2DMGA

Solution structure of the third c2 domain of kiaa1228 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
142
structure length
142
Chain Sequence
b'GSSGSSGSPLGQIQLTIRHSSQRNKLIVVVHACRNLIAFSEDGSDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSVSLPEVQRRTLDVAVKNSGGFLSKDKGLLGKVLVALASEELAKGWTQWYDLTEDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1228 protein
publication title Solution structure of the third C2 domain of KIAA1228 protein
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 13
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2dmgA00
3L13A 3APFA 3B7YA 3F04A 2WXKA 4L23A 4FADA 1DJXA 3L9BA 4IQHA 4WWOA 1BYNA 3R7RA 2CJTA 3APDA 3CSFA 1WFJA 3T8MA 5EDSA 3TL5A 1DSYA 1DJYA 1E8WA 4QJ5B 4TV3A 3TWYA 1E7UA 2BWQA 2CHZA 1UOVA 1W16A 3FDWA 3ML8A 2JQZA 2FK9A 3OAWA 3IM1A 4PS7A 2WXPA 1TJXA 3DPDA 5G55A 3ZIMA 4EZLA 4F91B 4AOFA 2YOAA 3ZW3A 2KI6A 2NSQA 3ML9A 3IBEA 1E8YA 2A5UA 2WXNA 1DJZA 1K5WA 1DJIA 4BFRA 2Q0ZX 4OVUA 3JZYA 3HHMA 1DJWA 2B3RA 3F00A 1DJHA 3LJ3A 4G11A 4WAFA 1YRKA 2WXOA 3NZSA 2WXRA 4XZ4A 4DNLA 3OHMB 2CM6A 2Q3XA 3TJPA 3N5AA 4JPSA 1V27A 4FJZA 4FA6A 2UZPA 2K3HA 3L08A 4XE0A 3W57A 4F92B 4KZ0A 1A25A 3ZVVA 2WXFA 2WXQA 1CJYA 5H4YA 4NPJA 4ANVA 4QAMB 2ENPA 3MJWA 4ANXA 4TUUA 5CCJA 4KITB 4EZKA 1E8ZA 4Y1TA 1BCIA 5CCGE 2EP6A 4PS3A 3PRZA 3QJZA 4WWNA 2CHXA 4OVVA 3QAQA 5G2NA 1RLWA 1RH8A 4NPKA 1UOWA 2K4AA 1UGKA 1W15A 3RPBA 1BDYA 2X38A 4QJ4B 2CHDA 2R83A 4LDCA 4WWPA 5T8IA 4F93B 3R7QA 4QJ3B 1GMIA 4L1LA 4L1BA 1DQVA 3S2AA 2ISDA 2WXMA 5JHAA 2WXHA 4GB9A 4FJYA 4ICWA 2N1TE 2K8MA 4GNKB 4BGDA 2WXLA 3HIZA 3QR1A 2DMHA 4HVBA 3FBKA 1E7VA 3NSJA 3L17A 5H4ZA 2D8KA 2Y3AA 2LHAA 3L16A 3L4CA 1TJMA 1WFMA 2V4LA 3APCA 2ENJA 4AJWA 3PREA 3QR0A 4L2YA 4WEEA 4Y1SA 3W56A 4LCVA 2WXGA 4ANUA 4J6IA 3F05A 2RD0A 2CM5A 2NQ3A 1E8XA 2ZKMX 4FULA 1QATA 1HE8A 2FJUB 3HN8A 3PS6A 1QASA 3PYCA 4XX5A 2WXJA 1E90A 4FHJA 3RDJA 5KJ7E 2CHWA 2K45A 3PFQA 3SD5A 3GPEA 1RSYA 3M7FB 4ANWA 4PS8A 4URKA 3CSTA 3KWTA 4HLEA 4KZCA 2CJSA 3DBSA 3NZUA 3QK0A 1DJGA 4IHBA 5JHBA 3P2BA 4FLHA 2DMGA 4EZJA 4F1SA 5CCHE 2NCEA 4LT7A 4NS0A 4A55A 4FHKA 2A4ZA 3L54A 3ENEA 3KWUA 2QZQA 2YRBA 2Z0UA 4NP9A 4DK5A 4ICXA 2ENQA 2QZ5A 2WXIA 4V11A 3QARA 4MJJA 4TS6A 3F01A
chains in the Genus database with same CATH superfamily
1R33A 3QZBA 3EFDH 3WKNA 1RURH 3DRQA 2GC7C 2VL5B 2ADJA 4A63A 1N2RB 4Y4HA 5EUOA 3FT3A 2IWEA 5E0QA 3GNMH 1PEWA 5ICXB 5CEZD 3I84A 1RK0B 4JO5A 4UCFA 1KY7A 1DUZA 1CBJA 1MXGA 3BLBA 1XAUA 4F2ME 4RGOL 1RQ5A 3KW8A 4LHUA 2K9UA 2A7BA 2QPUA 3DDFA 4ALAC 4DTGH 5CCKH 3EJZC 2XOTA 5KSBB 3K6SB 4Y2OB 1NBCA 4DGYH 2YEVB 1XEUA 2FWLB 3A24A 4N1CA 5AYUL 4MCYA 3IDMB 4TSBL 3TS8A 5FGRA 1J0YA 2HJFB 2Q3XA 4JN1H 1L5GB 2AQRA 5AAPA 4L3CB 1HHJA 3QNYB 2IV9A 1I1FA 3H4HA 1MY7A 3T3PB 3T71A 1LWHA 2XG4B 3AJ7A 1LO5A 2W9LA 4ONGH 4B41A 4L3EB 2JKNA 4Z7VF 4PSPA 2ITCA 1UA7A 2ZUQC 1DQJA 3VRIB 2ITDA 5HJGA 5JHLA 3PABB 5BPPA 3S0PA 1T1YA 4F8PA 4FTVB 4XO9A 2KQMA 5HHPA 5BZDA 3MRKB 3RQ3A 2D73A 3ES6B 3R7QA 1Q9KB 1C9SA 1DVUA 2Q6WA 3KZ8A 3ZMEA 5LLIC 4G7QB 1FZKB 1NDTA 1Y1DA 4D94A 4O02L 1G7JB 1GJWA 4GAAA 3EJPA 5IR1B 4PY7A 2W94A 2AP2A 2YQ3A 4XBEL 3NJGA 2UUDK 1NUNB 3KLSA 3NSYA 2JIXB 1A3RH 1Q0YH 1QRND 3V6OC 2NY5H 2AQPA 3VWKA 4LE8A 1QI5A 3E6FA 1JPEA 3CN4A 4G3YL 2B1AL 4Z77B 4CGTA 4I18C 4Y5YC 2OR8A 1S78C 1X4ZA 5GISL 1P84K 4HJUA 4BFOA 5T5FL 3GUTB 1A64A 1ETZA 3QUYD 4L0PB 2AJVH 1MFMA 3FUFA 4EQ2A 1X5HA 3OVUB 4RBPK 2GBVA 4YMPA 4HJEA 4XTRD 3WHE0 3GSQB 2VSMB 3B5GA 5SV4A 1ADQL 5KYXB 2B0SH 4M5YH 3RB5A 1IAOA 3S98A 5E4EB 5ACMA 4DK5A 3LN5B 4MYPA 1W0VA 1K4DB 2YA2A 1MKFA 1O6SA 4TSCL 4L8BA 2BOCB 1EO5A 3QUML 1NPNA 3MFGB 4D9RD 4ODUB 5C0CE 4QRUB 3L9RA 4F7CB 3MO1A 1BQSA 1S7TB 3C6EA 3QO0B 2DWEB 2BIQA 5CGBA 3T09A 2X6MA 3D48R 3BLKA 1FFTB 3C2SA 5CLTA 3IDNB 4XBMA 1XF2A 2YD2A 2NXZD 4HVBA 1LJMA 3AU1A 3Q43A 4GW5B 4K7PH 5KVEE 2UWEF 3O81A 5GS3A 3DHPA 3OMIB 4PVMA 4P06A 5BOZG 1AGCA 4OZFH 3V0VB 43CAB 1U8HB 3MXWL 4LSSL 1N5YH 1W72B 4FI7A 2FECI 4KUZH 5L4FA 1XGZA 2UXTA 3K0YA 3ULUL 4O4YH 3EJUA 3NZSA 2NNAB 1LD9B 1F4AA 1H5BA 1WAPA 2QQKL 4HUCA 2R0WL 2VXTH 4K2UH 1OAXH 4N9GA 3MLVH 2HFFB 5T1JA 1RVFL 4M7JH 2PO6D 1HEHC 3UBGA 1F58H 4NPJA 4FP8L 4AJ0A 1M7IB 1SYVB 1V7MH 2W9DH 1E4KC 1H8SA 2HG0A 1G9MC 5ERWA 3RTQC 3QFJB 3SO3B 3MRLA 1HWGB 4WI2A 4YQXL 3P69A 1C5CH 1MFAH 1AVAA 2LV4A 3C09B 4XVTH 1FVEA 3N2JA 1G7HA 3UXFA 1KPVA 4JX0A 1FO0L 5DJCA 1TNNA 2HFGH 3D4ZA 4HWEH 4XNYL 5SWQA 3VFMB 5AW0B 1JWMB 3DJTA 4X99B 5I0YA 1YHPA 2HT4C 3CDCA 4A67A 5BOPA 3JUYA 1OGAD 1F97A 3QEQB 3LN4B 1AG0A 3B9KC 2UX6A 3S5LG 3N43B 2IDCA 1ID5I 5HPOA 4KXDA 5ADPL 4TKWA 3D05A 1WFMA 4K9EC 3B1UA 4K94H 3LEVH 3KXFD 3KH4A 4J6IA 4RX4A 1ZHBB 3MRQA 4KHXL 4HETA 4ZNEE 3O4LA 5BRZA 3TJHD 2F9BT 2NY4C 3D18A 2ZSWA 2IDSA 4Y1AE 1ORQA 1QEXA 5CJQL 3WEXB 3CNKA 5FO7B 2R8SL 3MTRA 5EA0H 5IIEB 4YEEA 4FQCH 3QORA 1ZHKA 1DEEA 3AW5A 4UILH 5HHQA 3CC5A 1U58B 2ARJQ 3W2DL 4E9RA 1TEFA 2ZWYA 5KSUB 5EEYA 2VXSL 5HI3D 1KWKA 1I3RA 2ICCA 1CT8A 5LWYL 1BLNA 2ATPA 1KIPB 1H19A 1SXCA 1HQ4B 1SN2A 3PWPE 4ORGB 5DVNA 5INDA 2J21A 3F7VA 2XKUA 3UPAA 2N7SA 3KPPB 2OJZH 3FCSB 5IB2B 4XAWH 3CWGA 1U8QB 4R7XA 4Q74A 1KLFB 4B50A 3DV6B 5I1LB 2DQJL 1JWUB 1T2JA 2EDYA 1UA6L 3MGTA 2YOAA 4NN5C 4P5KB 3K4DA 1AE6L 3AAZA 4JE0A 3LS4L 3NCFB 5JUEL 3HC0A 1A4JA 2XTSA 4ADGA 4Y2DB 4E9TA 2JVUA 2OJ1A 5FKPB 3Q5YA 5IFAL 1CGSL 5BO0D 3FO0L 4YR6B 3HUJB 3HPJB 4JFPB 3KPQA 4G71B 4UQBA 5IQ7L 2ZOOA 4JRXA 4OFKA 3FUDA 1XF1A 3H2QA 2AK4E 2R23B 4U7SA 5E08L 2B20A 3TH4T 3IYLW 1CZ8H 3B7TA 2KDGA 3MUY1 4H0IA 4UB0L 1NLDH 3GXNA 4H88H 5CD3A 2FJGA 4WSGA 1AO7B 2BW5A 1MCQA 3RY4A 3MJ8B 4I48A 4K3JH 2NY5C 5HDBB 4HCGA 4UIMB 4M93B 5LBSH 4NQEB 1MCJA 3C60A 2GSIB 3WNOA 5DJXB 2GT9A 2BHUA 4NQTA 4DK3A 4P23C 3F12A 5JW4R 3TO2B 3AMLA 5D1QD 4R0LB 5FGBC 5F9WC 5DDHA 5FYJH 3F84A 3CH1A 5CS7A 5KS9E 2OSLB 4PB0L 4F15B 4EN3D 3OKLA 3MV8D 3W5MA 3JV6A 4X6DB 5J13C 1GMEA 2X12A 5EC1B 3GZOA 5F1IB 3E0GA 1FE8H 4YSQA 3SKOA 1RZKH 1EEQA 5AQ0A 1NAKH 4HIHA 3O6KL 3CSYB 3DXAD 4XNQB 3RYMA 2D2CC 3TH3T 4XWOC 3SCMA 2O5ZL 1WG3A 1T0NA 4LCWE 5EU6D 4F7MB 5BMFH 3UH8A 1RAMA 4UIKL 3MCG1 4PTUB 4ZAKA 1FH5H 2WGNB 4WHTA 3N9GH 4EMZA 4HX1B 4CDHA 5KSAD 4CW1B 1CG9B 4K3HA 4F2MA 3FPYA 3SDDB 3WS3B 3NGBC 4OZGB 4TNFA 4NZRH 2H0JA 5AKRA 5CLWA 1QW8A 2NNRA 3A6CH 1JGLH 2DYSB 1ZK9A 3ZKXC 1NBZB 3ZKMC 3BQUD 3IDIA 5C6TH 3WUWG 1NFDE 3SDAD 2B2XL 5L4JA 2PMZA 4HFWB 4Y5VA 2R0ZH 3LPPA 4Q9BA 5EF3A 1JCKA 4N2AA 4X4MA 3MNVA 5IJKA 1ZJAA 5A43C 2QFPA 3BXNB 3UBXI 2XPGB 4ZUVA 2K4WA 3MDJA 3RWIB 1KTKE 1EZLA 4PGEB 4UUJA 1AMXA 1KBVA 5KJRL 5J5EA 3KBFA 4XB8A 1ZA3A 2R2CA 3QJQB 4KUCF 2CD0A 2OL3H 2V17H 3FT1A 4WFGE 2A5UA 2WQSA 2VRKA 4Z3TA 2KDYA 4Y88A 1JUFB 1JDDA 1KZQA 4NENB 4ZX6A 3FH7A 2FJHB 3ECWA 5F2FA 4QXVA 3BKML 4P3CH 4LSVL 3LRSB 1TT6A 3BT2H 3P3RA 4LSQH 3NG5A 4X9BA 5GZND 1TVBA 3HC4L 4NAJA 3QIUD 3UROR 3LD8C 2VMCA 2WXQA 4OY9A 4GAYA 1N0LB 3NA9H 4A6YH 1NFAA 5C3LD 2YKLH 3II3A 3AGVA 1Y1UA 2HWZL 5T1KA 1QSFB 3MFFB 3OKDA 4OKVA 4QO1B 1NFIA 5LNDA 4Q4EA 3EFFA 2AQNA 1G1KA 1G0DA 1L0YA 2Y5TA 1A1MB 2JQMA 3BPNB 1HHHB 2R0KH 5BXFA 2VN5A 5HHOA 3DVFA 3QCUH 3WFEL 5J11C 1B4JL 5TTRA 2P47B 1R46A 1E4XL 3JVGC 5EZIL 2UY6B 5I19H 3S2AA 5GJTL 2CU9A 3LY6A 3ATAA 1U8LA 5DF0A 5CEXB 1PZAA 4PJAE 4XXWC 1IGFL 5SWZD 5BNXD 2ICWA 4I0KA 5FC9A 1KJ3L 3D7PA 2X1WL 1OZUA 1VCBC 2CO6B 5IG7B 4GSXA 5HGDB 3A21A 4G6AD 1OM9A 4FEIA 5IF0B 3SPHA 1NC4B 5E5MA 1OK8A 5C0CA 1NCGA 4AMKH 2PPCA 1ZV2A 4IRSD 4MJIE 4TQHA 1ZPUA 2B4CL 1DQDL 5KS9F 4IKJA 4N0UB 3KBPA 4M8QA 4G6JH 2FCBA 5A2FA 1SLWA 3BWAB 1H9DA 4ZD3L 2QKIC 1EQWA 5F7HA 4IBUA 3EGXB 3UTTE 5HHME 4CVZB 5L2JB 3U2SB 4WK2B 1I3GL 3KHQA 3MLSL 3FB8B 1ML0A 4W93A 4A2FA 5HYQB 1LP9B 1JHLL 4IGBD 1EDHA 3ENEA 2LAAA 3HVNA 3DHJA 2ZXEB 1JS4A 3CX5K 3KPRD 2LTQB 4GI8A 2QTVA 1LL1A 1CD9B 5ESVA 2CJTA 4H26A 5C0AE 1IGYA 3T8MA 4UTAA 2O61A 1E50A 2YJQA 3FN9A 4C8XA 3CDGA 5FA4B 1UOVA 1SJVA 5KBNC 1NFDF 4TNVF 4PS7A 4AQ8A 5CWSA 3MRFA 1TIUA 5IOPA 2AS5M 2OTPA 1IAII 1VFBA 4PB9H 5JA9A 1T7ZA 5AVVB 1WGVA 3RY6C 3WYRA 3T0VA 1G9NL 1RZ8B 4AWJC 5C7XL 4KQ3H 3RVUD 2X4RB 3LJ3A 3LQAH 4ISVB 4R3SB 1GGBH 4ZW6A 4YHKL 1PG7W 3VXME 5C3TA 2WHVA 4N3UA 3CGTA 1TQVA 3BYTA 3S5ZA 1UM4L 4UINH 1UXSA 2V5YA 5AYQA 3ALWA 4PCYA 1TU2A 1LMKA 2W8CA 5F9AC 2YD1A 5D6CA 2AEPL 4U6YA 3F8UB 2DQUL 4PJHB 4C55A 2WZ6A 3QJSB 3S3CB 3K4ZA 1RZKC 3WV0A 3UTZB 5FLUA 5T1DL 4FD0A 1DLHA 4ZNEA 3HLKA 4K3DH 3HNTL 4S1SL 3VXUE 4Y1AA 3A67H 2WLLB 4NHUA 1IGIL 5D72H 4WU7A 3ZYZA 1IFHL 2L7EA 5FO9A 2O5YH 3L3OC 1WBYB 1MHEA 5EZLB 4GNKB 1QI4A 4CVWA 1B90A 4WK0B 3STZA 5IFJA 3KLKA 3O11B 3P3UA 3MACH 3MLZH 1U2HA 2ERJC 1S5IH 4GMTH 3PWPA 4KFZC 4P3DA 3G5VB 3H9ZA 4NO5A 4NRXB 3IFPB 5F3HB 4RFOH 4P59H 3GMRB 4GG6A 1OCCB 1BAFH 1QBLL 2VLLA 1QKZL 2V4LA 4GRWE 4LLMB 4YXKH 5B8CA 3C5JB 4PJAF 1PX3A 5DR5H 4XNMA 4XPBL 3EJQA 3GXDA 4HUKB 5HGHA 5TDOA 1HZKA 5EDXA 4JG0L 1YEIH 2HX9A 3E38A 4JDVA 4XX5A 4G7VH 4L1DA 5AWNL 4AQEA 1C12A 4WFFE 4JVWA 4UT6L 5JOPE 5DWPA 4JB9H 2DRUA 2XKNA 2YR3A 1J12A 4C58B 2BDNH 4ZPTA 3FSVA 3GLDA 2HYMA 2WINB 3DUHA 3P2BA 5D7JA 4ODTL 4ABUA 4BQ8A 1EHAA 1IGCH 4OTXL 1S9VB 3T0EC 4XOBA 2DQTH 4MGXA 4Q2ZA 3FFCE 4YDZA 1JPGB 4NDMA 1QHOA 2VZTA 4U1JB 3H9SD 2AK4A 2DDQH 4JRYB 2Z31D 3HI1B 1QYGL 1ZANH 3HE6D 5DMGC 3VA2C 3GJFK 2DJUA 5IM7A 2ATKA 4AM0Q 1TTUA 1F3JA 1BZ7B 1CE1H 2CXKA 4MXQD 1YNKL 1CLZL 2OZ4A 4BQ9A 1R3KB 1U4FA 4NO0D 5TPWH 2TSBA 1NKOA 4XO4A 2NSQA 4PJ6A 2P5WD 4J8QA 4ZUTA 1UWEL 3IDUA 3QT2A 4XN9A 5KS9A 1KXTB 1A9BB 4NIKB 3ECQA 4P2OD 2BNUA 3NAAH 3U1PA 5ITBH 5D5MA 4KJWD 2R69A 2EIKB 4DP6X 5FXCH 1AIFB 3FO2B 4FZ8L 4PJCE 3CBJB 4DAGL 1RMFH 3AZUA 1AXTL 1WC7B 2BNRA 4N8VG 1UT1A 1NGPL 3OTTA 5DVMA 1UHVA 1R4XA 4ODXB 3DI2B 4GW4A 4HA1A 1J0JA 4MQXC 1VFAA 3WSQL 1KF9B 1K3ZA 1YEHH 5KVMC 3NBNA 1XCXA 4OZHE 1UJ3B 5A2IH 2RHEA 1LO0L 1VKXA 2YD7A 2HN7A 2X2YA 1N18A 3P4NA 4BSVA 1GC1C 4NBXB 1QMUA 4HGWB 2HTKD 3NMEA 1SNRA 2EQDA 2CZNA 4HLZH 3U0TA 2IO5A 2WAHA 4XOCA 5CZXD 1U3NA 2XYBA 1MFDL 4ADIA 1XCTB 3OL2A 2BIIA 4PD4K 2DD8L 3CG8A 4KO6A 1JNNL 2NLJA 3NACH 4LLVB 4RMWA 3U4BL 2OL3A 3BUQA 2QLYA 4HHAA 3UEZA 3WIHH 1J48A 3BP4B 1ZTXH 1NFDA 3GI8L 2EIZB 2WVVB 2XVLA 1NAML 2FEJA 3ABMB 3DO7B 5JPMC 5EFIA 3KGTA 4K07A 3C6LA 5EIIG 2E27H 4DQOL 1PD6A 1NUGA 2E6QA 2WKOF 2YEQA 2FATL 2J8OA 3BFWA 3SE9L 5K1NA 3QNXB 1OPOA 1UCTA 4I2XE 2IWFA 4DPCX 1QTPA 2HJKA 5KJ7E 3RDJA 2V2TB 1AQDA 1Z9SB 1AI1H 1O7VA 2CBQA 4MNQA 4Y5XB 4PJ8A 2I5YH 5IVXE 2Q1EA 4GRWF 2WBWB 3VFPA 4JN2B 1HYSD 1OGAB 4JO2L 3PGCA 3HHRB 1U33A 2WBJC 2H32B 3G6JB 5CLZA 2H3NA 3QDGB 3UZEC 1M1XA 1ED3B 3QPQC 1T1ZA 3V0JA 3I75B 2FQGA 2QR0A 3LQAC 4JUTA 4AL8H 2OX5B 4PYGA 1WFJA 1IFRA 3B7UX 5F6IB 1LNUA 3TZVD 5D7IB 1SUJA 3QCVL 4U0RC 4AT6A 5I1CH 2FX9H 3QDMD 4QYAA 1GW0A 3MV9A 1TO5A 3QJFB 2FUQA 1IC5L 4Y16A 1L4IA 4JO1H 4OLZL 3BGMB 3ZL4L 5CEYB 5KSVB 1P4UA 1G7QB 4JFFB 1ASPA 4P4RA 5EN2A 2E7LA 4RA0C 5EPMA 4N0YH 4GLRI 4FNTA 3EO1B 5D2NA 4M6AA 5MERA 1WGOA 4KK6C 1XIWC 2IH8A 4JFYB 4XMKH 1UM5L 3MC0A 5KVFL 4Z7UE 2ZCHH 2E56A 1Y7VA 3H3PL 4X5PA 4NM4L 3IWUA 3UCQA 3NK4A 1U2CA 1I9IH 1X9QA 3DRTB 5E2WH 4N8PA 3U36B 1I8IA 2FEDC 1JFQH 4IK7A 4FG2A 4W4OC 3VDCA 1SLUA 2EE2A 4XHJC 4CU7A 3UPCA 4YNYB 3AFLA 1EO8L 1BFVL 4PJCF 4QRQB 2JKIS 1WRFA 3AACA 3UTTA 3ET9F 3S8WA 2I9TA 2NNCA 2IIJA 1PF3A 5JW3H 2MHAB 5GGVH 2GYSA 2YPLD 3TIDB 4C47A 2HVKB 1WZAA 3GTTA 4I0PD 3RIFK 3MLYL 2ZOKA 3GBMH 1KIQB 2MQGA 3DJRA 2C9XA 2MNJB 2YMOA 3CLFL 4KK8D 5LG6A 3OKEA 4GMSH 3WG7B 2ZKHH 3MRDA 1OGSA 4JDTH 3MRHA 2WSDA 2MCG1 3RKDD 3FU9A 3MNWB 3K6NA 5C0AA 4BH7B 5CBAA 5F6HJ 3HS0C 3OLGA 1JE6A 1SOQA 5AAWA 4FQQA 2NYYC 2VAAB 1TFPA 1PLGL 3IGLA 4A1RA 1AZZC 4EN2A 1J1XL 4JR9H 3IMSA 1MREL 2ZD0A 3VO0A 2NY6D 1AD0A 1F6AB 1K4CB 4MXVE 1JZFA 1JV5A 1MRCL 2C1PA 3KWTA 2BLFA 2P5EE 3RTLA 4NRZB 4EN3B 5JHBA 5HJDA 5EBMB 1NBYA 3F3HA 3G7TA 3N3EA 2DJMA 1HHKB 4GRLA 1L3WA 2JSFA 2ZKXA 5IROD 2ZZUT 5G4NA 3VFWA 3VXMA 1BECA 2DW5A 2EDKA 2WOYA 2VITB 5DHDA 3VWJD 5CFAA 4KNQA 3CXFA 4AENA 1NCJA 2EYTB 1SY6H 4HIXL 5BZZA 4DGIL 4U6XB 2VH5H 3RWJB 4XMPL 5IVXF 5EU6B 5SX5H 4U1GC 4RIRA 3V4PB 5IB1B 5HTSA 1NEZB 3T0XA 4MRBA 3ORJA 2OXGB 5HVGB 3QQDA 2A77L 2HG5B 4B7IA 5C1MB 1S7WB 5J56B 3NIGE 1KB5H 5E2UH 4FNSA 3P4LA 2WLIB 3RVWD 1F8TL 2K0RA 5C08B 4Q8BA 4I7ZC 1JZEA 3E80A 1N7ML 1R5VB 5MENB 1GZHA 4OVUA 2EUVA 4KX7A 1MI5B 2WWOA 2QSCH 4N5ED 2R2HA 1DBJL 3E3QE 2YGVA 3IJEB 4WJ5B 1KZYA 1JGUL 2NW2A 3NH7H 1LVEA 1GOFA 2J8UE 1AZBA 4HUUA 5CBEA 3W1ZA 3FMGH 4D3CH 3TF4A 1UCBH 3POCA 3JT2A 3OGCA 1IQDB 5D6DC 4NQSB 3BN9C 1MHPL 2A9ML 3O3EB 3RGVD 2APXA 1HTYA 3REWA 4G80A 4KMLB 4Y1TA 1BCIA 1GZQA 2R4SL 2WB7A 3NRQA 4LKXB 4OLWH 4ZNCD 3SPCA 2P4AB 1B6UA 5IEHB 3RFZB 1UWGL 2JKTM 1FL3A 3P11H 5F7DA 4Z7UF 5JXEA 3QFDA 2D0FA 3DMMD 2ZSVA 4NQVB 1YZZA 5KYWA 4LLWB 4KHTL 4V2CB 3DTXA 3FB5A 4LVHC 2QKSA 4R4BB 4MMZA 1IZJA 1GGIH 5E7FA 2APVA 2CKBB 4TVPD 2GTZA 3BYYA 5EEVA 4I77H 3F6IA 2XHNA 4PJDB 2C9UA 2DJSA 3FFCA 1I7UA 1MCOL 1A7QL 2AK1H 3QIUB 2DIEA 1G87A 1ULVA 5J6GB 3V79C 4HV8B 4PIRF 1UH2A 1S7RB 1VEOA 4KRPD 3WLBA 3QZWA 3FW6A 4DKFH 4KC3B 1QR1A 1EZVY 3BO8B 3FUIA 3SQOH 4O51A 2OP4L 1BVNT 3BH8B 3DX1A 1P5UC 3C5ZA 1RSFA 3PP3H 5LAXA 1ZS2A 3LQMA 3N40F 5GJSH 2R7EA 2DQFA 2Q86A 2YGQA 1OB1A 1MCIA 4PUBH 3BEVB 3JWNE 3UBXA 4UNVA 4AL8C 3PJSA 4N8CL 5MEPB 4Z78A 3UJIL 1I7ZA 2RQEA 5IWLC 3AG3B 3B2PA 4FCAA 3NZUA 4LQ1A 3BKCH 5GSRB 4EI5D 5BV7L 5SWZB 1XO8A 4FXGA 2F5BH 3CPLA 2IPKB 3F58H 5L6YH 3MBXL 1AY1L 4IKLA 2VLME 4RGNE 1VGEH 3OV6A 5K9JL 2ED6A 3D9AH 4MCZB 3SGDH 1ZPLA 4PRNA 5FF6B 3WO4B 1J0ZA 3FF7A 4XNZB 1U92B 1BFOA 1F2QA 4MXVF 3ZN6A 1PDKB 3CN0A 4IRSB 3PL6A 3PWUA 5H94B 1QPXA 1U42A 5F7YC 4RSVA 4BHUI 4O2CA 3GMPB 4OZHA 5C71A 1DQLH 4HCRA 3UTSB 3TWYA 2VR8A 3BX7C 3V0GA 5E4OA 2VKWA 1TJXA 4NBZB 5AOMA 4KKZA 4R97C 3OKOB 1LK3L 1VIWA 5IK3A 5IJCC 3TTYA 3S4SB 1PX8A 1R3JA 2V33A 3UJTH 4F9PA 5FB8B 3IGAA 2WGXA 4QKTA 4NJ9L 4XVOA 4KZDH 2WCGA 3TT1H 1C08A 4FQXC 1SHSA 5TGBA 3NIGF 5I5MA 4A2HA 3MCKA 4M43L 2VDOL 3ARFD 4QRAA 3WHXA 3ARDA 3NP4A 3QUZD 4G1EA 4N0FB 3MLRL 3ZDYE 1J1PL 2V37A 5C09E 3HFMH 4HWNA 4OJFH 3B9DA 1S9YA 4MDIA 4QAWA 4XPAL 1TLKA 5D4QA 5I6LA 1F02I 5EIVA 4B60A 2J8UF 3WY2A 5IQOA 4KDVA 1G6RB 2JK5A 4UQCA 3KJ4B 2K3TA 3NCXA 4DZ8A 2QPEB 1W15A 5C0BE 1DANT 3TWCH 1I1YA 5TE4H 1MW0A 3VRJB 1AQHA 5IWLA 4GUPB 3C6SA 3RKPA 3T9WA 3QHZH 2DZEA 4ZO6A 5EO9A 4R2GD 2WO2B 2UWEB 4J12A 1FC1A 2HKAA 3DX8B 5MI0C 3L2NA 1OTUC 3GS7A 1AHWC 1D7BA 1MF2H 2KZBA 5AW1B 4X7DC 4IKKA 4PG2C 5EO1A 1U8CA 1U8JB 2D7NA 2RBLA 1D5MA 2C26A 4Y4KB 4FYQA 3RVXD 4LVNC 1RCYA 2RH0A 4KROD 1DQIA 3P73A 3AY4A 4U1MB 4MAYD 1EHLL 2R9HD 3S3PA 5J3HD 1YDPB 4W9EC 5FYLD 4D0BA 2VDLB 3SD5A 1QWHA 1U6AH 4JKKA 1DVFC 5J1AA 3V55A 4HW6A 2NY2C 3O2WH 3UIYA 3MCLL 4GAGL 3BWUF 4U4BA 3SQBA 5B38B 2AQTA 1PZBA 1MNUL 5IMOA 4E41E 2QMJA 5LGYA 4N0RA 2IOIA 2AKRA 5BO1H 4JEGB 4CL7A 4ODSL 1Q8MA 1H6FA 1NMBH 2HLAB 2A1WH 3B7YA 4NWUL 4L1TA 3EYFA 4KPHL 3BHBB 4AKOA 3K2UL 5GGQL 2D9CA 3CSFA 5I5JA 1CO1A 2VXQL 4HK0B 1F41A 4GXUN 4YSRA 2CMRH 1THAA 1G0XA 2G75B 5EH1A 2IG2L 1KYFA 2AJXH 1LDPH 3DPDA 4WO4A 5IGXL 2A74B 4G9DA 3IN2A 1KTRL 5IMLB 2A9DA 5F9OH 3TCLA 1KIUA 2APWA 3JZYA 3SE3C 5GPRA 3TJEH 4WEBL 1NGWA 2ZUYA 1FIGL 3F65A 1PCSA 4M61A 4HKXB 4WCYL 4RGMC 4LSPL 4DCQB 5DD5H 5I6KA 1MWAL 3LRHA 1PLAA 4ZSOE 2NXYC 2JELL 2Z31B 5DVPA 4OCXH 4BFNA 4LF3B 4P2RE 5ID0B 1JZ5A 1OF2A 1YN7B 3O6ML 4KDWA 3P4OB 2OI9B 3VD2A 1K8DA 5I75C 2VDPH 4CMMB 4PY8J 4JZOB 3D3VE 5INCB 4AYMC 2YXMA 3I9IA 1YYML 4V1DE 1XGRA 4L4TB 5I1KH 5B4MD 2E4FA 2ED9A 2OR7A 1FYTE 4NO0B 2WIIA 3WLWD 3OKKB 3IMTA 3HB3B 4XN8A 3W0WB 4A2GA 4NPKA 2RAMA 1AG6A 3ZDYF 5KJ4A 3B2VL 4ODWA 2F8VA 4P2OB 1K5NB 1KTCA 2P5EA 4RGOH 5CILH 1KB5A 2WQUA 4CSPA 1G7MB 5I73B 3QEGL 2HRPH 2ZT9C 1FDLL 3O9WB 3PHOB 4IRZL 4LHJB 2EUZA 3RAJL 4DZBB 3W9EB 5AYUH 2J5LB 3HG1B 1PZ2A 1NGZB 3OB8A 3RI5K 2OKMA 4ZMZA 1JN6B 3Q2LA 4O58L 1IM9A 1MEXL 4GQQA 4XH2A 3M1OA 3GMMA 3RX9A 3DIVA 4G8EA 5HVHC 2XWCA 2GBAA 1VPOL 3QQNA 4JHWL 4S2SA 2YXWA 3BP6B 4WI0A 4Z3EA 1HEZB 3KWXA 3FOLA 3VXQA 4OR1A 4YSCA 1KNOA 4K73A 1XD0A 4LAQL 2JWYA 4EPSA 3K81A 4UOQA 5IFHH 1UD2A 1UZGA 1FSKC 4NNXA 4G83A 4Z3FA 1D7FA 1SM3L 1WUNT 5E8PA 2F18A 1HKFA 2QADB 1EDQA 5JO5B 5DUJA 2P7TB 2YAFA 1C8QA 2LT9A 4CNIA 4OV5A 3O3AA 2DQIL 2J8UA 3GDBA 2PNDA 3FUJA 3MNDA 4JRFA 2VMEA 4F5CE 3FB7B 3K1DA 3NDZE 1UEMA 5E9DB 3V9CA 4L5FH 4NNPL 2VW6A 4CGUB 3GSRA 4IBWA 32C2A 1JVLA 2F7PA 1PZSA 3BLPX 3GI9L 3CMGA 5D70L 4G3YH 2B1AH 1FNGA 3BDXA 1YMHA 4KI5C 1H6EA 4WUUD 2ZKWA 4EVNB 1JD9A 3DOHA 1NKRA 5JPNA 2D9QB 4KXZH 4TUOB 3MX0A 4PVNA 1W72L 1DCLA 3ILEA 3N1QC 2OYMA 2B14A 2FBJL 2WZ5A 5ID1A 3AS1A 3F7YA 4HIJB 5IB5A 2UYLA 1V5JA 2F61A 1LO4L 4E9YA 4JHVA 3CVIL 3TA3D 3FQNA 3NIDB 4OUOA 3STBA 3BPCB 4P9ML 4B9CA 3WFCL 4H7VA 1RU9H 1FVDA 2R1XA 1NC2A 1ZE3H 2Z7UA 4FYRA 5I8CB 3FKUS 4P5SA 4UM9A 4PHZA 3TZVB 3ULUE 3QQ3B 5H35B 3RFRA 1KG0B 3LEYL 4DESA 4YHNB 4GIOA 3W5NA 2W1NA 2X4OB 4Q97A 1BA9A 1T03H 1E2VA 2QVKA 2XNAB 4NUGH 3L5HA 5AOJA 1TTRA 3OD3A 4OT1L 5EBGA 3DX6A 5IQLA 4J1UA 3EOBB 1X7QA 3QG7L 3Q8CA 4PJXE 5HPMA 5I5RA 4ZYKA 4QHLA 2W0PA 4LSSH 1E4XI 4ETQA 1JXDA 2ZOLA 4GUOA 2A0LC 3O6FD 4OD3L 2V6HA 2WLHA 5FKAB 4X5XA 3E6HA 3ZQWA 2VMJA 2DTSA 1GHFL 2FGWL 2AZUA 3D12B 2QQKH 1KJVB 4PRDB 3S97C 4BGLA 1F11B 1Z5LB 2FVNA 2PYED 4U2YA 3L3KA 1EDYA 4JFEB 2VDML 2WWKT 4YWGL 3KG5A 4B97A 4MFHA 3VI4B 4FP8H 4KKCD 2YUVA 2BSED 3IRPX 1F4XL 4RFEA 1NCCL 3STLA 3AVEA 1MFCH 2ZWNA 2VR4A 1MQ8A 3KLAB 4UTBA 4OGYH 4XAKE 2I32A 1IEHA 2ZKYA 3KJ6L 1LE9A 4KY1L 4I0PB 1BXUA 3A4DA 1AP2A 3FTYA 4F1SA 1P2CB 4L8SB 4YHPB 5D1ZI 5HGGS 2OMWA 2G60L 1T0MA 2BP0A 5IVZA 4EI6A 2QZ5A 5DS8B 1G4RA 2XSKA 3FQ1A 3O6LL 4UNUA 4UYQA 1OCRB 2XWDA 1WTGT 1TVHB 1ZOXA 5DQDL 3D69B 2C5DC 2WUCH 4HIEB 5C09A 4JY6A 2DWYA 3O8XA 4GQPH 3EOAA 3FQXB 5H8DA 1FNEA 3SE6A 3ELAT 3UO1L 3T4AB 2X1PA 4EZLA 4GRMB 3L4YA 1HHGA 3TBYB 2AI0L 2ICWJ 3KPOB 3ML9A 1HH9B 2B1HH 5DMYA 3LZLA 5C0BA 5I76B 3L3HB 1KJMB 1EV2E 2XWEA 3LKQB 3AS2A 4QKXB 3ARPA 2ZAHA 3K74B 5EORL 5EO0B 3T8XB 3GSNB 3CZFB 1X9UA 4ANKA 5B21A 4JK0D 3KAAA 1L9PA 4WUKL 3VM5A 3BN3B 3K72B 1IEAB 1FFPA 1G1CA 3VWJB 1WBXA 2CO7B 5I5IA 4TRPL 1H9VA 2NW3B 4MCMA 2VC2H 2YD5A 1E3ZA 2XA3A 3JYCA 1JRHI 3IDYB 4L9LC 3QO1B 4QY8A 4M3HA 2PXYA 2DI7A 4RMTA 5GHWH 2DQDH 1JTPA 2K9FB 4FL4C 1VACB 4PRAB 3ZK0A 2EYSA 2VDKH 2XX0A 1SVCP 1PPIA 3LDBC 1PLBA 3ESUF 4J27A 3ARTA 2EO7A 4F93B 1T3FB 2R39A 2BWDA 4W9JC 1UA6H 1R0AH 3M8OH 3D30A 35C8L 1AE6H 3UL4A 2F54D 3LS4H 2V3DA 3IXAB 3MV11 4E41A 1DDHA 4KVPA 3V4UL 4LOVA 3ZQ9A 5JUEH 4LCCC 1U91A 3FB6B 1F56A 3L17A 1H8OA 1CGSH 2HT3C 4KK9C 3T3ME 4EIBA 2Z8RA 4ZMXA 1KTLB 5HVFB 2X42A 2OMYA 4X83A 5IQ7H 3LIZL 1UVQA 4ZTPH 1F0LA 2OMBA 3DBXB 2NX5E 4PJXF 5E8NB 5E08H 2XN0A 4FKKA 1TUPA 1IBZA 2KMWA 5CP3A 2L4OA 3JQOB 4BK5A 1ECZA 3S5LB 1OAKL 1B3JA 3MRNB 3Q5TA 3KBHE 3DO3A 1JHTA 5IBTH 1HH6B 3ZY7A 2Z65C 4Y2DC 3QUHA 3PAVA 3FAXA 2V5SA 3LKSA 2NT1A 3QUXD 4AGMA 1UQSB 1YEJL 1OTSC 3ZTDC 5A16A 4ZT1A 1ZVSA 2CIKA 2YPVL 1ZT7B 4ONHB 1E9OB 4AVIA 1OAZL 3SDXA 3N85H 3QXVA 4XCNA 1R19A 2GTWA 1A6WH 1LEKA 2C9QA 2R0LH 1KMGA 3BP7A 3TESA 4NQDD 3KCPA 4PV8A 3WTTA 4P2RA 3F01A 2ZJSH 1AZRA 4GOSA 4YIQB 1SXZA 4PGZA 4YDVB 3L95A 3AREA 2R2BA 3X1FA 1ZGLA 5E1QA 1ONQA 1VAHA 3O6KH 4IRJA 3D3VA 4M93C 4WTQA 5EV7A 3SGEH 3UTPE 4HOWA 2WQAA 4H0HB 2O5ZH 3EYQD 3OMNB 4HJ0D 3ZYIA 1ZE3C 4IMLA 4R0LC 4UIKH 4E9XA 4JLRB 1YA5A 2AEWA 2IJ0C 3QZMA 4KRLB 3WIFB 2WLKA 4XPHH 1NM9A 1KIRA 2VLJE 4F15C 4RVBA 3T2PA 4KKLD 4EI5B 3S36L 3H6AA 4WFEE 1UOLA 5IT2L 1M42A 4HSQA 1YSOA 2ZX9A 3LSOA 1Q9LB 4JDZB 3ARBB 2E3VA 3D08A 5ENWB 3AM8A 2AMGA 3HFFA 5CEZH 4BKLA 4XI5D 2IQAB 3BD4A 1TETL 2ZCLL 3QA3B 4LHUD 4X9HA 4H8HA 2B2XH 4AQAB 4XPFL 3QDJB 4IBTA 2H4EA 4NT6A 1OL0A 1N59A 3WN6A 2OMXB 4E0RA 5I1IL 1VJSA 3S34L 3DYMA 4O02A 4GBXA 5F0LB 2CK0H 1N6QL 3FZUD 3FQUB 4UBDD 3KYMA 2PCPA 4IS6B 2I26N 4APXA 2O6DA 1MVYA 1QLEB 5KJRH 5D4HA 4NUJB 3D8MA 1D5XB 4YO0A 5K9QG 3IJHB 2BCMA 4U1SB 1JERA 2BERA 2GJZB 2FJFA 4ZFOB 3SGJA 3TBCA 2VXVL 4PMFA 5T5FA 4KI1A 4UQ9A 4HPYL 2D7QA 3SGKA 2YXVA 2L7JA 1DFBH 1WS8A 3Q05A 1LEIA 1MVUA 4J8RB 5FECB 4KKRA 3MUGA 3OWRA 3BKMH 4LSVH 3QUZB 2J43A 2VO8A 2WYHA 4PRIA 4CSTA 4F5CA 3ILDA 3LHPL 3LKOA 4PWKA 5HDWA 5DYOB 2AZAA 4FRWA 1TZOA 3KPSE 2FIKA 1FWXA 3CHXA 1XGTA 4QCIA 1ADQA 2YD4A 3HLAB 3MRBA 1C5DA 1CGVA 3BZFA 3QIWA 4YGVB 5ICZB 3B43A 3VVWA 2LOEA 4AIOA 2ZKMX 1QZ1A 2QGDA 3QQ4A 4C56A 4MXWL 4X98B 3VTMA 3W38A 3VWKD 3T3MF 3QUMA 3COOA 5FYJE 2NY1D 1A2YB 1A6ZB 3WAJA 1QO3A 4KKNA 3WFEH 1DL7H 4LCYA 3UZQB 6FABH 2VN6A 4X4YB 4H25A 1IGJB 5IVOA 5KVGH 4MZ2A 1DLFL 5JNYB 3FQWA 4BWWA 1IBYA 4AE0A 5FO8A 4M1DH 4KDTA 5FA3B 1M7XA 3TN0A 2G3MA 2NTSP 1A14H 3B37A 5F3FA 1NGXA 1PNCA 4G72B 2R29L 1SDDA 4BELD 4WWOA 2YGPA 4QXGH 1M3IA 1NANH 5JIQA 5T3XD 3EZ8A 2BY1A 3G6AA 3WJLA 3WUWB 1CVRA 1HZHL 5K9KA 3QW9A 3BPNC 5C0NC 3CCHA 2B4CH 4PWEA 1DQDH 3RNKB 5JQ6L 3DURB 5EUKA 3HC2A 4QHUB 1C16B 2F8OA 2FYYB 3IXTA 4NCDA 3VFSA 2MMXA 3IBEA 1YEKL 3D39E 3TVMA 3U1SL 4N25A 1FV1A 5CGYD 3H9HA 5DJ8A 2ZP8A 1MW2A 3CFKB 1F18A 4H8WL 1HCYA 3V7MA 3B8YA 4BE6A 3C8KA 2CA4A 4RFNC 3QWRD 4ZOAA 5E51A 3N0PB 1HQRA 3WDHA 1OOAA 2BSTB 2TSAA 3DVIA 1JHLH 3BUYB 1CE6A 1ND0A 3OC8A 1FO0A 4UAOB 3ULAB 3G5YA 4FI8A 4NI6A 4LESA 4DN3L 3L3JA 1H3VA 5I1HH 2X9WA 3ZJAA 2LVEA 1YJDL 3KGUA 2DEYX 3ULVL 1HU8A 1R9FA 3VFRB 5F44A 1G94A 3T0EE 1AQMA 4JQVA 1F1AA 1NDGA 2QVFB 2X2IA 3V4VA 1BVLB 2M8XA 3ELQA 2XWXA 1GSMA 2KLTA 4UDUA 4Y4FA 1G9NH 3BDYH 4N90E 2ALWA 4NQQA 5DQ9B 2E74C 3BH9B 5A2AA 2QVMA 1ZT4A 5HJ3A 3WGVB 4YHZL 2J55A 1N26A 4UV7L 2X4UA 1AQ8A 2DPKA 3VXRE 4S1DD 4BZ2H 2DQGH 2ITFA 1UM4H 3OXRB 3QIBB 1IBGH 5T1MA 1IBHA 4NJAH 1AD9A 4AGLA 2AEPH 3LKRB 2DQUH 2BIOA 2H32H 3H2WA 4RNRB 2WJ5A 1J8RA 2GITB 4UT7L 4AE1A 3PXLA 2CHWA 5FHBL 4I8DA 1CK0L 3IFLH 5DRWB 4HGMA 1YQVH 4XVJH 1BJ8A 1ZT1B 2ADGB 4YHYB 4JM4H 1ZSDA 3P9MB 2YUZA 3C08H 4JO8A 3WNMA 3MRGB 1IFHH 4M1GH 5GGRA 3AMKA 1O6VA 4XNUH 3O4LD 3LPGA 5E2VH 1G7PB 5CP7A 5BRZD 4AYFB 2VLKD 4A66A 2DM2A 5F7KC 5JDJA 3FONB 4M3JA 5DUML 3LPWA 2I07A 4PG9B 3QZWG 3LNEA 4A7VA 1P6FA 1A4AA 2NY7L 1BOGB 1MJ7H 2YPKB 4KNSA 1DJYA 2LABA 4PRHB 4F9LC 3D34A 3G5XA 3Q6FB 2IGFL 3AU0A 3KPTA 1QKZH 4JHZA 5FDWB 4QRPB 5GRZA 5BQ7B 4DPRA 3GJEA 1CD8A 3JV4B 4WW2B 3X12A 2NUPA 2DS4A 1LE5A 2JKXA 4GSDH 1NINA 2QPDB 3RJDA 1QUNA 3WDIA 2FWSA 4JG0H 5ACZB 4XP4L 1FN4A 4GQ9H 2AANA 4YHOL 5EWIL 4OBRA 15C8L 5KYUA 5C0EB 2OJEA 1OAJA 4G8IB 4PGCB 4HLZG 2G30A 5KBLA 4EAEA 3L4UA 1OK0A 3EW3B 3GXFA 3U30B 4W9IC 4OTXH 2VDNH 1BVKB 1RZ7H 3L7EB 3M1BA 5CFHA 4YSDA 4J6RH 4BH8B 2WSKA 3INOA 1BVOA 1VGKA 3MREA 2YSSB 3OC5A 1LQBC 1JK9A 3WKMH 2DQ6A 1OCWL 2F6AA 3LZFL 2VDRL 4JRXD 5IQMA 4O9HL 5B1JC 1NFKA 1PSKL 3O0RL 1CLZH 2A9NL 3RPBA 4Z3JA 4OCRH 1T1XB 4OM0L 4X6FB 3ZTNH 1PFCA 3KL5A 5KBMA 5EOQH 3EH4B 4P4KB 2FWOB 2XY1A 2K8MA 1N8ZA 4QTFA 3C60D 5FWRA 3VCLB 4AW7A 1W8EA 2Z8WC 2YSTA 2A73A 3F6JA 2H9GB 1S7VB 3G08B 3LZRA 2LHAA 5JORB 1YPZA 4L29B 4JZJA 3QUYC 1TJMA 5DMIH 1UURA 2WNGA 2XTJD 1BAWA 3U6RA 2RFXA 5D7LE 2ZF8A 3CFEA 2VDQL 5DJYB 5SX5K 3MUJA 2HMID 3WSQH 2UY7B 4QDGA 5AOLA 3RA7L 1F6LL 5AW3B 5I16A 4XTRC 1N3NA 1UZ6E 3CLEL 4RMBA 4AYBA 4I4WB 1ROWA 5F7EH 1I1RA 1LO0H 4B27A 3MMEB 2KT6A 4OB5H 4PSRA 1N10A 3EJJX 3SCMD 5F1NA 1QLFB 2AQ2A 2HRGA 5DC4B 3RIAF 2W07A 2A6JB 4LT7A 3B9VA 4ZAKD 2ZUUA 4PJEB 4GSQA 2JCCB 3SDCA 4GW1B 2V5RA 4NKOA 3ARGB 4NN7B 4YC2B 3U4BH 3RP1A 1EGJL 2PWFA 1T66D 1UFGA 2O6PA 4QT5B 4XCYB 4JHAL 3PHQB 2PYEB 1ZS8B 1S3KL 1S3RA 5E94A 4Q9RL 5ICUA 1R3LB 2RQ8A 2UZYA 5D7HA 4NLAA 2X9ZA 1CN4A 5ETUB 4DQOH 1BD2E 4F37K 1RZFH 3PAZA 2FATH 3SE9H 3GUFA 5A3ID 2VQ1A 4AC2A 5IHLB 1ES0B 1CI3M 1D2OA 2J72A 2PCFB 3VB9A 1XXDC 4X7CC 1WUZA 1B4RA 2LAGB 1H3PL 4AW4A 4AZ8A 1FNSL 5C9JA 3D25A 4YBQD 1S5HB 3RWFA 4K8RC 3GMLA 4HT1L 3KPLA 1MFUA 4N2CA 1YYCA 1MIML 4RAVB 3V6ZB 4JANB 1I85A 1FZMB 2XWJB 5G5DB 5JHLL 3NJKA 3FTGA 4OIBA 4KZ0A 5JYMA 3I6GB 3GSVB 3KPSA 1G9NC 4HUNB 5DJZA 4AQ1A 4N2HA 3T2NL 3WN5A 4YZFE 4UQEA 2R4RH 3QEHA 4OIIH 3V95A 3FQRA 1IGTA 2E7BA 3QPXH 5HJBA 1OAQL 4U6VL 2CDEB 2EXTA 2XBDA 5KVFE 3TASA 4N8VB 3WL9B 3PP3K 5KBKA 1X9LA 4D0DA 3R1GL 2BNQB 2X3CA 4Q0XL 4WK4B 3VB8A 2X38A 1ZRUA 2H6PB 5DT1L 2EZ0D 2LLNA 2F74B 3A5VA 4HKZA 4HS8H 3VYOA 4N2OA 3EXJA 2WZPA 4OLZH 3LOWA 3GHEH 2E76C 1ROCA 3PXHA 2DY2A 4B3VA 3IU3A 3PIQB 4M4RA 3UAEA 5MEOB 1P7QB 5E56A 1GYUA 1HESA 4LSTL 5HHOD 3GXUB 2Y3AA 4K7FA 1UKTA 5F6IC 3IAQA 5D1ZA 1HC1A 4G1MB 3DGDA 1PL3A 3H3PH 3VAEA 5HBBA 4XP6L 2VISA 4D0CA 4NM4H 3JT0A 2WQVA 1EAQA 3TJHC 4Z7QB 3V0EA 2QLVB 5HYFA 1AHMA 4MQ7B 5AVTB 2ZONA 3PGFL 5EU3B 3TO4B 3TBTB 1JGDB 5TK4A 1J0HA 3OPZH 3IMBA 3SBWA 3DWTA 3GMNA 5C0CD 4FFVD 5EIIB 1EO8H 1I8MA 1QFOA 3D85A 2XWTB 2DLFL 1R3IH 2F54B 1RXLA 5LNGA 1MIEL 2V5MA 1YUHB 2IADB 4N2IA 2B77A 2PO6A 3U9WA 1PZDA 4MJHA 4X7SL 1M71A 1UZ6F 1ZCRA 2WN2A 3KYNB 4LPWA 2VE6B 2K8QA 2DIBA 5DJAB 3FQTA 4UQ3B 3T0AA 2OCFD 4HAGA 3MYZA 3P2DA 1M7DA 3V4PL 3QYNA 3FQYA 2OSYA 4Z95H 2BCKA 1DSYA 3MRMB 5DK2B 4OZ4A 2YRLA 4PJGE 5JOFA 2HH0H 1AQKL 1UXLA 3WTVA 1T20B 2LU5A 5LN8A 3HBPA 3CVHL 1G4MA 3NCYP 5I30H 4BA8A 4W70A 4TUKH 5D8JL 1R5WB 1GVIA 4JGNA 3OXSA 3GJFB 3TX4A 3SE4C 4YFLF 1DJHA 3GO1H 4IU2A 1ZA6A 3LNIA 2N59A 4HU2A 1R5IB 5FYJU 3HNSH 2XVKA 3CUPB 4F8NA 2UZPA 1DVYA 3IU4L 4FXKB 1INQB 3KXFA 1LHZA 1WIUA 2EO9A 3MRCB 1N4XH 3VXRA 3O2DL 4HIXH 4DGIH 4G7RB 3MRRB 2Y06H 3MPCA 4XMPH 1N5AB 3ZT5A 4HULB 4KVCH 1N19A 1KGCE 2AJ3A 2V8MA 4Q58C 5D1QC 4Z18A 1VFMA 2YFNA 1ZWIB 1A21A 1RZJL 4CBPA 4ABQA 2ZXBA 4EN3C 2BRRH 5HYSG 2X9XA 2GK0A 2NR6D 4Y4HB 3FT3B 1U3HB 4GG8B 4RMRA 3NTCL 4PN6A 3UBFA 3PV7A 1Z32X 4ZXBB 4YZFF 1G5GA 4F58H 1SXAA 2BM3A 3RUGE 1BEYL 3IMUA 2X4SA 1DBJH 4WEUD 2VJ0A 1A1OA 1W8NA 3BP5B 4Q7DA 4Y1AD 1N68A 2IC2A 3KPNB 2VDLH 4ZTOL 3ETBF 1U3YA 3KLQA 5AB9A 4UT6A 4DKDC 3JWOH 5FUCE 3FSAA 1DVQA 5E1GA 3KL0A 1RUPH 4S11A 4UOJA 5GGTL 2NZIA 4APQA 1MDTA 1ZDSA 1QQDB 3T4YA 5KSAC 2XN9E 3L7FA 4Z8FL 3DVNA 2CGYA 1HHJB 5TE7H 3JWNG 1WZMA 1I1FB 1F6FB 3D0VA 3GTNA 2CR6A 4YX2H 2R4SH 2XZAH 3PWPD 3LN9A 4FHJA 2XXGA 1UWGH 2D0GA 3ZRSA 3BQUC 1L9QA 3ECBA 4D7PA 1TMQA 2FT8A 3SDAC 1NUDA 4UQ2A 1HOCB 1T1YB 1IM3D 1RHHA 2XV2A 3NJJA 5HHPB 2ADIA 1Q0XH 3J2PA 4ICXA 1XMWA 1PW3A 5MHSE 3WFDH 3LQZA 3L4ZA 3CFBA 3S9DB 3NRPA 5GGUA 3BFOA 1E4JA 4GPVA 1MUJA 4HFUL 5MP6L 5D7JD 5J0BA 3I9PA 2E6JA 3X14A 3RFZC 1JNJA 4OV6F 2Q7AA 1YMME 1DBAL 1KCRH 4KTEL 4PY7B 4C4KO 1A4BA 4JM2A 4K3EL 5D1QA 3ZYJA 5IBLD 2OP4H 4NNYA 1DO6A 1GXEA 1F90H 1GKEA 3UDWC 2AK4D 3E6FB 4CRPA 5I0ZA 1UH3A 2KI6A 4R7DA 1DQQA 2E6PA 5JR1L 1EXUB 2YAMA 3MV8A 3RHWF 2HFEB 4ZZKA 1X4YA 1N70A 5DD3L 3VE0A 5GZNC 2A4EA 2XVGA 2VLRB 4PJGF 4F80A 3QIUC 1TCRA 1OT4A 2X89D 2J1KA 4JJHA 3QC6X 1CD0A 2OMZA 5E6IA 1V27A 1UD3A 4NHCL 4HWZA 2JV6A 1BQKA 3HKZA 4G70B 4GJTB 2FO1A 1ZTMA 3FUHA 1IAOB 3S35X 5CCJA 1INDH 1W0VB 2HRHA 1O6SB 4L4VB 1FFRA 1G6RL 3AQXA 3OAZK 4M6NH 1XH3A 4UT9L 1SFDA 1NAMA 4XCFL 2X2HA 3MO1B 2BC4A 4O2FA 2ZUQB 1T4KA 1WD9A 1RIHL 4EUPA 2EICA 3EAKA 3KLLA 4LCWD 3IRCA 5EU7C 1HILA 2YAHA 1KCBA 4NBYB 4G6AC 4NCC1 2YD3A 3WO4C 4DO6A 2L7UA 4NJ9H 4XNZC 1WF5A 3CZEA 4IRSC 5DMKB 3VXSE 3PJLA 5DVKA 1ASQA 3JTSA 4IDJH 5JXAL 2JJWA 1EMTH 4M43H 2VDOH 4PJFF 3IKCA 4AYDC 5DLLA 1J1OL 1J1PH 1H5BB 4WEEA 1PBYA 5C07E 3PWJA 1NA8A 5BRPA 4FULA 4NCC2 4U3SB 4L1HA 1YO4A 4NSKA 4YHIB 3C8HA 1Q4NX 5DD0L 1WH0A 4N3TA 2PWDA 1JP5A 3FFDA 4HUVA 5AFAA 5GZOA 5ERWB 1B9ZA 2V8LA 5DRZA 4XC3L 1I9JL 4JAMA 3GB7A 1ORSA 4GKSA 5F0MB 1KJ2L 2G4EA 2QV4A 1KPVB 4OJYA 4PJ5E 5DJCB 4WFGD 1CR9L 4L37B 1QSEE 2QBWA 2Z35B 4F7EB 1L7IL 2V7NA 5L7XL 3APFA 4PJ8D 3ZU8A 5SWQB 1WIOA 4R8WL 3IPBA 3ZKND 2IBGA 1RZGA 2HPTA 3KJ4C 3NEOA 4FN0A 4NRYB 5BS0E 1XB6A 5JLZA 4YE4H 2VABA 2W9EL 3LB6D 4CADA 1NEPA 3RL2A 3AXLA 1SBSH 1NCAH 2C1OA 4JQIL 4LB8A 3GTVA 3AS3A 5CR8A 4FCHA 5JIMA 2VAJA 3PWNA 4S1RL 3PP4L 1XZWA 3QXDA 2RACA 1NCOA 4ADJA 1B0WA 4KZEH 1FVCB 4BSWB 1AFVH 3EUUA 3O4LB 3P02A 2IXQA 4GAGH 5K39A 3D18B 3MV9D 2ZSWB 3QRGL 1ORQB 3BKYH 1KCSH 1OP9A 3DROB 5CSZB 5KSBE 3SQRA 4WJG3 3DX7A 4Y4KC 1HOEA 3RDTD 3QORB 1AYRA 1QEWB 1ZHKB 2P8PA 3EYUL 5HHQB 1GS8A 3GM0A 4YHMH 3CC5B 4WQOA 3W39A 2O30A 2OMVA 4NWUH 4KPHH 3TM6A 3K2UH 5GGQH 1I3RB 1Z9NA 5AG9A 1W80A 5AB2A 1CT8B 2VXQH 2NYKA 3S37L 5EU4B 3UJJH 2ATPB 1KXVA 3JWOC 2A6DA 5INDB 4PJIE 2HP4A 1QD0A 4IGBA 4E42A 1JMXA 3QUGA 4WWPA 4PP1D 4ZX4A 2EDFA 1J8HE 3O2VL 5FYKE 4L1LA 3P77A 3ZDWA 3UC2A 4DVBA 2WO3B 4IIZA 1PEZA 5CMAB 1LO2H 5AAMA 1JNHA 4FTVE 4MZIA 1L7TH 5I15H 4EKJA 3US1A 4KI5E 1KTDA 3UTTD 3AAZB 2J2ZA 5HHMD 4CJ0A 3HI6H 3UAJA 2F19L 5JW4N 3ZMNA 3TV3L 1MWAH 3ILQD 1OW0C 2E0PA 1A4JB 3HC0B 5FO2A 5I74B 4B3EA 1DVTA 1QFWL 1FZJB 2J4WH 3LRMA 3O6MH 4X9IA 3W9DA 4ODBD 2Y36L 5M94B 4PJGA 5I6OA 2A74C 3B9KB 4KH9A 4JRXB 2CM5A 1A6TA 3UC0L 4FNRA 1RK7A 1F2XK 1D6EB 4Z7NB 4YUEL 4ELME 1ZIBA 5I28A 1UACH 2Z6FA 4M6MH 5CD3B 1T6WA 4XXCA 5C0AD 3DI3B 1JK8A 1JSYA 1BF5A 5DC0A 2BMKB 1J0IA 5IMKA 4AG4H 4I48B 5LCVH 5T1LB 1XCQA 2EIBA 3B2VH 2Z31C 2GT9B 3UPRA 2X4QA 2NY4B 3I3BA 3KEDA 3U82B 3F12B 4X6EB 2OI9C 4XR8C 1IMHC 3UMTA 4EF3A 2G2PA 3WD5L 2PR4L 5IY5B 3QAZC 5TDPA 1B88A 5C0GA 1M56B 2EH8L 1SDYA 1SHMA 1I3VA 1PJ9A 3OKLB 4QGYA 4GRLD 3JV6B 4XWGL 1YEFL 3DECA 3RB7A 3KPMA 5LXVA 1MH5A 4UMGA 3SKOB 3VXMD 4BCXA 1NDMA 4HIHB 3DUSA 3AC0A 2W88A 4P2OC 4WI7A 4WY7L 3JTBA 4H0GA 4CVXB 4MJ5A 1NH6A 2KPNA 3SCMB 3BAXA 4LAQH 1T0NB 4KJWC 2G2NA 4KBPA 3BZ4A 1YAZA 5CJOL 4XBPA 4B9FA 3NJMA 4PR5A 2E8ZA 4QF1B 1ID2A 1QA9A 1SPDA 2J5LC 5GIRA 4Z3IA 2YARA 3I85A 5LGHH 3RUGA 2XWZA 4PJBF 4UZGA 4JPSA 3VXUD 2IAMA 2CQVA 3CQQA 4XCEB 5HHXL 2PPDA 3LZOA 5LUMA 2BY3A 1BZQK 1CFSA 1T5XA 5CHNA 2Y7OA 1JZIA 5I1GL 3LV3B 2LQRA 1I4FB 2HTKC 2EDLA 1EXHA 3FN0L 2BFVL 3LRKA 5CZXC 4BZ1L 3QE5A 3L3DA 4JG1L 4N4YB 4LQFH 2HRLA 5KSBF 1GPOL 4EOWL 4OGQC 2CHDA 5C0RH 2P8MA 1KC5L 3QJVB 4ZFQA 3MJ9H 4UUJB 2OPCA 5C8JA 2D3LA 2WM0A 1EHNA 4LCUA 1OPGL 1XF5A 4OGAD 1UG9A 3OAYK 5K59E 1MJUH 5CN2A 4XZUB 3VFUB 3HE6A 4DERA 3T3PF 2ZWSA 2A4CA 5JXED 4XP5H 5TE6L 2PW1A 3ZUNC 5BZWA 4WFFD 2UUDH 4LASL 3Q9PA 5F9WB 2C9RA 1IT9L 3CVIH 5JOPD 2GCYA 3FUNA 2ZWLT 4WU5A 2IPUK 1FL6B 4FQIL 1YMMA 1MFBL 4TVPH 5J13B 3QEQE 1WCQA 4Q9QL 3RWHA 1U3ZA 1TVBB 1JYWA 1FRGH 3FFCD 2BJML 1A4CA 3MTXA 4GKZA 1BJ1J 1YG9A 3CIQA 4KI5F 2IANE 4Z7WE 2GB2A 3LEYH 4X0KA 2YLHA 1HYSC 2VIRA 3QJXA 5BVPH 1I1AA 2X0UA 2ICEA 3RRQA 4H2AA 1DEDA 1F4WL 2WTRA 3C5ZD 3DGGA 3OKDB 1NFIB 5T1KB 1BP3B 1HEJC 2GPZA 3EFFB 3IJYA 4WWKD 4D9LH 2EDNA 2Y5TB 2J8HA 4LVOC 4MWFA 5BXFB 7FABL 4NGHH 3KVQA 4X4XA 5HHOB 3H54A 4V11A 5D1XE 4LLDA 3WKQA 4ZK8A 3CXDH 3TZVC 3FRPA 4OD3H 4OIAA 4YSOA 4N5UA 3SYPA 2Z0BA 1U8LB 3QCTL 2H41A 3VM7A 1DSFL 2IBZY 1KV3A 2FGWH 4XN5A 1OANA 3T5WA 2YBGA 2ICWB 1I8AA 1J5CA 1GGCL 2P26A 1FG9C 5LG1A 4D8PA 3APNA 2CCLA 5AZ2L 3TH2T 3S35H 2XVBA 2WXPA 2D4DA 3X11A 4E9VA 1BV8A 2Q76A 3PL6D 1MRDL 1EJFA 3GMOA 4Y7MA 5HGAA 4M8QB 3ISYA 4X9FA 3HOGA 3I9GH 3DX9B 5DO2C 1FORL 1MSPA 3KJ6H 4WAFA 4KY1H 5DS1A 4BINA 2EC8A 1J9CT 2F68X 5CLYA 3VXSA 4A2LA 1I9EA 5GS0C 2JB6A 3O6LH 1QBMH 3SD2A 2OCJA 4QRTA 3ULSB 5I66B 5DQDH 1P4BL 4Z76B 4GY4A 3MLUL 2Q10A 1CL7I 3CK0L 5CAYB 3V5DA 4LSUL 5DYFA 1D6VH 2A2QT 3D2UD 3ARDD 3LD8B 5KYNA 4I0PC 3OR7A 4DUWA 2HVJA 4HWBL 4H26B 1IGYB 3A6BH 5AVQB 1B4TA 5IB4A 3VYPA 2JJSA 5C2BL 3CDGB 4F8QA 4BJLA 4GB9A 5JHMA 3BC9A 4ZW5A 1EK3A 4NQEE 2X0VA 5CWSB 4IKNA 3RKDC 5IOPB 1Q9OA 1CDIA 1HKLH 4PJ5A 1HL9A 4PJ9D 5JZ7D 5J11B 2AJSL 2C8NA 2V9UA 3HAEA 1BZ9B 1CLOH 1R24A 1HFUA 5CZVL 1TQWA 1JZHA 3FULA 1JWSB 1A3LL 1KELH 3PNWA 5ALCL 3T4AC 4HC1H 4X6DE 1IC1A 2IPUG 4X80L 4J4PA 5BS0A 1AYOA 5IOKA 3BESR 2PW2A 3QNZB 4KX8A 3R0NA 1ICTA 4BFJA 4XX1E 4ZMYA 1OE2A 3FTVA 3OPUA 1SXBA 1P53A 5D6CB 1CIDA 2VL5A 2XXFA 4U6YB 1N64H 4TVUA 5HHVL 2VXQA 4JFSA 2DMGA 3QYMA 1YNLL 3CXHK 5C0IA 3VWJC 3LKNA 4HZLA 1DLHB 4N2FA 3BKJH 2F1AA 1YNTA 5GRVK 2EC9U 1E28A 1QWUA 1MN4A 4OLXL 3N43F 3IDYC 4NHUB 4XVSH 3QJTB 5FYLH 3V4UH 4WU7B 4OZGE 4TS6A 5FO9B 5KSBA 1B3IA 3HI5H 1X5KA 2IF7A 5DJ2A 2BK8A 5GQBA 1MHEB 1NIDA 1H6UA 2JCWA 3STZB 5EZOH 5IFJB 1XQ4A 3IDMA 5KTEL 3RVWC 7TAAA 3HZVB 2BVPA 3NIFB 3T1FA 2DQHH 2QSVA 3QNYA 1MWAA 2VUKA 3EYOA 3PWPB 4P3DB 1S9KC 4YDJA 4ZS6D 4PJIA 1OQXA 1EFQA 4N5EC 1G84A 1JTOA 1X5FA 3W81A 5CKAA 4GG6B 1MCNA 4OH2A 2CALA 1Q90A 3GIZH 1OAKH 1J8HA 2IALA 4Y0GA 4DIXA 1DJWA 1PZ5A 3PABA 2HT2D 4XNMB 5F97E 2Q2LA 5DEFB 2WSPA 5AVXB 5TDOB 1KYOJ 5DJ6B 1J8SA 3CMOL 4JDVB 4NC1C 1YYLH 4WO4D 1C12B 4BYHA 4TNWK 2VRQA 4XO5A 3RGVC 1NPJA 4WNQA 3CFIC 5B3NA 4ZPTB 3VG0H 1BFSA 5D7JB 4MJ4A 5HYEA 3AT8A 1FZKA 4Y9CA 5FFGA 5DQJB 5LGKA 2O6CA 1GJUA 1G7JA 5IR1A 4HBQA 1MW1A 1F45A 2MCPH 3DMMC 3RIKA 1GY2A 4GFXA 4NDMB 2XA8H 2EP6A 3PRZA 4IRZA 2E5EA 1QLEL 4J3BA 5JOEA 4ELMA 1E6JH 3DK2A 1Y6NR 2HSIA 5IM7B 2MPAL 5DLML 2X4PB 3S88L 3GSOB 4JBSA 2RIKA 3AADB 1F3JB 4LL1A 3ARVA 3GUTA 4LIQL 4DKAA 5IROA 2Y1VA 5AD0A 4YSSA 1FJ1B 5FOBA 5IT2H 3HUJF 4XNXH 2WXLA 2EE9A 4ZFZA 2HKHL 5IUCA 1JYNA 3EO9L 4KRPC 4JFZH 4AIEA 2I60L 2DM7A 1R34A 3QYCA 1PAZA 5D2LA 3UG4A 2HLFD 2QFRA 2P5ED 4TL4A 2BVUA 3GFUA 3LH2L 5KYXA 3APCA 4PQXA 5D5MB 1DYZA 5HDBF 1TZGL 5AALA 1MRFH 4JY4A 1A7OL 2BNRB 4M6OH 3UAFA 1BPLB 4ZS7L 1CF8L 5KAQF 3S34H 1A7PH 1Y07A 2WXJA 2X3AA 4FXLA 4EI5C 2M83A 4QRUA 4F7CA 1E3XA 4Y8AA 2YFOA 3U0PA 5I18H 3MLWL 1VFUA 2E75C 4N0UE 4OQTL 1UXWA 4UOW0 5DD6A 3FTZA 4Y19B 1KBBA 5LBVA 2H0PA 4X6DF 1VKXB 2HN7B 5AL8A 4BSVB 3P4NB 1OAYL 2VXVH 5SX4I 4GW5A 5FYKU 3EFOB 3U0TB 1X4XA 4L2LA 3A0OA 1U8HA 2OSXA 2PN5A 3DOSB 3N40P 2ZYIA 2SEBA 1MHCA 1W72A 4J7RA 1LP9E 3LHPH 1A0QL 1H15B 2OL3B 5A6IA 4HHAB 4BFGA 4Q52A 1PQZA 4NZJA 5T5NG 3GKWL 3LYRA 3ML8A 2HFFA 5EFIB 5E24E 3C6LB 4JPWL 3MKGA 3K0WA 3L1GA 4TPRH 5EZJB 2HCZX 2G5BB 1TVDA 3BVXA 1Z5HA 3BVTA 4CC0A 1JZ2A 4OZIB 4YLQT 4HQQH 3ZLQC 1X5XA 2R56L 2XETA 3NP3A 3BCFA 1CDCA 3QUZC 1YRKA 2HJKB 2FO8A 3NFNB 3NSCA 4JGMA 1AQDB 1NLBL 2BSSB 3I50L 4ODVH 3SJVB 4ZBJA 4CC4A 4MNQB 1SLXA 2E4TA 2JJTC 2DI8A 2DMKA 1DLFH 4YN3A 4F92B 2E7MA 2B9AA 4PJ8B 5CGMA 4ZDHA 3KCWA 2ZX7A 4GP8B 4TQEL 3T6QC 3VFPB 3WXVL 4N22A 1JWMA 4X99A 4XC1H 4NO3A 4G9FB 1S9WB 3QEQA 4KQ4L 2H3NB 3LN4A 1QSZA 3M07A 2HJLB 3T0WA 1M1XB 2YD6A 1BM7A 2IANA 4Z7WA 1HZHH 2Q20A 4KK5D 4RWYL 1FNLA 2DBLH 2QR0B 1SYSB 1N9PA 1WZKA 3ASOB 2J73A 4R2GC 1KOAA 1LNUB 4F7PB 1T7YA 4LEOA 4OLVL 4PJHE 5J9PA 3MBEA 4UM9D 1YEKH 1S7XA 3LIUA 4GUCA 4DW2H 1TJIL 1EZUA 1ZHBA 4AT6B 2VQTA 4BGDA 3TBBA 3ULVE 3MV9B 7CGTA 4H8WH 3KYOA 5IREA 4QOKB 5D1XA 4Y16B 5JHDB 1RPQA 3FNKA 1WPCA 2XZCH 2PTTA 4P4RB 3RVXC 1M3JA 3CHPA 4JFQB 4KROC 5CUSL 4EJ1C 4KJQD 4ZUSA 5GRUH 5D2NB 4MAYC 1U58A 4Q6IC 5MERB 1QBBA 2R9HC 2V5TA 4FYTA 5J3HC 2E9BA 4DN3H 5EEZA 1OM3L 4RGND 2VLMD 3EYVB 3EO0A 4ORGA 1HQ4A 1NBVL 1YJDH 2GC4C 2Z3FA 4WV1C 3ZZQA 1I8IB 2FD6L 3VGDA 3FCSA 1OE3A 1RULH 5IB2A 3EG9A 3ARFA 4WTZA 2Q2EB 1JWUA 1UKSA 4UAOC 1EUUA 4P5KA 3NJVA 5HHMB 3UTTB 3O41A 1SMOA 2I9TB 2Y07H 4ZFGL 2Z7WA 4KOBA 3WNLA 5L0QB 5DD1L 1A6PA 4F24A 2AXHA 3H56A 2OR9H 2ZOKB 2ZX6A 3S5YA 4YHZH 2KZWA 4HH9A 3GRWH 1NCNA 4UV7H 2E47A 3TIEB 3CSGA 3OKEB 3HPJA 3ZDZE 4P8QA 4OJEH 3OAWA 1A9EB 2R23A 5I1DA 4JRYE 3L3GB 3MRHB 1IKNA 3CBKB 5L8JB 5EIQA 5C09D 2VMFA 5CBAB 3O8XD 4UT7H 1LP9F 2DF3A 2YN3A 1JL8A 1NCTA 5F21B 5KVGE 4LGPB 4FQQB 1WTLA 1HINH 1VSCA 2P28B 1J18A 1RIUH 1LWRA 2OMTA 3RX5A 3O45B 4NQEA 3CFMA 5F7UA 3DX3A 4OM1L 3RVTD 1L6ZA 1AD0B 5C0BD 2C1PB 4XE0A 4YAQA 3NJNA 3SEPA 3E8UL 1KB9J 5B4MC 2OSLA 1WICA 1AMYA 4GRLB 4XP9H 2WNKA 1HNFA 2ENPA 1EHKB 3N6YA 3WLWC 5I17A 3ABLB 4AUUA 4QUOA 4QTIL 1O7DE 1QNZL 3VFWB 3VXMB 2XZQL 5F1IA 2J7LA 1WE5A 2FQFA 3INUL 2MIZA 4IMKC 2BP8B 1NZRA 2GTQA 1GGYA 3CSYA 2JJVA 4YHYC 4TUJA 5D96C 2AQSA 3CVCA 4RIRB 3LIZA 2E46A 3SYOA 2QGEA 5TQ2L 4MX7B 4LMQI 3B2XA 2ZOUA 1J5OH 4BSJA 5EWIH 4YHOH 4CU6A 2ADYA 1WAAE 3NRFA 1JDCA 4NQXB 3S3SA 1CG9A 1T89A 4NZDA 4CW1A 5ECJE 3SDDA 1IBBA 1NGYB 3P3YA 4OZGA 1L0XA 3F2LA 3MV7B 4PJHF 5DJDA 1OSPL 4PWGA 2NW2B 4KTDH 1BZEA 1KEMH 4E41D 4WW2C 2YPVA 2GW5A 4LCVA 4TSAL 2DWXA 2D3NA 2GIYA 5CBEB 2NQ3A 4HFWA 5IHWA 4FLOA 5I6PA 5CR1A 5FEBA 1TJHL 4AH2A 5F0PB 3OGCB 3BXNA 2N1KA 1BBJA 1KT2A 3LZFH 1RZPA 4JPQA 3M86A 4O9HH 4EUPG 4OD2A 3ME0B 4G80B 4PGEA 2Y1ZA 4FYSA 1GZQB 2A9NH 4KJYA 5E23A 3U30C 3IAGC 4OM0H 1FL3B 1I8LC 3TBSA 2DLGA 3NJHA 3UO8B 3HPLA 1T80A 1MJ8L 2VR3A 2ZSVB 4W9CC 1FGVH 3SOBH 4HS6A 3DTXB 4ZOEA 3FB5B 5HI4D 1TTCA 5C0FA 3CIAA 2FJHA 4FDWA 3NN8A 5I1JL 2GTZB 43C9B 3LRSA 4RISL 1IJ9A 2FR4B 3G6JE 3FFCB 1I7UB 1Q72H 3GBNH 1AHKA 3A4FA 2DWDA 3JZ7A 3QDGE 2P80A 3NYKA 1U8OA 4F2EA 1ZY9A 2VDQH 1P9MC 2BVEA 4LBEA 4P2RD 3V0DA 1L0PA 1UKQA 2Y22A 1N0LA 3EH5B 3BIKA 3QZWB 4KKBD 4P4KC 3CFNA 3ARED 5D7SH 3VGAB 3LAFA 4O51B 1TJGH 4TQPA 2OYPA 1JYXA 2ZUSA 1P6WA 1UEYA 3D3VD 3EHBD 4IRJD 2XWBA 3TA3C 5D7IE 2C3HA 2DQFB 4V1DD 2Q86B 2NMSA 3LNFA 4HXBL 5IHUL 1FYTD 3BSZL 1BW8A 2H8PB 2PABA 3GQFA 3PJSB 4H20H 1A1MA 4ZUWA 5A1AA 2G0KA 2P52A 5ALBH 3ATBA 2ZXWB 2DL2A 1NSNH 4JFFE 4ES8A 4X6BB 3VTAA 4UANA 5FR3A 3MOBL 4FXGB 1CTOA 3CPLB 4KRNA 3R19A 1SVBA 4B5ZA 2FNBA 4YSTA 3TYGH 2QEJA 5HGDA 5CN1A 2RTTA 2R15A 3CHRA 1BZ8A 1NC4A 3E7JA 3PL6B 3HBGA 2EXYD 3PWUB 4N87A 4KKQA 3GZKA 4JL2A 2OK0H 1L9MA 1M1SA 4O2CB 4OZHB 4N0UA 5A7EA 5CO1A 1WEJL 2ISDA 1DDTA 4NN7C 3ARGC 1CQYA 3BWAA 1ZLEA 2IMNA 3GEWB 4YC2C 3NOIA 4E2OA 1HXMA 1TLMA 1UJTA 4R26H 5IK3B 1J05A 5L2JA 2N0KA 1EO7A 1BGXL 1XGPB 4KKCC 4L3FA 1YEEL 4TNEA 5HYQA 4WUUA 1AIZA 4YHLL 4R4FL 4E5XA 1NMCC 3DGCR 5JHLH 5L4IA 2VZSA 2F53B 3B7RL 3KVDD 5EF2A 3C2AL 1ZHNB 2WXGA 5TQ0H 3MCKB 3RTQD 4DP1X 3T2NH 1WAAF 2Q8AH 4G1EB 2X9YA 1SJHA 4FNLH 2BW4A 2R29A 4DKTA 1V7NH 5I0XA 3TONA 1G7LA 2YRZA 3EH2A 1S9YB 1TEYA 2WLNA 2MFNA 1PZCA 2LU4A 4CSZA 4RETB 5I82A 1IAIM 2VOTA 2YXFA 5KVDL 5DZPA 1Q1JL 4DEPB 3FBQA 4B5EA 5I8OH 4KY2A 1A8JH 1NOFA 1IARB 1AANA 5DUPH 1GYWA 3HCVA 5A2LH 3PGDB 2PTUA 5EO9B 4AEHL 4ISVA 5F1OB 1V8HA 3POHA 4XP6H 3HZ3A 3BMWA 2EDMA 2W0LA 1OB0A 2F2HA 3TN0D 3I2CL 4OI7A 3EDEA 5E4IA 2K78A 4JFTA 3T2OA 5D71H 1U8CB 5CZKA 1UATA 4MAZA 2EEAA 4PVLA 3O6FA 5L4MA 3K6IA 5T3XH 3ULUD 4DT2A 3P73B 1REIA 3HS9A 1H3TA 1LILA 3G6JF 4OCYL 1JOIA 1A22B 2RJMA 2XU9A 2X1OA 1T5KA 4D0BB 1CDBA 2VM9A 3I6LE 5C08E 1OSEA 1S46A 3TVMD 5J1AB 3TEYA 3EH1A 5MENE 3BAYA 3HG4A 4XCCL 2ZF9A 1MI5E 1WBYA 2FTAA 3GXPA 1SDAB 1YECL 4PBWD 5IMOB 1IL1A 3PU7A 4FQXB 5ISZB 5D7IF 4H40A 3TO4C 3BUDA 1LO3L 3PAYA 4UQAA 2FT6A 2MQ0A 1DQKA 1HIML 5FV2A 2WP3T 1KACB 2CHXA 3EYFB 3G5VA 4NRXA 3IFPA 5DFVD 5F3HA 3GMRA 3SDYL 2XZZA 1W8OA 1HVXA 3C75A 1UM6H 1ZJBA 1ZLSH 5CSGA 2FX8H 5D8JH 8PAZA 4Z0BH 3FTXA 4WO4B 4K7PY 5D4JA 1WBZA 3O3DA 4G9DB 1I8KA 4TXVB 2K7QA 1RJLA 3TCLB 4XAKD 4HJTA 4LMQE 5DK0B 2EDWA 1FLRH 3L5IA 1NGWB 3KGRA 4CKQA 1KN4H 3IU4H 4ZG1A 1KPUB 2K7PA 4M61B 3ETBJ 4HSCX 1S9VA 4UTBL 4O5LL 1OARL 4XXDB 4PJDE 1KFAL 3O2DH 5I9QC 2DIJA 1AHWB 1QFWI 2CLRB 1QATA 1OAUL 1UENA 1NL0L 1OF2B 3QUXC 4U1JA 4JRYA 1A7BA 4LOUC 3HI1A 1BWWA 1QACA 1TQSA 1MCRA 3VGGA 4CU8A 1K8DB 1JZ8A 3FN3A 4G6FD 1E5ZA 2Y69B 4MB3A 1RZJH 4ZX5A 5IW3A 4W6YB 1S7QA 3OG6B 4LVNB 4Q6KA 4EBQH 1TF4A 3ZRFC 2WIIB 3ZTCC 4FXKC 5IEKA 4Z7VE 2EDRA 3MRJA 5DRNA 4QRSA 1BQHG 1DVFB 2AEQH 2NY2B 3KR3L 4ODWB 1E0OB 2FEEI 2P5EB 5DI8B 1KB5B 2P5PA 3EYQC 2J6EL 3GEFA 3CHOA 4HJ0C 2CJUL 1FPTH 1HI6B 2VWEE 4ZTOH 5ICYA 1G1OA 5EU7E 2YQBA 2JI1A 1C7SA 2Y3NA 3FPXA 5GGTH 4MNGA 4KKLC 1L0QA 4K3GA 2BSDA 4Y4HC 1EZSA 2KS0A 1R6VA 3ZW3A 1NTDA 2DQEL 4Z8FH 1FHGA 1IM9B 3RU8H 4AVJA 3GMMB 2HXAA 2FHCA 1E27A 3L2MA 4NC2B 4G8EB 4S2SB 1UJ3A 4MA3B 3UTSE 4WI0B 4TL5A 5B1BB 3CU7A 3ZKMD 1USQA 2WXRA 2XG5B 3QJUB 4HGWA 1UB6A 4YZWA 4JVPA 4NNXB 3W57A 3I02A 2DMCA 1XB8A 1P4IL 5E8PB 3QZPA 2FLRT 4PP2A 2WD0A 3FZUC 5PCYA 2FAUA 4JM0A 4CNIB 4RGMB 4PHXA 4UBDC 3T0BA 4ANXA 4OV5B 3O3AB 4RLDA 2DOCA 2I85A 4HFUH 1WT5A 3ZE0B 2A6KA 1QFHA 2EIZA 2WVVA 1BMZA 2FYVA 2NXYB 1O6TA 4Z6AT 3B56A 1MCPL 2VR9A 1PX4A 3DO7A 3GSRB 4J3TA 5I75B 2ZPKH 2XIDA 4X9GA 1HXYB 2WOBA 2WKGA 3RE0A 1FNGB 4K9JA 4NQDA 3X3FL 1KTJA 4JREB 5DD3H 3CPUA 5JPNB 3VI3A 2ADFL 3T77A 1MLCA 1XV8A 2WBXA 4PYHA 2D8KA 4Y5XA 5HYSB 1ACXA 2PR9A 4MLIA 4YLCA 2DQCL 5EEWA 5DC2A 5ID1B 3F7YB 4WHCA 2UWEE 2UYLB 3HR5A 2CRYA 3PWVB 3UZVB 3PREA 3VWKC 4LSDA 4AC4A 1KN2L 5I0WA 1PMYA 2C9AA 3WY4A 4V33A 3D1MC 3QDGA 2NY1C 3MROB 1AR2A 1FVDB 1NC2B 3MZTA 4HZAA 3LVEA 1EGJA 3PAUA 4Z7OB 4URTB 2K45A 4HUWB 5CU9A 2OX5A 4ANWA 4ILDA 1D3CA 4UM9B 3OM3B 4XCFH 5HVHB 3ZHLA 4R5VA 2WCPA 3UTPD 1W91A 3BZDA 1B0IA 2Z4TA 5D7IA 1KDIA 1RIHH 4PJDF 3GT6A 4AJVA 3MBWA 3BRFA 3WFBH 1FSKB 3VGHA 4ZFFA 1NCDL 3HAEG 3TU6A 2VLJD 3DX6B 3BGMA 1X7QB 3RWEA 1PAMA 4I3SL 4JFFA 4WFED 3FH5A 4TULL 5HPMB 4ZYKB 4B53A 1CLCA 3FHEA 3EO1A 4G82A 5SWSB 2ZOLB 3SDCD 5FK9B 4X5XB 3HE7A 3E6HB 4AKQA 4OJAA 5CGYC 1TQTA 1J1OH 4PCSA 5G55A 1UTDA 1FAIL 3DRTA 3L3KB 4K4KA 3LXUX 1TZ8A 4NZUH 4FQJL 2GJ6B 5FGCE 2A99A 3ROOB 2FH6A 5KG9B 4HU8A 3STLB 4X6CA 4QRQA 2EABA 2CNZA 2GI7A 1AGFA 4PRPB 5E99H 3TNMB 1GIGL 4S0HA 1LE9B 2VR5A 5LN4A 4M7KH 1KJ2H 3FSZA 3B6SB 5F93C 4F57L 1H5BC 1WZ1H 2KHAA 1I31A 3L3IA 5FCUL 1IKFH 1L7IH 2OMWB 3VFNB 1T0MB 2BP0B 3P4MA 2WUBL 4F8LA 5D7KE 4AX3A 4FKEA 1DZ0A 3SE8L 2FH8A 3KVPA 3BDBA 1A66A 4ONFH 3N04A 4JPKH 3AWEA 5E7BA 3VMPA 4YVNA 3NJXA 3ROLB 4JY6B 1DE4A 2W9EH 3O8XB 3KPSD 3MNWA 3EOAB 1G9ML 2EH7L 4BH7A 3K5RA 1FNEB 4P5TA 4XVUD 1X5YA 5A7BA 2F58L 3PP4H 2KYIA 3KBEA 4L4TE 4C59B 1XAKA 2X70A 1HHGB 3QR1A 3W0WE 3LX9A 1YEWA 1N0XH 3GPSA 4MHHI 4S1DC 5C0BB 3NSJA 3EH3B 3QHFL 3ZZSA 2D7PA 1F6AA 1W9XA 4YDKL 4NRZA 2E9WA 5ITFA 1HHKA 1RJYA 2WZPD 5FHAH 4A04A 5LXGL 3THML 1FFPB 1T21B 1NCHA 1K8IB 1WBXB 3EJCA 4XMLL 1MCSA 2VITA 1HE8A 3HG1E 3IJ9A 6TAAA 5I1EL 3IVKB 3UTQB 4DUVA 3BZEA 4K9EL 1A3QA 1FNAA 5D1ZD 1HJBC 1F4YH 2EXSA 4QY8B 3S37H 4N6RB 2PXYB 3QWRA 3TCXA 1MELA 3V4PA 4LCIH 1NEZA 3M17B 4QR7A 3EFDL 2ZUXA 5H37A 4ACTA 1RURL 3UEQA 2X6CA 1CLVA 2QHRH</