2DMEA

Solution structure of the tfiis domain ii of human phd finger protein 3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
GSSGSSGSADQIRQSVRHSLKDILMKRLTDSNLKVPEEKAAKVATKIEKELFSFFRDTDAKYKNKYRSLMFNLKDPKNNILFKKVLKGEVTPDHLIRMSPEELASKELAAWRRRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 3
publication title Solution structure of the TFIIS domain II of human PHD finger protein 3
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 2dmeA01
4BY7X 3NDQA 4BY1X 3PO3S 1ENWA 2DMEA 4BXXX 2LW4A 3GTMS
chains in the Genus database with same CATH superfamily
4G6LB 2ZPFB 4YOSA 1OI9B 2W9FA 1AD6A 2LW4A 3LQ5B 4BCKB 4CFWB 5LMKB 1G3NC 2UZBB 1C9BA 1H25B 3MY1B 3X26B 4OB0B 3TW7A 3QZ9B 2CZ6B 3MIAB 2CYZB 1GH6B 2ZZDB 4MFEA 2PK2A 3TNHB 2BPMB 2ZPIB 3A8OB 4BCOB 2ZPBB 1GY3B 2WHBB 3TNWB 5LQFB 1QMZB 3VKGA 1ZP2A 5BNJB 2DPPB 3B57A 1JSTB 2BS4A 5I5ZB 2R7GA 4EOMB 1OL1B 2IW9B 4HLQA 2BKZB 1JOWA 2W99A 1ENWA 4EOSB 4CFMB 1XO2A 3DJBA 3VYHB 4BCND 4M6VA 3BLRB 3QZ5B 1FVVB 4BBRM 5HQ0B 4YC3B 4BCGB 4QSHA 1V29B 2WXVB 3MY5B 3BHVB 5HBHB 3QYEA 4JX6A 4CFUD 4OGRB 5IDPB 1H26B 2CCHB 3BG9A 3X28B 4EOIB 4TTHA 2UZEB 1UNLD 2QQ8A 5HBEB 4BCHB 4FX3B 4YOZA 2D0QB 3QYHB 3BLHB 3VKHA 1OL2B 4EOQB 5IHYA 2ZPHB 5EJCA 5CEIB 1H28B 4MIMA 4CFXB 1UNGD 2ZPGB 4BCPB 1H24B 2WIPB 3TW6A 5HVYB 2CJMB 2G77A 4EC8B 4EOOB 2UZDB 4KRDB 4ELJA 2PMIB 1UGPB 4BCQD 1H1SB 2IW6B 3TN8B 2WJ9A 4HL4A 1UGRB 3HHTB 1IREB 2BS3A 4JX4A 3DL1A 3DOGB 2QDJA 4HNUA 4OR5B 4EOLB 4BY1X 3PO3S 3BLQB 4BCMD 2UUEB 1OKWB 3A8LB 1UNHD 3QWLA 4I3ZB 1VYWB 4AI6A 2I40B 4AKIA 1E7PA 3EIDB 3X24B 4BCJB 2QDYB 1D3UB 3NDQA 2PJQA 1BU2A 3F5XB 4CRLB 3BG3A 3X20B 2DD4B 1P5EB 2DXBB 3HZJA 2DMEA 2F2CA 4Z6YA 2W2HA 2KR6A 1OKVB 1AHJB 3MI9B 2QF7A 3QHRB 3TNIB 5IF1B 1KXUA 3M03A 3WVDB 3G33B 1UGSB 4EONB 1E9HB 1FKMA 3QYBA 2WFYB 1TFBA 4ROCA 2QFZA 4AKHA 5L2WB 4ELLA 4F6UB 4EOJB 3KHIA 1QLBA 3A8HB 1H1QB 4LOCA 1H1PB 4F7NB 3DDQB 3O0GD 1GUXB 4ZGDB 5DQWA 4BXXX 2W9ZA 4HNTA 2WMAB 1O9KB 4MFDA 2WMBB 4FM4B 4BCMB 4CXAB 5IDNB 4F7LB 3QYGB 5HBJB 3RGFB 5FGKB 3DTOA 4EC9B 2C4GB 2C6TB 4F7SB 4ZGJB 3EOCB 4Y72B 2IN3A 5HNBB 2KMGA 2V22B 4YOOA 4OB1B 3HB9A 3HO8A 5ICPB 4BCNB 1VOLA 2DXCB 1N4MA 4JX5A 4ZGEB 2CZ0B 2C5OB 4IMYB 4BY7X 3A8GB 2UZLB 1H27B 1OGUB 4BCFB 2ZCFB 5DQVA 3WVEB 2G9XB 4CFUB 3BHTB 4CFVB 2B9RA 2DD5B 4NSTB 2IW8B 1GUXA 5CYIB 3A8MB 1URCB 2W96A 4ROEA 5ACBA 3HBLA 1F5QB 4UN0A 1O9KA 4F6SB 2C5VB 4BBSM 4EOKB 1JKWA 3EJ1B 4F6WB 2CZ1B 2JGZB 2C5NB 2PK9B 4HNVA 2WIHB 2BS2A 4CFNB 4F7JB 1OIUB 2PHGA 4EORB 1H1RB 1AISB 1OIYB 3VYGB 4F70B 3H4CA 2I53A 3POMA 1FINB 3BG5A 4BCQB 3QHWB 2AHJB 4RODA 2WPAB 5EFQB 3K7AM 4OB2B 3BHUB 1JSUB 1VINA 4EOPB 2EUFA 2WEVB 4KRCB 2IVXA 3DDPB 3GTMS 1TD6A 2QGSA 1UGQB 4OB3B 4BCIB 4NC6A 4II5B 1W98B 3X25B 2CZ7B 2C5XB 3QXEB 4AKGA 1H4LD 2CCIB 1PKDB 2X1NB 2ZPEB
chains in the Genus database with same CATH topology
4BY7X 3NDQA 4BY1X 3PO3S 1ENWA 2DMEA 4BXXX 2LW4A 3GTMS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 X;  3NDQ A;  4BY1 X;  3PO3 S;  1ENW A;  2DME A;  4BXX X;  2LW4 A;  3GTM S; 
#chains in the Genus database with same CATH topology
 4G6L B;  2ZPF B;  4YOS A;  1OI9 B;  2W9F A;  1AD6 A;  2LW4 A;  3LQ5 B;  4BCK B;  4CFW B;  5LMK B;  1G3N C;  2UZB B;  1C9B A;  1H25 B;  3MY1 B;  3X26 B;  4OB0 B;  3TW7 A;  3QZ9 B;  2CZ6 B;  3MIA B;  2CYZ B;  1GH6 B;  2ZZD B;  4MFE A;  2PK2 A;  3TNH B;  2BPM B;  2ZPI B;  3A8O B;  4BCO B;  2ZPB B;  1GY3 B;  2WHB B;  3TNW B;  5LQF B;  1QMZ B;  3VKG A;  1ZP2 A;  5BNJ B;  2DPP B;  3B57 A;  1JST B;  2BS4 A;  5I5Z B;  2R7G A;  4EOM B;  1OL1 B;  2IW9 B;  4HLQ A;  2BKZ B;  1JOW A;  2W99 A;  1ENW A;  4EOS B;  4CFM B;  1XO2 A;  3DJB A;  3VYH B;  4BCN D;  4M6V A;  3BLR B;  3QZ5 B;  1FVV B;  4BBR M;  5HQ0 B;  4YC3 B;  4BCG B;  4QSH A;  1V29 B;  2WXV B;  3MY5 B;  3BHV B;  5HBH B;  3QYE A;  4JX6 A;  4CFU D;  4OGR B;  5IDP B;  1H26 B;  2CCH B;  3BG9 A;  3X28 B;  4EOI B;  4TTH A;  2UZE B;  1UNL D;  2QQ8 A;  5HBE B;  4BCH B;  4FX3 B;  4YOZ A;  2D0Q B;  3QYH B;  3BLH B;  3VKH A;  1OL2 B;  4EOQ B;  5IHY A;  2ZPH B;  5EJC A;  5CEI B;  1H28 B;  4MIM A;  4CFX B;  1UNG D;  2ZPG B;  4BCP B;  1H24 B;  2WIP B;  3TW6 A;  5HVY B;  2CJM B;  2G77 A;  4EC8 B;  4EOO B;  2UZD B;  4KRD B;  4ELJ A;  2PMI B;  1UGP B;  4BCQ D;  1H1S B;  2IW6 B;  3TN8 B;  2WJ9 A;  4HL4 A;  1UGR B;  3HHT B;  1IRE B;  2BS3 A;  4JX4 A;  3DL1 A;  3DOG B;  2QDJ A;  4HNU A;  4OR5 B;  4EOL B;  4BY1 X;  3PO3 S;  3BLQ B;  4BCM D;  2UUE B;  1OKW B;  3A8L B;  1UNH D;  3QWL A;  4I3Z B;  1VYW B;  4AI6 A;  2I40 B;  4AKI A;  1E7P A;  3EID B;  3X24 B;  4BCJ B;  2QDY B;  1D3U B;  3NDQ A;  2PJQ A;  1BU2 A;  3F5X B;  4CRL B;  3BG3 A;  3X20 B;  2DD4 B;  1P5E B;  2DXB B;  3HZJ A;  2DME A;  2F2C A;  4Z6Y A;  2W2H A;  2KR6 A;  1OKV B;  1AHJ B;  3MI9 B;  2QF7 A;  3QHR B;  3TNI B;  5IF1 B;  1KXU A;  3M03 A;  3WVD B;  3G33 B;  1UGS B;  4EON B;  1E9H B;  1FKM A;  3QYB A;  2WFY B;  1TFB A;  4ROC A;  2QFZ A;  4AKH A;  5L2W B;  4ELL A;  4F6U B;  4EOJ B;  3KHI A;  1QLB A;  3A8H B;  1H1Q B;  4LOC A;  1H1P B;  4F7N B;  3DDQ B;  3O0G D;  1GUX B;  4ZGD B;  5DQW A;  4BXX X;  2W9Z A;  4HNT A;  2WMA B;  1O9K B;  4MFD A;  2WMB B;  4FM4 B;  4BCM B;  4CXA B;  5IDN B;  4F7L B;  3QYG B;  5HBJ B;  3RGF B;  5FGK B;  3DTO A;  4EC9 B;  2C4G B;  2C6T B;  4F7S B;  4ZGJ B;  3EOC B;  4Y72 B;  2IN3 A;  5HNB B;  2KMG A;  2V22 B;  4YOO A;  4OB1 B;  3HB9 A;  3HO8 A;  5ICP B;  4BCN B;  1VOL A;  2DXC B;  1N4M A;  4JX5 A;  4ZGE B;  2CZ0 B;  2C5O B;  4IMY B;  4BY7 X;  3A8G B;  2UZL B;  1H27 B;  1OGU B;  4BCF B;  2ZCF B;  5DQV A;  3WVE B;  2G9X B;  4CFU B;  3BHT B;  4CFV B;  2B9R A;  2DD5 B;  4NST B;  2IW8 B;  1GUX A;  5CYI B;  3A8M B;  1URC B;  2W96 A;  4ROE A;  5ACB A;  3HBL A;  1F5Q B;  4UN0 A;  1O9K A;  4F6S B;  2C5V B;  4BBS M;  4EOK B;  1JKW A;  3EJ1 B;  4F6W B;  2CZ1 B;  2JGZ B;  2C5N B;  2PK9 B;  4HNV A;  2WIH B;  2BS2 A;  4CFN B;  4F7J B;  1OIU B;  2PHG A;  4EOR B;  1H1R B;  1AIS B;  1OIY B;  3VYG B;  4F70 B;  3H4C A;  2I53 A;  3POM A;  1FIN B;  3BG5 A;  4BCQ B;  3QHW B;  2AHJ B;  4ROD A;  2WPA B;  5EFQ B;  3K7A M;  4OB2 B;  3BHU B;  1JSU B;  1VIN A;  4EOP B;  2EUF A;  2WEV B;  4KRC B;  2IVX A;  3DDP B;  3GTM S;  1TD6 A;  2QGS A;  1UGQ B;  4OB3 B;  4BCI B;  4NC6 A;  4II5 B;  1W98 B;  3X25 B;  2CZ7 B;  2C5X B;  3QXE B;  4AKG A;  1H4L D;  2CCI B;  1PKD B;  2X1N B;  2ZPE B; 
#chains in the Genus database with same CATH homology
 4BY7 X;  3NDQ A;  4BY1 X;  3PO3 S;  1ENW A;  2DME A;  4BXX X;  2LW4 A;  3GTM S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...