2DLQA

Solution structure of the tandem four zf-c2h2 domain repeats of murine gli-kruppel family member hkr3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
124
Chain Sequence
GSSGSSGVECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRLHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLI-Kruppel family member HKR3
publication title Solution structure of the tandem four zf-C2H2 domain repeats of murine GLI-Kruppel family member HKR3
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 25
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA02
1X3CA 2EMAA 2EPCA 3MHSC 1A1JA 1A1GA 2EN2A 2EOYA 2EMZA 2CSHA 2EOXA 1G2FC 2EM3A 2HGHA 3EPLA 2EMCA 4X9JA 4R2SA 4R2RA 1A1FA 2R1FA 2EN4A 2ADRA 1ZU1A 2EMYA 3MHHC 4R2DA 2EMHA 2EMFA 2WBUA 1A1KA 2EMGA 1X6HA 3EPJA 4R2PA 2EN6A 2EM8A 2YRHA 3M99B 2EM4A 3UK3C 1AAYA 2RPCA 2GHFA 1G2DC 2EOEA 2LCEA 1DGCA 5KL4A 2EOHA 4FK5C 4M9VC 2YTEA 1B69A 2EM7A 2YTQA 1UBDC 2EMLA 2EJ4A 2BB8A 2EOOA 1X5WA 2EORA 2A25A 2YTJA 2YTFA 2DRPA 1A1HA 5KL7A 2YRKA 1TF3A 2YSPA 2YSOA 4IJDA 2D9HA 1YSAC 2GLIA 2YU5A 2EPUA 1KJKA 2MDGA 2EN1A 5KL5A 1JK2A 4R2QA 2VRDA 1A1LA 1BB8A 2CTDA 2EOFA 2DMIA 2YTDA 2LT7A 2JPAA 2EPPA 1Z1BA 2EQ0A 1ZR9A 2ENCA 4R2EA 2DGCA 1TF6A 2DLQA 2EOQA 5KL6A 3EPKA 2EE8A 2LV2A 2EQ3A 1BBOA 2EL5A 2EM2A 2EM5A 2EPAA 4WSGA 1ZAAC 2JP9A 2EL4A 1UN6B 5KL2A 2EOZA 2ELYA 2EN7A 2EMKA 2LVHA 1P47A 2EMXA 2WCC3 2PRTA 2YTOA 1X6FA 1A1IA 2LO3A 2EM0A 2I13A 1WJPA 4F2JC 2YTIA 2EP3A 4F6NA 2YTGA 1LLMC 2EPRA 2EOMA 2CT1A 2DLKA 2RSIA 2EPZA 2YRMA 2EN8A 4R2CA 2YTPA 2NABA 2EM6A 4IS1C 2EMWA 4GZNC 2EOJA 3EPHA 1RMDA 2ELZA 2EL6A 2ENAA 2YTNA 2EMIA 1MEYC 1NCSA 1YUIA 2WBTA 2WBSA 2EOSA 1F2IG 2ENHA 2YU8A 2MKNA 2J7JA 2EN3A 2EMBA 2EPXA 1JK1A 2M9AA 1TN9A 4F6MA 2MKDA 1X6EA 2E72A 2EQ1A 4R2AA 5KL3A 1YUJA 2EOIA 3VHTB 2EM9A
chains in the Genus database with same CATH superfamily
2EPCA 2HGHA 5AE3A 4X8WA 5A6AA 5F3WA 4TUIA 4GKKE 2ODRC 2UXBE 5BR8E 4R2DA 4BMJA 3T1HE 2I9IA 1X6HA 2UUCE 4GEQB 4WFTA 2EM4A 2M1SA 4DKKA 2RPCA 2EZ6A 1G2DC 2EOEA 1DI2A 2IHR1 1PJQA 1YFHA 3BBGA 2EOHA 4RH8A 3THNA 4DV3E 1YYKA 3KZYA 4JI3E 2EMLA 3HPZA 2EJ4A 2NUFA 3LLHA 2DRPA 3VK6A 1TF3A 1L4SA 4YY3E 2NA2A 4LF9E 1YSAC 2YU5A 1KJKA 4DR6E 4F54A 3JAMC 2YTDA 1Z1BA 2EQ0A 1ZR9A 2FV4B 3THOB 2VF1A 5LLQA 2FGGA 2EOQA 1HNXE 5KL6A 4JI1E 1KYQA 4NZVA 2EM2A 1YYWA 2EPAA 2HJJA 1ZAAC 1EH8A 2JP9A 1UILA 2EL4A 1EKZA 3ADJA 2YT4A 1PJSA 4WXDA 3BIDA 2JR1A 2EMXA 2KONA 2LO3A 5IXMB 2I13A 1WJPA 1SFEA 4F2JC 2DB2A 4GKJE 4F9BB 2EOMA 2DSYA 4X66E 2GPIA 2JVAA 5CFFE 4DR5E 2G7HA 3J7Yp 4LF8E 3ADLA 4L5NC 2EM6A 4IS1C 4GZNC 2JYAA 3EPHA 1MGTA 2B3TB 2ELZA 1BBGA 4N4RB 2VQEE 2EOSA 2FTXB 1J26A 3C6KA 2ENHA 2MKNA 4LFCE 1JK1A 2CPNA 1TN9A 4F6MA 3J7AG 1X6EA 4DR4E 5KL3A 3VHTB 2EM9A 4K0KE 2EPOA 1XNRE 1X3CA 1GQEA 1G2FC 1FKAE 4M0VA 2KOUA 5A2QC 2V8QB 4Q28A 1A1KA 4DR3E 3IWDA 2Q8UA 4WYQB 2RSMA 2YRHA 1PKPA 2LTSA 4M2ZA 4LF6E 2NUGA 3FIGA 1SR9A 1XMOE 2LJUA 2VE7C 3P1XA 3C6MA 3EQ1A 4P7DA 2EOOA 2BBGA 2L2NA 1N3GA 2EPMX 1A1HA 5KL7A 2MDRA 2YSPA 3MSWA 5ADZA 4LF4E 4DUYE 2EPUA 4LU9A 2MDGA 2LRSA 2CTDA 2UU9E 2DMIA 4F9AB 1HNZE 4KZSA 2UUAE 2JPAA 1NEIA 2DGCA 2ENCA 1N34E 4P78A 1N36E 2DLQA 2EPKX 2HHHE 2RQLA 1FJGE 1RQ0A 2EM5A 2L33A 5A69A 1QNTA 1EH7A 5IWAE 4JYAE 3VYYA 3T1YE 4ZYGA 4TUGA 4LF7E 2H36X 2LVHA 1P47A 3HPSA 2EPLX 2V85A 2EM0A 1AH5A 4DUZE 2YTIA 2EP3A 4F6NA 2YTGA 1LLMC 3BF2A 3J81C 2RSIA 2YRMA 5LMUE 2EN8A 2B9DA 4DR7E 4R2CA 2YTPA 4X65E 3BGHA 5FLXC 2B7VA 2NABA 1X48A 4DMIA 5A6JA 1T4OA 4AQYE 3KWRA 2EMWA 4BC7A 5DNYA 3DJWA 4WX9A 4WSPA 2ENAA 4JV5E 4X64E 2EMIA 4NXNE 5AC5A 3QG5C 1T4LB 2J7JA 3AUZA 2EPXA 1IBME 2YWQA 3TQMA 5A6BD 2V87A 4JI8E 2LUQA 1X47A 2EMAA 4ZYDA 1A1JA 4OX9E 1A1GA 2EOYA 2EMZA 3IWCA 2EM3A 2V86A 3EPLA 2YPNA 2RS7A 1QU6A 2K7IA 2N3GA 4X9JA 4R2SA 4R2RA 5TSEA 4B3TE 2EN4A 1O0WA 2JXPA 4I8OA 2UUBE 3MHHC 2WBUA 2EMHA 2EMFA 4DR2E 2EMGA 5AASA 3DF6A 2RS6A 2EM8A 1ZBQA 2ZM6E 4O24A 4L8NA 4YHHE 4DV1E 1AAYA 4B3SE 2GHFA 2MC6A 2V83A 4FK5C 2YTEA 2B7TA 1WHNA 3ECRA 4LFBE 4BHCA 3LMLA 2EM7A 1IBLE 2ODRD 4WPYA 2BB8A 1X5WA 2L92A 3JTZA 2EORA 2LE2A 2A25A 2JY9A 2UXCE 2LUPB 2WZOA 4HTGA 2YRKA 3JU0A 2YSOA 4IJDA 2D9HA 2GLIA 1PDAA 2JOXA 1JK2A 1BB8A 4R2QA 2L2KB 3K6QA 2VQFE 2LT7A 1IQSA 2LTRA 3C4BA 1XMQE 4LTYA 2JOBA 4JI2E 2EE8A 2LV2A 2M4IA 2EQ3A 1YYOA 4WSGA 1UN6B 4HEIA 3OTOE 5KL2A 3HQ1A 1T38A 2EOZA 2ELYA 3C4TA 2NUEA 2EN7A 2EMKA 2WCC3 2E5LE 1GTKA 2PRTA 2YTOA 1X6FA 1A1IA 5A6BA 2EPRA 1HNWE 1WHQA 3J80C 1X49A 4B3RE 4RHBB 2DIXA 2F4VE 5AE2A 3ZOQB 5AE1A 1YZ9A 2EOJA 1RMDA 4DV7E 2EL6A 1MEYC 2YTNA 4NXME 4MLQA 2L3JA 1ZBTA 2WBSA 1HR0E 4LF5E 3ADIA 2YU8A 3AV0A 3HXLA 2EN3A 4R03A 2EQ1A 2E72A 4R2AA 2R76A 1N33E 2EPNA 4R8OA 3MHSC 2L3CA 2EN2A 3F6GA 1T4NA 2CSHA 2EOXA 5LMNE 2EMCA 4O4KA 1T39A 1DQ3A 4BC9A 1A1FA 2R1FA 3IWBA 4KWYA 1GZ6A 2ADRA 4DV0E 1ZU1A 2EMYA 3VYXA 2V88A 1WRJA 3EPJA 4R2PA 2EN6A 3M99B 1I94E 2E1MA 4Q35B 2JWOA 3UK3C 4DV4E 2EWLA 4DV2E 2LCEA 1DGCA 4M30A 4F9CB 5KL4A 4WXCA 2V89A 4ZYEA 1WXRA 1B69A 4M9VC 3RMPA 2K4VA 4DR1E 2YTQA 1UBDC 1IBKE 1EH6A 2DMYA 4BCAA 2L6MA 3F6HA 2YTJA 2YTFA 1STUA 3OMLA 2EN1A 4OOGC 5KL5A 1A1LA 2VRDA 4X62E 2EOFA 2KHXA 2LJHA 2F8BA 4MLVA 2EPPA 5IV8B 4R2EA 4DV6E 1TF6A 4JI5E 1J5EE 2N3HA 2YZTA 3EPKA 4JI4E 4JI7E 4B3ME 2L2MA 4J8ZA 1BBOA 2EL5A 1YPNA 2UXDE 5T6JA 2HC5A 1IQOA 1IMUA 2N8XA 2RTXA 3KZZA 1N32E 4JI6E 3L00A 5AC4A 3ADGA 4ZYHA 2LMZA 4BHBA 4KHPE 1RC7A 4NHRA 2CT1A 4BS9A 4BBYA 2DLKA 2MC5A 2EPZA 1PJTA 4DV5E 2M7QA 3H09A 5LL6R 5A6KA 2L8TA 1XNQE 4O43A 4LFAE 1NCSA 1YUIA 2WBTA 1F2IG 4JI0E 5IT9C 2EMBA 4O5GA 2M9AA 2MKDA 1UHZA 2EOIA 2LBSB 1YUJA 3HTXA
chains in the Genus database with same CATH topology
1X3CA 2EMAA 2EPCA 3MHSC 1A1JA 1A1GA 2EN2A 2EOYA 2EMZA 2CSHA 2EOXA 1G2FC 2EM3A 2HGHA 3EPLA 2EMCA 4X9JA 4R2SA 4R2RA 1A1FA 2R1FA 2EN4A 2ADRA 1ZU1A 2EMYA 3MHHC 4R2DA 2EMHA 2EMFA 2WBUA 1A1KA 2EMGA 1X6HA 3EPJA 4R2PA 2EN6A 2EM8A 2YRHA 3M99B 2EM4A 3UK3C 1AAYA 2RPCA 2GHFA 1G2DC 2EOEA 2LCEA 1DGCA 5KL4A 2EOHA 4FK5C 4M9VC 2YTEA 1B69A 2EM7A 2YTQA 1UBDC 2EMLA 2EJ4A 2BB8A 2EOOA 1X5WA 2EORA 2A25A 2YTJA 2YTFA 2DRPA 1A1HA 5KL7A 2YRKA 1TF3A 2YSPA 2YSOA 4IJDA 2D9HA 1YSAC 2GLIA 2YU5A 2EPUA 1KJKA 2MDGA 2EN1A 5KL5A 1JK2A 4R2QA 2VRDA 1A1LA 1BB8A 2CTDA 2EOFA 2DMIA 2YTDA 2LT7A 2JPAA 2EPPA 1Z1BA 2EQ0A 1ZR9A 2ENCA 4R2EA 2DGCA 1TF6A 2DLQA 2EOQA 5KL6A 3EPKA 2EE8A 2LV2A 2EQ3A 1BBOA 2EL5A 2EM2A 2EM5A 2EPAA 4WSGA 1ZAAC 2JP9A 2EL4A 1UN6B 5KL2A 2EOZA 2ELYA 2EN7A 2EMKA 2LVHA 1P47A 2EMXA 2WCC3 2PRTA 2YTOA 1X6FA 1A1IA 2LO3A 2EM0A 2I13A 1WJPA 4F2JC 2YTIA 2EP3A 4F6NA 2YTGA 1LLMC 2EPRA 2EOMA 2CT1A 2DLKA 2RSIA 2EPZA 2YRMA 2EN8A 4R2CA 2YTPA 2NABA 2EM6A 4IS1C 2EMWA 4GZNC 2EOJA 3EPHA 1RMDA 2ELZA 2EL6A 2ENAA 2YTNA 2EMIA 1MEYC 1NCSA 1YUIA 2WBTA 2WBSA 2EOSA 1F2IG 2ENHA 2YU8A 2MKNA 2J7JA 2EN3A 2EMBA 2EPXA 1JK1A 2M9AA 1TN9A 4F6MA 2MKDA 1X6EA 2E72A 2EQ1A 4R2AA 5KL3A 1YUJA 2EOIA 3VHTB 2EM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3C A;  2EMA A;  2EPC A;  3MHS C;  1A1J A;  1A1G A;  2EN2 A;  2EOY A;  2EMZ A;  2CSH A;  2EOX A;  1G2F C;  2EM3 A;  2HGH A;  3EPL A;  2EMC A;  4X9J A;  4R2S A;  4R2R A;  1A1F A;  2R1F A;  2EN4 A;  2ADR A;  1ZU1 A;  2EMY A;  3MHH C;  4R2D A;  2EMH A;  2EMF A;  2WBU A;  1A1K A;  2EMG A;  1X6H A;  3EPJ A;  4R2P A;  2EN6 A;  2EM8 A;  2YRH A;  3M99 B;  2EM4 A;  3UK3 C;  1AAY A;  2RPC A;  2GHF A;  1G2D C;  2EOE A;  2LCE A;  1DGC A;  5KL4 A;  2EOH A;  4FK5 C;  4M9V C;  2YTE A;  1B69 A;  2EM7 A;  2YTQ A;  1UBD C;  2EML A;  2EJ4 A;  2BB8 A;  2EOO A;  1X5W A;  2EOR A;  2A25 A;  2YTJ A;  2YTF A;  2DRP A;  1A1H A;  5KL7 A;  2YRK A;  1TF3 A;  2YSP A;  2YSO A;  4IJD A;  2D9H A;  1YSA C;  2GLI A;  2YU5 A;  2EPU A;  1KJK A;  2MDG A;  2EN1 A;  5KL5 A;  1JK2 A;  4R2Q A;  2VRD A;  1A1L A;  1BB8 A;  2CTD A;  2EOF A;  2DMI A;  2YTD A;  2LT7 A;  2JPA A;  2EPP A;  1Z1B A;  2EQ0 A;  1ZR9 A;  2ENC A;  4R2E A;  2DGC A;  1TF6 A;  2DLQ A;  2EOQ A;  5KL6 A;  3EPK A;  2EE8 A;  2LV2 A;  2EQ3 A;  1BBO A;  2EL5 A;  2EM2 A;  2EM5 A;  2EPA A;  4WSG A;  1ZAA C;  2JP9 A;  2EL4 A;  1UN6 B;  5KL2 A;  2EOZ A;  2ELY A;  2EN7 A;  2EMK A;  2LVH A;  1P47 A;  2EMX A;  2WCC 3;  2PRT A;  2YTO A;  1X6F A;  1A1I A;  2LO3 A;  2EM0 A;  2I13 A;  1WJP A;  4F2J C;  2YTI A;  2EP3 A;  4F6N A;  2YTG A;  1LLM C;  2EPR A;  2EOM A;  2CT1 A;  2DLK A;  2RSI A;  2EPZ A;  2YRM A;  2EN8 A;  4R2C A;  2YTP A;  2NAB A;  2EM6 A;  4IS1 C;  2EMW A;  4GZN C;  2EOJ A;  3EPH A;  1RMD A;  2ELZ A;  2EL6 A;  2ENA A;  2YTN A;  2EMI A;  1MEY C;  1NCS A;  1YUI A;  2WBT A;  2WBS A;  2EOS A;  1F2I G;  2ENH A;  2YU8 A;  2MKN A;  2J7J A;  2EN3 A;  2EMB A;  2EPX A;  1JK1 A;  2M9A A;  1TN9 A;  4F6M A;  2MKD A;  1X6E A;  2E72 A;  2EQ1 A;  4R2A A;  5KL3 A;  1YUJ A;  2EOI A;  3VHT B;  2EM9 A; 
#chains in the Genus database with same CATH topology
 2EPC A;  2HGH A;  5AE3 A;  4X8W A;  5A6A A;  5F3W A;  4TUI A;  4GKK E;  2ODR C;  2UXB E;  5BR8 E;  4R2D A;  4BMJ A;  3T1H E;  2I9I A;  1X6H A;  2UUC E;  4GEQ B;  4WFT A;  2EM4 A;  2M1S A;  4DKK A;  2RPC A;  2EZ6 A;  1G2D C;  2EOE A;  1DI2 A;  2IHR 1;  1PJQ A;  1YFH A;  3BBG A;  2EOH A;  4RH8 A;  3THN A;  4DV3 E;  1YYK A;  3KZY A;  4JI3 E;  2EML A;  3HPZ A;  2EJ4 A;  2NUF A;  3LLH A;  2DRP A;  3VK6 A;  1TF3 A;  1L4S A;  4YY3 E;  2NA2 A;  4LF9 E;  1YSA C;  2YU5 A;  1KJK A;  4DR6 E;  4F54 A;  3JAM C;  2YTD A;  1Z1B A;  2EQ0 A;  1ZR9 A;  2FV4 B;  3THO B;  2VF1 A;  5LLQ A;  2FGG A;  2EOQ A;  1HNX E;  5KL6 A;  4JI1 E;  1KYQ A;  4NZV A;  2EM2 A;  1YYW A;  2EPA A;  2HJJ A;  1ZAA C;  1EH8 A;  2JP9 A;  1UIL A;  2EL4 A;  1EKZ A;  3ADJ A;  2YT4 A;  1PJS A;  4WXD A;  3BID A;  2JR1 A;  2EMX A;  2KON A;  2LO3 A;  5IXM B;  2I13 A;  1WJP A;  1SFE A;  4F2J C;  2DB2 A;  4GKJ E;  4F9B B;  2EOM A;  2DSY A;  4X66 E;  2GPI A;  2JVA A;  5CFF E;  4DR5 E;  2G7H A;  3J7Y p;  4LF8 E;  3ADL A;  4L5N C;  2EM6 A;  4IS1 C;  4GZN C;  2JYA A;  3EPH A;  1MGT A;  2B3T B;  2ELZ A;  1BBG A;  4N4R B;  2VQE E;  2EOS A;  2FTX B;  1J26 A;  3C6K A;  2ENH A;  2MKN A;  4LFC E;  1JK1 A;  2CPN A;  1TN9 A;  4F6M A;  3J7A G;  1X6E A;  4DR4 E;  5KL3 A;  3VHT B;  2EM9 A;  4K0K E;  2EPO A;  1XNR E;  1X3C A;  1GQE A;  1G2F C;  1FKA E;  4M0V A;  2KOU A;  5A2Q C;  2V8Q B;  4Q28 A;  1A1K A;  4DR3 E;  3IWD A;  2Q8U A;  4WYQ B;  2RSM A;  2YRH A;  1PKP A;  2LTS A;  4M2Z A;  4LF6 E;  2NUG A;  3FIG A;  1SR9 A;  1XMO E;  2LJU A;  2VE7 C;  3P1X A;  3C6M A;  3EQ1 A;  4P7D A;  2EOO A;  2BBG A;  2L2N A;  1N3G A;  2EPM X;  1A1H A;  5KL7 A;  2MDR A;  2YSP A;  3MSW A;  5ADZ A;  4LF4 E;  4DUY E;  2EPU A;  4LU9 A;  2MDG A;  2LRS A;  2CTD A;  2UU9 E;  2DMI A;  4F9A B;  1HNZ E;  4KZS A;  2UUA E;  2JPA A;  1NEI A;  2DGC A;  2ENC A;  1N34 E;  4P78 A;  1N36 E;  2DLQ A;  2EPK X;  2HHH E;  2RQL A;  1FJG E;  1RQ0 A;  2EM5 A;  2L33 A;  5A69 A;  1QNT A;  1EH7 A;  5IWA E;  4JYA E;  3VYY A;  3T1Y E;  4ZYG A;  4TUG A;  4LF7 E;  2H36 X;  2LVH A;  1P47 A;  3HPS A;  2EPL X;  2V85 A;  2EM0 A;  1AH5 A;  4DUZ E;  2YTI A;  2EP3 A;  4F6N A;  2YTG A;  1LLM C;  3BF2 A;  3J81 C;  2RSI A;  2YRM A;  5LMU E;  2EN8 A;  2B9D A;  4DR7 E;  4R2C A;  2YTP A;  4X65 E;  3BGH A;  5FLX C;  2B7V A;  2NAB A;  1X48 A;  4DMI A;  5A6J A;  1T4O A;  4AQY E;  3KWR A;  2EMW A;  4BC7 A;  5DNY A;  3DJW A;  4WX9 A;  4WSP A;  2ENA A;  4JV5 E;  4X64 E;  2EMI A;  4NXN E;  5AC5 A;  3QG5 C;  1T4L B;  2J7J A;  3AUZ A;  2EPX A;  1IBM E;  2YWQ A;  3TQM A;  5A6B D;  2V87 A;  4JI8 E;  2LUQ A;  1X47 A;  2EMA A;  4ZYD A;  1A1J A;  4OX9 E;  1A1G A;  2EOY A;  2EMZ A;  3IWC A;  2EM3 A;  2V86 A;  3EPL A;  2YPN A;  2RS7 A;  1QU6 A;  2K7I A;  2N3G A;  4X9J A;  4R2S A;  4R2R A;  5TSE A;  4B3T E;  2EN4 A;  1O0W A;  2JXP A;  4I8O A;  2UUB E;  3MHH C;  2WBU A;  2EMH A;  2EMF A;  4DR2 E;  2EMG A;  5AAS A;  3DF6 A;  2RS6 A;  2EM8 A;  1ZBQ A;  2ZM6 E;  4O24 A;  4L8N A;  4YHH E;  4DV1 E;  1AAY A;  4B3S E;  2GHF A;  2MC6 A;  2V83 A;  4FK5 C;  2YTE A;  2B7T A;  1WHN A;  3ECR A;  4LFB E;  4BHC A;  3LML A;  2EM7 A;  1IBL E;  2ODR D;  4WPY A;  2BB8 A;  1X5W A;  2L92 A;  3JTZ A;  2EOR A;  2LE2 A;  2A25 A;  2JY9 A;  2UXC E;  2LUP B;  2WZO A;  4HTG A;  2YRK A;  3JU0 A;  2YSO A;  4IJD A;  2D9H A;  2GLI A;  1PDA A;  2JOX A;  1JK2 A;  1BB8 A;  4R2Q A;  2L2K B;  3K6Q A;  2VQF E;  2LT7 A;  1IQS A;  2LTR A;  3C4B A;  1XMQ E;  4LTY A;  2JOB A;  4JI2 E;  2EE8 A;  2LV2 A;  2M4I A;  2EQ3 A;  1YYO A;  4WSG A;  1UN6 B;  4HEI A;  3OTO E;  5KL2 A;  3HQ1 A;  1T38 A;  2EOZ A;  2ELY A;  3C4T A;  2NUE A;  2EN7 A;  2EMK A;  2WCC 3;  2E5L E;  1GTK A;  2PRT A;  2YTO A;  1X6F A;  1A1I A;  5A6B A;  2EPR A;  1HNW E;  1WHQ A;  3J80 C;  1X49 A;  4B3R E;  4RHB B;  2DIX A;  2F4V E;  5AE2 A;  3ZOQ B;  5AE1 A;  1YZ9 A;  2EOJ A;  1RMD A;  4DV7 E;  2EL6 A;  1MEY C;  2YTN A;  4NXM E;  4MLQ A;  2L3J A;  1ZBT A;  2WBS A;  1HR0 E;  4LF5 E;  3ADI A;  2YU8 A;  3AV0 A;  3HXL A;  2EN3 A;  4R03 A;  2EQ1 A;  2E72 A;  4R2A A;  2R76 A;  1N33 E;  2EPN A;  4R8O A;  3MHS C;  2L3C A;  2EN2 A;  3F6G A;  1T4N A;  2CSH A;  2EOX A;  5LMN E;  2EMC A;  4O4K A;  1T39 A;  1DQ3 A;  4BC9 A;  1A1F A;  2R1F A;  3IWB A;  4KWY A;  1GZ6 A;  2ADR A;  4DV0 E;  1ZU1 A;  2EMY A;  3VYX A;  2V88 A;  1WRJ A;  3EPJ A;  4R2P A;  2EN6 A;  3M99 B;  1I94 E;  2E1M A;  4Q35 B;  2JWO A;  3UK3 C;  4DV4 E;  2EWL A;  4DV2 E;  2LCE A;  1DGC A;  4M30 A;  4F9C B;  5KL4 A;  4WXC A;  2V89 A;  4ZYE A;  1WXR A;  1B69 A;  4M9V C;  3RMP A;  2K4V A;  4DR1 E;  2YTQ A;  1UBD C;  1IBK E;  1EH6 A;  2DMY A;  4BCA A;  2L6M A;  3F6H A;  2YTJ A;  2YTF A;  1STU A;  3OML A;  2EN1 A;  4OOG C;  5KL5 A;  1A1L A;  2VRD A;  4X62 E;  2EOF A;  2KHX A;  2LJH A;  2F8B A;  4MLV A;  2EPP A;  5IV8 B;  4R2E A;  4DV6 E;  1TF6 A;  4JI5 E;  1J5E E;  2N3H A;  2YZT A;  3EPK A;  4JI4 E;  4JI7 E;  4B3M E;  2L2M A;  4J8Z A;  1BBO A;  2EL5 A;  1YPN A;  2UXD E;  5T6J A;  2HC5 A;  1IQO A;  1IMU A;  2N8X A;  2RTX A;  3KZZ A;  1N32 E;  4JI6 E;  3L00 A;  5AC4 A;  3ADG A;  4ZYH A;  2LMZ A;  4BHB A;  4KHP E;  1RC7 A;  4NHR A;  2CT1 A;  4BS9 A;  4BBY A;  2DLK A;  2MC5 A;  2EPZ A;  1PJT A;  4DV5 E;  2M7Q A;  3H09 A;  5LL6 R;  5A6K A;  2L8T A;  1XNQ E;  4O43 A;  4LFA E;  1NCS A;  1YUI A;  2WBT A;  1F2I G;  4JI0 E;  5IT9 C;  2EMB A;  4O5G A;  2M9A A;  2MKD A;  1UHZ A;  2EOI A;  2LBS B;  1YUJ A;  3HTX A; 
#chains in the Genus database with same CATH homology
 1X3C A;  2EMA A;  2EPC A;  3MHS C;  1A1J A;  1A1G A;  2EN2 A;  2EOY A;  2EMZ A;  2CSH A;  2EOX A;  1G2F C;  2EM3 A;  2HGH A;  3EPL A;  2EMC A;  4X9J A;  4R2S A;  4R2R A;  1A1F A;  2R1F A;  2EN4 A;  2ADR A;  1ZU1 A;  2EMY A;  3MHH C;  4R2D A;  2EMH A;  2EMF A;  2WBU A;  1A1K A;  2EMG A;  1X6H A;  3EPJ A;  4R2P A;  2EN6 A;  2EM8 A;  2YRH A;  3M99 B;  2EM4 A;  3UK3 C;  1AAY A;  2RPC A;  2GHF A;  1G2D C;  2EOE A;  2LCE A;  1DGC A;  5KL4 A;  2EOH A;  4FK5 C;  4M9V C;  2YTE A;  1B69 A;  2EM7 A;  2YTQ A;  1UBD C;  2EML A;  2EJ4 A;  2BB8 A;  2EOO A;  1X5W A;  2EOR A;  2A25 A;  2YTJ A;  2YTF A;  2DRP A;  1A1H A;  5KL7 A;  2YRK A;  1TF3 A;  2YSP A;  2YSO A;  4IJD A;  2D9H A;  1YSA C;  2GLI A;  2YU5 A;  2EPU A;  1KJK A;  2MDG A;  2EN1 A;  5KL5 A;  1JK2 A;  4R2Q A;  2VRD A;  1A1L A;  1BB8 A;  2CTD A;  2EOF A;  2DMI A;  2YTD A;  2LT7 A;  2JPA A;  2EPP A;  1Z1B A;  2EQ0 A;  1ZR9 A;  2ENC A;  4R2E A;  2DGC A;  1TF6 A;  2DLQ A;  2EOQ A;  5KL6 A;  3EPK A;  2EE8 A;  2LV2 A;  2EQ3 A;  1BBO A;  2EL5 A;  2EM2 A;  2EM5 A;  2EPA A;  4WSG A;  1ZAA C;  2JP9 A;  2EL4 A;  1UN6 B;  5KL2 A;  2EOZ A;  2ELY A;  2EN7 A;  2EMK A;  2LVH A;  1P47 A;  2EMX A;  2WCC 3;  2PRT A;  2YTO A;  1X6F A;  1A1I A;  2LO3 A;  2EM0 A;  2I13 A;  1WJP A;  4F2J C;  2YTI A;  2EP3 A;  4F6N A;  2YTG A;  1LLM C;  2EPR A;  2EOM A;  2CT1 A;  2DLK A;  2RSI A;  2EPZ A;  2YRM A;  2EN8 A;  4R2C A;  2YTP A;  2NAB A;  2EM6 A;  4IS1 C;  2EMW A;  4GZN C;  2EOJ A;  3EPH A;  1RMD A;  2ELZ A;  2EL6 A;  2ENA A;  2YTN A;  2EMI A;  1MEY C;  1NCS A;  1YUI A;  2WBT A;  2WBS A;  2EOS A;  1F2I G;  2ENH A;  2YU8 A;  2MKN A;  2J7J A;  2EN3 A;  2EMB A;  2EPX A;  1JK1 A;  2M9A A;  1TN9 A;  4F6M A;  2MKD A;  1X6E A;  2E72 A;  2EQ1 A;  4R2A A;  5KL3 A;  1YUJ A;  2EOI A;  3VHT B;  2EM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...