2DLQA

Solution structure of the tandem four zf-c2h2 domain repeats of murine gli-kruppel family member hkr3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
124
Chain Sequence
GSSGSSGVECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRLHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLI-Kruppel family member HKR3
publication title Solution structure of the tandem four zf-C2H2 domain repeats of murine GLI-Kruppel family member HKR3
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 25
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlqA02
2YSPA 2EN1A 2EOYA 1WJPA 1X5WA 2MDGA 1F2IG 4R2CA 2GHFA 2EMBA 4F2JC 5KL3A 2EPAA 2DMIA 2VRDA 3MHSC 2YRKA 1A1IA 1X6HA 2EP3A 2LV2A 2EPCA 2EOHA 2YU8A 2EMZA 2R1FA 5KL7A 2EOMA 2YTEA 1KJKA 2LCEA 4M9VC 2EMLA 2M9AA 1A1FA 2EOXA 1G2FC 2EQ0A 3EPKA 2EMHA 2EL5A 2EMWA 2DLKA 1BBOA 2EOSA 1LLMC 2DRPA 1BB8A 2EOFA 2E72A 2EQ3A 2RPCA 1A1LA 2EN3A 2NABA 2DLQA 1RMDA 2EM6A 2EE8A 1JK2A 4FK5C 2EMYA 1P47A 2WBSA 2GLIA 1NCSA 2YTFA 4R2AA 2YTIA 2PRTA 1B69A 2EMCA 2EOEA 4X9JA 1A1HA 2EN7A 2YTJA 3UK3C 2YTPA 2EPXA 2EM3A 2ENCA 2YTDA 2YTOA 5KL4A 2EN8A 2WBTA 4F6NA 1X6FA 2CTDA 2EM0A 1JK1A 2EM9A 5KL6A 2CT1A 2EM8A 1A1JA 2DGCA 2EN4A 2EORA 2YTGA 1YSAC 2WBUA 2EMFA 2EOJA 1YUJA 2EOQA 3EPLA 2LVHA 4R2DA 2EMAA 2YRHA 1X3CA 2EOZA 2YRMA 3MHHC 2ENAA 4GZNC 2ELZA 4R2QA 2EMXA 2BB8A 2ELYA 4R2RA 2EOIA 2LT7A 2CSHA 2ENHA 2EM4A 2I13A 2EMGA 1ZU1A 1DGCA 1ZR9A 2JP9A 1AAYA 4IJDA 2EMKA 1UN6B 2HGHA 4R2SA 2YTQA 1G2DC 2J7JA 2EM7A 2LO3A 4R2EA 2EJ4A 1A1GA 1TF6A 2YU5A 3VHTB 5KL2A 3EPHA 2EL6A 4IS1C 1MEYC 1TF3A 3EPJA 5KL5A 2EQ1A 2EN6A 2EPUA 1X6EA 2EOOA 2RSIA 2A25A 2EPPA 2YTNA 2EL4A 2EPRA 2EM5A 4R2PA 2WCC3 2EM2A 1TN9A 2JPAA 2MKNA 2D9HA 2ADRA 2EN2A 1A1KA 4WSGA 2EPZA 1UBDC 4F6MA 2EMIA 1ZAAC 2MKDA 1Z1BA 2YSOA 1YUIA 3M99B
chains in the Genus database with same CATH superfamily
2EN1A 1WJPA 2YPNA 2MDGA 3T1HE 4R2CA 2RS7A 2EMBA 3DF6A 4F2JC 5F3WA 4DR5E 3MHSC 4ZYHA 2MC5A 4KWYA 1EH8A 2EP3A 4DV2E 2NA2A 1N33E 2YTEA 1SFEA 4JYAE 1UILA 2VQFE 2LCEA 2EMLA 5IWAE 2EOXA 2WZOA 4NZVA 2UU9E 2M1SA 2EOFA 5A69A 1STUA 2E72A 2RPCA 4DKKA 1N36E 2NUFA 2EN3A 2NABA 1FJGE 3P1XA 2ODRD 1PJSA 1N3GA 1YZ9A 1T4NA 2EMYA 4GKJE 5LL6R 4JI6E 2YTFA 3JU0A 4DR2E 2EOEA 4KZSA 4DV7E 2YTJA 2I9IA 4GKKE 1PDAA 4AQYE 2EM3A 2WBTA 2IHR1 2CTDA 2KHXA 2YWQA 3DJWA 1YSAC 4LFBE 1NEIA 4DMIA 2EOJA 2N8XA 2LJUA 1O0WA 4Q28A 4R8OA 4OX9E 2LRSA 2LVHA 4R2DA 2YRHA 1X3CA 1YFHA 2EOZA 2YRMA 4TUGA 4DR4E 1T39A 2ELZA 2B9DA 2ELYA 4R2RA 4WXDA 3ZOQB 3OMLA 4MLQA 4X64E 1GTKA 4IJDA 5ADZA 5AC4A 2YTQA 4DR7E 2ODRC 4R2EA 2UXBE 3F6HA 2HC5A 1XNQE 1TF3A 3EPJA 2R76A 5A2QC 2EN6A 2WCC3 4HTGA 4JI4E 3KZYA 2D9HA 1T4OA 2JXPA 2EPZA 3ADGA 4WSGA 1ZAAC 4LF5E 1ZBTA 1A1GA 3F6GA 4ZYGA 2YSPA 2CPNA 1X5WA 4F9AB 4X66E 4JI7E 1BBGA 3KWRA 5AE1A 1WRJA 4Q35B 1XMQE 2YRKA 1A1IA 4LF8E 1PJQA 3K6QA 2EOHA 2YU8A 2R1FA 2EOMA 4P7DA 1KJKA 5A6BD 4B3RE 2RQLA 4LU9A 1QNTA 4DV5E 3L00A 2G7HA 1IBME 2EMWA 2DRPA 3H09A 2EZ6A 4GEQB 4P78A 3OTOE 2MDRA 1XNRE 4FK5C 4WFTA 2ZM6E 2GLIA 1NCSA 4O24A 4R2AA 2PRTA 2EMCA 1DQ3A 5AE3A 1ZBQA 3UK3C 3J81C 2EN8A 4YY3E 5A6AA 5KL6A 2EM8A 2DGCA 1IMUA 4RH8A 2EN4A 2LBSB 1WXRA 2NUEA 1J5EE 1YUJA 4O4KA 1GQEA 2EMAA 2JOXA 4I8OA 4O5GA 2K4VA 4JI2E 4KHPE 3VK6A 2L92A 1DI2A 2H36X 2EMXA 4R03A 1PKPA 1MGTA 2I13A 3MSWA 2FTXB 2FGGA 3ADJA 4B3ME 1ZR9A 1AAYA 4X8WA 2L2MA 2KONA 2J7JA 4DV1E 5KL2A 4IS1C 4DUZE 3HPZA 2N3HA 5KL5A 2LMZA 2RS6A 1X6EA 2RSIA 1FKAE 2F4VE 2ADRA 1A1KA 1UBDC 2HJJA 5IT9C 2UUBE 2L2KB 1Z1BA 4DV3E 1IBLE 1YUIA 5T6JA 4DR3E 4WYQB 2EOYA 4L5NC 2V89A 4WSPA 3J7AG 1L4SA 1AH5A 2UUCE 5KL3A 2FV4B 2EPAA 2DMIA 2VRDA 2BBGA 1X6HA 4F9BB 4ZYDA 2LV2A 2Q8UA 5KL7A 1GZ6A 1N32E 1YYKA 2DB2A 5AASA 2RTXA 4BMJA 2N3GA 2B7TA 2DMYA 2M9AA 1A1FA 4NXNE 1EKZA 2DIXA 2JYAA 3BIDA 5FLXC 2EQ0A 2V8QB 3T1YE 2DLKA 1EH7A 1LLMC 3RMPA 4K0KE 2EQ3A 3THNA 4X65E 1A1LA 2YZTA 4JV5E 1HNZE 3BF2A 4DR6E 2LE2A 2EE8A 1JK2A 3HQ1A 4JI8E 2LTSA 4LF4E 1P47A 1T4LB 3ADIA 2WBSA 2LUQA 1A1HA 3LMLA 4X9JA 2JWOA 2EN7A 2UUAE 2EPKX 1X49A 4N4RB 1PJTA 2YTPA 4DUYE 2YTOA 4F6NA 1X6FA 4F54A 3C6MA 2EM0A 1RQ0A 2CT1A 1A1JA 2L2NA 2YTGA 4JI1E 3IWBA 3TQMA 2EMFA 5BR8E 3JAMC 4BHBA 5DNYA 3EPLA 2EPOA 2EPMX 1IQOA 4BC9A 2LTRA 4M30A 3MHHC 4DV0E 2ENAA 2GPIA 5IV8B 3KZZA 1YPNA 4OOGC 5A6KA 3HTXA 2F8BA 2LJHA 4R2QA 2BB8A 1I94E 2EOIA 2LT7A 2CSHA 2ENHA 2JVAA 4HEIA 2B7VA 2V85A 2JP9A 1DGCA 2EPLX 4BHCA 2EMKA 3J7Yp 2JOBA 4R2SA 4MLVA 5IXMB 1G2DC 3VYYA 2EJ4A 2UXCE 4LF6E 3EPHA 1MEYC 2JR1A 5CFFE 2L3JA 2YT4A 2E5LE 2EPPA 4LTYA 2EPRA 1IBKE 2EM5A 4R2PA 2JPAA 2EM2A 5TSEA 2MKNA 4JI3E 4WPYA 2E1MA 2EN2A 4B3TE 1HNXE 2EMIA 2MKDA 3ADLA 5LMNE 2L6MA 3BBGA 1RC7A 2YSOA 5A6BA 3M99B 4RHBB 1F2IG 3IWCA 4BS9A 2VF1A 2K7IA 2GHFA 3J80C 3BGHA 2V86A 2V88A 3FIGA 2NUGA 2EPCA 2JY9A 2EMZA 2L33A 1X47A 2HHHE 1N34E 4WXCA 3AV0A 4JI5E 4M9VC 4LFCE 1G2FC 3EPKA 2EMHA 2EL5A 3EQ1A 1HNWE 1BBOA 1J26A 2EOSA 2M4IA 1BB8A 2L8TA 3IWDA 3C4BA 3THOB 5LLQA 2EWLA 4B3SE 4BBYA 1X48A 2DLQA 1RMDA 4L8NA 2V83A 2VQEE 2EM6A 2B3TB 3C6KA 5AC5A 2DSYA 3VYXA 2YTIA 1B69A 4X62E 3LLHA 4DR1E 2EPXA 2L3CA 2ENCA 2YTDA 5KL4A 4LFAE 4M2ZA 1QU6A 2MC6A 3HXLA 5LMUE 1JK1A 2EM9A 4O43A 1YYOA 4DV6E 2EORA 4NXME 2WBUA 1SR9A 3QG5C 2RSMA 5A6JA 1HR0E 2EOQA 2KOUA 2EPNA 2LUPB 3HPSA 4YHHE 4J8ZA 4WX9A 5AE2A 4M0VA 4DV4E 1EH6A 4GZNC 4JI0E 4NHRA 1WHQA 4LF9E 2VE7C 4BC7A 4LF7E 2EM4A 4TUIA 2M7QA 1XMOE 2EMGA 1ZU1A 1IQSA 3ECRA 2HGHA 1UN6B 4F9CB 2EM7A 2LO3A 1WHNA 2UXDE 1TF6A 1T38A 2YU5A 3VHTB 2EL6A 2EQ1A 2EPUA 2V87A 2EOOA 2YTNA 2A25A 2EL4A 3C4TA 1YYWA 1TN9A 4BCAA 1KYQA 3JTZA 4F6MA 1UHZA 4ZYEA 3AUZA
chains in the Genus database with same CATH topology
2YSPA 2EN1A 2EOYA 1WJPA 1X5WA 2MDGA 1F2IG 4R2CA 2GHFA 2EMBA 4F2JC 5KL3A 2EPAA 2DMIA 2VRDA 3MHSC 2YRKA 1A1IA 1X6HA 2EP3A 2LV2A 2EPCA 2EOHA 2YU8A 2EMZA 2R1FA 5KL7A 2EOMA 2YTEA 1KJKA 2LCEA 4M9VC 2EMLA 2M9AA 1A1FA 2EOXA 1G2FC 2EQ0A 3EPKA 2EMHA 2EL5A 2EMWA 2DLKA 1BBOA 2EOSA 1LLMC 2DRPA 1BB8A 2EOFA 2E72A 2EQ3A 2RPCA 1A1LA 2EN3A 2NABA 2DLQA 1RMDA 2EM6A 2EE8A 1JK2A 4FK5C 2EMYA 1P47A 2WBSA 2GLIA 1NCSA 2YTFA 4R2AA 2YTIA 2PRTA 1B69A 2EMCA 2EOEA 4X9JA 1A1HA 2EN7A 2YTJA 3UK3C 2YTPA 2EPXA 2EM3A 2ENCA 2YTDA 2YTOA 5KL4A 2EN8A 2WBTA 4F6NA 1X6FA 2CTDA 2EM0A 1JK1A 2EM9A 5KL6A 2CT1A 2EM8A 1A1JA 2DGCA 2EN4A 2EORA 2YTGA 1YSAC 2WBUA 2EMFA 2EOJA 1YUJA 2EOQA 3EPLA 2LVHA 4R2DA 2EMAA 2YRHA 1X3CA 2EOZA 2YRMA 3MHHC 2ENAA 4GZNC 2ELZA 4R2QA 2EMXA 2BB8A 2ELYA 4R2RA 2EOIA 2LT7A 2CSHA 2ENHA 2EM4A 2I13A 2EMGA 1ZU1A 1DGCA 1ZR9A 2JP9A 1AAYA 4IJDA 2EMKA 1UN6B 2HGHA 4R2SA 2YTQA 1G2DC 2J7JA 2EM7A 2LO3A 4R2EA 2EJ4A 1A1GA 1TF6A 2YU5A 3VHTB 5KL2A 3EPHA 2EL6A 4IS1C 1MEYC 1TF3A 3EPJA 5KL5A 2EQ1A 2EN6A 2EPUA 1X6EA 2EOOA 2RSIA 2A25A 2EPPA 2YTNA 2EL4A 2EPRA 2EM5A 4R2PA 2WCC3 2EM2A 1TN9A 2JPAA 2MKNA 2D9HA 2ADRA 2EN2A 1A1KA 4WSGA 2EPZA 1UBDC 4F6MA 2EMIA 1ZAAC 2MKDA 1Z1BA 2YSOA 1YUIA 3M99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSP A;  2EN1 A;  2EOY A;  1WJP A;  1X5W A;  2MDG A;  1F2I G;  4R2C A;  2GHF A;  2EMB A;  4F2J C;  5KL3 A;  2EPA A;  2DMI A;  2VRD A;  3MHS C;  2YRK A;  1A1I A;  1X6H A;  2EP3 A;  2LV2 A;  2EPC A;  2EOH A;  2YU8 A;  2EMZ A;  2R1F A;  5KL7 A;  2EOM A;  2YTE A;  1KJK A;  2LCE A;  4M9V C;  2EML A;  2M9A A;  1A1F A;  2EOX A;  1G2F C;  2EQ0 A;  3EPK A;  2EMH A;  2EL5 A;  2EMW A;  2DLK A;  1BBO A;  2EOS A;  1LLM C;  2DRP A;  1BB8 A;  2EOF A;  2E72 A;  2EQ3 A;  2RPC A;  1A1L A;  2EN3 A;  2NAB A;  2DLQ A;  1RMD A;  2EM6 A;  2EE8 A;  1JK2 A;  4FK5 C;  2EMY A;  1P47 A;  2WBS A;  2GLI A;  1NCS A;  2YTF A;  4R2A A;  2YTI A;  2PRT A;  1B69 A;  2EMC A;  2EOE A;  4X9J A;  1A1H A;  2EN7 A;  2YTJ A;  3UK3 C;  2YTP A;  2EPX A;  2EM3 A;  2ENC A;  2YTD A;  2YTO A;  5KL4 A;  2EN8 A;  2WBT A;  4F6N A;  1X6F A;  2CTD A;  2EM0 A;  1JK1 A;  2EM9 A;  5KL6 A;  2CT1 A;  2EM8 A;  1A1J A;  2DGC A;  2EN4 A;  2EOR A;  2YTG A;  1YSA C;  2WBU A;  2EMF A;  2EOJ A;  1YUJ A;  2EOQ A;  3EPL A;  2LVH A;  4R2D A;  2EMA A;  2YRH A;  1X3C A;  2EOZ A;  2YRM A;  3MHH C;  2ENA A;  4GZN C;  2ELZ A;  4R2Q A;  2EMX A;  2BB8 A;  2ELY A;  4R2R A;  2EOI A;  2LT7 A;  2CSH A;  2ENH A;  2EM4 A;  2I13 A;  2EMG A;  1ZU1 A;  1DGC A;  1ZR9 A;  2JP9 A;  1AAY A;  4IJD A;  2EMK A;  1UN6 B;  2HGH A;  4R2S A;  2YTQ A;  1G2D C;  2J7J A;  2EM7 A;  2LO3 A;  4R2E A;  2EJ4 A;  1A1G A;  1TF6 A;  2YU5 A;  3VHT B;  5KL2 A;  3EPH A;  2EL6 A;  4IS1 C;  1MEY C;  1TF3 A;  3EPJ A;  5KL5 A;  2EQ1 A;  2EN6 A;  2EPU A;  1X6E A;  2EOO A;  2RSI A;  2A25 A;  2EPP A;  2YTN A;  2EL4 A;  2EPR A;  2EM5 A;  4R2P A;  2WCC 3;  2EM2 A;  1TN9 A;  2JPA A;  2MKN A;  2D9H A;  2ADR A;  2EN2 A;  1A1K A;  4WSG A;  2EPZ A;  1UBD C;  4F6M A;  2EMI A;  1ZAA C;  2MKD A;  1Z1B A;  2YSO A;  1YUI A;  3M99 B; 
#chains in the Genus database with same CATH topology
 2EN1 A;  1WJP A;  2YPN A;  2MDG A;  3T1H E;  4R2C A;  2RS7 A;  2EMB A;  3DF6 A;  4F2J C;  5F3W A;  4DR5 E;  3MHS C;  4ZYH A;  2MC5 A;  4KWY A;  1EH8 A;  2EP3 A;  4DV2 E;  2NA2 A;  1N33 E;  2YTE A;  1SFE A;  4JYA E;  1UIL A;  2VQF E;  2LCE A;  2EML A;  5IWA E;  2EOX A;  2WZO A;  4NZV A;  2UU9 E;  2M1S A;  2EOF A;  5A69 A;  1STU A;  2E72 A;  2RPC A;  4DKK A;  1N36 E;  2NUF A;  2EN3 A;  2NAB A;  1FJG E;  3P1X A;  2ODR D;  1PJS A;  1N3G A;  1YZ9 A;  1T4N A;  2EMY A;  4GKJ E;  5LL6 R;  4JI6 E;  2YTF A;  3JU0 A;  4DR2 E;  2EOE A;  4KZS A;  4DV7 E;  2YTJ A;  2I9I A;  4GKK E;  1PDA A;  4AQY E;  2EM3 A;  2WBT A;  2IHR 1;  2CTD A;  2KHX A;  2YWQ A;  3DJW A;  1YSA C;  4LFB E;  1NEI A;  4DMI A;  2EOJ A;  2N8X A;  2LJU A;  1O0W A;  4Q28 A;  4R8O A;  4OX9 E;  2LRS A;  2LVH A;  4R2D A;  2YRH A;  1X3C A;  1YFH A;  2EOZ A;  2YRM A;  4TUG A;  4DR4 E;  1T39 A;  2ELZ A;  2B9D A;  2ELY A;  4R2R A;  4WXD A;  3ZOQ B;  3OML A;  4MLQ A;  4X64 E;  1GTK A;  4IJD A;  5ADZ A;  5AC4 A;  2YTQ A;  4DR7 E;  2ODR C;  4R2E A;  2UXB E;  3F6H A;  2HC5 A;  1XNQ E;  1TF3 A;  3EPJ A;  2R76 A;  5A2Q C;  2EN6 A;  2WCC 3;  4HTG A;  4JI4 E;  3KZY A;  2D9H A;  1T4O A;  2JXP A;  2EPZ A;  3ADG A;  4WSG A;  1ZAA C;  4LF5 E;  1ZBT A;  1A1G A;  3F6G A;  4ZYG A;  2YSP A;  2CPN A;  1X5W A;  4F9A B;  4X66 E;  4JI7 E;  1BBG A;  3KWR A;  5AE1 A;  1WRJ A;  4Q35 B;  1XMQ E;  2YRK A;  1A1I A;  4LF8 E;  1PJQ A;  3K6Q A;  2EOH A;  2YU8 A;  2R1F A;  2EOM A;  4P7D A;  1KJK A;  5A6B D;  4B3R E;  2RQL A;  4LU9 A;  1QNT A;  4DV5 E;  3L00 A;  2G7H A;  1IBM E;  2EMW A;  2DRP A;  3H09 A;  2EZ6 A;  4GEQ B;  4P78 A;  3OTO E;  2MDR A;  1XNR E;  4FK5 C;  4WFT A;  2ZM6 E;  2GLI A;  1NCS A;  4O24 A;  4R2A A;  2PRT A;  2EMC A;  1DQ3 A;  5AE3 A;  1ZBQ A;  3UK3 C;  3J81 C;  2EN8 A;  4YY3 E;  5A6A A;  5KL6 A;  2EM8 A;  2DGC A;  1IMU A;  4RH8 A;  2EN4 A;  2LBS B;  1WXR A;  2NUE A;  1J5E E;  1YUJ A;  4O4K A;  1GQE A;  2EMA A;  2JOX A;  4I8O A;  4O5G A;  2K4V A;  4JI2 E;  4KHP E;  3VK6 A;  2L92 A;  1DI2 A;  2H36 X;  2EMX A;  4R03 A;  1PKP A;  1MGT A;  2I13 A;  3MSW A;  2FTX B;  2FGG A;  3ADJ A;  4B3M E;  1ZR9 A;  1AAY A;  4X8W A;  2L2M A;  2KON A;  2J7J A;  4DV1 E;  5KL2 A;  4IS1 C;  4DUZ E;  3HPZ A;  2N3H A;  5KL5 A;  2LMZ A;  2RS6 A;  1X6E A;  2RSI A;  1FKA E;  2F4V E;  2ADR A;  1A1K A;  1UBD C;  2HJJ A;  5IT9 C;  2UUB E;  2L2K B;  1Z1B A;  4DV3 E;  1IBL E;  1YUI A;  5T6J A;  4DR3 E;  4WYQ B;  2EOY A;  4L5N C;  2V89 A;  4WSP A;  3J7A G;  1L4S A;  1AH5 A;  2UUC E;  5KL3 A;  2FV4 B;  2EPA A;  2DMI A;  2VRD A;  2BBG A;  1X6H A;  4F9B B;  4ZYD A;  2LV2 A;  2Q8U A;  5KL7 A;  1GZ6 A;  1N32 E;  1YYK A;  2DB2 A;  5AAS A;  2RTX A;  4BMJ A;  2N3G A;  2B7T A;  2DMY A;  2M9A A;  1A1F A;  4NXN E;  1EKZ A;  2DIX A;  2JYA A;  3BID A;  5FLX C;  2EQ0 A;  2V8Q B;  3T1Y E;  2DLK A;  1EH7 A;  1LLM C;  3RMP A;  4K0K E;  2EQ3 A;  3THN A;  4X65 E;  1A1L A;  2YZT A;  4JV5 E;  1HNZ E;  3BF2 A;  4DR6 E;  2LE2 A;  2EE8 A;  1JK2 A;  3HQ1 A;  4JI8 E;  2LTS A;  4LF4 E;  1P47 A;  1T4L B;  3ADI A;  2WBS A;  2LUQ A;  1A1H A;  3LML A;  4X9J A;  2JWO A;  2EN7 A;  2UUA E;  2EPK X;  1X49 A;  4N4R B;  1PJT A;  2YTP A;  4DUY E;  2YTO A;  4F6N A;  1X6F A;  4F54 A;  3C6M A;  2EM0 A;  1RQ0 A;  2CT1 A;  1A1J A;  2L2N A;  2YTG A;  4JI1 E;  3IWB A;  3TQM A;  2EMF A;  5BR8 E;  3JAM C;  4BHB A;  5DNY A;  3EPL A;  2EPO A;  2EPM X;  1IQO A;  4BC9 A;  2LTR A;  4M30 A;  3MHH C;  4DV0 E;  2ENA A;  2GPI A;  5IV8 B;  3KZZ A;  1YPN A;  4OOG C;  5A6K A;  3HTX A;  2F8B A;  2LJH A;  4R2Q A;  2BB8 A;  1I94 E;  2EOI A;  2LT7 A;  2CSH A;  2ENH A;  2JVA A;  4HEI A;  2B7V A;  2V85 A;  2JP9 A;  1DGC A;  2EPL X;  4BHC A;  2EMK A;  3J7Y p;  2JOB A;  4R2S A;  4MLV A;  5IXM B;  1G2D C;  3VYY A;  2EJ4 A;  2UXC E;  4LF6 E;  3EPH A;  1MEY C;  2JR1 A;  5CFF E;  2L3J A;  2YT4 A;  2E5L E;  2EPP A;  4LTY A;  2EPR A;  1IBK E;  2EM5 A;  4R2P A;  2JPA A;  2EM2 A;  5TSE A;  2MKN A;  4JI3 E;  4WPY A;  2E1M A;  2EN2 A;  4B3T E;  1HNX E;  2EMI A;  2MKD A;  3ADL A;  5LMN E;  2L6M A;  3BBG A;  1RC7 A;  2YSO A;  5A6B A;  3M99 B;  4RHB B;  1F2I G;  3IWC A;  4BS9 A;  2VF1 A;  2K7I A;  2GHF A;  3J80 C;  3BGH A;  2V86 A;  2V88 A;  3FIG A;  2NUG A;  2EPC A;  2JY9 A;  2EMZ A;  2L33 A;  1X47 A;  2HHH E;  1N34 E;  4WXC A;  3AV0 A;  4JI5 E;  4M9V C;  4LFC E;  1G2F C;  3EPK A;  2EMH A;  2EL5 A;  3EQ1 A;  1HNW E;  1BBO A;  1J26 A;  2EOS A;  2M4I A;  1BB8 A;  2L8T A;  3IWD A;  3C4B A;  3THO B;  5LLQ A;  2EWL A;  4B3S E;  4BBY A;  1X48 A;  2DLQ A;  1RMD A;  4L8N A;  2V83 A;  2VQE E;  2EM6 A;  2B3T B;  3C6K A;  5AC5 A;  2DSY A;  3VYX A;  2YTI A;  1B69 A;  4X62 E;  3LLH A;  4DR1 E;  2EPX A;  2L3C A;  2ENC A;  2YTD A;  5KL4 A;  4LFA E;  4M2Z A;  1QU6 A;  2MC6 A;  3HXL A;  5LMU E;  1JK1 A;  2EM9 A;  4O43 A;  1YYO A;  4DV6 E;  2EOR A;  4NXM E;  2WBU A;  1SR9 A;  3QG5 C;  2RSM A;  5A6J A;  1HR0 E;  2EOQ A;  2KOU A;  2EPN A;  2LUP B;  3HPS A;  4YHH E;  4J8Z A;  4WX9 A;  5AE2 A;  4M0V A;  4DV4 E;  1EH6 A;  4GZN C;  4JI0 E;  4NHR A;  1WHQ A;  4LF9 E;  2VE7 C;  4BC7 A;  4LF7 E;  2EM4 A;  4TUI A;  2M7Q A;  1XMO E;  2EMG A;  1ZU1 A;  1IQS A;  3ECR A;  2HGH A;  1UN6 B;  4F9C B;  2EM7 A;  2LO3 A;  1WHN A;  2UXD E;  1TF6 A;  1T38 A;  2YU5 A;  3VHT B;  2EL6 A;  2EQ1 A;  2EPU A;  2V87 A;  2EOO A;  2YTN A;  2A25 A;  2EL4 A;  3C4T A;  1YYW A;  1TN9 A;  4BCA A;  1KYQ A;  3JTZ A;  4F6M A;  1UHZ A;  4ZYE A;  3AUZ A; 
#chains in the Genus database with same CATH homology
 2YSP A;  2EN1 A;  2EOY A;  1WJP A;  1X5W A;  2MDG A;  1F2I G;  4R2C A;  2GHF A;  2EMB A;  4F2J C;  5KL3 A;  2EPA A;  2DMI A;  2VRD A;  3MHS C;  2YRK A;  1A1I A;  1X6H A;  2EP3 A;  2LV2 A;  2EPC A;  2EOH A;  2YU8 A;  2EMZ A;  2R1F A;  5KL7 A;  2EOM A;  2YTE A;  1KJK A;  2LCE A;  4M9V C;  2EML A;  2M9A A;  1A1F A;  2EOX A;  1G2F C;  2EQ0 A;  3EPK A;  2EMH A;  2EL5 A;  2EMW A;  2DLK A;  1BBO A;  2EOS A;  1LLM C;  2DRP A;  1BB8 A;  2EOF A;  2E72 A;  2EQ3 A;  2RPC A;  1A1L A;  2EN3 A;  2NAB A;  2DLQ A;  1RMD A;  2EM6 A;  2EE8 A;  1JK2 A;  4FK5 C;  2EMY A;  1P47 A;  2WBS A;  2GLI A;  1NCS A;  2YTF A;  4R2A A;  2YTI A;  2PRT A;  1B69 A;  2EMC A;  2EOE A;  4X9J A;  1A1H A;  2EN7 A;  2YTJ A;  3UK3 C;  2YTP A;  2EPX A;  2EM3 A;  2ENC A;  2YTD A;  2YTO A;  5KL4 A;  2EN8 A;  2WBT A;  4F6N A;  1X6F A;  2CTD A;  2EM0 A;  1JK1 A;  2EM9 A;  5KL6 A;  2CT1 A;  2EM8 A;  1A1J A;  2DGC A;  2EN4 A;  2EOR A;  2YTG A;  1YSA C;  2WBU A;  2EMF A;  2EOJ A;  1YUJ A;  2EOQ A;  3EPL A;  2LVH A;  4R2D A;  2EMA A;  2YRH A;  1X3C A;  2EOZ A;  2YRM A;  3MHH C;  2ENA A;  4GZN C;  2ELZ A;  4R2Q A;  2EMX A;  2BB8 A;  2ELY A;  4R2R A;  2EOI A;  2LT7 A;  2CSH A;  2ENH A;  2EM4 A;  2I13 A;  2EMG A;  1ZU1 A;  1DGC A;  1ZR9 A;  2JP9 A;  1AAY A;  4IJD A;  2EMK A;  1UN6 B;  2HGH A;  4R2S A;  2YTQ A;  1G2D C;  2J7J A;  2EM7 A;  2LO3 A;  4R2E A;  2EJ4 A;  1A1G A;  1TF6 A;  2YU5 A;  3VHT B;  5KL2 A;  3EPH A;  2EL6 A;  4IS1 C;  1MEY C;  1TF3 A;  3EPJ A;  5KL5 A;  2EQ1 A;  2EN6 A;  2EPU A;  1X6E A;  2EOO A;  2RSI A;  2A25 A;  2EPP A;  2YTN A;  2EL4 A;  2EPR A;  2EM5 A;  4R2P A;  2WCC 3;  2EM2 A;  1TN9 A;  2JPA A;  2MKN A;  2D9H A;  2ADR A;  2EN2 A;  1A1K A;  4WSG A;  2EPZ A;  1UBD C;  4F6M A;  2EMI A;  1ZAA C;  2MKD A;  1Z1B A;  2YSO A;  1YUI A;  3M99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...