2DMHA

Solution structure of the first c2 domain of human myoferlin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
140
structure length
140
Chain Sequence
GSSGSSGMLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDFSSSLGIIVKDFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first C2 domain of human myoferlin
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Myoferlin
total genus 11
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2dmhA00
1DJWA 1RSYA 1E7UA 3DBSA 4NP9A 2CHZA 3QJZA 4IQHA 5KJ7E 3ML8A 5JHAA 2K4AA 4WEEA 3NSJA 1RLWA 2D8KA 1DJHA 3CSFA 3R7QA 5EDSA 5G2NA 3F05A 4AJWA 3FDWA 3L4CA 3CSTA 1W16A 1UGKA 3APFA 3IBEA 2DMGA 2WXMA 4Y1SA 4EZLA 4F91B 4FULA 3PRZA 5T8IA 3W57A 1QASA 3PYCA 4ANUA 2R83A 4PS8A 3S2AA 1K5WA 3NZUA 4EZJA 5CCHE 1E90A 3L08A 4ICWA 2CHDA 2K8MA 2ENJA 2NQ3A 4BGDA 4L23A 4J6IA 4A55A 2WXFA 4NS0A 3HIZA 4XX5A 1E8XA 2Q0ZX 4PS7A 3ENEA 3QARA 2QZ5A 3R7RA 4XZ4A 2K45A 2WXKA 1W15A 4GNKB 4HLEA 4MJJA 3TJPA 3FBKA 2N1TE 4WWNA 4OVUA 1BDYA 4KZCA 4L2YA 2V4LA 1DJYA 1HE8A 2ZKMX 4IHBA 3QK0A 4FA6A 3SD5A 3L54A 4F1SA 3M7FB 2YRBA 1A25A 2WXQA 3PREA 3KWUA 2B3RA 3F00A 4GB9A 2K3HA 1QATA 2KI6A 4FLHA 4BFRA 1GMIA 2ENPA 3MJWA 3ML9A 4DK5A 1CJYA 4FJZA 4WWOA 4JPSA 2Q3XA 2WXIA 4QAMB 4OVVA 5H4ZA 3APDA 4WAFA 1RH8A 2BWQA 2QZQA 1TJMA 3B7YA 3P2BA 3OAWA 4ICXA 5G55A 5JHBA 2CM5A 4FADA 3OHMB 1DSYA 4ANWA 3F01A 4L1BA 3NZSA 3L13A 4ANXA 4TS6A 4TV3A 2CHWA 3HN8A 3TL5A 3IM1A 3N5AA 2X38A 1YRKA 4KZ0A 2FK9A 4L1LA 1E8ZA 1E7VA 1UOVA 4HVBA 2LHAA 4URKA 4EZKA 4WWPA 4XE0A 2CHXA 3PFQA 3F04A 3GPEA 4TUUA 1BYNA 4FHJA 3RPBA 4ANVA 4QJ5B 1V27A 3QAQA 4V11A 4G11A 3RDJA 1DJGA 1WFJA 4Y1TA 4FJYA 5CCJA 3ZIMA 4QJ3B 2WXNA 2WXJA 3T8MA 2JQZA 2NSQA 2WXGA 3L9BA 3JZYA 3ZVVA 4NPKA 2A4ZA 4PS3A 2CJTA 2Y3AA 2A5UA 3HHMA 4LT7A 3L17A 1DJXA 1E8WA 2ENQA 1E8YA 4NPJA 2WXOA 1UOWA 4FHKA 3DPDA 1TJXA 2YOAA 2FJUB 3TWYA 4F93B 3W56A 3LJ3A 1DJIA 2Z0UA 2CM6A 2WXRA 2WXPA 4LDCA 5H4YA 4AOFA 3L16A 1DQVA 2NCEA 3APCA 1BCIA 4LCVA 4KITB 2WXHA 3QR0A 1WFMA 2RD0A 4F92B 2CJSA 5CCGE 3PS6A 2EP6A 2UZPA 1DJZA 2WXLA 3ZW3A 4DNLA 2ISDA 4QJ4B 2DMHA 3KWTA 3QR1A
chains in the Genus database with same CATH superfamily
5C6TL 2I9LB 3BP5A 4PJFE 1RSYA 1E7UA 2AV1B 1KACB 1NLBH 2VDNB 3PHOB 4ERSH 4HGWA 4E41D 1U3NA 5K9KA 5FO8A 1EDYA 4LEXL 1QSFD 4L4TD 3QULA 5FV1L 3LRSA 3WV0A 4DW2H 1ID2A 1N18A 2DJUA 4ZSOE 3N04A 2WQRA 2ATAA 2WIIA 4ODXB 4UM9D 5SV4A 4LDLB 4Z7OF 4OFDA 1LE9B 3VSTA 4AVJA 3VQMA 1RK0A 2VDPH 3RUGF 3EBAA 4IBWA 1QRNB 3WUWA 2KZ1B 2H3KA 1UG9A 2YQBA 1P84J 3VM7A 4LSUL 2WWMC 3LQZA 1OOAA 2OP4H 4OF5A 3CBKB 1EPFA 3CQQA 3BFWA 4H8PA 3UIYA 4BQBA 4U1MB 4X80L 2YAQA 1V55B 3FCSB 1R6VA 3UDWA 3MNVA 4KDTC 1TKWB 3UTTB 4DWHA 4XP1L 2GC7C 2JCWA 1J86A 2WQVA 4TL5A 4B9GA 2YXWA 2O93L 1M1XA 2AQTA 3KGTA 3SYOA 2DQDL 4G42B 4NKOA 3V0DA 3RVVC 2ZP8A 4P5KB 1KLGB 1RIVL 5GS0D 3A67H 3TZVD 5C0ND 2VC2L 3LSOA 3I3BA 2EXYC 1AI1L 3ECVA 2M8XA 4MDRA 1JDDA 4X5RA 1EA9C 3GXTA 3UPRB 3B8SA 4NQCB 5KTEH 3JTTB 1XR9B 3JXAA 1WQVT 1PEWA 4FXGA 3ECBA 1TF4A 4W9LC 1ORSB 5HI4D 3D2UA 3DV6A 4WU5B 5DHMC 3SKMA 4Z18A 3QPKA 1GGTA 1TQSA 2P7TA 4XE5B 1OM9A 1VEMA 4H26A 1HHHB 2JI3A 2WBXA 4X7SL 3ZGIA 6PAZA 2X1XR 3WUWG 1UXLA 3ZE2E 1EHLH 1Z9OA 3LXUX 1KGCD 2IBBA 1U91B 4RGND 5FDWA 4YBHA 4XMKL 1BPVA 5SX5H 4AWJC 1H8SA 3ERXA 5AUMB 5EULV 5AZEL 5DZPA 1T2JA 5ETUB 3KYOA 3VE0B 3IVKA 1B2WH 4OCYL 2PN5A 5AKSA 2VW7A 3O9WA 2A5UA 5JO5A 1ZLEA 3T6VA 5KYNA 4HJJH 2MNUA 1JV5B 5HI4C 1U58A 1ZTXL 2K9UA 3LZOA 1FL3B 2GITB 1OTUC 3SE4A 5B22A 4R96B 1SBSH 1YYMH 4TULH 4OCRH 2NZ9C 3HPLB 4FZ8H 3UADA 1ZK5A 4JFYA 2E8ZA 4Y4FB 5GGUB 5F7KC 4J3UA 1CTNA 1B0RA 5AENA 1A9BB 5E1IA 3ETTA 4NLHA 4IKNA 4YHLL 1R3JB 4NO0D 5DJDB 1SN2A 2ILLA 2MOQA 2Q7YB 2WWOA 3P3RA 1PZAA 1UM6H 3ZHDA 3TNNB 4TOYH 2G2RA 2IWKA 2D8KA 5CGYC 4AJWA 4ZTOH 5ECJE 3D4GA 5DMKB 4AM0B 1T1WB 2BNRA 3NTCL 5DD6A 3OAYK 1KJVB 4QHUB 4XCCH 1CIDA 4E0RA 2NZ9D 5EEZA 3M17A 3MLYL 4XMVA 4HOMA 4I85A 3GSOB 4MDIB 2D3LA 4MXVF 4PIBA 3HRZA 4P5TA 5FYJH 3VXOB 2K45A 1J11A 3ILPA 1WC7B 3V4UH 1Q9WA 5F3HB 4F2MA 4RISL 2FJFB 4CC0A 2NUPB 2FO4A 4ZW6A 5KBDA 1OSZA 2CIIB 5E2VL 3NACH 3ALWA 1XL4A 4F1SA 1S6NA 4XMWA 4RQQA 1MFMA 4X6BA 1ZGLA 1UYWL 3VMOA 3MBXH 2GEEA 4NQUA 5BOZG 5HD8C 2EJ1A 4G8GB 1JNNH 2EAEA 2X70B 4LHJB 4N3TA 5LLIC 2WD0A 3K71B 1W91A 1M7DA 4YWGL 2C9PA 2NY4C 5IR1B 3NTCH 5GJSH 2H26A 3MRDB 3GJFA 3HAEA 5C0CA 2ATKB 2DTML 3L5JA 1KUMA 4XMKH 2WY3B 5E9DA 5AYTA 12E8H 5L2KA 4F27A 4GAJL 2RACA 4ELME 3DXAA 4FAAB 2XWRA 3GLAA 1Q0EA 1R3LA 1KEGH 4GRWE 2X4RA 5IF0B 2Z8SA 4LHQB 3S7GA 4R97B 2P28B 3TXAA 1MFDH 3I75B 4OGAD 5CD3B 1YRKA 1ZT7A 4MYPA 5IMLA 15C8H 4ACPA 4TL4A 1L4IA 3GGWA 5HHMB 4XVJH 5C07A 35C8L 3BAJA 2VDOB 1BYNA 1KOAA 3VG9C 4AIXA 5HI5C 3DTXB 1KTDA 4W9KC 3E6FB 4JN1H 1V27A 1B0GB 1PS3A 3VFWB 2BS9A 3VG0L 1ZVHA 2EUXA 4JQIH 2WXNA 1JZGA 1AGDA 4JO3H 4GLRI 4CSZA 1Z9NA 3Q8AA 5K5YA 1VGEH 1NLDH 4HEMA 3X12B 4GPVA 1M1SA 2EE2A 3MI6A 3DETC 5D5MB 3DX9B 2B1AL 2YPLB 4B5EA 1RMFH 1Y18A 2YD5A 3PGDA 4K7PH 4M6MH 4ELMB 4HU8A 4AYSA 1CR9L 3HBGA 5HYFA 4JM2B 2DEYX 1F4XH 2JH2A 1G7PA 1I7UA 4PJHA 1Y1DA 2NXYB 5DQ9B 1E9OA 3TCXA 2VTFA 3T3ME 2OMTB 1LO3H 4JJOA 2A6JB 1NBYB 1BXAA 4N0CD 4OR1A 4A7UA 1I8KB 2FZ3A 5C0EB 5KSBA 4QD2E 2EC9T 3QCTH 3GHBL 4HWZA 5JW4Q 4TNVK 3FOMB 2G3NA 3SY0B 5DI8B 4DGIH 4IMKA 5DD1L 1VACA 2PP9A 4HSQA 3PQYB 4PD4K 1IGFL 2KC0A 3CSFA 1RURH 1OE1A 4ZFOL 3IJHB 3UJJL 1FZKA 2IQAB 1QSFA 4FQXB 3RDTC 1CG9B 1THAA 4R6UA 1W0WA 2HKAA 2P9RA 2V2XB 3QSKB 4NWUL 5EBMB 4KNTA 4WEBH 4PQXA 2CJUL 1SXAA 3ZRCC 3TS8A 3WTVA 2F08A 3NAAL 2AI0H 4NUQA 4WTZA 3VD3A 3OB0K 2AEOA 2PYFB 4FQHB 4DUWA 3EJYC 1QLEB 2XWZA 2OTUB 4MJJA 4DGYH 2GCYB 3T2LA 1LMKA 2OL3B 1FVDA 2BC4B 2DYPD 1SHWA 3TA3C 2HFEA 4JRXD 2CHNA 4X8XA 4M1DL 1AO7A 1GHFH 4JPIA 1INEL 4Z7WA 4F57L 2X0VA 3QEQB 1U8KB 1ADWA 2DIBA 3HTLX 4BM7A 2FATH 5JW3H 1XSOA 3WN5B 4PBDA 1A1MB 3MRQA 3PCYA 4XMUA 4I88A 4BSVA 2HVBA 3QDMA 2AEQL 4PH8A 1BEYL 3VFOA 3QVAA 2J73A 2OR8A 3FAWA 3X3GL 5KSVB 5AVTB 3SKOA 3LB6C 4YGVA 1X9LA 1DHKA 4QTFA 5KANI 1NCIA 3MR9B 3VJ6A 3LXBA 5C9JB 2CDFB 4HBQA 4J3OD 3KPMB 1KB5H 2JB5H 1G4RA 1IQDB 2OCCB 4OFQA 5FKAB 4XZUB 3BDYH 4K5MA 4A39A 2DLEA 1QFHA 3AM8A 2WHVA 1QOKA 2IF7A 3ASOB 4E5XG 3QRFM 4GAYA 3FU9A 2DQTL 2WVVA 5AOLA 5D1XC 1LO0L 4B97A 3CSYA 1JZ4A 3TH4T 4XBPB 3M17B 3WIHH 4Z76B 1J1PH 1SF3A 1M7IA 4MS8C 1P2CB 5I15L 3B9VA 3HHMA 3MUZ1 1GVIA 1N0XH 1V3LA 4JG1H 4UV7H 3V8CA 1BQRA 2H0JA 3D39E 2J5WA 4ZS6C 1UM4L 2DOCA 2B5IC 2CGYA 2PXYC 3IJEB 3MRMB 4G8FA 4NOFA 2EEDA 3LXAA 1OWWA 4Y2DA 3VFWA 1IGTA 2ZWLT 2D31A 4FMKA 1AZVA 1MSPA 3DUSB 3RU8H 5E99L 4YS4A 1FNGB 4OQ1A 1F97A 1IE5A 3DRQA 3CZFB 3GB7B 3VAEA 1CDBA 1ILSA 1HILA 1H8LA 3LKPB 4GW5A 1BGXH 4FFZH 2ID5A 1X7TA 1CXFA 5F7MC 5AVUB 4E5XA 3ULVE 4L3CB 2HA1A 1UQSB 1S7WB 4ZBJA 4Q6YA 2NTSP 3RNKB 3GRBA 1BEXA 2A9NH 3GHPA 3MC0A 3RL1A 4FEIA 4NZFA 3P4OA 4O2CA 3GIVA 3KPSA 4BZ1A 4LHUB 2ZP0T 4TYUA 1OIOA 4QRTA 2VE6A 2AJSL 3MX0A 3IGKA 3GSWA 3RZCC 4OLZL 1I1RA 1HINL 2R2HB 3E6FA 2DW5A 3KHQA 4BDVB 4OLYH 3KPPB 1S7VA 1MNUL 4MSWB 2KS0A 4HIIB 1ET5A 4QTHA 3Q48A 5TTRA 5DCCA 3HFMH 4D94A 3SGJC 1XV8A 4N90E 3T04D 3ARFA 4K71C 4BZ2A 4AEIH 1ACZA 1CGYA 4MZIA 1ETA1 1CD9B 1XF1A 2HFFB 2OK0H 1HXYA 3GXUB 4J3BA 3WY3A 4ORZC 4OGQC 1QNIA 3IMWA 2BCKB 4RX4D 1PKOA 4QF1A 5B4MC 2HRGA 3RZCD 1UWEH 4FYSA 1X7QA 5EOCJ 2QTEA 5ISZE 3ARFB 3KS0J 4M4RA 1BFSA 3J2PA 2GTZB 1UVQB 4JDVB 4G7VL 1MHHB 1SDAB 2WO2B 4L4TE 3P11L 4O51A 4XWGH 3EG9B 3QZBA 4CRPA 4UQ2A 3L3OC 4J8QA 1I53A 3DVGB 1V7NH 2JTYA 1JYWA 5IM7B 3PPEA 5IEKA 2V5MA 5FS5A 1ET8A 5INCA 4BSVB 3EBHA 4WHYH 2WZ6A 4IBTA 3KM2A 5FUCC 3SODB 1AIZA 2PW1B 3NIGE 1NQBA 3H9HB 4NZJA 2DQUL 3BPCA 4W4OA 4PRNB 2FRGP 1MCSA 4XO9A 4QY8B 1U8HB 3BP7B 2ZX5A 4MJ5B 4XPGH 1WWWX 5AYQA 3T0EE 1JWSB 3CVHL 1NGZA 4QXTA 3B7UX 4ZI8A 3ZXAC 3FQRB 5GHWL 3ZYZA 4JRYE 4F58L 1N6QH 3AU1B 1FYHB 5E4IA 2HJKA 4ZUVB 3B7RL 3EDFA 4LLAA 1O9VA 1J8SA 1E28A 4ZT1A 1A2YB 3GM0A 4WI3A 1U8LB 4P0DA 4UOW0 5D2NB 4YDIH 3CFTA 4D9RD 3P77B 5EZOL 4DZBB 1DCLA 2OMXA 4FI7A 4PW4A 2VXQA 4P2OA 3N41B 3QAZC 3ARTA 2AW2A 1ZLUH 1ID5I 3OJDB 2GFBB 3C2AL 3QEQA 2OPCA 1DVFA 4XMPL 2GJRA 2FO1A 2NY3C 1P7QB 1DN2A 1WZAA 4JGMA 5DFVD 3RUGE 1PCSA 2HFEB 2HKFL 3UROR 3BIAX 3QEHB 1QFOA 5KJRH 1OSEA 2E6QA 2HZHA 4ZUUA 4D0DA 3GC3A 4QRUA 5SX4I 5LQBH 5IVZB 4M6AA 1KPUB 1IB5A 4C57C 4Y2DD 4AUJA 2J7LA 4L4VA 2YIHA 4N2EA 3JV6A 3VXRD 4HFWB 2JB6B 3X13A 5IR1A 4UTCA 2O5ZH 2FHFA 5DJ0B 3LIZA 3K6FA 4HXAH 3OR6B 3P4MA 2DM2A 1L5GA 4X8GA 1DBML 2XV6B 3ZTEA 1KFAH 2NR6A 1YUHA 4HF5H 4E41A 1T20A 5I1AB 1N5YH 3VI3A 2NY2D 3ZE1E 4LGPB 1YYLH 2V3FA 4HV8A 5AZ2H 5A43C 4QRTB 3NSFA 1IT9L 2HTKD 3EHBB 2F74B 3IPFA 5ISZB 4B0MM 4WAFA 9PCYA 4QRRB 2NQCA 1BBJA 3QG6A 3WFDL 5LWYH 3WLBB 5J12C 4YBLC 3TU6A 3CZLA 3KR3L 3ATEA 4K94L 4M43H 3UAEA 3V95A 3NCXA 3TFKD 4DTGL 4Z3FA 5JXEC 4FP8L 4NZTL 2JJVA 4OJFH 3VDCA 5M7QA 4JFPA 1T7YA 3IM1A 4E42B 2VZ3A 1R3LB 1RZPA 2HLEB 1DLHB 3D30A 3A24A 1R5WA 1TCRB 2VXUH 4DQOL 5LDSA 3AGWA 2YZ1A 2XN1A 4M1GL 4HCRA 2XWBA 3U0TA 2EUVA 4LIQE 4FQQA 2VDKB 4WV1A 3C60A 4FRWA 4PY8J 3MRRB 1CN4A 1OEZW 1F11A 4AQ8A 1SXZA 1SJVA 4PVLA 3HKFA 2YSSA 2B0SL 4HKBA 3U9UB 2R2EA 3UO1H 1CLVA 2D0FA 4NNYB 2J8UF 3UO1L 3MNZB 4NQVB 2N4IA 2H4EA 4KFMA 4S10A 3S96A 3O2DA 5K9KB 2BVUA 5D1ZA 1YMMD 2A6JA 5C0EA 4ZPTB 3OG4B 5FYLE 1AGFB 2BMKA 3BKCL 1RJLA 3CIAA 1XIWB 3EH2A 3S5ZA 1CQKA 2NX5E 1RZKH 5D1ZD 4MMXB 4PLJC 2ZCKH 1Q1JH 4CBZA 4HU2A 3QS2A 3PABA 1C1EH 1HKLH 3IGAA 1GPOH 4Q58C 3UZQB 2X4PB 4J4PC 3CFCH 1CG9A 4LFHD 4F2EA 1KNOA 2XIDA 1SXNA 5FGCE 3GMQB 4RZKA 5TE6L 4L8SA 1MHHA 1FG9C 3PAYA 3BKJL 4B3EA 4MMXA 3GXFA 5DEFB 1FVCB 5CLTA 4XRCB 2IGLA 5KSAD 4TNFA 4NO3A 2BCKA 1IAOB 3TX4A 4G42A 4NFCA 5FGSA 1FL3A 2GITA 4HKXB 3BKCH 2N1TE 4X7SH 1NBVH 2BVEA 1QR4A 4MX7B 1O6TA 1P6WA 1X9RA 3B7TA 5DD6B 3FRPA 3I2CL 4KJWD 4GRLB 4X6DB 2BSSA 4R7XA 3DVIA 3BI9X 5BZXA 1A02N 2B3RA 1EXGA 5C08D 2VUOA 1YEEH 4ZUSB 5JIHA 2VWEE 4LVEA 3SKJH 5JOFA 4MNGE 4Y88A 5KS9F 1LO2L 1ZT1A 3HG5A 3TBSB 43C9B 3FT4A 5FYLD 5DUPH 4GKNA 1P7KB 2B0SH 3GDBA 4LGSB 4R90L 5D6CA 3VXPA 5FYJL 5T1MB 3WN6A 1NMBL 1CDJA 5JIQA 1CF8L 2JVUA 4MAYB 1HZHL 4ZUVA 3KLHD 2JLLA 4Z8FL 1LO4H 3F85A 4JM0A 2WQSA 4QHNA 2WNWA 2ZAIA 3VX1A 5FAAA 1MCWW 5CEZL 3MJ8B 3BHBB 5LBVA 4L4JA 1JZHA 3D39B 2G4EA 4Z7NE 4LB8A 1CFTB 5IGXL 2APFA 1V7MH 4MRCA 1FZJA 4FI8A 5I74C 4WO4C 3W2DH 3OSKA 4LLQB 3R1GH 2X09A 3WIHA 1ECZA 2E8YA 1VKXB 3QCVL 4Z3HA 4JKWA 5A7EA 3M07A 5AG8A 1PLBA 2AXJA 3QCVH 3LV3B 1XGYH 5EU4A 2OLDA 2F53B 2N01B 1FG2B 2WKGA 5HXMA 5IMMB 1NFAA 3PIQB 4NWTH 3RVWC 3Q1SH 5CEYA 4KK9C 2MRYA 4X5XB 3GJFH 1ZA6B 4N5UA 3T4AA 2WZ5A 4UU9A 4Z7OB 1ZGLB 2JIXB 4OSUL 5F0JB 3WENA 3TNNA 1TR7A 3AREC 1IGCL 2YRZA 3PG2A 1CF8H 1ET7A 3P4MB 4H0IA 2DJSA 1D5IL 1KZQA 2CRMA 5DUPL 4CVXA 5F7HA 5IVNA 4JZJC 2C1PA 2ICCA 3QIWA 4GMSL 3QWQB 1EH9A 3PS6A 5HJ3A 2ICWB 5MERA 4FG4A 4MB1A 3KWWA 4LU5H 3IXAA 3NIFF 5DZVA 3QZNA 4MAUH 4GBXD 2FO8A 3B56A 4JM2F 3H3KA 4HWEH 4W9CC 1UZ6F 1DVFD 5CBAB 1XF4B 1ACYL 3R7QA 4F9LA 4OJAA 2JKLA 4ZTEA 3RWFB 5LVEA 2ZG3A 2WWNA 3UBXA 5EBWB 5F9DC 4HAGA 4UQAA 1DBKL 3OC8A 4P9ML 4U1MA 5GJTL 2ITDB 3O9WC 2KHAA 5HPMA 3QBTB 2VDRB 3E6HB 3MUGA 5DUBB 5GGRY 1L3WA 4E36A 3IFNH 4ZS7H 3B3IB 5AB9A 4NHUB 4MA3B 5I74B 5DRNA 5JXEA 1DSFL 3BVVA 4L3EA 3Q13A 1GZPA 5F0LB 2VXSH 3NRQA 1T0NA 2ZE0A 2Q86B 3Q3GB 1K8IA 2XVLA 5HGGS 3WO4B 1J8HE 2VSDA 1IIKA 3S37L 1IC7H 3ZZSA 3TC9A 1GTFA 3OGCB 4XCCL 2PTVA 2IADB 3S5YA 2Q2EB 4OZ4A 4YZWA 4EN3C 3JWOH 3ZIYA 1G0XA 3UAFA 3QUMB 3ZOAA 3CHRA 3GBNH 4FQXD 1OQOA 1HILB 1I3RB 3QH3A 4OUUB 3LQAH 3RILA 4N2DA 1TYJA 2JJTC 2HT4D 3FUMA 4IOFD 3WN5C 2NY2C 4ICXA 4W9EC 5I6OA 4P9HH 2DI7A 1BXVA 2OS7A 3TO4C 4V1DB 4Z7NF 3W9EA 5KVEE 4R3SA 3QDHA 5KOMC 3SOTA 1PF3A 2DLGA 1UT2A 2GAZB 1WBZB 2NSMA 3MV01 3ZPDA 3MLVH 1LWHA 1H3PL 2BNQB 3DBXA 4CN6A 3DJ9A 3L4ZA 5AOIA 3N1MC 4FNUA 1ZLVK 1BYOA 2BWDA 3I9IA 3V0FA 4GQ9H 1KY7A 1XCTA 5L7XH 2JKTM 5E6ID 2DI8A 3SGEH 2B9BA 1ZGLM 5LBSL 3VXRE 5I1LA 2P80D 1U8MB 5ESVB 3UTSD 2YKLH 4JFYB 1N0XL 1WT5A 3HZKA 4JREC 4GEJA 2WXJA 2XWCA 5F3FA 3VXME 4EIBA 1BVLB 3F5WB 4Z6AT 1J5OH 2AXFB 3NG5A 2YRPA 4CSSA 5GS1A 1T7VA 1U8QA 2VLJD 1BD2D 1JGEB 1MG2C 3PV6A 5CFAA 5IB1B 2NQDA 3OG6B 5GS0L 3MJGX 5FKPA 1KYUA 4PCYA 3KNBB 5F9JA 1KGXA 2EKSA 3II1A 4XAKD 3GT6A 1OM3H 4Q9RH 4AMKH 2RB8A 1AP2A 4MMZB 1U3HA 2DMHA 4UAHA 3RB7A 2FQDA 1KLFA 5ABDE 1I82A 4NP9A 3O11A 3ULAB 3QNYA 2OX5B 1BLNA 1MCPH 2ROYA 3BGMA 2Z4QA 3OJDA 3MNMA 5T1JA 2HT3C 2VWEC 3NPSB 3K7UA 2WCGA 4H20L 2GKIA 1CO1A 1Y6NR 3CFEA 4PU2A 4Z0XB 5DJ6A 3WAJA 2R4SH 1MHCA 2UXTA 4AL8L 5ID0A 3WNMA 4LSSH 2CPCA 1X4ZA 5KYXB 1A6VL 1XF3A 4C4KO 1NC4A 2H1XA 2QKIA 4PWKA 5F7NC 3VWJC 4A7SA 1JSYA 2G5BB 3KDMB 3FW6A 3LIZH 3MRCA 4GFTB 1JN6B 3VFUB 1DBBH 1M42A 2BXZA 3TYGH 4E9QA 1QO3A 2L0DA 3ZKQD 5D7HA 8CGTA 3T0EA 3RIFK 1O9WA 4LSPH 2EEAA 2ZUSA 5IFJB 3WNKA 1XF2A 3RX8A 4HD9A 5DHYA 4K15A 4HMEA 3KGUA 2WP3O 5KVDL 5B3SB 2FR4B 1T4KB 2EIDA 4WEBL 2XQYA 2CIKA 1ROCA 5T3XH 1FAIL 4B7IA 2UUDH 2VMEA 1JDAA 5HSFA 5AVRB 3O41B 2X6VA 4XHJC 3WKPA 5AALA 1ED3A 1U8OB 3SDCB 4MDIA 3NA9L 4PRPB 3CSYB 1PSKH 3QUMH 2X4SB 3EYFA 1URZA 3HZMB 3T3PF 4JY5H 4ZW3A 3AREA 4JB9H 3QULB 1MELA 2FSEA 3MRBB 4PJBF 3QUZA 4Q8BA 2WQUA 3D39D 1GJUA 5B1JC 3K8LA 3US0A 4OLUH 3QIWC 2PP8A 2OZNA 3HHSA 1AKJA 1BXUA 4P4KC 3LH9A 1AR1C 2JQMA 3ZKNC 3ZQ9A 2FYVA 1OP5H 3O6LH 1NOLA 4H44C 1XT5A 4RFEA 4WGWB 1BSIA 1VPOH 2M26A 5DS8A 3VXSE 4NDMA 3N1GC 2PCFA 4FLRA 3BSGA 3NDYE 5HJ3B 2EDDA 1NKGA 4JDEA 4NCC2 2NY1D 1QRND 1VGEL 5SWZB 3INUH 4KY1L 4QTIH 2R0KL 5HHVH 1EMTH 5D7LD 3LHPH 2LGNA 3D50A 2IGTA 4Z7WE 2AJXL 3VXNB 1E8YA 4J2QA 1UZ8A 1AZCA 2QFPA 5BMFH 1L9RA 3MNZA 1HINH 4NQVA 2P52A 4CADA 5GGRA 4I1NB 3IGAB 2Z0UA 5GGSA 3BAYA 4AITA 4WW2B 2X2JA 4NDMB 4P5KA 1JGVH 1LEKB 3NCYS 2HLAA 2X3CA 1JZJA 5AVXB 5EUOB 4BFOA 1QZNA 5IIEB 5E56A 5AW1B 2J55A 2B3IA 4ENED 2XZQL 4KKZA 3F12B 2FBJL 1J88A 3SCMC 5IG7A 4J8RA 3V10A 1HHHA 2XV0A 1G9NL 4TSCL 4X0KA 4M61B 3KDPB 2H1PL 2NNFA 3CLWA 3FDWA 1E9QB 3OGCA 2OTPA 2J2ZA 1F02I 2ZQKA 5DMJB 4YXKH 4YHNA 5GRVK 3TONA 2YEZA 3OKMB 1NBCA 3NPZB 4TMPA 1LO5A 3NVQA 4TPRL 1T7ZA 4POYA 1XL6A 3ARXA 3MGAA 4XX5A 1NBYA 5I8OL 3HI5H 5KSBB 5L6YH 1F00I 3FSVA 3V0IA 3L3IB 4I87A 3S97C 2NDFA 1ZMYA 1FIGL 4UIMB 3FYIB 4HX1A 1EUTA 1U2YA 4CMMB 3AUVA 3T77B 3VA6A 1WBZA 2PXYB 3G5ZA 4E9LA 4EI5D 1WD9A 8PAZA 1DANT 1J10A 1NBZB 4NC0B 3DTDA 5DVOA 4Q4EA 2Z35A 1HFUA 4G59C 5E6RB 2BIMA 1EEQA 3A47A 4ODTH 1QMUA 1M3JA 4BFRA 2VISA 1KCSL 2QKIB 2NY2B 4P2QB 3JV6B 2PWDA 4UT9L 2DQGL 1BJ8A 2H6OA 4KMTL 1CLZH 4FG0A 4XNAA 5H4ZA 5I1HL 3SIKA 4Y9GA 5D7KD 4AW4A 4MVBD 5EF0A 2WLKA 3SB3A 1OAXL 2D3NA 1MNUH 1YAZA 2MPAH 1OAXH 3G5YA 4ANWA 3C6LB 2YPVL 4LQFL 3UYPB 1PD1A 4YXKL 4HCIA 1U33A 1XEUA 4KXCA 3CFJB 4F8LA 4FQCL 1X5ZA 2CPUA 3MV8B 3QNYB 5I5MA 4LOUD 4Z95H 2M2DA 4O00A 5CWSA 5E1QA 5BRZA 2GBVA 2VN5A 4KX8A 2H2PD 4OAWA 1KN2H 3QDMB 1OK8A 2Q9OA 2HCZX 3G3LA 4WI5A 4L37A 3RZCB 3X13B 3QAQA 1F3RB 1QEWB 1M56B 2B4CC 2XWTB 2KKQA 2XUWA 1H5BC 3L3JB 4CVZA 3N40F 1OP3H 2AC0A 4Q2ZB 1MWAL 4A7GA 1J48A 5DJ6B 1BVNP 3T71A 3THML 3N43F 2N56A 5A3IC 4X6BB 2RCSH 3BAEH 3F7YA 3TFBA 4U6HA 5I71B 2VR4A 4GI6A 4JHWH 5T1KB 3OAZH 1S7SA 4K7PX 2W1NA 3CPUA 3H42L 1NH6A 4JGNA 2ZKXA 3VRJB 5BZZA 3N2JA 1Z6JT 4JKKA 4BFGA 5CCGE 5FW7A 4GUOA 2LABA 2H0FA 3ARFC 2VXVH 3LQMA 4QJ4B 1A7OH 4FYQA 5TDOB 2YK1L 3QFJE 5GRUL 2UY7B 3QJFB 1ZLSH 3O3EA 3ULVF 4HIHB 3VCLA 4FQQB 4KROD 5DLML 1MW1A 3F7KA 1NCOA 3T0EB 3OR6A 2WO3B 3OXRB 4LVNB 1ZVSA 3MGOA 4MA7L 5CBAA 1MPAH 1OANA 2MH4A 1A7BA 1Z7JA 2ZX8A 3BPOB 4NQSA 1RJLB 1CDGA 4XPAH 3GMOB 2FLBT 2IFFH 4CDHA 2ZYSA 1LHZA 3ISWA 1BQHG 2B9AA 3FSOA 3UG5A 1IC1A 2FGWL 2FYYB 4DQOH 3MSPA 4ZMPA 1QA9A 2C4XA 1R0AL 3PGDB 4XNBA 4ELMA 2AKRB 1AGEB 2J2ZB 1URIA 3Q5OA 3CAFA 5I18L 4ELKB 1A3QA 1PFCA 2XXGA 3MV8E 4PUBH 2JNZA 5IBLC 4KVNH 2WZPA 3QDJD 3QIBA 2J1YA 4IGBC 4GB9A 1A6UL 4OJCA 3C5SA 3V4VB 1UA7A 4QAWA 4F15B 4KI5C 4NQCE 5L9DH 1U36A 5J6SA 3V6ZA 4FHBD 4O2CB 5IEHB 4QLWA 3VRIA 2HN7B 3JWNE 5ICXB 1UJ3C 3CFBA 1BVKB 4CBPA 5LGJB 3WLWD 1J9CT 1MI5E 3TM6A 1MDTA 1CE6B 3SE8L 2EQDA 4UNIA 5T3XD 3GMLA 1O7DC 2K8QA 3KXFA 2H3XC 1P4BH 3BH8B 3U1PA 4AT6B 1BREA 2CDGB 2BDNH 3BFOA 5KS9B 1BVLA 3F5WA 3QUXA 1SLUA 3VG9B 1NKRA 1ORSA 2X44D 4XCYB 4QOKA 3VSUA 1UXMA 3EDDA 3HCVA 2UXGA 2HAZA 1E9PA 4YDVB 3R0NA 3FN9A 4OF6A 5KSBE 4RGNE 1T5WA 5C09D 2DBLH 3ZKND 1U8LA 1KTJA 5AAMA 2XPGA 5KS9E 2AQ2A 4UM9A 5MP6L 1T03H 1F45A 1NCBL 3KLLA 4ZAKD 1IFRA 5D6DA 4BCXA 5DJCB 2YS4A 2EE9A 4H88H 2Q8BH 1LO4L 1MRFL 3LKNB 4Y16D 3RVUC 1INDH 1JTOA 2L8AA 3FU6A 4PMFA 3VXUA 4PLJD 1MCKA 1CD1B 3ZMNA 3HNTL 4TSAH 2DLTA 2JI2A 2UX7A 3QYCA 4PJ9A 4QRBA 3UZVA 4YDKH 1HHGB 3S3DB 2K1MA 3HRZC 1B4TA 1QD0A 4XPAL 3IAGC 3P30L 4FOMA 5C0NC 4XN4A 2VMDA 3SKJL 2YA1A 5SX4H 5EZIL 2PXYD 5EEYA 1DUYA 3LVEA 1A6ZA 5ADOL 1XCTB 1EO8H 2XV3A 4M62L 1HAWA 2XKNB 1WSST 1C1EL 3QYNA 3ABGA 2VABA 3BZ5A 4I0KA 4Y16C 3L3KB 1JGLH 1RUMH 3BPLB 3CLEL 3L3GB 3DUHA 3JWNG 5E5MA 3ESUF 4XVJL 4MHHI 5AAWA 1QTPA 4TM9A 3PIQA 3LEYL 1IAMA 1PLGH 1F2XK 3FN0H 4NT6B 3LMJL 1CPUA 2OTWB 3VXQB 4Z7UA 3SKUD 3GZKA 3DX8A 3VD9A 1YEIL 1P6FA 4Y1AB 1WA2X 1ZTXE 3DVNA 5JORB 4D3CL 5KW9L 1I1AA 4JFFE 1JYVA 5C0AB 5CEXA 1CL7H 2VDMB 3TPKA 1ZVYA 1KMGA 5IT2L 3WMPA 4JPVL 3DXAB 4K5LA 1KV7A 5GSRA 3BXNB 4B9JA 3DOSB 2VDKL 1OAZH 4YHKH 2LW3A 2OJZH 5E8OA 2EDMA 3LDBB 3IFLH 2CH8A 2YA0A 3TH2T 5FHAH 4L18A 3BKYL 1GA2A 3JWNC 1C7SA 3X3FH 4DVRH 4OD1H 5CZXC 1GZPB 4KRLB 2HKHL 4U05A 3C5ZD 5I5RA 4XXDB 4NUGH 1ORQB 1F11B 2IOOA 3LH2H 2X4UA 3DGDA 3QJRB 4YZFF 1JFHA 1TZAA 4E41B 3FFOA 4TLSA 4RDQG 1BBDL 1Y6MR 1YA5A 2ICEC 1KJ3H 3DOSA 3IB4A 5C0AE 2XJKA 4UTBA 3FUKA 2VLJA 5DZLA 4G82A 3HLAA 5ESQB 4UMGA 4ZXBC 3HVNA 1BAWA 3MLYH 3VI4E 4KK9D 4AQZA 2IPTH 1V7ML 4JHZA 2HFTA 1U8CA 4NERA 5D7IB 4UMSA 3MV11 3JV4A 2IWGA 3WFCH 5A2JH 3SSGA 4UANA 4FFYH 4XHQA 3MGOB 1N8ZA 2Y2WA 1TKWA 3UTTA 5JW4N 5LBSA 3NFNB 4I89A 3MV7D 5K1NA 2YARA 4ZS7L 3WIAA 4EUPA 1JZ8A 2NY6B 5EBLB 4DKAA 3LJ3A 4FKKA 3HS8A 1H0DA 5ANHA 3GSWB 3UABA 5JIPA 1I9EA 4AH2A 1M3IA 3COOA 5IROA 4F92B 1IZJA 1HOEA 4AENB 1NC4D 3OKMA 2OMWB 4I5BA 3NFPA 2OMTA 1TQBC 3OR7A 4X6DF 1JFQL 4HK3J 5D1QA 4AL8H 2WCSA 3BQUB 4OV6F 3NIFE 5CIPB 2IDFA 2XYCA 2K4AA 3HZYB 4W70A 4UF7C 3WU1A 1DQQA 3ARFD 2BW4A 2MPVA 4HKXA 4PWHA 3PJLA 5CN2A 3WO3B 3HC3H 3T9WA 4UILL 4HOWA 1WF5A 2VN7A 3PDOB 3CX5J 3IT8D 2CMRL 5K39A 1FAKT 3OKOB 5T5FH 3WOVA 1XBRA 1S5IH 4R90H 1S78C 2ZXDA 4NENB 4PGCB 2Y06H 4ZK8A 1RJCA 1XSJA 3WXWH 3WAKA 1Y0LA 4PBVC 4CU7A 5TH2B 4NS0A 5B38A 1NGWA 1SMAA 1W72H 3CLFL 3MACH 3DVGA 4GIOA 2V3DA 1PBYA 4EUPG 2XWJA 1EWHA 5FKPB 3AG1B 3AM8C 1D5BA 3HG0A 3R1GL 2VW6A 1PKQE 3BWUC 1I7ZA 4P46B 1DZBA 4QNPE 2BSEA 2XYBA 3KXFB 3NSCA 3LSOB 4QXTB 3ZYJA 4PRDB 5HHPA 5CEZD 4JAMB 5DEJA 2WLMA 4NWUH 3U0WL 3BP7A 4FQ1L 5DVPA 3T3MB 3O3DB 3TBTA 4Y1AA 3TPUA 1IM3B 5IHZA 1UH4A 4PJ9B 5TK2A 3IFPA 1U8MA 5ESVA 1HWGB 1L3NA 1PKQB 4L8DA 5DMKA 3FB6B 1I7ZB 3OJMB 3VFMB 5HPOA 3BEVB 3BLPX 4ONOA 4KMQA 2BVPA 5LNGA 4HUXA 3UTQA 2DRUA 2V0AA 2ZUUA 5K1VA 1Q0YL 3EFOB 2BZDA 2LV4A 3KL5A 4Q9RL 4JANB 5MENE 4XE0A 3TT3L 1E6JH 3FT3B 4TOYL 3VXSB 3Q44A 2EDOA 5C0CD 3HS0A 1UACH 4M6ML 4IBUA 4R2GC 4K3DL 5KAQG 4PJBB 3QJHB 4Y4FA 3CHSA 3NZHL 5CM1A 2FD6L 4ODVH 5DRWA 2PR4H 2FH8A 4G6FD 4PV8B 4NQTA 4JHAL 2BNQD 4KC3B 5JQ6H 5HBBA 3KPTA 3L7EA 4U6VH 5EO0A 3LAFA 5B3JF 3A5VA 2Y5TA 3QPXH 3VWKC 4WK4B 1INEH 3MCKA 4L0YA 4POUB 3E38A 5F9WC 4MJ4A 3U25A 1EAPB 1ZWIB 2Q76A 4LMQI 2VZ1A 3OKLA 1N4XH 4J27A 2WVSA 4O5LH 4U1KB 2GEQA 5GRVL 3MV9E 4PGDB 5E08H 2O6DA 2R9HD 2YXMA 1H15A 4H40A 1DJWA 4ESKA 4B6ZA 1DN0A 2FWSA 2ZOLA 3TYFB 3VI3B 5IB4A 1A5FL 1IE4A 4C54A 3L5WB 1MIEL 3NZHH 2C9RA 3D0VA 3OBAA 5FB8A 2MTPA 4XCFH 3K8MA 5H2BA 3A3YB 3UGEA 2Y1AA 3O0RH 4HFUH 3AMLA 4JGUA 3VXOA 4L8CB 4P5TC 2PCFB 5D93C 4JFFB 5D5MF 5CJ5A 5ILTH 1QFWI 2VSKB 4LPWA 5BS0E 5HYIA 3VQLA 4J4PD 3WSQL 1NC2D 1SEBB 2ICWA 3GHBH 5MERB 4ODTL 1RZIB 4HBCH 2JK5A 4AQ8C 1E30A 1OARH 2WXKA 4Y4KB 4P5MB 2CLZA 1MRCH 3CNKA 5ESQA 2OULB 3VFRA 3K5SA 2XOTA 4G8FB 1GZQB 3WI9A 2ZNWA 2HH0H 3FU8A 1YN7B 4P2RA 4HUWB 2ZF8A 4U4BA 3VWKA 3KYMB 4ZFZB 1FLRL 3CK0H 4JO1L 4MDJB 4U1SA 4GKSB 5E0FA 2NYKA 4O51B 1D6EB 1MLCA 1JGUH 3IDXL 4C56A 2DWEA 2KUTA 4QIRA 3WUWB 2ED9A 3MCLL 5TH2A 5G4MA 4ZD3L 3MLXH 5HYQA 2DQJL 1KTLA 4WNSA 1O5DT 5AKRA 1Z9MA 3U48A 2VAAA 1MHEA 1VFMA 1NLDL 1CICB 2P8MB 4N2IA 3UYRL 5BXFB 1AOZA 1MHPH 3G5VB 4PGBA 4QOKB 5F0MB 4MNHA 3FCGA 4NZRH 3TTYA 2ICEB 3BC9A 4ELDA 2GJ6A 3WKNA 4XN1A 5C0GB 3HI1B 1H3PH 1QLRA 2NR6D 1A3LL 1JK8B 4AV0A 1KCLA 1RLBA 3MUHL 4X9IA 4RA0C 4GJTB 4UBDD 3BUQA 15C8L 1XFPA 4J6RH 4XNZB 3NFPB 4PI2A 2Z92A 3FS9A 4XAWH 2FB4L 4BCZA 4BDVA 3EOAB 3U9WA 1IM9B 1I3RA 1T5WB 2DH3A 3L1FA 3QUXD 2YSTA 1M2VA 4X6FB 3H6JA 4ODHL 4HGMA 1GS6X 4P2OC 3SQOL 5F96L 2XLLA 2OSLB 2J8UA 4NENA 1JPSH 4TVSa 5JDSA 3UC2A 4C55A 1WBYA 4RMWA 2AMGA 3JWOL 1FE8L 3GM8A 4I7ZC 2E4FA 4JO3L 1VFAB 3CFMA 5C07D 3T2NL 3SPVA 3P9LA 5AL0A 3UZEA 3A6CH 1BLNB 5DJ8A 3WKML 4CJ0A 1FPTH 4RX4A 1A7NH 4N0YH 5F6HI 1JV5A 1ZLSL 1J7VR 5GRJL 3E2HC 4U1LA 1G94A 2F8IA 1VPOL 4B41A 5BOPA 3DJTA 2IH3A 1TVBB 2J43A 2IH1B 4JAMA 4HLZG 4POZC 2KPNA 3GK8H 1AJ7L 2FEEI 5G5DB 2FWUA 4W68A 4AEHL 3QHZH 4ZNEA 5IB1A 1EAOA 5EA0L 1CBVH 2KYIA 5IM7A 4LSRL 3FT0A 3L3KA 1BZ8A 4HXBH 2XWJB 2WLHA 3BAEL 4HIPA 2B4CH 4ODWA 3AACA 2ZXGA 5DEZA 4OLWH 1N6QL 1XR8B 5DVKA 3AFLA 1PLAA 2XKSA 1KXVC 1ZHBA 1BFOA 1JMXA 3TPUB 3QARA 1IC0A 1F4WL 2NNAA 3Q6GL 3MGTB 4HAFA 3OSVA 4D9QD 1TQTA 3MYZA 5I8KL 5C7XH 3W38A 3JVGA 3U36B 3O6LL 1BECA 3VYNA 1J8HD 2WXQA 3FT2A 4WEMB 5ALBH 4AMKL 4OZIE 4PRPE 4N1CA 1FG2A 5IQ9A 4K71B 1BAFL 4A7TA 1DFXA 3QG7L 3SDXB 3S35X 3P4NA 4YE0A 3QFJB 4XXDA 4G9DB 5GSVA 1P4LB 5AG9A 2ICWI 2YXFA 1BZ9A 3GBDA 3U83A 4DO6A 4H20H 3BIKA 1RVFL 4U49A 3EO1A 1G6RL 2EDJA 3BMVA 3HE7A 2B2XL 1D9KA 4FQXC 4WW2F 4F7PB 3GHEL 2CIIA 1F86A 1C8QA 5E2UH 4DZ8A 1YY9D 4E9TA 1JGDB 6CGTA 3DMMA 3SBWA 3HR5A 4L1TA 3D3VD 3CIQA 3KYKL 2ZYHA 3F7YB 4H13C 5AAMC 4FABH 2W60B 5DD0H 8FABA 1G7JB 5FO7A 5TE6H 4GOSA 3KGSA 2IALA 2QQNL 4EZMA 4D8PA 4RRPA 1U8NB 5MP6H 4P3DB 1AMYA 1BVKA 2A6KA 3RDJA 5ICZB 2ZNXA 5DFTA 3ZIMA 3V5KB 3BWUF 2YJLA 3MXVH 3MRJB 4H8HA 3UBXB 3ARPA 2CBMA 1ZGLP 4K5NA 3V0VA 4XNMA 1KCBA 2G75B 3FB5A 4P3WA 5L88L 5L2JA 3ATDA 3Q6FB 3ARGC 1IEAB 3IMTA 1KIQB 2Z91A 3L5XL 4UQIM 1A4KA 2IPUG 4UV7L 2MHAA 2BDNL 4JZJB 3W56A 5C92A 3MRGA 2UV3A 4WGVB 5DVLA 1I31A 4X4ZA 1P5VB 3NJKA 2NY5C 3WHE0 3FQ2A 4RFOH 5CSZA 2QDVA 1MFEL 2YWZA 1P4IH 3OZKA 5EU7E 4NZTH 4P49A 3E8UH 4NFDA 1ITBB 2WAQA 1UXWB 3B9AA 1M1XB 4X98B 5J6HA 5GZOA 2R9HC 5LUMA 3VXUB 5F7EH 2YPLA 4KKCD 4EZLA 4C83A 5I6XB 2LFGA 4NN5B 1GY2A 5F6IB 3CN4A 2H2SC 4YSRA 2MCPH 3OGOE 1TVBA 1G9NC 2L7UA 3WL9B 3IJ8A 3QQDA 4NNPL 4JR9L 1N5YL 2OMXB 2RMNA 2VB5A 5EZOH 5IVXA 2Q0ZX 4F33A 1Y0LB 2DQEH 1DLFH 3ARGA 3GJFK 2NW2A 5CZKA 2DQCL 4X5WA 2WB1A 5EFIA 3M86A 3ZTCC 1JVOA 1A25A 1TITA 2DQCH 3N41F 4HH9B 4KKCC 4KKBC 4M5TA 4RIRA 3MRKA 3B4NA 4BE6A 3WG7B 2YD6A 5A6MA 1NINA 1CFNA 1GY1A 1NCCL 4LPVA 3ULVL 1UM5L 1J5IA 1ZSDB 3IVKB 1DSWA 4JJHA 1SPDA 1AHWC 3B3BA 1QTYT 1VZGA 2PO6D 1S7TA 4F2FA 5IB5A 3C5JB 4LLWB 3F01A 2VDQL 3VXMA 1MCIA 3NEEA 4JG0L 4W6XB 5AVQB 4N86A 3LN4B 4JANA 5I30H 1Z5HA 1NAKL 3BSZL 3SZKC 3V0AC 2IBGA 3BVWA 4HUXB 3UTQB 4GIAA 2ITCA 3RWCB 5C0BB 2ZAGA 4HJSA 2RQEA 2IFGA 5FFGA 3CCHA 3T8VA 3REWB 1DZ0A 3QJUB 2R8SH 4C8XA 3B2MA 4XPBL 5LCVH 4N8VB 1GTNA 4LBEA 2JKNA 1G6VK 1T20B 4RGNC 3WMSA 2I7OA 3AS1A 3OLGA 4PRDA 1E8WA 3EYQC 4CGTA 3BAKA 4RVBA 4XZUA 3FQTB 3H7BB 5D7IF 3Q0HA 1AD9A 3H42H 4AYGA 1EEZA 3D69A 3ZHLA 4AGMA 4HZ1A 3ISRA 3BSZH 3MV9D 4PLOB 4YIQB 3IETA 4L37B 1QQDA 3CPLB 5IVZA 1XCWA 4PP2A 1KYFA 1ZEAH 3P0VL 2ESVD 1KBWA 3DO3A 2GQHA 5F72S 1MN4A 3U2SA 5B39G 5D8JH 1YDPB 1Z9PA 5I66A 1QRKA 3C87A 3OMAB 2Z7WA 4JZJA 3BQUC 3CZUB 1A8ZA 3WJMA 3REVB 3KLKA 4MFHA 4OD1L 5FO8B 4BWWA 4QGTA 3BUYB 4DPRA 4PS8A 2N0MA 5D9SA 4G6ML 4DSYA 3G6JA 2P5PA 3QISA 5HHMD 4A6YA 1VA9A 4PCSA 3L4UA 4TQEH 4NQEA 2WLNA 2NQ3A 3ZL1A 3EJTA 3AZUA 1RZ7L 5C0CE 3SPHA 1YEEL 4MNQE 3RY5A 4IK7A 1YECH 1RJYA 1U8NA 3QH3B 4OUUA 1XCXA 4N8PA 2GT9A 4X99B 4CSPA 1T6WA 3GMNB 1G7JA 5FO7B 5ANMB 4CADB 3VCLB 3BQUD 2WOYA 1A6TA 4XBGA 1JPFA 2UZYB 2IAMC 1P9MA 2C9UA 4XNQB 3TVMC 2EC9U 3O2VL 3ZMRA 1R75A 4BFJA 1QR1B 4KVPA 1OCZB 1GGBL 3IXAB 5DK0B 1G1CA 2N7AA 3QPQD 4Y2OB 5B38G 4HMCA 4LCIH 3DGCR 3AABA 2C26A 1SZNA 3EXJA 3N1QC 4Y16A 3TBWA 3TT3H 3WFEH 4XPTH 3O3AA 1SY6H 1E4XH 3FTYA 2CNZA 1ZLVH 2J88H 5GS1C 4XBGB 3FPXA 1BX2A 1FDLH 2D7PA 1LQBC 4M4RB 1OXYA 5C08A 4PG9A 1ZJBA 4PJ5E 2AK4A 1J05B 5DJCA 3FUNA 1QEXA 4Z7UE 4GKOA 4EF3A 2R23B 3DJRA 1UADC 1IM3A 2VM9A 4ANVA 1Q8MA 1W6WA 2A9AA 1L0XA 1ODUA 4K7FA 4AW7A 5FYJD 3WTTA 2Y9RT 3RWDB 3N40P 3V4UL 1NPJA 3SDDD 4PS4H 1T03L 1B0RB 4G5AA 1RP9A 1OF0A 3VW3L 4P46A 3UYOD 5JXAH 4KPHH 4LEOB 3FTZA 2A6IA 3L81A 5TQ0H 2R1XB 1TJIH 2ZSWA 2Z0BA 2EVJA 1I7TB 3LQAC 3TZVA 1AH1A 3OWRA 2YOAA 3BH8A 5IHBA 3X2QB 5FGBC 4CU8A 1ZK9A 4HS6A 2QV4A 1BQKA 1UFUA 1QFUL 4W9HC 3D07A 2V17L 2OTUA 1BZ7A 4W81A 4XBMA 4U1IB 1BOGA 5IMMA 1AY1L 2LU7A 4K94C 3EJPA 3ZW3A 1CU4L 4F15C 4N8VG 5F3BA 2DQFB 4WY7H 4AIZA 3AWEA 3IFNL 1XDTT 4K7PL 1KB3A 3TEYA 2XWXA 3K6DA 5GRXG 1EK3A 1RV6X 3U7AA 3DDGA 3ETBJ 1H6TA 4W9IC 5CWSB 5BRZB 4MXQC 3NSDA 1I9RH 2JJSA 2WLIA 4LL1A 4OSUH 3EOYG 3CLEH 1PZSA 4LGRB 2NW2B 3N85H 2YPLD 4GG6A 3LRKA 1TLMA 4XMLH 5IJDC 3FOLB 5AYUL 1SBSL 2CGRL 4A2DA 3SYAA 2R29L 1FFPB 3NZUA 1XZWA 2CGRH 3VI3F 1XIWD 2H8PB 4NO2A 1WFIA 1IBYA 1OAYH 1RK1B 1NA8A 4FFWD 4F5CE 3ENEA 1EIBA 1AQKH 3AJ7A 2XNAB 1W15A 3OPZL 2DQJH 3TA3B 25C8L 2FJGA 4LIQL 4WWNA 4NUJB 1IFHL 3KNBA 5F9JB 3K3QA 4JQVC 4UOQA 1KCRL 4WY7L 1JVKA 5EBWA 3NIFB 1EGJL 2JKSA 3BEVA 1BWWA 1YYCA 4S0TD 1TZIB 3MRHB 5LAXB 2QKIC 3IDGB 3TBBA 3VWJA 3VQ2C 5I9QC 3TO2A 4IRZH 4Z76A 5BRZE 4YE4L 5E8PA 2WKLA 1G9MH 3T0XA 2Q8AH 1BAGA 3MV7A 4NWTL 4N8VA 3N91A 5AZUA 4Y2LA 3TJHD 2XNAA 5TDOA 1ERNA 5F0PB 4M3HA 2C8NA 3RX7A 2Z9TA 1R3JA 2AK4D 1HIML 5T33L 4RAVB 1N9PA 4TNWK 4NCC1 3N6YA 2GIMA 1V3JA 1N59B 2VXSL 4LNRA 1RIUH 2BXYA 4XC1L 4DZ8B 35C8H 3VW3H 5AYUH 2BOCB 3TO4B 2J3SA 5ES4B 4J3WA 2ZCHL 4XTRC 3DIFA 4HP5A 4JRXB 4LNVA 1XMEB 3FB7B 4L3EB 4L5FE 4NBYB 5J06A 4GG6F 4LF3A 3AAZB 3H0TB 5AOMA 4OB5H 1KLUA 3GBNL 5TDPB 5C0FA 1D5ZA 2FUTA 2X4OB 3V5KA 4X42A 1IFHH 1EAPA 3MRRA 3H2WA 5EOQL 3QUHA 3ASWA 2A6KB 2W94A 2BY0A 3GD1C 1TPXC 1HH9A 1JYXA 2E7CA 5CINL 4K8RC 4CL7A 1JK8A 2F58H 4WTWA 5AQ0A 1MUJB 3ARWA 1SQ2N 2W65B 2R0LH 3DO7A 4LSQH 2D3JA 3FU3A 1AAJA 2PMZA 4HHAB 4RQQB 4HULB 4Z7NB 3QPXL 4DN4H 4ZMVA 3D0VB 3FUHA 2VOTA 2XT1B 2BHFA 3F58H 5IMKB 1A4JB 3E2HB 3ULUE 2EIBA 2WOBA 2Y7MA 2WXLA 3DI2B 5DK0A 1MFNA 1UC6A 2BP0A 3E1ZA 3VQ1C 2ENYA 4NQCD 4NHUA 4NM4L 4IKJA 3RVUD 2JKRM 1KEGL 4GKLA 4NJAL 3LQAL 1NEUA 4EUPB 3E6HA 3MUGB 4ZPVB 1O7SA 1IBGL 3WDJA 5IW1A 3F7QA 3IDUA 5IKCB 3C6SB 3P54A 1YPZE 1KCUH 2R15A 4KJWC 3T3MF 1QFPA 1XCQB 4QO1A 3UYRH 1IL1A 2NY5H 4AXWA 4R4NC 2D73A 4B9IA 4MJ2A 1MREL 4CMMA 1N6UA 3U7WH 4QUOA 2ATPB 1M9SA 1RPKA 4JO5A 3O4LE 3JZ7A 1TJGH 1XEDA 5HYJE 1RZGA 5CJOH 2EDWA 3PJSA 3MNWB 3C9NA 4ZFOA 1DSFH 1ZA3B 3TNMB 4L8BB 1IRAY 4HC1L 5HHNB 4PW3A 4F7TB 4YL9A 1ITCA 3Q06A 3I85A 2Z4QB 2VC2B 2JELL 4YHOH 4L8SB 2X4TA 2VDLL 3IYLW 4OTXH 1FO0A 3JUZA 4XC1H 5DUMH 1HN1A 4PB9L 4R5TA 4F7KA 2BCMA 2ZOTA 2ROXA 4FQLL 4N25A 4HKJB 1TVDA 1WAAE 1S9XA 1A6VH 3OKNB 4OZGE 4E9SA 4P48A 3WTXA 4ZD3H 2W38A 3MRCB 4LSSL 4OCSH 5C0DA 3U2JA 5JOFB 4HCRL 1GRWA 3FMGH 4BD4A 1F3DJ 3V5HB 3TIDA 4U1IA 4PWJA 3RZCA 4BFBD 4I9WE 1KCVH 2BSSB 1OD7A 3AGVA 4WUKL 1O9ZA 1TQBB 2NZIA 1XSKA 4Z7UF 3GYRA 1MWOA 3WIHL 1WRFA 3QNZB 3L3OA 2ZCLH 1E8ZA 3V4VL 3D2UD 3CFJA 1EERB 3MBWA 2CSPA 5KUMA 4KI5F 4ODSL 3T0BA 4R9HA 3VXQA 3ZU8A 3GJFB 3LD8C 4YVNA 3QDAA 4QJ5B 4K4KA 1B4JL 4JO4H 5FM4A 2H1LM 1PZ2A 1O75A 4Y1TA 3UG4A 1SYSA 3E1F1 4IRSD 1PJWA 4WFGD 4BXVA 5JQ6L 4PJXA 4OLZH 4NM4H 3VXRB 1WP6A 5CR8A 4M7KH 3EFOA 1YUHB 4AX3A 5I1AA 1R0AH 2F5BL 2GHZA 2ZD0A 3H7BA 1OHQA 2K78A 3PNRB 3SDDC 1I1AC 2LQRA 2RHEA 1NMAL 3EGDA 3QDJA 4IOSA 5D7JC 4OQTL 2VLKA 2HVKA 3MRIB 5IB5B 3HRZB 2XU9A 3SN6N 3INOA 2P1YA 3EYFB 4I0PC 2ED7A 4P59H 4TVPE 3QWOA 4FFZL 2CXKA 3QJHA 4OM1L 2BS8A 3LPWA 1XHHA 2AJUH 3CE1A 1BOYA 2XRAH 1MZYA 3P2DA 1JIBA 3KPMA 3NRPA 5DK2B 2RA1A 3AC0A 3BVUA 4PJ7A 2BS71 3O3EB 4I8DA 4MAYC 2ZOUA 2DMGA 3H55A 1ONQB 5IFJA 1X5GA 1LQSR 5ANMA 5FLVA 2FSDA 2E0PA 4LPYA 2CD0A 4MXQD 5CILH 3ARVA 3UP1A 4ZRGA 1P2CA 4XNUL 4K7PY 3SGKC 2LTQC 2ITEA 1VENA 3E9TA 1KSRA 3ZDXF 4X4ME 3SO5A 1LEGB 1CD0A 2OYMA 5EO1A 4S0HA 2X9YA 1DBBL 3JWDL 3RWFA 1JS4A 3E8UL 3H9SB 3BUPA 1YLBB 2A77H 4GKZA 3EUDA 4XN9A 3ZT5A 4KXZH 1H3VA 1OO2A 4JFQA 1TJHH 1BM3L 5HDOA 2H6PB 5E9DB 4A1RA 3GRWH 3KPNA 3DRQB 1NGPL 5E6IC 3SQOH 1HCFX 4JQIA 1UWEL 4N85A 4UAOC 2E47A 1QLEH 1FLTX 4I0PA 1ANUA 1NUNB 3AAZA 3H0TA 1HHKB 4G1EA 1IEBB 1KB9K 4JG0H 4LEBA 4XH2B 1OT4A 5F7DB 1T22A 1HYSD 3IU4H 3S3JA 4KH2A 2VT0A 1YJDH 3QQXA 1TMCB 3IU4L 3M46A 5DJZB 4L1BA 1SJHA 3TJHC 4WLCA 2DDQL 3MZTA 2CKBB 4U3HA 1IGIL 3EOTH 2H6PA 2E9JA 4PJCF 5INDB 5KSBF 1QFWL 1X3DA 3HE7D 4ODUB 3C6LC 4W4OC 1S7WA 2NCMA 3BKMH 3UTSA 2GIXA 2IWEA 2P49B 3FZUD 1NGZB 4M7LL 4CAGA 4ZYKA 2Y6TE 2P24B 3DX4A 2N1KA 3BQUA 3WEBA 4IRSB 1JD7A 4P57B 3G9VA 1TETL 2V9RA 4JCLA 3OKDA 5CJ8A 3CFQA 1GC1H 3CJJA 1EZVY 3RA7H 3IPEA 3WEMA 2PPFA 2PW1A 1Z2KA 4FFWC 3TLRA 4GT0A 4JM2A 1U21A 2RJMA 3FULA 3HW7A 3CK0L 4JS7A 2C3VA 3JBG7 1QR1A 4IBYA 5EBMA 3RIFF 3HJ0A 3HNSL 4UWQB 1HI6B 1DVZA 2NXZD 2E7BA 4UDUA 1N26A 1RSFA 3KEDA 2DL2A 3L5XH 2BPBA 1NUDA 2VL5B 3AITA 2IH8A 2V2WA 1WJ3A 4YLQT 1KDJA 5E6SB 3VYOA 2X1QA 1CXHA 4L4TB 4X6FA 4XPFH 2B8OT 2OA9A 5F7WC 3RIAK 1X7QB 5D96B 1YNTF 1BQLH 1MCQA 5KJRL 2NY1B 1H3UA 4NCDA 1I8AA 2AJYL 3ZO0A 2BVTA 5EIVA 3H3BC 3O3DA 4DGWC 1E43A 2A0LD 1P4IL 3EIFA 4DHLA 4ZX4A 1JWUA 4GRWH 5LNDA 1HL9A 1ICTA 2KLSA 5HHPB 3EJQA 4PRIE 1CFTA 1TTBA 2VLKB 1QLFA 3MLWH 4WWID 4OFKA 3SDXF 1QAWA 1SN0A 3NH7L 3LHAA 5JORA 1DVQA 3EDKA 4LLUB 1UB6B 3FU7B 4A04A 1HWWA 3AMKA 3ZR6A 2V3EA 1ETJA 2G0LA 3RNQB 2W0FB 3RWIB 2FT6A 4TPRH 4CN1A 4J6IA 1EEUA 1YAIA 4LCYB 1XSIA 2FL5B 3E7JA 2R4RL 4BZ2L 5I0XA 4HLEA 1NAKH 2A0LC 3VXUD 5BW7A 3D7PA 3OXSA 3QJVB 5KVGE 2ED8A 2R7EB 4JREB 5LWYL 4GIPD 3FU7A 1S7RA 4Y2NA 3SZ6A 4GS7B 2NUPA 1IO4C 3I6KA 4HISA 3PV7A 2JIXD 1CGXA 1KYAA 3K74B 5ADPL 5FFOA 5C09A 5IJCC 4PN6A 1SLWA 43CAA 4P4RA 5DT1H 4FQ2L 2Z7ZA 1N0LA 1ZHBB 1JF1A 4HWNA 2YAEA 4W9ZA 4QRRA 3NJMA 1BLIA 1FL6B 4HGKC 3X11A 4HOZA 4HPYH 1YECL 2R0ZL 3X1NA 1Z0MA 2YPLE 3I6KB 4WWKD 3AT9A 2FIKA 2AZUA 2ZUVA 2PPEA 1YO4A 3KPRB 3O45A 4N0CC 5A2CA 1COBA 5I30L 4E9WA 1RFDH 1B4LA 3CVCA 3K6SB 1D5IH 5MEPA 1H15B 4L1DA 3MJ7A 4TF4A 1U8OA 1QRNA 4MXWH 1HHKA 1PLGL 2F18A 2QELA 2E86A 4AQ1C 2FYYA 1JJUA 4BBWA 5C0BD 3D33A 2DMCA 1O0VA 3L3DA 1GSKA 2MKWA 4WO4D 4AE0A 4ZXBA 3IXTA 4ZNCD 3TBVA 1IC4H 3ETSA 3MRLA 3SDDB 2X7LA 2V5TA 5D7JB 5IQOA 4KOBA 4IBLT 2H3NB 1UTDA 1BZOA 3T4YA 3HUJE 4CDGC 3V0WL 2VDKH 1B2WL 4OCYH 2YO3A 4NGHL 3CZFA 2W88A 4KV5E 5IW1B 4YOKA 1E40A 3WLBA 2MQ0A 2HN7A 2NCEA 1MCOH 4JFDB 1RHHA 4J4PA 2AXWA 1I1AD 1ZD6A 4IRJB 4XR8C 1MRDH 1LEKA 2DWEB 3EUUA 2EDRA 4JUSA 4LHUA 4DPAX 5HYEA 3QQDB 1V3MA 4DP6X 5LG6A 2WLLB 3EOBB 3GMPA 3GSNA 4OFYA 5E9NA 5FX3A 1SY6A 1ES0B 2IIJA 3TZVB 3KPNB 4F7MB 1BIHA 5IMOA 2BIPA 3DHPA 3ESVF 1DQDL 1TCRA 3LPGA 3OMIB 1I75A 4I3GA 2ZKWA 4G9FE 5BRQA 5E1AB 1HNGA 1EZSA 4ZOAA 3ROLA 1KYDA 3ABMB 5JPNB 3D51A 1HH9B 4EIGB 1N3NA 3BPLC 2CHDA 1LTXA 1XGYL 4LCUB 5C97A 1NBVL 4WTZG 1TFPA 3QWNA 3BP4A 3UTSB 1D5MA 1EDHA 5I1CL 4ZO9A 1A6PA 4M1CC 4AGLA 3VRLF 1SDDA 4OJDH 1X4YA 1FO0B 2VKXA 1K8DB 4JNXA 1JPGA 2BP0B 3KYNB 4BV1A 3V0HA 3CXHK 3D9AL 1IARB 1NCBH 4I0PD 5KYUA 3WN5A 4L5FH 2IXQB 3LKQA 2CBTA 4JFSA 5DYFA 3UAJC 1FBIH 4ENZA 1JNLH 4Z78A 3B2VL 1Q1JL 1JK9B 1NSNL 3I6LE 4WK0B 1Q90A 1IGJA 2FE0A 3G5XA 3IE4A 4MNGB 4NO0B 3U79A 1WH0A 3GKZA 3W2DL 1ML0A 3NGBB 2IG2L 1EDQA 3G6JE 3RWHA 4MZRA 3TO4D 1PPIA 3G5ZB 4XCFL 4Y4FD 4NN6C 1KJMB 4X0NA 3FKUS 4YSTA 1QBLH 2QR0A 4QYOB 2Y22A 3B43A 4PPTA 1HJCA 5C0RH 4P2OB 4YHIB 3ZL2A 4N2NA 3RGVA 2GW5A 2ADJB 5JUEH 3FZUC 2COQA 2Q7NA 2EVFA 1KXVA 5D2NA 1LL1A 4KKLC 5FUZL 4BGLA 3GUTB 1PX4A 1NGXA 2BSED 3P02A 3MV8A 3HS9A 3RX9A 1FGNH 1H6EA 5TE4L 2WYIA 3MA7A 1TEFA 1PZCA 4PTUA 2I9TB 1AQDB 1RUKL 2YEQA 3DKHA 1TO5A 4Y4FC 5SWQA 3B9EA 3PHOA 2WCPA 5IJBC 5JHDD 2NTFB 2R0WH 2AEWA 1BCIA 5D7IA 3OHXC 1UCBH 4S2SA 5BUAA 2VO8A 2QSQA 5D7SL 1JI2A 5GJTH 3SO3C 3US1A 5JMOC 3M6DA 5AKTA 2D2CC 3OAYH 1LXMA 4NT6A 3VD5A 2NY7H 1K3IA 2I24N 1YEFH 5C08E 1BFVH 1NCWL 3QIUC 5F7YC 5K33A 1QYGH 4W4NA 1J1OL 3WE6A 4R7DB 4AL8C 4H2CA 2R7EA 3IAPA 4YEFA 3QJFA 5JYMA 3ELQA 3LNGA 1L5GB 3CFDB 4P2AA 1GZQA 2EH7L 4PRPA 1RUPL 2CO1A 1H3GA 3EBGA 4M48L 1QUNB 3K1KC 5GRYA 4C47A 1CI3M 4WW1B 5CU5A 4R4FH 1YMMA 5HI3C 5SWZA 4XAWL 4NI6A 3RWGA 1NIBA 1CFQB 4KXDA 4OCWH 5CKAA 4N2AA 3BXNA 1OCCB 1TVHA 4K3HA 4FQ1H 4WCYH 3MOBH 3PAUA 2GK0A 2DF3A 5DC2A 2L7EA 3QORD 1R3KB 5ENWB 2NY6D 2OCFD 1MI5B 4JKPL 4XNMB 3WFHA 1NAMH 3BE1L 4HC1A 4M7ZC 5C0IA 4GLRH 4XBEH 3GSVA 4N9GB 4P46C 4AENA 3MO1A 2NX5D 4M1DH 3KPOA 1T2XA 2B5IB 3APDA 4LF3B 3LCYA 4NRZB 2J88L 4KKBD 3GSQB 1KGIA 4F8PA 1JZIA 3EOAA 1DDHA 4NN7C 3OKEB 2DWSA 2E6JA 1FZKB 5IV2B 3BOVA 2I26N 3WD5L 2NYYC 4O4YH 1INQB 1D5XB 2AKRA 2XG4B 4P5RA 4ZO6A 1NEZA 2K0RA 2X4QA 3LRSB 2BNUB 3QIUB 3D08A 3IDNA 4XX1G 2NXYD 3PDDA 3EJZC 3UC0L 2P8PB 3BVNB 3TV3L 3I9PA 3C9NB 1EEYA 4KHTL 1T83A 1CD8A 3WTWA 3C5ZB 4LSVH 4RESB 3RQ3A 1IBGH 4R7VA 2IDSA 5AKVA 3ZY7A 1S5HA 5IFHH 4MASA 1OM3L 1WCBB 2VIRB 3JZYA 2X88A 3HI6H 1QNZL 2WKOF 3GXDA 4AH2B 4ZMYA 4U7KA 1WAAF 3QQ9D 4KX7A 4MD0B 4OJYA 4WI0B 1IQWL 3SBPA 1LYQA 4WO0A 1HL5A 2Y5EA 4ONHB 1MXDA 4KY2A 4HHGA 1G7IA 1AO7D 1JRHL 1JOIA 2A6DA 3G04B 5TGBB 5ECGA 4JGJA 2NUTB 1JRHH 2A2QT 2EC8A 5FO9A 3S5LG 5KYYB 1BA9A 5LN4A 2YD4A 4OJEH 5EWIH 4ORGA 2BP8B 2YFNA 3N9GH 2XN9B 2WGXA 3FRUA 5T3ZL 2PYED 2OZ4A 5ALCH 2EXSA 1ZCRA 5D4QA 3S88L 2I32A 1FYTD 2X89A 4JB9L 4OI8A 2HJFB 5F96H 3OTTA 3U1SH 2D9CA 3ARDC 5SWZD 2CK2A 3BCFA 1OPGL 5MEND 2X0UA 5JO5B 1Q72H 4PJ8A 4AIOA 5J11C 3VXMB 1MJ7H 4NKIL 4YL4A 1ZY9A 3W57A 1FRGH 4EQ2A 5ACMA 5EUKB 2XWTA 4TSCH 2J71A 2L7JA 5DA4A 2VSCA 2ZCLL 2WBWB 1ZLWK 4HEPG 4DEPC 3ME0B 2HJLA 1NGPH 2G30A 2V2XA 2F6AA 1WFOA 5D70L 5T3ZD 1YEJH 4PLNC 4YDIL 4JY6A 5BQ7A 4BFIB 2DM3A 4RMUA 4U6YA 4TQHA 5AW6B 3WIIH 3HI5L 1U4EA 1QZ1A 5H94A 5HYSA 2JKWA 3AG3B 2QVMA 4G3YL 4BYHA 4IGBD 5ILTL 3N50A 2VUKA 2ITFA 4FQLH 3TBYB 2EH8H 4WF7A 4KV5F 1U8JA 3D4ZA 3GB7A 2VXQH 1W8NA 4JLRB 4Y5YA 4XNUH 1XGQB 4ZTPH 1KPRB 3S36X 3B6SA 1FNHA 4I18C 3VX0A 3ZTJG 5E2TH 1WIOA 3BSZA 1I1FB 1VFBA 4JEGB 5LBGA 2A74A 1T1WA 1FCGA 3QI9D 3OXRA 2FBJH 1I3GL 3MRMA 2OR9L 1RURL 3KBFA 3O8XD 3MRBA 3VD0A 5GRWA 3F83A 1RZJH 2F19H 4EI5B 3ZDZF 4KZEH 3VXNA 2E3VA 3DUUA 4XGZA 2NY3B 1DFBH 3FT1A 4XWGL 1TTGA 4X9BA 2YD7A 3PHQA 5E23A 3U2SB 1QTSA 2EDTA 2WQAA 3QDGA 2PETA 3ET9F 1UD4A 2FT8A 5DQJB 1QWNA 4PJCB 2C5DC 4A67A 1E27A 4DN3L 1EGJH 1YHPA 1E9OB 1ZIBA 2X5PA 4OF7A 4TLUA 3V9FA 2A4ZA 4ZFZA 1A6TB 4Q9QL 1AHKA 4XWOC 4CC4A 2BINA 1P7BA 3MLSH 2WTOA 2X4RB 1JZEA 2G75A 4X4XA 4LLDB 5KVGL 4JDTH 5IKCA 2I9LA 3BP5B 4AEIL 3FPYA 4XCNA 1BAFH 1B0IA 1JE6A 3K8KA 3MLUL 4HBCL 4N2OA 4XVTH 2C9SA 3O6FA 4KKAD 1B4JH 3LQZB 4JO4L 5AB1A 4NX0A 1KLUB 2ODHA 3NZ8B 4XP9L 5TDPA 1DJZA 3GSNH 1CLZL 3SDCA 5KN5B 2Y7SA 1B0GA 2APTA 4FFVC 1P5UC 2CLRB 1VDGA 2FCBA 4L3FA 4OZ4B 2C7FA 4LVNC 3MYJA 5JHAA 3VMPA 3QJQB 4XWOD 3PUCA 3IDXH 3FQYA 1TG8A 3HC2A 1MIEH 5JR1L 1YNTB 1QHQA 4HHAA 5C0AD 4K23H 3SYQA 4WUUB 1KB5A 1OZUA 5E2WL 5KN5A 3NPSC 4HIXH 3OF6D 3QXTA 2FQGA 4BUQA 2UVEA 3B9KA 4CA4A 4MA7H 3BRFA 2WJ7A 2FGZA 2QFRA 4DFIA 3GUFA 2E9BA 5DMIH 4CUCA 1AGBA 2AJYH 2XWDA 1BXXA 3KR3H 4OCLC 4QO1B 2YKKA 3HE6C 4AEHH 3FUDA 5DUML 2FHBA 1KB5B 1EJOH 1L7TH 4AYBA 4OV5A 4IGBB 1EZLA 4XN7A 4G83A 4B60A 3LYRA 5EFIB 1MFCL 1EXUB 3PREA 4JFFD 1AXTL 2A6IB 2ICEA 1RK7A 2PWHA 2Z8WC 4UT6H 2MOVA 2NRDA 2OCJA 2ZSVA 4EN2A 5IY5B 1NFKA 3EJCA 4X9GA 2XIBA 2ARJB 4RAUB 4L8BA 4UTBL 5H37G 1A7QL 4HCGA 3V6OC 1SUHA 5KYYA 2VDLB 4HLZH 1HSAB 3ZDZE 5FCSH 1ZT1B 4IBVA 4KAQH 3HBQA 4TTGA 1A7PH 2QADC 2JFCA 1NAMA 2AV7B 2J4WH 3B1UA 1VJSA 4R0LC 5DO8A 5I5IA 3X14B 2KBGA 2H9GB 1NKOA 4FFYA 1H5BA 1NPUA 4RAHA 5D93B 4Z7VA 2CXGA 1DVXA 3RY6C 1U8QB 2H2SD 1J0JA 2DQFA 2GBTA 4W9GC 1G0DA 4AIZB 3LKOA 4TTDC 3WTYA 4I1PA 2EACA 2OXGA 3TN0B 3K91A 2HJFA 4LCWB 5ICYA 3D25A 4UDTA 3O0LA 1U92A 3NOIA 2VDMH 5IREA 5DVNA 3ARDA 1G7LB 1XGTB 2KQNA 1T21A 2G9HB 5I1KH 1YCSA 2EYRA 4OZGF 1N12A 2EZ0C 1T5XB 2UUDK 2XG5A 3WS6C 1AQDA 1D7CA 3BZEB 1ZANH 4G6KH 1C08A 1AO7B 1O7DE 2F8VA 3OZ9L 3QNZA 2JIXA 2NXZB 1CICC 5E8NB 4GRLC 2HTLC 3QZLA 4G1MA 3GJEA 1N7MH 4M93C 4N4YB 2WXHA 3IS1X 4Q7DA 3SDXE 3E3QC 4YC2C 1GR7A 3PL6D 4Z9KB 5DHXB 5C0JA 2NY0D 2KMWA 3VD2A 5FA3A 1NJ9B 5E8PB 2UWEE 4G8IB 2HJKB 2WUBL 3WFEL 3GO1H 3UEQA 3ZRSA 3TT1H 3CU1A 2XETA 1R5WB 1JG9A 4X4XB 3ZHFA 2W60A 3ZLQC 2QGBA 3VFGL 1EJOL 1L7TL 3N0PB 2GK0B 2Z93A 4R0LB 2YQ3A 3KPQA 4FULA 5AW4B 2CKNA 3PYCA 2YQGA 4DOHE 4P3CH 1C5DA 2FJFA 4YNYA 5AAWC 1BZDA 2C1OB 2YLHA 4P3CL 5EZIH 3L08A 5I73C 3TURA 2R2EB 2YAHA 1IGTB 5ID1B 1QUNA 3A23A 2DI9A 1HH6B 1YNLH 3D06A 3QFJA 3LNDA 1JRHI 4KUZH 2DQIL 2VLKD 3I50H 2DAVA 1HNYA 3LKSA 3VNZA 1X6NA 3LN9A 2EXWD 4IEFA 4WV1B 5JHLH 3RTLA 4EE2A 1X5XA 4C83B 5BO1L 3LDBC 2B1HH 1F1AA 3ARBD 5BO1H 1ZHKA 1HXKA 4LP5A 4ZMWA 1OP4A 1SEBA 3AREB 4I18B 2WLZA 3K46A 4NPYB 1DQKA 5FOBB 1IEHA 1OP3K 4D8PB 4QPEA 4HUVA 1WZMA 3WNIA 3VB9A 4HS8L 1MHEB 2P8MA 1AHWB 3P2TA 1YC7A 3DHUA 1X7SA 3EOTL 5D2LA 4N8CL 4YPJA 4HS3A 1MH5A 4JFEB 1EXUA 4B9ZA 3FYEB 3QUZD 2DKMA 4PJDB 1XH3A 3KGRA 2EO7A 4HUWA 3NJFA 1JXDA 2DICA 2QQQA 4G6MH 1NGQL 1ZV5A 4JDEB 2J1WA 2OZ4L 2QVKA 1JGLL 3NJXA 4EVNA 3UCQA 4XH2A 5KG9B 4EDXB 3F12A 3ULVH 3BP4B 4DUVA 2W07B 3JWOC 3RVTC 3U4EA 1UKTA 4LLWA 4H2AA 3L1OH 3KVQA 3O6FB 4JFDA 2ZXAA 4PFEA 3U6XA 2OL3L 1U91A 1RJZB 3K2UH 3LB6D 1KTRL 5EZPA 5EU3B 2DWDA 2FEJA 3ORJA 4X6DA 1FF5A 1H5BB 1WHPA 4GY4A 3ALXA 1IIIA 1NANH 2P5WE 4W9DC 5DVMA 5IT2H 5DHVA 1AIFA 1Z9LA 4N26A 3NK4A 4A2GA 3POCA 3T2PA 3DWTA 5BUPA 4DKDC 4GXFA 1DVFB 4NO3B 1JPTL 1Z3RA 4QRRE 5FV2A 3WEXA 2XN9A 5GQBA 1DDHB 2R1YB 2CBQA 1MJUH 2AGJL 2J8UB 2OSLA 4GKNB 5JDSB 5CLYA 2F9BT 4N8UA 3OF6A 4L0ZA 1F8TL 5FGRA 4NUGL 5HVFB 1K6QL 3FB8A 3QR1A 3IMBA 3PE9A 4HIQA 5D7JD 3GSXA 4NKMA 3NQIA 4HD5A 4WI8A 2RCSL 1I3VA 2A73A 5KBNC 1SM3H 2Z7YA 3FQTA 4PAZA 3VGAC 4Y1SA 4F3FA 4YDJB 5K59F 1VFUA 2YD8A 1AC0A 3CFCL 1L9QA 1PAMA 2LLLA 4QY8A 5TF0A 2W5PA 2HUEA 3F7RA 4UILH 2VXVL 4NQXA 4K3GA 2Q6WB 2G3MA 4DETA 4HJIA 1MHCB 3ESNA 2JXMB 4IHOA 3TBYA 1GGBH 5E95B 3MRKB 4L8SC 2ZIDA 3EGDB 1XD0A 3DHJA 4K8RL 5H94B 3VXSA 1UD8A 3J07A 5F9AC 3F8UB 1HEJC 2XFGB 3O3BA 3BGMB 3ILDA 4DQAA 5F71A 3NBNA 5BQ7B 1TU2A 4Z0BL 3U6RB 4K94H 4M43L 4FXTA 3PDGA 1PQZA 4YR6B 3LN4A 2ZWNA 1E3XA 2JKXA 2XQYG 2QLVB 4Z7WF 2O5YH 1NOFA 3FUIA 1EZUA 4L4VE 2WXIA 1P84K 3TP4A 3V0JA 3RVVD 2O6EA 3CTTA 3RPIB 3QXUA 1QSEA 4JLRA 2HX7A 1KTBA 2E4TA 3GRGA 1SYVB 1HYRC 5C0FB 5EOTB 4MA1C 4WKZB 4RSVA 1VERA 4TQPA 5DR5L 1T1YA 3Q8EA 1TLKA 3L95A 5E8EB 1Z0NA 1CLYH 4ZFGH 1DQLH 3CZSA 1P7QA 3MRLB 5F7FA 4L1LA 1UUNA 1N5AB 5K9OA 4WWPA 4PJIA 3CXHJ 3P9WB 3SE6A 2B15A 1HDMB 1QW8A 1UKSA 3DX8B 4MAYA 1FO0H 1T1ZA 3VGAB 1JHTB 2WMPB 2PO6B 4LLMA 1SF5A 2QSCL 2V7HB 4ALAH 3RGVD 3MA9L 5TQ0L 4FG2A 3V5DA 3IETB 4RFEB 4IRJA 1IC4L 2JTDA 3EF7A 1NC2B 4BZYA 3VWKB 4KJPD 1G7HA 4IK6A 4NPJA 5ITBH 1IC5L 1UXSB 4PG9B 5F89B 3G6DH 4O4YL 1CZ8H 2X4NA 3FQWB 5I1EL 1NDMB 4E42A 3MU3A 1HHIB 5E00B 1RZIA 5D7LE 2XA8L 3BUTA 3N3EA 5M94B 1XGUB 3F7PC 1ETZB 2VZVA 4QHLB 4V1DE 3FO1A 7PCYA 1LK3H 2BSTB 4G8GE 4YGAB 5D4IA 4GXVH 3SCMA 5JPNA 4JFZH 5C2UB 1ADQL 2Y1YA 3L5HA 4G80B 2YRLA 4Y5XC 4Q97A 2HTLD 2YC1B 3II3A 3OMNB 1DCEA 1WZ1H 5I23A 1RZFL 2QADD 1RZKC 5EC1B 5AWNL 2FHCA 1KIUA 4ONHA 3DOHA 1BF8A 4RGOL 4JN1L 3INUL 4KY1H 3FCUB 5LGYA 5DJ2A 1I85A 3CSGA 3N06B 2A1WH 3QZWG 2EUWA 4C56E 3AS0A 5GRZA 1J8HB 5DMGD 2FNBA 5D7SH 4ONGH 4A2FA 5CR1A 2P80A 3JV4B 1N64L 1C5BL 1KGYE 3QXAA 3F6LA 3GXPA 2VR5A 2OMYB 5I1CH 3QUXB 12E8L 3D52A 1EO5A 4FXKC 4IBZA 4XP6H 4ZYKB 2V4LA 1HE8A 5E1AA 5IQNA 5J13B 4X98A 1KBBA 1SHMA 4EEEA 5J6HB 3UX9B 2ORBL 2DS4A 4X8JA 4DKEL 1D5XA 3ARGB 3K6NA 5KANG 1D9KC 5LGJA 2VR3A 3OKKB 5EU5A 4ZW8A 4TLKA 3FSZA 4Y2DC 2Z1KA 3VFTA 4H25B 1WBYB 1I3UA 3JVGC 4P04A 5FYKL 4Q14A 2OR7A 3ZBMA 4KPHL 1I3GH 1IU1A 2O72A 2R39A 2JMRA 2NXYC 3CG8A 2ZXWB 4WSGA 1OTTD 3MRQB 4IDLA 2HWZH 4A38A 2CJUH 1DSYA 4KTDH 2CUAA 3RLSA 4A7VA 4WJG3 1E4WH 4TS6A 5GISL 2IG2H 1UA6L 3EYSH 4ZFFA 1UB6A 4OF3A 3N5AA 5D6DC 5EIQA 3UYPA 4KJQD 2K7PA 3U7YH 3V9CA 1TTUA 3FRPB 5AD0B 3X14A 1R3HB 5CINH 1FH2A 3PFQA 1MCCA 4U3XA 5EO0B 5IB3A 2Y7OA 2YD3A 4X83A 2NR6C 32C2B 3CDCA 4NN5C 2X87A 5HVGB 3RJDA 2QVIA 3WHXB 1DJGA 2NTFA 1KEMH 5KYUB 3GI8L 4AYDC 1OTTC 4G9FB 3RWEB 3REWA 4QNPF 4F2ME 3ES6A 2P5ED 4XAKE 3DJSA 5DZ9A 1GCFA 4JFHE 1AXSA 3T3PE 1WGVA 1NCJA 4PY8I 2FR4A 4N0UB 3VJ6B 5C9JA 2R56L 4IMLB 4O5LL 3OXSB 3ILQC 5IB4B 1OAQH 5IHUL 5ITFB 3UMNA 4HG4J 1W8EA 2AABH 1P4LA 1DUYB 4MQXC 2BY1A 1I8UA 1FL6A 2EILB 3X11B 2I5YH 3KJ4C 3LIZL 4XP4L 1ZWIA 3O0RL 4HFUL 5DMYA 4NZRL 3T1WA 4NLAA 3BT0A 5K59E 4ZAKB 4BSWB 2AJSH 4P4RB 3LZNA 4QXVA 4MCZB 4IIQB 3FT2B 3T6ZA 4GG6B 1OOWA 1QWHA 1YJDL 1NGYB 4KI5D 3QRLA 5I1GL 3L9YA 3DO7B 1U2CA 4OV5B 3FAXA 4U0RC 4WWKB 3V4VH 1A3ZA 4GW5B 3BHBA 3IBEA 2H32H 1ZV9A 4Y1AE 1MW0A 5ACZA 3NN8A 3KBHE 2FATL 4X8CA 1QSEB 4U3SA 4DJMA 4MQXD 4NBXB 1FUNA 3QNXB 2K8MA 3VFOB 3TCLB 3ZJAA 4W9FC 4B50A 1PG7L 1V54B 4XP9H 2AF2A 5D1ZC 5TPWL 2BVOA 2KLTA 2FEEL 1G6RB 1F0LA 1YUKB 2QJDA 3G08A 4BK5C 4A2MA 3MMEB 1HDMA