2DMGA

Solution structure of the third c2 domain of kiaa1228 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
142
structure length
142
Chain Sequence
GSSGSSGSPLGQIQLTIRHSSQRNKLIVVVHACRNLIAFSEDGSDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSVSLPEVQRRTLDVAVKNSGGFLSKDKGLLGKVLVALASEELAKGWTQWYDLTEDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the third C2 domain of KIAA1228 protein
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords KIAA1228 protein
total genus 13
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2dmgA00
2WXNA 2FK9A 2A4ZA 3F01A 4EZKA 3NZUA 1A25A 2WXIA 1DJIA 2NQ3A 1UOWA 5H4YA 5H4ZA 4AJWA 3ZVVA 5JHAA 4WWNA 4FLHA 4FADA 2WXQA 4F92B 5CCGE 1DJXA 1DJHA 2R83A 2V4LA 2X38A 1TJMA 2CM5A 4ICXA 4XE0A 5T8IA 3T8MA 1W16A 3DPDA 1RH8A 3ML8A 1WFJA 3KWUA 2WXRA 2Q0ZX 1BYNA 1K5WA 1E8ZA 4QJ4B 1E7VA 4F91B 3HIZA 1BCIA 4L1LA 4F1SA 3CSTA 3QJZA 3ENEA 3S2AA 4TS6A 3ZW3A 2CM6A 4EZJA 1DJGA 2Y3AA 3CSFA 4G11A 3L4CA 4OVVA 3QAQA 4Y1TA 2UZPA 2ZKMX 3ZIMA 1CJYA 1YRKA 4WWPA 4WAFA 4HLEA 4FHJA 3QR1A 4MJJA 2Q3XA 2CHXA 2WXGA 4FJZA 3FBKA 3R7QA 4DK5A 1QATA 3KWTA 2WXOA 1DSYA 2DMHA 3IM1A 1TJXA 1W15A 4EZLA 2YRBA 2BWQA 3PFQA 2D8KA 1E90A 1BDYA 1GMIA 3OAWA 2KI6A 2LHAA 2ENQA 5CCJA 4BGDA 3L54A 3APDA 2QZ5A 4URKA 4NS0A 1QASA 2ENPA 3HHMA 4LDCA 4L23A 2CJSA 1E7UA 3B7YA 2WXHA 2WXPA 2WXKA 3L13A 2K3HA 1DJYA 4ANUA 2A5UA 4FHKA 3TJPA 2JQZA 4NPJA 4ANXA 3F04A 3IBEA 3APFA 4GB9A 3L9BA 3MJWA 4LT7A 4FJYA 3TL5A 2QZQA 2DMGA 4NP9A 3OHMB 2K8MA 3ML9A 2WXLA 2CHZA 2K4AA 3LJ3A 3QK0A 3N5AA 1DJZA 3QR0A 4AOFA 4HVBA 3DBSA 2RD0A 4LCVA 4ANVA 2WXMA 3PS6A 5CCHE 4BFRA 3HN8A 3RDJA 2NCEA 3R7RA 4DNLA 4Y1SA 4PS3A 2CHDA 4PS7A 4FA6A 4GNKB 4J6IA 1UOVA 3P2BA 3W57A 1E8YA 4TV3A 4QJ3B 4IHBA 3TWYA 3W56A 5G2NA 4ICWA 1HE8A 4L1BA 3GPEA 3L16A 4PS8A 2YOAA 4WWOA 2N1TE 3NSJA 4KITB 3L17A 2WXFA 1V27A 4WEEA 4KZ0A 3JZYA 4V11A 3L08A 4A55A 1RLWA 5G55A 3M7FB 1DQVA 4TUUA 2WXJA 2Z0UA 1E8WA 2CHWA 5KJ7E 4QAMB 2FJUB 4NPKA 5JHBA 3PREA 1DJWA 2EP6A 1WFMA 5EDSA 2B3RA 3PYCA 2ISDA 3QARA 3NZSA 2K45A 4QJ5B 4XZ4A 4ANWA 2CJTA 3F00A 3FDWA 3F05A 4L2YA 3SD5A 1RSYA 1E8XA 1UGKA 2NSQA 4IQHA 4XX5A 3RPBA 2ENJA 4OVUA 4FULA 3APCA 3PRZA 4JPSA 4KZCA 4F93B
chains in the Genus database with same CATH superfamily
1LNUA 5JORA 5EEVA 3T3PF 2PWGA 1S9XB 3N41B 4Z7WB 5L2KE 1LYQA 3PFUA 1OAKH 3B7TA 3GINA 2CPUA 1FNSL 2D7MA 4DESA 4RMRA 1I9RH 4DFIA 1NL0L 1FIGL 1ZKAA 4CADB 4OU3A 2X12A 3LH8A 1G7PB 4ODVH 1J5OL 3D69B 1Z32X 4WFHD 3ME0B 3KWUA 4AM0A 4F8TA 5JXAH 2R23B 2V8MA 2X4TB 2CBQA 5ISZD 3LAFA 4BZ2A 2ROXA 3OR7A 1I7RA 1QQDA 4YHIA 1ORSA 2J5LB 1FG2B 1PLAA 3WS3B 1X5KA 3ATBA 3OWRA 4JCWA 2CDGA 3ZYZA 4ZT1A 1MHHB 3M17B 5E8PA 1MCWM 1U42A 3QDGA 4LRIA 5D2NB 1P9MC 5D7JD 4ZX5A 4IRSC 1MHCA 2P5EA 5D1ZD 3EOYG 3BP4B 1G7MB 1B4JL 2HX9A 2VLJE 3DIDA 1KYDA 3OF6A 4HBQA 3ZDXE 3DX1A 2E6PA 3HTLX 4M48L 2HFGH 3TN0B 3S0PA 3LNEA 3O6MH 3SDAD 2C4FT 5E00A 4AKQA 5B7FA 1UXSB 3OX8A 1D5BB 2BFVH 3LKSB 3B5HA 4PY8J 5D6DA 1TJIL 1P4BH 5D1QA 2ZYRA 1SDDB 5CSZA 3OAZH 5HYJB 1OAXH 3CN3A 1FNGB 3DLQR 5IROD 4DN3H 2WQSA 4KKBC 1SXZA 5JDSA 1MN4A 4K7PY 1IGCL 1M53A 4M3HA 4NAJA 4OTXL 3O8XB 4PGCB 5K9JH 3W39A 1MHCB 1ZY9A 3T3PE 1MVUA 5KJ4A 3U9UB 5SWZE 3WJMB 3EBIA 4U6XB 1X9LA 4OZHA 1SLUA 4AGOA 4U1IA 5IB5A 2JLPA 4PB0H 1LDPH 3NJKA 3P2BA 1KELL 1A4BA 5KS9A 4OZHF 2OL3B 5IT2H 3UGEA 4ZOBA 2DIBA 1I8UA 1AP2B 3NSJA 4AJ0A 3HS0B 4EDWH 4UQDA 3SEPA 3E9TA 3GNMH 1M71A 4KNSA 4V11A 5JIMA 2VDKL 5CJXC 3TM6A 5T5FH 4N20A 3BFWA 5DD3L 4EMZA 3BKYH 3BH4A 2XN9A 3UG3A 1KGXA 3W5NA 3MRQA 2YOCA 1YSOA 1BQSA 2CDFB 3EDDA 3CFTA 4W4NA 4OSUL 4Y4KB 4DH2A 3NCYS 3KHOA 3CXDH 2P43B 4GRWH 4G7SB 5DJ2A 1UWXH 1EERB 2AJYH 3G5WA 3RVTD 4RQQA 4QT5A 4LBEA 2ZG3A 1TTUA 3V0GA 1F58H 5IP4A 5I24A 4TVPD 1GL4B 2JCCF 1XGYL 4N8VA 5DJXB 1R3IH 3OG6B 3SDDB 4CW1A 3Q5TA 1R5IB 1WQVT 1QFUH 3KYKH 5DVPA 5EHFA 3L3HA 5I28A 1GYCA 5JTWA 2FDBP 3IRPX 4JE4B 5DQ9A 3D85B 3GLEA 5JHLL 4ZSOB 5IJDC 4UAHA 4G6JL 3WAJA 3GRWL 2K70A 4LSUH 4PLNC 5DDHB 1ZOXA 2PYFA 1M2VA 3UDWA 2GJZA 3GMQB 1Q1PA 1V54B 3CUPB 4N4YB 1MFEH 4F8LA 1IAIL 1JGLL 2FCBA 1MAJA 3MRLA 2DEXX 4GMTL 1U3ZA 3MLYH 5D55A 4FFWD 2BINA 4PD4K 1JDDA 3IETA 3SDDA 1OPOA 2HFFB 2MKLC 3RWFA 4CW1B 1HC1A 5EU5A 3C6LD 4DP4X 3AS2A 4KU1A 1MFDL 1LP9F 2YMTA 3CMOH 2AP2A 4X6CF 1VPOH 2IANA 3HB3C 4L8BB 1XFPA 4LPWA 3RA7L 5CCJA 5KN5B 1P5UC 4UIKL 4N1CA 4NX0A 3VG0L 2AKRB 4KK8C 5D1XE 1Q90A 3A6CL 3TBBA 2O30A 4XBPB 2D0GA 2ADFL 3UX9B 3N0PB 5FK9A 1XXDC 4NNXA 1A6PA 4NN5C 3G6AA 1TTGA 2MRYA 4C47A 5GGTH 3PUUA 1I8MB 3D0AA 3IJEB 1WD8A 2WWMC 4HISA 1NPUA 5EA0L 1F8TL 2IFFH 1F00I 4BSVB 1GCFA 4Y16B 1X7TA 4XGZA 4HIXH 3WNMA 2VE6B 3AZUA 2E76C 1I9EA 2VMCA 3I75A 4M5YL 2BPBA 5DK0B 1ZLEA 4BRVA 4F8QA 4URTB 1DFBL 2E74C 2HG0A 3JWNE 2AQTA 2R69L 4UQ2B 5ES4B 1GYAA 4TNWF 4UOW1 1PAZA 2I5YL 1OAKL 5ERWA 1UOVA 4Z78A 3QFJE 5IV2A 4MSWA 3S36L 3MNMA 4CU8A 4DOHE 2AJVL 3THMH 4KX9A 3WL9B 1YUHB 1F5WA 4NO5B 4OF3A 4ALAH 2J8UB 4QHLA 3G6DH 1WFUA 5I0XA 1ETZB 3PAZA 4RLDA 5BO1L 1D5BA 3E0GA 1I3GH 4A55A 4QI3A 4KDWA 5G5DB 3W9EA 1AQ8A 1XSOA 2DQTL 3DHJA 3CFKA 2FJUB 3BCDA 5KUKA 1R0AL 2OJZH 2QDVA 2VE6A 5IBUB 3PYCA 5ID0B 2OK0H 2ERJC 5IJBC 1F3DJ 3BQUD 3CFCL 3CU1A 2R0ZH 1JWSA 4RAHA 2KLTA 4JJ5A 5BO0D 3LKQA 2XA3A 2P8MB 2ZUQC 1IBGL 2DQMA 4K9EL 4XX5A 2JJTC 5J0BA 4CSPA 3F64A 4KO6A 2CAKA 2B9BA 3MREB 1OGTB 35C8H 3HG5A 4LCCA 4PV9B 4AE0A 2XA8H 2NQ3A 2J43A 3OWEA 1JV5B 4FNRA 1MFBH 4N2IA 3V95A 3UBGA 3IFNH 4DT2A 1F4AA 4JFYA 3KXFB 2IOOA 3NRPA 1OAXL 2RFXB 2YGNA 4M7ZB 5CGYD 3P69A 4DN3L 3QXWA 2BNUB 4F7TB 4BYHA 4NO2A 4U4IA 3MUHL 3G5XB 5CLZA 4BQ9A 2YEVB 1A6ZB 3T0WA 1N0XL 2YAFA 2OL3H 4HD9A 2IOIA 3VU1A 2DTML 6FABL 3HZ3A 1KBPA 1NCHA 4WI8A 4JQIA 4U1JB 4B3EA 3BPOB 4MWFB 5DUBA 3ZTJH 1JP5A 1EEYA 3BZFA 4XP5L 4C56B 1F42A 1HHGB 1NGPH 3FTVA 1CE6B 3EF4A 1XT5A 4Y9CA 2IGLA 3OAZK 3R1GH 4FFWC 1I1YB 3AQDA 4ZOEA 5J11B 3I9IA 1IARB 2H6UA 5GZOA 2MTAA 2ZSVB 2XCMC 3ZYIA 1A9BB 4PJ5D 1IGYA 3LQAC 5GISH 2OSLA 3L6FA 3NZ8A 3BEVB 2QKSA 3F7QA 1T22A 4M3KB 4WUKH 1HOEA 3INOA 4ZJ9A 4UZSA 4Z95L 4UV4L 4WENB 4OCYH 5HDQL 3WEBA 1N6QH 1TU2B 4TLUA 3WEXA 5BZWA 2FX7L 3CLFL 5ETUA 5EF1A 1NGXB 3F7PC 3HKFA 4NDMA 4X9IA 4PS3A 3TPUA 1QWUA 3BWAA 5MENA 4Y2DD 3HUJA 5J1AB 4KKLD 2H1XA 2CRZA 5JHLH 1IE5A 4AIXA 2IAMD 4FA8A 4OI9A 2VKWA 1LK2B 4CJ0A 4GO6B 2AXHA 4LBEB 3N1FC 5DQDL 2VZTA 4LLQB 2VL4A 2ZXDA 4CAGA 1A3RL 1DO6A 1MCQA 4KQ3L 3BRDA 5IF0A 5KS9B 1XDTT 1T22B 5B39B 3WAKA 3T0AA 4D9RD 4JY4A 3RL1B 3SCMB 1HH6B 3HAEA 4TSBH 1AOZA 3VJ6A 4M6NH 3KJ6H 4U6HB 1WFMA 2YMOA 4QXVA 3O4LD 4LSVH 5CKGA 1JXDA 3NZSA 1AXTH 5I1JH 4QJ5B 1LD9B 1J88A 1FLTX 3BYYA 1UENA 1UZ6E 3MRHA 4YGVA 4PVNA 4GBXB 3FFOA 4ODXB 3SJVD 3Q7JA 3TN0C 4QXUL 3RPBA 3NACH 3ISRA 3QYNA 3F6JA 4F58H 2GBTA 2HVKA 2EEBA 1QFWM 2ZCLL 1XX9C 3MX0B 2B39A 1MCIA 2JK5B 4L3ED 2AQ1A 5TQ2L 1PKOA 1QHOA 3CZKA 3IEAA 4HDIA 4QIRA 4P5KA 3FNKA 3QIUD 4P3DB 4XP9L 2LLGA 4HG4K 3V4VH 1NFDF 2EXYC 3US1A 3A67H 1EFXB 3LNDA 1MJUH 1RH8A 3D3VB 1INQA 5IB4A 3SD2A 1EHNA 3KPLA 5D2LF 5T1DL 1MRCH 3FK3A 1S7UA 3IFOA 3WO4C 5ID0A 5EOTB 2IBZY 1AMYA 3DXAA 3BWUF 3FQYA 5C0AA 1PY4A 4OJAA 3UTSB 4RFEA 2FUQA 3MLZL 2XOTA 1UVQB 5FS5A 4LAJH 4X5XB 1CR9H 4OLUL 4PAZA 4PH8A 4OZIA 2FL5B 1UT1A 2VO8A 4FNLH 2DJMA 2DAVA 1S7VA 5TE4H 4EN3D 4ZK8A 4OB5L 3MRDB 3EYVB 4RGOH 1A4KB 1S9VB 3TVMB 1HX0A 2LHAA 3E6HA 5BVPH 5GSRA 4ZYKA 4Y88A 2HT4C 1ZANH 4OLZH 5AG9A 1KELH 3R8QA 3GJEB 2X0UA 4UM9D 3WMPA 4RIRB 1M7IB 2J8UA 1JPFB 5F9AC 1T1XB 5DD1H 3QZWG 2Q76B 3BUIA 3EO1B 4FOMA 1N8ZB 4GOSA 1ETZA 4OF0A 5AW8B 1ES0B 4OQTL 4AMXA 1B9ZA 3KWWB 4NBZB 1WHOA 2BNQB 4HJ0C 1S7VB 4ZFGH 5I23A 1H3PH 4P2OC 2G3XA 2K9FB 3E6FB 2WZAA 1UEMA 3FQXA 5DRWB 5I75C 5JHDE 5EBLA 3VI4F 4ADJA 4ENED 5FO8B 4YDIH 3HE7C 3FQ1A 2OMBA 1FL3A 3IB4A 5FGBA 1DVYA 1I3UA 4Z8FH 4RAVB 3MCKA 3SDYH 5K9OB 1TG8A 4U05A 3ZXAC 3R0NA 5H37A 1BAFH 1CZ8H 1SHMA 1MCEA 5E6ID 5IROC 3Q9QA 1KC5H 3CDZA 1QR1A 3KHQA 1ZVYA 1PY0A 3IDNB 4QRPA 3UO1H 1ACCA 1MRDH 4KRPD 5LWYL 4POUB 4UAOC 1SYSB 1ROWA 2AEOA 3REVA 4AV0A 3P54A 1CGSH 4P3CL 1MPAL 2IDSA 3ZHKA 1Z5YD 1I1FB 3EHBC 2BVPB 5E6UB 2ZCZA 1U8OA 3GBNH 5DT1H 1NEZB 4IQHA 2IH8A 2HVJA 3P2TA 5JPNC 2DWTA 1M7DA 3ZL4H 4RZCB 5CEZE 2E7DA 2H45A 3FCTA 1NBVL 3DX8A 2Y72A 4LCWB 1R34A 2CBOA 2D3NA 2KUTA 3BO8A 4HUNB 4YDZA 1NLDL 1YECL 1ZDSA 4G7VH 3P11H 2IAMC 5C97A 5KBLA 4MQTB 5IK3A 3BPNB 4R96A 3LNFA 3AREC 4HIHB 4OGAD 4XRCA 5JPMC 1KV7A 1X5LA 2QKIA 5B39A 3U79A 3GMOB 4XO5A 4S2SB 3KVQA 1R33A 3DJ9A 2FATH 4LCUB 4JKWA 3W81A 1IBZA 5D7KD 3V6FB 4QHUA 4LCWA 3VDAA 2BNRD 2CGYA 5GRUL 2BY2A 3GM0A 1CFTA 4GY4A 5AOKA 1XTMA 5CD3B 4KMQA 2EE0A 4JZJB 5HGDA 4G8AC 1OSZB 1YNTA 1A3RH 2W38A 4MHHI 3QNZA 3PGFH 4P2RB 1EEYB 4NNPH 5DRNA 4OFIA 3APDA 3F5WA 4F7KA 4QXTB 3JWOH 4P2RE 1UH3A 5IHWA 4CRPA 3MBWB 4GRLA 2A6JA 2NXYD 3PWPE 3QDMA 4I18A 1ZLSL 3TA3D 2F2HA 1KJVA 3MUGB 2WCSA 3Q06A 4D9QE 4AQAA 3H3PL 2GG1A 3W11C 1N8ZA 2YN5A 4DCQB 2WLIA 3FU9A 1AR1B 3GI9H 4RGND 3FF8A 1C08A 4PJ8C 4YHKL 2YGPA 4L0YA 1ZXQA 3FCGA 1R9FA 4S1SH 1KGUA 2JXMA 2O5YL 4FCAA 3H1ZA 3X1GA 1DQKA 5HI3C 2FECL 2VQUA 2YBRA 5FKPB 5E24E 2QL1A 1X7QA 1YC7A 4LDEB 1KEML 3W38A 3UTPD 1FNHA 1UACH 4PBVC 2PCPA 5KTEL 2EVJA 1UM5H 1CVSC 2P5EB 3PPSA 4WUUB 3BOVA 5IQ7H 4TQ8A 1CLCA 1GTNA 3N1MC 2YD1A 5CWSB 3I6SA 2P5EE 1I7TB 3UTOA 2VKXA 4LQ1A 4PWJA 4C83B 2WNWA 3QEGL 4TM9A 4B7LA 3P3RA 5EDXA 2A73B 5HSFA 1BECA 1L7TL 3O9WC 4HWNA 1IC5H 5DS8A 1Q9LA 1R47A 2YLHA 2RJMA 2DIJA 3CFDA 5IB1B 4AVHA 5AFAA 3S37L 5TE4L 1ZT7B 5IQMA 2FO4B 3MRGB 4HIIA 1JGVH 2FSEA 2A6KB 3DVGB 4JPSA 4M1DL 5C0AB 4P5MA 3GSOB 1JMZA 1U3JA 1RUPH 1W72H 3NSCA 4LOUC 5EUKA 2JI3A 3TA4D 2LU3A 3CQPA 4MMXA 1FO0A 2J2ZA 3JYCA 4JO4L 2XIDA 2VDNB 5GGRA 4IJ3C 4YZFE 2IPTL 4PLKD 2ZP8A 3Q1SH 3LD8C 4EVNB 3VH8G 1IC4L 1KXVA 4QEGA 1S9VA 1NCJA 3I6KB 1GYUA 1HAUA 4ZXBB 1A7NH 4QD2E 3TVMC 1CF8L 2XZCL 3IFPB 2AV1A 3NMEA 1E7VA 1EUTA 3CZFB 2XWEA 1KTLB 2YWZA 1BIHA 3MNVB 4G1MB 4XPTL 4XNMB 2XN1A 2W9LA 1CJYA 1JNLL 3MV9B 1MFDH 5DVMA 1DBKH 2WUCL 3GZOA 1A1NA 5HHPB 2GFBA 1OP4A 4U49A 3BD4A 4WHTB 4ZDHA 4DZBB 4M9OA 2BC4A 4GAJH 4NC1E 3DURB 3NQIA 3TBTA 1EJFA 1DBJL 3H42L 2KZWA 1SY6A 4L23A 4W4OC 5L0QC 4ZMPA 4WQOA 5EA0H 1BVLA 2OTPA 3GSQB 3FRPB 3QPXH 4QXWA 1RZGA 4UDTA 4Y2DA 1S7RB 3HG1A 5HHXH 5ISZA 1D5IL 2XETA 3HZMA 5DRZB 4RSYA 1M2VB 1MUJA 2IMMA 3S3CB 2V8LA 3MHZA 1X4YA 4Y4FC 4Y8AA 4JL1A 3KR3L 3PS6A 1FGVL 2WM0A 3AM8A 1ZHBB 4YQXH 3FB6A 1A4AA 4TSCH 2OMZA 5TK2A 1TQWA 4JFUA 5TQ0H 1BXVA 2PYEB 1HS6A 3D87B 4HGWB 2ITEA 4NYLB 3SE9L 3EGXB 4M29A 1Y6NR 2ADJA 2NPLX 5IHLB 2HVJB 2E5EA 2JKJA 3GSQA 3NA4A 4JANB 4JFDA 2AQQA 3RL2B 1OAUL 5I74C 5EU6A 1AJ7L 5MHSD 5FFGA 2C4XA 2WN3A 1M57B 1JGUH 4HIHA 2V2XA 4K3GA 3ULSA 3BISA 4JNXA 3D07A 4OM0H 5KVFE 3BW9B 2WB1A 5C3LD 2ICEA 3DO7B 4OVUA 1JF1B 4FQQA 2EE2A 5L88L 5I1AB 5IR1A 1SHXA 2R1XA 2V5TA 3SKOA 1A25A 2R8SH 5H4YA 5L4FA 5DSCA 4MJID 4XOAA 4EE2A 3WENA 3L1OL 1EPFA 4P46B 2B0SL 1NUDA 4U7KA 5C0BD 3MLWH 5I8OH 1XCTB 4AENB 2P52A 5C92A 2V5SA 2GBAA 5LNEA 4P2QB 4U6VH 1OCZB 2YPKB 1DBMH 5FYKU 2BNRB 1NCCL 3U9WA 1FFNA 3CZFA 5ACLA 3TH3T 3PGDB 3BIKB 1LO4L 3ZTNL 4NENA 1V7NL 1JPST 4JFEB 3CC1A 5DZPA 1JWSB 1M05A 2NX5D 4V1DE 1NPNA 1U6AH 3SYPA 5AG8A 3BYTA 5DMKB 2P8MA 2YR3A 1HL8A 4DETA 2EH7H 1MIEL 4IKJA 1GMIA 5EN2A 2VDMH 3BP7B 3FUKA 2V3DA 2AW2A 3MA7B 4PLKC 3WY2A 1JV5A 3B5GA 3C8KB 4JDEA 2PCPB 5CD5C 1U8LB 2BP8A 3VFUB 1JYVA 1E0OB 1PS3A 5ESAB 5DMGD 3SDCD 2ITFA 1QUNB 4HWBH 3WFHA 4J12A 5DC4B 1II4E 4PLJC 5I76A 4EAEA 2DQCL 4JLRA 2YZ1A 4OUUA 3U0PA 3BAJA 1KIRA 2Y36H 5FW8A 5F6HJ 3UJIH 4I0CC 2PXYD 3WTSA 4FD0A 1Z9MA 4GAGL 1G9ML 2BXYA 1VCAA 1D2PA 5IQ9A 3CU7A 1IAIM 1TZHA 1YPZE 4IOIB 3IDUA 3GC3A 3SE4C 1TMQA 2OMNA 1KIQA 2VSDA 3TA3A 1GAFL 3CX5K 4YR6A 5CLYA 2UWEA 4M6NL 2FJSA 3GDBA 3B3IA 3NFSH 2Y2WA 2MCG1 1SN0A 2CHWA 3WKMH 3BEWB 1YMME 1DUYA 4J4PA 1M3IA 3O81A 2P45B 1YCSA 3EFDL 5KVGE 1R3IL 4KY1H 3WJJC 4L9DA 3DX6A 4IMKA 3QUHA 3NACL 1C9SA 1HAWA 2AQPA 2HFTA 3D6GA 3KPPA 3C5SB 4LVHB 1A6AB 3F00A 3EJRA 1PLGL 4WF7A 1S7WB 3SD5A 1OXYA 4XNUL 4QRPD 2ICEB 4KTDH 4M6OH 2YAOA 3ETBJ 2WINB 5CZXC 5DHVH 3PWNB 1RU9L 3X13A 4UB0H 2QQLH 4AYFB 1SM3L 4KUZL 1AZRA 3ARBD 1AY1H 2BY1A 2HLEB 1A21A 4X8JA 3AS0A 1W80A 3S5YA 1NCGA 2AJUH 2VDQH 1MJUL 4ILDA 1A2YA 1F2QA 3P4MA 2NUTB 4UILL 4Z7VF 2VQ1A 1NSNL 2KLRA 5CU9A 3Q3GB 5EB9A 2CM5A 2YJLA 5EU6B 3SBPA 1NCNA 1EZVX 2O6FA 1SXSA 3AQXA 3DGGA 1I9RL 5JW3H 1A02N 3GJFA 1A6WL 2R51A 1NC4A 3U30B 2H5UA 1JD9A 3HIZA 5FO9A 4A2GA 3KLHD 2FZ3B 5J6SA 4GPVA 3WFBL 3QNYB 1AACA 3OSVA 3SCMA 2BERA 1K72A 1ZLSH 1HHJB 4Y1TA 3I9PA 3UJTL 1UXMA 4LKXA 2PW1A 5DMJB 4MJJA 1FF5A 4FQQB 4OCWH 2WBKA 3WTYA 3RX9A 4N0YL 4TOYL 2VO5A 5F97E 2BHZA 2YA1A 3ECUA 2F7OA 1INEL 3QHZL 1I8IB 1IE4A 2J72A 2V7HA 1HXKA 3DYMA 3US0A 2F5AH 4MCZA 2WY3B 2ZUQB 5F1SA 5GS3A 3RVWD 1B3JA 2I9TB 5J1TC 3REWB 4M62L 3OVUB 1AKJB 4KVCL 5IFAH 2YXWA 4E9WA 4R8WL 1FYTD 1T0MA 3PGCB 1QBML 3ES6B 1TEFA 3TEXA 3IBEA 2PYEE 1BSIA 2Q5BA 2XWTB 4K0OA 1FYHB 4PMEA 1KLUB 2X0VA 4ABUA 3IDXH 4O51B 1OAZL 4KNTA 3QCTL 4PG9B 3WLWC 1RZGB 3TEYA 2NY5H 4BJLA 3UGUA 4N8CL 5AB2A 2GTZA 5FCUH 2EINB 1YEKL 5CMAA 5JLZB 1T6BX 1I53A 3HN8A 3BD3A 3P3SA 2CLZB 1LHZA 4LE8A 5I1GL 2VDOL 4XNXH 2LGNA 4Z8FL 1TZOA 3X3GH 1EAPB 1CGTA 4Q6KA 1J7VR 1LDPL 2YAPA 4UCFA 3VFGL 3GKWL 4OGXL 4E0RB 4RAUA 4X6CB 2WZPD 2YIHA 3CFCH 4HPHA 1F11B 4AEEA 2O61A 1X5XA 1TZGH 4TN9A 1WBZA 1MCFA 1DBML 3BN9D 3MV7E 3OJ2C 1OW0A 4IKKA 3PWUB 1MI5D 4UOW0 3RQ3A 2BVQA 3KPRB 1V05A 4L2LA 2VXQL 4NO0B 5GS2H 1LO4H 5K1NA 3KLLA 4NHCH 2Q10A 2XV0A 3H2PA 3ZL1A 4WW2A 3DO4A 1XVSA 1YEEH 1ZV5A 4MMYB 5GRJL 5BVJA 3FZUD 4OKVA 2KLSA 1QBBA 3DRTB 4R5XA 4Z7IA 3CXDL 2VDLB 4JPQA 3RWHB 4FFYA 1S5HB 5JW4R 1FH5H 4YDJA 2EH7L 2MPVA 2MTPA 3BPCA 4UQBA 2D4FA 5EIIB 1IGFH 2NY5C 2CDGB 2NZ9D 3O3EA 1LK3L 2Z6FA 1OK0A 4ZPVA 1G7JB 4ZPTB 4G6AC 3L48A 2NY0B 3DUHA 3VFMB 1TJHL 1XMEB 2KZBA 4L4TB 6FABH 4ZBJA 5GZND 3ROOA 4DTGH 1EMTL 1E5YA 4BH7A 1KJ3H 5KVDE 2F58H 5DJCA 2C9QA 3OSKA 1G4RA 1V3JA 4CJ1A 1EDYA 4OZFB 1UTDA 3PHQB 4KVNL 3RE0A 4NO3A 3ZQ9A 4R0LA 5E6IA 2AVFA 4Y16C 3NZHH 1XF5B 2XNAA 3K7UA 2UUDH 1E9QB 2NSMA 2O5NA 2JF1A 3PG2A 5DHEA 2C9RA 4L3EA 3FQTB 5SX4I 3BSHA 2E75C 3DUUA 4XO8A 1YN7A 2OMXB 2FQFA 3KPQA 4HKBB 3UAFA 1BDYA 1SJHA 4AW4A 1QA9B 5DA4A 3AAZB 5HDQH 4OAWA 2JJTA 1N10A 2EDJA 4L4JA 3A6CH 1AKJA 1RUKL 4KRPC 5ANHA 1QFHA 3GYRA 4L3AA 2OMTB 3CC5A 3EDFA 4JM2B 1P4IH 4LKCB 2VXVH 2XWTA 3GSUA 1QSED 1RJCA 3EGSA 4XNUH 4F7MB 3L4TA 1RZIB 1AJ7H 1G6VK 3BH8A 5EV7A 2IFFL 4PJAF 4YK4B 3ZZQA 4QHKJ 4QAWA 1LEKA 1R3KB 1UM4H 4ETQB 4MLSA 5CKAA 4LKXB 1TSRA 3CPUA 3V8OA 4OLEA 2FVNA 1Z2KA 2X6CA 3QUZC 4WSJA 5DGQA 3UZEA 3MA9L 4R4NC 3ARQA 4PP1D 2VDQL 5H35B 2FX8H 4CGUB 1JGEB 2FHBA 4TQHA 5DEGB 1W2KT 5IQ7L 2X4PB 1IJNA 3VX0A 1E4JA 1OGAE 1OM9A 5A1AA 2ZXBA 4JAMA 2JMRA 2FX9L 2WP3T 2Z64C 2QFPA 2W88A 5SV3A 1U91A 2EDDA 1O6TA 1NFDE 4R7NB 5KANI 4D0BA 1IL1B 2PTTA 4O02B 4FKEA 4G9FB 1JF5A 3R18A 1LEKB 5C9KA 3CH1B 1RCYA 1QBAA 2EDFA 2F19H 1HNFA 3GXDA 1XF4B 3B8SA 3I02A 1IAKB 5IFHL 3UC0L 4N26A 2O26U 5HDBF 2BSBA 4U6VL 1U2HA 4HKXA 3UXFA 2VRQA 2KPWA 5CNHA 5JIKA 2BDNL 2P8PB 3RWDA 5F1NA 3RILA 3U4EB 2C3WA 1C12A 1TTCA 3IWUA 4P2QD 3VFWA 2X7LA 4F2EA 3NZUA 5D71H 2IPTH 4CBZA 2X4RB 2WXIA 4X0KB 3Q1SL 1E5AA 1P7HL 3RVVC 5DJDB 2OXGA 1A1OA 3VXQB 2WQXA 3VFOA 2YK1H 4P06A 1HFUA 3M1OA 3ML8A 3DPBB 3UBFA 3GMNB 2NY5L 4PN6A 2K7PA 4J6RL 5DJ0A 4K23L 4U1NB 3ZKXC 4FYTA 4L4VB 5H37G 1S78D 2F1BA 3TIDA 4X7SL 4ZG1A 2Y22A 4BZ2H 3GSXB 1SOXA 2CNZA 2FH6A 5DJAA 2SODB 1VEPA 1XF5A 2XNAB 3FZUC 5AOIA 4WAFA 1JPSL 1IBYA 4ZAKC 3P2DA 2GCYB 5T1JA 5IIEA 4NFDA 1BX2A 3K5SA 3IAQA 4X8GA 4ZPVB 4XAKE 3V7AG 5EBMB 2FBRA 1H8NA 3RZCB 2OZ4L 4XO4A 1T20A 1FO0B 4FMKA 3LYRA 4F8PA 1E4KA 5GJTL 3WI9A 4YJZL 3SDAB 4ONHB 3IXTB 4LT7A 1TXKA 4PJ5A 3GB7B 4YSTA 5ANME 1H6FA 1U8JA 4DWHA 2O61B 5GS1A 3FU5A 4NXKA 1NC2B 2EXWC 2EH8L 4XB8A 4L9LC 3VXRA 2R4RL 1VSCA 4R7XA 4AOFA 3V10A 4PGEB 4Z7AA 4JFEE 4K3JH 3VXMA 1CPUA 2VLJB 2Q8AH 2EXTA 5IJVA 3RTQC 1FWXA 1G7QB 2LAGB 2OCCB 3JTTA 3WN5A 4NJAL 2MCAA 1JHKH 5H8DA 3QI9A 3WUWG 1W9XA 2GTWA 1T3FB 5JXED 3KDPB 3FFCB 2DIAA 3BQUC 5LCVH 1ORQB 1VGEL 4EI5B 2V2TA 2W60B 3NN8B 1JGUL 2NUPB 1WISA 4PP1C 1QSFE 4UT9H 4MD5B 3BAIA 4LOVA 2FB4H 3NDZE 2R0LH 4C57C 1TENA 3VRJA 2WK2A 4HALA 3QYMA 1F4WH 2A9ML 1VERA 4K2UH 4XXCC 5C0GB 5F96L 1KEGH 4XN1A 1T5XA 4G5AA 4BXSV 3NP4A 4Z3FA 5AW5B 4PBDA 4K07A 4Y19E 2V9QA 1CQYA 2D2CC 4GUQA 2J6WA 1I8LA 4MVBD 2FBJH 2MCMA 3GMMB 3KMDA 3G5ZB 2HAZA 1QHQA 3IJEA 4NQCD 1GYWA 2JJVA 3V4VA 4IEFB 4G83A 1V10A 4P2YA 1OAJA 1QACA 4FTDA 4M7LH 4XPAL 2CA3A 2VISB 4FNUA 5C0CD 1XMWA 4P4KD 4B9KC 5A2CA 3S88H 3M1CA 4NQTA 5LGJB 2R0KL 1OB0A 5HHVL 1P4IL 1R3HB 3EGXA 3DROA 4KK9D 3D9AL 4F80A 1PDKB 5E2TH 1JYNA 2X4NA 5D1ZB 4CGTA 2NY4B 2NYZA 1U8IA 1A9BA 4ZTOH 2ZCHL 3AT8A 3RVUC 4EXPX 3GI8L 1VIWA 1UGNA 4RH4A 3ZIMA 2QEJA 3BAKA 4MJ4A 5HDWA 1FGNL 5CU5A 2P8PA 2VDNH 5K5YA 4M4RA 4KDVA 1I9JH 3B9VA 3L2LA 1P84J 1DFXA 1RJYA 3DYPA 2YD5A 2VZVA 4PJGB 1G6RH 3FQRA 4JW3A 1FFOA 2YPVL 3OF6D 4UT7L 3VQ2C 4M7JH 4P0DA 2YXMA 5E1QA 4WKXA 3TEWA 3RDTA 2HVBA 1IM3B 2X1WL 1GCYA 1L0XA 3B7YA 4IU2B 3SB3A 3FO1B 3WHXA 2HKHH 5C0DB 1CB4A 5GGVL 2PMZA 3T2QA 4GLRI 3T0VA 4KK5C 4LCYB 4AYBA 3Q48A 3CHOA 5CLWA 2R29H 1FHGA 4RFNC 1P69B 1QSEE 2EECA 1HHIB 5C08D 5JHMA 3ARED 4OGAC 3FH8A 4NZRL 4D9RE 5JPMA 4B97A 3MRNA 1YQ2A 3VRLF 2VN5A 1MFUA 2RTTA 2IAND 4LKCA 3GXPA 3EYUL 4R83A 1CGWA 4N0CC 7CGTA 3V0VA 2E8YA 2DQJH 4QRFA 1WAPA 4QRUA 1ITCA 1GOGA 4H8QA 1YQVH 3VFSA 5DMGC 3SDXB 3US9A 4IRJD 4IYKA 5DVKA 3OLGA 3U9UA 3IF1A 5I26A 4Z3HA 1KB5H 1XIWA 4X4MA 1U8NB 1SYVA 4PJ9B 5FR3A 4IBSA 3STBA 3SDYL 2UVFA 2DM7A 4A6YL 3H3KA 1MVFA 1TZ8A 5C0RL 1PGRB 4FKKA 1KC5L 1CL7L 1CT8B 2R1YA 5IB2B 1S8DA 1U95A 5AKVA 3B7UX 5D2LA 1DUZB 4Z7UB 5A6LA 1MZYA 1P2CA 4G70B 5EIVA 5J9PA 3TEUA 4MLIA 4HJGB 4U1HB 5CP7B 2HT3C 4GRLC 4WW1A 5EO0B 2F61A 2XN0A 5FYJE 4AEHH 4I7ZC 4KXZI 4GRWE 5LQBH 1KIPA 1MCPH 3QEHA 4L4TD 2GI7A 3TH4T 4DGYH 1RJLB 3L9YA 2CD0A 1JVOA 3CZEA 5DVNA 4F2ME 1FG2A 3BIAX 4BGLA 5DO2C 1QTYT 3WUWB 3QH3A 2FSDA 2XQBH 4KJYA 4A7GF 1PSKL 4FQ1L 2A9DA 3E6HB 4LK4A 4XHQA 1HXMB 4DP2X 4QXGL 1RPUA 4NP4L 4UQCA 1N18A 4N8VG 1MJ8H 5J9PB 2YFOA 5DYOB 3BP4A 1B4RA 1NCOA 1S5IL 4FGMA 1YEDB 4ES9A 5GGSB 4M7LT 1YHPA 2H32H 1AR1C 1L5GA 4DP1X 1ITBB 1B4LA 1OARH 3MV8D 4DZ8B 2HMID 2C3GA 4G6KL 3TIDB 4ZX3A 1MWAA 3OM3B 3FBKA 4O2CA 1A5FL 3AQYA 1X5ZA 3UH8A 4AJVA 5D96B 2E9BA 2WGNB 1SMAA 3H9SA 2H2PD 1DE4A 4X4YA 1VFBB 1JG9A 2XPGA 2R56L 5EU5B 3OTTA 3UTQB 5I30H 4R8WH 2H3NB 1TVBB 4P2OB 3V9CA 5BZZA 2IXQB 1NCWH 5C86A 3UYPB 1CFQB 4L3CB 3KE0A 4IU2A 2Y6TE 2A9MH 4WI6A 1FGVH 3F04A 3CXFA 4UMGA 1H3VA 2F54E 2NDGA 3CFJA 5I9QC 1P7KB 2EKSB 1CGYA 1ZJAA 2X6BA 2XWZA 4OZ4B 5AKRA 2FYYB 5EEUA 5B3JF 3LDBB 5I1KH 4GRWF 4HVBA 5FYJL 3IRZA 3TBSA 5BV7H 4ZRGA 1G9NH 1F6AA 4Z7NF 1FC1A 2LQRA 4Z7WA 2BWDA 3JWNC 2N59A 3VXSD 3GMPB 4TSAH 5LBGA 1T1ZB 4PS7A 4XPAH 1GY2A 2MEJB 4OLVL 3GXNA 4X6BB 2R0WL 5L2JB 1DQLL 5JR1H 3BVDB 1MWOA 4YSCA 2DDQH 2BCKB 2MFNA 1AZUA 4WWOA 2KQNA 3DV4A 3O2WL 1S3KH 1WTGT 1IM3A 4DAGL 3FUJA 1J5IA 4R26L 4YXHL 5IK3B 3CDGA 2FR4B 5ID1B 3X3FL 5C0DA 2BJML 3I9AA 3CVBA 4AW7A 4WI5A 4RBPH 3T6QC 1YEEL 3MGOA 5FYLL 3FQNA 3O8XC 4C55A 3TBSB 3QARA 3BZ5A 1YNKH 4UTAL 2B1HH 1QTPA 3RVXC 1LO5B 1MI5B 2P46B 3RB5A 4AV5A 1FH5L 1HYRC 3BMWA 1YVLA 4TUJB 4W4OA 2A77H 1NCDL 3VU2A 4J6RH 3S37H 4A6YB 2DW5A 4YHPA 1HWWA 2ZXGA 4GUCA 3V6FA 4TTDC 4EZKA 3O4LA 1J8HA 2YQBA 4YUEH 1KBVA 1NEPA 5I15H 4PJ7B 2J6EH 2XUWA 3B3BA 1CC3A 1A3QA 1MQKH 1W91A 3QRBA 4LLWB 5GGTA 1O0VA 4L8CB 4JQXC 2DPKA 3T6XA 1MW3A 3GXFA 2R29L 4RX4D 5LGYA 5HGGS 2L8AA 2GIXA 5AVQB 2QQNL 2F8VA 1FL3B 2XVBA 3L81A 4LU5L 2A7BA 3Q0HA 3QJTB 2AJ3B 1EDQA 3EH5B 1A7NL 3MCKB 4BM7A 4U6XA 5EO1A 4OZHB 4QRQB 4F1SA 4XP4H 3C8DA 4NWTH 5FYJD 4Z23A 1OKEA 1CXEA 4GBXD 3S5LB 1MW1A 2IALA 2WZPA 2VJ8A 4WCYH 3IU4L 7FABH 4JJOA 2OW7A 1BBJB 1AP2A 3LZLA 1JNLH 4CN1A 1BAWA 3RGVB 5JHDB 4QF1A 4C8XA 1M71B 2WIIB 5IMOA 4X7EC 1RI8A 1F86A 1RUML 1C5BH 4BFNA 1QBLH 5CXPA 4NN6C 5DURB 3EDJA 3K6NA 2QZ5A 3IN0A 4KI5D 4PTTA 5KUMA 3GK8L 3Q9PA 1QFUL 3KYKL 3UYPA 3N43B 4JRXE 1T89C 1UYWH 1MJJB 1HESA 3NJFA 1D2OA 3V0AC 5DYOA 3GRWH 1CMOA 5J57B 2WVUA 2VYRE 3BSZA 4Q0XH 3O3AA 3QK0A 4IIQA 3K0YA 2K6ZA 4XNAA 2DYPA 3SDCB 4OJFH 1N4XH 3KL5A 5DEFB 3GXIA 4GKNA 1I7RB 5E4AA 3LEVL 1QQDB 4YHIB 5KSUA 3MODH 5IB3A 2VN7A 1DUZA 5G5DA 3W9EB 2G75B 3BT2L 3WS3A 4AXWA 3WIHH 2X6VA 4AGPA 5KVDH 1G87A 2EKJA 1N5YL 4YH6A 3UTTA 3L3JA 2QFRA 5K39A 1RJZA 5DZAA 1T7WA 3CMOL 1RV6X 1U8NA 1QRNA 4W70A 4TUUA 1EGJA 1ZEAL 1CVRA 1JDCA 4JE0A 3BUYA 1UWEL 3NJMA 3PCYA 3QQDA 3ECQA 2EDXA 1G94A 4GKNB 5IB3B 2WQVA 1SXBA 3WXVL 2EDEA 3N9GL 2ATKA 5DI8B 1IV8A 1JZ7A 2K1MA 2UXGA 2ZP9A 1LP9A 4DQAA 2OJEA 2R56H 2X10A 4K5MA 5HI4D 4M00A 5LN8A 5F9OL 2NT1A 3FB8A 1Q1JL 5FHBL 3TBWA 4A2DA 1BVNP 4XBPA 1RZKH 3MBXL 5JNYB 1KY6A 2BVTA 2KT6A 5CBEA 4PJ7A 4XCCH 2WXQA 3DV4B 3FHQA 2IH3B 1SJVA 5JYLA 1W16A 1AZCA 1H5BA 3BKCH 3MOBL 1GOHA 1E2VA 1AQDB 1UA7A 1J05A 3D39E 4KDTC 2ZONA 2F5BL 1JWMA 4TXVB 1F4YH 4NSKB 4KKAD 4R7NA 5BW7A 4JM2F 5JHLA 5C3TA 2XV6B 1BREA 2ARJB 2OJZL 3PL6A 2DN7A 4WFGD 3W11D 4ZSOE 5I9QB 3QIWB 4D0DA 2D8KA 1AKPA 4NN7C 2BMKA 3QJHA 4P3WA 2HN7A 2DQFA 3B37A 4OLXH 2OMZB 3CIAA 3P9MB 5DCCA 2BVOA 4O9HH 2ZAHA 3DX2A 4C4UA 4L8CA 1T7YA 1QNZH 3GIZH 3Q43A 4HPYL 4ZAKD 2QGEA 4W68A 1P1ZB 1NGXA 5T3XH 5L9DH 1N9PA 5L2JA 4XWGL 2JJSA 5DQ9B 3MBEB 1N6UA 4PREB 5E56A 1L9PA 4LPVA 4UWQB 5I1GH 4PWHA 4X50A 2R59A 3RL2A 3ZGIA 1ZPLA 2Y6SD 4QRAA 4MZ2A 5F72S 5BJTA 2X3AA 1HOCA 2PYFB 3TZVB 1XWVA 3L8QA 4HWBL 5C0RH 2JE8A 4LCVA 3EO0A 4FJ6A 2ZOOA 2EKSA 1ZHKA 4FHBD 1OCWL 2FD6H 5C6TH 3QWQB 1IO4C 5T33L 2FJGB 3CN1A 1H0DB 2IPUG 1SF3A 4FA6A 5L4JA 3IFPA 3BDBA 4IRSD 4KGLA 1X3DA 3Q44A 3D34A 2VH5H 3IJHB 2BNUA 4I4WB 1FZJB 4F7TA 4U4BA 3KPNA 2VXTH 4N2EA 5ALBH 3UTTB 4IRJB 2CUIA 3NIDF 3VB8A 1L7IH 2QHLA 3MV9A 2VXQA 1F1DA 3C60A 2GFBB 5C09B 1KSRA 2Z0UA 2TRHA 3M7OA 3CVIH 2UY7A 3PIQB 2DI9A 2EDHA 3AREB 1KGWA 1IGFL 2N7AA 1KYUA 5FA4A 1W0VB 4TRPL 4OD3H 5CIPH 4U3SB 3BLBA 4XTRC 1TJGH 4X80H 3ZE1B 4RSVA 4JFFB 2Q20A 3GB7A 3MZGB 4I1RA 5K9KA 4PJFF 3VFTB 2W9DH 1V7MH 4Y1AB 1NC2A 4LSRH 4ZXBD 1JZ2A 5C0FA 4AXWB 4JCLA 2IQ9L 4FQHA 5ILTL 5I16B 4OLYL 4HWEH 3CLFH 5JPNB 1OE3A 1T80A 3QZWA 3V4PH 3EJPA 1UD8A 5SV4A 4UM8B 1RJZB 2YKKA 5ITFA 4IJ3B 1HSBA 2X70B 4S0HA 1AG0A 5JQ6H 4NUGH 1SXNA 3HNTL 4OV6F 5DQDH 2AEIT 1XH1A 3LRLA 4JFFA 4YBLB 5DD6A 4HEPG 3V7AE 2CLRB 3OKLA 1KYAA 1B0GB 1WT5C 1BQHG 4X4XA 3UOAB 3KJ6L 1J0ZA 1CICD 4AUJA 3ZDXF 3DV6B 4UYPA 2VDQB 3ARGC 3QR1A 2O5XL 3A23A 5CN1A 3IDMB 5KVGL 3JZ7A 1JZ8A 4JUTA 1GYVA 5H37H 3OC8A 1NJ9A 4U7MA 3O3AB 5CZKA 1UD2A 4KKCC 5HHME 1AHWA 3SDCC 3DRQA 5F93C 1GJUA 5I8CB 2A3TA 3N0AA 3D2UA 5I19L 2XVLA 4F1ZA 3DGCR 4PJHB 1ORSB 1TPXC 1VZHA 2VAAB 4Z0XA 4ZMOA 3TJPA 4YLQT 2BRRH 4AG4H 5MP6L 1KWKA 3DVIA 4XZUB 3LEYH 4GBXA 4HOWA 4HX1B 4ANKA 1WFOA 4WFGE 1JE6A 4WI2A 4N6QA 1RP9A 3ML9A 4AYEC 1SF5A 3EFFB 4PCTA 5AOLA 2P7TA 1OALA 3MLSL 2CU9A 4WJ5A 5FHBH 1NL0H 4A63A 1JK8B 3ARTA 4N0RA 3VGDA 1BJ1H 3HNVL 3VTMA 3TBCA 2CGRL 2EC8A 2FWOB 2UY6B 4DW2L 4LLDB 3KYNA 2BOBA 3WFCL 3QJHB 4JZNA 4HZ1A 4QTHA 5AVWB 4Y16A 2OTWA 2X6AA 4FC3E 4M43L 2RR3A 2OAAA 4NXSA 2WXFA 2P5WB 5HJ3A 1AFVL 1NGYA 3MU3A 4H8WL 5F7UA 1OHQA 1Y6MR 1AGDA 4I0KA 2P4AB 3ZUNC 2J1WA 5TE7H 3T2NL 3VO0A 1A2YB 3P4MB 5A2JH 5IW1B 4FLOA 4M1CC 5AWNL 4NOFA 4OD2A 5TF1H 4UQEA 3B9KB 5F6IC 1XGZA 2F7PA 4QT5B 3CLWA 3NT0A 3GMLB 2HLFC 2FEDC 4GLRH 4W9GC 5C0CB 4AEHL 4E5XB 4HJJH 1AHKA 5J12B 4H26A 1HHIA 1BEYL 2P9RA 4JZNB 1FLRH 2GTQA 3QCUL 4KXZH 1H3PL 2LR4A 4KJPD 1ASQA 1BOYA 4OFQA 5EUOF 1DJIA 3SKJL 2YEQA 1EUUA 4B95C 1WGVA 4E9QA 4NQXB 3PLYA 3IU4H 3A6OA 5I0YA 1EK3A 1MWAH 4I85A 3QAZC 4OF6A 4YDIL 1KGJA 3IE4A 4FTVD 4WUKL 4F8NA 1AXIB 4XB3A 1TMCB 3UZEC 1KTDB 4UV7H 2I9LA 2ID5A 1N6QL 4LLQA 2WW8A 1YYLH 4KBPA 3QUMB 4AL8L 3L3KA 4YFLF 5D5MF 5GIRA 2EUZA 3A22A 4ZQKA 1WEJH 5C0JB 5DJYA 4Y5VC 3B56A 4GIAA 2GJ6D 2WVVA 3W39B 1R5IA 5JIHA 5GZNC 4QWWD 3X14B 3E7JA 1XGTA 3TEZA 3VI4A 4LPCA 3C87A 3QEUB 4X4KA 2VH5L 1ZV9A 5SWSB 3UTSE 1FNAA 4UBDD 5IUCA 2IDFA 1AS6A 2ITDB 1T7VA 1NJ9B 1TJXA 2FIRT 4LASH 4KTEL 1H3GA 4EZLA 1WRFA 2OL3A 2ZWLT 4GG6B 3CSYB 3RZCC 3VQLA 1E90A 3TZVD 2MNUA 2Y6SC 1T0NA 1A7RH 1WJ3A 5E9AA 2Y7SA 4BDVB 2XWBA 5CJQH 3QJUB 2ED6A 2LV4A 3GRGA 4KROD 3KGRA 1EEQA 3MV01 3UAJC 3VWJA 4BK4A 3OZ9H 5I6NA 1I8KB 4AYFA 3ARSA 4ZAKB 4LF3B 5IOPA 3QFDA 4J3OD 3IDYC 4PJDB 2IPUK 2L0DA 4N2BA 2D4DA 3MRMB 4NJ9H 4X4XB 1KPRB 1T1WB 3AITA 2NQDA 3HB3B 4JFPA 1WC7B 3FCSA 1E5ZA 3L4YA 1I7TA 3KG5A 1UM4L 1WS8A 2O4EA 3QP3A 4AX3A 4DGIL 5JR1L 3D69A 4YEEA 3ME0A 4AYID 4BFOA 1BG1A 3FTWA 1OF2B 1IAIH 1RXLA 2HLAA 2XWBB 1IBBA 3OBAA 2NY2C 3U7YH 2J8HA 3V0EA 3VFTA 1OGAD 4UT6L 5IEHA 2EYTB 3VH8B 1GGTA 4LESA 4ZAKA 5IOPB 3D05A 4WUUE 4LSPH 3CHPA 5DC0A 1D7DA 3WBDA 4H0HB 4AEFA 3I75B 1AIZA 3FB7B 5DK0A 1DJWA 4YDLB 3BGMA 5EUKB 2XHNA 3T5WA 3CVCA 4UQ2A 4WU7B 4N68A 4KRPB 3IJ7A 1UHVA 2O1AA 4YL4A 4FKHA 4K3DL 5C0CA 5KSBE 2WO3B 2ZCKL 4ZUTB 4K5PA 3NAAL 1E4KC 1FORH 3HR5B 1YNTF 4UIMB 4X98B 1L9NA 4U3SA 2F54A 2AI0H 1GJWA 5AL0A 5EH1A 3MRRB 1RZFL 1A3LL 3EOAB 4IRSA 4KKZA 3QQ4B 4LPYA 3SE3A 4JS7A 4WTZA 4LRNH 1DL7H 1XIWD 3Q8AA 4HJ0D 3ELQA 2DMCA 4NQXA 2GTZB 3GD1C 4FLHA 4OCXL 4PJFA 4XI5D 5F7EL 5GRXG 1B2WL 4ODXA 3RTQA 4OIAA 3S97C 4Y2LA 1XEUA 1KTDA 3MXVL 5D6DC 1FGNH 5I1LA 1FNLA 1PY9A 2VDKB 3C09C 4IGBC 4N1HB 5F7NC 3ZHFA 4ADIA 2BSED 1M42A 3T0ED 3I6LE 4XN9A 5KYWA 5FGSA 2XZQH 3BQUA 4N87A 1DJGA 4KKCD 3Q8EA 2FHCA 4X7SH 1E3FA 3CFUA 4X7FC 4Y9GA 3VUAA 3UYOD 2K78A 1IQWH 4FFZH 3ZDWA 3QCVL 3A47A 3C9NB 3EYFB 4JB9H 1M7XA 3HG1B 4JY6B 4D8PA 4FXKA 5TFSH 3LIZL 4HC1A 4YNYB 1BZOA 4WI0B 2VLLB 3DVNB 5C6TL 1ET7A 3K72B 1QPKA 1OL0A 2ENQA 4M1DH 2OSLB 3NZ8B 1ANUA 3PL6D 3T8XA 1HEZA 4AQEB 1A6UH 5A3ID 1C8PA 3RX5A 4HUXA 4G9DB 3O41B 1LEIB 4H1LB 1MF2H 1OD9A 2OX5B 4DSYA 1TU2A 3QRGL 2DQJL 3L7EA 1I1AA 1AQHA 3QYCA 4JPVH 3HN3A 2HUEA 2P5WA 5HJ3B 1KYFA 3BZFB 3MGAA 3W0WB 1MKFA 2J44A 3OHMB 2UZYA 5J13C 2D2OA 2CG9X 5B4MC 3LJ3A 3C9NA 1ZLDA 3EYFA 1NGQL 3MODL 1OCRB 4E68A 3QCUH 3RP1A 4V2BA 3KPSE 4FNPA 5DZVA 3AVEA 1IIKA 1KDJA 2DQEH 3QIUB 3D0LB 3PP4L 5CGBA 3ZIYA 4WFEE 4GNKB 3SPVA 4ALAC 3GTNA 4NQSA 3A21A 3QORA 4X80L 1OB1B 2A6DB 1F97A 3WFEH 2ICWI 3MO1B 3FHAA 3TIEB 1JPGA 2VMJA 2BK8A 4LLDA 5E1HB 3LZFL 1OP5H 5LN4A 3QEQA 3S8WA 1CLZL 1DQVA 3FQXB 4YPGA 3NIFE 4PJAA 1MCPL 1Z6JT 4L8DB 1E4WH 2VLKE 5AZEL 2F08A 3QPXL 4J3OC 3SCMD 2JKWA 5HHPA 3QNXB 3UPAA 1S7QA 4QGTA 4XOBA 2LAAA 4G42B 4MBRA 4ZUTA 4OD1H 4ES8A 2ZUXA 1JNHA 4IDLA 4Q9QH 3HNSH 5LBSL 4O5LL 3EO9L 5F9WB 1I31A 1F18A 1OSYA 1YA5A 4MDIA 3F7YA 4WW2F 4KK8D 3X11A 2Y1YA 3NCJL 4OCYL 1KCUH 2APFA 2EYTA 3H7BB 5CJXA 2A38A 4CNIA 4PTUA 4JR9L 1DO5A 2LABA 3EZJB 1RIHL 1A3ZA 4Q52A 2WJ5A 3HCVB 1AQMA 3KPOA 4MXQC 1G7PA 4YBHA 1HCZA 4HIEB 1UWXK 4UQAA 2P8LB 1UVQA 2V2WB 3ZRFC 5FV2A 2X44D 5I19H 4NHUA 4UI2A 1F8TH 3KLQA 5DHYA 2ZAIA 1JNHB 3AABA 4Q6IC 4AIZA 3L3OB 1NAMB 5AW9B 4ODWA 4A38A 2Z7YA 3KYOA 3WFDL 2ICWB 4PP2A 5C7XL 4OM0L 5DS8B 2R69H 3S48A 4P23C 4HOZA 4Y4HD 1JI1A 1EV2E 1A6TB 1BG9A 1J0YA 3D3VA 4KKAC 2GAZA 3AJ7A 4HCIA 5HDOA 5SWSA 2ENSA 5HHOA 3LQAH 4HMCA 1MRFH 5B21A 4KHXL 5IG7A 4F20A 2R8SL 4LVHC 3OX8B 2V7HB 4H1LG 2X4SA 1M3JA 4Y7OC 3COOA 4HUKB 4BDVA 5I0ZA 3CK0H 3L9BA 3PF2A 5LB1A 1WICA 1S4IA 2J6EA 4WFED 43CAA 1FYTB 4OCMC 4IGBD 4X5WB 2CCLA 2R0WH 2B5IB 3ES6A 3L5JA 4TUOB 3VFOB 5HYSB 4YGVB 4IHOA 1J5DA 1RZFH 3ETBF 1U0QA 1H9DA 3V4VL 5TF1L 1FBIH 3KXFD 5FUOH 5HI4C 3CCHB 5E5UB 5LDSA 3D0LA 5D1XD 3FU6A 1ZE3C 3X3FH 5JLZA 3UPRA 4NGHH 3LHPL 1QFOA 4L4VA 3RGHA 3TWYA 4AQAB 1D5ZB 2WYTA 4LCCC 2DBJA 4L1BA 5ICXA 4JDVB 5LBVA 2QLYA 3FUMA 1K4CB 4J5VA 4GG8A 4ELME 1EVTC 2VLRE 4KRNA 1FLRL 2D3JA 3CVIL 1BXAA 4HIJB 2X2IA 5I1IL 4ELMB 4H1LA 2OX5A 3CQQA 2X1OA 2AAVA 3ECBA 3H55A 2GSGB 2KL6A 4OD3L 4R7VA 1VADB 5EZLA 4I0PB 3V0WH 4XODA 1AHMA 4OI8A 5F88B 3WIFA 1V7ML 1RUAH 3L5XH 3R0MA 4OUOA 4ISVA 3TFKC 4N86A 3ARXA 2J6EL 1U8IB 3I6LD 4OLYH 5I2IA 1MH5A 1HOCB 2DLFL 4UUJB 5DU7A 5KYWB 4GYBA 4K71C 3WSQH 3UJIL 1FL6B 2WBJD 1NC4B 2OCJA 4QRPB 1F4HA 1ZHBA 5M95B 3QNYA 4GAGH 3JVGA 3D85A 4YVNA 1NGWB 5F7AA 4JFED 2ZUVA 3JWDC 4NQDA 2V4LA 3EFOA 1NBCA 4LASL 3FSVA 2XQBL 4WWKB 5F6IB 2HH0H 3DYOA 4FQIH 3ZDXB 5INCB 3WNNA 5CEXB 1B6UA 4DVRL 5ESVA 4QJ4B 3LCYA 5TGBA 4DFHA 4NBYB 4PGZA 4NRZA 4K55A 5GS0L 5LXGL 2NUPA 4IU3A 2DQ6A 1R24A 5IFJA 3MLRL 4ACPA 1PNCA 5A16A 2EVIA 1EZLA 3QS3A 1DSYA 4JRLA 4RZKA 1RPQA 5MEQB 1QHPA 3KXFA 5DZ9A 4HBCH 4K73A 4APXA 3NTCL 1KV3A 2VC2H 2VZUA 4WHYG 1IGJB 4YHLL 5KEZA 4L5FE 1IMHC 4LB8A 5BS0A 4OZGF 1QASA 4GSDL 3TO2A 3GBNL 5DT1L 5J8OA 5T5NG 5LXVA 4GKZA 2APTA 4JBSA 1B9KA 1QA9A 3ZOAA 3FUFA 4NPYA 1A6VL 1IGML 1Y1UA 1U8CA 1DBAH 4NP9A 4Z7QE 2C3HA 2MJWA 3JWDH 4FTVB 5CUSL 2K8MA 2NNXA 4FFYL 3TT1L 4DP7X 1AGFB 4HHAA 4MA1B 5KAQG 4KWUA 1NZRA 3SYAA 4C56A 4EI5D 2B5IC 1TR7A 2FJFB 3OJVC 4XXDB 3SE8H 2NCEA 3KCPB 5DD6B 2YQ3A 4XMVA 1G9NL 3F7VB 1B0GA 3F6IA 2X9ZA 4XX1G 3VFVA 2PPEA 4ZMXA 4W9EC 1P5VA 4NUJB 1UT9A 2VLJD 4FERA 4G42A 4XNZB 3TH2T 3S9DB 3TBYB 1M05B 1H8OA 3EH3B 2WWMD 4XP9H 4X5XA 3GMRB 1JYWA 1MCCA 3L1GA 4LRNL 2L4OA 4PW3A 4YXHH 4PJXF 4P4KC 1RULL 4J39A 3O0RH 2AK4B 5EZJB 4UT9A 1TT6A 5MEPA 1CWVA 4YDNA 3PGFL 4K8RL 3OB0H 5C0BB 4MHHG 2K45A 1AQKH 3RFZA 5DJ6B 5BMFL 4W93A 3KPOB 4WFHE 2E4FA 1NOFA 3QWOA 3QXDB 2A83B 4G6MH 2ZX8A 3PDGA 5I82A 1M1XA 3QC6X 3MVSA 1WGOA 1MXDA 1N19A 1XH0A 4BSJA 3CH1A 4MZ3A 3LN5B 3C6SB 5G4MA 3T1WA 2ZXAA 1T66C 1VEMA 4HCRA 4MXQD 3SY6A 3T3MB 3IDJB 2CR0A 4KHXH 5E95B 5A2BA 3SO3C 3U4EA 3RIFF 2XWDA 1KB9K 3KBEA 4I88A 1WLHA 1CICA 2L7UA 1IKNC 3CH8A 3MV9D 3KGUA 4ODSL 1TVHA 1SN2A 2HA1A 2OXGB 5FPIA 2HRLA 3KYMB 3Q6FB 3T1FA 5DMYA 5ALCL 4OGYL 5KBPA 3OAUH 3ZTEA 1U3NA 1B88A 4LU5H 4R2GC 4G8GE 2BSDA 4A68A 2I85A 1RQ5A 2BIIA 3E8VA 4Z9KB 4CMMB 2E6JA 3QAQA 4ZFGL 1HCFX 1A1MA 1K6QL 3GDCA 5E0QA 4M8QB 4K8RC 3UBXB 1NBZA 4RMBA 2C7FA 4WIQA 3N42F 3PWVB 2BY3A 4CVZB 3LS5L 4YO0A 3SY0A 4X6BA 1I4FB 4BSWB 1SLXA 3AY4C 4KROC 1EBAA 1LK3H 4AVKA 2F53D 2H3XC 5IROA 3N44F 1F02I 2RBLA 3S34L 3RZCD 1UYWL 1JGEA 2VDPB 3LZQA 1UB5A 5ADOL 4ERSL 2BP3A 5HGAB 2F68X 5FLUA 4F9LA 2QMJA 2YUZA 1CFSB 1XZWA 4KKQA 3UBXA 1NBZB 3FQNB 3QG7L 4XRCB 3WS6C 4MXVF 1U3YA 1SQMA 4AQZA 3FT2A 2IBBA 4D3CH 3R8BB 1X5IA 3TPUB 2A9BA 2P5ED 3ULUC 1Y18A 3HA0A 1XV8A 3TNNA 4WI4A 5JMRA 1V8HA 1CDYA 5G2NA 4BH7B 3GLZA 1IAII 1HQ4B 2Z4QA 2OMWB 3MUY1 3UPRB 1CE1H 2Q8BH 4JGUA 1ZSDB 4OLWH 4G8EB 4K15A 2I25N 4OY9A 3KJ4B 1FZMA 4B9ZA 3L95A 3UJJH 4CILA 4H2AA 2O6DA 2XTJC 2MCPL 1QLFB 1E9QA 3WO3B 2CKBL 3U2SB 1TVBA 4P2OA 3QB7C 4PLJD 1KZYA 3TA3B 4RRPA 4LF3A 4YX2H 4V33A 4RAVA 1D7FA 2FEJA 3D0VA 2VC2L 5MEOA 3BEWA 3AB0B 1HIMH 2VDRB 2E56A 5C6PB 4M62H 3BP6B 1R5WA 1MIML 3MNZA 2JSFA 2HKFH 1NMBH 4B9CA 1DVZA 2AXFB 3STZB 1KUMA 3TBVA 2YPLA 2AJXL 2AZAA 2BVUA 3QQ9C 2Z31D 3GMRA 2F7QA 4HAKA 3AWGA 3DX9A 5CSBA 2AXWA 3BDYL 4A7QA 5EC2B 2N4IA 2H6PB 2E4TA 4ODVL 1J5OH 4IBWA 5KVMC 4LEXH 2HWZH 5IMLA 4DGUA 4MQ7A 2ATAA 1JN6A 3ZT6A 2HPOA 4EN2A 3QDHA 4YHKH 5JZ7D 2QPEB 4BKSC 4JQVC 1AI1H 1IEAA 3GSRB 4XVOA 4I0PD 1RK1B 4F2MB 1E5UI 2IBGA 3K81A 4IIQB 4ONHA 1U3HC 5G4NA 5ECGA 3DRTA 3VSVA 1HI6A 1SHWA 1E6JH 2WN2A 3OR6A 2DWDA 3HI6H 2EDTA 5HY9B 3HC3H 3ZPDA 1O9WA 3C8KA 4JDEB 4KVPA 3IFLH 5EZOH 4JM2D 4NQQA 1FCGA 5A43C 1KULA 2J5WA 3FQRB 1DQDL 4U1MB 3GQFA 2Q87A 5BS0B 3LH9A 1ZHNA 5GSVA 2AERT 5AYUH 3T77B 3C2AL 1ET8A 2Z7WA 1U41A 3UZVA 3B9AA 2BP5M 5LO7A 2XIBA 2JTYA 3OZLA 3FRUA 1U58A 3N44B 1O9VA 2A74C 4HYTB 3SO5A 3CVHB 4BZ2L 3V6ZA 4F5CE 1KTCA 1FVDB 3DA0A 2W07A 2Z8RA 1JXFA 4QRQA 1WZLA 1FFRA 3HE7B 4JN2B 1KJ3L 3ATFA 3OKNA 4O51A 4PG9A 4HT1L 4WI3A 4HS3A 4MZIA 2WNGA 3DSFH 3GJFH 4PRHB 2OMWA 2Z4QB 1GR7A 3BH9A 4MS6A 4EPSA 5ICYA 3PQYE 4X8CA 2L7EA 2PPCA 3GNML 4K9EC 1BLIA 5FM8A 5I18L 4G8FA 2Q9OA 4G6FB 4MJ2A 1TTAA 4N2LA 2Q1EA 2NY1B 4MZRA 1BWMA 5L0QB 4R84A 1I1FA 3H9YA 3LRSA 5E4EB 2AGJL 3C5ZC 1KNOB 4I2XE 4KY2A 4NQEA 5TJWK 3W0WA 5FFLA 4NSKA 3SGJA 3T4YB 3LS5H 1DTUA 1Y18B 3FPYA 3C5XA 4G71B 2OA9A 1TUPA 4RDQG 4F9PA 2ODIA 3BH9B 4BCZA 4F2FA 4YHZL 4AL8H 1SXCA 3UP6A 1WZ1H 1I75A 3MYJA 3JV4B 2AQRA 1OEZW 4RNRA 5D5MA 4Q9RL 4HU8A 1I85A 3C5SA 3SGKC 4WEBH 3EHBD 3S3JA 4JGNA 2QJDA 3UTSD 1ZGLB 1WUNT 4AMWA 2RCSH 4GG6E 1UT2A 5CP3H 1RMFL 1HJCA 1Z66A 2PYEA 2BXZA 2PW1B 1R3JA 1R19A 2YXVA 5I74B 4D3CL 8CGTA 1J18A 5DURD 2KPNA 5HYFA 1C1EH 4XP6H 3RY4A 2YGOA 3KR3H 1MCJA 4MJIA 2W65B 1DCEA 1PZCA 2IWEA 2CHXA 2YAEA 4IK6A 3NQKA 4AYMC 3ARBB 3WHE0 4PRDB 5AYTA 4P9ML 2FX9H 4FYRA 4XPFH 4O58L 4PWFA 2WCPA 1WVZA 2G3ZA 3AADB 5A40E 4W6WB 4ENEC 2XV3A 3F3HA 3U0TB 3CX5J 3F12A 2NR6D 3L13A 2XPGB 4UIKH 3ULVL 2OJEB 5HI5C 4EF3A 2F19L 3B3IB 2E7MA 2W1NA 1FL5B 2IXQA 1HZHL 5BUAA 4YFLI 5E9DA 2JI1A 2YD8A 1CFNB 4OGQC 1GGYA 2F74A 2H9GB 3GMMA 1CQKA 4X2UA 4X6DF 1SQ2N 1UUSA 3GSRA 4IRZH 3W0WD 4ATWA 3LV3B 4TQPA 1HTYA 3TO4C 1EZVY 4QJ3B 3Q1EA 5IHZB 4G6ML 1HI6B 3BUTA 1SJEB 2LFGA 3EHBB 3FTGB 4UT6A 3RTLA 32C2A 1YDPB 5IIEB 4FNTA 3GSVB 4PCYA 2VITA 1JVLA 1AC0A 4P49A 3QZWB 1H15A 3VQMA 4KAQH 4Y2DC 4K3DH 1DVFC 4FG2A 1R5WB 2ZCKH 1IEBB 2IDQA 3NESA 4XAWH 2MKWA 5EWIH 2F6AA 4Z7QB 4C83A 5FFOA 3RZCA 3FQUA 1RJLA 4YSSA 5DMKA 1OOAA 3RGVD 4DKTA 4QRTB 1J0IA 5KW9H 3GLDA 5DUPL 2B8OT 5J6GA 2AF2A 1J9QA 2FWUA 1ZWIB 2YPLD 1CLYH 2YPVA 4PJ5B 1HILB 4RAUB 4X6CA 4IMLB 4R2GD 2NY1D 2UYLA 1WZMA 4NCDA 4U3CA 1QBMH 4GRMA 2PO6A 2C1PB 5H2BA 2PTTB 4AGLA 3CDCA 1N7ML 3IPBA 5EZOL 3S4SB 3UFIA 1GKOA 1RURH 3LKRA 5C0NC 3QCTH 3EO0B 3SKJH 4PHXA 2V7NA 3GSNB 3LKPA 5AZUA 2Z65C 2J88L 1ZV2A 2A6IB 3QEQD 1BQRA 3ILDA 3I3EA 3BHBA 1ZSHA 3HE7D 4W9ZA 2R4RH 2AJYL 3TC9A 4JPWL 1D6EA 3MCYA 3SQRA 2VQ4A 4I4WA 5D9SB 1OIOA 3DARA 5ANMB 4NQUA 4OIIH 4Q9BA 2Q8AL 4MJ6B 2WKOF 2CA4A 4P2OD 4IS6B 5D4HA 2O6PA 5DLML 2LOEA 2VRKA 5E5LA 4N0FA 1IIIA 1MW2A 1WEJL 2Y36L 3LXCA 2OL3L 1JHKL 3OB8A 4ELMF 4QGYA 2B1AL 2QBWA 3DIVA 3WIFB 2PXYB 2Y1AA 1MDAA 1OSEA 2OLDA 4YHLH 1G9MH 3RWGB 1JZ4A 1VGEH 1QSFB 2D7PA 2ZWNA 1RL1A 3EGDB 3KJ4C 1N6VA 3QRGH 3VI3B 3BSGA 5FXCH 1NGPL 1WIUA 1XCTA 2H1LM 3MRPB 4KTEH 4KXDA 1QEXA 3OQRA 4QY8B 4UT9L 4G2AA 3FFCE 3SE4A 5AW4B 5D1QD 1U8KA 1QVOA 3MLUL 2WXKA 3JWNG 1ZLUH 1XH3A 5J89A 1DDHA 2AJZA 4EBQH 3H3BC 5IGXH 4MNGA 4NBXB 2D7TL 2I69A 3IMWA 4WHYH 1LWRA 3RJDA 2BCKA 1MUJB 1FE8L 4NZTH 1T4WA 2PXYA 2B59B 1MG3C 4ZO9A 4UDUA 3RGBA 3R7RA 3IMUA 2MCPH 1K9TA 1NCBH 3D8MA 3O9WD 2X87A 3QJSB 3MJ9A 3S6CA 4EO5A 3MRPA 2Y2YA 4QY8A 2IADB 5CHNA 1I3VA 1U91B 4QOKD 3CNKA 1NGZA 3SQOL 3D9AH 4XO9A 2IJ0C 3VFRB 3UIZA 4BK8A 4MB4A 4KZ0A 2WPGA 5EZPA 5JW5A 1JZGA 3RTQD 4JN2A 3E3QC 3OKNB 3O6ML 4PUBH 2HKFL 4OCLC 3VMPA 5KBKA 4LSPL 1FZKA 4ETQA 4LNRB 5TDNB 1PX4A 3SKMA 1SUJA 5ICYB 1KLFA 2WYIA 1L4IA 1YJDH 5C07E 2CUHA 4KQ0A 4GP8B 2Z35B 3MPCA 4JPKH 1DE4B 1VFBA 1HHKA 2VUOA 1TZHB 5JA8B 4IOIA 2P47B 1I1AC 4GS7B 4E42B 2W0FA 1FG9C 1KN2L 5EC1B 1U36A 4QCIA 2LLNA 4N6RA 4BHUA 4R7LA 5HYQA 3EKCA 4FI6A 4DEUA 2HUHA 3HS8A 2UWEB 5GS0D 1TETL 3AU1B 4M6AA 5GGRY 3CZGA 3CDFA 4AC2A 2WKGA 5C08B 2QR0A 3AAZA 5I6LA 4N0CD 4MCMA 3IYLW 3QO1B 2F53A 3H9HB 1P5VB 3MKGA 4PRBB 4JKPH 4E41A 1YMHA 3TBYA 4GJTB 3QORC 1E42A 1SMDA 5HYJA 1U9KA 3JV5A 4KHTL 4L18A 2PP8A 1EJ6A 4MRBA 3Q2WA 3S5ZA 1FA4A 3CVHL 5F89B 3U4KA 4IRZL 4U2YA 2G9HA 1FFNB 2QVFB 6CGTA 2DL2A 4PTTB 4HUUA 4YOKA 3CHRA 5D7LE 4I13B 2W9EL 3O2VL 3QAZB 2Z8WC 5ICUA 5EC1A 1AANA 3WJLA 1H8LA 1CFNA 2F74B 3TWCH 4XPHH 5T3ZH 3B9KD 5GXBB 4R4FL 1KPRA 2DMHA 4L5FH 2FHFA 1OAYL 3BRGC 3QW9A 3H7LA 2QR0B 4H0IA 1JXJA 3D39B 1UZGA 2F53B 3H9HA 4RETB 4WW2B 5FYKH 4UQ3B 5GPRA 5HYEA 5D1XC 3J07A 3BP7A 4LFHG 5CEZH 4HK0B 1SN5A 5DEFA 4W9FC 3VTTA 5IOKA 4PJ9C 5IHHA 1CD0A 1HEHC 1S5HA 5EPMB 2VABB 4GFTB 3GSVA 2DMGA 3SCMC 1K5NA 1K8DA 4P4KB 3K6SB 1FL5A 1AO7A 1NICA 2C1OB 4WW2C 4OQTH 4FABL 3QWRD 5LG1A 1DQQB 1F3JA 2XFXA 4QRSB 3AG1B 3ILQC 4GMTH 2BP0B 2DKUA 2G5RA 3LHAA 2AKRA 1WIOA 4OBSA 4NRYA 4MCZB 1BYOA 3P4OB 1PZ5B 5GS0C 1ZHKB 2VAJA 4IHBA 1OHZA 1HL4A 1DQIA 1I8MA 5TE6L 3TONA 4MB5A 4AKPA 2WLLA 4A39A 3P1VA 2EAEA 2G5BB 4QRUB 5G55A 4P23A 4YO0B 4TLSA 3MR9B 5AAMA 2AQ3A 5FA3B 3WXWL 2P28B 3PY9A 2B3RA 4KKNA 4G7QB 4LHQB 4RMQA 2ISDA 3WSQL 3LNHA 3CX2A 3RIFK 3FO2B 5I1LB 3KNBA 5DJ2B 3KPPB 3UADA 1UD6A 1I9IL 5DC9B 2VR9A 3NJNA 3CHXA 5J1SC 4FULA 5F9WC 5GJTH 1UFUA 2FO8A 5C09E 4PGDB 2FK9A 3L3HB 4ACTA 3BAXA 5D72L 4GIOA 3RVVD 3L45A 4PWKA 4FG6C 5J56B 3FYEB 2WLLB 2YBGA 3BT2H 4HQQL 1JGIA 3GBML 3ZX1A 4Y4KD 2H3KA 4KX7A 3AY2A 4NKMB 2X38A 4LSVL 5DDHA 4XE0A 3B34A 2EE9A 2IQAB 4CC0A 4K5OA 3QZPA 4PJEB 3KS0H 3VNYA 3P0GB 3MRBA 4B9PA 1NM4A 4EEEA 3QUYA 4UTCA 4WO0A 1TTBA 1JPEA 4G9DA 1LEIA 1USZA 5KS9E 2XX1A 4NQCB 5DEGA 3FO0H 5DUJA 2FZ3A 4JFFD 4YLBA 5FDWB 5J3HC 3V4VB 1D6EB 4KZDL 2ZKMX 3AMKA 5FECB 2H1PL 4ODUA 1MNNA 3O4OC 4Z6AT 3N85H 1CDUA 5E2UH 3N1QC 1CG9A 4G80B 3N9GH 9PCYA 3DHUA 4F15C 5LGJA 4C4KO 5GRUH 2RFXA 3HC3L 3QUZA 1NWPA 5EMYA 1QOKA 2B4CH 3AMLA 5E7FA 3LZRA 4TLKA 1AR1D 3SJVA 1FNSH 4BKLA 1L5GB 5EBGA 4P8QA 4FI7A 1NDMB 2GJJA 4BQBA 1HHHB 4U0QB 3O6FA 3C2AH 3LQAL 4XH2B 4RFNB 2B1HL 2ZKWA 2BY0A 2CIIB 5I8CA 2ZX6A 4Z0BH 4IRSB 3KDMA 4P4RA 5DI8A 2JCCB 3UBXI 3D2TA 2A99A 5I5JA 4P9HH 3QIBA 4M7LL 1IC7L 3IGAA 1HHGA 2X0WA 3TURA 3ULVE 3FQTA 1P6WA 4HUUB 3TN0D 3LKQB 2P26A 2YRPA 2WXMA 2DQHH 3RWCB 4DKFL 1COBA 1S46A 2R0KH 4AVIA 5J11C 4GW1B 3V4PA 2DTMH 3L7FA 1UXWA 4N90E 2BP0A 4MNHA 5A2AA 1ONQB 1JN6B 2ICWJ 1HWHB 3MREA 4ONOA 2V5RA 5GGSY 2V3FA 1D5MA 1MREL 4UQ3A 4F2MA 4B5ZA 4LGSB 2BFVL 4AEIH 5E8PB 5FWQA 2BNQD 4L3EE 3E3QE 2NT0A 3RNKA 5FCSH 4M5SA 1FJ1B 1YNLH 3KBPA 3AQZA 4JMNA 1ZS2A 2HX8A 4BE6A 5TPWH 3HW7A 5GISL 4HIEA 1JZDC 4UM9B 4CL7A 1KIPB 3NA9L 1AR2A 2HTLC 4HLZG 4XPHL 5T3ZL 4I5BB 4LCWD 3II2A 4MVBC 1U2YA 5KYUA 1KLFB 5ECJE 1SYVB 4C4BA 1JPSH 4BZYA 4GO8A 3V5HB 2Z8VC 1MCWW 4XVJH 2I7OA 3VXOA 4Z7WF 3KLKA 1JZFA 3T0DA 2WV3A 2XQ0A 5AQ0A 4Y8DC 3A4AA 4GEIA 1WG3A 1IRAY 1CBJA 5H4ZA 4X99B 1U8HA 3AG2B 4JGJA 5IB2A 2B1AH 1QSEB 1KB5B 3RWIA 1JZHA 5C0EA 3MFFA 3MJ8B 4PWEA 1BF8A 3FONB 5ALBL 1A66A 2VN6A 3ULVF 4NQSB 4NRXA 5FUCC 3HE6A 2J71A 1DYZA 4FXGA 3RBSA 2FWSA 5D1XB 3D3VD 3SYQA 2HVKB 4NQCA 2CM6A 3T71A 3OKMB 3SGDH 4ORGA 3V6OC 2D7TH 5FDWA 3HMXH 4YE4L 5F3HA 2D7OA 2X7LB 4U1GB 3PDDA 1BIIA 5EORL 3HC0B 1NFDA 2XTSA 2WXGA 4IRJA 2BLFA 2D3LA 1TJGL 5B8CC 4MD0A 3IF1B 3QHFH 3RUGE 3V0DA 4ZMYA 3LKOB 3RFZC 4LSRL 4BGDA 5LAXB 2X89A 2YGVA 4HC1H 2X9XA 4XN5A 4ENZA 2ZQKA 3IVKB 4ZO6A 5CZXD 3HG4A 2YXFA 2ZKHL 3U9PL 5LQBL 3OLIA 4ZZFA 2GBUA 3APFA 3MRBB 5E2VH 1LO0H 1U92A 4Y4HB 4Z7NE 3ALXA 4RCAA 4HZLB 1Z5LA 1EH9A 1JRHI 3SDXF 4GAYA 1ADQH 2QQKL 3VXPB 4J8QA 3WEXB 5H94B 1JWUB 3QUML 1KXTB 1TQUA 1VADA 2A1WH 3CLEL 2AK1L 3DBSA 4BQCA 4Y5YA 4NNPL 3KH4A 1R3KA 4EN3B 3HBPA 3HUJB 5J1AA 2EEXA 5DTFB 2K4WA 1PDKA 1KGCD 2PN5A 1MCBA 4JPKL 4J3SA 3VDBA 2FR4A 4GG6F 4U3XA 3VG0H 2X4PA 4FYSA 3F7RA 1TPXB 4DP5X 1KJMA 2XWCA 1YPZF 2CKBH 3K46A 4RGOL 1S3RA 2VR7A 4CC4A 1F1AA 1A7PH 1L3NA 4I9WE 1USQA 3FUHA 1P9MA 3ISYA 5E2TL 1F6AB 3HLKA 2XN9B 4JRYE 4S1SL 1LE9B 3LPFA 4PGEA 1MDTA 2V17L 3GMPA 4NC0B 2Y23A 1T1ZA 3RWJA 5EIIG 3SE6A 4C54A 4YFEA 2CO2A 2WZ5A 3VGGA 1EO8H 3VWJD 1G7HB 4Q56A 2ITCB 1RUQL 3P30H 2BSCA 5K9OA 3RUGF 4WU7A 3D25B 4LMQI 1BQLH 2NY4C 2ZIDA 4ONGL 2OW6A 2WXNA 2W94A 3QI9C 3MLSH 1SLWA 4U1JA 5A2KH 1JZ6A 2AJVH 3KBHE 4Y1AE 5L9DL 3MJGX 4Z18A 1RZJL 3HMXA 4F9LC 4LVEA 5DJZB 3VXRE 3G6JA 5D4IA 1LMKA 4R3SA 5HYSA 1TQVA 1JGDA 5BO1H 3HZKA 4E9XA 3Q13A 2H0EA 3CSBA 5IVXE 3QWNA 1N5AB 3HUJE 3RHWF 2YFNA 4N1EA 1JGVL 3DSNA 3NIGB 5D1QE 4XXCA 5ICZA 1QZNA 1YAIA 4HLJA 1XF2A 1BWWA 2VXSL 3D18A 4XX1E 3LKSA 1E4XL 5DR5H 3U7WL 3MOAL 1KZQA 4UM9A 1E6JL 3VCLA 1I8LC 4KH9A 4WI9A 3BAEH 2A0LC 1E9PA 2SEBA 1SOQA 1NCCH 2CWRA 1PZAA 3GXTA 3AXLB 1OLLA 3BKYL 5KG9B 3KS0J 3EYVA 2X88A 3KGSA 3TJHC 2XA8L 1JGDB 3LXAA 3MTRA 1PF3A 1U95B 4M56A 1JVKA 3ZL4L 5EUOA 2M2DA 2VDRH 3TV8A 2DJUA 1EWHA 1XIWC 3VXRD 4EBQL 2OZNA 3UTTE 1AO7D 1ID2A 3V2AR 2EO9A 4GRWB 2OMVB 1CYGA 4TRPH 1Q38A 3PDOB 4LIQH 4Z7NB 1DQJA 4XCYA 4KPHL 1HNYA 4UAOB 5AZ2H 1CFTB 2W9DL 2WUCH 4WFFD 1DBBH 4NM4L 3IMVA 4DKEL 4AZUA 3JWNH 4XGZB 3ULVC 2VN3A 3QBTB 4DPRA 1NTDA 3WTVA 3DMMA 3QZBA 4NCC1 1RVFL 5B8CB 2UXFA 4PR5A 3HFMH 4K8RD 5A7BA 1LP9E 3RVTC 4DGYL 1KTJA 5IVXF 2YUXA 2CCVA 2BH0A 5L8JB 3ZE1F 4U33A 1WPCA 2HRHA 2YKLH 3DOIA 2OP4L 3MLYL 4PFEA 3TZVA 5DWUL 2C9UA 3MGTA 3PJLA 3I6GA 3PPEA 4AH2A 3VD9A 1J1OH 3MO1A 1HQRA 3SDDC 7FABL 1U3HA 2KH2B 2A74B 2G4GA 4JG9A 1LNUB 2JJUA 4W9HC 2VR4A 4R97B 2WAQA 3FOLB 2AJ3A 25C8L 4P2AA 2H47C 4MS8D 3VAEA 3VXPA 3V0VB 5H94A 5F44A 2FLBT 5KYXB 1FAIL 3N6YA 2YAHA 3WTWA 1X9QA 1VESA 3T4AA 4F7CA 4XCNB 1SFDA 1RSYA 4QRRE 4JPIA 1M9SA 2ZNWA 1CGXA 3DTDA 1I82A 1LM8V 4ESKA 1KIUB 4KZCA 4W9CC 4XMKH 3O0LA 5GGTL 4KGJA 2J8UE 1A1MB 5BZDA 4P5TA 4GQZA 3RB7A 1S9YB 2YD3A 4OM1L 4IEFA 4M7KH 3MLVL 3BQUB 3E38A 1MFCH 2J1YA 3IKCA 2G2RB 2FQEA 2HJFA 1MIMH 2A74A 3F5WB 3K91A 2QKIB 5CBAA 1QLRA 5CILL 1NKGA 4S2SA 2FH8A 4UILH 2G0LA 1RKRA 3CVHH 3SKUD 4Q97A 3UTZA 3TV3L 1JZEA 4FXKB 3W2DH 3DJZA 4FL4B 2N7BA 1JZIA 1GTFA 2QLVB 2BSTA 1RZ7H 4S1DD 2YD0A 3QQ9D 3U48A 4XTRD 3NEXA 2B77A 4AGMA 3B9KA 3WFCH 3NCEB 3MAWA 1J9CT 3MRJB 1QATA 2VW6A 1H8SA 4QRPE 1FNGA 5D2LE 3ESNA 3WDHA 2NY0C 5DRXA 5E9DD 1H5BB 2G4EA 2ZUSA 3HC0A 1HJBC 1FORL 4Y16D 4LOUD 5FC9A 4L1HA 1PNDA 4PJ9D 3P0VL 1TF4A 1JWMB 3V9FA 2F5AL 4LHUG 2GAZB 2IGFH 2XJKA 4R26H 3SGJC 4EXKA 3DTXA 1YEDA 3C5JB 4NPJA 4QKTA 1MREH 3HRPA 1DQDH 3DC0A 2VRAA 2JKLA 2R2BB 2Z4TA 1NCTA 3QE5A 1VF5C 1Z3RA 3EBGA 4UIMA 4X98A 3ZLQC 3IFNL 4ZDHB 3MXVH 1CDGA 4DZBA 3BFOA 4BXVA 1E9PB 3U6XA 1IAMA 4L1DA 3HG3A 3B2MA 2O93L 1CBVH 3M07A 2AV7B 1ZVSA 3VXUB