2DMGA

Solution structure of the third c2 domain of kiaa1228 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
142
structure length
142
Chain Sequence
GSSGSSGSPLGQIQLTIRHSSQRNKLIVVVHACRNLIAFSEDGSDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSVSLPEVQRRTLDVAVKNSGGFLSKDKGLLGKVLVALASEELAKGWTQWYDLTEDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1228 protein
publication title Solution structure of the third C2 domain of KIAA1228 protein
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 13
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2dmgA00
4EZJA 1E90A 3GPEA 2RD0A 3L17A 4DK5A 3LJ3A 3F00A 4ICWA 4NS0A 3NZUA 3F05A 3R7QA 4FA6A 4IQHA 3W56A 2FJUB 4PS8A 2A5UA 4PS3A 2ENQA 3N5AA 1QASA 4PS7A 2CJTA 4F93B 2V4LA 2NCEA 2X38A 2N1TE 4FHJA 4KZCA 3RPBA 4WWOA 2YRBA 2WXFA 4ICXA 4Y1TA 3RDJA 5EDSA 2WXHA 1DJXA 1E8WA 2WXGA 4QJ3B 4EZKA 2D8KA 3HN8A 3L9BA 3FBKA 3L54A 3TL5A 4NPKA 3OAWA 5JHAA 3DPDA 2WXNA 1E8YA 3QK0A 2NQ3A 1UOWA 1W15A 4OVVA 2K4AA 5KJ7E 3PRZA 1CJYA 5H4ZA 4TV3A 3APCA 3IBEA 3QR0A 4WAFA 1RLWA 1QATA 2BWQA 4WWPA 1UOVA 4FHKA 2R83A 4Y1SA 3ZIMA 1DSYA 4GNKB 3APDA 3B7YA 4LT7A 2KI6A 2K8MA 2WXIA 3ZVVA 4FLHA 2CM6A 1DJYA 2CJSA 2CM5A 2UZPA 2WXPA 3P2BA 2ISDA 1E8ZA 3APFA 3MJWA 3S2AA 1WFMA 1DJZA 1DJGA 2CHWA 1WFJA 3FDWA 1UGKA 4FULA 4V11A 4DNLA 4IHBA 3L08A 3QR1A 3SD5A 3PREA 4F1SA 2WXLA 1V27A 4FADA 1E7VA 2WXMA 3TJPA 3W57A 4URKA 1BCIA 5JHBA 1GMIA 2QZQA 4TS6A 4JPSA 1RSYA 3HHMA 5G55A 2B3RA 1TJMA 1DQVA 3QJZA 3ENEA 4MJJA 3IM1A 2K45A 4L1BA 5T8IA 4A55A 1A25A 3L4CA 4ANUA 1W16A 3PFQA 2CHDA 3TWYA 4L2YA 4NP9A 2CHXA 3CSTA 4F92B 5H4YA 4AJWA 4FJZA 3KWTA 2YOAA 3ML8A 4LCVA 4HVBA 4GB9A 4J6IA 4QJ5B 3L13A 4ANVA 3QARA 3L16A 3PYCA 3R7RA 1TJXA 2ENPA 2WXKA 3F04A 4BGDA 2Q3XA 4WWNA 3T8MA 1BYNA 3ZW3A 1YRKA 1K5WA 1DJWA 2Q0ZX 4QAMB 4QJ4B 4OVUA 4XE0A 4LDCA 2Y3AA 2ZKMX 3KWUA 2NSQA 2WXJA 2Z0UA 4BFRA 3NZSA 3DBSA 4FJYA 4ANWA 2K3HA 4XZ4A 1RH8A 2QZ5A 2WXRA 3F01A 3NSJA 2LHAA 3HIZA 4L23A 5CCHE 3CSFA 3QAQA 4XX5A 2DMGA 1HE8A 2WXOA 3ML9A 4HLEA 4KITB 5CCGE 1BDYA 2CHZA 2A4ZA 4TUUA 4WEEA 2ENJA 5G2NA 4NPJA 2EP6A 2JQZA 3OHMB 2DMHA 4AOFA 4EZLA 3M7FB 4G11A 5CCJA 1DJHA 4KZ0A 1DJIA 3JZYA 2WXQA 4F91B 4ANXA 3PS6A 1E8XA 1E7UA 4L1LA 2FK9A
chains in the Genus database with same CATH superfamily
3HHSA 2AXGB 2H1PH 2F2HA 3BUTA 1PY9A 4MJIA 4EIZC 5DVLA 3ULVE 4PRAB 2LLNA 2Y7OA 3NZHL 3WHE0 4JFZL 5BS0D 4C59B 2C9XA 1YHPA 3WNLA 1YAIA 5ANHA 3I02A 3K6OA 3FQRA 2X9XA 4JO3H 3MPCA 5CLTA 1A21A 2ZOOA 4PJCB 2MMXA 4QHUA 3T2NL 2AI0L 2WP3T 1LO3L 3NPSB 4JQXC 5INCA 4HZAA 3VJ6A 3MUJA 5FDWB 3V0HA 4LAQL 3KG5A 3MLTB 5JOPE 1ZTXH 2CALA 4POZC 4JM2A 5D96B 1P5UB 2EE0A 3PL6B 4NPKA 4KKAD 2WXNA 4Q58C 3T0DA 5FO9B 4X8GA 3APCA 4AI7A 1XIWB 4P4RA 1JYVA 1L4IA 4MCYA 5E4OA 3C5SB 3APDA 1IARB 4WO4B 3PUUA 5AB9A 1CYXA 1SM3H 2E9IA 5J1AB 5DFVD 3PNRB 3WDHA 3LXCA 1WFNA 1WSST 2ICWB 4D0BA 3OB0K 5LJYH 2NY0C 3CLEH 1T20A 1IEAB 2J56A 3PF2A 4PHXA 2YRZA 5IBLD 4GI8A 4LPCA 4UNTA 3O0LA 3S34L 4YDNA 1PFCA 4JQIH 3TS8A 5C8JB 4JFTA 2HKFH 3MLRL 2EDOA 2OM5A 4P4KA 4JANA 3IMRA 2OMBA 4M5YH 4JZNB 5FW8A 5LAXB 3S97C 2DBJA 4MJJA 5T8IA 2NT0A 1JK9A 1M7DA 2JXMA 3UABA 4WEBL 3FZUD 3ROOA 3ZKNC 1X5HA 1JRHL 2CIKB 1E40A 4QTHB 5DHYA 1N12A 4OV5A 1ADQA 5KSAA 1RZ8B 1G7JB 1UEMA 3ULAB 1YEWA 3IE4A 4AENB 2MHAB 5HGBB 3F84A 2Z92B 4GMTH 1B4TA 3S7GA 2NY5H 3GSRA 2B4CL 1D9KA 2VAAA 2NX5E 2Z91A 3JV0A 4YHIA 4MD4A 4Q9RH 1Z5YD 2AVFA 3U6RA 3WLBA 2PR4L 3T8MA 1GGUA 4DZ8B 2RR3A 3MYJB 3QUGA 1Q9LB 5F9WB 4FZ8L 3KGUA 1MAJA 1SLUA 4GRWH 5FYKD 3QDMA 4UZGA 3HC3L 2FO4A 1MFAL 3DBXB 3WKMH 5CGYC 2HLAA 4Y16B 3B5HA 5DZPA 4JDEB 3O2VL 4X4YB 3NZ8B 4V1DE 5IB3B 3QUHA 1SPDA 3WEBA 2VLKE 5A2KH 2A1WH 4FNTA 2GSMB 3ZKMC 5DC4B 3VFOA 2J55A 3EFDH 4C55A 1CXFA 1G43A 5T1MB 3UYOD 5IJVB 4WY7H 3PGDA 1OTTD 1EGJL 1KCUL 1Q72H 3S8FB 4X4XB 3BJ91 4NT6A 3AU0A 3QRGL 3IFNH 5IVXB 4F37F 1DE4B 2FJUB 1UM6H 5HHNB 3QIUA 3WIIH 5BOPA 2J3SA 1JDAA 2OMVB 4BE6A 5GGSB 3RP1A 1JWSB 1IEBA 3DGCR 4H20L 2A7BA 3CVCA 4PWHA 3AY4A 4HK0B 2YEZB 1E5AA 4HSCX 3QVAA 4N0UE 4Q9CA 4XMPH 4F9LA 1NCBL 1J0YA 2OBGA 2VSDA 1MCWW 1E8YA 4JN1H 1GJIA 4KQ4H 1FH2A 4QOKB 3D25B 1B2YA 3GMPB 2FQEA 4GQ9L 4TSAL 3CZGA 4ZOBA 2H6PB 5DQDL 2QPUA 4AKPA 2H8PB 4KXBA 3B1TA 1FO0H 4AYBA 4I0PB 4ZDHB 1L7TL 1H6UA 2WXIA 4JKNA 3DURA 4M8RA 2WK2A 3LQZB 4FKHA 3BSZA 4HPOL 4M3KB 2K6WA 2OSLB 3QJFB 3ZKQD 3KJ4B 4KH9A 4YIQA 1JV5B 1DDHB 5ENWA 2JJSA 2F53A 1L9QA 5BZDB 2E7CA 2J71A 3MHZA 3TO4B 5T5NF 4HDIA 5DS2A 5LO7A 4BV1A 1MF2H 2CRYA 3MV7B 5FGBC 3EJQA 4HQQH 3K74B 1JL8A 3QCTL 3QRFM 4OI8A 2DI8A 3DNKA 3FT4A 4LEOA 4M4RA 4FQIH 5HYJA 2X2JA 1RFDL 5LWYL 2WVVA 4OCRH 4PBXA 5HI3C 2OW6A 3RVVC 3VFVB 4FXKB 3VWJA 5I6NA 5MEND 3U2SB 1J5OL 3IDIB 4R4ND 5E8EA 5G5DA 2ED9A 5D96C 1P5UC 3PL6C 2X1PA 2X28A 5LG6A 2QADB 1TJXA 3GI9L 4JJ5A 4QPEA 1R3LB 2N01B 3O0RL 3UPRB 4Z95H 3CH1A 4GKZB 1B3IA 1XIWC 2ZP0T 4UQIM 1ZV9A 1CXEA 5CLWA 2Y4SA 3KLHC 2X3CA 4MA8H 4WQOA 4BZ2L 4WO4C 3MGAA 2WQVA 1NCUA 5E1QA 5C0CA 5C0GB 4LCCA 3O3DB 5JW4R 4PG9A 2AANA 2G5BA 3LEYH 1A6PA 5C0BB 4LFHD 3FUHA 4GAGL 4NBXB 3X14B 3B7RL 4MMZA 2NY7H 5I1KL 3WN5A 2Y2YA 3KPRE 1FYTB 3MBED 1L7IH 3RURA 4ZPVA 2E46A 1A0QH 4QRPB 3ARYA 1A1MA 2HB0A 2ZUXA 1TZHA 1KC5L 1J1PL 4HEPA 2C9SA 3VFGH 2F7RA 3MJ7B 3S5YA 3WMPA 1TQWA 5EU7E 4YHMH 2VSMB 3K0WA 4L29A 4QI3A 3T6WA 3NVQA 5DMGC 1LO0H 4PRNA 4IGBB 2I07A 5I8EA 3VWKD 4X6CF 1R5VB 1A7NH 1RUMH 5F9WC 1H3TA 4YDIH 5EDSA 5AVZB 1T21A 2QPDB 4UM8A 2YAPA 4FP8L 5IKCA 1AQDA 1S6NA 1IZKA 4Y16C 5J6HA 4M62H 1SYVB 3LPOA 4OFYD 1SHXA 1KLGA 3TGXA 1GPOL 3U0PB 3C60B 3HBZA 3X1GA 1S7WA 2QTVA 1N5AA 2DLEA 4NO2B 1BEYL 5K1JA 5D1ZI 4L8CA 4RNRA 1SY6A 2AAAA 5ELIA 2MPAH 4JGMA 4HOWA 4K5NA 3CCHB 4JHAH 4NRZB 2QBWA 4U1MB 1YMHB 3MUY1 5E08L 2WGNB 3BKCH 5GS0H 3M8OH 1NH6A 5GGTH 4PV8A 3UTPD 5IJBC 2BSSA 2FT7A 1DQMH 3QDJD 2NNRA 5MEPB 4DKAA 2YGPA 5D7KE 3Q5TA 2R0LH 4JFDA 3MRGB 1HZLA 4CW1A 4X6DF 2DYPA 1S46A 1J10A 3QQ4B 4O2FA 4KNSA 4AV5A 1EA9C 3MLYL 4PJFA 1ZAGA 4Z7VE 4LHUD 2LT9A 5DFAA 4A7VA 5EO9B 1K9TA 1YAZA 1UXWA 3B2XA 4CAGA 1S9XB 3QJUB 3SQBA 5IG7B 3MFGB 4L4TE 3A6CL 2HTLD 5J5EA 2GG1A 4NRXA 1F11B 3EADA 3ZY7A 5F1NA 1EEZA 3HAEG 1RUAH 3V7AG 1R24A 3IB4A 3QG7L 4UTAH 1AZVA 3I75A 3IU4L 4AUJA 1FFRA 3UDWA 4XP6L 3AGVA 2Y5TA 4PJ9D 4M61A 4I0PC 4TUOA 4YBLB 1MREL 4PJCF 3EH4B 4A7GF 3DXAB 4PWEA 4XVUD 1HC1A 4TQEH 1ACYH 3KJ4C 1KUMA 5BZWA 4JRYE 3HG3A 3A24A 2EDLA 3FO1B 3FYEB 4N2NA 1KTJA 1DVTA 3QORA 4XC1L 3FUDA 1ZLSL 2AJUL 3FYIB 1G7IB 2G75B 3TO4C 1N2RB 2P8LB 4GXUN 2UVFA 6CGTA 4KNUA 5KYUA 4L4VE 4KZEL 1KBGL 3VD0A 4HLZH 4ANXA 3O3BB 4E41D 3APNA 3EOTH 4CC0A 3LJ3A 4GRWB 5E0QA 3F05A 2EYTA 3PQYA 2JNZA 1YEKL 2P44B 1OB0A 1SFHA 2YUVA 3Q6GH 4FEIA 4XH2B 5J9PB 1GW6A 1PTZA 1HHKA 4FXKC 4OQTA 5KVGE 3WAJA 4BSWA 2YK1H 4L9LA 1I3RB 1GS6X 5C08A 4LRNL 2QADC 4U6TA 4JFUA 3RPBA 5INDA 1UWXK 2MCMA 3ZYOA 3OBAA 3W9DB 4ZW5A 4QYOB 2HLFD 2WXGA 4AQ8C 3Q8FA 4M43L 1SJEB 2P8PA 3GHEH 5TDNB 1I8IB 3RWFA 1W8OA 5KJ7E 1CFVH 1X6NA 1RHHA 2WKOF 3H42L 5IROD 5H4ZA 1S7QA 4Z7OB 2VZUA 2O5YH 3ECWA 4YUEL 3L95B 3QIWD 4PTTA 2AS5M 1DO5A 4I4WA 1SYSB 1WBZA 5BV7L 1QTSA 1JNHB 1G94A 1MKFA 1QRNA 2PCXA 5IUSA 3LKRB 1IM3A 1T6VN 3OHXB 1T1ZB 3IKKA 2AEQH 4YSAA 1I7TB 1GSKA 1KTLB 3QR1A 5BW7A 3T0VA 2QSCL 3RNKA 1QBAA 4JO4L 1LDPL 3D4GA 3CU7A 2I24N 4M6ML 2ZXDA 5AZUA 3PDDA 4DAGH 4EO5A 2I60L 2A0LD 3OKLA 3QH3A 4FFVC 4K3JL 4L8DA 1WIPA 3QT2A 3VD4A 1EH9A 5FF6A 3O6FB 2VXVH 3C2SA 2VQ4A 4N4YB 1J9TA 1QEWB 1CC3A 2BHUA 4XBEH 3VRIA 2OZ4L 3S35H 1FO0B 4CJ1A 4NFBA 5KANI 1YO4A 1D5XA 2P3YA 4H1LH 1Y1DA 5F6HJ 2BFVH 3HE6B 2G5RA 4HLZG 5FUCC 5KJ4A 1RZFL 1NGQL 3PWPE 1ITCA 3SKMA 4RRPM 1GVIA 5IVXF 4BHUA 1CI5A 1LNUA 3WIFA 1NAKH 5TE4L 3QQXA 4IRJC 3B56A 4YSSA 1LWRA 4UV7H 4B9ZA 4RGNB 4D7PA 4ZFGL 1QWHA 1EFXD 5K5YA 3WNNA 4DETA 3OPUA 4HKZA 4K5PA 4DERA 4RWYH 3K5RA 3MACL 2EIJB 4HZLA 4Y19E 1CQKA 2WIMA 2EH7H 4ZFQA 4JE4B 3D48R 2WIIA 2ZSVB 2LOEA 1U8OB 3B7TA 4AIOA 2VDLH 1QSFB 2WBJD 4KXZH 4AYDC 1PEZA 2HRPL 3HB3D 4U6XA 3H9SE 5KVFH 5DHDA 4BQ9A 1QLFB 4RMSA 4ZD3H 3NH7H 1WD9A 2RJMA 4IRSB 2GBAA 2WXQA 5L7XH 4XAWL 1QLEH 3TBCA 1T5XB 4IHOB 1GAFL 1LHZA 1P7KB 2AAVA 5LCVA 4OGXH 3FO2A 1KJ3L 2KPNA 2OI9B 3FULA 2C7UB 2WINB 5FUZL 5SWSA 3EJPA 1ZA3A 3VDCA 1QFWL 2H0JA 2MCG1 2UY7A 3QFJA 4MNGE 4P2YA 3PG2A 3S48A 4PSPA 2ARJB 1HKLL 2UZIH 4KKCC 3SBQA 1DLFL 4OIBA 2OYMA 3KPSB 5MI0B 4DQOH 5F3HA 2BWIA 4Y4FA 3PV6B 4K2UH 2YZ8A 3AM8C 4GG8B 1BMZA 4Y1TA 4E0RB 4C4KO 1U2YA 2JLLA 2Z4QB 4I87A 5EU3A 2G9HA 1XMEB 4G7QB 1ZS2A 4J8RA 1DVFC 2XXMB 3GSUB 3LIZA 4GW5A 4NQSA 1OVZA 2YC1B 1BXUA 4RMQA 2GUYA 2O5XL 1F58L 2WWMD 2QELA 3VFMB 3MV8D 1R17A 1SMAA 2R4SH 1YSOA 3FDWA 3BYYA 4AV0A 3WTVA 4IHBA 4MAYB 3S96B 1MI5A 1N0LA 1EPFA 1PCXA 3BHBB 4FADA 2KDGA 2YXWA 3QNZB 2B1HL 3ARQA 2QZQA 4J4PD 3RIFK 1E6OL 5T33L 5EEXA 1UD3A 2WN2A 1JZIA 3LKSB 4J39A 1K3ZA 1A7OH 3OX8B 4GW4A 5CEZL 4F7KA 1AGCA 2W60B 3VRJB 1I8LA 2WQAA 3WXWH 3WIHA 3TWYA 3T3PE 1H5BA 3EDKA 3L81A 3FB5B 2GI7A 2AQNA 3L4ZA 2YPLB 4Y2OB 5FYKH 4H8WL 5D2LA 1AO7D 2NLJA 1BVLB 5IOPA 4W9ZA 4EZMA 3ESOA 4TNWK 4KDVA 3FCBA 1JHKL 2IWFA 2GUOB 1NPUA 3FT9A 4HPYH 1F4WL 2HH0L 4OCYH 3LV3B 3TVMD 4BH8A 4M8QA 3KXFE 1DJWA 2KC0A 3N42B 5I1JH 1ZSHA 3A67H 4ODHH 4JDTH 4OU3A 4BSJA 2P8MB 4NQDB 2OSXA 5SX4H 1NGYA 4ZMTA 1EO8L 3RZCD 1DL7H 2QZ5A 2Y7NA 5HGDA 1XWVA 3DHJA 3H2WA 5D7SH 4L18A 4YBQD 4R0LC 4WUUA 2OW7A 5MHSD 3TBVB 2CGRH 2DM7A 5CFHA 3IMTA 3RIFF 3NZHH 5B38A 4JFZH 1MDAA 4WI2A 3O6FC 4P46A 2DTML 1BEXA 2C9UA 4LNRB 4C83B 2G2NA 4L37B 2YKKA 3KVDD 4P04A 3F7YB 4Q9BA 3RY5A 4YSRA 2X89A 4PVBA 1BF8A 2F6AA 5HI5C 1M05A 1ZPUA 2PW2B 2WMPB 2AI0H 3HE6C 4QTFA 4ZW7A 3T2NH 1LO3H 5E23A 1H3PL 3KCPA 4LAQH 4KQ3L 1FE8L 1ETZA 2DIEA 4X8JA 3I3DA 1E43A 1E4WL 1QUNB 4TNWF 2JKXA 3TT3H 4UANA 2AV7A 2CDEA 1GZPB 1JGIA 5GGRB 2B7DT 3I6GA 4FABL 1ZEAL 4X6EA 3NN8B 2QEJA 5D5ME 3PWVA 5EC1B 1BQHA 3ORJA 2PCPB 1MHCA 3BWUC 4ZMXA 3D30A 1ES0A 3BXNA 1T6WA 1QTPA 4XMVA 4FG6C 2GTWB 4OF7A 5DLML 3QDGD 5DQJA 3WY4A 2ZAIA 2X4SB 1IVTA 2FUQA 5CJXA 3VI3B 3G5WA 5DJYA 1G7MA 1HXKA 4NZUH 3S34H 2WWKO 2XTJB 2CM6A 1DJYA 1SLVA 3FT3B 4GY4A 4D8PB 1KIQB 3CUPA 4O9HL 3MLRH 3STLA 4C56E 1LILA 2DJSA 2Q76B 3ARZA 1E28A 1XF4B 2FEDD 2CUHA 4NZ8A 5IVZA 3ZHNA 4WEBH 1JRHH 5B1BB 2OI9C 4NNXB 5AAPA 4KKLC 5AL0A 3RU8H 1WTLA 4PJDA 2XFGB 5E9DA 4ZOAA 4LGRB 4CN4A 4GRLD 2W88A 1FCGA 1UUSA 2B4CH 4LZKA 4CVWA 5CEZD 1JDDA 5MI0C 4H8VA 1HQRB 1SUHA 1HWHB 1A9BA 3BMWA 1D5BB 1XR9B 2PR4H 4JO1H 2L7EA 1GIGL 3LNHA 4UOJA 1UZGA 2VZVA 4G42B 4B7IA 3VXSA 3TONA 3RFZC 4FZ8H 5EZLB 1CTMA 5DA4A 5CZKA 1T1YA 4X7SL 2FJFB 3K72B 4ZMVA 3O4OC 4GRWF 1MFAH 4LOFA 4L0ZA 2CE6A 1HNFA 3O2VH 5JPNC 2AP2A 3AXIA 1PYWB 4KU1A 1ZV5A 1ADWA 5LHDA 1I9EA 4HKBB 4P2QA 4V2CB 1XR8A 5B7FA 3J8F7 5SV4A 3AWFA 1PNCA 4UMGA 4G70B 1FV1B 1TITA 2GJZA 2CO3A 1C5BH 1K5NB 3VA2C 3LKOB 4U3SA 5D93B 1EGJH 1KCUH 2F54A 1NBYA 4J23A 4K5MA 3BD4A 4H1LB 4X99B 4WUKL 3FQUA 4NZTL 3DUSA 1JVLA 1TO5A 1ZS8B 4EBQL 3QFDA 2I5YL 2DMKA 3P4OA 4FCAA 3Q2WA 1IM9B 1RK0A 2AK4B 5C1MB 3HFMH 4Z7OF 3ULUE 1G7LB 2HKHH 3PS6A 4MXVE 2OJ1A 3UTZA 1T2QL 4E42A 4FMKA 4F24A 2OR8A 4MJ6B 4QRUA 4YSDA 1CTNA 3SE4A 4H20H 2B5IC 4IKLA 5KBDA 2PW1A 1L3NA 2ZOLB 2MNWA 4N90D 5D7LE 3MRFA 5GS0C 3U7YL 4D0CB 5FA3A 1VZHA 5BRZA 1NCBH 3CHXA 4MD0A 2VDLB 3CFDB 4DFIA 1ACCA 1DQIA 5I71C 3VD3A 4MBRA 4TSAH 1U8MA 1XBDA 3DUHA 1TYEB 5JW4N 2R1XB 1NDGA 5DZ9A 2W38A 3SPJA 5BS0B 5DQDH 5I30L 1I9RL 3QULB 1L7TH 2I7OA 3GBNL 2D4FA 3UTTD 1QLEB 1DUZA 3Q8CA 1CT8A 2AXFB 2BVPA 2NQ3A 5AG9A 3QJQB 1S7SB 4RCAA 5LXVA 1HQ4B 1COBA 3AZUA 4LGSB 4JBSA 5D1ZA 1YQ2A 1CICC 4WU7B 3D69B 5LKNA 3P2TA 4HIHB 1KBBA 3MRIA 2N4IA 2JMRA 4XO5A 3GMOB 2Y07L 3PAUA 5DEGB 5L0QC 3I6KB 3N44B 4PGDB 3FC8A 1X7QB 4NO5B 2A9NH 2NW3A 1KEGL 4OSUL 4QNPE 3BWUF 3C6EA 1RFDH 2VH5L 4K7FA 4EI5A 1MCNA 2OTPA 2YSSA 5LWYH 1IC0A 1S9WA 4AE0A 4QWWC 2CWRA 2AXWA 2JB6B 3CC5A 1J5OH 2I9TA 5IM7A 2K45A 4LF3B 3U79A 4U1HA 3I3EA 3P4NB 1TPXB 3IGAA 2R2EB 3GI9H 3O0RH 2OMYA 3QRLA 5TJWK 3MCLL 2IBZY 1K85A 4FJZA 1NCCL 2GJJA 5A3IC 5H37H 2OMUB 2YOAA 2ZWSA 1P4UA 3MRRB 4GB9A 3EBIA 4HHGA 4I88A 5TDPA 2EUWA 1NTDA 3FQWA 3WTTA 1PIFA 3LNDA 4M4PA 4TRPL 4RDQG 1I9JL 1JE6A 2BWDA 1EIBA 1LO4L 4UUJA 5IBTL 1WA0X 4GAGH 4H8QA 4P9ML 4Z23A 2XTJC 4PLKD 3G5XA 2EE2A 4O02A 2ILLA 2P5EE 3P0VL 5EBWB 2LU5A 5AKRA 3PE9A 2QQNL 4NQEE 1KC5H 1Z3RA 2P49B 3LVEA 2VC2L 2BOCA 5D4IA 5F97E 4YSUA 1PZ3A 5HY9A 4ABQA 4PB9L 1M9WA 1AIZA 4I1NB 2OR7A 2LGNA 1U3HC 4XN8A 1YEJH 5AB2A 1REIA 3PNWA 2CO7B 2BVOA 1DLHB 2NDGA 5I6OA 3BUYA 1N59B 4NSKA 1K8IB 3PWLA 5F7EL 1KJ2A 4KUCF 4NQCD 4F3FB 4JGUA 2X6VA 4ZO7A 3IYLW 3H7BA 4FP8H 1YMME 2IH3A 1BLIA 1XAUA 2B59B 3ES6A 1FC1A 1BEYH 1R75A 3GMRA 4U31A 3BQUD 2IPTL 3DIDA 4EZKA 3B4NA 3RL1A 5DR5L 2P5WE 2BIPA 2DQCL 3U36B 4X8CA 3D0LB 3DHPA 1JTOA 2W91A 2AZUA 2DQ6A 2VZSA 3ZO0A 5E08H 1UVQB 2WQSA 1KCWA 5IV2B 1QVOA 2BZCA 2W9EL 4XP1L 4ZX5A 1TO4A 3ZRSA 4IMLB 3BZ4A 1X5MA 2CR0A 4NKDA 5SWZD 3QCVL 3M17A 3P3SA 4WNQA 3WNKA 1L0PA 3FB8B 4DNLA 1UCTA 3N42F 2GJ6D 3HZYB 3MLYH 2OYLA 1BHGA 2BERA 2JCCB 4HJJH 3V52L 5ETUA 3MRQB 1R9FA 4G6FD 3ZE0E 1BXVA 2QJDA 3US0A 1S78C 2BSDA 4PJIB 3T5WA 5AZEL 4N0CD 4X0KB 2ZAHA 1N6UA 1W72L 1RJZA 4LKXA 1GS8A 3QG7H 4A7SA 3IU4H 4XR8C 2A6JB 5E94A 1WS8A 4XP6H 3AQXA 3FUEA 1FPTL 1TQTA 3QXUA 1A4KA 2COQA 2ZG3A 1MREH 3D3VD 5J6SA 3P02A 1BX2A 5I66B 3BGMA 1NCIA 2Q3AA 2K0RA 3IJSB 2WSDA 3RTQA 1L0QA 3L4YA 5CIPB 4TNEA 4P23D 3SPVB 4Q97A 2F5AL 1NC4D 3AREB 4XC1H 3SBRA 3B2PA 3MLUL 1ZT7A 2XV3A 5PAZA 5ILTL 1U8LA 4R26L 4WK4B 3WKNA 4KZEH 3MRCB 1GZHC 4DESA 1IGTB 1KBGH 5GSVA 1RJYA 1PX8A 1OSZB 1XCTB 3DPBB 3Q1EA 3VI4B 4F8LA 3S4SB 4HZ1A 3NUKA 1YEKH 2YS4A 2DMHA 4PG2C 3CVIH 4TL5A 4W4OA 3RGBA 5EEVA 1F86A 3X2QB 1Z9PA 4TQPA 3SYAA 3VI3F 3JZYA 3JYCA 3M86A 2A9CA 4WSKA 4YFLI 3O6KL 4XP5L 4FGMA 3N6YA 3RWHA 4JVUA 4LRNH 1TPXC 3S5LA 2J2ZA 4XOAA 1OP3H 1OAZL 4OZHE 4JLRA 4Z7WA 4FA6A 4LL1A 4GKLA 1KCKA 2HVKB 1QO3A 3MBEB 4BBWA 2YLKA 4ALAL 3EO0B 1LD9A 1FFOA 1NWPA 2ZX6A 4P49A 3FZUC 4B0MM 1KNOA 4TOYL 2C26A 4HBCL 5F3FA 4EI6A 2DLTA 4MNQA 1MLBA 4YUEH 1EUUA 2WXHA 1WZ1L 3HNTL 4XPAL 2QQLL 1MH5A 1X6LA 1ZXKA 4FLSA 4I89A 3T4AA 5BV7H 2ITFA 1KPUB 1TETH 1ZLUK 3VWKB 4YFEA 3BIKB 3FO9A 3LDBB 4O2EA 4Z3FA 1T7XA 3MA7A 2OAAA 2W9LA 5AZ2H 2QSCH 3IAQA 1UD5A 1LDPH 4JO4H 3EW3B 3I84A 4YDVB 3DX8B 3W0WE 4AW4A 2E4FA 4M6MH 2X0VA 2RB8A 2BOLA 1OE2A 2BRRL 4WWKD 1AG0A 1FA4A 4MZIA 2IVFC 4YHLL 4F1SA 3EJUA 1UXLA 3I02B 2HX8A 2PCFA 4OI9A 3EOBA 4IKJA 4F58H 5C09E 2OZ4H 3BO8B 3MLPA 5DK0A 1GJUA 2GI0A 2WZPA 1OLLA 3MRDB 1VAHA 4XCFL 1LM8V 3ALPA 1RZFH 1KGCD 3OZ9L 3FB6B 1VERA 1A64A 4DCQA 4GG6E 3QDJB 3WU1A 3VJ6B 1CGTA 4AYEC 3BN9D 4KK5C 4YHNB 3DDFA 5TE4H 4NP9A 3MRKB 3KM2A 4ZO6A 4IBUA 15C8L 3MREA 4BK5C 4ZFGH 4BRJA 1MFVA 1QFWM 4P4RB 4ADGA 4BA8A 1W80A 3LZPA 4LHUB 2N59A 3L13A 4MYPA 4OFVA 3MACH 5F9JB 4IDJL 1NCDL 3IXAB 4IS6A 3GUTA 4MHHI 2PYFA 5I0DA 1FJ1A 3LPFA 3WFBL 3K2UL 1QW9A 4HEPG 2HRPH 4NQVA 1WO2A 4MCZA 1CBVL 4CU8A 3HC0B 5E6SB 4JRXE 5FIEA 3DUUA 4JDVB 4K94L 4PJ9B 2RHEA 1GAFH 2YWYA 3EZJB 1KJ3H 2PETA 4LSRH 5FUZH 1JNLL 1U3NA 4D9LL 2V33A 1QFWH 3H2PA 4LOUD 3VXTA 1E3ZA 3FAXA 2EVIA 4TYUA 4JZJA 3HI5H 1F00I 5GZOD 2EABA 1HKLH 2RMNA 3DGDA 1GOHA 2VL4A 1J8SA 1NJ9A 2CRZA 1DLFH 1IC1A 2D7NA 2YAHA 4OIFA 4DEWA 2RAMA 1BFSA 1MNUL 5FW6A 4G6KL 2Z91B 4OCNC 5DUBB 1TEFA 3N44F 2HX9A 2PO6D 3AG4B 1P4IH 4U1LB 3US9A 3RDTB 4KOBA 3X1FA 1L6XA 1B4RA 4QT5A 1PZ5B 1S7XA 1ZLVH 2J73A 1G6RH 4HSAC 5CN2A 3OC8A 2H3NA 1AACA 5E7BA 2XZAH 3OQRA 1ET7A 4R4NC 5GGUA 2E86A 4OT1L 3AREC 1JYXA 4EKJA 1JPFA 1F58H 5JHAA 1VDGA 1UCBL 2OLDA 3VFOB 2F15A 3KZ8A 2N7BA 3RB5A 2QGCA 1LGVA 4Q7DA 1KPRA 3SBWC 5KS9E 1AY1L 1QW8A 4IOSA 4AK1A 3BW9B 4UM9A 2CK0L 1E6OH 2W0FA 4FE9A 2CNZA 4DWHA 5GRVK 2N56A 4F8PA 2JSFA 5ALBL 4F5CA 2XXGA 3S2AA 5CM1A 3ZE1E 1KENL 3FCTB 1NZRA 2J1XA 2R23A 5CEZH 4MQ7A 1R4XA 1RVFL 25C8L 5DMIL 1KGWA 3VD1A 1JTTA 3PPEA 4YZFF 3ARDA 2WQ8A 4XCYB 4EDXA 2C9VA 3V6OA 4PP2A 3W2DH 3C2AL 1M53A 3LXUX 3ZKXB 4H8WH 3KYNA 1TJMA 4HS6B 2PLTA 3FKUS 2Z31D 3DVNA 5JYMA 3KGTA 5C0AE 3UYPB 5E1AB 4WW1B 1G1CA 3JWDL 4OF5A 5JIQA 1JHKH 1LK2B 3KVPA 2VJ8A 1PJ9A 1QSEE 3P3TA 1F4WH 2HH0H 4G71B 5DD1H 2AQ2A 1U93B 4OH2A 2FSEB 2KQMA 4L3CB 2XC8A 5DJ0B 2WO3B 1EO8H 1XB8A 1FVEB 3O8XD 1UB5B 1WVZA 1QFHA 4OUUB 4HMCA 1KXTB 4XNAA 2G60L 5FW7A 1KULA 2R2HA 4MX7A 1FVCB 3CDGB 3QUMH 1CD8A 1JCVA 4E68A 2OMWB 5ENWB 2F53B 5FOJA 1AS8A 1CBJA 2V9TA 1PJWA 4G8GE 3N1GC 1RSFA 1UH4A 2EO7A 2DTMH 1CDHA 5LUMA 2XT1B 2A4ZA 2OL3L 2VRKA 4ZYKA 3FT4B 5MENA 4M4RB 3MODL 1SEBA 2HFGL 1H3PH 1HHJA 1OAQL 2FE0A 4BFKA 2F74A 2X4RA 3DOSB 4KQ0A 2WBJB 5E8EB 5G5DB 3BPCA 5FM5O 3OKMA 2IALA 1QD0A 3QXTA 4EF3A 2V2TB 1TJHL 12E8H 2CXGA 2NY3D 1YCSA 3TYFA 4JJ5B 4DO5A 1X5AA 1ZEAH 2ERJB 5KOMC 2D31A 2JCCF 3V7MA 4LSVL 2BP5M 1EXGA 1EV2E 2AEOA 2IOMA 3UO1L 4KRMB 3JV4B 1VFOA 1Q0EA 4PJIF 2BM3A 3CVDA 2BPBA 1NDMB 2FIRT 4PG9B 3OJDB 2G5BB 4OGQC 5L2KD 1S9VA 1QKZH 1HXYA 4U2YA 2ZWKA 5F9OL 4MMZB 3NG5A 1AR1B 2YD9A 5HHOA 4G9FD 4D2NA 1PL3A 1J12A 1W6LA 5DRNB 3H8NA 3T2QA 4CMMB 1CFBA 2OCJA 1CFQA 2BX5A 5IBUG 3TEWA 3U4AA 1E8ZA 2IH9A 2XDHA 3WTUA 3L2LA 4JHBA 4RISL 4HH9A 4LCWA 4YXKL 5JQHC 4MCNA 3TT1L 2APBA 4O4YL 4ZMLA 4QHMA 2WLLA 2IDSA 1IC4L 3TF4A 4Y5VB 2NUTB 2DWYA 1L9NA 2ZD0A 1PZSA 1GIGH 5E8PA 1SUJA 3MV8B 3BAKA 3BSGA 4I9WD 5I8EB 4ETQA 3D0VA 1DQVA 2YJLA 3G5YB 2F7PA 1T7VA 4KX7A 4TKWA 5TK2A 5L4IA 2AABL 1YYCA 4X7SH 3RDTC 3VI4F 3SY0A 4AYFA 4JKPL 1VHPA 3HNSL 4NJ9L 1A6AB 3PHAA 5DJZA 1NSNL 2BIMA 4H8PA 3IAPA 2X6UA 4HUUB 1R5WA 4XMUA 3LN9A 5I16A 2DN7A 4B0MB 1TZGH 4HWBA 4HVBA 5D2NA 5FEBA 3H9HB 4F8NA 5I24A 3MLZL 2R56H 2B77A 4KK8C 1BVNP 3D52A 1DANU 1AO7B 4WUKH 5E6RB 3BZFA 4EBQH 4KJWC 2Y3AA 5TK4A 1ZV2A 4N8UA 4XRCA 4PWJA 4FJYA 5IROC 4XZ4A 2I32A 1SFDA 3QEQE 1VFUA 3UJJL 2MKLC 1MWAL 2E9WA 2PWEA 3EFFA 3QWRA 4GFTB 5EIVA 3TVMB 1EAPA 5CCGE 1T2QH 4I3SL 4JFYA 2VXUL 2APTA 2EICA 3GBML 4PJFB 4FLRA 3LB6C 4LP4A 5D70L 3QAZC 2R51A 5G4OA 3ZKXC 5DEJA 2VR3A 2J8UA 4Y9FA 4LCYB 3AY4C 2A77H 1CUOA 3CSYB 4NDMB 4RDQF 4Z78A 43C9B 2KQNA 2E5EA 4ZNCD 3FOMB 2N0MA 4ZQKB 4AIZB 2BNRA 2UX7A 1R24B 2A0LC 2BINA 4RGMB 4AQAB 3IETB 1X7SA 5I30H 1W0WA 4XMTA 3I75B 3KNBA 1I75A 3ESUF 1I9RH 3LOWA 4BZ2A 3GBEA 4A7TA 3KLKA 4P9HC 1YN6B 3GBNH 1KB5L 4WENB 3BAEL 1BPVA 4U6YA 4DK3A 5CS7A 1JV2B 2QTEA 5KBPA 1Z9NA 2Z34A 2XV6B 3WE6B 1S9KC 3GZQA 4PJ7E 5EOCH 1TQCC 1W15A 2JJSC 3ZT6A 1XF3B 2Y07H 2R69A 4X4MA 5E2VH 1E3XA 2NYKA 3BLBA 4GS7B 3BD5A 1G9HA 2DOCA 4EIGB 1KEGH 3RWEA 3W38A 4OSUH 4AWJC 1SJXA 3RA7H 2IGTA 5IIEB 1C5CL 5DUML 2IH1B 1G7QA 3CDYA 4PMFA 3F5WB 1QBLL 3NJVA 4LLUB 3V0VA 4R8WL 3QDGB 1ZHNB 1VIWA 3N04A 1G6RB 3V8CA 3FT0A 2V7HA 3F6JA 1AYRA 3VXRA 3GGWA 4FI6A 3QNYA 4A38A 4L9LB 5JDJA 4GQRA 3OMIB 4HJ0D 5HHQA 3B2DC 4YZWA 5F1SA 3OPZL 2F7OA 3V0WL 2ERJC 1NCCH 3K0YA 3RE0A 1B4JL 4OZGB 4WI3A 3M7OA 1MCIA 2OMZB 2ZCHL 4JFXA 4PJGE 1ZDSA 4G8IA 4TRPH 1INEL 3THML 1LEIA 3KEDA 4LCCC 1I9JH 4S11A 3E3QC 1LO4H 5IBTH 1RHHB 1IL1B 2V5YA 4P9MH 5DO2D 5IQ7H 4KY2A 2P47B 4H25A 1F3RB 4JCWA 4FQPA 4MMZC 3SDAA 1AR1C 5B38G 3G04A 4DKFH 3WN5C 5CO1A 3GM0A 4G1EB 4WHCA 3T8VA 5AKSA 3P0VH 5C70A 1NCGA 5I28A 4ELKA 1IM3B 3EJJX 4KPHL 1UWGL 1TMQA 3RVUC 1P4LB 2E56A 2QQNH 5IK3B 1BF2A 4JM0A 2VC2H 5D4HA 4PJ5E 3Q0HA 4PB9H 5I8KL 1ZTMA 2XN9E 3OZLA 1I3UA 4HJIA 1J11A 2R0ZH 4L8DB 4NRYB 4AJ0A 3FQ2A 4GJTB 5ADPL 4NQXA 1R0AL 4Y5VC 1BQ5A 1ZA6A 3L4UA 3VG9C 3VUAA 4LQFL 5T1KD 3REVB 1T5KA 3GJFH 1E9QA 5IBUB 1BQHG 1GHFL 3DO7A 2QHRL 3SKMB 2CGYA 4PW3A 3TJHD 3T1WA 3IGKA 4N8VA 4ELME 5HYSA 4EN2A 2K70A 3TIEB 3RGVD 5EZOL 1S8DB 3MLSL 5IHUL 3N1PC 2FBRA 2WLMA 3QUMB 2W5PA 2NZ9D 4O2CB 2CJTA 2CDFB 5DR5H 2DQCH 3JWNH 3SO3B 5CR1A 2IIJA 1H0DB 5DC2A 1J0JA 1F41A 2LFGA 4W9FC 1YNKL 4ZUSB 3ZU8A 2NY4D 1MEXL 4AQZA 1H9VA 5EWIH 2W9EH 4XP1H 4Z7NE 1HJBC 4M9PA 1ESOA 1WT5A 3QCVH 3WFCL 4DGWC 2NY1D 2AW2A 5E6YA 4DQAA 1J1XL 3I9PA 4PCSA 5IQLA 2B2XL 3V4VA 4ACTA 3PV7A 5KN5A 2ZUSA 3HTLX 3OKKB 5EBLA 1P1VA 4G6ML 2FEEL 3BQVA 5LBVA 3DLQR 3V52H 3MFFA 3WY2A 4P2RE 2DLHA 2AQ3A 1HDMA 3H1ZA 4EI0A 2GK0B 1WFMA 5AZEH 3B5TA 4FS0A 2HG5A 3BCFA 1PY0A 3FRPG 4YBQC 1W72H 4ZJ9A 1OP3K 1QFPA 2BSCA 3ZHFA 3Q8AA 5K59F 4KK9D 4RGMC 2PPDA 4GSQA 3HHMA 4PRHB 2UXFA 4ODUB 5EO1A 4ZMNA 3UDWC 5HHXL 4BFBD 2AJZB 3VSTA 1CIDA 2GKIA 2NX5A 1NLDL 2G9HB 4JGJA 3V6BR 1RZIA 2V2WB 3BVTA 5CXPA 1NL0L 3IJEB 3ECVA 2H26B 3OVUB 1A2YB 5DQ9A 2F5AH 4NQSB 3AQDA 4MCMA 4OGAD 3MLUH 3KWVA 1LEGA 3QARA 5ILTH 4R26H 1MLCA 5E2TL 1BOGB 4HD9A 4J28A 1C1EL 1URZA 1P7QD 3ZE2B 1GGIL 1XF5A 4PLJD 3OM3B 3VFWB 2OQJA 4HEMA 2VUOA 4M6NL 1ZLWH 1N0LB 2BSTA 4F2EA 2J5LB 5I17A 1OCRB 1KLFA 1RIUL 2LVEA 4GUCA 1FG9C 3C87A 4GAFB 4U6HA 4GKNA 3O6KH 1JUFB 3G6AB 4XP5H 2K7PA 2OMXA 5H94A 4M00A 4L9LC 1Q9OA 2DBLL 2FIKB 4LVOB 1AGCB 4BE5A 6TAAA 4MMXB 2JB5L 3L7FA 4W4NA 4IIZA 1CDCA 4UQ2B 4M8VA 1VCAA 2PN5A 3F62A 4ALAH 5JR1L 4FEMA 5CWSA 4YOKA 3UFIA 2NLJB 1FSKB 3KLAB 2VDNL 4TF4A 1HILB 1ERNA 1IQDB 2X6BA 1WHPA 4TOYH 2FHFA 4YXLL 4HBCH 3DMMD 3MUUA 2BP0A 4N0UA 1WZ1H 2JK5A 4FXTA 5IF0B 5CF3A 4XPAH 4NIKB 5LN4A 2EAEA 2VQUA 4M8QB 2AJYL 4OFKA 2OMNA 3IMUA 4M7LL 3ULVL 4YHOL 3H0TB 1WF5A 1S7TA 2R27A 1NGYB 1BQLH 4BINA 1TYJA 5IMOB 1JYNA 2E7LA 3SKNA 4F7PA 4NQCB 3ZN6A 4MDIA 4Z7UA 5AFAA 5BW7C 1OAJA 3D39D 3FBKA 1BFVL 3QDAA 2BRRH 1U2CA 3HCVB 4LEXL 4MDJA 4ENED 4S0HA 2A4CA 2PABA 1E42A 5HVGB 5D1QA 1OY3B 3BQUB 3IJ7A 5HHMD 5I18L 3KL0A 1W6WA 2CM5A 2QFRA 5C2UB 2ZYSA 2ALAA 3TNMA 1N19A 3FU7A 3FQNB 2DM2A 5DJ2B 4XCFH 5CAYB 3HW7A 4FFZL 3DA0A 2Z6FA 5SWZB 3S3SA 5JHBA 4X9GA 3DSFL 5FC9A 3UBFA 1MXDA 4PJFF 3SO3C 2UZYA 3MR9B 2XKUA 3PWVB 3NJKA 4IDJH 1NCDH 1THAA 4QHLA 3T4YB 2XIBA 1KGJA 1FFQA 4LSPL 3HLAA 1ZLVK 2BIIA 2EVJA 5E5UB 3LSOA 3SBPA 2QFPA 1F4XL 5DQJB 5FGCE 1AGBB 4ZFOL 3QXDA 5DU7A 5MP6H 1MCCA 2ROXA 3VFSB 4N26A 5CZRA 1BZEA 5DJYB 1CBVH 4KRPD 3KGRA 5MERA 3MRNA 4FCHA 1MHHB 4XMLL 1D5ZA 4RQQA 3IAGC 4K94H 3I9AA 1F6AB 1D6VL 3KPRA 5T1LA 2Y7SA 1JNLH 4D9LH 3BKYL 4NOBA 1OKEA 5CR8A 3HBQA 2P45B 2WNKA 1QQDB 3Q5OA 2VXTL 3CSFA 4ZZKA 6PCYA 4P23B 3N1MC 4U6VL 1HL4A 1U6AH 4N2AA 5JDSB 1NC4B 1XMWA 1G9EA 4TUJA 4M1DL 1MNUH 3SDXE 1KACB 4G6KH 4MA1B 4ODSH 1FAKT 4Y4FC 1HOEA 3T2OA 5I0XA 3GTVA 1FNLA 4JG0L 5CJ5A 1WBXA 2ZPKL 3BVNB 5EOQL 3QYNA 4GP5B 4HXAL 3FRPB 4V2BA 1KIUB 3WENA 4F8OA 1FGVH 2VC2B 2VLJE 3L1FA 3NA9L 3DOIA 1WWWX 1NCTA 2H41A 1DQDH 3HG5A 5HTSA 4OT1H 2XPYA 4JO8A 1MJ7L 1UCBH 2DYSB 1MCHA 5ICXB 3TWCL 1WEJL 3ULVD 3M1OA 3UMNA 4FTDA 5TD4A 1F0LA 3WFHA 2XQBL 4OZGF 5E00B 1OALA 4I18B 1AY1H 1CQYA 4Y89A 4U3SB 5MEOB 3HPLB 1SRDA 3P9MB 3GJFB 4H5SB 3DUSB 4LSTL 2J5LC 2CK0H 3L54A 5B4MD 4PY8J 3CN1A 3TXAA 5HVHB 2YLHA 4AQOA 1IGYB 1YN7B 3QG6B 4MVBC 3SGEH 3P4OB 1KENH 1UGNA 2EDMA 5CUSL 3ZMEA 2G4EA 2EDJA 5B7EA 25C8H 2VN6A 4FHKA 1FNAA 1Q90A 5D1XE 5JOPD 4LVOC 5AL8A 4MMXC 2VLLA 4E42B 2E9GA 1I8LC 1OWWA 2FX7L 5ACMA 4QRUB 2ZCKL 5F7FA 3UCQA 1O6SB 2IG2H 1TXKA 1JGLL 4ZSOB 3O9WD 1TZOA 3TYGL 4Z7VA 3NP4A 4G72B 4JL1A 4X5WB 1V27A 3MRFB 1MCOL 1VSCA 4MD5B 4LK4A 5LVEA 1NEUA 4TMPA 4NC1C 3RWDB 1G1OA 4K8RL 5BRZB 3JWDH 4Y4KA 4DP9X 1KLUA 4L4TA 5I1LA 4W9LC 5CEYB 3AWEA 3ULSB 3TPUA 1IVLA 5F70A 3X1NA 4A6YL 1OQXA 3VG0L 4G7VH 1WAEA 1B9ZA 4OKVA 3HS0A 1NFDA 2BVPB 1JK8A 4HWZB 3SCMD 5E1HB 5EPMA 3JT0A 3SYCA 1JZEA 2G60H 3ZHKA 1MW1A 4HGKC 4Z77B 5HI4D 4BH7A 4Y88A 3A47A 3F7QA 5JHMA 5E6ZA 1W72B 2QQQA 2ENPA 3QUZD 4GAYB 5KJRL 4NNYB 3IF1B 3N41B 1NMBL 1YDPA 2MKWA 3N85L 3MGOA 4R7LA 1T0NA 4X9BA 2VJXA 3S5LG 4C4BA 3H6AA 2NW3B 2CUIA 2XWTB 2OL3H 4JFEA 2A74A 2ZIDA 4KJYA 5D4QA 4B9PA 3N1QC 4DEUA 4Z3HA 2JFCA 4EI5B 2YSSB 2HFGH 3BVWA 5IZ7A 3PXLA 1OAQH 1S9WB 2HTKD 5F7BA 1M7IA 1GOGA 1PZDA 1F4HA 3CHOA 3T3ME 3DTXA 2YSTA 1BDYA 3D2UD 3ARBD 1AG6A 4B60A 3TA3D 1TJHH 3IGAB 4JY4A 4PV9B 4V1DD 2BZ7A 4K3EL 2TRHA 2Q8AL 1AIFA 1KB3A 4YVUA 2VLKD 2XWXA 4LSVH 3UO1H 4JFQB 4WU5A 4XBGA 2HX7A 1F97A 3FQWB 3H9YA 3RI5K 5D71L 3G6DL 1G9NL 2JELL 5FFLA 4WTZG 1E2WA 1DYZA 3QPQC 5CJXC 5JIHA 1XH3A 4PLOB 3X12B 2J5WA 5F9OH 3AG2B 5JW4Q 2AQSA 1DQKA 5F1IB 3AU1B 3ZGIA 4R7DA 1K2DB 4S0SD 4B9FA 2PO6B 3DK2A 1FL3B 4HOZA 3KBHE 3G7TA 3EGSA 4R7VA 1FFNA 1VFAB 3VGBA 3NA4A 3BESR 2BW4A 4J3SA 3UZQA 4CADA 5T3ZE 1T7YA 4LSUL 4RISH 5DYOB 4YXKH 3V4PL 4QIRA 4JPVL 2ZX5A 2E8ZA 4P23C 3TT1H 3NJIA 4HJGB 3DRQA 1EBAA 3V9FA 1IC4H 2BO0A 2YQ2A 2BVOB 5GISL 4F7CA 4Q56A 3ZE2F 2Y3NA 1DJGA 3BUYB 3DYOA 1M7XA 3PWLB 2AABH 1J0ZA 4R97B 4JKPH 3C6LA 4OM1H 1CE6A 3ATBA 2GFBA 1IGCL 2NZ1A 5E4EB 1AC0A 4ATTA 4K8RD 2EIBA 3PFUA 2ENSA 3JYBA 3RI5F 3WKPA 4F1ZA 1NBQA 2XNAB 1NIBA 4OIIL 1FN4A 5A43C 2R1YB 2VE6B 3BKJL 3OG6B 3RL1B 2X88A 1IQWL 2CHDA 3MLZH 4WI9A 1DR9A 2WC7A 1S7VB 5B8CA 1C12B 4Y8DC 1NBVH 4Q0XH 3CFBA 4I18C 1BFTA 1CGVA 3O81A 3QDME 4ZS6C 2VABA 3MJGX 2CMRL 5T3XH 4IIQB 1NC2A 3W37A 4HKJB 2VR7A 3RFZB 3J07A 3HI1A 4WNQB 3UJJH 4P5MA 3KL3A 2BP8B 5DD5L 4C47A 1BIIA 4EN3A 2UWEB 4OLYL 5D6DA 4X6BA 2FUTA 3GBMH 1J8HE 3H9SA 4FNQA 1THCA 4PGBA 5DRWA 2PP9A 5D70H 3B8YA 3SE4C 1E4XL 3NCBB 3NZSA 1J87A 4ANWA 1QWUA 3TBSA 3E9UA 2DI9A 4AM0B 4KNQA 3DX7A 4N5EC 3ISYA 1KZQA 4FI7A 1BSIA 1BZ7A 4PRIE 1UKTA 2KS0A 4D0DA 5BVJB 4J5VA 1JDCA 3UC2A 4ZNEE 1KJVB 5IJDC 3NESA 3EYQD 4MNGA 1MQ8A 1UA6H 4AT6B 3VQMA 5A6LA 5EEUA 4HIEA 5E94B 4NGHH 5DJ8A 5BJTA 1KB5H 3BAEH 2CIIB 4ICWA 3BH8B 4XVSH 4F2MB 1HYSC 2DQIL 5JW3L 1WFIA 3MNZA 4N2GA 3BGMB 5AAWA 1DBAL 3IU3A 3GDCA 1J9RA 5D1ZC 5IY5B 1KIRA 1HZKA 4G80A 4JAMB 4LPUA 4BCYA 3ZTCC 4IK7A 3PDOB 5KG9A 2NY3B 4EUPA 1U8LB 2EEXA 2YXVA 4B6ZA 1HNGA 4B97A 4WHTA 4WTQA 3FRUB 2R2BB 1ZHLA 3NCYS 5AOZA 1C5CH 3PLYA 5KBKA 5DUMH 1C08A 4CNIA 4EI5C 4NZJA 2EECA 1QBLH 2ATKA 2F1AA 2UUDH 1LJMA 4R8WH 1U36A 3GXUB 3BRFA 3KLDA 2Y0SA 5L2KB 1QATA 3SGKA 4OZ4B 3LQAH 3VXMA 1RZQA 3X17A 2XKNB 3RWHB 1LXMA 1M56B 2EC9T 4Y5YA 3OPZH 2G2PA 1EEYB 3V0WH 1XXFC 3DO4A 5BUPA 3NSXA 4G9FB 3MV9D 2YA2A 4M48L 3QHFL 4EIBA 3GJFK 5I0VA 3BP6B 1B4JH 4EXPX 3TJEL 1B0WA 2ADFL 4ZAKA 2EEAA 2GC4C 3W11C 5HYJE 1GTFA 1LD9B 3ZX1A 1FFOB 4C57C 4B9JA 2AKRA 3MJ8A 3D87B 4XHJC 1INEH 5F7DA 1YYML 4KY1H 4FQLL 4QF1B 3U4EA 4YSEA 1KCSL 4OD2A 4EI6B 2ATPB 1NPJA 4KO9A 1SHWA 4RFOL 4FQ1L 1RUQL 2JE8A 4X6CE 2EINB 4RBPH 3TCLB 3I50L 4XNMA 4C58B 1KMGA 2FR4A 4BXSV 4ORGB 1OL0A 4ZUUA 4KPHH 3RZWA 1UWGH 4MQXC 1NIFA 5LBSA 4O2EB 2VLRD 1OGSA 5C0CE 3ZXAC 1EK3A 4Y9CA 2OJZL 3R1GL 3RNQB 1BYNA 3WS3A 5CBEA 1H15A 3CG8A 3QZBA 5GGSY 4FQXD 4ERSH 3FMGL 2XXCB 5J56B 1KOAA 2NNFA 5ADPH 1R0AH 5IVOA 1AD0A 5GS1A 4LQFH 5HHPA 3WD5L 4WI6A 2H1LM 5E2UL 1NOLA 1HEZB 3EYVA 2WTOA 3LHAA 1GHFH 3ARFD 4P48A 2QHRH 3MJ9H 4R97C 2JI1A 4OB5L 4PWKA 5KYXA 2OP4L 3D09A 4ODXA 4QHNB 5E4EC 2CO1A 3A3YB 3DX3A 3MLSH 2NTFA 2XIIA 3E9TA 5JHDA 5KSUB 4Y2DD 2YPVA 3BP5A 4BZYA 3D18B 4Y5XB 3MREB 3RPIA 3V6FB 2JKJA 4JVWA 4MYWB 2F8OA 3ARXA 1R1CA 3H7LA 2OL3B 1KB9J 2HLEB 4NB7A 1YNKH 5TQ0L 3GUTB 3SOBL 1MEXH 2PYFB 5D5MA 2PTUA 3LVTA 2ZWZA 2Y24A 4IIQC 4IW4C 3L5WB 1E4JA 3ZTDC 2X1XR 1J1XH 3GMNA 3ZDYB 3WELA 2B2XH 4MCZB 4RZCA 1G4MA 4RZKA 3TCXA 4YDKL 4PJCE 5I5JA 3X3FL 4G6MH 5I73B 1BBJA 4UQCA 1ZLWK 1KBVA 3QO0A 3EUUA 4PREA 1JGDB 1OGAD 3SDDD 1XGTA 1FLRL 5EZJB 4I8DA 5GZOA 1FFPB 2CLRA 2FEJA 3TH2T 2BY3A 1N68A 4R9HA 3QXAA 2MH4A 5CJQL 4JZJB 3AB0B 1I1AA 2VKXA 3GKWL 1DBKH 4GKSB 2HRHA 1NJ9B 3N41F 3VH8B 2XWZA 3IGFA 1MJJA 1R3KA 4KI1A 2QHLA 3UJIH 1HH6A 1ANUA 1MJ8L 1USQA 2YD8A 3DX1A 3ZR5A 2K6ZA 3ILEA 3ROLB 1INQA 4ZMPA 1NLDH 2CH8A 3MXVL 3IXTB 1KIPA 3O2DL 4ZMWA 1NL0H 4QT5B 3D9AL 3OJVC 1MHPL 1EXUA 4TVPE 5E56A 1F56A 3RTQC 4FXGA 2YD5A 1F45A 3I74A 1H6EA 2E47A 2XWDA 2F0CA 3FF7A 4HHAB 2OTUB 5E2TH 3GJEB 2IV8A 2NY3C 3TOPA 1ZWIB 3W9EB 2IADA 1BA9A 3UTQB 2XG4A 5HDOA 5DYFA 3A4AA 1UACH 3WLWD 4ONGL 1I85A 1OOWA 1ZJAA 1OOAA 2HKAA 3SKOA 1A6TB 1A6WL 1RIUH 5BPPA 5I8OL 2W0FB 1D2PA 3RWJB 1MUJA 3L1EA 4Z5RB 1WWAX 3IRCA 2GSGB 3V4UL 4K7PY 1I7UA 3C9NA 2R23B 1RXLA 4MQ7B 1TKWA 4A39A 2JB5H 3WUWB 5K69A 3S3BB 5DF0A 1QA9B 1AHWA 5JR1H 1IGIL 3RBGA 4NHUB 1KY6A 3FN9A 3GHBL 3DX4A 1IJ9A 1M6OB 2MQ0A 4ZFZA 1LMIA 3PQYE 4YXLH 2IJ0C 4WI7A 4QRRA 1SVZA 5F96L 3QI9D 4Y19D 4AOFA 4A67A 3JTTB 5SWQA 5C08E 1VGKA 4OLVL 2OZNA 4NP4L 2WY3B 3FPYA 5ANME 2AJYH 4JY6A 1GYCA 2P80A 2H9GA 3O8XA 3ULVH 4M7LH 5IEHB 1ZK9A 3F00A 1MY7A 1ET8A 1H3WM 2UVEA 1CLOL 2WQWA 4HS8L 2R29A 2W0LA 1M2OA 4YPGA 2HXAA 1TZ8A 3P9WB 1CCZA 3E6HB 3RWIA 3L3JB 3EDJA 1XF1A 2ESVE 4F7MB 1BFVH 5B21A 2EDBA 2R2HB 3GSOA 4LEXH 1TVHB 4QXUL 2O93L 2QKIA 3T1FB 1RPQA 1T22B 4LPVA 1RJLA 1RZJL 3MNVA 3BPNC 3L3KB 3VD2A 3CZKA 4BKTC 4PWIA 1JHLL 3FU0A 5I18H 4U1IA 3VA6A 5JIKA 2NR6D 1ORSB 4UQDA 5IJCC 2H2PD 3HJEA 1KBPA 2Q7YA 4UCFA 1J05A 3DX0A 2NY4B 4CSSA 1II4E 4PJHB 4RX4D 4HIIB 1HXMB 1EWHA 2KI6A 2VRAA 5M95B 3UO8B 5FAAA 1QNZL 2Y25A 4YNYA 3B9VA 1AGFB 4ISVA 4X83A 2UWEF 4Y5XC 1KFGA 2C4FU 5C7ZA 4Z76A 3QYCA 4P5TD 3LNGA 3EJYC 4LSPH 2IAND 2WLIB 2EDWA 3WHE1 4I9XA 2A83B 3CQQA 3IJ9A 1F4XH 4ZPTA 1MIEL 3QISA 4XNXL 1U91B 2X2UA 3HR5A 3HZKA 4ZXBA 4HUXB 4J2QA 2MCAA 4AEHL 1VJSA 4L2YA 2MNJB 4XMLH 3TURA 4KJQD 1O7SA 1OP9A 4Y1AB 5L2JA 2XRAL 5HHOB 3NGBB 2Y7QB 4IOFC 4JFPA 1OTSD 4PB0H 5I73C 2VO5A 1D6VH 2VDML 1BD2B 4ZTEA 4LVEA 5ES4B 3BKYH 2P5EA 4PYGA 1U92A 1OLZA 2VXTH 2EQDA 4GLRH 3VTMA 4JZJC 1U8CB 4U6VH 4AEEA 3AB0C 4LCWB 4N8VG 5AG8A 5HYSG 4M1DH 1QYGL 4PJEB 2BCMA 3WE1A 1AYOA 5I0YA 1HSBB 4PSRA 4G6JL 2V2XA 2HUHA 3MN8A 1HCVA 4JG0H 5E8PB 3DV4A 3KXFD 3U0WL 1LO5A 2ZPKH 3FONA 3NACH 4WJ5A 3GMMA 5EOQH 4A2DA 4HXAH 1LP9E 4JFHE 1FNHA 3U4BL 1U58A 4OLZL 1MHEA 3NA9H 3QFJE 4WKZA 2X40A 4X7DC 4OF0A 3FSAA 4U7KA 3TFKD 5ICZB 1YC7A 4N1HB 4FHBD 4QRPE 2LLGA 5I16B 1A22B 5ECGA 1MJ7H 2C1PA 4G83A 3TWCH 5JNYB 1WEJH 4HJ0C 2R9HC 3W56A 2TSAA 3CIQA 5I82A 2XQBH 4X6FB 1MCBA 2EJ1A 1F6LL 1WUNT 1KBKA 4AMKH 3F7KA 4LSTH 3DROA 3GO1L 3HVNA 4CL7A 5CEXA 2HT3D 2Q86A 3DMMB 3MQIA 4XRCB 5F7UA 1I8MB 5CUSH 1WZKA 4GLRI 5EDXA 5DO2C 3OR7A 2MIZA 4UTBL 3EFFB 4A2GA 3MGTB 4I5BB 1L3WA 5I76A 3L3OB 2LLLA 2FX7H 3ARDC 3TBYA 3WOVA 3FFCA 2ZCKH 4QKXB 4WDIA 1EBPA 5ESVA 1JGLH 1MI5E 4WIQA 3TYGH 1Z6JT 3AQYA 3CJJA 2BWQA 2VW6A 4LLYB 1OPOA 4Z78B 1Z66A 5BNXD 4K8RH 4N0YL 1E0OB 3BISA 3KPOA 2ITCA 5F6IC 1X5XA 3F12A 1ILSA 4YE4L 2CO6B 2NQCA 4V11A 1G0YR 3H3KA 4POZD 5I0WA 2D7PA 1W0WB 1CU4L 2D3JA 2VERA 1NCWL 1F8TL 4X2UA 4A6YH 2ENYA 1ASPA 3AAZA 5KVDL 1W8NA 1S7RB 2VDQH 4L5FE 4MHHG 5M7QA 3MLXL 1HWGB 1IBDA 4C56D 3S8WA 5D2LE 1Q9WA 1ZXQA 3L3IB 3MRLB 1NMCC 4MSWB 4U6YB 4L8SA 3Q9QA 4CU7A 4KTDL 3KYOA 5KUKA 3OMNB 4UQ3A 3UZVA 4G6AC 3OSVA 3RJDA 1HCZA 2H32A 3TJHC 5E03A 5EUKA 5FKAA 1EAJA 2A38A 1FNEB 2NYZA 2NY0D 2OR9L 1RAMA 1HOCA 1NMBH 5AVWB 4YMPA 1ICTA 4AJWA 4YJZL 4OFDA 5IR1A 2Y06L 5EUOB 1EANA 3L16A 2DQDL 1BM3L 1N3NA 1AZCA 3F58L 3KVQA 1G7QB 1EZVY 3ZKND 4WUUE 2XSKA 3CVHL 1SDYA 1X44A 4NWTL 5DHVA 4PJXA 1ZGLA 3IK2A 4WKXA 4MXQC 2ZXGA 3GGWB 3ZDYF 1B6UA 4KRPB 3NSDA 4FTVD 4K3EH 2Q8AH 2FX9L 1O5PA 4BEIA 2WNXA 1M2VA 1TZAA 4EOWH 1HNYA 5FB8A 1EHKB 1S5IL 4OZHA 4PRPD 2CCLA 2IQAA 1NKGA 3MROA 4JFXB 2CAKA 2G3MA 4LKCA 4AEIL 2J8OA 4N3UA 5D71H 3G6DH 4YHPA 1G9NH 1MJUL 2JELH 2M8XA 4FNUA 1TNNA 4CN1A 1P5VA 1UH3A 4DPBX 1WD8A 2YXFA 3K1KC 2DEYX 2ETWA 1AXIB 3UJTL 1AXSA 1CD0A 4KK9C 3K2MC 3LQAC 3ARGA 3SDAB 3G04B 4BZ1L 3II1A 4GRWE 3ZKMD 4H88L 3O3UN 3POCA 2XQ0A 4GKOA 4GOSA 2HPTA 3BPOB 5C6PB 3QW9A 5DGQA 1RIHL 3WL9B 1AGDA 4MMYA 3HVDA 1WBYA 1UWEH 1MWAA 3IDJA 1HHHA 4LSUH 3V4PH 5D7LD 4JPVH 3DV6B 1FZKA 4P3WA 2D2OA 5IB4A 5T1KA 3K4AA 4GMSL 4WCYL 2MQ3A 5GISH 1U8JB 4LLAA 2NW2B 3DETC 4PLJC 2E75C 3RGVA 1E9QB 5ITFA 5C09A 4PJDE 3DO7B 1IGCH 3WI9A 5E9DE 2XHNA 1WG3A 3G08B 3FUNA 1WK0A 1JXJA 3E8UL 4U1KB 4ZS7L 3O41B 4XZUA 5ALCH 2PYED 5F8RC 3QUKA 4OIIH 3MOAL 4HCFA 3RX8A 3P4LA 3BKJH 1IQWH 1O9ZA 5D2NC 4XMKL 1DBJL 2CO4A 2VZOA 1A4AA 4KO7A 1MFUA 3WXVH 3LRKA 2CJUH 1ID5I 1ZSDB 5IFHL 3O9WB 2D0HA 4TLTA 4PJBA 3HMXA 2CMRH 2F18A 2WTRA 2MOQA 1UHVA 1QOKA 1YPZA 1V3KA 2D7OA 3VFRA 1KTKE 1A9EA 5E6ID 3QZWB 5FFGA 2AJVL 2YMXL 4QRQB 5DD5H 3ILPB 3V4VB 4F57L 4NYLA 4OLYH 4UAOB 3F83A 1T2XA 5EU6D 1X3DA 4YDLB 4YXHL 2BC4B 1E4XH 5F0JB 5CJBA 3KHOA 2UUDK 4KOCA 4AQEB 4MB4A 2ADGB 4J1UB 1N8OE 1VACA 4PTUA 2BNQA 3FQTA 2I9LA 5GGRY 3BI9X 4RGNE 1M1XA 5HI3D 2CQVA 5EC2A 3RVVD 1U8IA 3QUZB 5IQNA 3UADA 2LHAA 1DEEA 2CR6A 4KC3B 3PL6D 5B39A 1VFBA 2DWDA 5T1DL 2ZXWB 1UZ6F 3QZLA 4YH6A 3RRQA 4N9GA 5BUGA 3RY6A 2NX5B 5IT2L 4LSSL 2DQIH 1CMOA 3VW3L 3DDGA 4U3CA 3KLHD 4YR6B 4PJHF 1DBAH 2WJ7A 4WO4D 4AQ1A 1VEPA 4NQED 1XQ4A 3D2UB 3S2CA 1X5IA 3STBA 1P7QA 1XZWA 1LEGB 1P1ZB 5AYQA 1MW0A 1VADA 3OXSA 4V1DB 1HCFX 2WJ5A 3OGCA 4R90L 5A16B 1TYRA 2VLKB 3VRLE 1WAPA 4KK6C 5AW2B 4JG5A 5IP4A 2ZQKA 2DW5A 3L3GA 4NKMB 2ZWYA 5HJDA 5BCAA 3CTTA 4B9IA 5FM5M 3WDIA 4ATWA 4M1CC 2X4QB 3UBXB 3D4YA 5KS9A 3HI6H 2B0SL 5KYYA 4QJ3B 4XI5C 4U1NB 1JZGA 4NKOA 2ZG1A 2KZBA 4GKNB 4M6OL 3L6FB 4U6HB 4OZIE 1YMMD 4DOHB 5H94B 3EOAB 4LVHB 3K6DA 1IBHA 3DRTB 1L9PA 5CINL 5DMGD 4M48H 4X5XA 4DN4H 3TJEH 2ADFH 3DGGA 1E27A 2YA1A 3ZTJH 2WSPA 4ZUVB 3BAJA 2P5WD 2OFQA 1AXTH 1ITBB 1YYMH 2GPZA 2QSQA 2DH3A 1GYAA 3VCLA 2VRQA 3MJWA 1KCSH 3QQ9C 2X9WA 1EHNA 2BP0B 2R0WL 3MNDA 1LEKB 2LU3A 4RFOH 4N0UB 4FQ1H 5C0AA 2JK5B 2FYVA 3INUL 4WTXA 4PJEF 2DQFB 3AT8A 3CK0L 3I50H 4UILL 3CFKA 5C0FA 1GGYA 4OCSH 3OLEA 3SDAC 5KW9L 4TTGA 4F7EB 5I23A 4Q2ZB 1S7TB 2AV1B 4HX1A 3D39A 3DHUA 1MVUB 2M2DA 2RFXA 3N06B 3LEXB 5D7JA 2WLZA 3CLFL 5CN3A 3SOTA 4R4BB 2PUQT 3R1GH 2ZUWA 4HW6A 3SIKA 1K8DB 3FMGH 4NUPA 1CFNB 4CVZA 3ZYJA 2DWSA 3T0EE 4A2FA 2K4WA 4QJ5B 4PBVC 3PYCA 3BH9B 3WD5H 4PFEA 5E2UH 4A6YB 3G5ZB 3MMEA 4G8GA 2VDQB 2VOTA 3FOLB 1YLBB 3B6SB 4KXDA 4K7PL 2YWZA 3U2JA 5ESAB 1BJ1J 4Y4HA 2ALWA 4OB5H 3HPJA 4LARL 2OP4H 4JRFA 1U41A 1JD7A 1JS4A 3QS2A 1IUZA 1DFXA 3MKKA 5EOTA 3L4XA 1YEIH 2XTSA 1YC8A 2XOTA 3FTZA 4QY8B 1UQSA 2A6IB 4DPRA 5TDOA 5DVOA 4QOKD 1KSRA 2E6QA 4U1JB 3NJFA 3IJHB 2UZYB 2JQZA 3KCWA 4QHLB 2HMID 1OZTG 5TQ0H 3HLAB 4MBOA 3RX5A 3GB7A 1X5JA 4JO3L 5DVKA 3UAJD 4BIKA 2YRLA 4N9OB 1RUKH 3H54A 3PY9A 5EBMA 1Q1JL 2E7MA 3HUJA 1JPEA 3QXDB 1J86A 5J1SC 1ZY9A 4XMZA 4UT9A 5C7XL 3FCSA 4BRVA 4YDKH 2D0GA 3X3FH 3ME0B 1D5ZB 3CFEA 4UAOC 5A6IA 3R4RA 1AQ8A 2YBRA 3TO4D 4V33A 4WV1B 4YDLC 4QD2E 1G5AA 4ESKA 1FLRH 3KPRB 5T1LB 2XBZA 5KYNA 2DIAA 3RIKA 5GS2D 5ABDE 1IAII 2D9QB 5DEFA 4EAEA 2PXYD 4HYTB 5HI4C 3M45A 3VE0A 5DRXA 4PJAA 3GKWH 3TP4A 3P40A 3WV0A 2VN7A 3QUZC 3LY6A 5GJSL 2AERT 3CLEL 4XN4A 3KPQA 1VA9A 1MJ8H 4U2ZA 1MPAL 3UGUA 2QADD 2CR3A 3KBEA 3ZIMA 2HYMA 2R83A 3LIUA 3QUXA 5EUOF 3MXVH 4Z0XB 1U95A 4WFFE 3O2DH 1E9PB 1BFOB 4EIUA 4HU8A 3D9AH 5EIIA 1MHPH 3BVUA 3U7AA 4FULA 3O11B 4X7TA 2IFFL 4PR5A 5T5FA 1HL9A 3BAWA 3W0WD 4EQ2A 4YHYC 5AW1B 5C0BD 4HP5A 1YY9C 2IDQA 2A73B 1UT9A 1RZ7L 3GRWL 2WOYA 3QZPA 3ATEA 3ZQ9A 1J48A 1HESA 1F2QA 1W2KT 4Q9RL 1FYTD 5I75B 1A25A 1W16A 3PFQA 5DRZA 2FVNA 2VW4A 1A6WH 3FT2A 2Z7YA 3HN3A 5I8OH 2GSIB 1SDDA 2CZNA 3BD3A 3AMKA 3NFNA 3V4UH 1CYGA 4NBYB 3C09B 1JZ8A 4PP1C 4FFVD 5F1KC 4LVHC 1JZ5A 3QEQA 4WSJA 1E67A 1EEQA 1IGIH 2A1WL 2O61A 3LPGA 2IXQA 4JPWL 3WO4B 1N7ML 3ISWA 3DI3B 2WVUA 5IWLA 4UQEA 5F96H 3QA3A 2V7NB 1GRWA 2Z35A 3Q2CA 4OLVH 4NP4H 4Z7WE 2HVJB 3S37L 1FNSL 3LZNA 3GINA 1NANH 4IRJD 5E8NA 3ULVF 3SCMA 1U33A 4EUPG 4HS8H 1IAKB 4OTXL 2GT9B 1QI4A 4NLAA 4G5ZH 3CIAA 4JRXD 2AK4E 1RUPL 3L45A 2E7LC 1E50A 5EPMB 2ZYIA 4NHCL 1E90A 1LK3L 4U1GC 4QXUH 4BH7B 3B7SA 3A4EA 3E2HB 1PIGA 4QLRA 1CS6A 4MNQE 4WI4A 1RZJH 2V5MA 3ILDA 4KWUA 1SJHA 3TN0B 2XLLA 1JHLH 4JRYB 2DS4A 1V05A 4JN1L 4DGUA 4KQ4L 4P0DA 3MSPA 4KJYB 5KBLA 1NWOA 4DH2A 3FS9A 4JN2B 4L4VB 1IFHL 3BUQA 3BZ5A 3HG4A 2W65A 4ZRGA 3RX7A 3X13B 3VXUA 4BSVB 1HIML 3TA3A 5DHXB 4RAVB 4QMEA 3T77A 3HFFA 4YO0A 3TPKA 3FCGA 5K1NA 4LDEB 3QEUA 3AXHA 1ECYA 2Q5BA 2FWOA 1QNZH 1ROCA 1BZDA 3NRQA 4QKTA 2BY2A 4HUWA 4JY4B 3NJJA 4X9YA 1NGXB 4KKCD 4UDTB 3WMSA 1AIFB 1AD9B 4NIYE 4R7NA 1OGAB 2CBPA 3GMLB 1BBDL 5CN1A 4XBGB 4K9EH 1T04A 4ZMZA 3L2NA 2IPKA 4UU9A 2YXMA 2KLRA 4F9PA 4Z8FL 4OZFH 4XNXH 5DJXB 1DVFD 2EADA 3M07A 1TOXA 1WIOA 1OGPA 4FA7B 4AEHH 4DO4A 3OSKA 1FF5A 3RUGA 2XRAH 3CH8A 3AJ7A 3PJSB 1MW3A 3U46A 3KR3L 5TGBA 1JG9A 1G4RA 2ED8A 5MEQA 4JREB 3K71B 3TIDB 1CF8L 3MBXL 3WUZA 2A6KA 1WCBB 2BHZA 3Q1SL 5EF2A 2VXQA 4CADB 3TBTA 1K4CA 2FL5A 3PWUB 3UZQB 4DUWA 4WFED 4C8XA 1YY8B 2VIRA 5KOVC 1ZHBB 2R7EB 2DMBA 1N8ZB 1QYGH 3H85A 1OV8A 3V5KB 2RTTA 1KCRL 5EU7C 1SN2A 1ZK5A 1CLZL 1JI2A 3H3PL 2CKBA 2XN2A 2XN9A 1QSED 4G6JH 4F7CB 3EO1A 3GRGA 3TH4T 2P7TB 3U0WH 4FFYA 4IRZA 4BFNA 4TSBH 2EIMB 5F2FA 4QLWA 3LPWA 2J88L 3ILQD 3MO1A 2X09A 4P3DB 3U4BH 4QRTA 1S5HB 4WRLA 5J7CC 1L6PA 1KTDB 3C6LB 3LYRA 4OLZH 5I2IA 3KPNA 3BEWA 3NJGA 3PWPB 4N0RA 3EUDA 3LS5L 4ELMA 3ULUH 4YHML 3L3DA 5FYKE 4BCXA 2BVQA 4J3WA 3HE7A 4JPIA 1M3JA 5GIRA 3M7FB 1XD1A 1EJOL 3QWNA 3VFNA 1ZT1A 5LAPA 3IJYB 2AJSL 1OP5K 3IMSA 2PNDA 4AJYV 2EKJA 4PRDA 4UNVA 2LQRA 3GO1H 1NC2B 1F5WA 3NDZE 4NEHB 4Y19B 4X5PA 3HI1B 4NO0D 3SJVA 3BPLB 4L3EA 5DZAA 4UTBH 2FRGP 4P5MB 4M62L 3C09C 4XN2A 4K3GA 1BIIB 1HH9B 3QZMA 3O3EA 3HEIB 3H9SB 4TUKL 3K6SA 3MV01 1NIAA 3O6FD 5E4AA 5AB1A 3X11A 5HYQA 4FRWA 1MY5A 3DX7B 1OSPL 3TBWA 4F33B 1BZ7B 1SEQL 2CXKA 3HE6D 3RG1C 5GS0L 4YE4H 4Y4KC 5J6GB 1DQML 4MNGB 4N2OA 1QAWA 2YGVA 1TG8A 1A66A 1CU4H 3B9KA 3LAFA 2EKSA 1F8TH 4WFGD 3V6OE 5KVDH 3P4MA 2WPGA 2PTTA 4N3TA 1Z32X 3APFA 3II2A 5IFJB 1I4FA 3EBGA 2VZ1A 3FTGB 3U9UB 4A68A 3IVKB 4KTDH 2LU7A 4HCRA 3B37A 4KDTA 5L4JA 1OF0A 5LGKA 3ZTNL 3E2HC 1OIOA 3K3QA 3NJXA 2OR9H 1QTYT 4OJFL 1QSFD 2NQDA 4M3JA 3TN0C 3CFQA 1Q9KA 1ML0A 1J9QA 4L1BA 3FW6A 2Y06H 4WHTB 3L4CA 1PQZA 3GI8H 4H4NA 3NSFA 3S36L 4P57A 3U1SH 4R6UA 2DQDH 3BFQG 3RHWK 3FFDA 4KTEL 3FUKA 2HJKB 3QCUL 1BM3H 4HC1A 5GGVL 5JYLA 3GIVA 4CNIB 3FO0L 2X4OA 5A2AA 3CVHH 4KKLD 3QEHA 1U8PB 3U82B 5DHEA 1FNFA 2Y72A 1ACYL 2KH2B 32C2B 5AVYB 2FX9H 5ID0A 3AUWB 1MAMH 2MNUA 4JKWA 4PJ8A 1CG9A 1M57B 3ARVA 1S5IH 3BJLA 3A0OA 1I1YB 4BDVB 3MOBL 5MENE 4ZAKB 4CVUA 3F7VB 4AEIH 3MJ8B 3T3PB 3VAEA 4WHDA 1PLAA 1XTMA 1MJUH 1N6QL 3EOTL 1JVOA 1DQLH 3NRPA 3IFOB 2EZ0C 3UJTH 4KMQA 2IEPA 1JNNL 2F58L 2X4UA 1UH2A 5AKTA 1ZHKA 4QXGH 2J6EL 1Q0YL 1LE5A 2VLRA 3LMJL 4M1GL 3P73A 4XNMB 4BZ1H 2VM9A 3BUIA 4H88H 1XGZA 2JJUA 1UUNA 4LXFA 4ZUUB 3KXFB 4L0YA 4OCLC 1RIHH 4HUVB 3IE9A 1GR7A 1IC7L 4FQXA 1CN4A 3RVXC 3EYFB 2GCYB 2N1KA 4GFXA 4JZOA 3BFWA 3N5AA 1A7PL 2YHGA 4E9LA 3QYMA 3GUFA 4FXLA 4JCMA 3UTSA 3IN0A 4GMSH 4WCYH 3OWRA 2X1QA 1AD0B 3JVFC 4QXTB 4ZO9A 1Q94B 1R3IL 2Z1PA 1UD2A 2WSKA 3EYVB 3OKOB 3PCYA 1KN2L 3LKQA 4ZMQA 4BJLA 2EEBA 3C6LC 2AXHA 1FZJA 1M71B 3NMEA 2AEQL 1LE9B 3BZEA 2WV3A 3E8UH 5GS0D 2HPOA 2VDOL 4ZS7H 2C1OB 2ICWI 3D07A 3JUZA 3U6XS 3MOAH 4DAGL 5ISZA 4PY7B 2IAMA 4GXUM 4XMKH 2ZJSL 3OLIA 2PTVA 1IGMH 3QC6X 2YFNA 1OARH 5L4MA 5B8CC 4N2LA 2C3VB 1PD0A 3VXQA 5IFHH 4WW2A 2CBOA 5JOFA 1DBML 3S35L 1R34A 1UWXH 5L6YL 2Y5EA 3QBTB 1CICD 1SJVA 2AJVH 3GBDA 1A7RL 2YMXH 3IM1A 2B9AA 3O4LD 5IB1A 4P05A 4EN3C 2GTZA 4YXHH 5I1AB 4ZUWA 4PREB 4GINA 4LHJB 1BZ9A 1XGTB 4C56B 5A2BA 4UV7L 3JV6A 4AVJA 1XD0A 4WNJA 1R5IB 2H32H 1TU2A 1F4AA 4OZFB 1JZ3A 5HDQL 4QWWD 3CD4A 5JMRA 1I1AB 4JHZA 2E4TA 3UZEC 2NY0B 1DJSA 2VDLL 1YRKA 5EORH 3KH4A 1OXYA 4MB5A 4BGLA 4LLVA 3DJZA 1WAAF 3QNXB 5T1DH 5KVFL 1KWKA 5IESL 4ZD3L 3NH7L 2DLFL 1INQB 3C5JA 2IQ9L 3JSSA 1CDGA 3Q7JA 4LSSH 4WGWB 2HFEB 3LD8B 3VW3H 5CKGA 4KKBC 1KG0B 1JGEB 4M93B 5A3ID 1KIPB 1BVOA 5D7IA 2X2YA 1N5YL 5AAWC 4OGXL 1EXUB 5CGBA 2HFFA 1Y7VA 3JBG7 2RH0A 5JLZA 2WZAA 5B3SB 3SB3A 1L0YA 5D55A 4PJ5D 3MRBA 4FTVB 3SYPA 1SJMA 4R90H 2UZIL 1HL5A 4R96B 2XTJD 4LASL 3MCKA 4P5KA 3V6ZA 1K4DA 3OF6D 4M9OA 2Y6TE 3S9DB 4PRPB 4AG4L 5GS2H 4K2UL 3FB7A 4JFOB 1E5YA 1YNTB 5IMLB 4N2BA 4K23L 3BSHA 2J6WA 1CF1A 1S2EA 2Y7MA 3GSWB 5FLUA 2B0SH 4YX2L 2BXZA 5ESQA 4M6OH 3SGKC 2OYKA 1OT2A 1IX2A 1TCRA 3HG1A 4E41E 1TKWB 3STZA 1SVCP 2WXFA 2F61A 1U3HD 2A9AA 2WN3A 5AW7B 3JV5A 5D1XA 1WE5A 4ZAKC 4LCUA 3SDCA 4MLSA 2NXYB 2PWHA 2CRMA 4FOMA 3T6ZA 4CUCA 2AQQA 2OCFD 3ABGA 5C71A 3OKEB 5CILL 5DTFA 3JZ7A 1MCPH 2FQFA 3KYKL 4LLMB 1KCVH 2R0WH 3FHEA 5CSBA 3CGTA 5D7LB 2JJTC 1I1FA 3IBEA 5SWQB 1A6ZB 1E5BA 4BFIA 1UOLA 2B1AL 1CL7L 5C07D 3CK0H 3VXOA 2Q2EB 5KW9H 2EE6A 3OR6A 5H2BA 1A7OL 4AJVA 1F4YL 1GYVA 3IKCA 1PD6A 3HG2A 3INOA 4KRNA 2XIDA 4NQTA 3SGDH 4AUUA 3WXWL 3RWIB 3QJXA 4G8EB 4OF6A 3ARRA 1IO4C 4R83A 4NN5C 2P52A 5JXEA 3GSOB 2UYLA 2VMFA 4D9RD 3FU6A 1KGUA 4L8BA 1IM9D 1UD8A 1I1CA 2OXHA 1F1GA 1NAMA 4K07A 2EXTA 5K9OA 5GS1C 4HPYL 3QIBA 5AVRB 5DD3L 2GAZB 4U1IB 3M1BB 3GS0A 4RX4A 5FKPA 2YAQA 3CFMA 3PWJA 3CSTA 1XGYL 3KPPB 2R39A 4QCIA 2BSEA 1YYLL 1J05B 1NQBA 1PPIA 1MFCL 4TQHA 5TE7L 1S78D 3I6SA 4KKQA 5D7SL 2HT3C 2FGWL 3G6JE 5FA4A 5E6IB 4OAWB 5AOMA 1RZJC 1HWWA 4C4KT 2IANA 2CGRL 1E4HA 1S7UA 2QL1A 5GRVL 3WSQL 5EU6B 3BP7B 1FDLL 1MNNA 1AKJA 4OLXL 3TZVA 2Z93B 4BM7A 2ODIA 3GLEA 3HRZA 4G1MA 3BEVB 2EE3A 5K9KA 1GTNA 2WTPA 2DWEA 1HHIB 5M94B 3CDZB 4MLIA 4UB0H 1B0GA 5HPMA 1Q1JH 3CVHB 1HJCA 3CMGA 2W07B 5EV7A 4L1HA 2J4WL 5C7XH 1KPVA 5LGJA 2J43A 2CG9X 2FATL 1ACZA 1KEML 2VMDA 1UJ3A 4JFPB 4OF8A 5CZXC 3TT3L 2IF7A 2O72A 2YKLH 2K8QA 4FI8A 1WA2X 2XFXA 2FJSA 3A23A 5FWRA 3WMQA 4K9EC 1U92B 3TV3L 4E36A 1D6EA 4WI8A 3IMWA 4NQEB 4NUGL 3MRPB 1W91A 4AZUA 4JGNA 4YL9A 5DWPA 3ZT5A 1I1AC 3G3LA 5GJSH 5F0MB 3FTSA 2ITDA 3I6LD 4HAGA 3ARTA 1P6FA 4X80H 2FTAA 1MPAH 4NZUL 1WUZA 2SEBA 5FK9B 3DV4B 3VMNA 4Y9BA 4ZW6A 3FONB 3GMMB 3LD8C 4HUKB 2Z8SA 4M93C 1U58B 1CJYA 4WKZB 3UXFA 2X4TA 2IFFH 3QNFA 4GP8B 4YAQA 4FXGC 3RU8L 3EFOA 2VR6A 1R46A 1YMMB 2DH2A 1IGJA 4NAQA 1RZ7H 2YJQA 3GRWH 3MNMA 4OCWL 5DSCB 2GW5A 3TLRA 3GSVB 2XY1A 1T5WA 1XGPA 3J7HA 3T3PF 2P5WB 4JO1L 5HSFA 4NM8L 5J4MA 3D06A 2LV4A 3LN4B 3EG9B 4LB8A 1RKRA 4RAUB 2Q86B 2XJKA 4UT6L 4KV5E 3GMQB 3OR7B 4E9RA 3FCUB 3CU1A 3OWEA 1NKRA 3ULUC 3OGOE 1CDIA 3UX9B 3PGCB 4AGOA 1RI8A 5B39G