2DM2A

Solution structure of the first ig domain of human palladin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
b'GSSGSSGAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords palladin
publication title Solution structure of the first ig domain of human palladin
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dm2A00
5B4MC 2OR9H 2IQAA 3WHXA 1UWGH 3ZHLA 4KROC 3DSNA 3VGGA 1B0GB 1R3IH 4RZCB 3QNYA 2X4SA 2NNAA 4OLUL 5CEZD 4XP5L 1Z9MA 4XNZB 4OTXH 5M94B 1IKFH 2J6EH 4BQ6A 1AI1H 3MV8A 3LKQB 4JFDE 4LSQL 3I75B 1JF1B 3QIWD 5J4MA 4I0KA 5DRNA 2XN9A 2ARJQ 1G7JA 3ESVF 4HXAH 1OPGH 1NL0H 2ICWA 4FXKB 4TNWK 3TT3L 1VSCA 2FZ3A 4MQTB 4LASH 3I84A 1OAKH 3W5MA 2CR3A 3FB5A 1I1AB 1I9IH 4PIRF 2R0WH 1A3LL 1UZ8B 3ARFC 3SJVD 5FAAA 4HLZH 3P77A 4L8DA 5IM7B 1OSPH 4R0LA 5JIKA 2DM7A 4KK8D 4MD0A 3NABL 5KJRH 3RWIA 1A9EB 1BBDL 4K9EL 3MA9H 3TT1L 4WFHE 1ITBB 3BKYH 1XF4B 4N8CH 2EKSA 1JN6A 2FIKA 4P4KC 5C0EB 2X4NA 3DSFH 2R2BA 3DGGB 3M45A 4AEHL 3ZYJA 5HHME 1FYTB 4XC3L 5EU6B 2I9TA 2X1PA 4YXKL 4UTBL 3TA3A 1SJXA 4U6TA 4DW2L 1A6VL 3CXDH 3LDBB 2EDDA 3NZ8A 3U9UB 2OSLA 4WUUA 3IJSB 3TBYB 1IGJA 4IRSB 1T89A 3ESUF 2YUXA 1LWRA 4YDLC 4UILH 3V6BR 4PJ7F 5D96B 4IDJH 5D7JA 4GFTB 4ERSL 3N85H 3P9LB 2IH3A 1OVZA 4PJEF 3QUZB 3V6OC 1XF2A 4RIRA 4Y5XB 1J88A 3EOTH 3P30L 3HG1A 2D4FA 2NY6C 8FABA 3KLHD 2D9QB 2FD6H 2W59A 2DAVA 4JJ5B 4X0KB 5I1AB 1ZVYA 2ICEB 5JTWA 3LN5B 2VZUA 5EIIA 1NUFA 1YDPA 1MCHA 4LBEA 4QRRB 3TN0B 1S7TA 1UB6B 2FNBA 5I8OH 3U36B 2VZVA 4F37K 4LLYB 2QADD 2DQHH 3OJDB 4HBCL 4NJAL 5IGXL 2VKXA 1FSKC 3WFDH 1PZ5A 5GJTL 1Q0YH 4HIJB 1LD9B 1HCVA 3AROA 2R0ZL 4PD4K 5MERB 4F8TA 1Q9WA 2Z8WC 3CDYA 4Q9CA 3VFTB 3DX6A 5IFHH 2P5WE 2XZAH 3LEVH 4MNHA 2BVTA 4N8VA 3MRCB 3PNWB 3O3BA 4ZAKA 4GRLA 1AKJB 1P84J 4DQOH 3NIFE 3ARSA 2HN7A 2Y1VA 3L1OH 4JDVA 2V7NA 3RPIA 1QBAA 1T20B 1U2HA 2P4AB 5C9JB 4YZFE 4PRAB 4MCZB 4QRSA 4IOFC 4UQ2A 1B2WL 3GI9H 3ZZ1A 2CKBA 1VKXB 2VMFA 1JYWA 3UDWC 4I0PB 3BX7C 4WU7B 4HJJH 1NCTA 3QDME 3KLDA 5C0DB 1JPGA 2QR0B 3DNKA 4AJ0A 2VZTA 5KSVA 3P4OA 4R97C 5T33H 4M7JL 2F54B 4WFEE 1SYVB 4F7PA 3FQNA 4IJ3B 1RVFL 4KKNA 1ZGLA 3CLFL 2YKLL 3B2UC 4ZQKB 3O2DH 4LQFL 3KGRA 4J1UB 3NA9L 1ADQL 3RDTA 2XKSA 3I2CL 4AQ1B 1D5ZA 4G8IB 4IHOA 3VXUE 2LABA 2EE2A 3OAUH 3ARDA 3NCMA 4XI5C 4UAOC 1T1XA 3QDJB 4ONHA 1IC5H 1WC7A 1CXLA 1MAJA 3UYOD 3GMPA 1NCCL 3JWOL 4Q9QH 1J1XH 4OKVB 1HH6B 4RWYL 3T8XA 2FYYB 2R2EB 3TZVC 1IBGL 3AB0B 1LEKB 4ISVB 1KOAA 4G6AC 5LGHL 4UI2A 1JPTH 1O7SA 3PL6A 1JWSB 3PWUB 4JGJA 3T0BA 2Y6SC 4GUPB 1A2YA 4MA1C 2APTA 4QTHB 5C7XL 4N9OB 4U2ZA 4XP1H 3L7EB 2JJWA 4CW1B 5IHUL 4B0MM 3GIVB 3O2VL 4GMTL 3OKOB 3MLWH 1E6JL 4MQXD 2DWDB 2BK8A 4P2RD 3BW9A 2HJFA 5FO9B 3PV7A 2DQCH 35C8L 1CLYL 1VERA 3FT4A 4PRNB 4HK0B 2IH1A 4PJCA 2VH5H 3AFLA 1MHCA 5L88L 5KS9E 4NKIL 5I1JH 4P4RB 3MZGB 1LO0L 3LKOB 2XQBL 5IB3B 2P24A 2H2SC 4OLXL 5JPMB 1K3ZA 1V05A 1BQLH 2YOCA 4ZUUA 1LO3H 4LHUG 4RCAA 4WVRA 2I07A 2XT1B 3RVUC 3RKDD 3RPKA 1VEOA 4J12A 3UO1H 1FFPB 3VDCA 3ZE1F 3I02A 2JIXB 3P0YH 1MVUA 4GS7B 5E2WL 2L7UA 4AK1A 5FYJH 2NTFB 2XTLA 3QEGH 4U1MA 4NM4H 4DKFL 3P0GB 1M6OB 4OM1H 3O4LA 3QXWA 5KTEH 1VFOA 4JM2A 1HXMA 5FUCC 1R5IB 4WW1B 2HMID 3BD3A 4MJID 3T3PE 3QR2A 1FL3B 5H37G 1U0QA 3FB8B 1JFQL 1T2QL 3QZWA 4YDLB 5ALBL 2EKJA 1CE6B 2VLJD 1D6EA 2DYPA 1QSFE 2NY0C 5FYJE 5I8CB 3QA3B 5DJZA 4IRZH 1LE9A 1P5VA 2D7PA 3D3VB 3MRGA 1BREA 4XCYA 5DUMH 5B8CC 4JFOA 2J5LB 1DUZA 3BESR 1IQDB 2FJHB 4LRIC 5T3XD 2ATPB 1YEEL 4CMHB 4DAGH 1U8QB 5L6YH 3MODH 3KR3L 4JFFD 2Q76A 4GAFB 4YHMH 4QOKB 1U8OB 3TBWA 4DGYL 1HI6A 4U6XB 4JHWH 3KPMA 1RK1A 4TUJB 1CFBA 1SVZA 1CXKA 3GMRB 3LZFL 5EOCH 4HCRL 2BNRE 2BVYA 3TESA 5AZ2L 3KS0J 4UBDD 4D3CH 1F45A 1MFEL 1P1ZA 2BY2A 4P23C 5D7SL 1MNUL 5MI0C 2IQ9H 4RAHA 1A4JB 2Z91B 3DRTB 2GUOB 3GGWB 2EYTA 1KTLB 1TLKA 3V4PH 1E0OB 1JNJA 1AFVL 2B5IC 3FT3A 3G9AB 4Y16C 2R29L 1DL7L 1KTDA 1CLZL 2XNAA 4LSTL 3MFFB 4AL8H 1H15B 3I9GH 2HFFB 3TNNB 3TPUA 4UDTA 4R2GB 4Y4KD 1G9MH 3I6GB 3VRLF 4KRPB 1RV6X 5MHSE 4KKCD 5D7LD 1DZBA 3CH1A 4X9IA 4NP4H 4QRTB 2EZ0D 1MJJA 4BQBA 2XZCL 5BRZD 1TZHA 3LPGA 1N64L 2HT2C 3RU8L 4NHCH 1ETZB 4HUUB 4F9LC 1EEUA 4PJGE 4MZ2A 4OB5L 1A5FL 4G8EB 3RKPA 4OFIA 5JORA 1UH2A 4AM0A 4PG2A 4HIEB 3QO0A 5D1QC 4AY0A 1K5NA 4DCQA 2R4SH 2CUHA 3GEWB 3FRPG 4M6ML 4GKOA 3QNZB 2EIZA 3ALPA 3BJLA 1OB1B 3S36X 4WHTB 2R4RH 3TYFA 1QKZH 3ZLQC 1GIGL 4HEPG 3PWVA 1KT2A 1NGXA 1UC6A 2VAAB 5BXFB 3CMOH 5LVEA 1U42A 5TPWL 4P2OD 3DUSB 3F65A 3NCFB 3ILPA 1QO3B 3NN8A 5BVJB 3GSRA 3SBWC 4N0RA 4XP5H 3H6JA 1CF8H 1EVTC 5SWSE 4YJZL 3VGAC 5DDHB 1XH3B 1JHLL 2UUDK 5ILTL 2XY1A 1OSZA 1UVQB 4LSQH 2R23A 1IM3A 1IGIL 2Y25A 1QFUL 1WJ3A 3RX7A 2Q6WA 2LU7A 4JZNB 2MPAL 3LV3A 4L4TD 5DGRA 1C5CH 5GRXG 3TT3H 5SWZA 4ENEC 2PYEA 4FTVB 1U9KA 3BRFA 2ARJA 3HZMA 2BNUA 3HKFA 4HWZB 3QQ4B 4PP2B 3MGOB 3WE6B 2BHYA 4X8XA 1A3LH 5CJXC 1MFAH 1FZMA 1HHKA 2BC4B 1KG0B 5CSBA 1X5XA 5DJXA 2CDGB 2NX5B 3NABH 3T1FB 3ZTJG 5DHVB 5FB8B 1BBDH 3PV6B 4K9EH 3TT1H 5DO2D 1FYTE 2QTEA 4NN5B 5JW5A 4KI5D 4RNRA 4X7EC 4GKSA 4XWGH 4MJ5A 2WBJC 3MACL 5CEYB 2DWEA 3IDIB 5ESVA 3BXNA 3PDGA 1U2CA 1FNEB 1T6VN 2BSSA 3OB0H 3TO2A 4QRPE 4S0TD 4XC3H 4P9HL 2KPNA 4YXKH 5IEHB 4UTBH 2ICCA 4CN6A 5JR1L 4EIZC 4ACPA 4DW2H 3QIBA 2B1HL 3KPSA 2AI0L 5DFVC 2H32A 2X4OA 1F4WL 2HLAA 1HDMA 3MREB 1NKOA 1FL5A 5DJYA 2ZG3A 1TCRB 4O2EB 2BSTA 2X4RA 5LGJB 3DWTA 3WUWG 1ZHKB 2XZQL 1B88A 1BLNB 2YN3A 4ERSH 2X70B 3QUXA 4NKOA 1J86A 4QRRE 1WWCA 3B9KB 5IB1B 4LPYA 5A2FA 5IK3B 3P30H 1S7SA 3G5VB 5CEZL 5C3LD 4HF5H 1B0GA 4RZCA 3LRGA 4BFBD 4GG6B 1DUYB 3RJDA 1Z9SA 2J12B 2R1YB 4MGXA 5DHYB 1V3KA 1CD8A 3EYSL 4BFEA 2F8VA 2AXGB 1BGXH 5F7DA 4CJ1A 4NJAH 2QKIB 3KPQB 5IGXH 5MEQA 3P3YA 1B6UA 4XZUA 4WI9A 1XFPA 4G7YL 4PTTB 5GJTH 4C58B 3VFRA 1SJEA 5F7HA 4FXKA 4EBQL 4H5SA 3ARBD 4MA8L 4UQ3A 5FYKU 2O26U 2RHEA 3QEHA 4F3FB 4HQQL 4KJQD 3T3ME 4MQ7B 1I1AA 4JANB 4LEXL 1UZ8A 3RIAK 1BM3L 1GSMA 3G5ZB 2FH6A 2ADJB 3B9AA 1BECA 3G6JA 2IWGA 3QDGA 1TJIL 4KTDL 5MEOB 4OGYL 3E2HB 3QIWB 1B2WH 1YNKH 4YGAB 1WZMA 2KDGA 3MUGB 2F54E 3BZFA 3OF6A 1B6DA 5C0EA 1CGWA 4LARL 3WNPA 1X5IA 1UH3A 1OTSD 4HH8A 2UVFA 2UWEF 1IQWL 3EO1B 4W4NA 5T3ZD 4QGYA 1K4CA 3QXTA 5EU6A 3DVFA 2I5YL 4M7JH 4PJAF 1ORSB 1VGKB 3CLFH 3U7YH 2YKLH 3SJVB 2Q86B 4LQFH 4ODTL 1L4IA 1I85A 4UINL 3NA9H 5I2IA 5D5MF 1ADQH 4QTIL 1A7QL 2EO1A 3I2CH 2EDKA 3QDJE 2VLMD 1ZK9A 2VDKL 2G5RA 5EFIB 3IFOB 3G6DH 1KB5L 5DK0B 3JVGC 3IFPA 4KJPC 5EU5A 3SCMC 1IRAY 4RGMC 4FZEL 2CXKA 2PO6C 3HB3D 4M3KB 5I1AA 5D93C 4JJ5A 4X0KA 3V7MA 2R0KL 1D3CA 3D48R 3LN5A 2IAMA 5CZVL 5CD3B 3UYPA 3TN0A 3MJ7A 1UXWA 1NCCH 4CNIB 1ZVHA 4RWYH 2FLBT 1TZIB 2VZSA 1IBGH 4D9RE 5KN5B 1KC5L 2EYSA 4L8SB 2O93L 5LGHH 3T0EA 1NQBA 5ENWB 4XHJD 3FJTA 1A6AA 1CQKA 1LD9A 3AMKA 1S7RB 1ES0B 5MERA 3EO0A 3VGAB 3QEUB 4O2FB 3IXTB 2X5PA 5C0CB 1KEML 4X6EB 1ZGLP 1YYMH 1AQKL 3MRCA 3PNWA 3ZDXE 3IGAB 3GB7B 1U91A 5IHUH 3SDCA 3O2VH 1RHHB 4GMTH 4ODXA 4QHKI 2AQ3A 1E6JH 3J7HA 3RA7L 3BSZL 5JQHC 5DZLA 5TH2B 4CU7A 3WFZA 2DQIL 3X14A 3B43A 4JVUA 4LLAA 2NMSA 3WUWB 35C8H 1CLYH 1VKXA 2PETA 4POZC 5L88H 1P4IL 5CSGA 3VXRE 4WU7A 1UM4L 4NWUH 3UTTD 5LBSL 5SX4I 3JTTB 4NKIH 4Z0XB 1H9VA 4B50A 2PW1B 1LO0H 2DJUA 3UC0L 4X4XB 5A40E 4YHYC 2IMNA 4P2QB 2XQBH 4ZUVB 2W9EL 5IVZB 1I3UA 1SYVA 1SBBA 4Y4HA 4MJ2A 3MRPB 3N06B 3WS3B 2WIIA 5CKGA 3P2TA 3QUYC 4N5ED 4UT7L 4WHYG 1C8PA 4M1CD 4S2SA 4F33A 2R2CA 5E2WH 3AU1A 2D0GA 4DKFH 2ADGA 3T0DA 3DI3B 4X6CF 3KPRD 4J6RL 4Z9KB 2HKFL 3LB6D 3VFUB 2GY7B 4YPGA 3FFCD 4YUEL 1CFVL 2C4FT 1EDQA 5AZEH 4MVBC 1T2QH 3D3VE 4JPVL 1C5DB 3ALWA 4GAGL 3R8BB 5ALBH 2FYYA 4UIMB 5EUOA 4Q9BA 1LEKA 1QRND 1OY3B 5DFTA 2GI7A 2EC9T 1JWSA 3CC5B 4Y19D 3PWUA 3MJ8B 3U6RB 5HGBB 4D8PB 3QIUD 1SHMA 5JOPD 3MLRL 2NY5L 1YEEH 3BPOC 4GUPA 2HVKA 3KR3H 1LP9B 3WLWD 5T1DL 1KXTB 3O6KL 3OSKA 3L7EA 1INDL 4JQIL 4CW1A 3OQ3B 4XCCL 4DGYH 3KDMB 5AAMA 1JHTB 5DRWB 2YRZA 5FGBA 4HCRH 4PV8A 5FXCH 4DKAA 5AZ2H 1FG9C 2VC2L 1MFEH 4AT6B 4HK0A 5D7SH 3WCYA 1MNUH 3ES6B 1WTGT 3ARFA 3D39A 3QB7C 5INDB 1CE1L 3DHMA 5TE7L 3IJYB 4P4RA 2I60L 5DWUL 2OZ4A 1AFVH 1AIFA 3GJFB 3LKOA 2R29H 4LSTH 3TIDB 1CLZH 5IB3A 3DYOA 5E8OA 4X5XB 3SGEI 3S88L 1GAFL 4NQCA 3IF1A 4Y1AE 4Z7WE 5E6IC 1FFPA 4P2RB 5F89B 2ITDB 2FEEI 4FNLL 3OKEB 5E7FA 1MWAL 3ZKXC 2IPTL 1VPOL 2XZCH 2NTFA 3I3EA 1WCQA 1N64H 5DJ8B 3RU8H 3IDGB 3BAEL 1M6OA 4OBSA 1CGTA 3WFBL 4EKXA 1R5IA 3GSNA 3BIKA 4LEOB 4OB5H 4WGWB 1GYAA 1ZT4A 25C8L 3BN3B 4G8FB 1FL3A 1A5FH 1E28B 1QNZL 1LE5B 3FB8A 1AXIB 4OIAA 3CSYB 1T7ZA 2OTPA 1YEIL 1FC1A 3SDXF 4Q2ZB 3ULVD 1T0PB 2JJTC 4MYWB 4U1LA 3V6OA 1LEIA 1H3XA 3IETB 3C2AL 3BH9B 5D6DA 4TVPH 3AXLB 1MY5A 3GHBH 1GIGH 3RRQA 5D2LB 5JUEL 2ATPA 5F96L 2P5EA 5FIEA 5TPWH 3CJJA 5HI4D 5EDXA 3WJLA 1RSFA 4JAMB 4OCSL 2C9AA 2DTSA 2EIBA 4QOKA 2EE6A 5C0BD 5EBLA 1Z0MA 4ZFGL 5DZNA 4TUJA 2WM0A 4R8WL 3BP4A 2VLJB 1BVKA 2LVCA 3GMRA 4TVPE 4LRNL 3U0TB 5DHVH 4GH7B 2W0FB 3KYOA 4JO2L 1R3LB 1JHLH 3TO4C 1U8IB 4PP1D 4OZFG 1CFNA 4J8RB 5ILTH 5GGVL 1IGIH 5AUMB 1QFUH 1U8NA 2MPAH 3CZJA 4KH2A 4X6DB 3MFFA 4M62L 3DGCR 3RX5A 1H15A 2YMXL 1AY1L 1J1PL 1N5AA 4R4NC 5D9SA 4NNXA 4OCRL 1V5JA 3LN4A 3V0AC 1ZANL 3I6GA 1CLOL 3P9MB 4XPFL 5IVXA 3RWCB 4QRTA 4RFNB 4KKBC 4HUUA 3VXMD 4EI5D 1N26A 1WFUA 3RIFF 4NQEE 4XMKL 2Z4QB 4FHBD 2VABA 4NC1C 1P69B 5HYSG 4ZUWB 4Q6IB 4G8EA 4LSVL 4I9WD 2OTWB 4KTEL 1CR9L 1I8MB 1IEHA 4JPIB 1HSAB 4DKEL 3KPPB 3QJFA 2CJUL 3OZ9L 5B39G 1F4XL 1VFUA 3IFLL 5A3IC 5ICYB 5JR1H 5D7LB 4PGZA 1W0VB 1Z2KA 5EBGA 3HC3L 2B1HH 3HE6C 2AI0H 1F4WH 3EGSB 4WNQA 5BRZB 5GSVB 2APVA 3REWA 3TZVD 2XZQH 3O4OC 1HIML 4K07A 4GG6E 1K8DB 5L9DL 3H2WA 4UZGA 3DUSA 4P2YA 3UEZA 4JLRB 4ZOBA 4OFPA 3VRJB 1AC6A 4LHUA 1D7FA 3TV3L 2R56L 5CEZH 1FGNH 1NCBL 3T4AA 3EYOA 4OCXL 3G08B 2V5TA 5I9QB 3S35X 3BIBX 4PD4J 4E5XA 5LAXA 3EYSH 4LAJH 4YR6B 1L9NA 2DQUL 3WLBB 43CAA 3MRMA 3QI9C 4CJ0A 4ZNCD 2ZP0T 4JPKL 4EBQH 4P2OB 5CEZE 5BS0D 5CZXC 2NY3C 1X3DA 4I18B 3MV8E 4FTVA 4ODUA 4HQQH 4NFCA 2W9DL 2ED7A 3QQ3B 3MGOA 4PP2A 1QSED 4WV1C 4YLQT 5D72H 4LEXH 5IVOA 3WE6A 2A0LC 5F7NC 1BM3H 4OGAC 2ZPKL 3WHE0 2NCMA 2NX5A 3T1FA 4KTDH 4OGYH 2W38A 4LVHC 3TH2T 1XIWD 2H2PD 4KJWC 3TNMB 5CEYA 5SX4H 2WW8A 4HWBH 3CZFA 3BKCL 4L4TB 4HXBH 5GHWH 4M1DL 4FFZH 3SJVE 4APQD 3MOBL 4NCC2 4OF5A 1IQWH 3UP1A 4PRIB 1RZ7L 1PVHA 2I5YH 1CLCA 5IEHA 3NACL 3SKOA 3BEVA 1MCNA 2VO5A 4W4OA 2MNUA 1LO2H 1SQ2N 2XPGB 3O8XC 4ODTH 3VA2C 3MREA 2HT3C 4OZFB 3OJVC 1IC7L 3MRKB 3PQYD 4UINH 1TCRA 2HTLC 4QTIH 1A7QH 5FYJU 1V3LA 3CFDB 2GK2A 1BLNA 2VDKH 4K3EL 1PZUB 5TFSL 1KB5H 3U2SB 1EXUA 4XBPB 4FZEH 1BFSA 3DURA 1KLFA 3CFCL 2R0KH 1JK8B 4QF1B 1DUYA 5CZVH 4LRIA 2LE9A 5DHYA 2BNQA 4HKJB 3KYMB 3B8YA 4U49A 1C7SA 4OFYD 4KHXL 2P7TB 1I4FB 1KC5H 1U8KB 2AXGA 4NC0B 1CGVA 1Q8MA 3KPQA 4UT6L 2ZKHL 5GISL 4F57L 3B2VL 1LNUA 1UJTA 3VE0B 3IDYB 4J3WA 2DJ4A 4PJ5A 3IJHB 4E41A 4HJGB 1TQCB 5GXBB 5IHLB 4F3FA 4FQJL 1B0RA 4MQ7A 4P23A 5I1LB 3I3BA 1KEMH 1AQKH 3FRPA 1XF3B 3QG7L 4U0QB 2E6JA 2ERJC 4YHPB 4JFYB 4CN4A 3RA7H 5FK9A 4Y16A 2GJJA 3OXRB 2DQIH 4YHNB 1HKLL 1TNMA 4DZ8B 4K94L 3F6LA 3GHEL 5T3ZL 1P4IH 1UM4H 5LBSH 1FJ1B 1P6AB 3ARBB 1IGML 1RJZB 3QJHB 3CVHA 2Q1EA 2F15A 2V6HA 4MDJB 4QXWA 3SGEH 3UC0H 2EDNA 1U8HA 1ORSA 1G9NC 4L4VD 4J2XA 5B3JE 2KZWA 2C1PB 2FX9L 4PGBA 5ISZB 1X5JA 1Z0NA 1PKQA 2MOVA 3WD5L 1JV5A 5D1QA 1CGYA 5F21B 4YDVB 1LO4L 1AD0B 2XTJD 3FQWA 1PD6A 1TVHB 1CD9B 2FO4B 1EA9C 5DK0A 2MKWA 3FCTA 4J6RH 2HKFH 1UXSB 3LSOA 1QOKA 2AXFA 1CFVH 4HFUH 3QQ9C 3K2MC 3UTSD 2HVJB 1AHWC 1EFXA 5GGRA 4JPVH 3UBXG 4GAGH 3TFKC 4M93C 3G04B 2ZNWA 1TZIA 1Y0LA 3KHQA 5FKPB 4UU9A 5C0JA 4U1JB 3TBTA 4F7CB 4KKLC 3DROB 1YN7B 4J3TA 1CG9A 4HWEL 4OZHB 4WDIB 3SBWA 3GRWA 4CVXB 3N9GL 1WLHA 2A6IB 4HIIA 2VUYA 3QXUA 1F6AA 2NY5H 4PJHE 2D7TL 4QRQA 4NRXA 2YEZB 1I7ZB 4HC1L 5T1DH 5C0CA 3O6KH 1INDH 3MROB 4JQIH 5TF1L 4XCCH 5ESQB 3RY6C 1HYSD 3QI9B 5TH2A 4UT9H 3WUWA 4MZ3A 5J6GA 3VMNA 4I5BB 2VDNL 1D5XB 1G7HB 3U4EA 5CJXA 4W68A 1BFOB 4X7DC 1CE1H 1X5KA 4Z0XA 2IADA 2CIKA 5TE7H 2I60H 3PJSA 2CLRB 5DWUH 4X4XA 4P2QA 4P2RE 3KJ6L 1KPRB 1WT5C 4LSPL 1KJMB 3MRPA 2ITCB 3VA6A 2YD9A 5EU4B 3RNKA 5BV7L 2WBJA 4ODWB 1N2RB 4ZPTA 1AGBB 1WTLA 3U1SL 5AEAA 3D25B 4FNLH 1MWAH 2IPTH 1VPOH 4I0CC 4OLYL 3BO8B 2ZSVA 5KVDL 5HVHC 5HYEA 4NT6A 4OIIL 3FO1A 3BAEH 5DFVD 3WFBH 1KYOJ 2P8PA 4NO2B 3EDJA 3O8XB 1JGLH 1BP3B 25C8H 1C5DA 3GMOB 4JG0L 1TNNA 1YEIH 3L5WA 3QO1B 4ZTPL 5IWLC 4NZRL 5H94A 1EGJA 1MCKA 5HXMA 4A6YA 4UB0L 1T0MA 3C2AH 1S78C 1ZV5A 5IKCB 4MJIE 1PY9A 5JUEH 2VJXA 3T0WA 1N0XL 1A6WL 5DA0B 5F96H 1BZ9A 3V6ZB 1C16A 1LP9A 1NFDA 2VLJE 3LEYL 3FFCB 4LVEA 4MX7A 4G9FD 4OCSH 4JFEA 5DK3A 5IOPA 1CCZA 1KB9K 2CRIA 4ZFGH 2O61B 1NGWA 1JHTA 5JOEA 4R8WH 4LRNH 3B5HA 1QRNB 1BF8A 4BKLB 1CWVA 4JO2H 5A2IH 4JFFE 4AT6A 2OZ4L 4X6DE 2H26A 2WWMD 4Y19B 4WGVB 5IROA 3Q0HA 3ULUD 5F97E 5GGVH 3QIUB 4JFQB 5KSUA 1CK0L 4AIOA 4EZMA 2QEJA 5E00A 4M62H 4X5XA 4JRWA 2YMXH 1J1PH 1YN6B 4HGKC 2HAZA 4YWGH 1VCAA 4G6FD 5TQ2L 4UMGA 1CLOH 4XPFH 1KIPB 3BYTA 3O3AB 1I7TA 2GT9B 4PUBL 5F89A 2ITDA 4I3RL 4WI4A 1T04B 3OKEA 1CGSL 5CZKA 2AJVH 1I3RB 3GSNL 4EVNA 5DJ8A 2AQ2A 2FH8A 1V7NL 4LLMB 3CFJB 4JKMA 5GS1C 4LEOA 4XMKH 5D7LE 1A6TA 1E28A 1LE5A 4BK5A 4TTDC 4LSVH 1OGAB 1DVFC 2GITB 3HRZA 4ZS6D 4WCYL 4KTEH 2WSKA 4QHNB 4DKEH 2FIRT 2YPLD 3WIHH 5BRZE 2CJUH 3OZ9H 1E4XL 1F4XH 3IFLH 5C0RL 1E4KC 1M71B 1I1YA 1H3TA 5GZOC 3JVGA 3MRDA 3IETA 4I4WA 3HC3H 1N6QL 3EOBB 5BMFL 5D1XC 4JG1L 2PO6A 1FPTL 3M17B 3QFJA 4UUJA 5FGRA 3CX5K 1YNTA 1ULVA 3UJJL 2YD1A 3FQRB 1HIMH 4YBQC 5L9DH 5EOTB 4F80A 5EG6C 3FOLA 4V1DD 3HAEB 3U0PB 4KZDH 3DARA 2VAJA 5J9PB 5DA4A 3TV3H 3MRQB 5CWSA 2A74A 3W0WD 1NCBH 4OCXH 4F7EB 3H9SD 3JWDC 4CVZA 1MCLA 2DDQL 1XCQA 4OFKA 1OD9A 4FFWC 2YD6A 4PFEA 1OWWA 3JV4B 1G0DA 4XXDB 2DQUH 3CGTA 5AUMA 5J06A 3Q1SL 2R2HB 2DBLH 4JPKH 1YC7A 4PG9B 2JLLA 2OLDA 3O3EA 2VXUL 2BERA 4JN2B 5C0BB 3R0MA 2EDEA 2W9DH 4RA0C 3SQOL 1YMMA 2G5BB 1AGFA 5IFJB 3DBXB 3MLYH 3RWCA 2IBBA 1QHPA 2ZPKH 3P4MB 3K46A 5SWZE 4L4TE 3UPRB 1FO0A 3Q48A 3TCLA 4BFGA 2X10A 3L5XL 2AKRB 3GK8L 4JREB 3QUYA 43C9A 3BKCH 3DVGA 4YFLF 3MOBH 1EJOL 4OI7A 4ZFFA 1RZKH 4LL9A 1I8MA 4ETQB 2YUVA 4JPIA 1HSAA 5IVNA 1RJLB 1G7IB 1RZ7H 2JCCB 4PGJA 1NDGB 5HVHB 3NACH 3VWJC 3NFSL 1E4XI 4YE4L 5IMOB 5KAQG 2V17L 2B4CH 1IC7H 5DEFB 1GGCL 3AS3A 5J12B 3RVWC 5KSAB 5E24E 4MD4B 3VXMB 4EI5B 1CDJA 1DJSA 1K8DA 3ARQA 1PJ9A 3BP6B 5TFSH 4PV9A 4JLRA 1EO8L 1CICC 1G7QB 3VRJA 2UY7A 3MRBB 4K7PY 3OAYK 2HG5A 1JWMA 1U3ZA 3G08A 1IEBA 3MV9D 4M02A 3ZHKA 4RMUA 1JRHI 5HBBA 2VERN 4WI3A 1G1CA 4KHXH 4YR6A 3NIDF 3GSVB 5HD8D 3F7YA 4F7MB 1P7HL 2ZUSA 3V6FB 2ZKHH 2WWKO 3S4SB 5GISH 4XWOD 4F57H 1A4KB 1F2XK 3B2VH 4U1HB 4C56D 2CLVA 3QUML 5IB2A 4P2OA 2OCFD 1QG3A 2G9HA 4RGNC 4DGIL 1GRWA 2VQTA 4NUJB 3SGJC 3ULSA 1T4KA 4FQJH 4OQ1A 1LK3H 4MWFB 4FQCH 1RUML 2VWEC 2DLHA 3QG7H 4P5TC 2QSQA 3B5TA 3EJZC 2YZ1A 5F6HJ 2PKDA 3ARUA 4Z5RB 5IMLA 3EOYG 3T3MF 1HKLH 5DVLA 5EU7C 4LCUB 5C09D 3X13B 5T3ZH 5F71A 1HHHB 5E6IA 4ZXBC 3EDKA 2QBWA 1IGMH 1PYWB 5BS0B 3WO4C 4LU5H 4PRIA 3QUMB 3AY4C 1B3JA 4Z7NE 2R1WB 1QSEB 1QBML 1MVFA 2IPUG 2MKLC 2IPKB 2GFBB 1AJ7H 2FX9H 4M7ZB 4OZFA 3WD5H 4JKKA 4ZFZB 5BOZG 1DVFB 1EUUA 5T3ZE 2A6DA 1XIWB 2HFEB 4KJYB 1LO4H 4S10A 4YBLB 3BMWA 5TDNA 4KUCD 2JJTA 1TJGL 3MGTB 4X7CC 5CGMA 5MP6L 2E7CA 4X83A 1VFMA 4S11A 4F58H 4WJ5B 2B2XL 5J7CC 5IJVB 5J11C 1KJ3L 1JK8A 3WNNA 1KN4L 5CAYB 3MYJB 4OZHE 1YECL 5ICXB 2D7MA 3KPLB 1A1OB 5JXED 3DO7A 2P7TA 3U83A 5D7IB 4HGWB 3PQYB 1KJ2A 3D0LB 4AEEA 3HR5B 3SDAD 2G2RA 4HWEH 2D31B 3RL2B 5E5RB 1ZA6B 4JCLA 3IJHA 3N9GH 5ADOL 3FKUS 4N0UB 1KGCD 2D7TH 4PB0L 4NRYB 1UKSA 3TO4A 4DN3L 4HC1H 1MCIA 3O11B 5B39A 2DQEL 2XWJB 1Y18A 3OHXA 3CSBA 2GTZB 1UH4A 2YD3A 3VXOA 4ZUSB 4FA8A 3JXAA 4U7MA 4YDJA 3OXRA 3ARVA 1P7KB 1X6LA 2ILLA 3NCCB 3PGFL 3LD8C 2GTWA 1P6FA 3ZDXF 4ZFOL 2VDNH 1FVDA 1K8IB 4P0DA 3U0WH 1EZVY 3U30C 1HINH 4PJXB 1FJ1A 1GOHA 3SN6N 5GIRB 1JGVL 2EDQA 3KLAB 3IRPX 3Q5OA 2A6JB 1KPUB 4QXTA 1T22A 3KJ6H 1IAOB 1MI5D 5HGAA 4IIQB 1KLUA 4JR9L 1T03L 4LCWE 4X9HA 3RVVD 5BV7H 4FFVC 5I8EA 1A7BA 2GSIB 2C1PA 3A6BL 3DYMA 4NPYA 5I74C 5ISZA 3RGVC 5EPMA 3VGFA 4MNGE 5IJKC 3UTTE 1BVLB 2VTFA 5J1AA 3PGDA 2P8LB 4DZBA 1SJHA 3CSPA 4ZSOB 4YDVA 2FEDC 3S9DB 3N1GC 4KWUA 4OLYH 4DEPB 2F19L 1TVHA 1YA5A 4PRPD 5CJQL 4OIIH 2BDNL 4ZO8A 4G8GA 1L0QA 4ELMB 4N0CC 1XR8A 4KTYA 1NGZA 4QY8B 1F3RB 1DDHB 5HSFA 4HPOH 2GY5A 4MA3B 4WTWA 5I1GL 3O9WD 1WVZA 4G6KL 4L4VB 5K9QG 4ZTPH 5DD6B 4HK3N 5FKPA 5HGHB 4QNPE 2BXYA 3KPRE 2YXFA 4MNQB 3LS5L 4RA3A 4UB0H 1WAAA 4QYOB 4WEBL 1Q9LA 3FFCE 4U0RB 3QISA 3L3KB 4WDIA 2XTJB 1LDPL 2EDRA 5C6PB 1N0XH 3BQUC 1A6WH 1UKTA 3LHPL 5EUOE 3F5WB 4CMMA 4PJDB 1ED3A 2E7HA 2YEZA 3C60C 3LEYH 1YZZA 1P7QA 4ZNEE 4HUMB 3ABZA 1SYSA 3MLXL 4Y19E 3QI9A 5DQ9B 2PNDA 4ZD3H 1X4ZA 1LVEA 4JDTL 1RFDL 3SDDC 3WO3B 1UB5B 5JOPE 4RGNB 3MMEB 1QHOA 1S9YB 5GGTA 1HH9B 4XPTH 2BVEA 2OZ4H 3SE8L 4X9FA 4MD5A 4WV1A 4X5WA 1G7HA 2CLZA 1BFOA 4P5TB 1ZHLB 1XZ0B 3OKNB 1CK0H 2CLRA 3FQXB 1I1RA 2AJZB 2EH8L 2A9NL 1DBML 1S8DA 2OM5A 1KJMA 3MLVL 1AR2A 2ITCA 1TPXB 2NR6C 5HYJD 1KN2L 3UJTH 4GXVL 1CDYA 3D39E 2BZDA 2VE6A 4X4YB 1VHPA 5TQ2H 5I1EL 5JMRA 5EC1B 5KSBE 1MJ8H 2C26A 3MNWB 4PUBH 4I3RH 1CGSH 3GSNH 5I16B 2HTKD 4I2XB 2FJFB 1K4DA 3Q5TA 3QXAA 1V7NH 1K6QH 1RY7B 4MXQC 4Q74A 5D1ZD 3VG9C 3O8XA 4JFXA 3I6LD 1HQRB 2VL5B 3ULVH 2XXCB 1BIIB 3GMOA 4WCYH 3QO1A 3RNQB 3GMMA 3IKKA 3LPFA 4AIZA 1E4XH 5KOMC 5C0RH 4JFPA 1CN4A 1A14H 1N6QH 2J1KA 1JPSL 3EJJX 3IKCA 5BMFH 4JRXD 1BQHG 5FHAH 1WWAX 4JG1H 5DJ2B 1GOFA 1BD2E 2E27L 4AQOA 3PP3H 3H7LA 4WTZA 3UJJH 3V6ZA 3FHAA 1UM5L 3ULVE 3PWJA 2EH7H 3KPOA 4NN6B 4D0BA 4FQXD 4Z77A 2FL5B 1A3RL 2A73B 4TULL 3QHZL 1BOGB 1JRHH 1T0NB 3K0WA 2EDFA 2ZUQB 5IW1B 4R4BA 3HMWL 2DDQH 4FQPA 3ULUL 1HSBA 2NW2B 1X5ZA 1CU4L 4JFQA 1R3JA 1FFOB 1J9CT 3Q1SH 4MDIB 3PHOA 1C08B 5DMGD 1H5BB 3K4ZA 4G9FB 1Q9OB 2VRAA 5DQDL 4HUVA 1DLFL 1UYWL 3UBXA 2C7UA 5FV2A 4LF3B 3LD8B 5FDYA 1JL8A 1QPXA 2NYYC 3SQOH 1BPVA 3VFNA 2GT9A 4JKPL 1I3RA 3EKCA 3U79A 4U1SB 4PLJC 1N8ZB 2YZ8A 5DD3L 3T08A 2CK0L 4AH2B 3BZDA 4JRYB 1A1NA 3PWPA 3L5XH 5I74B 3GK8H 5E6YA 3T77B 2Z8RA 5E2TL 5GGSB 4NWTL 1IAIL 5A43C 4KRNA 1OGAA 1EJOH 5E5MB 3UTPD 5GS0C 5I71C 4QHNA 5ERWB 4G6FB 1U93B 1JZ8A 4R3SA 1M71A 2ESVB 2Y06L 1OAUL 3VXME 3EOBA 1S7WA 4XCFL 2ZOLA 4YE4H 2EXWC 3C6LD 1ND0A 2VLKD 1AHWA 5E1AB 3M17A 3FN0L 1CI5A 2RJMA 1T66D 4I9WE 3S5LG 3H7BB 5I76B 4DFIA 1WUNT 3RTQC 2B20A 5DD5L 3QCUL 5F3BA 1MCPH 1LMKA 3HI5H 4KKLD 1EO8H 1M7XA 1IJ9A 1QQDB 4U6VL 5JA8B 4F7EA 2RFXA 5I1IH 1GVIA 3V79C 4GG6F 1CYGA 1VGEL 4OF0A 3RVXD 1D5BA 3C60B 4HWUA 2EDWA 1T7YA 2C3VB 5DJ6B 5H37H 1H3UA 3JV4A 3RY6A 1IT9L 1KXVC 1W0WA 4PJ9D 2YHGA 1NDMA 3MXVH 4OD1L 3SDDB 4I48A 2AK1L 2K7PA 3QUMH 5EH1A 2R1XB 3O81A 5TE6H 5B3NA 4V1DB 4P5KB 3WFEL 3SKMB 5C0BA 5E95B 4OZGB 5KW9H 3W0WB 5MENA 1RUMH 2J3SA 3H9SB 4GKNB 6CGTA 1M7DB 3E0GA 4KQ3L 4RMWA 4PRBB 1N7MH 3VXUD 4OV6F 3GSQB 4NDMB 1BQHB 2BJML 1MFBL 1UADC 4HS6B 1WT5A 3L3OA 3UPRA 3JTSB 3DUHA 3BN9D 5AG8A 2AKRA 3A67H 2BVQB 3HC0B 1RQ5A 3AAZA 1IL1A 3MNVB 5I1DA 1U3HC 1QFOA 4JQVC 3VWKC 3QNXA 1IAII 1RJLA 2JCCA 4OCMC 4BH8B 2YRLA 4PJEA 1NDGA 2VXSL 1CD1A 2YD4A 2HRPH 5IMOA 5HI3C 2EO9A 2AEWA 3HMXL 3EDDA 5KSAA 2D3VA 3BP5A 4MD4A 3T09A 5IWLA 1EO7A 1MCFA 1J0JA 4W6YB 2DS4A 1TJGH 3T65B 3SE3C 4OV5B 2VN7A 4P99A 4HIHA 1G7QA 5GRWA 1ZVSB 3W11C 4XT1C 3MRBA 2AK4A 2B2XH 3C5SB 4M61B 5HJ3B 3PQYE 4OZIB 1FFQA 1KUMA 1QVOB 2E7BA 1KN4H 3EO9L 4K23L 5ECJE 1PLGH 2VISB 1YECH 3BP7B 1N4XL 3ZE0E 1AO7A 4H25B 4N0UE 3GSVA 3LY6A 4XTRC 1MCWM 1DEEB 1FNSL 3V6FA 4I1NB 1AR1C 2WP3T 4U1HA 5I17B 3RUGB 3IFNL 1GOGA 5EU3B 1NANI 5ADOH 3GI8L 1CDCA 3DIFB 1MCEA 4PB0H 1DEDA 5MEPA 1A7PL 4M6OL 4DN3H 3VCLB 2Y7QA 2V9QA 4CVWA 2DQEH 3RWEA 1J05A 2XYCA 3ORJA 4LKCA 2AABL 4JEGB 3EOAB 4PJ5E 1MH5B 4MAYD 2JE8A 3DECA 4PJXE 2KH2B 2DI8A 3DX8B 1U6AH 4Z5RA 3V8CA 2XKUA 3PUCA 3PGFH 4S1RL 1E27A 3FQUB 4BELD 2R9HD 4C56B 1MCDA 1PYWA 5BS0A 5CILL 1JGVH 1ZWIB 1IGTB 3QPQD 4JO3L 5KANG 5T1KD 4CU6A 3JV6B 3QDAA 3VFPB 4XCNA 2PXYD 1NBZA 3L3DA 1FE8L 3F8UB 2R1WA 3EYVB 3L7FB 3S7GA 5I73C 4ZSOE 4JR9H 5HGDB 1T03H 5GS1A 2IPKA 2X44D 3RBSA 2GFBA 4LAQL 5FUZL 1SVCP 4PJBB 1DVFA 3L3HB 4EN3C 1Z3GL 3ARXA 4BSWB 3BPCB 2F19H 5C09B 1YY9C 2Z93A 5CJQH 1E4KA 3MGTA 1X5FA 3R06B 5F1NA 5T1LB 3VMPA 2BDNH 1G6RL 1A7RL 4DJMA 4L4VE 1JNLH 4G9DB 5HHQB 5IJVA 1GZPB 2LQRA 4ZDHA 3ZTJH 5I1GH 1KJ2L 5BZDB 4P2CG 2H8PB 1YEHH 4G6KH 1P5UA 3MYJA 3DVNA 2XTJE 5ICXA 5E8DL 1DBJL 3BWAB 4IBLT 1YJDC 4O2CB 5E6ZA 3LS5H 3HR5A 4PJDE 1MRCL 4YHKL 3I6KA 4NYLB 3UTSE 1OTUD 1LDPH 1ZA6A 3LHPH 1JCKA 4XP6L 5EORH 1JTPA 4OQTA 4LOUD 1W72L 1NFDF 1LP9F 1ZT1A 3RL1A 1MCOL 2GTZA 1FZKB 3MLXH 4Y5YB 1V8HA 4JDTH 1RFDH 1PGRB 1BJ8A 4QHUB 3HE7D 3VXSA 1UG9A 4HKBB 3G5YA 3W39B 2YPKB 3L3IA 2E7LC 3MV7D 1D5MB 2MHAB 2NQCA 4X7TB 3KLAA 5DJAB 3H0TA 2A6JA 3OV6A 1KPUA 2EH8H 3QPXL 1KNOB 2A9NH 4GRWB 3OG4B 1DBMH 4H20L 3MLVH 2OL3A 2GSIA 3KPNB 1W72B 3O6ML 5I1EH 1BQUA 1ACZA 1BVLA 2BFVL 2WWKT 1QRKA 1U3HB 1A8JH 3VWKB 3FRUB 1HXYA 5HPMB 3FQTA 3LPWA 1T5XB 3LS4L 4N8VG 4XNXL 1ZA3B 2NZIA 2OI9B 3VWJA 3ARDC 2UZYB 1CBVH 3OKMA 4ELMA 3NPSB 4QY8A 2ICWJ 3BDYL 3N0PB 1MI5B 5SWSD 1JZ4A 4L8CA 4E42A 4KMTL 1OAQL 3MRHA 2OP4L 1OP5H 5HGHA 1CTOA 1PAMA 4MNQA 1CICA 5CGYC 1KIUA 1JPSH 1J1OL 3HA0A 4KUZL 4YIQB 3L3KA 3CXHJ 3UPAA 4JZJC 4IRJC 4ODBD 4PRPB 1BVZA 2E27H 1S7XA 4GG8A 2RB8A 5D2LF 4BSJA 5CD5C 4NNPH 3F5WA 1UM5H 1N5YL 3EZJB 5LCVH 1EFQA 4XP9L 3BEWA 2ED8A 5FF6B 3MGAA 3O9WB 2VSCA 5GGTL 1A3RH 3VD7A 2K3TA 1H8OA 4TULH 1QFPA 1XGUB 3CVIL 3FOMA 2GEEA 3QHZH 5JDSB 5A16A 2DOCA 3MMEA 3HMWH 2ENSA 1HH9A 5E94B 3MOAL 3MX0A 3SGJA 3ULUH 4LKXB 5DURD 3PP4H 4G9FE 1CU4H 5H2BA 5FEBA 5E9DA 2A2QT 4NO0D 4P5TA 1F3JB 1XZ0A 3BYYA 3QRGL 3FQXA 2DIAA 4BH7A 4K3JH 2G60L 1NC2A 3QEQB 5FECA 1PSKL 2D2OA 1Q72L 3S8WA 3Q3GA 1ZS8A 2VLRD 4WW2B 3N1FC 1DLFH 4X6DF 2XQYG 1UYWH 4NZUL 4X4YA 1OOAA 5DTFB 2NY1D 5E08L 2XKNB 2PF6A 4ZXBA 3VGEA 5HYFA 3ULUE 1MHEB 1P53A 2F5AL 3MNWA 4NZTL 4JKPH 1J5OL 3MPCA 3V7AE 1U8JB 4I2XA 3AY4A 4Y5VC 5DD3H 2CK0H 1HILB 4O02L 4OZ4B 5EUKA 5LJYH 3BVNA 1QSZA 5DMKB 4HHAB 1K9TA 5E8NB 3REVB 1JYXA 4NZDA 1HQRA 3OR6A 5TJWK 1NBYB 5E2TH 2PTVA 2AS5M 4NWTH 1IAIH 1BIIA 4NOBA 3RNQA 5HYJB 2X9WA 2Y06H 1OAUH 3K80A 4L3ED 4WO4D 3HNSL 4XCFH 3CFKA 3MNZB 4J4PD 4PGDB 4EUPB 4S1SL 1T2XA 2WANA 3FN0H 2P44B 1R5VA 4YH6A 3KYAA 4F7TB 3KG5A 2YPLE 4PJIB 2J8UE 5D1ZB 4K3GA 3QCUH 4GXUN 2NXYD 1T7XA 4WHYH 2DF3A 5I8KL 5JW4M 3KVQA 4MMXC 4U6VH 3OKLB 3B6SB 1SY6L 2A73A 4D2NA 4Y8DC 3TVMC 4HLJA 5F44A 2CRMA 4XC1L 3X11A 5C8JA 5FO7B 1VGEH 3VD4A 4KKAD 2OXHA 1NMCB 1U92B 2NW2A 4JRXB 3ZKMC 1XEDA 3STBA 4V1DE 5IFAL 3U9PL 5EZJA 4KVCL 1IT9H 4RMSA 4OZGE 2W07A 3W0WE 1NANH 3Q6GH 4MDIA 3WHE1 4OD1H 1FG2A 3H9SE 4U6YB 1YQ2A 1PQZA 1JGEA 4LVNB 4WRLA 4UIKL 2EDOA 4FQXB 3WFEH 3OAZK 3MRRB 2PCPA 1IAKA 5I1CL 1BEYL 4NFDA 5CBAB 4WEUD 4G42B 4J7RA 4KQ3H 4OI9A 4XH2B 2MQ3A 1M1SA 5EBMB 5IB5B 3DXAA 1MFNA 5HHOA 4U1SA 3ZT6A 4K3HA 5CEXA 2BJMH 1MFBH 2ED9A 4JRYA 2AGJL 5HVGB 3SPVB 5JW4R 5D2NC 5HHMB 4YC2B 1UACL 3RGVA 3T77A 2GJ6A 5IJKA 1S7VB 3O6FD 4PS4L 5CP3H 4N9GB 1U93A 1G0XA 4PRHD 2ESVA 3LEXB 3RWJB 5C0AA 5GRVK 3HMXH 2BVUA 1ACYL 1XT5A 5E1AA 3NGBC 1FV1B 4LLVB 2R15A 5DQJA 1GGBL 4KI5F 5IIEB 4OF7A 5C07A 4U1GB 4FG6D 3B9EA 1MHPL 1J8HD 1QQDA 1I9JH 1BX2A 2VQUA 3D69A 4S1QH 3BZEA 3BQUA 5EZIL 5AWNL 3EO9H 4K23H 3NFNA 3ROOB 4ODSL 4KV5E 3C60A 3BPNB 2LV4A 2VLKB 3VXRD 3CIQA 3ZTNH 2HLFD 1NUGA 3P73B 4MA7L 1FNSH 4NQDA 3O3DA 3X3GL 4YQXL 3EAKA 3WN5B 2HT4C 4XVUD 1BZQK 3IFNH 3SDDA 3UBXI 3MV9E 2P5WB 2R1XA 3GI8H 4JJHA 4P5MA 3BHBA 2FX8H 4XMPL 1GHFL 3SKMA 5GZND 3GKZA 5DYOB 1A7PH 4Z7UA 4M6OH 3KXFA 3CX2A 2WUCL 1JWUB 3BGFC 1OAYL 2UWEA 4Y4FC 4KK9D 3VH8G 2AABH 2YWYA 4D0CB 4PRBA 5DS8B 4C56E 3ZDYE 4NDMA 1BQHA 3P4LA 3PABB 2JB6A 4HS6A 2YXMA 3VFSA 1FFRA 3JTSA 3AREC 4YDKL 2F74A 4D0DB 3QDMB 4OAWA 5D5MA 4PJ9B 4RFEA 5CMAA 1JF6A 2CRYA 3MYZA 3TCXA 4RRPG 5CILH 2YRPA 4JO3H 2A77H 1D6VL 5CP7B 3SHSA 5ID1B 5JNYA 3UAJC 4BH8A 1FE8H 5TE4L 4PJBE 1ERNA 1MIEH 5I0DA 3CFIC 3QIBC 5AAWA 1G9MC 5JMOC 3C8KB 5CBEB 3E6HA 4LAQH 5FUZH 3VXUB 4TRPL 5I66B 4JQXC 1YC8A 1Z3GH 4Z7NF 5ID0A 1U8MB 1FAIH 3H9ZA 1EK3A 1G6RH 1A7RH 1R3HA 1ZVSA 5H35B 4NZJA 4Z7VE 1P4BL 2X1WL 4ZTOH 5HJ3A 3L5HA 4NSKA 1EEQA 4OZIA 3V0VB 1W8OA 3C9NB 3UPCA 1QVOA 2CH8A 1S9VB 5L2KD 1M7IA 3NMEA 5JHDA 3BGMB 5E8DH 3CK0H 1LGVA 3SY0B 1DBJH 4KRMB 3IAQA 1QLFB 4KC3B 2ZUUA 1F11B 4K8RD 4YHKH 4C4KO 5I17A 3RUGA 3IS1X 1WCBA 2Q7YA 1VADA 4G80A 2RBLA 4RX4D 4HG4J 4XP6H 1GC1C 4OD2A 4ONFL 4Y1AD 3VCLA 1W72H 3CU1A 1MCOH 4NJ9L 1ZGLM 4U1IA 3EOAA 2R8SL 1MH5A 1Z5LA 3S36L 2Y5TB 4RAVB 2QV2A 4LNRB 5C08D 4HUXA 3RHWK 1FVCA 1P4LA 3CCHB 1ZSDA 3MCKA 1KGCE 1D9KD 2W92A 3MLTB 2X9YA 1XF1A 3WNLA 1UQSA 1ZWIA 4XGZB 1IGTA 3VFPA 3TBVB 4X6CA 1IM9D 1H0DA 4MXVE 3QPXH 2UYLB 1OGTB 4TNVK 2C1OA 5TGBB 5F1SA 2PTTB 2LTQC 4XAWL 5HGDA 4AENA 5FCUL 3ISWA 3O6MH 5F7YC 4PJ8C 4MAYB 1Z9OA 5F1OB 4IRSC 5D96C 4O5LL 5CJ8A 4MAUL 4LCYB 4BSWA 1JNNH 3LS4H 5C09A 4XNXH 3SKNB 4K71B 2NXZD 4PYHA 3VI3F 5T1LA 5IP4A 3QUZC 1DBBL 1UWXK 2WAHA 4Y5XC 4Y2DD 5ICZA 2DM2A 3LMJL 5CGTA 5T1KB 5HHQA 1GZPA 5IHZB 4WFFE 2PXYB 3PIQA 4LFHG 2AAVA 3BDYH 1YEDA 3NGBB 1QSFB 5BZDA 4U3XA 1GH7A 3L95B 4KMTH 1GGUA 1OAQH 3RTQA 2OP4H 1LK2A 4WI8A 3BWAA 5L8JB 1J1OH 1NGQH 5JZ7C 1WZ1L 1OP3K 4K7PH 4JE4B 1NC4A 1QA9A 1ZHBA 4HS8L 3VFMA 4GBXD 1ORQB 3NCYP 1FFNB 5IQ9B 1N5YH 4Z76A 1HHIB 4XP9H 1KCRH 1WAAE 3D2UB 4WWKD 5C0GA 5BW7C 5IBLD 1FZKA 5GGTH 2BNRB 2SEBA 1T6WA 5F7UA 3GBNH 3JUZA 3CVIH 4QHUA 3MLUL 2EDYA 1JPFB 1M05B 2P42B 4KK6C 5C6TL 3W39A 3MOAH 2YPKA 5EZLB 2X1OA 3FO9B 2VDLH 3BGFB 4I0PC 4PTUA 2E8ZA 3MRIA 2OL3L 5HI5D 5IB4B 2HFTA 3IDJA 5DJAA 5I30L 3C8DA 3IB4A 1YPZB 2G60H 3NOIA 1Q72H 3W9EB 4GW1B 4IJ3C 3S98A 4KAQL 4NZUH 3MO1A 4R7DB 1ZHNB 4RGOL 2VDQL 3EYQC 1JPST 5E08H 2IFGA 2DQDH 4XX1E 3VFOB 3SDXA 2GKIA 4C57C 4KK5D 4NZTH 3HE7B 1U3HA 3VWKA 1FORL 1T83C 1J5OH 5HPMA 3WKNA 3GNML 3LKNA 1F90L 1F58L 2QJDA 3DTXB 3V4VL 4O02H 3IVKB 3MV7B 2AV1B 3H42L 5HYJE 1UZ6E 4XP4L 4KRLB 5C0FB 2F8XC 4HX1B 3ZKND 1MI5A 5L7XH 1A47A 2VB5A 3AB0C 3ARGC 2R69L 1JZ7A 2FATL 3SE3A 2X4QB 4DVRL 5AYUL 4PJIE 3D18B 1E4JA 3HNSH 3T0XA 1T3FB 3BUTA 1INQB 3NA4A 4TSAL 3I6LE 1AD9A 2PN5A 4N1EA 4S1SH 1AQDB 3NAAL 4PRPA 2VLLB 2D9CA 2V2XB 1CT8A 2EDLA 3H3PH 3AVEA 3MV8D 1A6ZA 1SEBB 3HI1B 3DMMB 4DUVA 5ESAB 1F3DH 4X8JB 2XN9D 1AR1D 1UCBL 5SWSB 4JRXE 1SY6H 4CVUA 1JZ2A 1WFNA 5KVFL 4YHZL 5FGBC 1XF5A 5JDSA 4Z18A 2AJ3B 4XC1H 3ULVF 1ZE3C 2FHCA 1S5HA 4LKXA 3DJ9A 3QULA 4NQXB 3NFPB 5IFAH 5DEZA 3U9PH 3ILQD 1F3JA 3JV5A 5L8KB 1I8KB 3LQZB 3PXJA 4HS3B 2VIRA 3GSWA 1TENA 3IDMB 3QEQA 3QG6B 2V2TB 1MQKL 2UUDH 4JGUA 4UIKH 4U7SA 2AJSH 5JO5B 4LLWB 1ONQB 5DTFA 5I1CH 4RFOL 1TQBB 5IT2L 4GS7C 3RZCC 1FBIL 3MV01 2OJZH 3DRQB 3DVIA 4LLDA 5DUPL 3TA3D 3WFCL 2FR4B 1U8JA 1QACA 3SGDI 1HILA 1U8PB 5DURB 4OZ4A 2LTQB 5CIPH 4NO0B 4HKXB 3EBAA 4WUUD 5M7QA 1UACH 1OCWL 4QRPB 3RWGA 4PJ8B 3ZYIA 4GRMB 4PS4H 5D7JD 4G6ML 3NTCL 1FZOB 4XB8A 1J0IA 3HUJB 3FZUD 4EN3A 3CFBB 1DQTA 2VZ3A 3THML 4WHDA 4PBXA 1AGDA 2NY1B 2JCCF 4YK4B 3BD5A 3HG1D 1I9RL 4X4ME 4DWHA 1AGEB 1XGPA 5D6DC 1VEPA 5C9KA 3MNZA 1A64A 3MBEC 2J5LC 1ACYH 2BVOB 2VXVL 1S9XB 5K9OA 4CMHC 3UTPE 1AXTL 1FL6B 2NLJB 3MJ9A 2ZCKL 4OLEA 4X6BB 1GGBH 3WJLC 4RMRA 2Z0BA 3OJMB 1MHPH 4JZOB 4PBWD 3OKLA 3C09B 3B6SA 4HT1L 3ARYA 1WFOA 2VLKE 1EX0A 2APXA 3MQIA 3LH2L 1YMHA 5EZIH 1N0LA 4JFDA 1HEZB 4L3EB 1I75A 4ODSH 4WO4B 3GUTB 3UYRL 4ZAKD 4GRLD 3EHBD 5GGVY 5DJCB 4J3OC 4K3DL 2Y23A 4YQXH 1MF2L 4M00A 2NXYB 2X4UA 1HHGA 1RU9L 3RP1A 2J6EA 4R2GC 3UJIL 3WXVL 2F53E 3V8OA 1T1WB 1CXHA 4KRPC 1BZ7B 1FVEA 2WUCH 3QFDA 4X99B 2E7LA 1OAYH 5HHXH 3CUPA 2ZUWA 1MIML 4LSRL 3ZSTA 3EFDL 5IB5A 1RZIB 3QQNA 1CXIA 3UROR 4CDGC 1SM3L 1BIHA 3EYFA 3ZKSD 5FA4B 4F2MB 2M1KA 5E5UB 2AV7A 2B0SL 2BHZA 3O41A 5BQ7A 3RDTD 4HPYL 3EFFB 3OXSB 4RBPK 4HKZB 1S7VA 1MLBB 2YBRA 3FT2B 4OUUB 3DETD 5E8PB 1X4YA 3K8KA 3L9RA 1QFWL 5TE4H 1NJ9A 2W91A 3GDBA 4WWID 3RWJA 2JJUA 1DANU 2ATKA 1T2JA 4PJ7E 1A22B 3EJYC 2DRUA 2E7MA 4LVOB 3HS0B 5J6HB 3WL9B 5C6WH 1JZ6A 4Z7OE 2FWOA 3VXNA 3GMLB 3VXQB 3ARGB 3WNOA 4JVWA 2NZ9C 5IIEA 3PL6D 2YPVL 3LKPB 4Z8FL 4NNYB 3HLAB 3O6FB 3HZKB 3SKJL 1P4BH 4NQSB 1I7RA 5C2UB 4JZJA 4IRJA 1RIVL 4PRHB 4P46C 3LRSA 4ZPVB 1EAPB 4N8PA 3ROOA 1WBYA 4Y7MA 4KI1A 4XNMB 2E3VA 4YO0B 1IGYB 4G43B 5I75B 5D7IF 4JPWL 5KVMC 3FMGL 1S9KC 1W0YT 3ZKQD 3OR7B 1MCCA 3PWNB 1YUHB 2P5WA 3PDOB 1WBZB 4U1NB 5K9QI 3O0RL 3ZE0F 2AJXL 5C0IA 5IBTL 4ONFH 3FB6B 5DD1L 4N1HB 3RZWA 3S6CA 1OTTC 4LLUB 1VENA 4M1GL 4TN9A 3C08H 4D0CA 5I18L 3S36H 5DS8A 2VITB 4NO3B 4NCDA 4GO6B 3PABA 1WWWX 5KAQF 2P49B 3VXRB 4NN5C 4D0DA 3QDMA 2N4IA 4Z78B 1KTKE 3TBSB 2IBZY 3H9HB 4PJ9A 5DUBB 1RZJC 4X7SL 3UTZA 2XRAL 3Q6FA 3HPLB 3UCRA 3RZCB 3CMGA 1INEL 2ICES 4PJXF 5ID1A 4HUWB 4Y5VA 4HV8A 3O4LD 3BGAA 4JM2D 1FNGA 1QFWI 2CO6B 4OF8A 4W4OC 3FFDA 5FCUH 2GQHA 1RZGA 5CBEA 5HHNA 3G6AA 5BJTA 2AJYL 3WEXB 3MRJB 2JELH 1WBXB 4YNYB 2VQ1B 1GZQA 2DYPD 4O5LH 2XWBB 1MRFH 4MAUH 5D6CB 5IW6B 1U8MA 2B8OT 2X4PB 3B9KC 3RVTD 4QWWD 3O2DA 2OBGA 1DBBH 5SX5K 3HPJA 1NAML 5CSZA 2EIDA 3LMJH 3MBEB 4LK4A 4ELMF 4GMSL 3GSUB 4R96A 4BJLA 1HE7A 1B4RA 5I6XB 4R7NA 3SY0A 4U3CA 4K8RL 5IR1B 4NFBA 5K9KB 1R24B 2OQJA 5EO0B 2P8MB 1QLFA 4A2LA 1F11A 1JGDA 1WZ1H 3LKSA 4XHQA 5DEGA 4QT5A 3UTQB 2NY2D 3UZVB 3TVMA 4KZEL 3L5IA 4BSVB 4HS8H 4TQEL 4RQQB 1FZJA 3ZKMD 4U1KB 3BE1L 3M1BB 1CDBA 3OMZA 1R3KB 4OD3L 2CD0A 5ITBL 1C7TA 2BY3A 4YHOL 1GGIL 4LNRA 4YDIL 3MLUH 1IGCL 4ORGB 1L6XA 5KS9A 1LHZA 1Q94B 4XNYL 3E2HC 3QIWC 3B4NA 5C6TH 1YPZE 3V5KB 1O0VA 3MLTA 4H26A 5IESL 1RULL 1FQ9C 2Z31B 4XGZA 3WIFB 5KVEH 1XGTB 3DX7B 4NQVB 5CKAA 1ODAA 5I30H 3MLSL 1P84K 1S9WB 4Y1AB 4Z7WB 2ENYA 4YX2H 3ZE1E 1BHGA 2YC1B 1HK6A 1HQ4B 3S35L 5D2NA 4KAQH 5GS0L 4RGOH 4U6HB 5B38B 3MV7E 4KK8C 1QBLH 3TJHD 2NW3A 7CGTA 3BPLB 2H6PB 5DC4B 1BBJA 1FORH 3V5HB 4HZAA 3SGDH 3TIEB 4S1DD 3C5JA 3OL2A 1ZLWK 3GNMH 2JK5B 1F90H 1F58H 3SKNA 2EXYD 2NPLX 2RIKA 3V4VH 3WUZA 1BJMA 3H42H 1K2DB 5J3HD 5DI8B 4QHLB 2V2WA 3ZO0A 1VFBA 5F1KC 5CHNA 1IM9B 1EHAA 1QSFA 3VH8A 4ODHL 4F15C 3AGVA 1KCKA 2R69H 4GQ9L 5IG7A 4PLKD 2FATH 4L8SC 2Q87A 5AYUH 4DVRH 5BO1L 3CH8A 1MCJA 4TSAH 4FQ2L 3NAAH 2Q3AA 4PJFB 4OLUH 4P46B 2NXZB 2G75B 4RRPA 4Y2DB 5IQ9A 3WSQL 5ACZA 3L3GB 1HHIA 3IU4L 3KLHC 3D2UA 5TF0A 5FYKL 1UCBH 2DLTA 4TUOB 2BNRA 3D85A 1XCTA 2FJGB 2E6QA 5SWZD 2DQJL 2PYED 1QTYT 1XR9B 4ZOAA 2FDBP 5KVFH 4YHZH 2QADC 2HJLB 1CFSB 2DKMA 3FO9A 4JKLA 4YHLL 1FLTX 4GKZB 4WU5B 4Y4FA 4O51B 3STZA 4MJ6B 3M8OL 3U7AA 4GBXB 4GW4A 3GM8A 3TJEL 1KEGL 3HFML 1I1FB 3EZ8A 1OP9A 1NCWL 4M5YL 1MAML 4GW1A 1MQKH 4WWKB 3AREA 5ANME 4LCCB 3ME0A 1J12A 1S5IL 2VWEE 3TGXA 1LILA 1KSRA 2HKHL 4DVBB 1JI1A 4UV7L 3KAAA 4XMLL 3MTRA 4AEHH 1LEGB 3GMQA 1FLRL 5DGQA 3DUUA 5DUPH 4C4KT 1V3JA 3WFCH 4PJGA 4NQEB 3TYGL 4MLIA 3HUJE 2PYFB 2VLRE 4BZYA 5DJDB 1A6VH 1MQ8A 1CZ8L 3WV0A 3L6FA 1U8LB 5JOFA 2A9ML 4HX1A 3SO5A 5I1KL 1NFIB 2BXZA 4JQXA 3NTCH 4H1LB 1HCFX 3ZE2E 4PGEA 3MA7B 3QUXD 1KIRA 3THMH 5L2JB 3FN9A 5SV4A 3GSOA 5FA3B 1XGYL 1ZT7B 3C5ZD 1NEZB 1I9RH 2FLRT 2X7LB 1I8IB 3D18A 2UZIL 4I3GA 4W81A 2VLLA 1RK0B 4L3CB 3DX9B 4E0RB 1AXTH 5BOPA 4FFYL 3HI1A 3DMMA 5DXWA 1MCQA 1D5IL 4L9LB 5ESAA 4HBCH 4X8JA 4AEIL 3LKQA 3I75A 1JF1A 4L3EE 1KACB 1BWWA 2GSGB 3NIGE 1IKNA 4HT1H 3RX8A 4X9GA 4POUB 2IQAB 2R0ZH 3WHXB 1MLCB 5D7KD 3LH2H 2AJ3A 1L7TL 1I1AD 2P45B 1OT2A 5B21A 4NQXA 3NFPA 3UYRH 1UEMA 2X4SB 5IROC 2NNAB 1JGUL 3JWNC 4K3DH 1RURL 2XY2A 4D9LL 1G7PB 4P48A 5IM7A 3LQZA 3QDGD 1MF2H 3MV8B 2QSVA 3QG6A 2V2TA 1A9EA 1RU9H 2XN9B 1XF4A 3OF6D 3UJIH 2YA0A 5JW3L 3Q2CA 2ICWB 5HPOA 4MQXC 4Z7UF 1RIUL 1J7VR 3DGGA 4LSRH 1MJUL 3EFDH 4HJ0D 1JE6A 1FYTA 2FR4A 1SM3H 2ADFL 4DTGL 5LKNA 4BUGA 5TQ0L 1U8PA 1RVFH 4NC2B 3P77B 2B0SH 4R0LB 4MD0B 2BY0A 4HPYH 4QRPA 2CGRL 3U4AA 4PJ8A 3U9UA 2IGFL 3IJSA 3TBYA 4XVJL 4IRSA 4U31A 1VDGA 2FIKB 4LGPB 1K85A 3KJ4B 1QLEL 2X4NB 4DKDC 3BI9X 3P9LA 3RKDC 1QFWH 1X5AA 3QUZA 4Y5XA 5J56B 4KDWA 3HI6L 2I9TB 3OBAA 2IAMD 1JTOA 3HZVB 3TA3B 3TN0D 2ICEA 5DC9B 5KANI 4QRRA 2Q8AL 3T2QA 3JWOH 3NZ8B 4F15B 1UB6A 2OSLB 4WUUB 3U36A 4LLYA 4PRHE 2HMIC 1IGJB 3T0ED 1KV3A 3OJDA 2YPVH 4Z8FH 4GAYB 4AG4L 4JZOA 2CKNA 2ICWI 3E8UL 3SKJH 2IH3B 4HIJA 2OR9L 1RIVH 4OZIF 4M4RA 8FABB 1HEZA 3MUHL 1KLGB 4MLSA 3VFTA 5C7XH 2RCSL 3F58L 3GUTA 3SDCD 2DL2A 3GIZL 5EIIB 1KB5B 4LGSB 4OTXL 5BW7A 2F58L 1AKJA 1J8HE 3VW3L 1HYRC 4JPWH 4JO1L 3FMGH 5E1HB 3D6GA 2CKBL 2NY4D 4EQ2A 1R5WB 5GJSL 1T20A 2BCKB 3VDAA 1BFVL 5C9JA 2QADB 4PRAA 3RUGF 4MCZA 3O0RH 1PZ5B 2AJXH 4LCWD 1KCSL 5K9JL 4HXAL 1T1WA 1OPGL 5IBTH 3ARRA 4MB5A 2APWA 3ELAT 4X99A 4NQDE 4I0PA 1Q9WB 4M1GH 4LASL 4MSWB 5C0DA 1NEUA 2WBWB 2QR0A 2LU4A 3DX6B 4PY8I 1DBKL 1RZIA 1UM6L 3EDFA 4MNHB 4UBDC 5I18H 4Y4HD 3VD5A 5BCAA 3B8SA 5FA4A 4RFNC 3O3BB 2F54A 2DM3A 4ZAKB 4GRLB 4OLXH 4ZQKA 4KQ4L 2V7NB 3EFFA 4J1UA 2KL6A 2VL4A 4X7SH 4Q6IC 2XRAH 2D0FA 1MLBA 4QRSB 3TEUA 4UQ2B 4PJAE 3Q5YA 4G8IA 1T83A 2CKBB 3FT2A 1INEH 5HDQL 4Y4KC 3A6OA 3VRIB 4KKCC 1GCFA 4MS8D 4RSVA 3IDUA 5HGGS 1L9MA 2EZ0C 3QDJA 2IANE 5F7EL 3ZL4L 2AJYH 1ZGLB 3CXDL 1JFQH 5J6HA 5F70A 5A2JH 2DI9A 4OKVA 5B4MD 1HH6A 1KPVB 2GHWB 2R2EA 3VXQA 1GL4B 3S97C 3ARGA 3RDTB 1I8LC 1A3QA 4ISVA 4KROD 3LKPA 1D5ZB 4NNYA 3HLAA 3SE4C 5IBUB 4IDJL 1NAMH 1V3MA 4H0GA 3VXPB 4LPWA 1ADQA 4GMSH 5F9JB 5I9QC 4CGTA 3MJ6A 3EOTL 1T1XB 1EEYB 4UNTA 1EAPA 4GT7A 4QTHA 1WC7B 4YO0A 1H8SA 4V2BA 2Y07L 4K8RH 1IGYA 4C83B 4Q97A 1F13A 3GMPB 3GIVA 4G43A 4J23A 3OKOA 3T8XB 4YEFA 5FKAB 4PJHB 3OR7A 2DWDA 5F8QC 1CXEA 4KMQA 3PWNA 3LZFH 4KZEH 4P2OC 5CS7A 5JXAL 1S7QB 4TQEH 1WBZA 4U1NA 5FO9A 4I18C 2CQVA 5L2KE 1Q0YL 3CNKA 3BE1H 2V7HB 3ARFD 3D39D 4PRNA 4AEFA 3SQBA 2XA8L 3JV0A 5A2LH 4GJTB 4YHOH 3T4YB 1GGIH 1DL7H 1A6UL 4YDIH 3RWFB 3MXWL 5JPMA 1IGCH 4NQCD 4CADB 3OX8B 4P4KD 3VXRA 4XNYH 4J3XA 1WEJL 3DI2B 4BM7A 5JIHA 3BW9B 2HJFB 4OGZA 5IESH 4PLOB 2JIXA 1RULH 4XB7A 3WS6A 1J11A 3HPLA 3GI9L 3RZCA 2IH1B 4PJCB 5HDBE 3WNKA 1MHCB 3MLSH 4HUWA 5C08E 3T04D 4GRWF 3S35H 2FECL 1GJIA 1OQOA 4WW1A 3GZKA 4XRCB 2P24B 3WEXA 2YUZA 1WBXA 1BD2D 1K3IA 4JCMA 1GGTA 4MXVF 5DO2C 4NKQB 2XWBA 4KI5C 1CE6A 1A21A 3I02B 4M6MH 1L0XA 2X4PA 1AE6L 1MVUB 1Q38A 2IPUK 5I8CA 2NY6D 2QSCL 3QA3A 3K3QA 3OPZL 3D3VA 3S37X 4WTXA 3OAUL 4U1MB 1ZLUK 1EUTA 3MBEA 1IQDA 2P5ED 2FJHA 1RZKC 4JM2B 1HXMB 1MWAB 1U8QA 4ODHH 4GQ9H 4PJFE 4QOKD 4BUHA 3HC4L 4MJIB 2VUOA 3QZWB 5EO0A 2P8MA 4HIXL 1J1XL 2XICA 1U8OA 3C2SA 2B4CC 4U6XA 5BO1H 4FQ2H 5C86A 3IDYC 1LE9B 1X9QA 4RQQA 1TQCC 3MRGB 1ZLVK 4XCYB 3WSQH 5JIIA 3IU4H 3M1BA 3DO3A 2V5SA 1A4JA 5FYKH 2ZUTA 2Z91A 3DRTA 2GUOA 3GGWA 1R3KA 2O5YL 5C71A 1KTLA 5F9DC 4IMLB 5DVMA 5GPRA 2DQJH 4JFFB 2Z92B 4IOFD 4LNVA 1NAKL 2ADIB 3TBWB 2HFFA 3BDXA 4ORGA 3TNNA 1Q94A 2B1AL 3KPMB 4B7IA 1PG7W 3AS0A 2NY2B 4DFHA 3ARBC 2QQLL 2Z31A 2X2YA 3M8OH 4H1LH 1PG7X 2Z35B 1XGTA 3TJEH 1KEGH 4JO4L 4M43L 4PGCB 1S9WA 4HCRA 4KJQC 4ONOA 4Y1AA 3B2UD 4M5YH 1NCWH 3X3FL 1MAMH 4Z7WA 2EYTB 1ETZA 1VESA 1A7NL 1HQ4A 1WK0A 1S5IH 1PX3A 3WMSA 4WW2F 2J88L 2XNAB 3MACH 2HKHH 4U6HA 2FECI 4UV7H 4XMLH 4FQQB 3TPUB 4UDTB 4HIEA 4K55A 2H6PA 1FLRH 1MFDL 3V5HA 5GGQL 3UO1L 4P9HH 2JK5A 4Y4KB 4XI5D 3TYGH 3WYRA 3QNZA 1OB1A 5DI8A 4QHLA 1OTSC 4WHTA 5E4EB 5FYJL 1CZ8H 3QEGL 1TZHB 4OSUL 4NM4L 2A9MH 5HHPB 1IM9A 5I1KH 4N5UA 5BXFA 2VAAA 3F7RA 2WUBL 5DRXB 1CGUA 4JHZA 4G6AD 5JORB 4LHUD 4AM0B 2CR6A 3QO0B 4JVPA 1UZ6F 2UVEA 2Y6SD 4DCQB 1QO3A 2UZIH 4FXLA 5F1IB 3IU3B 2A1WL 5BVJA 2EIZB 1HZHL 4TOYL 4IRZL 4P46A 4O00A 2DJSA 3TYFB 5C70A 5DDHA 5DR5L 1XH3A 4WI7A 3EYUL 4FFYH 4DOHE 1UVQA 1NGXB 1D5IH 5FYLD 4AEIH 4FP8L 2FJGA 4JZNA 4G7YH 1RZFL 3QP3A 4MA8H 3NN8B 1L7TH 4WY7L 3GSRB 4HWZA 4XHJC 4GKZA 4ZOCA 3QQ4A 5EOCL 2XN9E 4WU5A 2C4FU 1EHLL 1RURH 4O51A 4D3CL 4D9LH 2NX5D 2BC4A 2X09A 1KG0A 3MSPA 2H2SD 1OSZB 5J0BA 2QL1A 2CDGA 1I1FA 2BOCB 2GK0B 1PX4A 1TJIH 2A38A 5DHVA 1EV2E 5FB8A 3PV6A 3K8LA 4MHHG 1IM3B 5GRJL 3RVUD 4I77L 2Q6WB 3V95A 3LV3B 5JA9A 3IDIA 2D4DA 4LARH 5SWZB 1BFTA 1CL7L 2EC9U 3W5NA 1FNEA 1RIUH 1IAIM 4EJ1C 1MJUH 4XNQB 1U58B 2ARJB 2C3GA 2IJ0C 2BNUB 3HZMB 2ADFH 1WQVT 4DTGH 4NQEA 5EB9A 5TQ0H 4YEEA 1FZMB 1HHKB 4ZO7A 3FAWA 1JHKL 1KIQB 1MHHB 2CGRH 2DQFB 4NHCL 1NLBL 2IGFH 1NFIA 2E9BA 4O2EA 4OLVL 4RNRB 5LGJA 1ZHKA 4MJ5B 2DWEB 5ESVB 1DN2A 1I7UB 3INUL 2NY0D 1RI8A 2X70A 5L2JA 1FNLA 4QCIB 4N5EC 3MCLL 1ZT7A 3B9KA 5IB1A 2X7LA 3TO2B 5IK3A 3G5VA 1NBVL 3HI6H 4M1CC 4WUUE 1FNFA 2YS4A 4GG6A 2BNQD 2R1YA 2Q8AH 1RK0A 4L3CA 3DX9A 1CDUA 2H32B 2X4OB 4E0RA 3LB6C 2HLAB 1HDMB 1I1CA 1FL5B 4LQ1A 4L9LA 2ZG1A 3HCVB 2X4RB 3HG1E 2QKIA 4AG4H 5M95B 4X7FC 1YNLL 2GSGA 3E8UH 1U3YA 2AVGA 1GC1L 4PJ5D 2YA1A 4NKOB 4PTTA 4E41D 4H0HB 1QR1B 4ONGL 1MLCA 1S7SB 2VSDA 3C5ZB 4WIQA 4P23D 1TITA 5F6IC 2RCSH 3F58H 1OLLA 1FYHB 3GIZH 1RPQA 2EE3A 4JANA 5GGSY 3OAYH 1CF8L 2F58H 3QIUC 4AYFA 3VW3H 1WIPA 2C3WA 1G7PA 3G5ZA 4Y16D 4BYHA 2ADJA 4JO1H 2RR3A 3BSZH 2CKBH 5GJSH 3GO1L 5F7DB 3WLWC 1BFVH 5MEOA 1FIEA 2ZOKB 5MEQB 1EHXA 4XZUB 3QIWA 1MCRA 1KCSH 5K9JH 1P9MC 3VFRB 3MUGA 1C5CL 1SJEB 4ETYA 4H5SB 4UQ3B 3NIFF 1J0ZA 3QEHB 4WTZG 3EO1A 1CL7I 1DBKH 4BQ8A 1UM6H 2HT2D 4YZFF 2W9EH 3U82B 1MFAL 1VGKA 3D9AL 5KVGL 4CN1A 3L3JB 5ETUB 1IARB 2Q86A 3SJVA 5F9WB 4KQ4H 3G6JB 2EC8A 3QDGB 4UT7H 2N7BA 5D1QD 2J8OA 3JSSA 4XPGL 4O9HL 4ZUTB 4K7PX 4XWGL 3TPKA 3BZFB 5ACMA 5EFIA 5HDQH 3IFOA 1NMBL 1K4CB 5FUOL 4D9QD 5IEKB 2Y4SA 1EFXD 4YUEH 3ARWA 4HWBA 5F7EH 3HZVA 3ZL4H 4UOW1 4OJFL 3O2WL 3P4NB 5CD3A 4CNIA 4LIQL 3OKDB 5I2IB 3KNBB 1B0WA 4LPXA 5KN5A 5F3HB 4L8SA 4GAYA 5FM5O 3SO3B 4JDZB 5ENWA 4CL7A 3RIAF 5E99L 5L0QB 1QYGL 1S7RA 5CCKL 3ULVC 3U46B 12E8L 3HRPA 3IFPB 1ES0A 1PY4A 3IDXL 5EU5B 3T0AA 4JFZL 4Z7OF 3MLRH 3VFWB 5C0CD 2J7LA 4HF5L 3QEUA 4O2FA 3IXTA 1KLGA 2IAMB 1KB5A 2Y07H 4X6EA 4W70A 3MJ7B 3IGAA 3GB7A 1UXWB 4HUNB 1RHHA 2DN7A 3V2AR 3VG0L 3GSXB 4WHCA 1HOCB 1R5WA 1F2QA 3WDHA 4ENED 2J4WL 1BGXL 2BCKA 5HI4C 2EYSB 3HN3A 5JXAH 3T0EB 1F6FB 4YFLI 2VC2H 1A6AB 2E6PA 4XPAL 5EIQA 2XA8H 3EO0B 3JTTA 4FMFA 4MSWA 4P2QD 4XAKD 1CVRA 2D7NA 3MV11 2PW1A 5IV2B 3GJEB 2APBA 1A6PA 4ZUVA 5GRUL 1A6UH 4L9DA 5IVZA 1U91B 3HAEG 4P59L 4O58L 1F8TL 4PP1C 3MXWH 3SDCB 4ODXB 1X7QB 2WBJD 4L1DA 3S88H 4PJCE 1GAFH 3A6CL 1WEJH 1ZMYA 4H8WL 5KS9F 3WS3A 4JREC 1CXFA 4OLWL 2NY4B 4FQHB 5HVWA 3X14B 4ELKB 2XWTB 2LAAA 1YNKL 5E0QA 4LCWB 1KULA 5DFWH 3VRIA 4AIXA 5IMKB 4MNGB 5EZOL 3UTTB 3TC9A 3VFUA 1NLDL 1F3DJ 4Y4HB 1QNZH 3U7YL 2YN5A 5J12C 5KSAC 2WIIB 4GAJL 4EI5C 1KPVA 2Z9TA 4UIMA 3DPBA 4URTB 2IEPA 3O4LE 1AE6H 2HP4A 1RZ8B 4S2SB 4F33B 2QSCH 5BV7B 2A83B 3OPZH 3AU1B 3T3PF 3CC5A 3VXPA 3ZT7A 2ADGB 2DQGL 3MJ8A 4LP4A 3U6RA 3UTOA 5C1MB 5CFHA 5HGBA 3G6DL 4D8PA 5F9JA 4DK6A 1LQSR 4YPGB 1EEYA 2JJVA 3KPRB 2P46B 4JFED 1CDHA 3HC4H 4C83A 4HIXH 1ROWA 3HZYB 2R39A 3E3QC 4MB3A 1OLZA 3KDMA 5EUOB 2VXTL 5FKAA 4PJHA 1XMWA 5DRWA 2DQTL 1EZVX 1S7QA 2DIBA 4KROB 3PHQB 2WV3A 5F6IB 3WFHB 1RHFA 2V7HA 3ES6A 3K8MA 5INDA 3D0VB 3LAFA 2HVKB 2O5YH 3IJYA 3KHOA 1DQJB 4ZS7L 3GJFA 3HHRB 1YYML 3T4YA 3TIDA 3RWFA 1NAKH 1AY1H 4CADA 3OX8A 4OCRH 4RISL 2B1AH 1ZANH 2VZ1A 3STLB 4A2MA 4NUGL 4PV8B 3WDJA 4P2RA 4WENB 2QQLH 1TXKA 2X42A 2Z8VC 5ADPL 4JO4H 4M43H 3ARFB 3D39B 4NWUL 1FAKT 4JM4L 1UJ3C 3X3FH 3IDGA 1YPZF 1A7NH 3S4SG 5KSBB 1AIFB 1SJVA 2MQCA 1KCLA 2J88H 4XRCA 2FGZA 4RMQA 5E8OB 4M7ZC 4POYA 4G8FA 1DBAL 3CSYA 1VEMA 3TP4A 4NQCB 3IF1B 1MFDH 1LO5B 1OW0C 1YEKL 5GGQH 1Y6KR 1CR9H 1XIWC 2H2PC 4P4KB 4Q2ZA 4YBLC 3SCMD 3T0VA 4KJPD 5D2NE 4FOMA 4PJGF 3B3IB 4APQC 2PO6D 3BH9A 2EEDA 4OSUH 3AXLA 3QFJD 3FB7B 5D2LA 5ELIA 2ZSWB 2ZZUT 3GBML 1FDLL 1MWAA 1JMXA 3BIKB 3GSNB 2WUBH 4KGLA 4W6WB 1G9EA 1ZT4B 1UENA 5GGUB 2VXQL 5AZEL 5KOVC 4MJIA 4JAMA 4EIGB 1N59B 2WBKA 1BD2B 4AZ8A 2R56H 2MWCA 2A1WH 4FQIL 3RIFK 4U1LB 1HZHH 2VLJA 4TOYH 1LEIB 2GJZB 3U0TA 3OJ2C 1MY7A 2NY6B 3UZEA 2W0FA 5DR5H 5FHBL 1R3LA 3EYUH 1ZXQA 1U8IA 4J8RA 1NGYB 3QWOB 3QHFL 2P5EB 1EHNA 4FP8H 4IMLA 4RWHA 4DN4L 1EBPA 4JFFA 1RZFH 4MB4A 4U05A 2Z92A 4X6DA 2VN4A 3K74B 2ADIA 1FSKB 3O6LL 3ZT5A 1UA6L 2MQ0A 4WY7H 5EBLB 4POZD 1YMMD 1MUJB 3BP4B 1BVKB 2Y9RT 3P9MA 4KHTL 4NO5B 1EHLH 3KYOB 2Z35A 1CFNB 2PYEE 4PGCA 5J8OA 5KG9B 2GCYB 5GRJH 4IIQC 4I77H 3QUYD 1U8NB 4EQ3A 1H3PL 2Z4QA 4PPTA 2APFA 2X1XR 5FCSH 4ZUWA 1CL7H 4Q6IA 1N5AB 4FQQA 4M1DH 5D9SB 4NNXB 2OTWA 3LN4B 5JIPA 2H32H 3KPPA 4Z7QE 4Y4KA 4DEPC 5IVXB 1MJ7L 5ICYA 5D7LA 2DLFL 1W0VA 4N90D 1JHKH 4R97B 4MVBD 1IC4L 1UWEL 3EGSA 5HHPA 1NLBH 4NBYB 5BRZA 5GSVA 4OLVH 1MEXL 1MAKA 1MREL 3N1PC 5DRXA 2VABB 3INUH 3HUJF 3IAPA 3DV4B 4N0FB 4K3EH 4HK3J 1I8LA 3KPSE 3B5GA 2H1PL 3MCLH 3SE4A 1NBVH 1G6VK 3QJFB 2VR4A 2DM4A 4U0RC 1QUNA 3IU3A 5F1IA 1KYOK 2IMMA 2XTJC 3CFCH 3ZE2F 5J1SC 1CFTB 3PXHA 4Z95L 4UAOB 4TVPL 3ARPA 3WIHA 3GHBL 5FYLL 1G7MB 4WNQB 4EOWL 2DLEA 3GFUA 3REWB 4UT6H 3WLBA 1YNLH 4M7LT 3TZVB 1GC1H 2V5RA 1Y6MR 1OF2B 4CBPA 2YK1L 4ONGH 4LHUB 4I18A 5T5NF 3T4AB 3EYOB 4BA8A 3QQ3A 5T5FL 4E5XB 3NIGF 5LAXB 4MA1B 1TCMA 3VFVB 2QHLA 1RZJL 1FCCA 3GO1H 4YBHA 2GK0A 2BOCA 5D7KE 2QLVB 43CAB 1TPXC 3MRMB 5ALCL 5E6ID 3SOBL 4K94H 3TNMA 1HYSC 3GHEH 4L4TA 4X80L 4CKVX 4PRID 3G6JE 4ODUB 4XNQA 5CJOL 1U58A 4O4YL 3X12B 2GIYA 3QDGE 3FTGB 1HWGB 5E8EB 1Q0XL 1UJ3B 2XQYK 3D9AH 5KVGH 4LHJB 2AJUL 1KIQA 1MHHA 2XOTA 2XPGA 2UZXB 2DQFA 5EO9B 2CDEB 3MRKA 1JYVA 1FH5L 5EU6E 4XPGH 4O9HH 3P9WB 4C59B 3CFDA 5I1HL 1I7UA 4YGVB 3CZFB 4FQLL