2DLRA

Solution structure of the rgs domain of human regulator of g-protein signaling 10
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
149
Chain Sequence
GSSGSSGSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RGS domain of human Regulator of G-protein signaling 10
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Regulator of G-protein signaling 10
total genus 34
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00615 RGS Regulator of G protein signaling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dlrA00
3AB3B 2DLRA 3C50A 2ES0A 1ZV4X 3CX7B 2ACXA 3CX6B 2PBIA 4WNKA 3C4ZA 2A72A 4L9IA 2I59A 3C51A 3C4WA 1IAPA 3QC9A 3T8OA 4GOUA 1HTJF 3CX8B 3C4XA 1SHZC 4YHJA 4PNIA 4IGUA 4WBOA
chains in the Genus database with same CATH superfamily
3AB3B 2K9AA 2Z6EA 3QOFA 4BJMA 2CM0A 1WYCA 3N9LA 3FB2A 3C50A 2ES0A 4UR9A 4EEBA 2V5DA 2JQQA 1HNZT 1O3XA 4GYSA 2BS4A 3GN5B 1HX8A 4HEAA 5DQVA 4I43B 2KZ7B 5AQOB 4ZI3C 2UXNB 4ZHQE 5JR9B 2CWYA 2WMOA 2WM9A 4I50E 4O4HE 4EOZB 5ABEA 2BDEA 1OEDB 2XAGB 2X66A 4U7IA 4ADZA 4NPPA 2XASB 4UXNB 2W67A 2YKSA 3DJBA 4AQFA 5FL1A 3AEFA 5HEUA 3RC3A 2WB5A 1KNRA 3NRYA 3PDYA 1N36T 2V7IA 3RLFF 2IHR1 5FL0A 3RH3A 3ZT5A 2H7OA 4DNDA 1G8XA 3UU6A 1M7KA 5KXJA 4UV8B 3OTOT 1YQ3A 1S94A 3AE1A 3PE0A 2YN6A 3AE2A 3FXEB 5DJQC 3ZSTA 2XAJB 2D0UA 3UFEA 4GK5E 4A56A 5IWAT 2W0GA 2L8KA 2W00A 3C64A 3HKDE 4ASKA 3PU8A 5LGNB 4ISSA 4UVAB 2WQYA 2OA5A 1XWMA 2V7KA 3CIRA 3ETVA 4H9RC 2XQ4A 4HFEA 2FJBA 2Q9QC 1M62A 4QX8B 4X1YE 3CX7B 5ABFB 3AE3A 2DWGA 5LOVE 3ZMUB 5HWXA 5LBQB 3RC8A 4PFOA 3F31A 1WFDA 3IBPA 2LKHA 2VK9A 3JCFA 3HKEE 3KVAA 5CFBA 4O2BE 3ZMZB 1VOMA 3L09A 3CVRA 4OFZA 4ZOLE 2VQET 4P0AA 4UF0B 3KV9A 5FXVA 3P4QA 1FMWA 4U74A 5EK4A 4TWFA 2IUBA 3RKGA 2EHOD 2PTFA 2WAUA 3ANWA 3FBLA 3SS1A 4DR2T 4DV6T 5F8PA 3T1HT 3GA8A 4FI5A 4QHOA 4IDOA 4LF8T 3PUZF 4ISTA 3FXDB 2LM9A 2VKOA 4IE5A 3RYCE 3K1SA 4TV9E 4JI8T 3IEEA 3VR8A 2W62A 1UGOA 2UXXB 3N9OA 3SFDA 2IDOB 3ZCJA 3GMIA 1UX4A 4CXXA 4E7ZA 5CA0E 3IHRA 4GK0E 2ZM2A 3CQGB 2W4XA 3I9WA 2V8SV 3TLWA 4X64T 4DR7T 2DWKA 1QUUA 4ZI2D 1XMOT 2UUAT 5CB4E 4X66T 3UUXB 4N78D 2V6YA 4P1NA 2JQKA 3EUHA 2D2SA 5HXEA 5LMUT 3UUNA 5E0OA 3GWHA 3NVOA 3ZYMA 3NZQA 4CI2B 2WS3A 2V26A 2JRKA 3C4XA 1V9DA 3EI0A 1W0AA 2NW7A 3CK6A 2LSJA 2Q9QA 4HKAA 2LSGA 2RPAA 2ODVA 3FZFB 2BBHA 3KBTA 5IYZE 1XDOA 3RHWA 3SFEA 5CJ5A 3P4WA 5LXTE 3QB5A 2BG9E 3RIUA 5ABGA 2M6BA 4JI3T 4DR5T 4AKHA 4DV7T 4OX9T 3ZMSB 2N1GA 4YSXA 4O4LE 4X1IE 2UXBT 2NWBA 3UFGA 3UUMA 4JYAT 5AQFB 3PU3A 3AVSA 3PUVF 1ZEEA 2BG9A 2HN2A 4DR3T 1MNDA 1SE7A 4I4TE 2PBIA 3UU3A 4JLEA 2A72A 4IDZA 3ZPOA 2CBIA 3ZT6A 4CQIA 4C91A 3AE8A 5AQIB 4QXCB 3ZLIA 3AECA 2CE7A 1HFAA 1T7SA 5JRCB 1NAFA 2LSKA 1Y64B 2XQ3A 2YDQA 3KV6A 3N9MA 4HFBA 1ZOYA 5F5WA 2MBGA 3RPUA 3JAFA 3VR9A 3ZJ1A 5JQGE 4LF6T 3N5LA 3OYXA 4OHFA 1SHZC 5FMNA 4ANJA 2E9XB 1HG2A 1QSDA 2CHNA 3DP7A 3K3OA 4AKLA 2X9WA 4CXYA 2VVNA 3AAIA 3NKZA 3ONXA 4JI0T 5JRCA 1MIYA 3RIAA 4BAYB 5JDLA 2FJAA 4F8HA 4WBNE 1YQ4A 2QRXA 3AEGA 4YSYA 3NBXX 1JNRA 3F2EA 2L3LA 2JJ9A 5C2TA 3BK9A 3BQLA 2XQYA 1XNRT 2IC6A 3BQIA 2N2NA 3I0OA 5FKYA 5DABA 4EZ4A 4H9SE 2NR4A 4TNVA 3PUSA 4YFSA 5IUXA 4AISA 2CA5A 3UUBA 1SUMB 4ZEYA 3D0TA 3RQWA 5L3GB 5HEJA 4PW8A 2XM1A 5LA6E 2EHOB 3N9QA 3P4SA 3QC9A 4PJJA 5J1GA 3RRWA 3UQ4A 4AXPA 5L3BB 2X0YA 3L3PA 2IW5B 1Y01A 3KDSE 5AQGB 2QGSA 2L9QA 4CI1B 1DU2A 4YJ3E 2JQHA 2QA7A 2Q9QB 2XQ6A 4XBFB 2XJ7A 4DBQA 5LG3A 1US7B 1X79A 4B6XA 5J0ZA 2YEVC 2C5IT 2WZIA 3LJCA 4GYRA 4JI6T 2WWUA 2LRKA 3UU4A 4ILAA 2VL0A 2ODUA 1FIOA 5HEGA 3AE6A 3FZKB 4OYKA 3KBUA 1I94T 1U4QA 1UK5A 2ACXA 5L3DB 3QUJA 2NW9A 3EDUA 4PFPA 4IREA 3R6NA 3JADA 1VRBA 2EHOA 3F57A 4HGAA 3HKCE 4I0UA 2D5UA 4IE4A 4KBMB 3J9X1 3ZN1B 1HR0T 1HNWT 4B3RT 2IC9A 2VWAA 4UV9B 3I9YA 3AA7B 3OYZA 1NEKA 4GOUA 5LG4A 1KNZA 3AEEA 4LF9T 3Q5DA 4QKNA 5JDMA 1IBLT 3G06A 2WMNA 1IJ6A 2LE8A 1YKEB 3ETUA 4JI1T 3AEBA 2E8IA 1W09A 2MAWA 1FMVA 2KT9A 4B3TT 4QXBB 1E7PA 4YXDA 2M67A 5EZYE 4PJNA 1ZP0A 4LMJA 4CI3B 2XZEA 1U5PA 5HXSA 4LFCT 3MZKB 2MTQA 3MA9A 3AEDA 2ZM0A 2LJLA 3CQCB 3RIUC 2HPLA 2CWOA 4UVCB 1QLBA 1WR6A 5H6QB 2BBJA 2X51A 3C4ZA 2XM2A 3LBXB 2QVAA 3RGLA 4ZZBA 5FXWA 3K8PC 1UUSA 1IBKT 3C51A 3LDQB 1BR4A 5LYJE 5FXZA 3OVUA 1N33T 3C4WA 3PURA 2UU9T 2BKNA 4DV4T 4F6RC 5KMGP 3H3MA 4LMLA 5ETWA 2A2FX 5L4HA 3OBVE 2AE9A 5FVLA 3PUAA 2PFVA 5JDFA 1S35A 5J2UE 3LFMA 5EK2A 5LB7B 3ZYKA 5AQUB 2E5LT 2C5JA 1BR2A 1XDPA 2X0LB 3LG7A 3AA0B 4UELA 2XSAA 4BJNA 5L47A 3RYHE 4KHPT 4B3MT 2QYWA 2X0HA 2I0MA 2EHOC 2PJQA 3H37A 3HR0A 5EK3A 4O8SA 4DMWA 4LFAT 4QH1A 4EAHA 1ZKEA 2LLYA 2CPTA 2X9XA 3AE9A 3Q2MA 3VU7H 3ZT7A 4PK6A 5JDNA 2E2AA 1FEWA 4ZZCA 2MYSA 4L0RA 4PJLA 4GKJT 4AKRB 3PUXF 4KUMB 3L39A 2BZBA 4K0KT 4IL4A 4PAGA 4U2YA 4Z91A 2E9XC 1D0YA 5FNVE 5ABHA 1LRZA 4FJOA 2JPFA 2K24A 1J1JA 3FZLB 2VL8A 3QB5K 2C0SA 5JDGA 4QWNB 5LHHB 5FY1A 3ZC0A 3MK7C 1SA0E 2H89A 4UIGA 3CKDA 4HFVA 3I0QA 5HCJA 5LGUB 1HNXT 1IBMT 2PG8A 4KI0F 4EXTA 3AA6B 2F4VT 2YINA 4K0UA 3RF1A 5AQPB 2FJDA 2X9HA 3FZHB 4IDNA 1VCTA 1BR1A 3RX6A 3T1YT 3M65A 2LHRA 2LHNA 4MLKA 2WY2A 4HN9A 4XZCA 4JEHB 2Y6XA 2V1DB 2DL1A 4YLHA 1ZV4X 2XQ5A 4IHJE 4DVDA 2UXCT 2W66A 4HWIB 2OLTA 3QK6A 4AKIA 3ANWB 1G73A 4X62T 3RKOA 2VKHA 3RIFA 4G63A 1HX1B 4X5TA 3U3IA 4U72A 2CHOA 3OKQA 5HXCA 4YHHT 1J5ET 1KF6A 4QH5A 4HFIA 3SWHA 1D1AA 5L3CB 3MKDA 4O2AE 2BKOA 5JTGA 2RP4A 3RYFE 3U78A 3AXJA 4P0BA 5LMNT 3NZPA 2CMRA 2XUEA 3WI3A 2NW8A 5A1LA 3V5SA 1HS7A 2UXDT 2B76A 3E22E 3RI5A 1LVFA 1H7CA 3PUGA 4Z8XA 4GIWA 2DCFA 3KV5A 4LMKA 4EGWA 2XSBA 1KNPA 2KINB 4O4IE 4DV1T 2ZM8A 3RRCA 5LNKA 3AAEB 3LK3B 1BR0A 2DI4A 2WDQA 2SPCA 1MNEA 2XHEB 4NUVA 4WNKA 3ZEFB 4LF5T 2M6IA 2X9YA 2VASA 5JR9C 4L9IA 2D0TA 1MMAA 2RA1A 4HTEA 2R6GF 4EV6A 2JQ9A 2LSIA 3N2OA 2YDRA 4ILUA 4EIWA 2V7MA 4EYUA 3IF8B 3KVBA 5FY7A 4HWDA 2V6XA 5AFUL 3TKLB 5FXXA 4YY3T 5JVDE 2YK0A 1E2AA 1IZNB 2E9XA 2LEHA 2Y48B 2YOEA 4HE8A 3AE7A 4TUYE 5AQQB 3AXJB 5AQKB 3WAKA 5LJNA 3TLTA 3OPCA 1YKHB 4NXNT 4KX6A 4H63V 5L2LA 3P50A 2IAKA 1D1CA 4H9NC 3ZKRA 1R8IA 5C3JA 3PV0F 3UQ7A 3OJAA 2LRLA 4JI2T 4DV3T 4AKGA 5FVKA 1HG5A 2XQ7A 3ZMVB 3JC6D 2VB6A 1D0ZA 1W9RA 5AQMB 2CXFA 5AQSB 5LCYA 1T98A 5L3EB 2VVSA 3MJXA 4IE7A 5FY0A 5GONE 4EB6E 4E7SA 4HWFA 4JV5T 2BG9C 3P4PA 2CRBA 4DR6T 2AXDS 2LM2A 4M1PA 4UEMA 2BS2A 3PJAJ 3PJAA 5HCMA 1AJ3A 1NENA 4LFBT 4EYYR 2XQ8A 5BMVE 1I6ZA 4HFCA 3Q5WA 1YD8G 2IIUA 2WSSV 4HWHA 4UVBB 5FP3A 3SOLA 1CUNA 3CPZA 2GK9A 2CLYB 2H88A 5JREA 3O1JA 3N2KE 1OEDA 3ZCIA 3S4UA 4EZHA 4NUUA 2XTLA 4QH4A 3TLSA 1Z8UA 3QNUA 5LBMA 3UULA 2V6YB 4HWCA 2HHHT 1UX5A 5H6RB 2YU1A 1LKXA 4U33A 3EABA 5BR8T 3RYIE 1KK7A 2OV9A 3E0ZA 4H9QC 4U2ZA 1WCRA 3AAAB 3ABVA 3CX6B 2W2UA 2XAFB 2XY8B 3EDVA 2XQ9A 1CHUA 4IE0A 4IT4A 2CXDA 4BA9A 2K3WA 3PUQA 4O4JE 1N32T 5M4YA 4X1KE 1NWMX 1HTJF 1T8BA 3R84B 4A98A 2I6HA 4AI6A 1WLXA 4IE6A 4IDQA 2XAQB 5HAXA 4PJMA 3HA4A 4X65T 2K5BB 3IA3A 4HFHA 2J62A 3A8YC 4CXWA 4DV0T 1WRDA 2WDRA 1HCIA 1XNQT 3AE4A 2LOPA 1MIVA 2WDVA 3B57A 4TZ4C 3UTKA 4WZXA 4JUYA 4KMCA 4J2CA 3PUYF 3J7Yq 2FUPA 4UF0A 4DR1T 3C98B 3ZMTB 2KNDA 4IDPA 4PK4A 2ZLYA 2C5KT 5HXRA 5KX5E 4GKKT 3E08A 3EVYA 3CQXC 3O1IA 5HWYA 3WAJA 4JI7T 4DR4T 3O9XA 2KXPB 2JMKA 3LBXA 4AQGA 3HKBE 4IIJE 4WYVA 3EAMA 3KFWX 4A5XA 2WCAA 5KDMC 1OWAA 2WU2A 4ZI2C 4DUYT 3P7IA 3PTRB 2LOSA 1KEYA 2VURA 3LSVA 4QX7B 5CGMA 4ILBA 4TX5A 4AQFC 2CEAA 4MHCA 2KSRA 5DQWA 3JC6C 3M3ZB 4HFDA 2XAHB 4L5GA 3TLUA 5LP6E 3CX8B 1D0XA 1OEDE 2BKPA 2CLYC 1MIWA 2ACZA 2NP9A 2W63A 4AIUA 2MOZA 2N9DA 3LK2B 4TN7B 1OXZA 2WZHA 5AQJB 5AQNB 4CN1A 4JEUB 4X20E 4YHJA 5JH7E 5C8YE 3PUWF 4IGUA 2FJEA 1KFYA 2NOXA 4V1Av 4G2AA 1W0BA 2HH7A 3N9PA 5LJMA 4DV5T 2MPKA 4JI4T 3FZMB 2HPJA 4U3CA 4CZZB 3KINB 4COFA 4ZI7E 1WR0A 5L3FB 3EHZA 2WWVA 3P4RA 2B1EA 1WYBA 3BQKA 1ZHCA 2A9UA 3O1HA 2LSYA 2BVLA 2Q9QD 4MFRA 5HEHA 4KHZF 3MXZA 2P9BA 3P8CD 5IHYA 3AVRA 4B3ST 1OEDC 3Q5EA 2XPKA 3A5XA 4ZS3A 5JR9A 4EEDA 1YW0A 2X68A 4ERRA 4YSZA 2VQFT 2WP9A 4OYJA 1B7TA 1XMQT 2JIWA 4ZS2A 4LF7T 4YJ2E 2KLQA 3HI2A 2YU2A 2BVMA 3LK42 3NWIA 3Q9DA 2G0UA 4U7YA 3HL6A 5AQLB 3T8OA 4QXHB 4Q25A 1T72A 4U31A 4WW0A 3DTOA 3FBZA 2UUCT 3O4XE 5LHGB 2NTYA 5AQHB 3ESLA 3UU5A 2YDSA 2A3DA 3KV4A 2ZMAA 2DNXA 1IJ5A 2JMHA 3N2GE 4I55E 1Z0PA 2D9DA 2DLRA 1MMGA 1MMNA 2BS3A 3AE5A 2KMFA 2J1DG 2WU5A 4MBQA 2Y8DA 2KWHA 2H3RA 3CMLA 3FHNA 3MACA 3NRXA 5AQRB 5AQTB 4H9OC 2LKGA 2K48A 1GQEA 5LHIB 1D1BA 4TWDA 4AQYT 4C90A 4XAXB 2ZM6T 1MMDA 4DMVA 4YTMA 4TV8E 1J5WA 2X67A 2NTXA 3ZJ2A 4LF4T 3RQUA 1N34T 3UT5E 2I59A 2WBLA 2FBWA 4H63H 3VHLA 4DV2T 1IAPA 4YT0A 3ZYLA 4A97A 1HF8A 4DBRA 4DO0A 3ZSSA 3SRZA 3A7MA 4JBWF 5ADXL 4NIQA 3X1DA 3I1AA 2J47A 3VRAA 5F3JA 1YXRA 3GN5A 3VRBA 5ABFA 4KP3C 4TNWA 3Q5XA 5CA1E 2LT3A 5JDQA 3AA1B 4PNIA 4WBOA 2CXLA 3TLVA 4NXMT 5FYMA 2VKJA 3B13A 4Z90A 4YTNA 3B5MA 5JDHA 5J2TE 2V7JA 4JI5T 1LVKA 3V5UA 3K3NA 2DHRA 1E1HB 4ILCA 3UU8A 5HEOA 2E5VA 5L4EA 5AQVB 2IMLA 4PK5A 3ONLC 5LGTB 5TAOA 4ZXLA 4IL9A 3N9NA 3L8RA 4H9PC 2BG9B 4CN4A 5HXHA 1XZYA 5HYAA 3VKHA 2HN1A 1EZ3A 4P09A 2E9XD 2J4GA 1JNZA 2H7VC 4CN6A 4DIDB 3JAEA 2CBJA 1UCUA 3W15B 3VKGA 1L0VA 2W61A 3ONJA 2V7LA 1FJGT 3AEAA 2VKDA 3K3QC 2CCQA 3H3AA 4TWHA 1X9BA 2XQAA 4YTPA 4ZI3D 3ZN0B 4DUZT 4OK0A 3CWZB 2UUBT 2V5CA 3ZC1A 2KWIB 1UURA 1VCSA 4MALA
chains in the Genus database with same CATH topology
3AB3B 2K9AA 2Z6EA 4BJMA 2CM0A 1WYCA 3N9LA 3FB2A 3C50A 2ES0A 2JQQA 1O3XA 4GYSA 3GN5B 4HEAA 1HX8A 5DQVA 4ZI3C 4I43B 2KZ7B 4ZHQE 2UXNB 5JR9B 2CWYA 2WMOA 2WM9A 4I50E 4O4HE 4EOZB 2BDEA 2XAGB 2X66A 4ADZA 2XASB 4UXNB 3DJBA 4AQFA 3RC3A 3NRYA 3PDYA 2V7IA 3RH3A 2H7OA 4DNDA 1G8XA 4UV8B 3PE0A 1S94A 5DJQC 3FXEB 2XAJB 2D0UA 3UFEA 4GK5E 4A56A 2W0GA 2L8KA 2W00A 3C64A 3HKDE 4ASKA 3PU8A 5LGNB 4ISSA 4UVAB 2OA5A 2V7KA 3ETVA 4H9RC 4ZOLE 3UUXB 4BA9A 4X1YE 2Q9QC 4QX8B 5HWXA 3CX7B 3ZMUB 2DWGA 5LOVE 3RC8A 5LBQB 4PFOA 3F31A 3IBPA 3KVAA 2VK9A 3HKEE 4O2BE 3ZMZB 1VOMA 3L09A 3CVRA 4OFZA 4P0AA 4UF0B 3KV9A 5FXVA 1FMWA 4U74A 5EK4A 2EHOD 2WAUA 3ANWA 3FBLA 3SS1A 5F8PA 3GA8A 4FI5A 4QHOA 4ISTA 3FXDB 2LM9A 2VKOA 4IE5A 3RYCE 4TV9E 3IEEA 2W62A 2UXXB 3N9OA 3ZCJA 3GMIA 1UX4A 4CXXA 4E7ZA 5CA0E 3IHRA 4GK0E 2ZM2A 3CQGB 3I9WA 2DWKA 1QUUA 4ZI2D 5CB4E 4N78D 5HXEA 3EUHA 2D2SA 3UUNA 5E0OA 3GWHA 3ZYMA 3NZQA 4CI2B 3C4XA 2V26A 2JRKA 5L3EB 1V9DA 2NW7A 4HKAA 2LSJA 2Q9QA 2LSGA 2ODVA 3KBTA 5IYZE 5LXTE 4AKHA 3ZMSB 2N1GA 4O4LE 4X1IE 2NWBA 3UUMA 3PU3A 3AVSA 1ZEEA 1MNDA 4I4TE 2PBIA 3ZPOA 4JLEA 2A72A 4IDZA 4C91A 4CQIA 4QXCB 3ZLIA 2CE7A 1HFAA 5JRCB 1NAFA 2LSKA 1Y64B 3KV6A 3N9MA 3RPUA 2MBGA 5JQGE 3ZJ1A 3N5LA 3OYXA 4OHFA 1SHZC 5FMNA 4ANJA 2E9XB 1HG2A 1QSDA 3DP7A 3K3OA 4AKLA 2X9WA 4CXYA 3AAIA 3ONXA 1MIYA 4BAYB 5JDLA 4WBNE 3NBXX 3F2EA 2L3LA 2JJ9A 3BK9A 3BQLA 2XQYA 2IC6A 3BQIA 2N2NA 3I0OA 5DABA 4EZ4A 4H9SE 4YFSA 3PUSA 2CA5A 5L3GB 3D0TA 4PW8A 5LA6E 2EHOB 3N9QA 3QC9A 4PJJA 5J1GA 3RRWA 5L3BB 4AXPA 3L3PA 2IW5B 3KDSE 2QGSA 2L9QA 4CI1B 4YJ3E 4XBFB 2QA7A 2Q9QB 4DBQA 1X79A 1US7B 4B6XA 2YEVC 2C5IT 3LJCA 4GYRA 2WWUA 2ODUA 1FIOA 4OYKA 3KBUA 1U4QA 5L3DB 2ACXA 3QUJA 2NW9A 3EDUA 4PFPA 3R6NA 1VRBA 2EHOA 3F57A 4HGAA 3HKCE 4IE4A 2D5UA 4KBMB 3J9X1 3UT5E 3ZN1B 2IC9A 2VWAA 4UV9B 3I9YA 3AA7B 3OYZA 4GOUA 5LG4A 5JDMA 4QKNA 2WMNA 1IJ6A 2LE8A 1YKEB 3ETUA 2E8IA 1FMVA 2KT9A 4QXBB 2M67A 5EZYE 4PJNA 4CI3B 1U5PA 5HXSA 3MZKB 2MTQA 3MA9A 3CQCB 2ZM0A 2LJLA 2HPLA 2CWOA 4UVCB 1WR6A 5H6QB 3C4ZA 2X51A 3LBXB 5JRCA 5FXWA 3K8PC 1KNZA 3C51A 5LYJE 1BR4A 5FXZA 3C4WA 3PURA 4F6RC 5KMGP 5ETWA 2A2FX 3OBVE 3PUAA 2PFVA 5JDFA 1S35A 5J2UE 3LFMA 5EK2A 3ZYKA 2C5JA 1BR2A 2X0LB 3LG7A 3AA0B 4UELA 4BJNA 3RYHE 3HR0A 2EHOC 2PJQA 3H37A 5EK3A 4O8SA 4DMWA 4EAHA 1ZKEA 2X9XA 3Q2MA 3VU7H 5LHHB 5JDNA 4PK6A 1FEWA 2MYSA 4L0RA 4PJLA 4AKRB 4KUMB 2BZBA 4PAGA 5FNVE 2E9XC 1D0YA 1LRZA 4FJOA 2JPFA 2K24A 2VL8A 2C0SA 5JDGA 4QWNB 5FY1A 3ZC0A 3MK7C 1SA0E 4UIGA 3CKDA 4HFVA 3I0QA 5LGUB 2PG8A 3AA6B 2YINA 4K0UA 2X9HA 3RX6A 1BR1A 3M65A 2LHRA 2LHNA 4MLKA 4HN9A 4XZCA 4JEHB 2Y6XA 2V1DB 4YLHA 1ZV4X 4IHJE 4DVDA 3QK6A 4AKIA 3ANWB 1G73A 3RKOA 4G63A 3U3IA 4U72A 3OKQA 5HXCA 3SWHA 1D1AA 5L3CB 3MKDA 4O2AE 2RP4A 3RYFE 3U78A 4P0BA 3NZPA 2CMRA 2XUEA 3WI3A 2NW8A 5A1LA 3V5SA 1HS7A 3E22E 1LVFA 1H7CA 3PUGA 4Z8XA 4GIWA 2DCFA 3KV5A 2KINB 4O4IE 2ZM8A 3RRCA 5LNKA 3AAEB 3LK3B 1BR0A 2DI4A 4NUVA 2SPCA 1MNEA 2XHEB 4WNKA 3ZEFB 2X9YA 2VASA 5JR9C 4L9IA 2D0TA 1MMAA 2RA1A 4HTEA 2LSIA 3N2OA 4ILUA 4EIWA 2V7MA 4EYUA 3IF8B 3KVBA 5FY7A 5AFUL 3TKLB 5FXXA 5JVDE 2YK0A 1IZNB 2E9XA 2LEHA 2Y48B 4HE8A 4TUYE 5LJNA 3WAKA 1YKHB 4H63V 5L2LA 2IAKA 1D1CA 4H9NC 3OJAA 4AKGA 1HG5A 3ZMVB 3JC6D 2VB6A 1D0ZA 5LCYA 2CXFA 1T98A 5GONE 3MJXA 4IE7A 5FY0A 4EB6E 4E7SA 4M1PA 4UEMA 1AJ3A 4EYYR 5BMVE 3Q5WA 1YD8G 2WSSV 4UVBB 5FP3A 3SOLA 1CUNA 3CPZA 2GK9A 2CLYB 5JREA 3O1JA 3N2KE 3ZCIA 3S4UA 4NUUA 2XTLA 5LBMA 3UULA 1UX5A 5H6RB 2YU1A 1LKXA 3RYIE 1KK7A 3E0ZA 4H9QC 3AAAB 3CX6B 2XAFB 3EDVA 4IE0A 2CXDA 3PUQA 4O4JE 5M4YA 4X1KE 1NWMX 1HTJF 3R84B 4AI6A 1WLXA 4IE6A 2XAQB 5HAXA 4PJMA 3HA4A 2K5BB 4CXWA 1WRDA 1HCIA 2LOPA 1MIVA 3B57A 4TZ4C 3UTKA 4JUYA 4KMCA 4J2CA 3J7Yq 4UF0A 3C98B 3ZMTB 2KNDA 4PK4A 2ZLYA 2C5KT 5HXRA 5KX5E 3EVYA 3E08A 3CQXC 3O1IA 5HWYA 3WAJA 3O9XA 2KXPB 2JMKA 3LBXA 4AQGA 3HKBE 4IIJE 3KFWX 5KDMC 1OWAA 4ZI2C 3P7IA 3PTRB 2LOSA 4QX7B 4TX5A 4AQFC 2CEAA 4MHCA 5DQWA 3JC6C 4L5GA 2XAHB 5LP6E 3CX8B 1D0XA 2CLYC 2NP9A 1MIWA 2W63A 2MOZA 2N9DA 3LK2B 4TN7B 1OXZA 4EXTA 4EZHA 5JH7E 4JEUB 4X20E 4YHJA 5C8YE 4IGUA 2NOXA 4V1Av 4G2AA 2HH7A 3N9PA 5LJMA 2HPJA 4CZZB 4ZI7E 3KINB 5L3FB 2B1EA 1WYBA 3BQKA 1ZHCA 3O1HA 2LSYA 2BVLA 2Q9QD 4MFRA 3MXZA 2P9BA 3P8CD 5IHYA 3AVRA 4ZS3A 3A5XA 5JR9A 4ERRA 1YW0A 2X68A 4OYJA 1B7TA 4ZS2A 4YJ2E 2KLQA 3HI2A 2YU2A 2BVMA 3LK42 3Q9DA 2G0UA 3T8OA 3HL6A 4QXHB 4WW0A 3DTOA 3FBZA 3O4XE 5LHGB 2NTYA 3ESLA 2A3DA 3KV4A 2ZMAA 2DNXA 1IJ5A 2JMHA 3N2GE 4I55E 1Z0PA 2DLRA 1MMGA 1MMNA 4MBQA 2KMFA 2J1DG 2Y8DA 2KWHA 2H3RA 3CMLA 3FHNA 3MACA 3NRXA 4H9OC 2K48A 5LHIB 1D1BA 4C90A 4XAXB 1MMDA 4DMVA 4TV8E 2X67A 3ZJ2A 2NTXA 2I59A 2WBLA 3VHLA 4H63H 1IAPA 3ZYLA 1HF8A 4DBRA 4DO0A 5ADXL 3SRZA 5F3JA 3I1AA 3GN5A 4KP3C 5CA1E 3Q5XA 5JDQA 2LT3A 3AA1B 4PNIA 4WBOA 2CXLA 5FYMA 2VKJA 3B13A 5JDHA 5J2TE 2V7JA 1LVKA 3V5UA 3K3NA 2DHRA 1E1HB 4PK5A 5LGTB 5TAOA 3N9NA 5HXHA 4H9PC 5HYAA 3VKHA 1EZ3A 4P09A 2E9XD 2H7VC 3VKGA 3W15B 1UCUA 2W61A 2V7LA 2VKDA 3K3QC 2CCQA 3H3AA 4ZI3D 3ZN0B 4OK0A 3CWZB 3ZC1A 2KWIB 2VKHA 4MALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB3 B;  2DLR A;  3C50 A;  2ES0 A;  1ZV4 X;  3CX7 B;  2ACX A;  3CX6 B;  2PBI A;  4WNK A;  3C4Z A;  2A72 A;  4L9I A;  2I59 A;  3C51 A;  3C4W A;  1IAP A;  3QC9 A;  3T8O A;  4GOU A;  1HTJ F;  3CX8 B;  3C4X A;  1SHZ C;  4YHJ A;  4PNI A;  4IGU A;  4WBO A; 
#chains in the Genus database with same CATH topology
 3AB3 B;  2K9A A;  2Z6E A;  3QOF A;  4BJM A;  2CM0 A;  1WYC A;  3N9L A;  3FB2 A;  3C50 A;  2ES0 A;  4UR9 A;  4EEB A;  2V5D A;  2JQQ A;  1HNZ T;  1O3X A;  4GYS A;  2BS4 A;  3GN5 B;  1HX8 A;  4HEA A;  5DQV A;  4I43 B;  2KZ7 B;  5AQO B;  4ZI3 C;  2UXN B;  4ZHQ E;  5JR9 B;  2CWY A;  2WMO A;  2WM9 A;  4I50 E;  4O4H E;  4EOZ B;  5ABE A;  2BDE A;  1OED B;  2XAG B;  2X66 A;  4U7I A;  4ADZ A;  4NPP A;  2XAS B;  4UXN B;  2W67 A;  2YKS A;  3DJB A;  4AQF A;  5FL1 A;  3AEF A;  5HEU A;  3RC3 A;  2WB5 A;  1KNR A;  3NRY A;  3PDY A;  1N36 T;  2V7I A;  3RLF F;  2IHR 1;  5FL0 A;  3RH3 A;  3ZT5 A;  2H7O A;  4DND A;  1G8X A;  3UU6 A;  1M7K A;  5KXJ A;  4UV8 B;  3OTO T;  1YQ3 A;  1S94 A;  3AE1 A;  3PE0 A;  2YN6 A;  3AE2 A;  3FXE B;  5DJQ C;  3ZST A;  2XAJ B;  2D0U A;  3UFE A;  4GK5 E;  4A56 A;  5IWA T;  2W0G A;  2L8K A;  2W00 A;  3C64 A;  3HKD E;  4ASK A;  3PU8 A;  5LGN B;  4ISS A;  4UVA B;  2WQY A;  2OA5 A;  1XWM A;  2V7K A;  3CIR A;  3ETV A;  4H9R C;  2XQ4 A;  4HFE A;  2FJB A;  2Q9Q C;  1M62 A;  4QX8 B;  4X1Y E;  3CX7 B;  5ABF B;  3AE3 A;  2DWG A;  5LOV E;  3ZMU B;  5HWX A;  5LBQ B;  3RC8 A;  4PFO A;  3F31 A;  1WFD A;  3IBP A;  2LKH A;  2VK9 A;  3JCF A;  3HKE E;  3KVA A;  5CFB A;  4O2B E;  3ZMZ B;  1VOM A;  3L09 A;  3CVR A;  4OFZ A;  4ZOL E;  2VQE T;  4P0A A;  4UF0 B;  3KV9 A;  5FXV A;  3P4Q A;  1FMW A;  4U74 A;  5EK4 A;  4TWF A;  2IUB A;  3RKG A;  2EHO D;  2PTF A;  2WAU A;  3ANW A;  3FBL A;  3SS1 A;  4DR2 T;  4DV6 T;  5F8P A;  3T1H T;  3GA8 A;  4FI5 A;  4QHO A;  4IDO A;  4LF8 T;  3PUZ F;  4IST A;  3FXD B;  2LM9 A;  2VKO A;  4IE5 A;  3RYC E;  3K1S A;  4TV9 E;  4JI8 T;  3IEE A;  3VR8 A;  2W62 A;  1UGO A;  2UXX B;  3N9O A;  3SFD A;  2IDO B;  3ZCJ A;  3GMI A;  1UX4 A;  4CXX A;  4E7Z A;  5CA0 E;  3IHR A;  4GK0 E;  2ZM2 A;  3CQG B;  2W4X A;  3I9W A;  2V8S V;  3TLW A;  4X64 T;  4DR7 T;  2DWK A;  1QUU A;  4ZI2 D;  1XMO T;  2UUA T;  5CB4 E;  4X66 T;  3UUX B;  4N78 D;  2V6Y A;  4P1N A;  2JQK A;  3EUH A;  2D2S A;  5HXE A;  5LMU T;  3UUN A;  5E0O A;  3GWH A;  3NVO A;  3ZYM A;  3NZQ A;  4CI2 B;  2WS3 A;  2V26 A;  2JRK A;  3C4X A;  1V9D A;  3EI0 A;  1W0A A;  2NW7 A;  3CK6 A;  2LSJ A;  2Q9Q A;  4HKA A;  2LSG A;  2RPA A;  2ODV A;  3FZF B;  2BBH A;  3KBT A;  5IYZ E;  1XDO A;  3RHW A;  3SFE A;  5CJ5 A;  3P4W A;  5LXT E;  3QB5 A;  2BG9 E;  3RIU A;  5ABG A;  2M6B A;  4JI3 T;  4DR5 T;  4AKH A;  4DV7 T;  4OX9 T;  3ZMS B;  2N1G A;  4YSX A;  4O4L E;  4X1I E;  2UXB T;  2NWB A;  3UFG A;  3UUM A;  4JYA T;  5AQF B;  3PU3 A;  3AVS A;  3PUV F;  1ZEE A;  2BG9 A;  2HN2 A;  4DR3 T;  1MND A;  1SE7 A;  4I4T E;  2PBI A;  3UU3 A;  4JLE A;  2A72 A;  4IDZ A;  3ZPO A;  2CBI A;  3ZT6 A;  4CQI A;  4C91 A;  3AE8 A;  5AQI B;  4QXC B;  3ZLI A;  3AEC A;  2CE7 A;  1HFA A;  1T7S A;  5JRC B;  1NAF A;  2LSK A;  1Y64 B;  2XQ3 A;  2YDQ A;  3KV6 A;  3N9M A;  4HFB A;  1ZOY A;  5F5W A;  2MBG A;  3RPU A;  3JAF A;  3VR9 A;  3ZJ1 A;  5JQG E;  4LF6 T;  3N5L A;  3OYX A;  4OHF A;  1SHZ C;  5FMN A;  4ANJ A;  2E9X B;  1HG2 A;  1QSD A;  2CHN A;  3DP7 A;  3K3O A;  4AKL A;  2X9W A;  4CXY A;  2VVN A;  3AAI A;  3NKZ A;  3ONX A;  4JI0 T;  5JRC A;  1MIY A;  3RIA A;  4BAY B;  5JDL A;  2FJA A;  4F8H A;  4WBN E;  1YQ4 A;  2QRX A;  3AEG A;  4YSY A;  3NBX X;  1JNR A;  3F2E A;  2L3L A;  2JJ9 A;  5C2T A;  3BK9 A;  3BQL A;  2XQY A;  1XNR T;  2IC6 A;  3BQI A;  2N2N A;  3I0O A;  5FKY A;  5DAB A;  4EZ4 A;  4H9S E;  2NR4 A;  4TNV A;  3PUS A;  4YFS A;  5IUX A;  4AIS A;  2CA5 A;  3UUB A;  1SUM B;  4ZEY A;  3D0T A;  3RQW A;  5L3G B;  5HEJ A;  4PW8 A;  2XM1 A;  5LA6 E;  2EHO B;  3N9Q A;  3P4S A;  3QC9 A;  4PJJ A;  5J1G A;  3RRW A;  3UQ4 A;  4AXP A;  5L3B B;  2X0Y A;  3L3P A;  2IW5 B;  1Y01 A;  3KDS E;  5AQG B;  2QGS A;  2L9Q A;  4CI1 B;  1DU2 A;  4YJ3 E;  2JQH A;  2QA7 A;  2Q9Q B;  2XQ6 A;  4XBF B;  2XJ7 A;  4DBQ A;  5LG3 A;  1US7 B;  1X79 A;  4B6X A;  5J0Z A;  2YEV C;  2C5I T;  2WZI A;  3LJC A;  4GYR A;  4JI6 T;  2WWU A;  2LRK A;  3UU4 A;  4ILA A;  2VL0 A;  2ODU A;  1FIO A;  5HEG A;  3AE6 A;  3FZK B;  4OYK A;  3KBU A;  1I94 T;  1U4Q A;  1UK5 A;  2ACX A;  5L3D B;  3QUJ A;  2NW9 A;  3EDU A;  4PFP A;  4IRE A;  3R6N A;  3JAD A;  1VRB A;  2EHO A;  3F57 A;  4HGA A;  3HKC E;  4I0U A;  2D5U A;  4IE4 A;  4KBM B;  3J9X 1;  3ZN1 B;  1HR0 T;  1HNW T;  4B3R T;  2IC9 A;  2VWA A;  4UV9 B;  3I9Y A;  3AA7 B;  3OYZ A;  1NEK A;  4GOU A;  5LG4 A;  1KNZ A;  3AEE A;  4LF9 T;  3Q5D A;  4QKN A;  5JDM A;  1IBL T;  3G06 A;  2WMN A;  1IJ6 A;  2LE8 A;  1YKE B;  3ETU A;  4JI1 T;  3AEB A;  2E8I A;  1W09 A;  2MAW A;  1FMV A;  2KT9 A;  4B3T T;  4QXB B;  1E7P A;  4YXD A;  2M67 A;  5EZY E;  4PJN A;  1ZP0 A;  4LMJ A;  4CI3 B;  2XZE A;  1U5P A;  5HXS A;  4LFC T;  3MZK B;  2MTQ A;  3MA9 A;  3AED A;  2ZM0 A;  2LJL A;  3CQC B;  3RIU C;  2HPL A;  2CWO A;  4UVC B;  1QLB A;  1WR6 A;  5H6Q B;  2BBJ A;  2X51 A;  3C4Z A;  2XM2 A;  3LBX B;  2QVA A;  3RGL A;  4ZZB A;  5FXW A;  3K8P C;  1UUS A;  1IBK T;  3C51 A;  3LDQ B;  1BR4 A;  5LYJ E;  5FXZ A;  3OVU A;  1N33 T;  3C4W A;  3PUR A;  2UU9 T;  2BKN A;  4DV4 T;  4F6R C;  5KMG P;  3H3M A;  4LML A;  5ETW A;  2A2F X;  5L4H A;  3OBV E;  2AE9 A;  5FVL A;  3PUA A;  2PFV A;  5JDF A;  1S35 A;  5J2U E;  3LFM A;  5EK2 A;  5LB7 B;  3ZYK A;  5AQU B;  2E5L T;  2C5J A;  1BR2 A;  1XDP A;  2X0L B;  3LG7 A;  3AA0 B;  4UEL A;  2XSA A;  4BJN A;  5L47 A;  3RYH E;  4KHP T;  4B3M T;  2QYW A;  2X0H A;  2I0M A;  2EHO C;  2PJQ A;  3H37 A;  3HR0 A;  5EK3 A;  4O8S A;  4DMW A;  4LFA T;  4QH1 A;  4EAH A;  1ZKE A;  2LLY A;  2CPT A;  2X9X A;  3AE9 A;  3Q2M A;  3VU7 H;  3ZT7 A;  4PK6 A;  5JDN A;  2E2A A;  1FEW A;  4ZZC A;  2MYS A;  4L0R A;  4PJL A;  4GKJ T;  4AKR B;  3PUX F;  4KUM B;  3L39 A;  2BZB A;  4K0K T;  4IL4 A;  4PAG A;  4U2Y A;  4Z91 A;  2E9X C;  1D0Y A;  5FNV E;  5ABH A;  1LRZ A;  4FJO A;  2JPF A;  2K24 A;  1J1J A;  3FZL B;  2VL8 A;  3QB5 K;  2C0S A;  5JDG A;  4QWN B;  5LHH B;  5FY1 A;  3ZC0 A;  3MK7 C;  1SA0 E;  2H89 A;  4UIG A;  3CKD A;  4HFV A;  3I0Q A;  5HCJ A;  5LGU B;  1HNX T;  1IBM T;  2PG8 A;  4KI0 F;  4EXT A;  3AA6 B;  2F4V T;  2YIN A;  4K0U A;  3RF1 A;  5AQP B;  2FJD A;  2X9H A;  3FZH B;  4IDN A;  1VCT A;  1BR1 A;  3RX6 A;  3T1Y T;  3M65 A;  2LHR A;  2LHN A;  4MLK A;  2WY2 A;  4HN9 A;  4XZC A;  4JEH B;  2Y6X A;  2V1D B;  2DL1 A;  4YLH A;  1ZV4 X;  2XQ5 A;  4IHJ E;  4DVD A;  2UXC T;  2W66 A;  4HWI B;  2OLT A;  3QK6 A;  4AKI A;  3ANW B;  1G73 A;  4X62 T;  3RKO A;  2VKH A;  3RIF A;  4G63 A;  1HX1 B;  4X5T A;  3U3I A;  4U72 A;  2CHO A;  3OKQ A;  5HXC A;  4YHH T;  1J5E T;  1KF6 A;  4QH5 A;  4HFI A;  3SWH A;  1D1A A;  5L3C B;  3MKD A;  4O2A E;  2BKO A;  5JTG A;  2RP4 A;  3RYF E;  3U78 A;  3AXJ A;  4P0B A;  5LMN T;  3NZP A;  2CMR A;  2XUE A;  3WI3 A;  2NW8 A;  5A1L A;  3V5S A;  1HS7 A;  2UXD T;  2B76 A;  3E22 E;  3RI5 A;  1LVF A;  1H7C A;  3PUG A;  4Z8X A;  4GIW A;  2DCF A;  3KV5 A;  4LMK A;  4EGW A;  2XSB A;  1KNP A;  2KIN B;  4O4I E;  4DV1 T;  2ZM8 A;  3RRC A;  5LNK A;  3AAE B;  3LK3 B;  1BR0 A;  2DI4 A;  2WDQ A;  2SPC A;  1MNE A;  2XHE B;  4NUV A;  4WNK A;  3ZEF B;  4LF5 T;  2M6I A;  2X9Y A;  2VAS A;  5JR9 C;  4L9I A;  2D0T A;  1MMA A;  2RA1 A;  4HTE A;  2R6G F;  4EV6 A;  2JQ9 A;  2LSI A;  3N2O A;  2YDR A;  4ILU A;  4EIW A;  2V7M A;  4EYU A;  3IF8 B;  3KVB A;  5FY7 A;  4HWD A;  2V6X A;  5AFU L;  3TKL B;  5FXX A;  4YY3 T;  5JVD E;  2YK0 A;  1E2A A;  1IZN B;  2E9X A;  2LEH A;  2Y48 B;  2YOE A;  4HE8 A;  3AE7 A;  4TUY E;  5AQQ B;  3AXJ B;  5AQK B;  3WAK A;  5LJN A;  3TLT A;  3OPC A;  1YKH B;  4NXN T;  4KX6 A;  4H63 V;  5L2L A;  3P50 A;  2IAK A;  1D1C A;  4H9N C;  3ZKR A;  1R8I A;  5C3J A;  3PV0 F;  3UQ7 A;  3OJA A;  2LRL A;  4JI2 T;  4DV3 T;  4AKG A;  5FVK A;  1HG5 A;  2XQ7 A;  3ZMV B;  3JC6 D;  2VB6 A;  1D0Z A;  1W9R A;  5AQM B;  2CXF A;  5AQS B;  5LCY A;  1T98 A;  5L3E B;  2VVS A;  3MJX A;  4IE7 A;  5FY0 A;  5GON E;  4EB6 E;  4E7S A;  4HWF A;  4JV5 T;  2BG9 C;  3P4P A;  2CRB A;  4DR6 T;  2AXD S;  2LM2 A;  4M1P A;  4UEM A;  2BS2 A;  3PJA J;  3PJA A;  5HCM A;  1AJ3 A;  1NEN A;  4LFB T;  4EYY R;  2XQ8 A;  5BMV E;  1I6Z A;  4HFC A;  3Q5W A;  1YD8 G;  2IIU A;  2WSS V;  4HWH A;  4UVB B;  5FP3 A;  3SOL A;  1CUN A;  3CPZ A;  2GK9 A;  2CLY B;  2H88 A;  5JRE A;  3O1J A;  3N2K E;  1OED A;  3ZCI A;  3S4U A;  4EZH A;  4NUU A;  2XTL A;  4QH4 A;  3TLS A;  1Z8U A;  3QNU A;  5LBM A;  3UUL A;  2V6Y B;  4HWC A;  2HHH T;  1UX5 A;  5H6R B;  2YU1 A;  1LKX A;  4U33 A;  3EAB A;  5BR8 T;  3RYI E;  1KK7 A;  2OV9 A;  3E0Z A;  4H9Q C;  4U2Z A;  1WCR A;  3AAA B;  3ABV A;  3CX6 B;  2W2U A;  2XAF B;  2XY8 B;  3EDV A;  2XQ9 A;  1CHU A;  4IE0 A;  4IT4 A;  2CXD A;  4BA9 A;  2K3W A;  3PUQ A;  4O4J E;  1N32 T;  5M4Y A;  4X1K E;  1NWM X;  1HTJ F;  1T8B A;  3R84 B;  4A98 A;  2I6H A;  4AI6 A;  1WLX A;  4IE6 A;  4IDQ A;  2XAQ B;  5HAX A;  4PJM A;  3HA4 A;  4X65 T;  2K5B B;  3IA3 A;  4HFH A;  2J62 A;  3A8Y C;  4CXW A;  4DV0 T;  1WRD A;  2WDR A;  1HCI A;  1XNQ T;  3AE4 A;  2LOP A;  1MIV A;  2WDV A;  3B57 A;  4TZ4 C;  3UTK A;  4WZX A;  4JUY A;  4KMC A;  4J2C A;  3PUY F;  3J7Y q;  2FUP A;  4UF0 A;  4DR1 T;  3C98 B;  3ZMT B;  2KND A;  4IDP A;  4PK4 A;  2ZLY A;  2C5K T;  5HXR A;  5KX5 E;  4GKK T;  3E08 A;  3EVY A;  3CQX C;  3O1I A;  5HWY A;  3WAJ A;  4JI7 T;  4DR4 T;  3O9X A;  2KXP B;  2JMK A;  3LBX A;  4AQG A;  3HKB E;  4IIJ E;  4WYV A;  3EAM A;  3KFW X;  4A5X A;  2WCA A;  5KDM C;  1OWA A;  2WU2 A;  4ZI2 C;  4DUY T;  3P7I A;  3PTR B;  2LOS A;  1KEY A;  2VUR A;  3LSV A;  4QX7 B;  5CGM A;  4ILB A;  4TX5 A;  4AQF C;  2CEA A;  4MHC A;  2KSR A;  5DQW A;  3JC6 C;  3M3Z B;  4HFD A;  2XAH B;  4L5G A;  3TLU A;  5LP6 E;  3CX8 B;  1D0X A;  1OED E;  2BKP A;  2CLY C;  1MIW A;  2ACZ A;  2NP9 A;  2W63 A;  4AIU A;  2MOZ A;  2N9D A;  3LK2 B;  4TN7 B;  1OXZ A;  2WZH A;  5AQJ B;  5AQN B;  4CN1 A;  4JEU B;  4X20 E;  4YHJ A;  5JH7 E;  5C8Y E;  3PUW F;  4IGU A;  2FJE A;  1KFY A;  2NOX A;  4V1A v;  4G2A A;  1W0B A;  2HH7 A;  3N9P A;  5LJM A;  4DV5 T;  2MPK A;  4JI4 T;  3FZM B;  2HPJ A;  4U3C A;  4CZZ B;  3KIN B;  4COF A;  4ZI7 E;  1WR0 A;  5L3F B;  3EHZ A;  2WWV A;  3P4R A;  2B1E A;  1WYB A;  3BQK A;  1ZHC A;  2A9U A;  3O1H A;  2LSY A;  2BVL A;  2Q9Q D;  4MFR A;  5HEH A;  4KHZ F;  3MXZ A;  2P9B A;  3P8C D;  5IHY A;  3AVR A;  4B3S T;  1OED C;  3Q5E A;  2XPK A;  3A5X A;  4ZS3 A;  5JR9 A;  4EED A;  1YW0 A;  2X68 A;  4ERR A;  4YSZ A;  2VQF T;  2WP9 A;  4OYJ A;  1B7T A;  1XMQ T;  2JIW A;  4ZS2 A;  4LF7 T;  4YJ2 E;  2KLQ A;  3HI2 A;  2YU2 A;  2BVM A;  3LK4 2;  3NWI A;  3Q9D A;  2G0U A;  4U7Y A;  3HL6 A;  5AQL B;  3T8O A;  4QXH B;  4Q25 A;  1T72 A;  4U31 A;  4WW0 A;  3DTO A;  3FBZ A;  2UUC T;  3O4X E;  5LHG B;  2NTY A;  5AQH B;  3ESL A;  3UU5 A;  2YDS A;  2A3D A;  3KV4 A;  2ZMA A;  2DNX A;  1IJ5 A;  2JMH A;  3N2G E;  4I55 E;  1Z0P A;  2D9D A;  2DLR A;  1MMG A;  1MMN A;  2BS3 A;  3AE5 A;  2KMF A;  2J1D G;  2WU5 A;  4MBQ A;  2Y8D A;  2KWH A;  2H3R A;  3CML A;  3FHN A;  3MAC A;  3NRX A;  5AQR B;  5AQT B;  4H9O C;  2LKG A;  2K48 A;  1GQE A;  5LHI B;  1D1B A;  4TWD A;  4AQY T;  4C90 A;  4XAX B;  2ZM6 T;  1MMD A;  4DMV A;  4YTM A;  4TV8 E;  1J5W A;  2X67 A;  2NTX A;  3ZJ2 A;  4LF4 T;  3RQU A;  1N34 T;  3UT5 E;  2I59 A;  2WBL A;  2FBW A;  4H63 H;  3VHL A;  4DV2 T;  1IAP A;  4YT0 A;  3ZYL A;  4A97 A;  1HF8 A;  4DBR A;  4DO0 A;  3ZSS A;  3SRZ A;  3A7M A;  4JBW F;  5ADX L;  4NIQ A;  3X1D A;  3I1A A;  2J47 A;  3VRA A;  5F3J A;  1YXR A;  3GN5 A;  3VRB A;  5ABF A;  4KP3 C;  4TNW A;  3Q5X A;  5CA1 E;  2LT3 A;  5JDQ A;  3AA1 B;  4PNI A;  4WBO A;  2CXL A;  3TLV A;  4NXM T;  5FYM A;  2VKJ A;  3B13 A;  4Z90 A;  4YTN A;  3B5M A;  5JDH A;  5J2T E;  2V7J A;  4JI5 T;  1LVK A;  3V5U A;  3K3N A;  2DHR A;  1E1H B;  4ILC A;  3UU8 A;  5HEO A;  2E5V A;  5L4E A;  5AQV B;  2IML A;  4PK5 A;  3ONL C;  5LGT B;  5TAO A;  4ZXL A;  4IL9 A;  3N9N A;  3L8R A;  4H9P C;  2BG9 B;  4CN4 A;  5HXH A;  1XZY A;  5HYA A;  3VKH A;  2HN1 A;  1EZ3 A;  4P09 A;  2E9X D;  2J4G A;  1JNZ A;  2H7V C;  4CN6 A;  4DID B;  3JAE A;  2CBJ A;  1UCU A;  3W15 B;  3VKG A;  1L0V A;  2W61 A;  3ONJ A;  2V7L A;  1FJG T;  3AEA A;  2VKD A;  3K3Q C;  2CCQ A;  3H3A A;  4TWH A;  1X9B A;  2XQA A;  4YTP A;  4ZI3 D;  3ZN0 B;  4DUZ T;  4OK0 A;  3CWZ B;  2UUB T;  2V5C A;  3ZC1 A;  2KWI B;  1UUR A;  1VCS A;  4MAL A; 
#chains in the Genus database with same CATH homology
 3AB3 B;  2K9A A;  2Z6E A;  4BJM A;  2CM0 A;  1WYC A;  3N9L A;  3FB2 A;  3C50 A;  2ES0 A;  2JQQ A;  1O3X A;  4GYS A;  3GN5 B;  4HEA A;  1HX8 A;  5DQV A;  4ZI3 C;  4I43 B;  2KZ7 B;  4ZHQ E;  2UXN B;  5JR9 B;  2CWY A;  2WMO A;  2WM9 A;  4I50 E;  4O4H E;  4EOZ B;  2BDE A;  2XAG B;  2X66 A;  4ADZ A;  2XAS B;  4UXN B;  3DJB A;  4AQF A;  3RC3 A;  3NRY A;  3PDY A;  2V7I A;  3RH3 A;  2H7O A;  4DND A;  1G8X A;  4UV8 B;  3PE0 A;  1S94 A;  5DJQ C;  3FXE B;  2XAJ B;  2D0U A;  3UFE A;  4GK5 E;  4A56 A;  2W0G A;  2L8K A;  2W00 A;  3C64 A;  3HKD E;  4ASK A;  3PU8 A;  5LGN B;  4ISS A;  4UVA B;  2OA5 A;  2V7K A;  3ETV A;  4H9R C;  4ZOL E;  3UUX B;  4BA9 A;  4X1Y E;  2Q9Q C;  4QX8 B;  5HWX A;  3CX7 B;  3ZMU B;  2DWG A;  5LOV E;  3RC8 A;  5LBQ B;  4PFO A;  3F31 A;  3IBP A;  3KVA A;  2VK9 A;  3HKE E;  4O2B E;  3ZMZ B;  1VOM A;  3L09 A;  3CVR A;  4OFZ A;  4P0A A;  4UF0 B;  3KV9 A;  5FXV A;  1FMW A;  4U74 A;  5EK4 A;  2EHO D;  2WAU A;  3ANW A;  3FBL A;  3SS1 A;  5F8P A;  3GA8 A;  4FI5 A;  4QHO A;  4IST A;  3FXD B;  2LM9 A;  2VKO A;  4IE5 A;  3RYC E;  4TV9 E;  3IEE A;  2W62 A;  2UXX B;  3N9O A;  3ZCJ A;  3GMI A;  1UX4 A;  4CXX A;  4E7Z A;  5CA0 E;  3IHR A;  4GK0 E;  2ZM2 A;  3CQG B;  3I9W A;  2DWK A;  1QUU A;  4ZI2 D;  5CB4 E;  4N78 D;  5HXE A;  3EUH A;  2D2S A;  3UUN A;  5E0O A;  3GWH A;  3ZYM A;  3NZQ A;  4CI2 B;  3C4X A;  2V26 A;  2JRK A;  5L3E B;  1V9D A;  2NW7 A;  4HKA A;  2LSJ A;  2Q9Q A;  2LSG A;  2ODV A;  3KBT A;  5IYZ E;  5LXT E;  4AKH A;  3ZMS B;  2N1G A;  4O4L E;  4X1I E;  2NWB A;  3UUM A;  3PU3 A;  3AVS A;  1ZEE A;  1MND A;  4I4T E;  2PBI A;  3ZPO A;  4JLE A;  2A72 A;  4IDZ A;  4C91 A;  4CQI A;  4QXC B;  3ZLI A;  2CE7 A;  1HFA A;  5JRC B;  1NAF A;  2LSK A;  1Y64 B;  3KV6 A;  3N9M A;  3RPU A;  2MBG A;  5JQG E;  3ZJ1 A;  3N5L A;  3OYX A;  4OHF A;  1SHZ C;  5FMN A;  4ANJ A;  2E9X B;  1HG2 A;  1QSD A;  3DP7 A;  3K3O A;  4AKL A;  2X9W A;  4CXY A;  3AAI A;  3ONX A;  1MIY A;  4BAY B;  5JDL A;  4WBN E;  3NBX X;  3F2E A;  2L3L A;  2JJ9 A;  3BK9 A;  3BQL A;  2XQY A;  2IC6 A;  3BQI A;  2N2N A;  3I0O A;  5DAB A;  4EZ4 A;  4H9S E;  4YFS A;  3PUS A;  2CA5 A;  5L3G B;  3D0T A;  4PW8 A;  5LA6 E;  2EHO B;  3N9Q A;  3QC9 A;  4PJJ A;  5J1G A;  3RRW A;  5L3B B;  4AXP A;  3L3P A;  2IW5 B;  3KDS E;  2QGS A;  2L9Q A;  4CI1 B;  4YJ3 E;  4XBF B;  2QA7 A;  2Q9Q B;  4DBQ A;  1X79 A;  1US7 B;  4B6X A;  2YEV C;  2C5I T;  3LJC A;  4GYR A;  2WWU A;  2ODU A;  1FIO A;  4OYK A;  3KBU A;  1U4Q A;  5L3D B;  2ACX A;  3QUJ A;  2NW9 A;  3EDU A;  4PFP A;  3R6N A;  1VRB A;  2EHO A;  3F57 A;  4HGA A;  3HKC E;  4IE4 A;  2D5U A;  4KBM B;  3J9X 1;  3UT5 E;  3ZN1 B;  2IC9 A;  2VWA A;  4UV9 B;  3I9Y A;  3AA7 B;  3OYZ A;  4GOU A;  5LG4 A;  5JDM A;  4QKN A;  2WMN A;  1IJ6 A;  2LE8 A;  1YKE B;  3ETU A;  2E8I A;  1FMV A;  2KT9 A;  4QXB B;  2M67 A;  5EZY E;  4PJN A;  4CI3 B;  1U5P A;  5HXS A;  3MZK B;  2MTQ A;  3MA9 A;  3CQC B;  2ZM0 A;  2LJL A;  2HPL A;  2CWO A;  4UVC B;  1WR6 A;  5H6Q B;  3C4Z A;  2X51 A;  3LBX B;  5JRC A;  5FXW A;  3K8P C;  1KNZ A;  3C51 A;  5LYJ E;  1BR4 A;  5FXZ A;  3C4W A;  3PUR A;  4F6R C;  5KMG P;  5ETW A;  2A2F X;  3OBV E;  3PUA A;  2PFV A;  5JDF A;  1S35 A;  5J2U E;  3LFM A;  5EK2 A;  3ZYK A;  2C5J A;  1BR2 A;  2X0L B;  3LG7 A;  3AA0 B;  4UEL A;  4BJN A;  3RYH E;  3HR0 A;  2EHO C;  2PJQ A;  3H37 A;  5EK3 A;  4O8S A;  4DMW A;  4EAH A;  1ZKE A;  2X9X A;  3Q2M A;  3VU7 H;  5LHH B;  5JDN A;  4PK6 A;  1FEW A;  2MYS A;  4L0R A;  4PJL A;  4AKR B;  4KUM B;  2BZB A;  4PAG A;  5FNV E;  2E9X C;  1D0Y A;  1LRZ A;  4FJO A;  2JPF A;  2K24 A;  2VL8 A;  2C0S A;  5JDG A;  4QWN B;  5FY1 A;  3ZC0 A;  3MK7 C;  1SA0 E;  4UIG A;  3CKD A;  4HFV A;  3I0Q A;  5LGU B;  2PG8 A;  3AA6 B;  2YIN A;  4K0U A;  2X9H A;  3RX6 A;  1BR1 A;  3M65 A;  2LHR A;  2LHN A;  4MLK A;  4HN9 A;  4XZC A;  4JEH B;  2Y6X A;  2V1D B;  4YLH A;  1ZV4 X;  4IHJ E;  4DVD A;  3QK6 A;  4AKI A;  3ANW B;  1G73 A;  3RKO A;  4G63 A;  3U3I A;  4U72 A;  3OKQ A;  5HXC A;  3SWH A;  1D1A A;  5L3C B;  3MKD A;  4O2A E;  2RP4 A;  3RYF E;  3U78 A;  4P0B A;  3NZP A;  2CMR A;  2XUE A;  3WI3 A;  2NW8 A;  5A1L A;  3V5S A;  1HS7 A;  3E22 E;  1LVF A;  1H7C A;  3PUG A;  4Z8X A;  4GIW A;  2DCF A;  3KV5 A;  2KIN B;  4O4I E;  2ZM8 A;  3RRC A;  5LNK A;  3AAE B;  3LK3 B;  1BR0 A;  2DI4 A;  4NUV A;  2SPC A;  1MNE A;  2XHE B;  4WNK A;  3ZEF B;  2X9Y A;  2VAS A;  5JR9 C;  4L9I A;  2D0T A;  1MMA A;  2RA1 A;  4HTE A;  2LSI A;  3N2O A;  4ILU A;  4EIW A;  2V7M A;  4EYU A;  3IF8 B;  3KVB A;  5FY7 A;  5AFU L;  3TKL B;  5FXX A;  5JVD E;  2YK0 A;  1IZN B;  2E9X A;  2LEH A;  2Y48 B;  4HE8 A;  4TUY E;  5LJN A;  3WAK A;  1YKH B;  4H63 V;  5L2L A;  2IAK A;  1D1C A;  4H9N C;  3OJA A;  4AKG A;  1HG5 A;  3ZMV B;  3JC6 D;  2VB6 A;  1D0Z A;  5LCY A;  2CXF A;  1T98 A;  5GON E;  3MJX A;  4IE7 A;  5FY0 A;  4EB6 E;  4E7S A;  4M1P A;  4UEM A;  1AJ3 A;  4EYY R;  5BMV E;  3Q5W A;  1YD8 G;  2WSS V;  4UVB B;  5FP3 A;  3SOL A;  1CUN A;  3CPZ A;  2GK9 A;  2CLY B;  5JRE A;  3O1J A;  3N2K E;  3ZCI A;  3S4U A;  4NUU A;  2XTL A;  5LBM A;  3UUL A;  1UX5 A;  5H6R B;  2YU1 A;  1LKX A;  3RYI E;  1KK7 A;  3E0Z A;  4H9Q C;  3AAA B;  3CX6 B;  2XAF B;  3EDV A;  4IE0 A;  2CXD A;  3PUQ A;  4O4J E;  5M4Y A;  4X1K E;  1NWM X;  1HTJ F;  3R84 B;  4AI6 A;  1WLX A;  4IE6 A;  2XAQ B;  5HAX A;  4PJM A;  3HA4 A;  2K5B B;  4CXW A;  1WRD A;  1HCI A;  2LOP A;  1MIV A;  3B57 A;  4TZ4 C;  3UTK A;  4JUY A;  4KMC A;  4J2C A;  3J7Y q;  4UF0 A;  3C98 B;  3ZMT B;  2KND A;  4PK4 A;  2ZLY A;  2C5K T;  5HXR A;  5KX5 E;  3EVY A;  3E08 A;  3CQX C;  3O1I A;  5HWY A;  3WAJ A;  3O9X A;  2KXP B;  2JMK A;  3LBX A;  4AQG A;  3HKB E;  4IIJ E;  3KFW X;  5KDM C;  1OWA A;  4ZI2 C;  3P7I A;  3PTR B;  2LOS A;  4QX7 B;  4TX5 A;  4AQF C;  2CEA A;  4MHC A;  5DQW A;  3JC6 C;  4L5G A;  2XAH B;  5LP6 E;  3CX8 B;  1D0X A;  2CLY C;  2NP9 A;  1MIW A;  2W63 A;  2MOZ A;  2N9D A;  3LK2 B;  4TN7 B;  1OXZ A;  4EXT A;  4EZH A;  5JH7 E;  4JEU B;  4X20 E;  4YHJ A;  5C8Y E;  4IGU A;  2NOX A;  4V1A v;  4G2A A;  2HH7 A;  3N9P A;  5LJM A;  2HPJ A;  4CZZ B;  4ZI7 E;  3KIN B;  5L3F B;  2B1E A;  1WYB A;  3BQK A;  1ZHC A;  3O1H A;  2LSY A;  2BVL A;  2Q9Q D;  4MFR A;  3MXZ A;  2P9B A;  3P8C D;  5IHY A;  3AVR A;  4ZS3 A;  3A5X A;  5JR9 A;  4ERR A;  1YW0 A;  2X68 A;  4OYJ A;  1B7T A;  4ZS2 A;  4YJ2 E;  2KLQ A;  3HI2 A;  2YU2 A;  2BVM A;  3LK4 2;  3Q9D A;  2G0U A;  3T8O A;  3HL6 A;  4QXH B;  4WW0 A;  3DTO A;  3FBZ A;  3O4X E;  5LHG B;  2NTY A;  3ESL A;  2A3D A;  3KV4 A;  2ZMA A;  2DNX A;  1IJ5 A;  2JMH A;  3N2G E;  4I55 E;  1Z0P A;  2DLR A;  1MMG A;  1MMN A;  4MBQ A;  2KMF A;  2J1D G;  2Y8D A;  2KWH A;  2H3R A;  3CML A;  3FHN A;  3MAC A;  3NRX A;  4H9O C;  2K48 A;  5LHI B;  1D1B A;  4C90 A;  4XAX B;  1MMD A;  4DMV A;  4TV8 E;  2X67 A;  3ZJ2 A;  2NTX A;  2I59 A;  2WBL A;  3VHL A;  4H63 H;  1IAP A;  3ZYL A;  1HF8 A;  4DBR A;  4DO0 A;  5ADX L;  3SRZ A;  5F3J A;  3I1A A;  3GN5 A;  4KP3 C;  5CA1 E;  3Q5X A;  5JDQ A;  2LT3 A;  3AA1 B;  4PNI A;  4WBO A;  2CXL A;  5FYM A;  2VKJ A;  3B13 A;  5JDH A;  5J2T E;  2V7J A;  1LVK A;  3V5U A;  3K3N A;  2DHR A;  1E1H B;  4PK5 A;  5LGT B;  5TAO A;  3N9N A;  5HXH A;  4H9P C;  5HYA A;  3VKH A;  1EZ3 A;  4P09 A;  2E9X D;  2H7V C;  3VKG A;  3W15 B;  1UCU A;  2W61 A;  2V7L A;  2VKD A;  3K3Q C;  2CCQ A;  3H3A A;  4ZI3 D;  3ZN0 B;  4OK0 A;  3CWZ B;  3ZC1 A;  2KWI B;  2VKH A;  4MAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...