2DLQA

Solution structure of the tandem four zf-c2h2 domain repeats of murine gli-kruppel family member hkr3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
124
Chain Sequence
b'GSSGSSGVECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRLHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLI-Kruppel family member HKR3
publication title Solution structure of the tandem four zf-C2H2 domain repeats of murine GLI-Kruppel family member HKR3
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 25
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA02
2EM4A 2GHFA 3UK3C 2EOQA 1G2DC 2GLIA 2DLQA 1NCSA 2EOIA 2EPCA 2MDGA 2YTPA 2YRMA 5KL5A 1X5WA 2EM7A 1X6FA 2JPAA 2M9AA 2LVHA 2EM9A 2HGHA 4R2QA 3EPJA 4GZNC 2YTIA 2EOZA 2YTGA 2YTOA 2WCC3 2ENHA 5KL2A 1BBOA 2R1FA 2EN8A 2EOOA 2EMHA 2A25A 4R2AA 2PRTA 1F2IG 4R2CA 2EOJA 1MEYC 2EM5A 2EM3A 3EPKA 2BB8A 4R2DA 2EMFA 2YTNA 5KL4A 2DRPA 2EORA 3EPHA 2EMLA 2EL4A 2YTJA 1YUJA 1ZU1A 2EMZA 2WBUA 2YU8A 1UBDC 2YRKA 2JP9A 2YRHA 2VRDA 1DGCA 2EL6A 2EM2A 1B69A 2EPAA 2ENAA 2WBTA 2YSOA 2EOEA 1P47A 4M9VC 2LT7A 2EPXA 2EM6A 4R2EA 2EN2A 1ZAAC 1UN6B 3EPLA 3VHTB 2EMKA 4R2PA 3MHHC 1A1GA 2EMYA 1Z1BA 2EOHA 2EOXA 2EPRA 1TF3A 5KL3A 2EOSA 2ADRA 2YU5A 1JK2A 2WBSA 1AAYA 2EMGA 4FK5C 2EMIA 2CTDA 2LO3A 2MKNA 2EM0A 2EMXA 4IJDA 2EL5A 2EOYA 1X6HA 4F6NA 2RSIA 1A1JA 2MKDA 4X9JA 2LCEA 1LLMC 2EM8A 1YUIA 2YTQA 2EQ1A 2YTEA 1X6EA 2J7JA 2DLKA 2EN4A 2EN7A 2EOFA 2DGCA 2EJ4A 5KL6A 2ENCA 1A1HA 1WJPA 4F2JC 1A1LA 2YSPA 2EPUA 2EN1A 1A1FA 1KJKA 2ELZA 2EE8A 2EMWA 1BB8A 4WSGA 2EP3A 2LV2A 4IS1C 2EMCA 1RMDA 4R2SA 2I13A 2EPPA 2EPZA 1A1KA 2CT1A 2EN3A 1TN9A 1YSAC 2EN6A 1JK1A 2D9HA 2EMBA 2NABA 2EQ3A 4F6MA 2ELYA 1A1IA 2EMAA 4R2RA 2YTFA 2CSHA 1TF6A 1X3CA 2RPCA 3M99B 1G2FC 2YTDA 3MHSC 2DMIA 2EOMA 1ZR9A 2EQ0A 2E72A 5KL7A
chains in the Genus database with same CATH superfamily
3UK3C 3DJWA 2DLQA 2EOIA 2LTSA 2NUFA 2CPNA 4DV1E 2EM9A 2HGHA 4DMIA 4R2QA 1WRJA 4KHPE 5AASA 1BBOA 4N4RB 2NUEA 2EMHA 2B9DA 4R2AA 4BC7A 4R2CA 2NA2A 2BB8A 1XNRE 2YPNA 1X49A 5KL4A 3EPHA 2EMLA 1HNXE 2N3HA 2WBUA 4DUZE 3FIGA 2YRHA 5A6KA 2VRDA 1DGCA 2V88A 5BR8E 4RH8A 3C4BA 4WXCA 2WBTA 1IQSA 2VF1A 2UXBE 1T38A 1X48A 1P47A 1PKPA 4GEQB 2FV4B 5AC5A 2DB2A 3MHHC 2YZTA 2H36X 3J7Yp 2YU5A 2KOUA 2L2KB 4JI5E 1PJQA 2EMGA 4B3SE 2G7HA 1PDAA 2L6MA 2N8XA 2UUAE 2EM0A 4JYAE 2V85A 1GZ6A 2RSIA 2EWLA 2LCEA 4X65E 2UUCE 3IWBA 1YYWA 2EQ1A 2YTEA 2LBSB 2EN4A 3EQ1A 2EOFA 1T4LB 2ODRD 2DGCA 3DF6A 2DIXA 3ADGA 5A6AA 5LMUE 1WJPA 2EPUA 4M2ZA 5A69A 4DR4E 1PJTA 1XMOE 2EE8A 3HQ1A 1UHZA 2LMZA 1BB8A 2LE2A 4O4KA 2K4VA 4KWYA 4OOGC 1N34E 4X8WA 1QU6A 4DV6E 2CT1A 2EN3A 2HJJA 1JK1A 4LF7E 2NABA 2EQ3A 1A1IA 2YTFA 4KZSA 4WXDA 2L2MA 1QNTA 3TQMA 2BBGA 4MLVA 1HNZE 2EPMX 2EOQA 4NZVA 4LFAE 1MGTA 2GLIA 2JVAA 5AE1A 2EPCA 2YTPA 1X6FA 4JI7E 4JI6E 5IT9C 4GZNC 5A6JA 4JI3E 2EN8A 2A25A 2PRTA 1F2IG 2EOJA 2EM3A 1WHQA 2B7VA 2YT4A 5IV8B 2B7TA 4Q35B 2YTNA 2DRPA 3C6KA 4DR1E 2DSYA 1YUJA 3F6HA 2EZ6A 2B3TB 4BS9A 2ZM6E 2EL6A 2EPKX 1ZBTA 1N36E 1B69A 2EPAA 4MLQA 1SR9A 5AE3A 2MC5A 2RS6A 4JV5E 2R76A 3ADIA 2YWQA 5LMNE 2EM6A 4R2EA 4LF5E 1ZAAC 2IHR1 3C4TA 2E5LE 2K7IA 5CFFE 4JI4E 2EMKA 1A1GA 1FKAE 2UXDE 1Z1BA 4WSPA 2EPLX 1TF3A 2EOSA 1JK2A 5A6BD 4RHBB 1YFHA 2EMXA 2UUBE 3T1HE 2EOYA 2VE7C 4F6NA 3L00A 4X66E 4X9JA 2FGGA 1YUIA 4L8NA 1X6EA 2J7JA 2EN7A 4YY3E 5TSEA 2I9IA 3P1XA 5KL6A 4JI1E 4GKJE 2WZOA 1A1LA 2YSPA 2HC5A 2VQFE 5IWAE 2F4VE 2ELZA 2JOXA 5AE2A 2EP3A 2LV2A 5LL6R 2F8BA 1GTKA 2RS7A 4R2SA 2I13A 2EPZA 4BHBA 2JYAA 4J8ZA 4LF8E 4LU9A 3HPZA 1YSAC 4DV3E 2EMBA 4GKKE 4F6MA 2ELYA 2LUQA 3BIDA 2JOBA 1TF6A 1X3CA 3BGHA 3K6QA 4M0VA 2EQ0A 1ZU1A 2WCC3 2UXCE 2GHFA 3HPSA 4WPYA 3H09A 1NCSA 2MDGA 4LFBE 4WFTA 1X5WA 2EM7A 2JPAA 2M9AA 2JWOA 2LVHA 1XMQE 3C6MA 5IXMB 2JY9A 2FTXB 4DKKA 3LLHA 3LMLA 4F9BB 3EPJA 3MSWA 2YTIA 2EOZA 2YTOA 4ZYHA 5KL2A 2R1FA 3T1YE 2EM5A 3VYXA 1WXRA 2V83A 5A2QC 2V8QB 2EORA 3ZOQB 4ZYDA 2M1SA 5FLXC 4AQYE 2YU8A 1UBDC 2JP9A 1EH6A 2L3CA 1T4OA 4ZYGA 1IBKE 3QG5C 2EM2A 2ENAA 2YSOA 2EOEA 3HTXA 4M9VC 2VQEE 2EPXA 1EKZA 4O43A 3F6GA 1UN6B 2L3JA 4K0KE 3VHTB 4R2PA 2EMYA 1ZBQA 2EOHA 1J26A 4B3ME 2MDRA 2EPRA 4P78A 5KL3A 2ADRA 2WBSA 1AAYA 2LJHA 2CTDA 4TUIA 2MKNA 2JXPA 5T6JA 1DI2A 2LRSA 4Q28A 3THNA 1X6HA 4DV2E 4DR3E 2MKDA 3J7AG 1LLMC 2EM8A 4R8OA 2V89A 3JAMC 4R03A 1YPNA 5F3WA 4NHRA 2L92A 2ENCA 1A1HA 4DR5E 1RC7A 1T39A 2KHXA 2L2NA 3IWDA 4BHCA 3HXLA 2EMWA 4ZYEA 4L5NC 4O5GA 1T4NA 5A6BA 4DV0E 1A1KA 1STUA 2EN6A 1NEIA 5LLQA 3RMPA 2RTXA 3BBGA 4R2RA 2LJUA 4I8OA 4DV5E 4DV7E 1N33E 2CSHA 2LTRA 3M99B 2RPCA 3J80C 3MHSC 2DMIA 4HTGA 2EOMA 2E72A 3AUZA 2E1MA 2EM4A 4LTYA 1IMUA 1G2DC 1N3GA 2YRMA 4BC9A 5KL5A 1DQ3A 2GPIA 2RQLA 1YYKA 4TUGA 4LF6E 4M30A 1IBME 1O0WA 5AC4A 1WHNA 2YTGA 2ENHA 2KONA 2EOOA 1HR0E 2DMYA 1KYQA 2UU9E 3KWRA 1MEYC 1YYOA 3IWCA 3EPKA 4R2DA 3VK6A 2EMFA 4JI0E 1IQOA 2EL4A 2HHHE 4BCAA 4NXNE 2YTJA 2EMZA 1BBGA 2YRKA 1EH7A 2EPNA 4DR7E 1PJSA 2N3GA 3OTOE 4WYQB 4LFCE 1EH8A 4BBYA 4O24A 4BMJA 3THOB 2LT7A 4NXME 4F9CB 4B3TE 2EN2A 1IBLE 3J81C 3BF2A 3VYYA 3EPLA 3ADJA 2EOXA 3KZYA 1YZ9A 4WX9A 3AV0A 3ADLA 4F9AB 2NUGA 1HNWE 1FJGE 4YHHE 2MC6A 4FK5C 4B3RE 4DR6E 1L4SA 2EMIA 2LO3A 3JTZA 3JU0A 4IJDA 1X47A 2EL5A 2Q8UA 2ODRC 3KZZA 4JI8E 4JI2E 1A1JA 1GQEA 2V86A 1RQ0A 2YTQA 4LF9E 2DLKA 1N32E 2V87A 4OX9E 4DV4E 2EJ4A 3ECRA 4LF4E 1SFEA 4F2JC 4HEIA 1UILA 2EN1A 4DR2E 1A1FA 4X62E 1KJKA 2LUPB 2L8TA 1AH5A 2RSMA 4F54A 2JR1A 4WSGA 4DUYE 4IS1C 2EMCA 1RMDA 3OMLA 5ADZA 2EPPA 1I94E 2M4IA 1TN9A 2L33A 2D9HA 1XNQE 1J5EE 2EMAA 4X64E 5DNYA 1G2FC 2YTDA 4P7DA 1ZR9A 2EPOA 5KL7A 2M7QA
chains in the Genus database with same CATH topology
2EM4A 2GHFA 3UK3C 2EOQA 1G2DC 2GLIA 2DLQA 1NCSA 2EOIA 2EPCA 2MDGA 2YTPA 2YRMA 5KL5A 1X5WA 2EM7A 1X6FA 2JPAA 2M9AA 2LVHA 2EM9A 2HGHA 4R2QA 3EPJA 4GZNC 2YTIA 2EOZA 2YTGA 2YTOA 2WCC3 2ENHA 5KL2A 1BBOA 2R1FA 2EN8A 2EOOA 2EMHA 2A25A 4R2AA 2PRTA 1F2IG 4R2CA 2EOJA 1MEYC 2EM5A 2EM3A 3EPKA 2BB8A 4R2DA 2EMFA 2YTNA 5KL4A 2DRPA 2EORA 3EPHA 2EMLA 2EL4A 2YTJA 1YUJA 1ZU1A 2EMZA 2WBUA 2YU8A 1UBDC 2YRKA 2JP9A 2YRHA 2VRDA 1DGCA 2EL6A 2EM2A 1B69A 2EPAA 2ENAA 2WBTA 2YSOA 2EOEA 1P47A 4M9VC 2LT7A 2EPXA 2EM6A 4R2EA 2EN2A 1ZAAC 1UN6B 3EPLA 3VHTB 2EMKA 4R2PA 3MHHC 1A1GA 2EMYA 1Z1BA 2EOHA 2EOXA 2EPRA 1TF3A 5KL3A 2EOSA 2ADRA 2YU5A 1JK2A 2WBSA 1AAYA 2EMGA 4FK5C 2EMIA 2CTDA 2LO3A 2MKNA 2EM0A 2EMXA 4IJDA 2EL5A 2EOYA 1X6HA 4F6NA 2RSIA 1A1JA 2MKDA 4X9JA 2LCEA 1LLMC 2EM8A 1YUIA 2YTQA 2EQ1A 2YTEA 1X6EA 2J7JA 2DLKA 2EN4A 2EN7A 2EOFA 2DGCA 2EJ4A 5KL6A 2ENCA 1A1HA 1WJPA 4F2JC 1A1LA 2YSPA 2EPUA 2EN1A 1A1FA 1KJKA 2ELZA 2EE8A 2EMWA 1BB8A 4WSGA 2EP3A 2LV2A 4IS1C 2EMCA 1RMDA 4R2SA 2I13A 2EPPA 2EPZA 1A1KA 2CT1A 2EN3A 1TN9A 1YSAC 2EN6A 1JK1A 2D9HA 2EMBA 2NABA 2EQ3A 4F6MA 2ELYA 1A1IA 2EMAA 4R2RA 2YTFA 2CSHA 1TF6A 1X3CA 2RPCA 3M99B 1G2FC 2YTDA 3MHSC 2DMIA 2EOMA 1ZR9A 2EQ0A 2E72A 5KL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM4 A;  2GHF A;  3UK3 C;  2EOQ A;  1G2D C;  2GLI A;  2DLQ A;  1NCS A;  2EOI A;  2EPC A;  2MDG A;  2YTP A;  2YRM A;  5KL5 A;  1X5W A;  2EM7 A;  1X6F A;  2JPA A;  2M9A A;  2LVH A;  2EM9 A;  2HGH A;  4R2Q A;  3EPJ A;  4GZN C;  2YTI A;  2EOZ A;  2YTG A;  2YTO A;  2WCC 3;  2ENH A;  5KL2 A;  1BBO A;  2R1F A;  2EN8 A;  2EOO A;  2EMH A;  2A25 A;  4R2A A;  2PRT A;  1F2I G;  4R2C A;  2EOJ A;  1MEY C;  2EM5 A;  2EM3 A;  3EPK A;  2BB8 A;  4R2D A;  2EMF A;  2YTN A;  5KL4 A;  2DRP A;  2EOR A;  3EPH A;  2EML A;  2EL4 A;  2YTJ A;  1YUJ A;  1ZU1 A;  2EMZ A;  2WBU A;  2YU8 A;  1UBD C;  2YRK A;  2JP9 A;  2YRH A;  2VRD A;  1DGC A;  2EL6 A;  2EM2 A;  1B69 A;  2EPA A;  2ENA A;  2WBT A;  2YSO A;  2EOE A;  1P47 A;  4M9V C;  2LT7 A;  2EPX A;  2EM6 A;  4R2E A;  2EN2 A;  1ZAA C;  1UN6 B;  3EPL A;  3VHT B;  2EMK A;  4R2P A;  3MHH C;  1A1G A;  2EMY A;  1Z1B A;  2EOH A;  2EOX A;  2EPR A;  1TF3 A;  5KL3 A;  2EOS A;  2ADR A;  2YU5 A;  1JK2 A;  2WBS A;  1AAY A;  2EMG A;  4FK5 C;  2EMI A;  2CTD A;  2LO3 A;  2MKN A;  2EM0 A;  2EMX A;  4IJD A;  2EL5 A;  2EOY A;  1X6H A;  4F6N A;  2RSI A;  1A1J A;  2MKD A;  4X9J A;  2LCE A;  1LLM C;  2EM8 A;  1YUI A;  2YTQ A;  2EQ1 A;  2YTE A;  1X6E A;  2J7J A;  2DLK A;  2EN4 A;  2EN7 A;  2EOF A;  2DGC A;  2EJ4 A;  5KL6 A;  2ENC A;  1A1H A;  1WJP A;  4F2J C;  1A1L A;  2YSP A;  2EPU A;  2EN1 A;  1A1F A;  1KJK A;  2ELZ A;  2EE8 A;  2EMW A;  1BB8 A;  4WSG A;  2EP3 A;  2LV2 A;  4IS1 C;  2EMC A;  1RMD A;  4R2S A;  2I13 A;  2EPP A;  2EPZ A;  1A1K A;  2CT1 A;  2EN3 A;  1TN9 A;  1YSA C;  2EN6 A;  1JK1 A;  2D9H A;  2EMB A;  2NAB A;  2EQ3 A;  4F6M A;  2ELY A;  1A1I A;  2EMA A;  4R2R A;  2YTF A;  2CSH A;  1TF6 A;  1X3C A;  2RPC A;  3M99 B;  1G2F C;  2YTD A;  3MHS C;  2DMI A;  2EOM A;  1ZR9 A;  2EQ0 A;  2E72 A;  5KL7 A; 
#chains in the Genus database with same CATH topology
 3UK3 C;  3DJW A;  2DLQ A;  2EOI A;  2LTS A;  2NUF A;  2CPN A;  4DV1 E;  2EM9 A;  2HGH A;  4DMI A;  4R2Q A;  1WRJ A;  4KHP E;  5AAS A;  1BBO A;  4N4R B;  2NUE A;  2EMH A;  2B9D A;  4R2A A;  4BC7 A;  4R2C A;  2NA2 A;  2BB8 A;  1XNR E;  2YPN A;  1X49 A;  5KL4 A;  3EPH A;  2EML A;  1HNX E;  2N3H A;  2WBU A;  4DUZ E;  3FIG A;  2YRH A;  5A6K A;  2VRD A;  1DGC A;  2V88 A;  5BR8 E;  4RH8 A;  3C4B A;  4WXC A;  2WBT A;  1IQS A;  2VF1 A;  2UXB E;  1T38 A;  1X48 A;  1P47 A;  1PKP A;  4GEQ B;  2FV4 B;  5AC5 A;  2DB2 A;  3MHH C;  2YZT A;  2H36 X;  3J7Y p;  2YU5 A;  2KOU A;  2L2K B;  4JI5 E;  1PJQ A;  2EMG A;  4B3S E;  2G7H A;  1PDA A;  2L6M A;  2N8X A;  2UUA E;  2EM0 A;  4JYA E;  2V85 A;  1GZ6 A;  2RSI A;  2EWL A;  2LCE A;  4X65 E;  2UUC E;  3IWB A;  1YYW A;  2EQ1 A;  2YTE A;  2LBS B;  2EN4 A;  3EQ1 A;  2EOF A;  1T4L B;  2ODR D;  2DGC A;  3DF6 A;  2DIX A;  3ADG A;  5A6A A;  5LMU E;  1WJP A;  2EPU A;  4M2Z A;  5A69 A;  4DR4 E;  1PJT A;  1XMO E;  2EE8 A;  3HQ1 A;  1UHZ A;  2LMZ A;  1BB8 A;  2LE2 A;  4O4K A;  2K4V A;  4KWY A;  4OOG C;  1N34 E;  4X8W A;  1QU6 A;  4DV6 E;  2CT1 A;  2EN3 A;  2HJJ A;  1JK1 A;  4LF7 E;  2NAB A;  2EQ3 A;  1A1I A;  2YTF A;  4KZS A;  4WXD A;  2L2M A;  1QNT A;  3TQM A;  2BBG A;  4MLV A;  1HNZ E;  2EPM X;  2EOQ A;  4NZV A;  4LFA E;  1MGT A;  2GLI A;  2JVA A;  5AE1 A;  2EPC A;  2YTP A;  1X6F A;  4JI7 E;  4JI6 E;  5IT9 C;  4GZN C;  5A6J A;  4JI3 E;  2EN8 A;  2A25 A;  2PRT A;  1F2I G;  2EOJ A;  2EM3 A;  1WHQ A;  2B7V A;  2YT4 A;  5IV8 B;  2B7T A;  4Q35 B;  2YTN A;  2DRP A;  3C6K A;  4DR1 E;  2DSY A;  1YUJ A;  3F6H A;  2EZ6 A;  2B3T B;  4BS9 A;  2ZM6 E;  2EL6 A;  2EPK X;  1ZBT A;  1N36 E;  1B69 A;  2EPA A;  4MLQ A;  1SR9 A;  5AE3 A;  2MC5 A;  2RS6 A;  4JV5 E;  2R76 A;  3ADI A;  2YWQ A;  5LMN E;  2EM6 A;  4R2E A;  4LF5 E;  1ZAA C;  2IHR 1;  3C4T A;  2E5L E;  2K7I A;  5CFF E;  4JI4 E;  2EMK A;  1A1G A;  1FKA E;  2UXD E;  1Z1B A;  4WSP A;  2EPL X;  1TF3 A;  2EOS A;  1JK2 A;  5A6B D;  4RHB B;  1YFH A;  2EMX A;  2UUB E;  3T1H E;  2EOY A;  2VE7 C;  4F6N A;  3L00 A;  4X66 E;  4X9J A;  2FGG A;  1YUI A;  4L8N A;  1X6E A;  2J7J A;  2EN7 A;  4YY3 E;  5TSE A;  2I9I A;  3P1X A;  5KL6 A;  4JI1 E;  4GKJ E;  2WZO A;  1A1L A;  2YSP A;  2HC5 A;  2VQF E;  5IWA E;  2F4V E;  2ELZ A;  2JOX A;  5AE2 A;  2EP3 A;  2LV2 A;  5LL6 R;  2F8B A;  1GTK A;  2RS7 A;  4R2S A;  2I13 A;  2EPZ A;  4BHB A;  2JYA A;  4J8Z A;  4LF8 E;  4LU9 A;  3HPZ A;  1YSA C;  4DV3 E;  2EMB A;  4GKK E;  4F6M A;  2ELY A;  2LUQ A;  3BID A;  2JOB A;  1TF6 A;  1X3C A;  3BGH A;  3K6Q A;  4M0V A;  2EQ0 A;  1ZU1 A;  2WCC 3;  2UXC E;  2GHF A;  3HPS A;  4WPY A;  3H09 A;  1NCS A;  2MDG A;  4LFB E;  4WFT A;  1X5W A;  2EM7 A;  2JPA A;  2M9A A;  2JWO A;  2LVH A;  1XMQ E;  3C6M A;  5IXM B;  2JY9 A;  2FTX B;  4DKK A;  3LLH A;  3LML A;  4F9B B;  3EPJ A;  3MSW A;  2YTI A;  2EOZ A;  2YTO A;  4ZYH A;  5KL2 A;  2R1F A;  3T1Y E;  2EM5 A;  3VYX A;  1WXR A;  2V83 A;  5A2Q C;  2V8Q B;  2EOR A;  3ZOQ B;  4ZYD A;  2M1S A;  5FLX C;  4AQY E;  2YU8 A;  1UBD C;  2JP9 A;  1EH6 A;  2L3C A;  1T4O A;  4ZYG A;  1IBK E;  3QG5 C;  2EM2 A;  2ENA A;  2YSO A;  2EOE A;  3HTX A;  4M9V C;  2VQE E;  2EPX A;  1EKZ A;  4O43 A;  3F6G A;  1UN6 B;  2L3J A;  4K0K E;  3VHT B;  4R2P A;  2EMY A;  1ZBQ A;  2EOH A;  1J26 A;  4B3M E;  2MDR A;  2EPR A;  4P78 A;  5KL3 A;  2ADR A;  2WBS A;  1AAY A;  2LJH A;  2CTD A;  4TUI A;  2MKN A;  2JXP A;  5T6J A;  1DI2 A;  2LRS A;  4Q28 A;  3THN A;  1X6H A;  4DV2 E;  4DR3 E;  2MKD A;  3J7A G;  1LLM C;  2EM8 A;  4R8O A;  2V89 A;  3JAM C;  4R03 A;  1YPN A;  5F3W A;  4NHR A;  2L92 A;  2ENC A;  1A1H A;  4DR5 E;  1RC7 A;  1T39 A;  2KHX A;  2L2N A;  3IWD A;  4BHC A;  3HXL A;  2EMW A;  4ZYE A;  4L5N C;  4O5G A;  1T4N A;  5A6B A;  4DV0 E;  1A1K A;  1STU A;  2EN6 A;  1NEI A;  5LLQ A;  3RMP A;  2RTX A;  3BBG A;  4R2R A;  2LJU A;  4I8O A;  4DV5 E;  4DV7 E;  1N33 E;  2CSH A;  2LTR A;  3M99 B;  2RPC A;  3J80 C;  3MHS C;  2DMI A;  4HTG A;  2EOM A;  2E72 A;  3AUZ A;  2E1M A;  2EM4 A;  4LTY A;  1IMU A;  1G2D C;  1N3G A;  2YRM A;  4BC9 A;  5KL5 A;  1DQ3 A;  2GPI A;  2RQL A;  1YYK A;  4TUG A;  4LF6 E;  4M30 A;  1IBM E;  1O0W A;  5AC4 A;  1WHN A;  2YTG A;  2ENH A;  2KON A;  2EOO A;  1HR0 E;  2DMY A;  1KYQ A;  2UU9 E;  3KWR A;  1MEY C;  1YYO A;  3IWC A;  3EPK A;  4R2D A;  3VK6 A;  2EMF A;  4JI0 E;  1IQO A;  2EL4 A;  2HHH E;  4BCA A;  4NXN E;  2YTJ A;  2EMZ A;  1BBG A;  2YRK A;  1EH7 A;  2EPN A;  4DR7 E;  1PJS A;  2N3G A;  3OTO E;  4WYQ B;  4LFC E;  1EH8 A;  4BBY A;  4O24 A;  4BMJ A;  3THO B;  2LT7 A;  4NXM E;  4F9C B;  4B3T E;  2EN2 A;  1IBL E;  3J81 C;  3BF2 A;  3VYY A;  3EPL A;  3ADJ A;  2EOX A;  3KZY A;  1YZ9 A;  4WX9 A;  3AV0 A;  3ADL A;  4F9A B;  2NUG A;  1HNW E;  1FJG E;  4YHH E;  2MC6 A;  4FK5 C;  4B3R E;  4DR6 E;  1L4S A;  2EMI A;  2LO3 A;  3JTZ A;  3JU0 A;  4IJD A;  1X47 A;  2EL5 A;  2Q8U A;  2ODR C;  3KZZ A;  4JI8 E;  4JI2 E;  1A1J A;  1GQE A;  2V86 A;  1RQ0 A;  2YTQ A;  4LF9 E;  2DLK A;  1N32 E;  2V87 A;  4OX9 E;  4DV4 E;  2EJ4 A;  3ECR A;  4LF4 E;  1SFE A;  4F2J C;  4HEI A;  1UIL A;  2EN1 A;  4DR2 E;  1A1F A;  4X62 E;  1KJK A;  2LUP B;  2L8T A;  1AH5 A;  2RSM A;  4F54 A;  2JR1 A;  4WSG A;  4DUY E;  4IS1 C;  2EMC A;  1RMD A;  3OML A;  5ADZ A;  2EPP A;  1I94 E;  2M4I A;  1TN9 A;  2L33 A;  2D9H A;  1XNQ E;  1J5E E;  2EMA A;  4X64 E;  5DNY A;  1G2F C;  2YTD A;  4P7D A;  1ZR9 A;  2EPO A;  5KL7 A;  2M7Q A; 
#chains in the Genus database with same CATH homology
 2EM4 A;  2GHF A;  3UK3 C;  2EOQ A;  1G2D C;  2GLI A;  2DLQ A;  1NCS A;  2EOI A;  2EPC A;  2MDG A;  2YTP A;  2YRM A;  5KL5 A;  1X5W A;  2EM7 A;  1X6F A;  2JPA A;  2M9A A;  2LVH A;  2EM9 A;  2HGH A;  4R2Q A;  3EPJ A;  4GZN C;  2YTI A;  2EOZ A;  2YTG A;  2YTO A;  2WCC 3;  2ENH A;  5KL2 A;  1BBO A;  2R1F A;  2EN8 A;  2EOO A;  2EMH A;  2A25 A;  4R2A A;  2PRT A;  1F2I G;  4R2C A;  2EOJ A;  1MEY C;  2EM5 A;  2EM3 A;  3EPK A;  2BB8 A;  4R2D A;  2EMF A;  2YTN A;  5KL4 A;  2DRP A;  2EOR A;  3EPH A;  2EML A;  2EL4 A;  2YTJ A;  1YUJ A;  1ZU1 A;  2EMZ A;  2WBU A;  2YU8 A;  1UBD C;  2YRK A;  2JP9 A;  2YRH A;  2VRD A;  1DGC A;  2EL6 A;  2EM2 A;  1B69 A;  2EPA A;  2ENA A;  2WBT A;  2YSO A;  2EOE A;  1P47 A;  4M9V C;  2LT7 A;  2EPX A;  2EM6 A;  4R2E A;  2EN2 A;  1ZAA C;  1UN6 B;  3EPL A;  3VHT B;  2EMK A;  4R2P A;  3MHH C;  1A1G A;  2EMY A;  1Z1B A;  2EOH A;  2EOX A;  2EPR A;  1TF3 A;  5KL3 A;  2EOS A;  2ADR A;  2YU5 A;  1JK2 A;  2WBS A;  1AAY A;  2EMG A;  4FK5 C;  2EMI A;  2CTD A;  2LO3 A;  2MKN A;  2EM0 A;  2EMX A;  4IJD A;  2EL5 A;  2EOY A;  1X6H A;  4F6N A;  2RSI A;  1A1J A;  2MKD A;  4X9J A;  2LCE A;  1LLM C;  2EM8 A;  1YUI A;  2YTQ A;  2EQ1 A;  2YTE A;  1X6E A;  2J7J A;  2DLK A;  2EN4 A;  2EN7 A;  2EOF A;  2DGC A;  2EJ4 A;  5KL6 A;  2ENC A;  1A1H A;  1WJP A;  4F2J C;  1A1L A;  2YSP A;  2EPU A;  2EN1 A;  1A1F A;  1KJK A;  2ELZ A;  2EE8 A;  2EMW A;  1BB8 A;  4WSG A;  2EP3 A;  2LV2 A;  4IS1 C;  2EMC A;  1RMD A;  4R2S A;  2I13 A;  2EPP A;  2EPZ A;  1A1K A;  2CT1 A;  2EN3 A;  1TN9 A;  1YSA C;  2EN6 A;  1JK1 A;  2D9H A;  2EMB A;  2NAB A;  2EQ3 A;  4F6M A;  2ELY A;  1A1I A;  2EMA A;  4R2R A;  2YTF A;  2CSH A;  1TF6 A;  1X3C A;  2RPC A;  3M99 B;  1G2F C;  2YTD A;  3MHS C;  2DMI A;  2EOM A;  1ZR9 A;  2EQ0 A;  2E72 A;  5KL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...