2DLQA

Solution structure of the tandem four zf-c2h2 domain repeats of murine gli-kruppel family member hkr3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
124
Chain Sequence
GSSGSSGVECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRLHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the tandem four zf-C2H2 domain repeats of murine GLI-Kruppel family member HKR3
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords GLI-Kruppel family member HKR3
total genus 25
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA02
2BB8A 2EM7A 1A1KA 2DRPA 3MHHC 2RSIA 2LV2A 2ENHA 4R2PA 2EM9A 1B69A 2GLIA 2MKDA 1F2IG 4R2DA 2EOMA 1MEYC 1RMDA 2YTNA 1G2FC 3EPLA 1KJKA 2LVHA 2EE8A 2R1FA 2ELZA 2WBTA 2YU8A 2EOQA 2EOZA 1X6EA 2M9AA 4FK5C 4IS1C 1BBOA 2EM6A 2EN6A 2EOSA 2EL5A 2EL6A 1YUJA 2EL4A 2EMKA 2EN2A 2EMIA 2EN7A 5KL2A 2WBSA 4R2AA 2LT7A 4F6MA 2YTGA 2EQ0A 2EPZA 1AAYA 2ADRA 1X6FA 3M99B 1A1LA 2EN1A 1A1GA 2EM8A 2DLKA 2E72A 2EMAA 2YSOA 2EMHA 2D9HA 1ZU1A 4F2JC 2EP3A 1P47A 1G2DC 2EM4A 2EPCA 1UN6B 4R2CA 1X6HA 2YRHA 1BB8A 2EJ4A 1X5WA 1A1IA 2DGCA 2EMZA 4X9JA 3VHTB 1X3CA 2ENAA 2EPAA 1A1FA 2EOIA 2EPXA 2EM2A 2YU5A 2NABA 2ENCA 2YTDA 2EOEA 2EQ3A 4M9VC 2YTPA 4R2RA 3MHSC 2EM0A 5KL3A 2DMIA 2YTJA 1ZR9A 2LO3A 2MDGA 2EPUA 3EPHA 2EN3A 2YTFA 4R2QA 1A1HA 2MKNA 5KL4A 2EOXA 2A25A 5KL7A 2EMCA 2EMYA 1JK1A 2CT1A 4R2EA 2I13A 2EOOA 2DLQA 2YSPA 2YRKA 4R2SA 3UK3C 2J7JA 2GHFA 2CTDA 3EPJA 2JP9A 2YTIA 2EM3A 3EPKA 5KL6A 2EM5A 1TF3A 1UBDC 2EMFA 2YRMA 2EN8A 2CSHA 2EMBA 2YTEA 1WJPA 2EPRA 2YTQA 2WCC3 4GZNC 1JK2A 2HGHA 2ELYA 2EMLA 4IJDA 1DGCA 1ZAAC 2WBUA 2EOYA 2EMGA 1YSAC 2VRDA 2EORA 2EN4A 1TN9A 5KL5A 2YTOA 1YUIA 2EQ1A 2LCEA 4F6NA 1LLMC 1Z1BA 1TF6A 2EOHA 2JPAA 1A1JA 2RPCA 2EOJA 2EOFA 4WSGA 2EMWA 2EMXA 1NCSA 2PRTA 2EPPA
chains in the Genus database with same CATH superfamily
4GKKE 3THOB 4B3RE 2RSIA 2LV2A 2LE2A 2EM9A 4R2DA 1FJGE 1YYOA 1MEYC 2LMZA 2YTNA 4F9CB 1BBGA 2ELZA 1X6EA 4FK5C 3T1HE 2L2NA 5A6BA 2EL6A 5DNYA 4BC9A 2EL4A 4O24A 2EMKA 1AH5A 2N3GA 5KL2A 3OTOE 4WSPA 2EPZA 4JI0E 1AAYA 3JU0A 2FV4B 3F6GA 2D9HA 2IHR1 5FLXC 1P47A 1G2DC 5A2QC 4LF4E 2EPCA 1MGTA 1X5WA 2DGCA 1T4NA 4J8ZA 1J26A 2V87A 2HC5A 1X3CA 2EOIA 2NUEA 3QG5C 3MHSC 2VQFE 2DMIA 3HTXA 2N3HA 1T39A 2L2MA 4LFAE 1L4SA 2EN3A 2MDRA 3BF2A 4X8WA 1YZ9A 3K6QA 2EMYA 4LF6E 4DV4E 4M30A 2EOOA 2DLQA 2YSPA 4TUIA 2J7JA 3UK3C 2V8QB 2JOBA 1UILA 4F9BB 2EM5A 3EQ1A 5AC5A 2RS7A 1TF3A 3EPKA 2CSHA 2YTEA 2JWOA 2YTQA 4HTGA 2RSMA 4LU9A 2YZTA 4DUZE 4IJDA 4JI8E 1DGCA 4DV1E 1HNXE 2EOYA 2EMGA 1YSAC 2L2KB 5A6BD 2EPKX 5KL5A 2YTOA 2HHHE 2EQ1A 2LCEA 2V88A 2F4VE 2UUCE 1UHZA 1A1JA 4DR7E 2UU9E 3IWBA 5T6JA 3ADIA 4JYAE 2EOJA 1X47A 2EMXA 2EPAA 4YY3E 2BB8A 3H09A 4LFBE 2GPIA 2EM7A 1GZ6A 5AASA 3J7Yp 4RHBB 2ENHA 5AC4A 2JOXA 4BHBA 3DF6A 2K4VA 2L3JA 2L8TA 1RMDA 1IBME 2KONA 1HR0E 5LMNE 1G2FC 2UXCE 2F8BA 1T4OA 2EOZA 2EM6A 2LUQA 2EL5A 4DR3E 4JI6E 2EPLX 2EMIA 3OMLA 2WBSA 3J81C 4F6MA 3TQMA 4DV0E 1A1LA 1ZBTA 3C4BA 2EM8A 2DLKA 2E72A 2EMHA 1ZU1A 2RS6A 3ECRA 1N3GA 4JI5E 4MLQA 2EM4A 4LTYA 1WXRA 1UN6B 2YRHA 2EJ4A 4F54A 1XNQE 3J7AG 4I8OA 2R76A 1EKZA 4YHHE 2YTDA 2LBSB 4KZSA 2JR1A 4NHRA 4DR6E 1IBKE 4L8NA 1N32E 2FTXB 1EH7A 4LF8E 2EPUA 4R2QA 5KL4A 1KYQA 2A25A 4DKKA 3THNA 2VQEE 2E1MA 2EMCA 1NEIA 4R2EA 5LMUE 4KWYA 4R2SA 2MC5A 2CTDA 5A6KA 3VYYA 4Q28A 2LTRA 5ADZA 1EH8A 5KL6A 4LF9E 2HGHA 2WCC3 3HQ1A 1WJPA 2EMLA 1ZAAC 4F9AB 3ZOQB 3LLHA 2JVAA 2VRDA 4BBYA 2EORA 4P7DA 3C6KA 2V83A 1LLMC 1QNTA 2DMYA 2EOHA 2EZ6A 2Q8UA 2B7VA 1T38A 4OOGC 2EOFA 4R03A 3KWRA 2PRTA 4X66E 3VK6A 2DRPA 4ZYHA 2LRSA 3FIGA 2GLIA 4ZYDA 1F2IG 5IV8B 2EOMA 1N33E 4LF5E 3EPLA 4NZVA 1KJKA 2LVHA 2FGGA 2E5LE 2EE8A 2WBTA 4JI3E 2YU8A 2EOQA 3RMPA 2EN6A 4L5NC 2RQLA 1YYWA 2H36X 5F3WA 2EN7A 4GKJE 1X49A 4M0VA 4WYQB 5AE1A 2YPNA 4R2AA 1WRJA 2YTGA 4P78A 3HPZA 3ADLA 4JI1E 1RC7A 4X64E 2ADRA 4N4RB 2V89A 2EN1A 1WHQA 2LTSA 2EMAA 2YSOA 1ZBQA 2LUPB 1PJTA 2K7IA 2EP3A 3BGHA 4DR2E 1N36E 1SFEA 1HNWE 4LF7E 5CFFE 1IMUA 1YPNA 4R2CA 1X6HA 1PKPA 1QU6A 4JI2E 1IQOA 1HNZE 2EMZA 2UUAE 4X9JA 4WX9A 3VHTB 1J5EE 1A1FA 3L00A 5IXMB 4DV6E 3KZZA 4M2ZA 2EOEA 3J80C 4M9VC 2YTPA 2B7TA 4R2RA 5LL6R 4BCAA 5IWAE 5TSEA 5KL3A 2DIXA 2YTJA 2EPOA 3VYXA 2LJHA 5IT9C 4JI4E 4AQYE 4GEQB 2MDGA 4X62E 2ZM6E 2NUFA 1EH6A 1X48A 2DB2A 2MKNA 2EOXA 2L6MA 2VF1A 3JAMC 1YYKA 4BHCA 2CT1A 4DUYE 4B3ME 3C6MA 4K0KE 4WXCA 4KHPE 2GHFA 2NA2A 2L92A 2KHXA 1PDAA 2EM3A 1RQ0A 3BBGA 4NXNE 4RH8A 1STUA 4R8OA 1GQEA 2YRMA 1DQ3A 2EMFA 2EN8A 4GZNC 2WZOA 1JK2A 2B3TB 4NXME 1N34E 4O5GA 2EN4A 4OX9E 4F6NA 2VE7C 1Z1BA 4DR1E 1DI2A 3HPSA 2JPAA 2V85A 2G7HA 4JV5E 4WSGA 4X65E 2EMWA 3BIDA 1A1KA 3AV0A 3ADJA 2ODRC 2HJJA 3IWDA 3AUZA 3MHHC 1WHNA 4WFTA 4R2PA 4DR5E 1B69A 2MKDA 3MSWA 1SR9A 1XMOE 2R1FA 4LFCE 2BBGA 2M9AA 4IS1C 5AE3A 1BBOA 2EOSA 2RTXA 2UXBE 3KZYA 4Q35B 1GTKA 1YUJA 2M7QA 2M4IA 3F6HA 2EN2A 1IBLE 3JTZA 2ODRD 1YFHA 1O0WA 4BMJA 2LT7A 3ADGA 1T4LB 2EQ0A 1XMQE 4JI7E 2V86A 4DV5E 2CPNA 2MC6A 1X6FA 4TUGA 3M99B 4ZYEA 2EWLA 5A6JA 1A1GA 2UUBE 4F2JC 1XNRE 3LMLA 2N8XA 4DV7E 2KOUA 4BS9A 1BB8A 1A1IA 5AE2A 2ENAA 4BC7A 3P1XA 2EPXA 4HEIA 2EM2A 2YU5A 2NABA 2ENCA 2EQ3A 2B9DA 3DJWA 4DR4E 5BR8E 4B3SE 2EM0A 2DSYA 2NUGA 1ZR9A 1PJQA 1I94E 2L3CA 1PJSA 4MLVA 2UXDE 2LO3A 4WXDA 3EPHA 2YTFA 1A1HA 3IWCA 5A6AA 5KL7A 1JK1A 4O4KA 2I13A 2YRKA 2JYAA 2YWQA 3EPJA 2I9IA 5LLQA 2JP9A 4O43A 2YTIA 4DMIA 4DV2E 1IQSA 2M1SA 1UBDC 4DV3E 2EMBA 3T1YE 2EPRA 2ELYA 5A69A 2L33A 2WBUA 1TN9A 2JXPA 1YUIA 1TF6A 2EPMX 2LJUA 3C4TA 2JY9A 2RPCA 4ZYGA 2EPNA 2YT4A 1FKAE 4WPYA 3HXLA 1NCSA 2EPPA 4B3TE
chains in the Genus database with same CATH topology
2BB8A 2EM7A 1A1KA 2DRPA 3MHHC 2RSIA 2LV2A 2ENHA 4R2PA 2EM9A 1B69A 2GLIA 2MKDA 1F2IG 4R2DA 2EOMA 1MEYC 1RMDA 2YTNA 1G2FC 3EPLA 1KJKA 2LVHA 2EE8A 2R1FA 2ELZA 2WBTA 2YU8A 2EOQA 2EOZA 1X6EA 2M9AA 4FK5C 4IS1C 1BBOA 2EM6A 2EN6A 2EOSA 2EL5A 2EL6A 1YUJA 2EL4A 2EMKA 2EN2A 2EMIA 2EN7A 5KL2A 2WBSA 4R2AA 2LT7A 4F6MA 2YTGA 2EQ0A 2EPZA 1AAYA 2ADRA 1X6FA 3M99B 1A1LA 2EN1A 1A1GA 2EM8A 2DLKA 2E72A 2EMAA 2YSOA 2EMHA 2D9HA 1ZU1A 4F2JC 2EP3A 1P47A 1G2DC 2EM4A 2EPCA 1UN6B 4R2CA 1X6HA 2YRHA 1BB8A 2EJ4A 1X5WA 1A1IA 2DGCA 2EMZA 4X9JA 3VHTB 1X3CA 2ENAA 2EPAA 1A1FA 2EOIA 2EPXA 2EM2A 2YU5A 2NABA 2ENCA 2YTDA 2EOEA 2EQ3A 4M9VC 2YTPA 4R2RA 3MHSC 2EM0A 5KL3A 2DMIA 2YTJA 1ZR9A 2LO3A 2MDGA 2EPUA 3EPHA 2EN3A 2YTFA 4R2QA 1A1HA 2MKNA 5KL4A 2EOXA 2A25A 5KL7A 2EMCA 2EMYA 1JK1A 2CT1A 4R2EA 2I13A 2EOOA 2DLQA 2YSPA 2YRKA 4R2SA 3UK3C 2J7JA 2GHFA 2CTDA 3EPJA 2JP9A 2YTIA 2EM3A 3EPKA 5KL6A 2EM5A 1TF3A 1UBDC 2EMFA 2YRMA 2EN8A 2CSHA 2EMBA 2YTEA 1WJPA 2EPRA 2YTQA 2WCC3 4GZNC 1JK2A 2HGHA 2ELYA 2EMLA 4IJDA 1DGCA 1ZAAC 2WBUA 2EOYA 2EMGA 1YSAC 2VRDA 2EORA 2EN4A 1TN9A 5KL5A 2YTOA 1YUIA 2EQ1A 2LCEA 4F6NA 1LLMC 1Z1BA 1TF6A 2EOHA 2JPAA 1A1JA 2RPCA 2EOJA 2EOFA 4WSGA 2EMWA 2EMXA 1NCSA 2PRTA 2EPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BB8 A;  2EM7 A;  1A1K A;  2DRP A;  3MHH C;  2RSI A;  2LV2 A;  2ENH A;  4R2P A;  2EM9 A;  1B69 A;  2GLI A;  2MKD A;  1F2I G;  4R2D A;  2EOM A;  1MEY C;  1RMD A;  2YTN A;  1G2F C;  3EPL A;  1KJK A;  2LVH A;  2EE8 A;  2R1F A;  2ELZ A;  2WBT A;  2YU8 A;  2EOQ A;  2EOZ A;  1X6E A;  2M9A A;  4FK5 C;  4IS1 C;  1BBO A;  2EM6 A;  2EN6 A;  2EOS A;  2EL5 A;  2EL6 A;  1YUJ A;  2EL4 A;  2EMK A;  2EN2 A;  2EMI A;  2EN7 A;  5KL2 A;  2WBS A;  4R2A A;  2LT7 A;  4F6M A;  2YTG A;  2EQ0 A;  2EPZ A;  1AAY A;  2ADR A;  1X6F A;  3M99 B;  1A1L A;  2EN1 A;  1A1G A;  2EM8 A;  2DLK A;  2E72 A;  2EMA A;  2YSO A;  2EMH A;  2D9H A;  1ZU1 A;  4F2J C;  2EP3 A;  1P47 A;  1G2D C;  2EM4 A;  2EPC A;  1UN6 B;  4R2C A;  1X6H A;  2YRH A;  1BB8 A;  2EJ4 A;  1X5W A;  1A1I A;  2DGC A;  2EMZ A;  4X9J A;  3VHT B;  1X3C A;  2ENA A;  2EPA A;  1A1F A;  2EOI A;  2EPX A;  2EM2 A;  2YU5 A;  2NAB A;  2ENC A;  2YTD A;  2EOE A;  2EQ3 A;  4M9V C;  2YTP A;  4R2R A;  3MHS C;  2EM0 A;  5KL3 A;  2DMI A;  2YTJ A;  1ZR9 A;  2LO3 A;  2MDG A;  2EPU A;  3EPH A;  2EN3 A;  2YTF A;  4R2Q A;  1A1H A;  2MKN A;  5KL4 A;  2EOX A;  2A25 A;  5KL7 A;  2EMC A;  2EMY A;  1JK1 A;  2CT1 A;  4R2E A;  2I13 A;  2EOO A;  2DLQ A;  2YSP A;  2YRK A;  4R2S A;  3UK3 C;  2J7J A;  2GHF A;  2CTD A;  3EPJ A;  2JP9 A;  2YTI A;  2EM3 A;  3EPK A;  5KL6 A;  2EM5 A;  1TF3 A;  1UBD C;  2EMF A;  2YRM A;  2EN8 A;  2CSH A;  2EMB A;  2YTE A;  1WJP A;  2EPR A;  2YTQ A;  2WCC 3;  4GZN C;  1JK2 A;  2HGH A;  2ELY A;  2EML A;  4IJD A;  1DGC A;  1ZAA C;  2WBU A;  2EOY A;  2EMG A;  1YSA C;  2VRD A;  2EOR A;  2EN4 A;  1TN9 A;  5KL5 A;  2YTO A;  1YUI A;  2EQ1 A;  2LCE A;  4F6N A;  1LLM C;  1Z1B A;  1TF6 A;  2EOH A;  2JPA A;  1A1J A;  2RPC A;  2EOJ A;  2EOF A;  4WSG A;  2EMW A;  2EMX A;  1NCS A;  2PRT A;  2EPP A; 
#chains in the Genus database with same CATH topology
 4GKK E;  3THO B;  4B3R E;  2RSI A;  2LV2 A;  2LE2 A;  2EM9 A;  4R2D A;  1FJG E;  1YYO A;  1MEY C;  2LMZ A;  2YTN A;  4F9C B;  1BBG A;  2ELZ A;  1X6E A;  4FK5 C;  3T1H E;  2L2N A;  5A6B A;  2EL6 A;  5DNY A;  4BC9 A;  2EL4 A;  4O24 A;  2EMK A;  1AH5 A;  2N3G A;  5KL2 A;  3OTO E;  4WSP A;  2EPZ A;  4JI0 E;  1AAY A;  3JU0 A;  2FV4 B;  3F6G A;  2D9H A;  2IHR 1;  5FLX C;  1P47 A;  1G2D C;  5A2Q C;  4LF4 E;  2EPC A;  1MGT A;  1X5W A;  2DGC A;  1T4N A;  4J8Z A;  1J26 A;  2V87 A;  2HC5 A;  1X3C A;  2EOI A;  2NUE A;  3QG5 C;  3MHS C;  2VQF E;  2DMI A;  3HTX A;  2N3H A;  1T39 A;  2L2M A;  4LFA E;  1L4S A;  2EN3 A;  2MDR A;  3BF2 A;  4X8W A;  1YZ9 A;  3K6Q A;  2EMY A;  4LF6 E;  4DV4 E;  4M30 A;  2EOO A;  2DLQ A;  2YSP A;  4TUI A;  2J7J A;  3UK3 C;  2V8Q B;  2JOB A;  1UIL A;  4F9B B;  2EM5 A;  3EQ1 A;  5AC5 A;  2RS7 A;  1TF3 A;  3EPK A;  2CSH A;  2YTE A;  2JWO A;  2YTQ A;  4HTG A;  2RSM A;  4LU9 A;  2YZT A;  4DUZ E;  4IJD A;  4JI8 E;  1DGC A;  4DV1 E;  1HNX E;  2EOY A;  2EMG A;  1YSA C;  2L2K B;  5A6B D;  2EPK X;  5KL5 A;  2YTO A;  2HHH E;  2EQ1 A;  2LCE A;  2V88 A;  2F4V E;  2UUC E;  1UHZ A;  1A1J A;  4DR7 E;  2UU9 E;  3IWB A;  5T6J A;  3ADI A;  4JYA E;  2EOJ A;  1X47 A;  2EMX A;  2EPA A;  4YY3 E;  2BB8 A;  3H09 A;  4LFB E;  2GPI A;  2EM7 A;  1GZ6 A;  5AAS A;  3J7Y p;  4RHB B;  2ENH A;  5AC4 A;  2JOX A;  4BHB A;  3DF6 A;  2K4V A;  2L3J A;  2L8T A;  1RMD A;  1IBM E;  2KON A;  1HR0 E;  5LMN E;  1G2F C;  2UXC E;  2F8B A;  1T4O A;  2EOZ A;  2EM6 A;  2LUQ A;  2EL5 A;  4DR3 E;  4JI6 E;  2EPL X;  2EMI A;  3OML A;  2WBS A;  3J81 C;  4F6M A;  3TQM A;  4DV0 E;  1A1L A;  1ZBT A;  3C4B A;  2EM8 A;  2DLK A;  2E72 A;  2EMH A;  1ZU1 A;  2RS6 A;  3ECR A;  1N3G A;  4JI5 E;  4MLQ A;  2EM4 A;  4LTY A;  1WXR A;  1UN6 B;  2YRH A;  2EJ4 A;  4F54 A;  1XNQ E;  3J7A G;  4I8O A;  2R76 A;  1EKZ A;  4YHH E;  2YTD A;  2LBS B;  4KZS A;  2JR1 A;  4NHR A;  4DR6 E;  1IBK E;  4L8N A;  1N32 E;  2FTX B;  1EH7 A;  4LF8 E;  2EPU A;  4R2Q A;  5KL4 A;  1KYQ A;  2A25 A;  4DKK A;  3THN A;  2VQE E;  2E1M A;  2EMC A;  1NEI A;  4R2E A;  5LMU E;  4KWY A;  4R2S A;  2MC5 A;  2CTD A;  5A6K A;  3VYY A;  4Q28 A;  2LTR A;  5ADZ A;  1EH8 A;  5KL6 A;  4LF9 E;  2HGH A;  2WCC 3;  3HQ1 A;  1WJP A;  2EML A;  1ZAA C;  4F9A B;  3ZOQ B;  3LLH A;  2JVA A;  2VRD A;  4BBY A;  2EOR A;  4P7D A;  3C6K A;  2V83 A;  1LLM C;  1QNT A;  2DMY A;  2EOH A;  2EZ6 A;  2Q8U A;  2B7V A;  1T38 A;  4OOG C;  2EOF A;  4R03 A;  3KWR A;  2PRT A;  4X66 E;  3VK6 A;  2DRP A;  4ZYH A;  2LRS A;  3FIG A;  2GLI A;  4ZYD A;  1F2I G;  5IV8 B;  2EOM A;  1N33 E;  4LF5 E;  3EPL A;  4NZV A;  1KJK A;  2LVH A;  2FGG A;  2E5L E;  2EE8 A;  2WBT A;  4JI3 E;  2YU8 A;  2EOQ A;  3RMP A;  2EN6 A;  4L5N C;  2RQL A;  1YYW A;  2H36 X;  5F3W A;  2EN7 A;  4GKJ E;  1X49 A;  4M0V A;  4WYQ B;  5AE1 A;  2YPN A;  4R2A A;  1WRJ A;  2YTG A;  4P78 A;  3HPZ A;  3ADL A;  4JI1 E;  1RC7 A;  4X64 E;  2ADR A;  4N4R B;  2V89 A;  2EN1 A;  1WHQ A;  2LTS A;  2EMA A;  2YSO A;  1ZBQ A;  2LUP B;  1PJT A;  2K7I A;  2EP3 A;  3BGH A;  4DR2 E;  1N36 E;  1SFE A;  1HNW E;  4LF7 E;  5CFF E;  1IMU A;  1YPN A;  4R2C A;  1X6H A;  1PKP A;  1QU6 A;  4JI2 E;  1IQO A;  1HNZ E;  2EMZ A;  2UUA E;  4X9J A;  4WX9 A;  3VHT B;  1J5E E;  1A1F A;  3L00 A;  5IXM B;  4DV6 E;  3KZZ A;  4M2Z A;  2EOE A;  3J80 C;  4M9V C;  2YTP A;  2B7T A;  4R2R A;  5LL6 R;  4BCA A;  5IWA E;  5TSE A;  5KL3 A;  2DIX A;  2YTJ A;  2EPO A;  3VYX A;  2LJH A;  5IT9 C;  4JI4 E;  4AQY E;  4GEQ B;  2MDG A;  4X62 E;  2ZM6 E;  2NUF A;  1EH6 A;  1X48 A;  2DB2 A;  2MKN A;  2EOX A;  2L6M A;  2VF1 A;  3JAM C;  1YYK A;  4BHC A;  2CT1 A;  4DUY E;  4B3M E;  3C6M A;  4K0K E;  4WXC A;  4KHP E;  2GHF A;  2NA2 A;  2L92 A;  2KHX A;  1PDA A;  2EM3 A;  1RQ0 A;  3BBG A;  4NXN E;  4RH8 A;  1STU A;  4R8O A;  1GQE A;  2YRM A;  1DQ3 A;  2EMF A;  2EN8 A;  4GZN C;  2WZO A;  1JK2 A;  2B3T B;  4NXM E;  1N34 E;  4O5G A;  2EN4 A;  4OX9 E;  4F6N A;  2VE7 C;  1Z1B A;  4DR1 E;  1DI2 A;  3HPS A;  2JPA A;  2V85 A;  2G7H A;  4JV5 E;  4WSG A;  4X65 E;  2EMW A;  3BID A;  1A1K A;  3AV0 A;  3ADJ A;  2ODR C;  2HJJ A;  3IWD A;  3AUZ A;  3MHH C;  1WHN A;  4WFT A;  4R2P A;  4DR5 E;  1B69 A;  2MKD A;  3MSW A;  1SR9 A;  1XMO E;  2R1F A;  4LFC E;  2BBG A;  2M9A A;  4IS1 C;  5AE3 A;  1BBO A;  2EOS A;  2RTX A;  2UXB E;  3KZY A;  4Q35 B;  1GTK A;  1YUJ A;  2M7Q A;  2M4I A;  3F6H A;  2EN2 A;  1IBL E;  3JTZ A;  2ODR D;  1YFH A;  1O0W A;  4BMJ A;  2LT7 A;  3ADG A;  1T4L B;  2EQ0 A;  1XMQ E;  4JI7 E;  2V86 A;  4DV5 E;  2CPN A;  2MC6 A;  1X6F A;  4TUG A;  3M99 B;  4ZYE A;  2EWL A;  5A6J A;  1A1G A;  2UUB E;  4F2J C;  1XNR E;  3LML A;  2N8X A;  4DV7 E;  2KOU A;  4BS9 A;  1BB8 A;  1A1I A;  5AE2 A;  2ENA A;  4BC7 A;  3P1X A;  2EPX A;  4HEI A;  2EM2 A;  2YU5 A;  2NAB A;  2ENC A;  2EQ3 A;  2B9D A;  3DJW A;  4DR4 E;  5BR8 E;  4B3S E;  2EM0 A;  2DSY A;  2NUG A;  1ZR9 A;  1PJQ A;  1I94 E;  2L3C A;  1PJS A;  4MLV A;  2UXD E;  2LO3 A;  4WXD A;  3EPH A;  2YTF A;  1A1H A;  3IWC A;  5A6A A;  5KL7 A;  1JK1 A;  4O4K A;  2I13 A;  2YRK A;  2JYA A;  2YWQ A;  3EPJ A;  2I9I A;  5LLQ A;  2JP9 A;  4O43 A;  2YTI A;  4DMI A;  4DV2 E;  1IQS A;  2M1S A;  1UBD C;  4DV3 E;  2EMB A;  3T1Y E;  2EPR A;  2ELY A;  5A69 A;  2L33 A;  2WBU A;  1TN9 A;  2JXP A;  1YUI A;  1TF6 A;  2EPM X;  2LJU A;  3C4T A;  2JY9 A;  2RPC A;  4ZYG A;  2EPN A;  2YT4 A;  1FKA E;  4WPY A;  3HXL A;  1NCS A;  2EPP A;  4B3T E; 
#chains in the Genus database with same CATH homology
 2BB8 A;  2EM7 A;  1A1K A;  2DRP A;  3MHH C;  2RSI A;  2LV2 A;  2ENH A;  4R2P A;  2EM9 A;  1B69 A;  2GLI A;  2MKD A;  1F2I G;  4R2D A;  2EOM A;  1MEY C;  1RMD A;  2YTN A;  1G2F C;  3EPL A;  1KJK A;  2LVH A;  2EE8 A;  2R1F A;  2ELZ A;  2WBT A;  2YU8 A;  2EOQ A;  2EOZ A;  1X6E A;  2M9A A;  4FK5 C;  4IS1 C;  1BBO A;  2EM6 A;  2EN6 A;  2EOS A;  2EL5 A;  2EL6 A;  1YUJ A;  2EL4 A;  2EMK A;  2EN2 A;  2EMI A;  2EN7 A;  5KL2 A;  2WBS A;  4R2A A;  2LT7 A;  4F6M A;  2YTG A;  2EQ0 A;  2EPZ A;  1AAY A;  2ADR A;  1X6F A;  3M99 B;  1A1L A;  2EN1 A;  1A1G A;  2EM8 A;  2DLK A;  2E72 A;  2EMA A;  2YSO A;  2EMH A;  2D9H A;  1ZU1 A;  4F2J C;  2EP3 A;  1P47 A;  1G2D C;  2EM4 A;  2EPC A;  1UN6 B;  4R2C A;  1X6H A;  2YRH A;  1BB8 A;  2EJ4 A;  1X5W A;  1A1I A;  2DGC A;  2EMZ A;  4X9J A;  3VHT B;  1X3C A;  2ENA A;  2EPA A;  1A1F A;  2EOI A;  2EPX A;  2EM2 A;  2YU5 A;  2NAB A;  2ENC A;  2YTD A;  2EOE A;  2EQ3 A;  4M9V C;  2YTP A;  4R2R A;  3MHS C;  2EM0 A;  5KL3 A;  2DMI A;  2YTJ A;  1ZR9 A;  2LO3 A;  2MDG A;  2EPU A;  3EPH A;  2EN3 A;  2YTF A;  4R2Q A;  1A1H A;  2MKN A;  5KL4 A;  2EOX A;  2A25 A;  5KL7 A;  2EMC A;  2EMY A;  1JK1 A;  2CT1 A;  4R2E A;  2I13 A;  2EOO A;  2DLQ A;  2YSP A;  2YRK A;  4R2S A;  3UK3 C;  2J7J A;  2GHF A;  2CTD A;  3EPJ A;  2JP9 A;  2YTI A;  2EM3 A;  3EPK A;  5KL6 A;  2EM5 A;  1TF3 A;  1UBD C;  2EMF A;  2YRM A;  2EN8 A;  2CSH A;  2EMB A;  2YTE A;  1WJP A;  2EPR A;  2YTQ A;  2WCC 3;  4GZN C;  1JK2 A;  2HGH A;  2ELY A;  2EML A;  4IJD A;  1DGC A;  1ZAA C;  2WBU A;  2EOY A;  2EMG A;  1YSA C;  2VRD A;  2EOR A;  2EN4 A;  1TN9 A;  5KL5 A;  2YTO A;  1YUI A;  2EQ1 A;  2LCE A;  4F6N A;  1LLM C;  1Z1B A;  1TF6 A;  2EOH A;  2JPA A;  1A1J A;  2RPC A;  2EOJ A;  2EOF A;  4WSG A;  2EMW A;  2EMX A;  1NCS A;  2PRT A;  2EPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...