQYK 3C9NA 3SQOH 3HLAA 4ZODA 1ZGLB 4HAFA 2Y1VA 3DYOA 1QPPA 4ZO9A 4M6OH 1OAUL 3P0GB 4JAMA 1NMCC 4LSQH 1X4XA 4FQIL 5FECB 4F2MA 1CFNA 1MIEH 3MGTA 3LKRB 4IRJB 1DQQA 1JZ4A 5KS9E 4P57B 5FOBA 3CJJA 4RFNC 3G9VA 3RBGA 2X1XR 5CP7A 3P73A 5DFVC 3VXMB 2Q1EA 4Z7OE 2G2RA 2BOBB 3KNBB 5GGVY 3DNKA 3DSFH 5KTEH 1D3CA 3OKKB 4BZ1H 4NRXA 5D70H 1MELA 3IDNA 3FT4B 4G6ML 4RBPK 4TN9A 3QXDA 5ICYB 3V79C 1EFXD 1CGXA 1RIVL 2K9UA 2CXGA 5FOJA 1A9EA 3O6LL 5FKAA 1T03H 3MRPA 3CH1B 1N6QL 1N59B 1FFPA 5JORA 2V9QA 4R9HA 1QRNB 2K1MA 3PL6B 3PWUB 4LSDA 4P5MB 3CD4A 5AD0A 2P43B 4YO0B 5D7LB 3D87B 4U6YA 4J3WA 4B50A 1D6EB 1T1YA 5AAMA 3RU8H 1A7QL 4LOUD 4HW6A 1HHHB 6CGTA 2CRZA 4KMTL 3QUMH 2EDYA 3AREB 5C08B 5J6GB 4L4VB 4ODSH 1FCCA 3RWFA 4CU8A 2BSRA 3SKNB 1JZ7A 1G9EA 1T80A 4UT7H 1QVOA 4L4TD 4LLVA 5IKCA 4M6NL 2BMKA 5T1DH 2VZUA 5L8JB 4JR9H 3HZKA 3O3EA 5TQ2L 3UPCA 4C55A 1B3JA 2FIRT 1AD9B 1ZA3A 3BKCL 4M00A 3RX5A 1G9NC 4HIHB 4HKBB 3JV6B 4N0UE 4EN3A 3ARFA 3DUUB 1TJHH 2HJLA 1N4XH 1NDGA 5I8CB 3H7BA 1XR9A 3DRTB 4MDIA 4FHBD 4ZUTA 5HHOD 4YHIB 1CD9B 4OLXH 5KANG 3ARDC 1VHPA 5HHNA 1YA5A 4JZJC 2CO7B 4GBXD 1Q8MA 2RFXB 4XP6H 3SE8H 3MXWL 4OKVB 4JKKA 1REIA 4HS3A 1ZV5A 5KSAC 1P4LA 3MV01 4RMTA 2VH5L 4HFUH 2Y25A 1B9ZA 3R8BB 4R2GD 1MY5A 4EQ3A 4YQXH 1T1XA 5C0IA 1SMOA 4OCXH 1H3PL 1ETZB 5AUMB 4ZPVB 2PCPB 1ZHNA 4Y4FD 1RZ8A 3ZL4L 3WFHB 1U8KA 1A7NH 1E6JH 1FE8H 1LO3H 3HMXH 2UY7A 1M71A 4M7LT 1UQSB 2NY2C 5FDWB 2ZNWA 1EGJA 4EIGB 3QDJB 3QDGB 1Z9MA 4FQHA 4PJ5A 4X6EA 3WDIA 2OQJB 3LSOB 1AQDB 3UYRL 1BQLH 2MKLC 1XIWC 2AXFA 2GY7B 3N1PC 4M03A 5JDSA 1M05B 3FCTB 5J1TC 4X7TA 4XPAL 3QUYC 5KANI 5T1MB 5C0AB 2XFXB 3LIZL 5I8KH 5JW4N 3V4VH 2MHAA 1GPOH 3SJVB 1CD1A 5BZWA 5FM4A 3MJ9A 3NFNA 4FFYL 2VWEC 5D1XB 2UVFA 1IL1A 1QLRA 1I9IL 4MD0B 1R0AL 5ILTH 1B0RA 4KK5C 4NPYA 1EHXA 3HPLB 2YXMA 4AL8L 2E8YA 2IAMB 1T66C 3FRUB 5F8QC 3ZDXE 5HI3C 5D1QD 4QXUL 3X17A 3LQZB 3KPNB 1HHGB 2LU3A 3SGEI 2V9TA 3RDTA 5I1DA 5HHOE 5E70A 2DQGL 4NQCA 4I8DA 4GO6B 4DOHB 3L6FA 5SWSB 3TBYA 3WMSA 4QXGH 2XWTA 3MV8D 3ARGD 1TCRA 2NY4D 4HEME 4QRPA 4X8XA 4YXLL 3FT3A 2HFTA 1KTLA 4L8BB 5ANMA 3UEZA 3DHMA 4KJWD 3R1GL 4DW2H 4AENA 1FAIL 3KYMB 5EIQA 4NGHL 5T3ZD 1FN4A 5E6YA 4LLMA 4G6AC 2L4OA 5AZEL 2R0LL 5GS1A 1U3HC 1T2QL 1IT9L 5DVMA 2F58L 4Z76A 5DUMH 3C2AH 1KCRH 5CP3H 4G8EB 2YPKB 2H3NA 3C2AL 1JTTA 4PGCA 1BLNA 3RVUD 4PJ9B 5C09B 1CT8A 1VFOA 4XWGL 1D5BB 1PY4A 5CGYC 2VZTA 4KPHH 4K8RD 5BRZA 4L8SB 3D2UB 1UXSB 1UWXH 1E4KC 1D6VL 3LEYL 4LSVH 3MRKA 4MNHA 2C9AA 3L7EB 3HC4H 4IS6A 5KVEH 3VXSD 1R3HA 1QSVA 5C0DA 4OAWB 4EDXA 3BVNB 2DL9A 3GGWB 3QQ9D 1I8IB 1RULL 3OAUL 3CC5B 2WP3O 3VXTB 5IMMA 2VZ1A 4F33B 3BPLB 4PJGA 3L7FB 1NCAH 4F7PA 3SQBA 3TYFA 2CKNA 2VIRB 1WSST 3H9HA 3QWOA 2DTMH 1MJ7H 1UM4H 3DO3A 3NIFE 2Q86A 1LNUA 1H0DB 1N6UA 4NRYB 4TUOA 2VC2H 3I9GH 1Q0YL 5F96H 4HG4K 2YD4A 2JB5L 3F12A 3NCYP 2XACC 4OLVL 4ZUWB 1BQHA 3IDIB 4R3SB 1XF3B 4JN2A 5CINH 2EDFA 4Q6IC 1PX3A 5DRXB 5ESAA 5JW3L 3MV8E 5D5ME 5GISL 4A6YH 1ZLUH 5ALCL 5I15H 2Y6SD 5E0QA 1BECA 1RK1B 1YY8B 4FQJL 5FYLH 3CFEB 5T3ZE 3LS4L 4KROD 3T1FB 2XRAH 4KRLB 2Y5TA 4ZG1A 5ABDE 1KPRB 3K2UL 1ZLWK 1MCHA 4I0KA 4XNYH 5JOFA 1JRHL 1TQBC 3QXUA 3SO3B 3P4NA 4PJXB 4U7KA 5CSZA 3IFNH 4NKQB 3T04D 1BVLA 1Q38A 5KW9L 3F7QA 1I7ZB 5EZLB 1X3DA 4U1JB 3NAAL 3TH3T 1KXVC 3WFDH 4HGWB 4HUWA 5LQBL 4KRPD 3J8F7 3FB6A 1D5XA 5ISZA 1E28A 2QQNH 2GTZA 1OGTB 1OM3L 3MLSH 4N8CL 4JFHD 5EUOB 3U48A 4FG6C 1S8DB 1TZGH 3VXSE 3F7PC 4RWYH 1S5HA 1I8MB 4P2QB 4LEOB 2F53D 5I8EA 4XT1C 4ZYKB 1SBSH 4ZFGL 1NC2B 1BD2B 4WUUB 2Q76B 4BA8A 1KJVB 1MCWW 1JNHA 4LDOB 2VDML 3MLTB 3QO1B 2XKNA 1Z2KA 4JCLA 3VGDA 3OKOB 3FFDA 5BZDA 1G7PB 3NIGE 1YMHA 4JZJA 5FYJH 4IMLA 4QRRD 4H0IA 3QBTB 1H3XA 4P9HC 3ETBF 3L5WB 4L3AA 4X8JA 1OCWL 4JKPL 4HIIA 2Y9RT 2RB8A 5GRVK 2P5WA 4KC3B 1J87A 4O4YL 1BZ7B 2N7AA 1JGUL 4HJJH 2Q8AH 4MMZC 2DBJA 3KPQB 5ADPL 4NQXB 4UU9B 3O6KH 4AT6B 2VLMD 4JREB 4JFOB 1IJ9A 2XTJB 4UIKH 4OF0A 4ZUSB 1YEFL 4YXKL 1IEAA 4NQDA 5E99H 1T6WA 1GYAA 1V7ML 1FLRH 5E99L 4R6UA 1SM3L 2VDNH 3MRBA 2R23A 4N1CA 2AXGA 4E41A 4EDWL 1EO8L 4LIQE 5IQ7H 2X4QA 3L3KA 5H2BB 4U6XA 4C4KO 4FQQB 3GM8A 1N5AA 2M2DA 1XIWA 1GC1C 1F90L 3GSUB 3P4MB 4U1MA 1QBLL 3B9VA 3GSQB 4Z78A 4ZFFB 3QUYA 1WBZB 1MFEL 1G7QA 1QSFD 3BHBA 3RNQB 4M5ZH 3O4LB 4OF7A 3JWOL 5TDPA 2LQRA 3L5XL 5CEZL 1N26A 4NO0A 2BVOB 2A6JB 4HZLB 4QRSA 3RVTD 4OGAD 4D9QD 3FQWA 4UNTA 1HOCB 2IGFH 2R0KH 3O3AA 4JFHE 2CD0A 4UV7H 1ZWIA 4H25B 3KHQA 3QEQA 4H8WH 5H35B 2JLLA 4MHHG 4QHNB 3BT2H 1ULVA 5LGJB 1MWAB 3HE6C 3NCEB 4HK3N 5KZCB 4WVRA 1W8OA 2F53E 3OKDB 3DIFB 1A22B 4F8TA 1J0JA 1XZ0B 4WCYL 5CHNA 3WXWL 3AXLB 5HYJA 2ED9A 2GSIB 4M6ML 3GMMB 3M07A 1KB5H 3PGDB 5EBMA 3TNMA 5HYQB 3MNZB 1RJZB 3G08B 3LMJH 5D7JC 5MEOA 1RVFL 4QRRE 1PEWA 4PJEA 4BKLA 2R0ZH 1WFUA 3I3DA 4J4PC 4Q9RL 2HJKA 3MLUH 4ZUVA 4WEBL 1MNUL 2R0ZL 2I27N 1CICB 3MLUL 5FHAL 3OB0H 4FN0A 2GK0A 4WY7H 1OTTD 2VLME 2QV2A 1TNMA 4OZFH 2APFA 2E27H 2FL5A 4I1NB 2W1NA 3BUTA 4K55A 3OR7A 4GW1A 1S9YB 3HB3C 3PHOB 1U3HA 4PJCA 2DQCH 3CFJB 1FNGB 4MHHI 2X4SB 3ZE0E 3VFUA 3V2AR 3GO1L 1J88A 3GZKA 5DD1H 4Q97A 4GG6B 4XVTH 4DFIA 5IF0A 3MNVB 3U79A 5IGXL 4KFZC 2X4NA 1ORQB 2EC8A 4GMTH 2CK0L 2FD6L 5CLWA 5JR1H 2BY0A 1E4KA 4XNQA 1MRDH 1JVKA 2ADIB 4N68A 4C58B 1UKQA 4MA1C 3RY4A 3L3DA 3VFTA 4XNXH 1C5BH 1GOGA 2VNCA 4HS6A 3VFVA 4UQ3B 4D9QE 2Q6WA 4YK4B 3U83A 1AKJD 4Z0BH 5DJ8B 2FATH 4MWFA 4NZDA 5I1IL 3JTSB 1IBGH 3QDMB 4PLJD 4PV8B 4UT6H 1VKXB 3O0RL 4RRPA 2ITDB 5L9DL 5DJYB 3Q3GA 4KHTH 4ELMA 3TN0B 2EO1A 3MGAA 3ESVF 4LK4A 4F57H 1SJXA 3S7GA 2BVUA 4B41A 2YMXH 1CIDA 1OLLA 3Q6FB 3SCMD 4P2OC 1HK6A 4YE4L 4KV5E 5CGTA 1DFBL 5BV7B 2VISB 3AU1A 4NN5C 1ZVSA 2YWYA 3QEUA 4M5YL 5EZOH 4PJDA 4XC3L 3TEUA 1YQVL 3AAZB 3OG4B 5CJBA 3ULUH 1CL7L 1FIGH 3V0WL 4G6KL 4JRXA 4Q6IA 4K3DL 2IPTH 4GBXC 3RPKA 3PQYD 1NKOA 5C70A 1BBJA 4R96A 3ZSSA 4J3TA 2Z4QB 2HKHH 2ID5A 4YZFF 4G5ZL 2IF7A 5IVXE 1ZHLA 4R2GC 2VDPL 4XCEA 2ESVD 1EMTL 3U4EB 1BAFL 4GXUN 5IK3A 3RP1A 4GQ9L 5F1NB 1CFBA 2CIIB 2XZQH 5KVGL 2UWEB 3MV9B 3WIFA 1YN6A 2ICWA 2VDOL 1S9WA 15C8L 4P9MH 5DF0A 4K94L 4ZXBD 2PNDA 1HXMA 43CAB 3IETA 4NM4H 5JO5A 3JV0A 2BY3A 4OD2A 5D2NE 5KS9B 3EFDH 3D69A 1NGXA 4OLWL 1DE4A 2V5MA 5GJTL 2C1PA 1XEDA 1PJ9A 2M8XA 2PO6D 4NZTL 1QBMH 4RDQG 4UT9H 4NYLA 1A3LL 2BERA 1W72A 5E00A 3MCKB 4JY5L 2H2PC 2OSLB 2GT9A 1QSEB 4Z7VA 1WEJL 4ENEC 4KVNL 2YKLL 4OCWH 3QUZB 2MWCA 1SY6A 1YMMD 5TE6H 4CAGA 5E2UL 2BY2A 4I2XA 4YHOH 5HGHA 2BNRA 2FH6A 2NX5B 1TCMA 1H5BC 3VJ6A 3OHXA 5B3JF 3TFKC 5BOZG 3FMGL 3VDBA 3F7VB 1FZMB 4DN3H 1CFVL 2BNUB 4GW5B 3HE7C 4UB0L 4MMXC 3P4OB 2DRUA 1HEZB 5GRVL 3W0WE 1J0ZA 3BXNB 1L9MA 3WNOA 1KPUA 2FGWH 3GRWL 2FX8L 4OF5A 3SDCD 1I1YA 3GKZA 4YHZH 2JB6A 4FABH 1IZKA 2FGWL 1NFDE 2V9RA 3PQYE 3TM6A 5DC4B 2YHGA 4PFEA 4F15B 2X4RA 3RPIB 1MHPL 1EXUB 1JMXA 2Y23A 2JKXA 3O2DL 1HQ4A 4X7DC 4QRTA 1KCKA 1YJDH 1QR4A 4LF3A 4JFED 4LEXL 1NEZB 3MRJB 4TULH 4Y1AA 3WIIH 4JFXA 3O3DA 4TTGA 3SGJC 3X3GL 12E8H 3MRNB 4MNGE 4PGEB 2ESVE 3FO2A 1UWEH 3V0VB 3RVXD 2NY0B 2UZYB 2UVEA 4JFDA 4PJGE 4U0RC 4UV4H 4R97C 4BQBA 2PTUA 1CLOL 1EHAA 2AJUL 4IRSD 3VI4E 4BSVA 2F74B 1A6WH 3KPMB 3OGCB 4Y5XA 2G5BA 1ZTXH 5GGVL 5DQDL 2AABH 3DRQA 1QR1B 4YDVB 3CFBB 4GKSA 2W59A 5GGTL 4H20L 4ODWA 4TQEL 2DM2A 3NCJH 2IBGA 2OS7A 4OZ4B 5C7XH 3QR2A 4OZGF 2B1AH 3S4SB 1HILA 1OAKH 5H8DA 4R7DA 2FX7H 2C1OB 2DAVA 2V17H 2V7HA 3T0VA 1NUNB 3WSQL 3EOAB 4XCFL 4ZMAT 3O4OB 3LZFL 2MKWA 3MBEB 3QQ9C 3U4AA 4RQQA 1YMME 1OQXA 3QXWA 1D9KD 4ZSOE 4X5WB 5D7JA 5EO1B 2Q3ZA 1CFSA 2X41A 4MLIA 5BVJB 4S1QL 4ISVB 4J4PA 4NIKB 1KC5H 1RUKH 1UH4A 4S11A 2V5RA 1S7UA 5INDA 3RWEB 1YY9D 2V7NB 4X6DF 1FVCA 1EHNA 4OCLC 1ZS8A 2RJMA 1T5XA 4MCZA 2ATPA 4P46D 3IF1A 1XAUA 4UZGA 3D0VA 3ES6A 3S96B 1Q1JH 5DHVH 1EFXA 1S7RB 4RFOH 2R4RH 4GSDH 3TZVB 2BCKB 4W68A 3MUZ1 5FUZH 3SY0B 3LY6A 4Q74A 4RAVA 4LARH 4GXVH 2WIMA 3WXVL 3SKMB 2Y6SC 2CKBH 4JFEE 4KJYA 3NIDE 5A2LH 5BVPL 4XAWL 1PSKH 3FB7A 2VL5A 3GIVA 1GZQA 4NZRH 3BDBA 1X5JA 5I16A 5LXGH 4EEEA 1MJUH 4QYOB 5DLMH 3S88H 4QHKI 1CGUA 2FB4H 2Q8BL 4OGYL 5ITFB 1CDHA 5DLML 1U8JA 3WKNA 2HLAA 4P99A 4XPHL 3U0WH 4PGBA 5HHOB 3QULB 5HPMB 3VWJA 1AGDB 5TDNB 3K74B 4JPVH 3PIQA 1T20B 4MVBC 1OPGL 4DQOL 2OJZL 1U8IB 4L4TA 4OM1L 1YC8A 1OAZH 2HVJA 3B9KD 1YEDA 3QG6B 4XPBH 5TF0A 3B83A 2XKSA 2BDNH 4RAUA 5C6TH 4P2OA 3G5YB 1LD9B 4YHNB 1OAXL 1PD6A 3CPLA 4O2FA 5DJ6A 4U1HB 1A5FH 2VXUH 3HKFA 5DXWA 1DP0A 4PP1D 4KK8D 2WLZA 4FXGA 1A5FL 2NY6C 3E2HB 3T1WA 2GCYB 1U91A 2FX9H 1GGYA 4DVBA 1DEDA 2C4FU 1PFCA 3GSWA 4JHWL 4P2RA 3T2PA 5L2KA 2XN9A 1VCAA 3MA9H 3HR5A 1DVFB 1W0VB 3ILQD 5GZOC 3UCRA 3RWIB 3ZKXB 3HI1B 3FTGA 4Z7UE 4MA8H 3QNZA 2HVKB 1NPUA 4YNYA 4JLRB 1NBVL 4PPTA 2X9XA 3SDDD 5LAXA 2QHRL 5AEAA 1K2DB 4NQEA 2H8PB 2EDNA 3PWVA 3SHSA 2IANA 1YNTB 4HG4J 3W5NA 1RZ7L 3MRIA 5KSVA 1VACB 3JV5A 5EU4A 2BRQA 5GGUB 4HJGB 4EI5C 2COQA 3V6OC 1MJJB 1S78C 1A1OB 4Z7WA 5DZLA 3ME0A 5L88H 3PABB 3QUKA 5DRWA 1Y6KR 5F9JA 2DKSA 3WLBA 3HCVB 5D1QB 3KYKL 2EYTB 2H2SC 5I0DA 4F9LC 4IIQA 3PGFH 4CBPA 3RGVD 2P8MB 4DN4H 1KEML 4I48B 4NC0B 5I17A 4K7PL 3RVTC 3TH4T 2HH0L 3LHPL 3UJJL 3MLZH 1QD0A 5E2VL 3V8CA 1OARL 1HINL 4TSAL 4MA7L 3T3MF 2AK1H 4QOKA 4LQ1A 1H5BA 5KSBA 3ARGB 4N0FA 3T4AB 1X5LA 5CIPB 2AGJH 4BH7B 5MEQA 1AXIB 3HE7A 5JXED 4POUB 4D8PB 4JHZA 3O2VL 3U9PL 3CX5K 2IPUG 1IGJB 3V95A 1RIUH 5AAWA 2DKMA 2Z35B 3TBTB 1MHHA 3B9EA 5DJCA 4LPYA 5IB2A 3RY5A 5ACMA 2IADB 3FFCD 4LL9A 4XP4H 1IAOA 4D94A 4WI6A 4M62L 3SGJA 2C3GA 1G0XA 1PW3A 1HNFA 1NAMA 3TCLA 3BYTA 1RUPL 4GOSA 4OCRL 4U1IA 4JQIH 1PKOA 3WNMA 3ZKMD 5C9JB 3PP3K 1G7HB 4KKBC 3MLPA 5EU7C 1JGEB 2I9TB 4WI2A 4KDWA 4ZO7A 1RUAL 4PRIA 3KPOA 1NKRA 4ZQKA 2KZ1B 1HH9B 1GAFH 1RZFH 1KELH 1XGYH 1AQKL 1T6VN 1W8NA 4F3FA 2APBA 4MJ6B 4HIJB 1XGYL 4XVSH 1IAKA 5ITBL 5D2NC 3KLAB 4PJBA 1TTFA 5IBTH 3DV4B 1HQRB 4NM8L 4CVUA 3BWAB 3QCTH 4JDTH 4FQPA 2OP4L 4QGTA 4JPIB 3FT2A 2V5TA 5I1EL 5JIHA 4TSBH 2BHUA 4M7LH 4DUVA 2YPLA 5IT2H 1J8HB 1ZVYA 3DXAD 4WWKD 3RL2B 2I60L 4XAKD 3UAJD 4AG4H 5JLZB 4OFDA 1DQMH 4ONGL 3TWCH 4BQ8A 2P45B 2H9GB 1XGTB 3C9NB 5B39A 3HLAB 1NBYA 3MFGB 2AXHA 4KROB 1FYTA 3QJHA 3ULUC 2MOVA 1IC7L 4JAMB 2HLFD 3QWQB 4NKOA 3RWJA 2IMMA 4C83A 3MO1A 3N0PB 4F2MB 1CFNB 3MGTB 4OCMC 1DQQB 2VSDA 5K9QG 5IHUH 1ND0A 2EECA 3QZWG 1JWUA 5IB3A 2ZWLT 2BSTA 2D03H 4N1EA 5CP7B 3FFCE 3P73B 4KRPB 3U0TA 5ENWA 3BGFB 4M4PA 1P4IH 1RURL 1DLFH 2G2RB 3EJZD 3RNKA 5HI4C 2WIIA 1DBBH 1G6RH 2A9NH 1R24A 3BDXA 4K7FA 4QEGA 2Z8RA 3HZMA 2R29L 4NRXB 3DYPA 3WLWC 2DIBA 3QXDB 2E9IA 1I3GL 1A9EB 1P7KA 4LKXA 1NBZA 1E4JA 5FKAB 3VD9A 3MRPB 1CZ8H 5T1LD 2Y72A 2HKFH 3TO4D 1FFPB 1ONQA 1FPTH 5JORB 4ZXBC 1T0MA 2ITCA 2DJ4A 2CGRH 2A6DA 5AD0B 5BW7A 4QRRB 3T2OA 1VB9A 2P8LA 4U6YB 2VDQL 5I19H 3E3QE 5GGSA 1IM9A 1U92A 2PO6C 3NZHH 5K9QI 1Y6NR 3HAEH 3D85D 3UTZA 1L7IL 2HFGL 3PXHA 4JM2F 3UC0H 4GAGH 2XQYG 1UB5A 4Y4KD 3DXAE 4D9RD 3N85H 2AJXH 4LCWA 4XAKE 3RWFB 1KV3A 2RCSH 3N85L 1L0QA 2NY5L 4U6VH 1QVOB 4LLVB 2FEDD 1NCDH 2VXTL 2BMKB 5DRNA 3HZKB 3O3EB 5IROC 4LSPL 3DUHA 1IRAY 3FONA 4MXQD 3I3BA 1ZA3B 3ARRA 4JFDE 4XI5C 4YWGL 4EN3B 1MHEA 1UWGH 4FQXA 1U8LA 2A73B 2HJLB 2YS4A 2ZSWA 1U8PA 3HMWL 4KTYA 3H7BB 1LEGA 3SDCC 1XR9B 3LVEA 4MDIB 4ZUTB 4Y16D 1FL6A 1VGKB 5AYQA 5HHNB 5F97E 5DI8A 4I13B 5FM5M 2BC4A 5MI0C 3VRLF 5KN5A 5HHVH 4IMKC 4HS3B 4MSWB 4UTAH 5IW6A 2Z31D 3EUUA 1P4LB 4EI5A 3V6OA 1CCZA 2VLLB 3SE4C 2DWEA 3RVVD 4FFVC 4TUKL 5CZXC 3CFCH 2B0SL 1SJHA 1KLGA 1ZHNB 3WUWA 1RZ8B 2DQFA 2EEAA 3CSYA 3H0TA 2EDJA 4F9LA 1GOHA 1U8KB 4MXVF 4OIIL 4JDZA 2P5ED 5JUEL 5C0NC 3MLYH 4PJ8D 4ZFOA 1U3ZA 1M71B 1EV2E 2DQTL 5FKPA 5J8OA 1YYML 5B8CC 3EHBD 3CU7A 4LVHC 3GB7A 4PJ5B 4P4KD 4X6EB 1P9MC 3OZ9H 3DPBA 3S37H 2YEZB 2W0KA 2AXFB 2CDEB 2EDLA 4RFEA 3QDHA 3BH9A 5CEYA 5JDSB 4X7TB 2WUBL 1N2RA 1IKFH 1KB5A 1WF5A 1MAKA 2NNAA 1NFKA 5BMFL 4NC1C 4MJID 5FGSA 4OLUH 2MHAB 4D9RE 1AXTL 3QEHB 2MPAL 3T65A 1CD1B 5BZWB 4APQD 3BPNC 4ONFH 5F7EH 4YAQA 3NFNB 1HIMH 2LE9A 3BN9C 1QLRB 1K8IA 1DUZA 2JJSC 3VFRA 3PV6B 1B0RB 3CVHH 4NPYB 4ODXA 1S7TA 4HCRL 4N8PA 4OZFA 4BK4A 2YUZA 5HVHB 4LHUG 4I3RL 4JO1H 4Y2DC 3K3QA 1JRHI 5D1ZD 2R2EA 1TETL 2VDLL 4P46C 2JCCF 5IESL 3FHQA 5BS0A 5I1DB 4XMLL 1LEKA 4NQCB 4WO4C 3QEGH 4RMVA 3L6FB 3ARPA 3TBWA 3G5ZA 4OB5H 3Q5OA 4F7TA 4G3YL 3TBYB 2UZIL 2XWTB 1J1XH 4L9DA 5GS0L 4NO2B 4XNZB 1OSZA 3C08H 5J06A 4QRPB 3IDJA 3FT3B 5DO2C 2VE6A 3H6JA 2EEBA 3STBA 1KTLB 2HJFA 4L29A 3VXQA 5A2JH 4AENB 3LKQA 2H26A 5E1AA 1K5NA 2FBJH 1RZJH 1FN4B 3OQ3B 4HHAB 4LLMB 3CAFA 4OUOA 2EH7L 1DQLL 1F6FB 3WEXA 5K9JL 5GS1B 3EOTH 3DOSA 2Z0BA 4O58H 4PRBB 4HIEA 2P5EE 3NACL 1DL7L 4Z76B 3W0WB 2Q7YA 3FB8A 4OI8A 5I1CL 1XGRA 1RI8A 1CQKA 2H3NB 5I73C 4PGCB 1BLNB 3SKJL 4CMHB 2EYRA 3O6FC 2PYEA 1CT8B 1MCLA 4OIBA 4NOFA 3EKCA 5D2LA 1TLKA 3WN5C 2ADJA 4HUVA 2ED8A 5BRZB 1YNKL 1EVTC 3P9LA 4MJIE 3S97C 4M3JA 4ZD3L 3HNVH 5FCUL 1PQZA 4MNHB 2EDBA 1V7NL 4IS6B 3RL1A 2IANE 1R3HB 5C0DB 3QCUL 4MNGB 2GFBA 4ODVL 4EDXB 2ESVB 4NZUH 3GI8L 3MREA 4PGJA 2V5SA 5IMMB 4PJGB 3REWB 2X4PA 5DHYA 1LHZA 1GGIL 4G9FE 5C0CD 4F7PB 3DO7B 5SV3A 2BRRL 3H9HB 3QWOB 3P0YH 3LKSA 4MXWL 1XF5B 2Q86B 4OQTL 1LNUB 4JGUA 2W0PA 3QIWD 1JNNL 4YC2C 1U3JA 3C6SA 3RAJH 2APTA 3U4BL 5IR1A 5BCAA 3F12B 2DQEL 1WLHA 3QXTA 1K3ZA 3MODH 2YRZA 1BQHB 3S3PA 2ZUWA 5TPWH 5TDOA 5ESQA 5ESAB 5MERA 1YNLL 4L3CA 4DUXA 3CXHK 4F9PA 2JIXA 4ZAKC 2CIKA 4EOWH 4PY8I 1TJGL 4MB4A 2DTSA 4XCCH 1RFDH 3A6BL 5JOFB 2IALA 4D0DA 3P4NB 2VR5A 3EDFA 1G6VK 3GMRA 5CSZB 4BZYA 4YHLL 1ZLSH 5C1MB 2LV4A 2VN4A 3RQ3A 5FM8A 2A83A 5D9SA 1RV6X 1PKQE 3NCFB 4HUWB 4G6JL 2VXQL 4YEEA 5CS7A 1CVSC 3FB6B 1D5XB 5ISZB 1E28B 4C57C 3O9WC 2GTZB 3EZ8A 4KKCD 1J1OL 1W2KT 1F4XL 5E8OA 5IROA 4P0DA 5FV2A 3IDUA 4N8VG 5JXEC 4YHPA 3FO1A 5I1JH 3IYLW 2PF6A 5I8EB 3BJ91 9CGTA 1J8KA 1MWAL 5F9WB 3MYJB 4NWUL 4WUKL 1JNHB 5C0CE 1OAQH 2XKNB 4V2CB 4GRWH 3FFDB 5BZDB 3PHQA 3TA3C 1A0QL 4JZJB 1RU9H 4IMLB 4EXKA 1RMFL 4N0YL 1JYNA 3O8XA 5TJWK 3GSNB 4X8JB 4HUUA 5EOCH 3UDWC 4IMKA 4WU7A 4HIIB 4WDIA 2P5WB 1RZKC 2APVA 3C5ZC 4NWTL 1Q9WA 3SE4A 4WV1C 2YPLE 3BEVA 4LHUD 3FQXA 5FYJD 3SE9L 4DZ8A 4BJLA 5DHXB 1MRFL 1NCWL 3ROLA 3GIZH 2O5YL 3ZKMC 3WKMH 1IEAB 4P3DA 5ALBH 1UJ3C 1WWCA 4Y8AA 2NY2B 4Z0XA 1BIHA 2J8UA 5HDOA 3MRBB 3ZTJH 2R23B 4E41B 2AXGB 1KJ2A 3QHZH 5GHWL 4B7IA 1MI5A 4U6XB 1MCEA 5E9DD 2DDQL 4LQFH 4PJIF 2R4SH 1KN2L 3QHFH 3TT3H 3JVGC 4Z78B 1GJIA 3C5JB 1I7TA 5F21B 4LLWA 5LCVH 4P5TC 2QQKH 3E3QC 1NUDA 3BKML 4K7PX 1G7QB 2MQCA 3BHBB 3PWJA 1DBMH 4JPWH 3EOBB 3H8NA 2DLFL 1CL7I 4X6CF 4TSCL 4PJXF 5TDPB 4WTZA 5CJ8A 5F7DA 5J0BA 4QRSB 4HWBH 3UAJC 4NHUA 5I0ZA 4CJ0A 3MJ7B 5DK2A 2FHCA 2JJSA 3O3AB 3FAXA 1ZWIB 3ZKSD 3C60C 3QEQB 2ZUTA 3MOBL 5CEZD 2HT2C 4N0CD 1EJOL 4NJ9H 4UILH 5C8JA 5EUOF 5DHVA 4Y2DA 1CU4L 3VH8A 3THMH 4JFFA 5CHNB 4KY1L 5HYJB 1F58L 1KCSL 2C26A 5EBMB 4DTGL 2AV7A 2DBLL 3TNMB 4BH8B 3V4PL 4HX1A 3TT1H 4WO4A 2CKBA 3ZYIA 1GCFA 4TOYH 5MEOB 2CRMA 4PJEB 1R3JA 1A6AB 3B9DA 3GKWH 4KUZH 3EDDA 3GSRB 4BKLB 5BV7L 4S1SL 4TVPH 3CX5J 4ZUVB 1GGCH 2F15A 4KU1A 4JRYA 2GK0B 1SJEA 2GHWB 4XNMA 5FYJE 2VLKA 2Z92A 3B9KB 2A6IB 2FL5B 3MRCA 5GJSH 3NZ8A 3OR7B 4O51A 4GW1B 5ESVA 1U3HB 4J23A 4JB9L 4PJCB 2E7BA 1JFQL 4DKAA 4AQOA 2X9YA 2V5YA 3VFUB 4W81A 4YZFE 2WNGA 1KJ3H 4XBGB 3QO0B 5IF0B 1T1ZA 3O6FA 1KTKE 3AS2A 2PXYD 4FFZH 4X5LA 4FTVD 2X4NB 4GW4A 3ZT6A 3UZVB 1WK0A 5ADOL 4HJ0C 3UJIH 4KTDH 4XNQB 1JHKH 3LKPB 3MCG1 3UYPA 3ARWA 4HGKC 1KTDB 1AC6A 2AI0H 2WWMD 3VFTB 2ORBL 4ZS6C 4JM4H 1I9RL 4HS6B 2B4CH 5EA0H 3H9SA 3CMOL 4MWFB 4RNRA 4CVZA 4GAJH 5E94A 3ILPA 2QSVA 5LGHH 5C0RH 1SYSB 5CEZE 4ELMB 1I1CA 3MA7A 5I1KH 1MCPL 1F8TH 1BF2A 2NY1D 1JPTL 1MCRA 4CL7A 1KFAL 4NKDA 1NMAL 2OYPA 2R1YA 3ZLQC 4WI8A 3M8OH 2AQ1A 3AMLA 3QQ3A 2X2YA 1ZVSB 3A0OA 3QEUB 4JG1H 3S5LA 4PJDB 5MP6L 5B3JE 5LJYH 4Y16C 4N0RA 4CU6A 4YDJA 5D6DA 3HS0A 3QPXH 4QGYA 1AIFA 4QWWD 4JRXB 4L1HA 4Q6IB 3BW9B 5AYUL 3T08A 1FO0B 5IEKA 3KPPA 1P7QA 1BBJB 4GH7B 4R96B 1BFVL 1IC4H 4W6WB 2NCMA 1MREL 1H15A 1N8ZA 5F89A 4JFPA 5ACZA 4ZAKA 3GMOA 2R1XA 3VFWA 4ODHL 4XCEB 4LCUA 3DETD 2HTKD 5IOPA 2B8OT 3BE1H 3MROA 4EXPX 4NNYA 2OK0H 1YEIH 3RZCD 5IK3B 1X6NA 3AS3A 2BNQA 1VERA 1AXSA 5GRUH 5KBNC 3RA7H 2SEBB 1QLFA 3WIFB 1YN6B 2ICWB 1S9WB 2EXYD 1PAMA 4NJAL 5FM5O 3CZFB 1LGVA 1HXMB 2OR8A 3IETB 3O9WA 4GG6F 3LDBC 4LPTA 4EJ1C 3QFJD 4TRPL 5F9OH 4O9HH 3D69B 1NGXB 1DE4B 4YHKL 2C1PB 4P23D 3MYZA 4Y5VC 1JPST 4UTBL 5ETUA 1KXTB 2R2BB 3VXRD 4DWHA 2BJML 4NYLB 2GI7A 1B4RA 4HLZH 1W72B 4EIZC 4PG2C 4APQC 1HZHH 2GT9B 3OF6D 3K46A 4Z7VB 5FUOH 1HZHL 3CLEL 3RX7A 2DLTA 5F3HA 5EOQH 2DQIH 1RQ5A 2RAMA 4OZGE 4I2XB 5HGHB 3TA3A 2BNRB 4DCQA 2X70A 4Q9QH 3VJ6B 2W0FA 3OHXB 2NZ9C 1GHFH 4H1LH 3UROR 1MVFA 1CF8L 4HQQL 5TE7H 3UDWA 2O26U 5EZIH 5JIIA 1GHFL 1M7DA 3AVEA 3C5ZA 2W38A 4S1DD 4WU5A 4PR5B 1OLZA 4WV1A 2DD8H 3P77A 4XWOD 5F7KC 4WIQA 3QIUC 3L5JA 1S3KH 2JB6B 4M8QA 5INCA 1I9EA 4JANA 1R6VA 5LGKA 3GMQB 2NY3C 3GNMH 1UJ3A 4Y19D 4X6DE 5T5FH 2X4RB 2C3HA 5JXAL 1RZJC 3QFDA 3T4YA 1HQ4B 4WWKB 4QRTB 1S7QA 3GK8H 1L0YA 2HWZL 3LB6C 5HYSG 4LSRL 4Y1AB 4JFXB 5KVFL 3O3DB 2V2XA 2K7QA 3H3KA 4G80A 4WHTA 4NFBA 1JGVL 1X7QA 1DJSA 4EBQL 3GMLA 4P5TA 3WFEH 4JFDB 3RTQC 2WINA 4JPKH 5CJOL 2NTFA 3MUY1 4FQLL 4BSVB 2J8HA 1A7PL 4X6FA 1QZ1A 4LGRB 4Y5XB 3N9GH 4OFYD 3MV7A 2FR4A 5FGRA 3DRQB 4HWZA 4HXAH 3S37X 2UWEF 3CLFL 3QJFA 1PY9A 2GITA 3QFJE 2DICA 4GKSB 4ODWB 3ARYA 3C60A 2WBKA 3VXRE 1ZEAL 4PY7A 1IEHA 1T21A 1HILB 4WHYH 4R7DB 4HWEH 5IFHL 4S2SA 4KQ4H 1JN6A 3EO1B 4NHCL 3OSKA 4M02A 4G7YH 3ROOB 4RQQB 1GXEA 1MFDL 4ETQB 2W9EL 5D7JB 2QSQA 4XPTL 4BFIB 1NANI 4H26A 3C09C 1N0XL 1G6RA 2ZJSL 4FXKA 4NCDA 3TO4B 4AM0A 1T1WA 2FNBA 5INDB 2LTQC 1S7UB 5F7WC 3SBWC 5B4MD 4WI5A 1FVCB 5DJZB 1ZK9A 2AK4A 1ZS8B 1T5XB 4QTIH 4MCZB 2ATPB 3IF1B 5C6PB 5IVNA 1B90A 4OLZH 2VR9A 3D0VB 5AG8A 4LDEB 3ES6B 5EH1A 5BO1L 3G5XA 3WFBH 1UKSA 2V2TA 3SDXA 4Y19E 3WHE0 4HPYH 4RAVB 1CXIA 1EBPA 4ODTH 3TESA 3T0DA 3BSZH 4WFHE 3BPOC 4HV8A 1CE1L 2BZDA 4ODTL 3W9EA 4KJYB 4AZ8A 4M1GH 3IDXL 2X89A 1RJYA 1NCUA 4XMPL 4KK9D 2VL5B 1MFCH 1LO2H 3GIVB 1GZQB 4JY6A 4I4WA 3HG1D 4HGMA 2HT3C 3QUMB 5I16B 1KN4H 2IFGA 1AHWB 2KBGA 3NFSH 4GS7C 4MQXD 3KPLA 3D39A 1GGBH 3GUTB 1EPFA 4MA1B 5FA4A 3IJYA 1U8JB 4YFEA 2HLAB 1I9JL 1MCIA 1LK3L 1P5VA 3TJEH 5JW5A 1PBYA 2ARJA 3VWJB 3TJEL 4OCSL 3HZYA 4JRWA 1CIUA 4O02H 1ZXQA 2NMSA 1DSFL 4H0GA 1K4DA 3X14A 1GZPB 3BESR 2QKIA 2QADC 1G7MA 2EKSA 1M6OA 4OM0H 2HVJB 4U31A 3ZHDA 5FUCE 1YEDB 3I75A 1WAAA 4TPRL 1MH5B 3MBXH 3KJ6L 2UYLA 3UTSA 3H3PH 3IFLH 4RAUB 3NFPB 4UOW1 5EU5A 2LAAA 4P2OB 2E7CA 3T2NH 3T3ME 1UA6L 2F5BH 3O11A 3CPLB 5DWUL 1E4WL 4O2FB 5DJ6B 2DWDA 4OD3H 4FXGB 4FFWC 1CN4A 3CK0L 5T3ZL 3CXDL 2ZSVB 2H45A 4HF5H 4G6FD 4O2EA 1BBDH 3GSWB 4LVOC 4P2RB 2EIZB 5GRJL 5L2KB 2XN9B 4P4KB 4LU5H 4LSSL 5E2TL 1OGAA 1YUHA 3HR5B 1DANT 1NL0L 4L5FL 3FTGB 3QNZB 3AMKA 1G7IB 1UYWH 1G9ML 1UM6L 1MSPA 5LAXB 1NMBH 1IGYA 4NQEB 4K8RL 4NP4H 2J6EL 2DQJL 1J10A 4NKIL 3PWVB 2IANB 2Y7QA 4HS8H 4H88H 3MRIB 1GH7A 4OLYL 3U7YH 4Z77A 1UACH 2FECL 5L7XL 2D7QA 3HG1E 4Z7WB 4G9FB 5A43C 3KLHD 3QUKB 2NXYC 1FDLH 3PWPD 2R2HA 3U9UA 5F9JB 2AEQH 3AM8C 5HVGB 3WLBB 4Y5VA 1KENH 2EZ0D 4IIQB 1YQ2A 1S7WA 3BKYH 5M94B 2ATKB 1BM3H 4KKAD 4FZEH 1CTNA 4UBDC 4PG2A 2XWBA 4APQA 4X4XA 5I17B 2VAAA 3CVHA 2YPVL 3CDGA 4X0KA 3HAEG 3P11H 1AFVL 1NCTA 4MD5A 2XG4A 3JWOC 4QCIA 4QOKB 2Y07L 5KSBB 2W9DL 2XICA 3QYCA 4NNPL 4N0FB 3INUH 3LH2L 3KPSD 4N0CC 5MEQB 2IFFL 1MRCH 3QI9D 1XGQA 4JM2D 3KGRA 4OFIA 1IQDB 4PLKD 3VGGA 3QQNA 5JMOC 2GUOA 4M93C 3VXPA 5F6HI 3FQRA 3V9FA 2DMCA 4GAFB 3WO4C 2LAGB 5I71C 2OTWB 4C56A 4JG0L 3QIUA 3GJFH 3DBXA 4OTXL 1I1AC 3MZGB 4YLQT 1MHHB 3ZDZF 2NR6C 4JCMA 1ZLVK 4I18C 1B4JL 4MA3A 2NTSP 1ZT7A 4PTUA 1KIUA 4NDMA 4RISL 1GIGL 4PV9A 3BKJL 3WDHA 3TCLB 4NBXB 4U1IB 4IOSD 4IRJD 4KZEL 3RTQA 2VXSH 4R97B 2L7JA 3EYVB 1QYGL 2C3WA 3BAEL 3HNTL 5DR5H 2EE9A 3VXMD 2GYSA 5IFAL 4PRIB 4S1RL 3K8LA 4ZQKB 2XA8H 1ERNA 1CVRA 3OKNA 1LDSA 4J8RA 1NGYA 3PWPE 1A7RL 1IAKB 1S7VA 4PJBB 3Q1SL 1DQJA 5CKGA 4GLRH 3B6SA 1CR9L 1KCUL 3C8KA 4LSUH 3QIWB 1FVDA 5CD3A 3FT2B 1S9XB 1DBJH 4HUNB 3MMEA 2XZCL 3HRZB 2YPLB 3T0XA 2AEIT 3TVMC 5C6WH 1QRND 3PL6D 5HD8D 1R3IL 3A6CH 3SE3C 3VXOA 4M7KL 5AG9A 4GFTB 5D7LD 4O5LL 1C12A 1XGPB 1ZOXA 3KPSE 3OV6A 3MR9A 1FV1A 5CJQL 4ZOCA 5B39B 1BX2B 3SBWA 1NBYB 1LDPL 4ZOAA 1FYTB 3QJHB 3ZDYF 5C08D 3ARED 1Q94A 4TVSa 4L4VD 4RGMC 1CXEA 2OMBA 4NKOB 3RWJB 1QBBA 4X9GA 4C83B 2UZXB 4A6YB 1GSMA 3TNNB 3MLXH 5D72H 5JW4M 3U30C 1NDMA 1JWUB 4KGLA 5IB3B 5CZVL 2BSTB 2HFEA 1T5WA 5ID0A 3IU4L 5CD5C 1PVHA 3U0TB 5I75B 5ENWB 3C87A 4K9EH 3RNKB 1E4XL 2WIIB 4YBLB 3K81A 4KI5C 2AEPH 4K7FB 3HZMB 1F45A 1J5OL 3VRLE 4YR6A 1YDPA 2FO4A 2X4TA 4X5XA 1YEGL 3HHRB 4YFLF 3ZZ1A 3GBLA 4LKXB 1P7KB 3G6DL 4LHJB 1B6DA 3VXME 5J11C 3DARA 4LAJH 2XZZA 1ONQB 4OBSA 3NPZB 4E0RA 4NUGL 3A6OA 2A6DB 2AJSH 3I6KA 3MLWL 4WEUD 1LP9A 4MXVE 2P8LB 4QRUA 4YXHH 1EGJL 4P23C 1A9BA 1BGXL 5GGSB 1IM9B 2VR4A 4U6TA 3U7WL 1N64H 1U92B 4ZS7L 4RZCA 1UB6A 2WBJA 5I1LB 3MV11 1IC5L 3SKUD 1B0GB 5GS3A 1UB5B 3V6ZA 5B38G 4CN4A 5DVLA 4LCWB 1QRNE 4ZNEE 3QDJD 4X99B 2MCPL 4HKJB 1KXQE 5D7LE 4EVNA 2NY6B 3BO8A 5E6IC 3HA0A 4U3XA 5DRNB 3MJ9L 4X6BA 2FO1A 4AMKL 4GUPA 5FEBA 1OTSD 5C08E 5F3BA 3NGBB 4L4VE 4ETYA 1MHEB 4QKXB 4FQXB 4U49A 3SJVD 2ZSWB 1U8PB 2A1WL 1LEGB 4XNUH 1GVIA 2FRGP 3MUHL 5DI8B 5TQ0L 2IH1B 3LKNA 1DBAH 2BC4B 1MY7A 1NFIA 2IAMD 2JCCE 5HDQL 3ULVL 3W11D 2GJ6D 5F93C 3BP4B 4EI5B 3U1SH 1BOYA 5E9DA 1IGIL 1PG7L 1JHLL 1SJHB 1KLGB 2CLRA 2LU7A 3AM8A 5DJ0B 1MJ8L 1VFUA 5SWSD 1NSNH 2DQFB 3WUWB 4HWBA 4XPGH 4JDZB 4ESKA 1JK8A 3H42H 1SBBA 3ECBA 3IAQA 5FKPB 4OGXL 2VLRA 2CMRL 2WMPA 5BOPA 1QFHA 1WJ3A 3GB7B 1XT5A 4OV6F 5IBUB 1BEYH 1PLGH 1WZ1L 1Z0NA 3Q5TA 1LE9A 4OJFH 2XWJA 4RFEB 3BH9B 4Q58C 3UBXA 1V05A 1N2RB 4QHMA 4F37F 1CBVH 1KB5B 2NNAB 4R4FL 3FOMB 4HKZA 3RY6C 5SX4I 2IWGA 2D9CA 1IEBA 4HBQA 3QDJE 2J3SA 4WNQA 4YAQB 4XXDA 2XZAL 5IJVA 5C09D 1AGBA 3OR6A 3C5SA 1QRKA 4YH6A 1I1AA 2D4FA 1F4WH 3IDMA 1YECH 1DUZB 3KXFA 3UTTA 3VFRB 4F7EA 3NABH 1ZT1A 4U7MA 4ODXB 3D2UD 1ZLVH 3AB0C 1S7TB 2HRPL 4I18A 4Z8FL 3R4DA 5J12C 4OZIA 4OZFB 1TZHA 5FF6A 1WC7A 3FO0L 4BYHA 2GAZB 3SJVE 2NW3A 5IV2A 5BS0B 4EUPH 2ZOKA 3BD4A 1KLUA 1LEKB 1DCLA 3ARUA 4Z6AT 1Q72L 2VB5A 3TBWB 1EEZA 3G5ZB 3BZ4A 4F7TB 5EG6C 4OSUL 1JHTB 1QFWM 2XOTA 3KYOA 5DUPH 1OSZB 2GJ6E 1HYRC 2J4WL 3IDJB 4X4ZA 2VE6B 4BQCA 1RSFA 2HJFB 4L29B 3VXQB 4WW1A 1LE5A 3REVA 5KVDH 2H26B 5E1AB 1K5NB 1WWAX 3QAZC 1SQ2N 4OZGB 4P59L 3V52L 5GS0D 1SEBA 4DOHE 5SWSE 1A3RH 2CUIA 5GGRY 3WEXB 2QSCH 4MNQA 2VLJD 3JBG7 4HIEB 4BQ6A 4HLJA 5E1HB 2Q20A 1PZUB 3F58L 1C5CL 2FZ3A 2QQLL 2Q7YB 3FB8B 1XGRB 5I1GL 1CLYL 4LRNH 25C8L 2AJYH 3TVMA 2EYRB 1IARB 1OD7A 2PYEB 4WW2A 3SE3A 3X12A 1AJ7L 4R90L 3B2VH 1TZIB 2ADJB 5DGRA 2AW2A 1NCBH 3ZKND 4HUVB 4X6DB 2IQAA 4MAYC 3P9LB 2B7DT 2CDFA 1A47A 4XXCC 3C6LC 3ZHLA 2Z91A 3D3VA 4AIXA 4L9LC 2ENYA 3RL1B 1JJUA 1G9NH 5C09E 2P24A 2GFBB 4W4OC 3T0WA 3MCLH 1F6AA 1H3GA 2PTTA 5C0JB 4I3SH 4YPGA 5DZNA 3RZCB 3QSKB 1ZVHA 2LVEA 2NXZC 4UINL 2ZPKL 2X4PB 5DHYB 1HWHB 3SDAD 1J9CT 4LMQI 2D7OA 3LKSB 2MQ0A 3OKMB 5H37G 3FN0H 1RUML 2EDOA 4HD9A 4P2QD 2HFFA 3V4UH 3FN0L 2WANA 3C6SB 1NC2D 3EYQD 4DGVH 4WUUD 2DQHL 3GSNL 5IR1B 1X5GA 1MF2L 4AYFA 1J18A 4DGVL 4NQSA 4M48L 3TYGH 1ROWA 3D9AH 2F8XC 3BUYA 2O61A 5IB4B 5TDOB 5ESQB 4E5XA 1UG9A 3B2UD 3ULVF 5MERB 1I3RA 4L3CB 4PJAA 2UV3A 1VDGA 3HPJA 2JELL 5JQ6L 3EYUH 1DQDH 2JIXB 1Y18A 3BOVA 1K6QH 5T3XH 2CIKB 3CVIH 3PG2A 3KLHC 3DMMA 3X3FL 3NTCH 4C56E 2VLJE 4CW1A 2IALB 3KR3L 3T0EC 2XTJD 2A77H 2NY7H 2EZ0C 3GMRB 5GRWA 5I8OH 4XCNA 4YDLC 1DR9A 2QL1A 5KJRL 3WD5L 1LILA 1NGQH 3PXJA 4PJIE 4FA8A 2E5EA 2HMIC 4PTTA 3VA6A 4X4MA 4H1LA 3FQUA 4Y19B 4JZNA 5E6IA 3EJYC 1MAMH 1HWGB 5E8OB 5C0BD 2D7TH 4X6CE 2KQNA 2IH3A 3B3IA 4JO3H 5L6YH 1ACYH 3EW3B 4YHPB 2O5ZH 3FO1B 4XBPA 5FIEA 1MIML 1OHQA 3JUZA 2DLIA 3O4LD 3SGKC 3MRFA 3PDDA 1KCLA 4YJZL 1UM5L 4GKNA 3IDYB 2WUCL 4V1DA 5JHDA 3FQTA 1L4IA 1EO5A 1DANU 1IAIH 4L8DA 2FLRT 5EUOE 2K7PA 1FH5H 4HIXH 3ZE2F 1KEGL 5DUBA 4LGSB 5F6IB 4U3CA 4PJGF 1BIIA 2GK2A 3GRWA 1IQWL 3O8XB 2XQBH 3BIKA 5ID1A 1I7UA 2DQUH 1Q9KA 3P2TA 4HUUB 5KZCD 4P2QE 4WU7B 4WDIB 2E7LC 4DGIL 4WUUE 5EIVA 5IVOA 1VESA 5AZ2L 2ZKHL 3BEVB 3FQXB 4PJ7A 3VFMB 3GEWB 3O2DA 3HC3L 4S10A 4DZ8B 1GGTA 4OZHA 1NLBH 3ROLB 1AY1H 2VQ1B 4KHXL 4XB7A 4P3DB 1LO4H 3HZVA 4LLQB 1NEZG 1F3DH 2IJ0C 4OI7A 2UUDH 4Z0XB 1INEH 3ARBC 1WIOA