2DM2A

Solution structure of the first ig domain of human palladin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
GSSGSSGAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords palladin
publication title Solution structure of the first ig domain of human palladin
rcsb
source organism Homo sapiens
total genus 12
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dm2A00
5DGQA 5E4IA 4JZNA 3VH8G 3UTZA 5HHNA 4HIXH 4KHTH 1KPUB 4OD3L 3T2PA 1GJIA 1BOYA 4O5LL 3CVHL 3VDBA 3I6GA 1X7QA 1G7MB 1QSZA 1P7QB 4HDIB 4Y5YA 3CFIC 1QZ1A 3SE4C 4GSDL 4HEPG 3LSOA 4LNVA 1VEPA 3BX7C 4CU6A 4F7PB 2ZCLL 3RVXD 5C08E 3K2UH 2Y36H 1OM3L 3O3DA 3KLDA 2WUBL 4F7TB 2ID5A 1IBGH 2HFGH 3TFKC 3QR2A 3U1SL 2AVGA 3NH7H 4P2RA 2X4QA 1YYLH 4BUGA 1CDJA 5IGXL 3GO1L 4Z9KB 1QLFB 1DBJL 1T03H 4YJZL 3TBSA 1F4YH 3SKMA 5D1XA 4BZ2L 4S0TD 4G9DA 5D4QA 4U0QB 1CS6A 4UU9A 1N59A 2J8UE 4FQPA 4BQ8A 3ZT6A 4L8SA 1IC1A 2V9RA 4PV9A 4MQSB 4PJFA 2HVKB 1UXSA 5EO0B 4YGVB 5M7QA 4OQTH 2OK0L 1MHPH 2DQFA 5DUBA 1HINH 1CYGA 1HOCB 4GKSB 2AQ1A 3ARBD 5IB3B 1A3QA 1PZ5A 3QEGH 1UQSB 4I1NB 1OTTD 5EIQA 5DJDB 4OTXL 2VXVH 2X4TB 3CCHB 1WFOA 3D2UA 4EUPH 1OY3B 1KG0B 4JN2A 2AGJL 2BVQB 4IIQC 1CN4A 3CFJA 4PJ7B 3CZFB 3MODH 1R24A 2YK1L 4B5EA 1S9VA 1B0RB 1KPRA 1MHCA 1Z9MA 1JUFA 1AKJD 1Q72L 3W11D 3L6FA 1KJMB 2YA2A 5FCUL 1JZ7A 2D4DA 4M7ZB 1K8DB 5DD6A 5DFWH 1YMMD 3MRJA 2ZUWA 1B88A 2JB5L 3H3KA 1M6OA 1V7ML 3U9PH 4JG0L 1DVFB 5GJTH 1BD2A 3V79C 5LG1A 2E6QA 4QWWC 3T0DA 3SE3A 43CAA 5FK9A 1A1MA 3MFFA 3DBXB 2ADGB 4CW1A 4ELMB 2WBJB 2H2SD 4PJAF 1I1FA 4BFGA 1MJUL 5IW6B 3E6HB 4P4KC 5I1GH 4E42A 3PWPB 4QF1A 3FN0L 5T5FL 3V0VA 1TJGL 1RJZB 1CL7L 1NBYB 3PP4H 3TYGL 5C0FB 4UINH 3NA9H 2F58H 4J4PA 4Y4FD 4OFKA 3HS0A 3R06B 4JN1L 4PUBH 2PXYB 3MJ9H 1T3FB 1E4WH 3PHSA 1T04B 3NABH 4UBDD 4Z0BL 4YFEA 5HHQB 4ISVA 2CIIA 1KFAL 3MV7B 5IF0B 3U30C 3FFCD 5IT2H 1HNGA 1T1WB 2F53E 4N8VA 5E99L 5E1AA 1Y6KR 1K9TA 4PJXE 2OTWA 5EU3A 3MLWL 4LQFL 4OF8A 3DVNB 1Q1JH 3EJYC 4ZOCA 1GAFL 4E5XA 5DVMA 2IPTL 4LLQA 2AXHA 2AABL 4GFTB 4K3DL 3RWIA 2ZOLB 5B39B 1IEBB 2A9ML 4MJIA 4Y5XA 4YHMH 4K3EH 5L2JA 1TQBC 4GBXC 2W9DH 4ZS6D 4OF0A 3GI8L 4BJLA 4K7PX 3DVGB 1I1YB 3EOTL 2BC4B 1S9WA 3GJEA 1U8HA 2QQNL 3V8CA 1DL7H 1TIUA 2XY1A 3V7MA 4YBQC 4ODXA 2P5ED 2IGFH 2BVOB 3I6KB 3MRMB 3GSWB 4NWTL 3TO4D 2VOTA 2YPLE 4K94H 1LILA 4PB0H 1RI8A 3IDIB 4LKXA 4XPGH 5E94A 4YHLL 3BZEB 3W0WB 3O0RH 3QG7L 4MQ7A 2O93L 1CGXA 1ZLUH 1FNEA 2AV7B 3BMVA 4OV5B 1VKXB 3Q1SH 3LN4A 4MAUL 1A0QH 3QAZC 5GJSL 5HYSG 2HLFC 4B7IA 3ZYOA 3GRWA 4KZEL 2IFFL 3VMOA 5LGHL 5EBMA 3STZA 4FTVD 3VFTA 1BOGA 4MCYB 5F1IA 4UQ3A 1CT8B 4M9PA 3U0PB 1LO5A 1NCTA 1PFCA 3QUXA 4OGZA 1S7WA 2YEZB 4KTEH 4J1UA 2IALB 1BIHA 1LK2B 1N3NA 4R6UA 1U8MA 3WKNA 5C0GB 5DRNA 4A2LA 1FV1B 4QRTB 1FFOA 5DQDL 1FL6B 4TUKH 3ARSA 4KQ4H 1DLFL 2VDNH 1FCCA 4DTGH 1QYGH 2E8YA 3DYPA 4JFFB 3HAEA 2VWEE 3VXUD 2Z92A 1TDQA 1TXKA 3HZKA 4F37K 3ALXA 4ZOAA 3RHWF 1GGTA 4XVTH 4HJJL 3PDDA 4RSVA 2BNUA 4Z77B 2HAZA 4FQIH 4PV8A 3HNVL 2EDXA 5GS1B 1JMZA 3S36H 3ZZ1A 1MFCL 3VRLE 4BSVA 4Z8FL 5D7LD 4FXGB 1R6VA 1XIWC 3CK0H 3RWHB 5HDBF 2J7LA 1BMGA 3IGAB 4FABL 3QQ4A 5AZ2L 4LARH 5I0ZA 3EOBB 3VXRA 1IRAY 4M62H 4OSUH 3D85B 2EXYC 4OZFB 4RQQB 3TPKA 3GBNH 2EYRB 1JGEA 4G6KH 3UX9B 1SBBA 3L9RA 5DD3H 3SGJC 3MLPA 1JF6A 3WS3A 1D5MA 5GGQL 4HV8B 3KPLB 3WO3B 1ZT1B 4YXLH 2DQJH 3MBED 4KI5C 2R0LL 4U3HA 3VD4A 4RMSA 5CZKA 4PTUA 3AFLA 1X5LA 5E8OA 2CMRH 1OARL 3QIUB 4G6FD 4MVBC 2H32H 2VDKL 4UOJA 1V7NH 3BSZH 2X9XA 2B7DT 3WXWH 1UXWA 3DX9A 2FR4B 2ADIA 4X6CA 4K94C 2Y06H 4LSPL 5T3ZE 4HUKB 2EZ0C 4M7JH 2ZSVA 1SYSA 2DWEA 5T3ZL 3CH1B 4RFEB 4O2EA 5K9QI 3NACH 3AAZA 3TFKD 1JGLH 4BA8A 1TNNA 1DQLL 1VFAA 4HWBH 5I2IB 5EO1B 5KVEH 4RDQG 5MERB 5DSCA 1WAAE 5J8OA 2YUZA 2EDEA 2Z4QA 4HS3A 5FEBA 3DROA 3AVEA 1U3HB 4O58H 5D7IF 5FUCE 3NFSL 4R97C 5FF6B 5IMOA 4AEHL 4WU5A 2EDRA 4PJHF 4KUZL 5L8LB 3KXFD 4YFLI 4HK3N 1CLCA 3VWJC 5J7CC 1F6AA 4HWNA 3FO9B 2OZ4H 1RUMH 3Q6GL 3SJVB 1F58L 3L3HA 1E28A 3HC3L 2BJML 3ULSB 4N0FB 3G5VA 2DQIH 3CFEB 1A6AB 2EDFA 4JFYB 4Y16A 3RUGA 2Z31B 3KGRA 3VW3H 3FT2A 3G5XA 1KJ2L 4FP8H 1JMXA 4G43B 4KMTL 1ZHNA 2VQ1A 5KW9H 1I9IH 4UOW1 4G8GB 1UM4L 4XNXH 1FSKC 3WXVH 3FB6A 2B4CC 4F9PA 4O9HL 5DQ9B 1K8IB 4LRIC 4YUEL 1A9BA 5DUML 5SV3A 5C86A 2X70A 2JTDA 4FQ2L 4RBPH 1Q9LA 4Z76B 2Q6WB 5IMLA 1GPOL 2JCCE 5EZLB 1CD1B 3GI9H 1WISA 5BZWB 5H8DA 4ODTH 3L3DB 1OSPL 5T33H 1NCDL 5DJ6A 1Z3GL 4Q9CA 4LCCA 4QWWD 5BS0D 2BY3A 1MFEH 4YIQA 2AK4D 1QBLH 2MOVA 1AQDB 1D5BA 4FFWC 4XNZB 5FGBC 5CJQL 5KZCD 3RRQA 5F7YC 4UQ2A 3OF6D 2EEDA 4JE4B 4WFED 1YMME 1I9RH 3WNKA 4TNWF 1KCVH 4P4KD 4ZUWB 1CQKA 3VFUB 1ADQL 3NZ8B 1AC0A 3RGHA 5CD5C 4GRMA 3NIDE 3RVTC 1MNUL 2GT9A 4LBEA 2PTUA 3MROB 4JM2F 5E8DH 2CPCA 5K93A 2CDFB 5B8CC 2X6MA 1XF3B 1RIVL 1RAMA 3RKDC 1B4JL 1KPVA 3C2AH 3QNZA 2BFVH 4GG6E 3FQXB 1NMCC 3DARA 5EOTB 3RDTA 4MWFA 3DJ9A 3BIKB 3VGAB 2NY3C 3DUHA 3QXTA 4M1DL 1MREH 2NY2B 3NFNB 4JHWL 4RIRB 4Q6IC 3JV5A 5E2VH 5MEQA 3G9VA 3MV11 3VDCA 4PRBA 4C83B 3EJYD 4HUUA 4POUB 1MF2L 3QO1A 4JO3H 5CGTA 2I9TA 4LRNL 4G6JL 1OWRM 3ZSTA 2VLKD 3C8KA 3QUMA 5BXFB 2GSGA 1OD7A 1QSFA 4JFED 2WM0A 3FFCE 1RUKH 3HUJA 2DQEL 1DSFH 4HJGB 1J8HA 4P3DB 2ZUVA 1Q9WB 1L7TH 1ERNA 2F5BH 3S35L 5FYKL 4F33A 5F9JB 4NN7C 3L5WA 5E6ZA 3FQUA 1YZZA 3KYNB 2ZPKL 1ZWIA 3MRNA 3HC4L 3V7AG 2EDKA 1WK0A 4H5SA 4XCEA 4GRWF 2EC8A 1U8QA 5C1MB 5L88L 4PJCF 5BO1L 5DJ0A 3SE9L 2OJZH 4ZUTA 2HLFD 3BGMB 1H8NA 4HLZG 2EH7H 3MGOB 5FYJD 3LHPH 2P5EE 4UUJB 1BFVL 2D7PA 1BEYH 4L4VA 4W4NA 4OKVB 1G6RL 1F00I 1WWWX 3RWCB 1HI6B 1WZ1L 3NTCH 4GKOA 5CMAB 3TT3H 4JO2H 4HKJA 4OJFH 5F3HB 3C09C 5TDNA 3U0WL 4Y19A 3JWDL 1ZA3A 1I7RB 1CXKA 1M4KA 3BGFB 4JJ5A 1D9KB 3TVMB 1Y6NR 2GUOA 3O45A 1XGPA 4HH9A 1CLYH 3FT3B 1FJ1A 4FTVE 1HXYB 3IDJA 4M6NL 2ATKB 3N1FC 4LP4A 4OD2A 2X5PA 3TZVC 2Z0BA 5IHUH 3IS1X 3BEWA 4NQDE 1S8DB 3HI6H 5D96C 5GXBB 3SY0B 1MCKA 3B43A 1BM3L 3V52L 3QXWA 2OQJB 4YC2B 2G60H 1ETZA 3O3EA 1RY7B 1KYOJ 4P5TA 3JV6B 3TH2T 1XIWD 2NY5H 3LKRB 3BPCB 3OMZA 1F8TL 5GRVL 4H1LH 5E2UL 1XCQA 2E9JA 3O11A 3UTSB 4FNLL 2H1PH 3T77A 4V1DB 5HHPB 4D9LH 3IDGB 1QFWH 1EUUA 1N5AA 1KELL 2D7MA 5E8EA 1Z9OA 4L4TB 1I8MB 1HYRC 1FHGA 1CFVH 2UWEF 5B38G 2R56L 3DX7B 5D7LE 1KT2A 4Z7VF 1CK0L 1CZ8L 4UT6H 4U1MA 5EZJB 3BI9X 1F2XK 2DL9A 1U8OA 3PGCA 4TRPH 1HDMB 1EJOH 4KI5D 1OTUD 4ZFOL 5JQ6H 1HHGA 3MRPB 1F11B 1NBQA 2C5DC 4LHUB 1HYSC 1K4CB 1NGXA 2UUDK 5EUOE 2FX8H 1HSBB 1A2YB 2J3SA 5DHYB 3SDXE 3B9KC 4O02L 4XB7A 3PWPD 3QULB 1OAYH 4ZTOH 3BVNA 3L95A 2LQRA 2HKHH 1QOKA 4PRPA 2R29L 3RGVB 4UV7H 2AAVA 4RZCA 1D5XA 5L7XH 1XZ0B 3T0VA 3PABB 4JZOA 2EZ0D 1UEYA 5ICYA 1PG7L 4DCQB 3IXAB 2EYTB 4HIEA 4O2FA 4ZUSA 1CLZH 2FH6A 4XPHH 4N0UB 1XR9B 1J12A 4HQQH 1V3JA 4HUMB 2DBJA 1DN0B 2Q86A 2X89A 1PQZA 5JQHC 5HGAA 5LJYH 3N9GH 4RAHA 4GAGL 3FMGL 1E4JA 4YHIA 5BV7H 1YPZF 4U7SA 5DMKB 4KK6C 5CSZB 1FZJB 4N5EC 3BPLB 1HQRA 4L4JA 5CEYB 3S4SB 1A6TA 3OKKA 5DZLA 4R7DB 5F8RC 5DURB 2OXHA 2Q20A 4HFUH 3VWJD 2ZUQC 1E6OL 4WNQB 4OZIE 2EEBA 2KDGA 4UNUA 3NFPA 3F12A 2PYEB 1OP3K 5D2NC 5GGUB 4PJEE 3T3PE 1YNTB 4NUGL 1GOHA 2HH0L 4JQVA 1KOAA 2ED9A 3GMNA 3P30H 3DYMA 3KXFE 4NN6B 5IIEA 3UBXI 2A77L 3QO0B 4TVSa 3HZVB 4PJ8B 1KTRL 4PJDE 5T5NG 5ANMA 5BJTA 2CGRH 2D7TL 2D9CA 3BPNC 2EECA 2VLJB 1SEBB 2SEBA 5GGVL 1RJYA 5GPRA 5SWQB 5DUPL 3L5XL 1U8LB 4YHNA 1JHTA 2VR4A 1T7YA 1T7WA 3VGBA 5TDPB 3R0NA 5AYUL 4X6EA 5HDQH 2XZAL 2HLAA 1M7IB 1ZVSA 4QHKJ 3WE6B 4OM1H 25C8L 2DI8A 3GMQB 3O6LH 1GC1C 3HG1A 3AMLA 3VFSA 4YDIL 3MPCA 4FFWD 4FQXA 3D39B 5IJVA 5IEKA 1NFDA 2VDLL 4LVOB 1BQHG 5DEGB 1IAKA 1R3KB 3VXMD 1DQMH 3F8UB 3C6LC 2XWJB 2V17L 1DR9A 2H6PA 3BE1L 4UAOB 5D2LA 5CD5D 3JTTB 5C0CA 3RVTD 2H2PC 2F15A 3EOAB 2AK4E 4G5ZL 5L9DH 2Q7NA 3NIGE 3FTGA 3HN3A 4PJGB 1J0HA 5CD3B 4OLYH 1MJ7H 4YQXL 3RKDD 4WFEE 3MBXL 3K8LA 4G7YH 1MFBL 1EEYB 2XACC 5ILTH 3QI9C 2ZUUA 1JHLL 2NY3D 4YK4B 1Z9LA 2CUIA 5I66A 3ZKNC 5CINH 5BV7C 3WN5B 4RMQA 3CH8A 4ONGH 1T4KB 3F7VA 4TSBL 1TZGL 4M61B 4AIZA 4YHPA 3SPVA 1RIHH 2X7LA 4QRSA 1KCRH 4WU7B 3EYOA 4F37F 4RNRA 4QXTB 4GS7C 3OXSB 2R0WH 3GRWH 1R5WB 3LOWA 3VD7A 1ONQB 3GIZL 4JHAL 4KC3B 1YDPA 3TWCL 1JV5B 1PKQE 1L7IL 5DMJB 1YEHH 1AXSA 3O3AA 2VXUH 3HKFA 4MNGA 1N7ML 4EBQL 5FO7A 3GMOB 2VLKE 1NL0L 2JK5B 4M6ML 5A1AA 5EN2A 1HHKB 1QVOB 1ZHBA 1I4FA 1WJ3A 2AEPL 4N0YH 3HAEH 2Q8AL 4LCWD 1HKLH 3ARUA 3MR9B 2R4RL 4XNUH 5KJRH 4B53A 5KSAB 1FL5B 2YRLA 4PRHD 5KSVA 1HEZA 4PLJD 4EKXA 4ZPVA 1N0LA 3ZE1F 1UCTA 3SO3C 1T2JA 1SJEB 4FQQA 2Z8WC 1FGVL 1U58B 1U3HD 3QEUA 5EU4B 5GSRB 1W0WB 3HMXA 2ORBL 1VENA 2XKNA 4WEMB 1UJ3B 3EFFA 1EXUB 2GJ6E 4A6YB 3QUYC 1H5BB 1RUAH 4LLVA 1LE5B 1U93B 2A6KA 4HWZB 1MCDA 3C6SA 2HTKC 3D0VB 1DEDA 2R69L 4K7FB 3EYSL 5E5UB 2VIRA 1OGAD 1AHWA 5FYJL 2X4PA 5IVXF 1X44A 2E9WA 3BH8A 2QKIA 4X8JB 3TZVD 1JGUL 1CIDA 2BNRA 4XNMA 2BY2A 4BYHA 5CBAB 4PGZA 5ITBH 2Z8RA 1T0NB 4GW5A 1WCBA 3TNNB 4X6FB 4ODVL 4KHXL 1K3IA 1VSCA 4XVSH 5KTEL 1R3LB 3FQRB 4DVRH 2J5LC 2PUQT 3DETC 4Y5XC 4PJ9C 4U1KA 5FKPA 4AMKL 3QWQB 3DO3A 1OHQA 3LAFA 1QKZH 2ICEB 1HILA 3QFJB 3RTQC 4XVJL 3QZWG 3WHXB 1UYWL 1RV6X 5BOPA 4KPHL 5F70A 4PR5B 5A40E 5D7IB 3BD5A 4JKPL 2X09A 4M7KH 1H3VA 4P2QB 3S3SA 1N8ZB 3O2DA 3L1OH 4MJ5B 3TN0B 5IVNA 2BY0A 4YZFE 2MQ0A 1C5CL 1QNZL 5J1TC 4GUPB 3ZE0F 1JZ3A 2DMBA 1LO3L 32C2A 3MLXH 2VKWA 4LVEA 4YXKH 1JF1B 1HYSD 3B9AA 4Y2DC 4XI5C 3BZFA 5DZOA 1SYVB 1PEZA 2VUYA 3B9KD 1G7JB 2XQBH 1EAPA 2GSIA 1NEZG 4IOIA 3R4DA 5E6IA 2IANB 1JRHH 4HLZH 1Q0YH 3KLAA 1FLRH 1JTOA 3C5ZA 3JTSB 4KI5E 3Q5YA 2HRLA 5KVDL 1YYML 4K71C 1A3LH 3V4UL 1KLGA 4O4YH 5ETUA 1W72B 5CKGA 3CLEL 1IGCL 2DLTA 1VACA 2WUCL 3GJFB 1NCWH 5E7BA 5EU6A 5F6IB 1CF8L 1TVHA 4R8WL 4EN3A 4XXDA 4L5FL 4N9OB 2XNAB 4PP2A 1HSAB 2DF3A 4J3OC 4MCZB 4MNQA 5I8EA 3BKCH 1S7UB 2D4FA 2ITCA 2EH8H 1BF8A 3WUZA 4KK6D 5ERWB 2DLEA 3U36B 3UTTB 4JDTH 4L1HA 4Z7WF 5JHDA 2OJEA 1FZOA 4DFIA 4PJIA 3R0MA 4YO0A 1HQ4B 1N2RA 2OTUA 5ISZD 5MENA 2GTWA 4XH2B 1F6LL 2QJDA 2C9AA 4CU7A 5E24E 3KYAA 3ZYIA 3F7YA 2DJ4A 3U0TA 2P24A 4ENED 5HHXL 5KANG 3ILPA 3BESR 3RZCA 5E9DA 3S5LB 4JM2B 5FDYA 35C8H 3NVQA 1G7LB 1W0YT 4HK0A 3HMWL 4YDLC 5E4EC 3STLA 1AGFA 1GSMA 4I18C 2ADJA 4NKDB 1G7IA 4HULB 3BP4B 1G84A 3S3PA 3JUYA 5HBBA 3EBAA 3G6JE 3UBXB 3IU4L 3BO8A 3AGVA 4L3EB 1AFVH 3DV6B 4U2ZA 4PGCB 1FIGL 4KWUA 1F45A 1E0OB 2AW2A 1A21A 4GRLC 2GCYB 4U1HB 1BPVA 1KEMH 1KGCD 1KXTB 5HYJA 3GSNA 3MRFB 5C09B 3IRZA 3LZFH 5D5MA 3U79A 3QUZA 4Q6YA 4U1GB 5FFLA 5F7UA 4Z78B 4PG2C 2YD1A 3P2TA 2VN7A 1IM9B 5TGBB 4LLDB 4PP1C 4HCRL 4PYGA 1A7NH 1EO7A 1EIBA 4DGIL 2B4CL 4LCIL 2EE2A 3AREA 3U7YL 5EUKB 4BH7B 4F7CA 1MUJB 1M7DB 2YD7A 3IDNA 1BVKB 4NO5B 1WBZA 4YWGL 1QD0A 3C6LD 4K3HA 4OI9A 3LMJH 3O4LA 4BFIB 5B3JE 3X11A 4X98B 1AIFB 1RZGA 4Z7UE 4D0DA 2VYRE 4QO1A 2H2PD 1PDKA 1DLHB 4PJCB 1F90L 3QUMH 3T1WA 5F1NB 1LHZA 4OZHE 3KPSD 4EUPB 4JFDD 1GH7A 1YEFH 2G9HB 2X4SA 1F2QA 4LAQH 2FZ3B 5INDB 1AO7A 2LAGB 2V2WA 3VXME 5AG9A 2DDQL 1PY9A 3QI9D 4PJFF 2XQYK 3O9WA 3C5JB 3Q6FB 4GXUN 1P5VA 3QRFM 3MRBB 1YY8A 5FKAA 3RBGA 2EDBA 2W9EL 4F15B 2HFFB 3BH9A 4ZYKA 4QHNA 2MHAA 4U1LB 4HIJA 1UM6L 4IHOA 4IRZL 2VC2L 3GBMH 2A1WH 4TOYL 1UACL 1U8JA 3N1QC 4LHUD 4XCYB 1WIUA 4K8RH 4X7TA 1IAII 1ZSDA 3TP4A 2O61A 3DI3B 3Q0HA 5I1DA 1GZPB 3M8OH 5F71A 5B3NA 1EAJA 4LMQI 2ZOKB 5BCAA 3UTQA 5DK0A 2FD6L 3CLFL 5D9SB 3LKPA 3V0WL 1ZKAA 4WWKC 1DQJA 1P1ZA 1IKNC 1P4LB 3TV3H 1TTUA 1AP2A 1NGQL 4MLSA 4FFYL 2FWOA 5I76B 5HGDB 4NQUA 4FZ8H 1R3JA 4R96B 3RAJH 4N0CC 2NX5B 3CVIH 1IGML 2B2XH 1F4WL 2X2YA 1MCOH 2VE6A 1T1XB 2BSTB 4GQ9H 3MLSH 1G6VK 5D6DC 4EI5A 1U41A 2PCPB 3O8XB 3UDWA 1VCAA 2J4WH 1AR1C 2HFEA 3L3JB 2ARJA 5JXEA 2Z9TA 2NY7H 2O5ZL 1K4DA 2QHRH 4NCC1 3U7WL 2EDDA 1OQOA 4OLZL 4L8DA 2DTMH 1U91A 2W59A 1YN6A 3KPOB 3LN5A 3QUYD 4LCWE 1NLDH 5D93B 2X1OA 1WUNT 1XGUB 4R4FL 3WUWG 1FE8H 5LGJA 5EBLB 3X12B 4GG8A 3HR5A 4PRHE 4KK8C 5ID0A 5KSBB 2XWTB 3DSNA 2X1XR 3H9SB 1AXTH 5CIPA 2WP3T 3C60C 5J1AA 1MQKL 5LCVH 1GGBL 3IB4A 3UP1A 2WW8A 3DO7A 5EIIA 3T3ME 5JOFB 4R26H 4XC1L 5IFAH 2YRZA 1R3HA 5JHLL 3DETD 5E1HB 4PJ9D 4H25B 5ESVB 4NKOA 5D1QB 1NAKH 2ICCA 1FZKA 1OGAE 5C0BB 3FAWA 5F9WB 1A4JB 1IGFH 5FO9B 1CI5A 4HHAA 4G8FB 4TUJA 4IRJA 3D3VD 3DYOA 2EXWC 4MMZC 3S37L 5IJKA 3KDMB 1H0DB 2C4FT 3C2SA 4PB9H 3W39B 2NTFB 4F57L 3PV6B 5JW4N 3L7FA 2OP4L 4HKBA 1NC4B 3QDMD 1OTSC 3MV8B 3VFPB 3PNWB 3PQYD 2RIKA 2FIKB 4F3FA 2E6PA 3JBG7 1S3KH 1S9YA 4NOBA 4MAYC 5D1ZC 1RULH 3A0OA 4NM4H 3TNMB 2NY6C 1BLNA 2CUMA 1GGIH 3I6LD 4XI5D 3O2VL 1RVFL 1DE4A 5EWIH 1LVEA 1I3UA 3BYYA 5DVNA 2Z91A 4PD4J 3OKLA 1RZJH 1FH5L 4JREC 3ILQC 1FP5A 3GHBH 4KVNL 2KPNA 1MHEB 2R1WA 4U2YA 4Q9RH 4NJAL 4X6DE 1P4IH 2LU4A 1BAFL 4WUUA 5F7DB 2A0LC 4OGYH 5HDLA 3W2DH 3E1F1 1WBYB 4UIMA 5EOCJ 2FL5B 3ARDB 3OWEA 2MPAH 3LEXA 1QFWI 3HNSL 1DDHA 1EHLH 4Q0XH 3CUPA 3FOLB 3EW3B 2DRUA 5HY9B 2DICA 4LFHG 3PL6A 1NC2B 2BRRH 2LFGA 5JMRA 3FO0H 1FC1A 3O4OB 3A6BH 5F3BA 3AXLB 3VXNB 4QXGL 3D25B 2RR3A 3WL9B 4L3CB 4S1DC 1A7OH 4NYLB 1BECA 2VJXA 3P4NB 4PG9B 4F58L 1U8IA 3MV9A 3TBVB 1DZBA 1P2CB 1IQDA 5EIVA 3V4VL 4X9IA 3MGTB 3ARGB 3MLTB 3MRRA 5KN5A 1M71B 1LDSA 4JRXD 2CDEB 4ODWA 3JVGA 5I18H 3MZTA 4KAQH 2I07B 4ZS7H 2H32B 1XGQA 2CLZB 1IT9L 1UA6L 5EOQL 3RQ3A 1Y0LB 2Y23A 5F21B 2HN7A 5FYKU 1X5GA 5ISZE 4TTDD 1C5BH 5K59F 4ONHA 4U0RC 2PN5A 3KYOA 4NP4H 5IFHH 1GHFH 5D2NE 3STBA 2DIBA 4RISL 3CFCH 3MYJA 4MSWA 2NMSA 4GRLD 5FB8B 3RWEB 3D69B 4ZNEE 1QR1B 1INEH 2P5WB 3CVHA 3KS0H 3R1GH 1ZGLP 3BW9B 1C5DB 5GRVK 4KMLB 3SE8H 1ED3B 1MJJA 5L6YH 1MFNA 5DS8B 1CGUA 2LE9A 4XC3L 4XNQA 2IEPA 1HHIA 4PP1D 2VABA 1DBBL 5C08A 3T4YB 5F7WC 3EYVB 3DGGB 3EDDA 2QSVA 1IGYB 4DAGH 1KGCE 3LEVL 4U4BA 3ZDYE 1F4XL 4EQ3A 2AXJA 3JV0A 4GOSA 4D0CA 1MCBA 1F6FB 3QEHB 2CK0L 2PF6A 5CLWA 3IFOA 1H8SA 5HJ3B 4R7NA 4KJWC 3DX6A 2AQ2A 4N5UA 4WTZG 5AG8A 4WI4A 5DHVB 4P5KB 4GKZA 2J8UA 1JPSH 1GC1L 3ARFB 5IM7B 2HP4A 4HZLA 3DXAD 3HHRB 3IFPA 4G8EA 1JK8B 4I3SL 1CFSB 4HD9A 1EO8L 2DB8A 3BKYH 3W9EB 1JN6B 1N4XH 4DGVL 3SGDH 1UCBH 4TPRL 4OD1L 1NCBH 1YC8A 3KR3L 3HE7C 1G9NC 1YQVL 3SDCB 5KS9E 1KCUL 1XGRB 2DI9A 3KYKH 3HRPA 3KPSE 3PHOB 3VH8B 4JFDE 2DIJA 4BELD 3ES6B 1X5ZA 1KC5L 3D18B 5EBGA 4PBWD 4QOKB 1R0AH 2P8LA 3F5WB 1NBVH 1AD0A 2V2TA 3IDYB 3THML 3WJJA 1I8IB 3H0TA 2KQMA 4JFQA 3OJDB 1JNLL 2BVUA 3HPLB 1R5IB 5FHBH 2VDPH 1MCIA 5E5MB 2ZKHH 4I3RL 4JPWL 4WWKD 4D9RD 2VLLA 3HMXH 1ITBB 4AT6B 5IBUG 1JFQL 4FQLL 3QIBC 5H37H 4S10A 5IB5B 4N0CD 1KN2L 4JPVL 4X6BA 4X5WA 4FQXC 3RZWA 3KYMA 2OX5A 4DFHA 2LABA 3VFWB 4H8WH 4Q2ZB 4UI2A 3C08H 4BSWB 1BFTA 3K74B 4LK4A 3X14B 1JYNA 3H3BC 1TVBA 3OKOB 3NGBB 1JPFA 2QTEA 5TF1H 3E0GA 4JFXB 5HPMA 4NC2B 1AR1D 4FFZH 5DI8B 3OPZH 2VISA 1AD9B 4PS4L 4YE4H 2EICA 3QHFH 3S34H 5TQ2H 3V4PL 3S88H 1NUFA 3UTTD 3V0AC 4HX1B 4MA3B 4PJ5D 5IKCA 1ZHKB 5ACZB 4NZUH 1LDPL 3OGCB 3SBWC 4XPFL 2AP2A 5LQBH 3LB6C 1IC5H 3BWAB 1GRWA 2DLIA 5FAAA 4FQHB 2D03L 4M4RA 4OQ1A 5EB9A 4KK8D 2GJJA 4LKCB 1IE5A 2DM3A 5DC9B 3C60D 2F53A 3O2DH 4AL8H 2Y6SC 2YN5A 4JM2D 3T1FA 1T2QH 4PJXA 1T1ZB 1A1OB 4M8QB 3DUSB 5CUSL 1A4KA 1T1YB 1V8HA 2YHGA 4PJAE 2HJKA 4YPGA 3QWOB 4IS6B 4Y4KC 4XT1C 4F2MA 3BP5B 4KKAC 2CIKB 4IRSB 5FGCE 4ELKB 4DZ8B 1J1XH 1N6QH 5CP3A 5A43C 4JLRA 1FLTX 2ZCHL 4PTTA 3WDHA 5IFJB 3SCMA 4G80B 2P8MA 4ONFL 1XCTB 4D8PB 5JLZB 2UVEA 2E27L 5AUMB 3SKOB 2NLJB 1FN4B 2CSPA 4ZFFB 4XBEH 2EXWD 3C9NB 3QJHA 3QRGH 3D9AL 1CIUA 3VWKA 1INQB 1U3YA 3LN9A 1NDGB 5C8JB 2AJYH 5DJ8B 1XGYL 2G75B 1A22B 2YPLA 1YUHA 4PY7B 3BHBB 4WHTA 2W60A 3VXSB 4Y5VA 4GAJL 4XRCA 3P11L 4W4OC 2VAAA 2V7NA 4MAYD 1O7SA 3CFDB 1EFXB 4R3SA 4RRPA 5IEHA 2NY6D 5C0DB 2ENYA 3D3VE 4J8RB 2MJWA 2CRIA 3RU8L 1I1AA 3G5YA 3P4MB 1G0XA 4OF7A 1GGYA 4R0LA 3KWWB 4HUVB 3IDUA 4G6AD 1N64H 3QDME 3QHZH 4APQC 3PQYE 4X5XA 2P45B 3HI1B 3GSUA 4PRNB 3T8XB 1A9EB 5F7KC 3RY6C 4NDMA 3OKMB 2A0LD 2CLRB 2YC1B 3I6LE 4F80A 4XGZB 1JE6A 5KG9B 4H1LB 1JZ4A 3HCVB 3H9HB 4NIKB 5J12B 1LGVA 3MOAL 4JZNB 2IAMC 3UTZB 5HHNB 3GIVA 4QTIL 3I6GB 2HG5A 1F02I 3PV7A 5ADPL 1X7QB 2R8SL 4Y5YB 1RU9H 2FGWL 3H42H 5D71L 1UWXK 3LSOB 4PRID 4XBPA 4S1DD 3Q5TA 2YPVH 3O3DB 5I15L 3U48A 5E70A 5GZOC 4P2RB 6CGTA 5T3XL 3GSNH 2X4QB 1OB1A 4Y0GA 4HAFA 5IMKA 1FRGH 5BVPH 3FN9A 3TBSB 3L3KA 3SKMB 4PREA 5D1XB 4ZUVA 3QXDA 1QQDA 2QQLL 4G9DB 4LEXL 1JRHI 3Q3GA 5IB4A 1CU4L 5JIIA 5LBSL 1S9XA 2DM2A 4UU9B 5I1EH 4JDVA 3LH2H 3ISWA 1N59B 4YHYB 1XMWA 4HMDA 1KTKE 3FRUA 5IK3A 1IQWL 4TTGA 4L8SB 4JHBA 4PV9B 4PJFB 3X13A 4PRAA 1UXSB 4ZFGH 5DR5H 4OCWH 2YSSA 3HE6A 5JO5B 2O5XH 3INUH 2DQFB 4XP1L 5DUBB 5BVJA 2OBGA 3CD4A 4JRXE 2B1HL 4DKFH 1QFUL 3C5ZC 1PZ5B 4RMRA 1QA9A 1I9JL 5HDBE 2ZNXA 1U2CA 2OSLA 4NQCD 1G0DA 1BFOA 3D2UB 3WJLC 4MS8C 3WFCH 4K7PL 4JN2B 3CFJB 3B5TA 2ADFH 4PJBE 2QLVB 1S7SA 4L29A 1R24B 1S9VB 3G04A 1KPRB 1MHCB 4GMSL 1JUFB 4EN3C 4I4WA 4MYWB 4P23D 4Y4HD 5EH1A 3L6FB 1SY6H 1M1SA 2RBLA 3DPBA 1TETH 1C08A 5DD6B 3MRJB 1MFAL 1WAAA 2MTPA 4ALAL 1I7TA 1M6OB 5FYJU 3EHBC 1Z5LA 3DRQA 4MNHA 1CDUA 3OQ3B 2FATH 2DQUH 3MXWH 1BD2B 4ZAKC 4JQXC 4X7SL 5GGSY 5GRZA 4KTDH 43CAB 5FK9B 1A1MB 3MFFB 1TZIA 4RAUA 3ZDZE 2C4XA 4HWUA 3RX8A 2E9IA 1C1EH 4CW1B 1UWEH 3V7AE 5IBTH 3CSPA 5CILH 1BBJA 4NGHL 4QXUH 1I1FB 1S7XA 3TCXA 4ERSL 5H35A 4M93B 4E42B 5GGTH 4QF1B 5C7XH 2N7BA 3V0VB 3OAYK 3HE7D 1D6EA 1OWWA 3KPMA 3RWFA 3HS0B 4IMKC 3GSXA 2VN4A 1HWHB 3MV8D 3LDBB 5MHSD 2NXZC 3T09A 4QTHA 5IQ7H 1CR9L 3DXAE 5DT1L 5LVEA 4ZODA 4LP5A 2Z93B 2QSCL 2FB4L 1RMFL 4BUHA 5F89A 4YHKH 4ISVB 5I19H 2CIIB 3SDYL 1INDH 2BOBA 3ARBA 4PJHE 5ESQA 4N8VB 4UV4H 1MWAL 5ABDE 4XWGH 5E1AB 1U42A 2OTWB 5EU3B 1VGEH 4JFZL 4OGXH 2JCCA 2PYFA 4E5XB 4WW2A 4YH6A 4LLQB 5FOJA 3MLYL 1IGJA 5JOPD 3QIBD 3RWIB 4NZTH 4MJIB 4Y5XB 2VSCA 2VXQL 2EIZA 1AKJA 5L2JB 4D94A 5GQBA 1CFTA 5D7SL 5CIPH 1XGTA 2B5IB 1Q94A 1S9WB 1YMMA 3GJEB 3ROOA 3I75A 1B2WH 3O6MH 3C87A 1NKOA 4JY5H 1U8HB 4D9RE 1P4BH 4DOHB 2XRAL 4ODXB 1NFDF 2FX7L 1WIPA 2M8XA 4NO0A 1DQTA 3HNTL 1NSNH 3LS4H 4LKXB 5E94B 5DEZA 2X44D 2MNUA 2YR3A 4MQ7B 1FNEB 5TFSL 3LN4B 3LB6D 1MIML 4GG6A 2CK2A 1OAUL 1Y18A 3V5KA 3WS6A 3FO2A 5EBMB 3STZB 3VFTB 1BOGB 4UDUA 4MZ2A 5F1IB 4Y4FA 2Y6SD 1HCVA 4JGMA 4UQ3B 1S7TA 2Q76A 1LO5B 3QUXB 3EDEA 1S7WB 2EIDA 4OLWH 3TLRA 1J18A 4PJ5E 1RIUL 4J1UB 4Q58C 1N3NB 2XN9D 1U8MB 4ODSL 1M05A 5GRXG 1CE1L 5DRNB 3ZKMC 2Y7QA 1FFOB 3SGKA 4Y4KD 2WK2A 1VPOL 1AI1H 4KKAD 1VEMA 5JIHA 3MMEA 4KRPC 2BX5A 1S9KC 3FFCA 3HAEB 2XQYG 2R4SH 5DRZA 5T1DL 2A9NH 2Y07L 2Z92B 3HZKB 1FBIH 2C4FU 1NMAH 3BKML 4Z18A 2BNUB 1OP3H 3HFMH 4KHTL 4KGLA 4PV8B 3QDGD 4F7EA 5EA0L 4GJTB 3VFRA 1DJSA 4BSVB 1J11A 3HRZA 3RL1A 3EO9H 3EIFA 1QSFE 5CEXA 3UROR 4HUNB 5ADOH 2DLFH 1NCCH 3QXUA 4S1RH 5IVOA 2BERA 3WFZA 3OBAA 3DVIA 3QQ4B 4EI5C 3VXRB 4UMGA 3LVEA 1KIQA 1E6JH 3VG0L 3NCMA 5J89A 2DD8H 3MLZH 1G6RA 2NNAA 4WGWB 1TPXB 4ODHH 2P5EA 2A6DA 1JGEB 3L9RB 3VFOA 3BQUC 3V8OA 1T03L 5AWNH 4ZO9A 3WS3B 1D5MB 3G9AB 1UZ6F 5IOPA 5CBEA 4U1IA 3MXVH 4APQD 4LASH 1IL1A 1YEEH 5FO8A 2PTVA 3GMRA 5JA9A 5JXAH 3DGCR 1C16A 4QRRD 3T0EC 3IYLW 4XMPL 3VFGL 1BBDL 1F3JA 2Z35A 1YA5A 1RURL 2VDML 1MAMH 4MD5A 1A6WH 4RGNC 4FTVA 1KENL 1S7VB 4PTUB 4N0RA 4R2GC 2IAMD 5E8OB 1FDLH 4WI5A 1SJHA 1H9VA 4NQDA 1UXWB 4GRWE 3DX9B 3W9DA 2ADIB 4X6CB 4DJMA 3NCJL 3RA7L 2JLLA 2ZSVB 2GTZA 1SYSB 2DWEB 3EKCA 4JDZA 1RJCA 2DQCL 3KPPA 5HYQA 5GGSA 4AIXA 4O2EB 2NXYB 1QR4A 4QOKD 4JR9H 1ZGLM 1PLGL 2NY1B 1MLCA 5E8NA 5I1JL 4AQOA 5GZOD 3AAZB 4OCYH 4O5LH 3CVHH 4WI8A 2APWA 1VFAB 4M8VA 4F9LA 5DSCB 2QR0A 2Z4QB 4GSDH 4HS3B 3DROB 3DV4A 2ZCLH 5IMOB 2E7BA 4PRIE 5D7LA 4JKKA 4WU5B 1OM3H 2WUBH 3G08A 3P9MA 5A3IC 4ZFOA 3U1SH 5GJTL 4HXAL 1A1NA 1F6AB 1IEAA 2J8HA 4WHYG 3GO1H 2VDRL 1DBJH 3L3HB 1E28B 2AI0L 3LKOA 3G5VB 5EUOA 3TCLA 3SDAC 3MLRL 4BZ2H 2FYYA 4Y16B 3RUGB 3SDXA 3QDHA 3PWVA 5J11C 2IQ9L 2XPGA 3FT2B 3RWGA 3G5XB 4HIHA 1ZHNB 2VQ1B 4E41D 2IQAA 5K9JH 3MBEA 1LD9A 2EDQA 4JZJC 5JIKA 4MS8D 3FB6B 1MCPL 1ORQA 4LVHC 5HGGS 4WV1C 4ODBD 2OK0H 1A6UH 3MJ9L 5DMGD 3GSQA 1MRFL 4QRPD 3NABL 1A9BB 1K6QL 2UWEE 2VLMD 1EUTA 1QHPA 1TTGA 2X70B 4Z7VE 4FXKA 4W6WB 3PP3K 1Q9LB 1IGTA 3MJ8A 1JZ8A 4OTXH 5FM5O 2DYPD 5M95B 5IMLB 4NQCE 4ZTPL 5IT2L 2BVYA 3EHBD 3R8QA 2Q3AA 2JJVA 3SE4A 3T4AA 1LEGA 3OZ9L 5CJ8A 5DJ6B 4BZ1H 4GKNA 2YK1H 4P57A 5IROC 4LCCB 1MI5D 3FHQA 5C07E 1IJ9A 3WFBL 4YIQB 5FYLD 2HJLA 5IVZA 5IQ9A 1D5BB 5FCUH 4OZIA 1WFNA 4UQ2B 4PJIF 3TC9A 2JB5H 3IS0X 1G0YR 1V7MH 2MFNA 4JG0H 2YD4A 3KS0J 2L0DA 4PJEA 4NZRL 3T2OA 2X1PA 4JCLA 4GRMB 4UIKL 3WO4C 1N0XL 4AIOA 4ZXBC 4DEPB 5TF0A 3FRPG 2GT9B 4LBEB 1HN1A 3KXFA 5D7JC 3QIWC 2NXZD 4PJDA 1TTFA 3QT2A 4DUWA 3M45A 4MA8L 1MJUH 1KPVB 3QNZB 4Z0XA 3FN0H 1NUDA 5T5FH 2R23A 2YXMA 1EFXD 1YPZE 1TJGH 2I24N 4WI6A 3RDTB 1CL7H 3TYGH 4MWFB 1KLUA 2WZPD 4L8BA 2PO6C 4JN1H 3BGAA 2Q8BL 3MFGB 2UY7A 4WUKL 5AYQA 3I85A 1G9NL 3K0WA 5MEQB 3QPXL 4PRBB 5MHSE 4HUUB 3QO1B 2PW2A 2I9TB 2CKBL 4U6YA 4Z0BH 4IIQA 4XPTL 4XP5L 1QRND 3C8KB 3E2HC 3V95A 1KFAH 1SEQL 1OVZA 2GSGB 2MCG1 2N1KA 4NOFA 5E99H 3HUJB 2LTQB 3BYTA 3MLWH 4LQFH 2HJFA 4OFPA 3SGDI 1J8HB 2CRMA 1GAFH 2IPTH 4JHZA 2AABH 4URTB 4X9HA 4G3YH 4FG6C 4K3DH 2M1KA 5JOPE 2A9MH 4F33B 1YEJL 3TF7C 4QY8A 3BPOB 2XTJD 4KUCF 2J12B 2AK4A 3L5WB 3FQUB 3QA3A 3LQZA 1ZWIB 3MRNB 5CP3H 4H5SB 3GI8H 3T0XA 4XCEB 3EOTH 3V5DA 1U8QB 3LPFA 5KOMC 5DJ0B 4ZUTB 2QQNH 3MUHL 3VG9B 3HC0A 4P2RD 4P4KA 2P49B 1QO3A 1A3RL 5DVLA 4M00A 4LPTA 4L4VB 5DK2A 1JYXA 5HHVL 4MJ2A 4YHLH 3BZDA 5D1XD 3QG7H 2AJVL 4Q97A 4G6KL 1MELA 4HKJB 5IHBA 5DLML 4RGOL 5TDNB 4Y19B 4MAUH 5GJSH 3P0VH 1ZA3B 3ZKMD 4LFHD 3NPSC 4KZEH 1OLLA 2IFFH 4JJ5B 4YXLL 1RZ7L 3VXOA 4HT1L 1DQQA 1JWSA 2P4AB 5LGHH 1JP5A 2GUOB 4WRLA 3J7HA 3O45B 1XGPB 1G9MC 2ZUSA 4HH9B 1FJ1B 4GAYA 3IDJB 4J3UA 1PKQA 4O00A 4OD2B 3H7BA 5D6CA 5EPMA 4K9EC 4NUJA 4ZDHA 1IKFL 3BEWB 2XN9E 2XFXA 4JQIL 5DQDH 3MOQA 2VLKA 1ETZB 3O3EB 4NN5C 4P5TB 5CFHA 5C0NC 4P46C 4JFEA 1BIIA 1XCQB 4MJ4A 5EFIA 4GBXA 3O11B 2R2HA 4HJJH 1LK3L 3T77B 4GO6B 1FGNH 4AM0A 3DLQR 1JI1A 1JGLL 2DLHA 4OBRA 1N5AB 3QDGE 5E8EB 4NKIL 3BQUD 1UH2A 2WBKA 2JKXA 1KT2B 1CDGA 5L8KB 2DQHL 1BD2D 2GEEA 3WKML 3QHTC 1U8OB 4FABH 3PGCB 2GJ6A 4MD0A 4JKLA 5AZ2H 4PY8I 3T0ED 3G6AA 1HHGB 4B7LA 1BF2A 4OIBA 1FL3A 1ZS8A 4DGYL 4KKNA 2DKUA 1NGXB 1S5HA 4JY4A 1P6AB 4RGND 4QHUA 2EIEA 4R2GD 1QRKA 3BVNB 3L95B 1OAXH 4PRPB 3VGHA 3P9WB 3N50A 4LOUC 3MLVL 4RZCB 3U4BL 1D5XB 2LVCA 4QRRE 2R0LH 5C0IA 4JZOB 1YY9C 1EZVY 1PAMA 5IG7A 3ARWA 5ICYB 4HIEB 4O2FB 4M1CC 4ZUSB 2HVKA 4PJ7F 3ZE1E 1OARH 3QYCA 3SQBA 5KVMC 2VDKH 2Q86B 3TA3C 2XZCL 4YXHL 3T0BA 3LRGA 1PQZB 5SX5K 5HGAB 1P7HL 4Y1AD 1BJ8A 4LSPH 4KMQA 3EO1A 1P84J 3BN9D 5J6HA 3N85L 3OJ2C 4YHIB 3MREA 4KJPC 1OT2A 5T3ZH 3MNZA 4LSVL 1HQRB 5DDHA 1XIWA 4RFOL 4IDJH 2F8VA 4EOWL 3OKKB 1A6TB 1UT9A 5A3ID 1IAMA 5IVXE 4MJID 3V9FA 5ALCH 3RVUC 3NFPB 1OAQL 3F12B 1ROWA 2OI9B 1DUZA 3SDAD 1IAIL 3NFSH 4M5ZL 3SGJA 4AEHH 2O26U 4LSTH 1A7PL 1WWBX 5DD0L 2NY4C 1KB5A 4EVNA 3GMNB 3BXNA 1U8NA 4LDEB 5IIEB 3Q6GH 1F58H 2ED7A 5ANMB 3O6KL 5BJTB 3HC3H 3DBXA 2SEBB 3B5HA 1RJYB 3MCG1 4U6HA 2NY0C 4YHNB 1JHTB 2E7LC 3C2AL 1KJ2H 1CDBA 2F8OA 5A16A 4KMTH 3ZE0E 4X80H 2BY1A 4E41E 1UM4H 5SV4A 4X6EB 1FFRA 2HLAB 4KK5D 1CG9A 3TM6A 1ZVSB 1T5WA 2RB8A 4O9HH 2XZQL 3ZMRA 4YUEH 1ZT7A 5E2VL 1MAJA 3HG1B 5DUMH 5C9JA 4QRPE 4FQ2H 5I30L 3VFSB 2VLME 3DOSA 2V2XA 3KPRD 5IJVB 5IEKB 1NFDB 3KJ6L 1GPOH 4IJ3B 2E8ZA 3CC5A 3O2WL 2P7TA 3WNMA 1IAKB 5TE6L 2D7NA 5J4MA 1RUKL 5FUOL 1OSPH 1NCDH 1Z3GH 2H6PB 5D2LB 5C0CB 3BRGC 4ZXBD 1MI5E 2JF1A 2ARWA 2FBJL 5D7JD 1Z6JT 3QIWD 5JOEA 3FTGB 5CJQH 3VWJA 5FYLL 3G6JA 1F42A 5I6XB 3EUUA 4UT7H 3RVVC 5TDOA 1LNUA 3UPAA 4U31A 2F74A 1ADQH 4DVBA 5MEPA 5F7HA 3NZHL 4DKDC 1J0ZA 4WHYH 4LQ1A 2PO6D 4Z7WE 1MNUH 1NAML 4JG1L 2OCFD 1SVCP 5I66B 2VXTL 5ENWA 1RUQL 5EG6C 3F7VB 1EDQA 4PLKC 4AIZB 3SPVB 3FQNA 1RIVH 3RIAF 1B4JH 4WWID 2GAZA 2X7LB 4NJ9L 4QRSB 4LRIA 3EYOB 4WCYH 1VKXA 4P2OD 4RNRB 4U1NA 1IMHC 3QDJD 5EZOL 1T66D 4JHWH 3IETA 1G7QA 4YBHA 1EERB 1YDPB 2EDNA 3LD8B 5FHAL 1FNSL 4FQJL 1MIEL 5TE7L 4I8DA 1OT1A 4AH2A 1AXSB 3O3AB 2RCSL 4LRNH 2WLZA 4RGMB 4G6JH 3K2MC 4HG4J 3RHWK 4MNGB 4FG6D 4KGJA 4Z7UA 5FO7B 2P42B 4H20L 2GK0A 4XP6L 1QRNE 5EN2B 5T1LA 1ZHBB 1TJHL 5J6GA 1I4FB 4OZHA 2BVPA 1J7VR 5FGBA 2DQEH 4M7LL 1TCRA 4ONOA 4WY7L 2NY5L 2NY1D 4WJ5A 4XXCC 1B6UA 4IBLT 5I8CA 3VXMA 1EPFA 3ARQA 3S35H 3GB7A 5FYKH 2HRPL 5EOCL 1H3UA 5T1KD 4XPBL 5KSVB 1HEZB 4ZPVB 4JRYD 1QFWL 3TBYA 2AJXL 4MGXA 3S37X 5A2IH 4FQQB 5AZEL 2ZPKH 3OGOE 2XTJE 3QEUB 4WTXA 5EBWA 3HC4H 3RX5A 4NCC2 5I71C 2XKNB 3EFFB 5L88H 4R90L 3SE9H 5BO1H 1HKFA 3GKWL 3QH3A 5B8CA 4LLVB 3SHSA 3PGDA 3IAPA 2A6KB 3C6SB 1AH1A 1B90A 1OOAA 1G6RH 3IF1A 1JWMA 2BP3A 2VIRB 2YD9A 1YNKL 1WZ1H 4BQ6A 1AHWB 3QJFA 2EYRA 2X4PB 1NBZA 2EIBA 4Q6IA 1CICC 3BH8B 2QKIB 1O5DT 3U0WH 2BNRB 4XNMB 3JWDH 4LPVA 4GW5B 1WCBB 5DA0B 2ICWA 1J10A 5IR1A 1L6ZA 2R0KL 4EIGB 2N7AA 3EYFA 4U1KB 5FKPB 2FHCA 2RFXA 1KNOA 4UTBL 5C0ND 4P46D 1HILB 4M6NH 2OZ4A 3M17B 1CGSL 4PRDA 5CHNA 1TJIH 1KTLA 4FRWA 4OAWA 4NCDA 4YNYB 2QADC 1UWGL 1ORSA 5AAMA 3V52H 5F9OL 1EMTL 4HUXA 2BNQE 1KYOK 5F97E 4WI2A 1F8TH 3EYQC 5DK3A 3BWUC 5E7FA 3LCYA 3OV6A 4XCCL 2ZG1A 2AV1A 4L9LC 3IU3A 4FNLH 5CCKL 32C2B 2H2SC 4V2CB 1BP3B 3ARTA 3OR6A 4LCWA 5L2KD 5DXWA 3QFDA 2X4OA 1KELH 3BZFB 4PRHA 4YAQA 2R56H 1TENA 1SBSH 1MY7A 5MI0C 1EAPB 1CK0H 2GSIB 1PX4A 4U3XA 1CZ8H 4WFHD 3T0AA 4L8CA 3MSPA 4IOIB 5E6IB 5DTFA 3KLAB 3MLUH 5CGMA 1S7RA 3C5ZB 4LHJB 4DQOL 5D72L 3T0EE 1CWVA 2F19L 1YY9D 2ZUYA 3P30L 4I0PC 1KLGB 2FX9L 5ETUB 5I9QC 2LV4A 1H3TA 1VHPA 4RGNE 4O02H 1VACB 1OGAA 2WWKO 3HB3D 5EU6B 1TVHB 3OXRA 4KK9C 3TA3D 1WV7T 4EN3B 4XXDB 1KBGL 2R29H 4PP2B 3TZVA 3FOMA 3AS3A 4MNQB 5I8EB 4GXUM 2W65A 2ITCB 1X5FA 2VLRE 4KJPD 3ZTNL 1PG7H 1NMBL 4Z6AT 3F7QA 3MUGA 4AZ8A 3PIQA 5JHDB 1T0MA 2OJEB 1FZOB 1W0VA 2WQRA 1KUMA 3MRKA 4PJIB 4YO0B 1N2RB 3O6LL 2OTUB 1RK0A 5DEFA 3VXPA 3FAXA 5MENB 4CMHC 2JELL 2GTWB 5E2TL 4X4YA 4Y1AE 4GAGH 3FMGH 3F7YB 3TO4C 3NCYP 3U0TB 2P24B 1AY1L 3ILPB 1BQUA 3GZKA 3RVWC 3RZCB 5E9DB 5FV2A 4KRMB 5CP7A 4X7EC 1EEQA 4TNWK 1HK6A 1CXEA 3GMMA 5ITFA 2NY4D 4HK0B 3STLB 1AGFB 4M03A 5GHWH 2ADJB 1E6OH 3MRHA 1G7IB 2XA8L 2O5YL 4X6DA 1A6VL 4NBZB 3BO8B 1OGTA 2J88L 1NPUA 5K9KA 2CXGA 4OF6A 4OFYD 1U92A 4NUGH 3B9KA 3NCYS 2DOCA 2F9BT 2HH0H 3OJVC 4WEBL 4ZUWA 1QPXA 5HYJB 3GSNB 4M02A 4NT6A 2AXGA 5D5MB 2A77H 3QUZB 5JW5B 1V3MA 4MHHI 2D7TH 1KB9J 4RWYL 3B6SA 4KH2A 5GGVH 4OZFG 3ZKXC 4NC1C 4AY0A 2IH1A 2GW5A 2YA0A 3HI5L 4P59L 3CMOL 5J13C 3VRLF 1FAIL 4MB5A 5AYUH 2L4OA 3SDDC 3AREB 5JR1L 1J05A 4FZEL 4F7CB 2XZAH 4G9FD 1GYAA 3FQWA 3IDNB 1WBZB 3EDKA 1HWGB 3WD5L 5ECJE 3SN6N 3O4LB 3X11B 3CAFA 2BMKA 1RZGB 4D0DB 3HR6A 2PNDA 1CDHA 2VXUL 3TT1L 1D7FA 3CX2A 4YDIH 3ZT7A 4XAWL 5DQJA 4Z5RA 5ISZA 4HS8L 2IH3A 3KPRE 2VDLH 3H3PL 4WO4D 4J23A 4ZOBA 5IW1A 2X4SB 2A6JA 1S7QA 5D2NA 1AO7B 2V2WB 1P5UA 1VA9A 4EI6A 2X1QA 2V17H 5HI4D 4S1SH 1HZHH 12E8L 2ZSWA 3O9WB 4LPCA 4ZNEA 4OGAD 1YY8B 1SJVA 4G5ZH 2YPKA 3KPTA 1J0IA 3DMMC 3L5IA 2OL3A 5EORL 4RX4D 2FSEA 3BH9B 4ZYKB 5I74B 4PLKD 4QHNB 2R39A 2MHAB 2P48B 3MBXH 3I2CL 4HIJB 4IHOB 1MFBH 3PF2A 3IFLL 1KEGL 1NUNB 1U8JB 4LGSB 4LVNB 5HD8C 1JHLH 5F96L 3BDBA 4X7TB 3GMLA 3CFBA 3F58L 4U6TA 1ZSDB 4JVWA 2O61B 4KRPB 2AEQH 5I1DB 2W92A 3JWNC 3P40A 1TZGH 1PYWA 3UTQB 5DK0B 3LKPB 2ZP0T 4EDWL 1DQJB 1P1ZB 4OFVA 1FZMA 3HZMA 5K59E 4PRPD 4M1GL 1AP2B 4JGJA 2R1XA 4I5BA 4P0DA 4EJ1C 2FWOB 1DBKL 4C56D 1R3JB 1ZT4A 4JHAH 3QDJE 1F4HA 3TWCH 3GGWA 2X40A 1L7IH 4OV6F 2VE6B 1QKZL 1F3DH 1TQCC 1U3ZA 3O6FC 4J6RL 1QSED 4EI5B 5D70L 4MX7A 1JPGA 3C6LA 1N7MH 3UJTL 5CWSA 5HYSA 4EBQH 1Q0XL 5SWSD 3VFVA 1NL0H 2GYSA 3QWRD 5GS0C 1KJ3L 2HFEB 2ARJB 1OCWL 1FVCA 4OUOA 1K4DB 1G7PA 5CEZD 3MO1A 5KS9A 3M07A 1I7ZA 4L8DB 4HGMA 3KPSA 5T1MA 4JFDA 1U91B 2Q8AH 1YN6B 3LN5B 2R4RH 2XXCB 3MV01 2YKLL 2R1YA 1S5IL 1UWXH 2BSSA 3I9GL 5LGJB 2PTTA 3QI9A 4GG8B 3HR5B 1K5NA 5ID0B 1JYWA 1D5ZA 4JRYE 1FGVH 5CIPB 3SOBL 5J1AB 4PBXA 1CICD 2CO7B 2ORBH 3BUTA 5JNYA 4X7DC 4K7PY 3DO7B 1IM3A 5EIIB 3SGEH 3TESA 5SWZD 4OLVL 1R3HB 5JDSA 2R69H 3EYSH 1IC7H 4NKOB 2JCCF 4IOSD 4LHUA 4MLIA 3BT2L 5FYJH 1WCQA 1FZKB 3PWUA 4O4YL 1G9ML 3MZGB 4HHAB 1JGUH 4P99A 4TUJB 4IRJB 4ODVH 4KHXH 1XEDA 5HHOD 2QADD 3KJ4B 4K9EL 4QLRA 5KTEH 2YXFA 4FXLA 2RGSA 4AMKH 3L7FB 4HKBB 2EYSA 3EYQD 4MXWH 4XVJH 2APVA 5JORA 1UYWH 2R15A 3MACL 4KPHH 4F3FB 1P69B 1S9YB 3LPGA 5DMYA 3H6JA 4JDTL 3BJLA 2DIAA 4YFLF 3U82B 4C59B 1BLNB 4CVZA 4JKPH 3H7LA 5CZXD 3DVFA 1GZQA 3ULUF 1DE4B 1E4KA 2Z91B 4CU8A 1C5CH 3OKLB 1QNZH 4NQVA 4LL9A 4FQCL 2WAHA 2J1KA 1LO3H 4NC0B 2R1WB 5C0AB 3QUYA 3ZE2F 4WUUB 4PJAA 5L2KE 4XP9L 1U8PA 4I0PD 3NN8A 3ALPA 3EDFA 1EGJL 4RMUA 3RL2A 1PJ9A 4UIMB 3LEXB 4KK9D 4WFHE 3W82A 5FYKD 1DDHB 1EX0A 3CUPB 3QEQD 2MQCA 4TULL 2V9TA 1KB5H 3UZVB 4QT5A 2ZG2A 2B20A 3PL6B 1YYMH 3OG4B 1FYTD 3VMPA 3V4UH 2EKJA 3IJSA 3NIFF 1J1OL 3CLEH 4PJ9A 5F3BB 1IGCH 1T5XA 3I50L 2F54D 3RTQA 4ZSOE 1CF8H 4EEEA 4R8WH 5HPOA 4L5FH 3AS0A 1I3RA 1I7UA 1MCSA 1U8IB 3MV9B 3D3VA 3CXDL 1P53A 1T21A 4X4XA 3MRRB 5KN5B 3LEYL 2ESVD 3RVWD 4ODWB 5ALBL 3QDMA 2RQ8A 1XGQB 5DD1L 3N1GC 3PQYA 3ULVF 2HN7B 2W0LA 3F62A 3V6BR 1M7XA 4X9BA 1FFPA 4CNIA 4H0IA 1HH9A 4PJGF 4YLQT 4ONHB 5C0EA 1PW3A 3KYOB 3V5HA 4Y2DA 5HHXH 4D0BA 3MYJB 1WTLA 4MSWB 4P3CL 2FJGA 3CVHB 3HMWH 4MB3A 3DTXA 1OD9A 4HFWA 1MJJB 5E6YA 1WFTA 4HGWA 5TQ0H 3CDGA 4XNQB 3IU4H 4KKCD 5EULV 3OHXA 4BQBA 1HHIB 4I2XE 1FIGH 3BD4A 2JB6A 5CD3A 2VABB 5DJYA 3TBTA 3WLBA 5C08B 4N90D 1ND0A 3AU1A 4LLMA 3SDDD 3U6RA 5BRZD 4D0CB 1QEWA 4DW2L 4C58B 4BH8A 3IFOB 2W38A 5CKAA 3IDXL 4LHUG 4DZBA 4R7NB 4KDTC 3D0LA 3GNMH 3DX6B 4U6XA 2N4IA 1QFPA 4DGIH 2B4CH 4LCIH 3OKNA 1JHKL 4GKZB 3UZQA 4ACPA 2J8UB 5IW3A 1C7TA 3U7YH 2VDQL 1R5WA 2X42A 4HZLB 3IFPB 3RWJA 4G8EB 3JWOL 3F6IA 4G9FE 2DJSA 4M7ZC 4YWGH 2FLRT 2B2XL 5KSUA 3F7RA 1BX2A 1OP5K 4JRXA 3IJYA 2DQTL 2DL2A 1DVFC 5GGRA 1F90H 3FZUD 1KN4L 3BRFA 3UTOA 3DMMD 4I18A 1OTUC 3K4AA 3TIEA 1J8KA 4GW1A 3HA0A 2I9LA 4I0CC 4RBPK 2DTML 2WBJC 2DDQH 4PJBA 3VGDA 2P8LB 3FQTA 1R5VA 5HD8D 4P4RA 4GRLA 1AD0B 2V2TB 3AM8C 1FAKT 1NLDL 3H0TB 1MSPA 3S4SG 4JFQB 2A83A 4KROB 3WYRA 1CFBA 4S11A 4TSAL 4PG2A 4NQED 2VLLB 4N9GA 1DBML 4H88L 2PXYC 5LAXA 4C4KT 1UM6H 5ID1A 3EDJA 4IRZH 4XNYL 1UACH 5BMFL 4BFEA 1I3GH 4X6BB 3K4DA 4X5WB 2ZUTA 4NN5B 5FECA 1HIML 3KYMB 1I8LC 1CBVL 2D3VA 3V0WH 2FD6H 3CLFH 3BDXA 3O6FD 5EU6D 1TVBB 1JPFB 3S96A 1NGQH 1VADA 5F7LB 5HPMB 1OAKL 4FFYH 4F7MA 2VNCA 3VA6A 1FVDA 3DWTA 5GS0D 1L0QA 2ZJSL 2VISB 3VD3A 4M48L 4C56E 1IGMH 4C57C 4MA7H 4JB9L 1F4WH 2D7QA 3CPLA 3NPZB 4AEIL 1J1PL 5IKCB 5AAWA 1OQXA 3BFOA 3DXAA 3HLAA 2ZCKL 1QSEE 5SWSE 5FDWA 2O5ZH 1X3DA 5KVFL 1MWAA 3U7WH 3IKKA 2BK8A 4OLZH 4PJHA 5IB1A 5CEZE 1BQLL 2F53B 2JJSC 1WBXA 5BZDA 4HF5L 1UVQA 4MDJA 3T1FB 4PJXB 5HGHA 3VMNA 5CEZL 2KL6A 4AG4L 5E00A 1A4KB 1BZ7A 2HJKB 4OCRL 4R4FH 5I1KL 4F2MB 2EDWA 4YBLB 1S78C 2V7HA 5IMMA 2YD2A 4JLRB 1MRDL 4PTTB 1MQKH 5J3HC 3SCMB 4Z7OF 2P8MB 1GGBH 3AB0B 1PSKH 2D2OA 2VRAA 4HUWA 5HHMD 4WWKA 2AK1L 1IKNA 3BD3A 3QJHB 4XC1H 3VWKB 5JHLH 2P46B 2EEAA 5SWZE 1UB6A 1MPAL 2YPLB 5HVHB 1YUHB 2WLYA 4WHTB 2W60B 4Y5VB 3VCLA 4XRCB 5DJ2A 5B38A 2ATPA 3T65A 3UJJL 2X4UA 1QFHA 2VAAB 3X3GL 3QDAA 2V7NB 1JWUA 2VO5A 3NIGF 4R3SB 5I1LA 5IEHB 3S37H 2UZXB 2DTSA 5D6DA 5HHOE 4F57H 1I1AB 3G5YB 1XF2A 4XTRC 1IEHA 2OP4H 3BDYL 3GSRA 4R0LB 3VGEA 5GS1C 4KUCD 4WI7A 3PP3H 4KZDL 1KTDA 4PJ5A 5I18L 1LWRA 1A6PA 3GSUB 3VGGA 3FCTA 4NDMB 3O2VH 1RVFH 2XY2A 4QHLA 3VI4E 3N0PB 4PD4K 1YEIL 4NFDA 1MCWW 4GXVL 3C60A 1FH5H 4KVNH 3GIVB 4KKLD 4NJAH 2HG5B 1LP9E 3IKCA 3R8BB 1BAFH 3R1GL 3OB8A 1MCRA 4P49A 5L6YL 5I1HL 1BJ1J 4MD4A 4XBPB 3HNSH 3QIUC 5FYKE 1OB1B 1VFUA 4DAGL 3QEQE 3PXHA 5IMKB 5FOBA 1P7QD 1FYTE 1MVUA 3L3KB 4PREB 4ZUVB 3QXDB 4HKXA 4QXGH 3Q3GB 5F7NC 2VAJA 5IB4B 1AGCA 1X5YA 1OPGL 1S9XB 4JO1L 2F54E 4JDVB 1YC7A 1N5YL 1Z9SA 2OMNA 4F58H 1WEJL 5IK3B 1WTGT 4MAYA 5D1ZA 1P9MC 5CS7A 1C12A 3X13B 2YUWA 4PRAB 3V4VH 4RA0C 2YSSB 3HE6B 4PLJC 3KHQA 5DGRA 5DHXB 5BVJB 4XZUA 1KIPA 2ESVE 1RD6A 1IT9H 1U3HC 1UA6H 3GSVA 3UJIL 5EOQH 3CDFA 4HC1L 4FMKA 4FQ1H 1QA9B 5E08L 2CR6A 1BFOB 1T6VN 4KKBC 5CGYC 1QTYT 2BHZA 4RISH 4OFDA 2GY5A 1S7SB 4ETQA 4L29B 4BSJA 3G04B 4FA8A 1MCJA 5CJOL 1RZKC 3MX0A 2Z31C 4I4WB 1UZ6E 4E9LA 3V6OC 1D6VL 4XC3H 4UTAL 1C08B 1Z0NA 4PGDA 1I7TB 2OL3H 1CE6A 1BQHA 2D9QB 3DRQB 4MNHB 4M43L 4NC1E 1DBBH 1WT5C 4XHJC 2IADA 4PRIA 1NCNA 1CTNA 2DI7A 4JANA 1ZLWK 4U7KA 4U33A 4N90E 3QXAA 3LEVH 1TZIB 4RAUB 3VXUE 3WBDA 5BRZE 1G1CA 2BZDA 2CK0H 2YMXL 5DYOA 2EDOA 5JDJA 4CUCA 1BBJB 4H8WL 1S7XB 5H35B 3SKJL 1LQSR 4HBCL 2IBGA 4P48A 4FS0A 1DVFD 2QL1A 5TF1L 4MQTB 2VITA 1D6EB 1GC1H 3KPMB 3RWFB 2J8OA 3GSXB 3SEPA 1CQYA 1GOGA 5J0BA 5C2BH 3BOVA 3UTPD 3AS1A 4I3SH 4I77H 4QTHB 2VMFA 4XNZC 3ARVA 5DWUL 1EO8H 3S36X 1IAOA 2WBJD 1ZLSL 3TJHC 2PW1A 4KI5F 5F89B 1JI2A 4NZUL 4TPRH 4OD1H 3U46A 2UWEA 3KR3H 1FFQA 4JPIA 3W5NA 5JUEL 1YQVH 4Z7VA 1KCUH 2BOBB 3ARBB 5KSBF 5ESQB 4U49A 4QRQB 1AC6A 4NQCA 3IVKA 2IPUG 4GW4A 1KC5H 2PXYD 2QHLA 2JCCB 2J6EL 4AL8L 2PYFB 3BKJL 4WW2B 2VQTA 5AEAA 3MUZ1 5F1SA 1IGJB 5C0AD 3PJSA 3OKEA 2OM5A 2NCMA 2WP3O 5DZNA 5C07A 3S5LG 5JPMA 4U6VL 4JJHA 4TNVK 2EIZB 1AKJB 4P23A 2C3HA 4Y4HA 1JNLH 3VGAC 3MV7D 1CFTB 2NY2C 2XOTA 1XGTB 1IZKA 4JPWH 1Q94B 1YMMB 3UBXG 3ROOB 3I75B 4NQEE 4MA1B 2YRPA 3ZDXF 1JFQH 1NGWA 4FQLH 3LRHA 4NO0B 2B1AL 1KN2H 4JPVH 4GQPH 1IZJA 4HKZA 3LY6A 1EJ6A 4RMWA 1UZ8A 3MRIA 3VRJA 5LKNA 5JTWA 4KV5F 3WNLA 2KBGA 1MEXL 4ENEC 2VDOL 4GG6B 5JW4Q 1YPZA 1CXHA 5L8JB 1KF9B 1Y18B 3V5KB 3FO2B 4PS4H 4UDUB 5GRJL 1HXMA 3HE7A 1OL0A 2FLBT 5GS0L 4Y4FB 1S7TB 2Q76B 4QNPF 5SX5H 1K2DA 3W0WD 2CKBA 1LDPH 3K8MA 1M05B 1DBAL 3FO1A 2Y7QB 4AYFA 3TBWA 2D03H 1F4AA 2YZ1A 1S78D 2AXFA 1P6FA 4K3GA 5I73C 3MMEB 1F3DJ 5BOZG 1WWCA 4QYOA 3FFCB 5J3HD 3OX8A 3QP3A 5DRZB 3MRLA 4GT7A 3QZWA 4EUPG 1J0JA 4HS6A 5CUSH 1DFBH 3AY4C 3ARPA 1ZANL 4N8PA 1NKRA 4UDTA 4J3TA 4F7EB 1A7QL 1DP0A 1LO4L 1NCAL 3L3GA 3BGFC 3VFRB 1NQBA 3QIBA 3HRZB 3RL1B 1A6ZA 3EYUL 5CEXB 1D9KC 3TVMC 2ZCHH 4YHZH 1WITA 1AE6L 4DN3L 4ONFH 3WFEH 4JFFD 1KIQB 5C6TL 5HHME 3D9AH 2HT3C 4OI7A 1G6RB 2NNAB 5JMOC 4XTRD 3P77A 5DJCA 1XGYH 2P5EB 2A6DB 3GSNL 4ZFZA 3MRCA 5BS0E 3BAEH 1RZ8A 3VFOB 1FRGL 2IFGA 4GAJH 4YC2C 3ROLA 5CBEB 4U1IB 4ODUA 3P11H 1ACZA 4CVXA 3SGEI 2GIYA 1IL1B 1NEZA 5FO8B 3A6CL 3GMRB 4U1SA 1A02N 4IMLA 3LS5H 1C16B 3SBWA 2DKMA 1JIBA 2CJUL 2VERN 1F3JB 2Z35B 3BEVA 1UB5A 1IFHL 3D85D 3RY5A 1LEKA 4MD5B 1ZHLA 4FTVB 4ZFGL 3HPJA 5DR5L 4OCWL 1YEKL 1SJHB 5JPNA 3GUTA 2JJUA 3KPQA 1MJ8L 4NQDB 2QEJA 4DKFL 1FIEA 2XN9A 3W9DB 2JIXB 2BXYA 3CSYA 3MRDA 4Y4KA 2GTZB 1FO0L 4JDZB 3RFZC 3ZKXB 5DMIH 3KPPB 5HYQB 3MOAH 4OZGE 5GGSB 3MJ6A 5GZNC 2EDJA 1MLCB 5E8NB 1U95A 3QIUD 4QTIH 4Z7NE 5ADPH 2R8SH 4Z95L 3TYFA 5E0QA 5FUZH 3OG6B 2QR0B 2FGWH 3QDGA 3QCVH 5D71H 2F8XC 4MJ6A 2X10A 3DV4B 3D87B 1TETL 4XB8A 5D7LB 2H3NA 4JM4L 5FXCH 1I8KA 4JFEE 5I15H 3G08B 3P9MB 3EFDL 4ZFOB 3C8HA 4W4OA 1JNHA 1A1NB 1IEAB 3QNXA 4KTDL 4DUVA 2RJMA 4OLXL 1CLOL 1SMOA 5ICXA 3LKOB 5EUOB 3LRSA 3TCLB 5GS3A 1E4KC 3BP6A 2FYYB 1CD0A 2QQLH 2E7MA 3G5ZA 4LEXH 2KH2B 4XP4L 3SDXB 1CU4H 3PWVB 4DKEL 3ZHKA 5LBSH 3TGXA 2XPGB 3RWGB 4HIHB 4APQA 3MTRA 3BZ4B 3UO1L 5DHVA 1IQWH 2IQAB 1JTTA 4JFHD 4OM0H 3MBEB 3T08A 4QRRA 1LD9B 4KKBD 1X5HA 5CGYD 3U4EA 5I8OL 3RY6A 3SJVD 2CUHA 2AJZA 2APXA 5FYJE 2F5AL 4XP1H 3GSQB 3ULUC 4C54A 5GS2D 2Z31D 2OLDA 1QFUH 2IAMA 4S2SA 4E0RA 3MUJA 4FXKB 4G6FB 1I9JH 3MJ8B 4AEEA 3PXJA 4NQXA 1T20A 4BQ9A 4MQXD 2YBRA 1IAIM 4NN6C 3REVA 1RZFL 4G8GD 4K7PH 4PJ8C 3T4AB 5I1CL 1LEGB 4XHJD 1MCQA 3U7AA 4LEOA 4GKNB 4P57B 3OAUL 4GMSH 2ZUXA 1VFOA 1T0PB 1LMKA 2HJLB 2Q87A 5IVZB 5IQ9B 5IVXA 4OZIB 2JJWA 2AEIT 4NHCL 1I8IA 4LSUL 4P9ML 1MFAH 4ALAH 3QBTB 1A5FL 2NW3A 3KVQA 4PJEB 3LKNA 1KJVA 1BVZA 2H45A 5EZIH 2VH5L 3A6OA 1B2WL 4X7SH 1P4BL 4PJ7E 4CJ1A 2G2RA 3KXFB 4I9WD 4PJDB 5EC1A 4ERSH 4LVOC 3L7EA 5TE4L 3TJHD 4Z0XB 2X41A 2R23B 4X6DF 4XBGA 4WFGD 1KLUB 4UAOC 1I1AD 4L8BB 7FABL 4NWUL 1ES0A 4XHQA 3ULVC 1LEIA 4E41A 4I48A 1YJDL 1CR9H 5DT1H 3GK8L 3UTPE 1KXQE 1FORL 3WJLA 2PW2B 3EGSA 4U6YB 2FB4H 1RMFH 4IIQB 4ELME 2PETA 1J0YA 4QRPA 3PWPE 3SDYH 3MOBL 4MZ3A 3BWAA 4YDKL 1MWAH 2NY2D 2I5YH 4YK4C 2DYPA 2MMXA 2HJFB 4JFZH 1LO2L 5KVGL 3WN5C 3UYRH 1AGBA 4M5YL 3MLYH 3WIHL 4ZAKA 4JQXA 1MI5A 2VXQH 3HFML 4QY8B 4ETYA 2AK4B 3QA3B 3LQZB 2EE6A 1JNNL 5D7SH 4DWHA 3MV7E 3V5DB 4Z7QF 5KZCB 1CFNA 2DLFL 2XRAH 3HC0B 4P4KB 3X3FL 2FX7H 3OAZK 1QO3B 1QBBA 1NAMA 5DK2B 3WUWA 3HNTH 4Z7WA 2DD8L 4ODHL 2AJUL 3PDOA 2YD5A 4IMKA 4TTDC 4M9OA 3P4OA 1V05A 1SM3L 5TFSH 4XCFH 5EC2A 1MIMH 4OCNC 4R4BA 4LASL 3VXOB 1DQQB 1JWSB 1OAUH 4YX2L 3RNKA 4ZG1A 5KSAC 4POZC 4CVUA 4GAYB 3U30B 3W5MA 3AC0A 1PKQB 3K3QA 4W81A 2ICWJ 3H7BB 5D6CB 1RIUH 4X7FC 5EPMB 2ICWI 3UYPA 1GIGL 4NUJB 4ZDHB 3W0WE 2IC2A 2VZVA 4ODSH 1UJ3C 1CE1H 5GRUL 4CADA 4LF3A 2XFXB 1QFWM 1XF1A 1NFIA 1H5BC 1UFUA 1VPOH 5A2KH 2VLKB 4K55A 5D8JL 1QRNA 4NKMA 2IG2L 1D9KD 3TVMD 4LCYA 5I16A 2CRYA 1TQBB 3B3IA 2A2QT 2XZZA 1BIIB 1L6XA 5T1DH 5EFIB 4GBXB 4HW6A 2R2HB 3BKMH 4QRUA 2VZUA 4JR9L 4AM0B 2HT3D 5DVKA 4OCYL 5C0JA 5EA0H 5IB2A 4JFPA 4UNVA 5C0RL 4YDJA 1YNLL 2OTPA 5DRWA 3MGAA 5IP4A 1HHJA 4GMTL 2GJ6B 2UZIL 4MD0B 4JFFE 3UTSD 4LIQE 3G6AB 5KS9F 3VG0H 4P2CG 3LQAL 3QAZB 1FL3B 4V1DD 5ESAA 5SX4H 1ZS8B 2VXSL 1EO5A 4LIQL 2YD8A 1S5HB 4JY4B 4ZNCD 1SY6A 1DQDL 3CMGA 4QHUB 4Y88A 4KQ3L 4L4TD 3RI5K 4O51A 1RFDL 3TN0C 2A6IA 4NNPL 1FNGA 4TSCL 3MCKA 3ZKSD 4XMPH 3VFGH 4OB5L 1FCGA 1BBDH 5C0IB 3JUZA 1RURH 5IG7B 5K9JL 2VDMH 1KENH 5JO5A 5GZND 2H9GA 3ME0A 3VGFA 3B9DA 1A6UL 5TJWK 5GGTA 5E8PA 2FECI 3ET9F 1N26A 5C2UB 3I02A 3MRGA 3NCJH 1F5WA 2GFBA 3RGVD 4GRWH 3EO1B 5E2WH 3RA7H 5J6HB 3PHQA 1A8JH 3MREB 2BNQA 3MNZB 4ZMAT 2HWZL 2DQCH 3S6CA 5DDHB 1XIWB 1NGZA 1PLGH 3DIFA 1FG2A 3JV4A 5I1JH 5IV2A 2WSKA 1T83C 4BZ1L 6FABL 5F6IC 4S1QL 2KKQA 4HWEL 2P8PA 4ORGA 1BZQK 4BM7A 3CX5J 3GMPA 1DUZB 1A14L 2CH8A 1HCFX 3U83A 4N1EA 3BQUA 4LGRB 2FO4A 1DUYA 3AMKA 3RKPA 5MEOA 1CFQA 5DJZA 1KB5B 4EVNB 3IRPX 3L5HA 4HXAH 4LU5L 2KZ1B 4NO0D 1QBAA 3BXNB 1U8NB 2WV3A 1X5IA 5DURD 2VDRH 2C1PA 5LXGL 3T0EA 1MCFA 2AI0H 2E5EA 1X4XA 1ZTXL 2PYED 3MLRH 2L7JA 5TPWL 3ULUD 4U6HB 4CL7A 2IQ9H 4WDIA 3WV0A 4JM2C 5A16B 1LE9A 1MH5A 4JFHE 3UC0H 2LVEA 4TNVF 1MCPH 1CG9B 4MXVF 3E8UL 1T5WB 4PJ8D 2VLRA 2VLJD 3SJVE 4AENA 1ZT7B 5I17A 1MRFH 43C9A 4JVUA 4EDXA 1K6QH 4WVRA 4WTZA 3ETBF 5C9JB 5HYFA 4RDQF 2Z93A 4MB4A 2DBLL 3V6OE 3EJZC 2R2BA 2V2XB 1RZKL 2AJSL 3CC5B 4ZTPH 4Y1AA 2P7TB 4U1GC 4LPWA 4XPAL 1RUPH 5C3LD 3WIFA 1B0WA 4G8GE 3WFDL 2DQGH 3NAAL 3OZ9H 3ZYZA 4R97B 4H1LG 4MDIA 3WFBH 2VZOA 4YEFA 4XX1G 3RX7A 3QCTL 1I75A 4G3YL 4XMLL 3HTLX 1ZV5A 3VWJB 1E27A 4BKLA 4H26A 3G6JB 3D39D 4WENB 3DI2B 3TO2A 5IUSA 5TDOB 1LNUB 2F74B 3RNQA 1AJ7L 3SDAA 4NZRH 4G6AC 4DVBB 4EXKA 5MEPB 4UIKH 1NDMA 4NFBA 1FQ9C 1VESA 1N0XH 4N8CL 4XCNA 2FNBA 3O81A 3ULVD 5ENWB 5BW7C 4I9WE 2NZ9D 1QBML 4NRXA 4DKAA 4JZJA 4MA8H 1FSKB 3FQNB 1BZ9A 4Q9QL 2GAZB 2BSRA 4WV1A 3UYOD 5T3XD 3P0VL 4U1NB 4WFGE 4W68A 1G7QB 3IETB 2CXKA 2Q8BH 3WNNA 1MCLA 2C7UA 4WUKH 1G9NH 4P5MA 3QPXH 1FFNA 1FNLA 1RHHA 4AH2B 4F15C 2CKBH 3ZHLA 2EKSA 4XPTH 4NQDD 1I85C 2R2EA 4XP5H 4Z7UB 5IROA 2GK0B 4POYA 1SEQH 2JIXD 5T1LB 3CXHJ 1H3PH 4W70A 5J6GB 4OZHB 5KOVC 2BVPB 3OR7A 1U8KA 3KPRA 1TCRB 4WJ5B 1SJXA 5I8CB 5LGKA 3VXMB 4P2YA 3GB7B 2BDNL 1QLRA 1FGNL 1YEJH 3TBYB 3WSQL 2H8PA 4ZXBA 5EBWB 2Z8SA 5D7JA 3QIWA 1OW0C 5IESL 3QCUL 2KZWA 3QH3B 3N06B 3QQ3A 5B8CB 5ACMA 3ABZA 2IBZY 2COQA 3SQOL 3PGDB 4ZD3L 1A3RH 1NMCB 3C5SA 1P7KA 5B4MC 3O8XC 4CMMA 2YA1A 5KSAD 5HHVH 3IF1B 1JWMB 4POZD 5JZ7C 2NY3B 5TH2A 2K1MA 1T89C 2PO6A 3QJFB 1WWAX 4P9HL 4PJBF 2EC9T 4JO4L 2AJVH 1NBZB 2XYCA 4Q6IB 1T22A 4WI3A 5DLMH 4RGOH 2ICWB 1OAXL 5IR1B 3V6FA 2GQHA 1RZ7H 2X4NA 1Z2KA 1TMCB 3P0YH 4HT1H 4X6CF 5D93C 3EAKA 3EYFB 4P2OA 2RFXB 1KNOB 4P23C 4KFZC 4MXQC 4TVPD 4Y4HC 5HGBA 3QDJA 1CDCA 4PRDB 3RPIA 5CHNB 1KTLB 5IWLC 1S7VA 3U2SA 1IKFH 3ZDZF 4OAWB 4JQIH 1ZE3C 3REWA 1ORSB 1AXIB 4JAMB 4HUXB 3RP1A 4UZGA 4CAGA 4NN7B 1IGIL 3GHEL 5D1QC 3QFJD 4N8VG 2AV1B 3IU3B 4JY6A 1LK3H 2WIIA 1ITCA 5F9WC 3UPRA 3OR6B 4QCIA 4LCWB 1OAZL 1EH9A 4IDJL 3QFDB 2A38A 2X4OB 4NO2A 4NKIH 5T1KA 4PRHB 4YAQB 5ALCL 4JRYA 4P2QD 3RUGF 5F72S 5I1IL 1KULA 4LLWA 3TN0D 4L8CB 2DQHH 5DTFB 3WKMH 3Q48A 1GGCL 3C09B 4D2NA 2MCPL 1S7RB 1O7VA 4LSTL 3UTSE 4DGYH 1B3JA 3D48R 4JCMA 4RMTA 1VDGA 4V1DE 5B22A 3UEZA 1OGAB 4L4TE 2NTSP 3FB8A 2Y72A 1CDIA 3OXRB 1WC7A 4CN6A 2IAND 3TZVB 5MP6L 3FOMB 3ESUF 3U4BH 3MLVH 4ZPTA 1TNMA 2DWDA 4JKWA 5D96B 5DHVH 1R3IL 2W65B 2WWKT 1OP5H 4X80L 4HPOL 3CFKA 3MUGB 2IPKA 3PIQB 4P46A 1MQ8A 1T0MB 1W0VB 3TIDA 3ARDC 3MRKB 4OIIL 5DEFB 1RK0B 2XZCH 4YXHH 3OB0K 3VXPB 4IDLA 4J2XA 4X4YB 1P84K 4Y7MA 3N85H 2HA1A 5DD5L 4RFNC 2XICA 3T2NL 4KY1L 3V6ZA 4LSVH 5CP7B 4JPKL 2WQ8A 4RFOH 3O4OC 3QQ9C 2OMBA 4EOWH 3GMMB 5ITFB 3B2VL 4G42A 3HAEG 2GJZA 4N0UE 3MNVB 2QQKL 4ZOEA 3MRHB 3KPNA 3DSFL 5C6PB 3RBSA 4X6DB 2GI7A 5L2KA 1EGJA 4NSKA 1OAQH 4OI8A 1OGTB 5K9KB 3JSSA 1IAIH 1UKSA 1OSZA 4M5ZH 3ARZA 3ARGC 1U92B 3PE9A 4M6OL 1XAUA 4UT7L 3B9KB 2JE8A 1A7PH 5DD0H 4NT6B 2AXGB 3WFHA 1E4XH 2AJ3A 2Y5TA 4UNTA 4NPYA 3U9UA 2E7CA 3O6KH 2DAVA 4NRYA 3B6SB 5I8KL 4L3ED 4NNYA 3EO0A 2PYEE 4X99A 2IH1B 3E6FA 3BISA 3ULUE 5D7KD 4ZSOA 3PWLA 4IOFC 1ZEAL 2GHWB 3ULUL 3EJZD 3TA3A 4WCYL 1J05B 5C09D 2EDYA 2R9HC 3HUJF 5CZVL 4LSSH 1U6AL 3FQWB 1HH6A 3ZE2E 2XZQH 2L7UA 1IM9D 4TUOA 4JGUA 2VLJE 2BMKB 2V5SA 5I30H 1J5OL 5B21A 4OLUL 5DQJB 1QUNA 4Z5RB 4LLYA 3MRQA 5ISZB 2ZUQB 2XG4A 3KJ6H 4L1DA 2IH3B