2DMHA

Solution structure of the first c2 domain of human myoferlin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
140
structure length
140
Chain Sequence
b'GSSGSSGMLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDFSSSLGIIVKDFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myoferlin
molecule tags Lipid binding protein
source organism Homo sapiens
publication title Solution structure of the first C2 domain of human myoferlin
rcsb
total genus 11
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2dmhA00
2N1TE 2K8MA 2CJSA 2WXOA 3KWUA 4BFRA 3CSTA 1HE8A 4GB9A 4QJ3B 3F01A 3IBEA 1QATA 3NZUA 1W15A 3M7FB 2A5UA 3LJ3A 1UOVA 2Q3XA 4IQHA 2CM5A 3HIZA 1TJMA 2WXJA 3L9BA 2WXGA 4F1SA 4WWNA 2WXHA 4QJ5B 2DMGA 4MJJA 4TUUA 2CJTA 2NSQA 2X38A 3L08A 4WWOA 4DNLA 4HVBA 2EP6A 2WXLA 2ZKMX 2Z0UA 1UOWA 2ENJA 3CSFA 4IHBA 4WAFA 1BYNA 5JHAA 2NQ3A 5T8IA 1E90A 2LHAA 3DBSA 5G55A 4KITB 3IM1A 1TJXA 3PFQA 1RSYA 3PS6A 2B3RA 4FJYA 1RLWA 4FULA 3DPDA 4TS6A 3KWTA 1V27A 4AOFA 4NP9A 4PS8A 4XZ4A 3R7QA 4ICXA 4PS7A 2FK9A 3OHMB 3L17A 3OAWA 2ENPA 2NCEA 4XX5A 4F92B 3APFA 5EDSA 1CJYA 2WXIA 4HLEA 1DSYA 3HN8A 4XE0A 3S2AA 4A55A 3QARA 1E8ZA 3ML9A 1DQVA 2V4LA 4KZ0A 2WXMA 3F05A 4G11A 4EZLA 4FHKA 4LDCA 2CHZA 4NPJA 1A25A 2FJUB 3QAQA 2CHWA 3HHMA 1WFJA 3QR1A 4LT7A 2WXPA 1DJYA 3ZIMA 4AJWA 2CHXA 4DK5A 2JQZA 2DMHA 3RDJA 2K45A 4OVVA 4URKA 4L1LA 3MJWA 3ML8A 2Q0ZX 1E7UA 2Y3AA 5CCHE 3PREA 3F00A 4L1BA 4BGDA 4L2YA 2UZPA 3W57A 1GMIA 1RH8A 3L4CA 4ANWA 3TL5A 3ENEA 3GPEA 4J6IA 3FBKA 5KJ7E 4FA6A 1DJWA 1WFMA 4WWPA 3T8MA 1BDYA 3PRZA 3R7RA 4JPSA 2WXKA 4EZJA 2QZ5A 3RPBA 2A4ZA 5G2NA 4KZCA 4FJZA 3QK0A 4OVUA 3P2BA 3APCA 2WXNA 3QR0A 1E7VA 3PYCA 2RD0A 1QASA 2YRBA 4FHJA 3TWYA 1DJGA 3NZSA 4NPKA 4F93B 1E8YA 2CM6A 1W16A 2CHDA 3TJPA 3L16A 1UGKA 4WEEA 2ISDA 2K3HA 4QAMB 3SD5A 4L23A 2KI6A 3APDA 2YOAA 3L54A 4NS0A 4ICWA 2R83A 1DJIA 1YRKA 5H4ZA 1DJHA 5JHBA 3QJZA 3L13A 3JZYA 2ENQA 3F04A 3B7YA 5H4YA 5CCGE 4QJ4B 3N5AA 2WXFA 1E8WA 2QZQA 4FLHA 4V11A 5CCJA 4FADA 1BCIA 3W56A 1DJXA 4GNKB 3FDWA 4Y1SA 3ZW3A 4ANXA 1E8XA 2K4AA 2D8KA 4F91B 4ANUA 2WXQA 2WXRA 1DJZA 4LCVA 1K5WA 3ZVVA 4TV3A 2BWQA 3NSJA 4Y1TA 4EZKA 4PS3A 4ANVA
chains in the Genus database with same CATH superfamily
3WFHA 4NB7A 4NKMB 3WLBB 3NSDA 1HOCB 4B0MM 3QIWC 1TTBA 3CUPA 1I9EA 1RZQA 2WSKA 1JV2A 4MJJA 1KGXA 4EI5D 4I3SL 4OUOA 1RZJL 1EMTH 1M2VA 2VR8A 1KZYA 1MRCH 1UKQA 1N4XH 4I3RH 3LHPL 2J4WH 1V3KA 3DBSA 1ZVNA 2EXWC 3IMWA 3PWNB 4GI8A 2H8PA 5D2LF 1REIA 5JHMA 4PY7A 5AZUA 2HT2C 1KENH 3AW5A 4AZUA 1YMMA 3RFZA 4YPGB 2XWEA 1B0RB 3EYUH 1BW8A 3KPMA 1PS3A 1U8JB 4G9DA 3H7BB 4DO5A 1KIPA 1IGML 5F7DB 4Y5VB 4J6RH 3VXUA 4HJIA 4P5RA 4YHPA 1SXAA 4NZUH 4BSVB 1S9XA 5CS7A 4N9GA 2B15A 4FXTA 1KXVC 4PD4J 1MCOH 1HQ4A 1TF4A 1XCWA 1CFNA 2VO5A 3Q48A 3D34A 4BBWA 1E2ZA 4CSSA 3UIYA 4HJ0C 5DD3H 1CYWA 2F7PA 4R7DA 4HUNB 3CH1A 1MJ8L 3WMSA 4NQDB 2KYIA 1UA6L 2V17H 3F7YB 3AZUA 3QQDB 5IVXB 1N6VA 2R2EA 1OSZB 2G2RB 3GHEL 4ZPTA 4D3CH 4NWTH 3MBEA 3FCBA 3VXRB 2IAND 5HJ3B 2OX5B 1EMTL 5F89B 5I17A 1NIEA 4WU7A 2QLYA 4ETQA 2DQIH 4Z3IA 1J88A 1JCVA 4LLUA 5EFIB 3WMPA 4KKRA 4ZW6A 4Z7VA 3OAUH 2IDUA 2MNJB 5J4MA 2LU7A 1ACZA 4LLDA 5ILTH 2GC7C 3E80A 3MRLB 3M6DA 1U93A 5TPWL 5D55A 5PAZA 1KCVH 1SEQH 5TK4A 1IFRA 3DX7B 1HINL 3PP4L 4W9JC 3REWA 1UZ8A 1UWYA 1JGDB 1M7XA 3FN0L 1MCOL 5LAXB 4XTRD 5IQNA 4FG6D 3SDYL 4NIYE 3E2HC 2VL5A 4N90E 2X3CA 3GK8H 5ILTL 2H0PA 4Q7DA 2F54E 3DDFA 5E1IA 3T2NH 2OCFD 3ZQ9A 5L4MA 5L88H 3KPRB 5BS0E 3OKMA 2XPGA 3B7TA 3TFKD 4YHLL 5GS1C 3LKRB 1A7PL 3MLRH 5EOCH 3VFGH 1IGFH 2EO9A 2A9NH 3QS3A 4PJAB 4PJDA 5EEYA 3OKLA 2K8MA 4ISVA 1M2OA 5FF6A 1T0PB 4OCXH 4MQXC 4P9HL 1T5XB 1A3LH 1UM6H 2FGZA 1O6SB 1WA1X 2NNRA 3CH8A 4JM4H 2AABH 4Z7WA 4E2OA 1L3NA 4P5TC 5JIIA 3LEVH 3W9EA 3RVVC 5BO1L 4NUJB 4WI9A 1OHQA 2N1KA 1XEDA 1PZAA 4U1MA 4JDVB 3PWLA 3NIGB 1JDDA 5GSVB 4X0NA 4PIBA 1F90L 1KB9K 2YUZA 4YHML 2KERA 2UZIL 4F2ME 3RNKB 3GLAA 5CIPB 2VLKE 3D08A 4UT9L 4Z5RB 2WLLA 1IMHC 2PCPB 4LAQL 1YQ2A 3P73B 1S7RB 4P9MH 4HEPA 2NY1B 4EE2A 3HZVA 2PCXA 3KVPA 1JFHA 4EXKA 1VKXA 2Y0SA 4HSAC 4LDOB 4EN3C 1M9WA 3QO1B 2WGNB 3EOAA 1NMAH 4M1GH 2VB5A 3L7FB 3TO4A 3L9YA 5T3ZD 4GAGL 1XB8A 2DZEA 3PAZA 3A6BL 3ULVE 1GJIA 1KCSH 1NFDF 2JMRA 3FT2B 4AQOA 2Q6WA 3QPXH 2OZ4A 3WUWB 1BJ8A 1F4WH 1UOKA 2EE0A 2HUEA 3QT2A 5DS8B 5KBMA 4XC3L 1FJ1B 3KYMA 3S48A 3CVCA 3I9AA 4OZ4B 1MQKL 3WO4B 1YPZB 2YAPA 1INDL 3G6AA 5AB9A 1FNSL 4JY4A 5D1XC 3O9WC 5CEYB 4JO1H 1WZMA 4J2QA 4JN2A 3OD3A 4A7VA 1G4MA 4GBXA 3K72B 4J6IA 4M6NH 3S4SG 5E5MA 1JV5B 1AZZC 2W80C 2VW7A 1H0DB 3ATAA 4M56A 2VXVL 2QZ5A 1N64L 3Q1EA 4HH9A 1CXLA 3WY1A 3H53A 5DJZB 4E0RB 4XO4A 4NUGH 4NEHB 5C2BH 4UM8A 3MRQB 2MHAB 4W9CC 1RXLA 3IU3A 2BDNL 4OF0A 1KLGB 2GG1A 2MKLC 1GCYA 2Y36H 3FTWA 3WJJC 3MLWL 1GYWA 2X70B 2XQYG 3X11B 4OLYL 4YIQA 3VVWA 3ZTJH 2QDVA 2CA4A 3SDDB 1JHTB 4WNSA 3RZCB 3KL5A 3QORB 2MCPL 3AQZA 3NAAH 4W9FC 5FIEA 5JHBA 4PIRF 2Y1ZA 2VQ1A 2X4NA 4YLCA 3RE0A 2P5EA 1DR9A 3NABL 2OSYA 1YPZA 4X7DC 3BKCL 4JFED 4KO7A 4FEMA 1CD9B 1AGCB 4Y2LA 1EWHA 4LRNH 3WHE0 1KEMH 2HKHL 3ZDXE 1NFIA 3V6OC 3LH8A 2CCVA 3M07A 1PLCA 4MJ5B 4A2HA 4LP5A 5C0IA 2K6ZA 3IKCB 4HIIA 5C09D 3OF6A 3LYRA 3UG5A 5FW8A 3ZUCA 5JXAL 3O3DA 3IJEB 2X4QB 5E1GA 3VRJB 1IGYA 2WZPA 3L08A 2X38A 35C8L 3S7GA 4HKBA 1W91A 4F5CA 1MFEL 1MRFH 2V7NA 2WKOF 3BUPA 5BZDB 1Q9OB 5DEFB 2X2YA 5IG7B 5ERWB 5DWUH 3ZDZF 3IAQA 1FHGA 3C9NB 5J56B 1LXMA 3NJIA 2XN1A 3CU1A 4NZTH 4L0PB 4PRIE 4NHUB 4YSCA 4L8DA 5LUMA 1ZD6A 4G8EB 4GI6A 4IHOB 4KK5D 4WFGE 5CP3H 3HR5B 2EYSA 2Z92B 1PEWA 3STZB 3H9HA 1SFHA 4F27A 5E6ZA 4ORZC 1ODUA 3BE1L 3SPVA 3V6OE 2XU9A 4JG1L 4NM8H 5F9JA 4IBVA 1E42A 5FUOH 1LP9B 4TSAL 1BG1A 2IH1B 3LNHA 2WXPA 5T1DH 3MGOA 1ZOXA 5E1HB 5FGBA 5IFJA 4Z7VF 4TNWF 3L4YA 4IBWA 1MCBA 1B4TA 5T5FH 1NBVL 4S1QL 5E9DE 3AXLB 3ARDD 1T20B 2BS71 5CGYC 1G5AA 4XHJC 2OAAA 4RSVA 4JE4B 5HGAA 3JWNC 4UQ2B 3K1DA 2C1PB 1K4DB 3RY4A 2VR3A 1CDJA 1I8IA 4NLAA 4TULH 5D7SL 5EZPA 4ONHA 5ADOH 1BJMA 3O6FC 1QA9A 3ULUD 3H8NA 2R2HA 4KXCA 5G4NA 4Z7WF 2VDOL 5F6IC 2R9HC 3ZKMD 4QRPB 3MUZ1 2UY6B 3GI8L 4M6MH 3WJLC 4RWYL 5L6YL 3VW3H 4MFHA 1EXGA 1HNFA 1Z9SA 1I7UB 1B6DA 2YN3A 4GKZA 3NAAL 4NT6A 3VQLA 2WUBH 5JPNB 3U9PH 4QJ4B 1WC7A 1QRKA 2JCCF 1DUYA 3MRGB 5CO1A 1QSFE 4YN3A 3T3PB 2QEJA 2WP3O 5C0JB 5I24A 2EUWA 2RAMA 4XP4L 1I3VA 3ZMNA 1PX3A 5JZ7C 2CJUL 2ZUYA 3UEZA 3LY6A 1MRCL 1AHWC 1OWWA 1EVUA 4UOJA 3W81A 1GGTA 5ID1B 1AOHA 5INDB 4ALAH 1NCCL 1DANU 2BVQB 1DQIA 4JL1A 2WMPA 4X4YA 4ANKA 2JV6A 3CK0H 5BOJA 3B7UX 2D9CA 2BOBB 1N5AB 4TNFA 4AGNA 4ZPVB 3PDOB 4NX0A 4KX7A 1T5KA 4X6FB 3FUHA 2OZ4L 4IOFC 4U1GC 2H8PB 2LU3A 3OQRA 5GQBA 2HT4C 4S1DD 5T1DL 3K6OA 2P42B 3WO3B 4AGPA 4YSPA 3MO1B 3FU7B 4W9ZA 3N55A 3WGVB 4Y7MA 3TN0D 1DQLL 2EDHA 2VLKA 3LDBB 1CN4A 4ONOA 4ZQKB 5DFAA 1U21A 3VQ1C 3QXDA 3PWJA 1NAMH 4K3EH 1U2CA 1RZ7H 4NRYB 3INUL 5IVOA 3FTSA 3KPQB 4XNZC 3W11C 1Q0XL 3KPRD 2A6JB 4AYGA 3FQNB 1UC6A 3GJEB 1WA0X 4CMHC 3TBCA 3M7OA 3Q2WA 5E4EB 5JORA 1RJYA 5FWQA 5EUKA 1QX1A 3MFFB 3NPSB 3V0AC 3SN6N 1KJ2A 4H8WC 1QYGL 1D7BA 2BIHA 1AQDB 3A23A 3L7EB 2L7JA 1JVKA 1IV8A 3HLKA 4TUJB 4NRZA 1FVEB 2I7SA 3P54A 1JDAA 4NQCD 3WIIL 3VQ2C 2EYRB 4L5FL 5T3XD 3ZSSA 1UWXH 4PW3A 3Q06A 1WYJA 4FGMA 1IL1B 4UQBA 4KQ0A 4HIXH 5ABAA 1IEHA 3FO0H 1U95A 3H9SA 1DSFL 5D2NC 1YEEH 1GAFL 3UACA 4ZD3L 4XWGL 1YNLH 2QQKH 2PR4L 4PCYA 4NENB 3CVHH 1U4EA 5BS0B 5MERA 1ZANL 4YJZL 3LTVA 2DQEL 1JK9B 4L5FH 3FJTA 4OU3A 4J1UA 4ZZFA 2W0FB 3PHOA 2J3SA 5C8JA 4NQXB 1P4UA 2WNKA 2ATKB 4J8RA 3WYRA 4CMMA 1IUZA 5IMMA 3C6SB 3BVNB 5I8CA 5DHMC 4JO1L 4Y4FB 4GY4A 2XN2A 5HY9A 5CD3B 1SVCP 4S0SD 5FF6B 1ZK5A 1CICC 2PP8A 3BC9A 1P9MC 3FT9A 4Y16C 1WTGT 2H0JA 4DH2A 2P47B 1V5JA 1O5DT 2D03L 5F3BA 2BZCA 4P06A 1QRNE 3UAAA 5SWZE 1LK3L 3K2UL 5C09E 3BZEA 1SUJA 2YXVA 4IGBD 1I9JL 3HUJA 4XMWA 3VXRE 3AWEA 3QI9D 3KYNA 2ADFH 4XMLH 5D2NA 4NKQB 4NZTL 4YDLC 4N6RB 2IIJA 1A6ZA 1DVSA 2Q7YA 3GBDA 3LEYL 1OM9A 3FONB 5DURB 1U93B 1I8MA 5AL0A 5KYXB 1JYWA 3M17A 4B53A 4YHYC 3LJ3A 3ZR6A 5DO8A 3T4AB 2CM5A 2HFGL 5E2JA 3MXVL 3MA9L 1QFOA 4LGRB 4WUKL 1LWHA 2BFVH 5D6CA 2X4UB 5LXGH 1GW0A 4QY8B 3GIZL 1QKZL 3OB8A 2VO8A 4IHBA 3CX5J 3K6DA 5HYJE 5IOKA 1IGCH 3DUUA 1HSBA 4BFGA 5FECA 3HG1E 1FG2A 1NGQH 5I9QB 4FFWC 1DBAH 5ANHA 4S11A 1OP5K 5C0CD 1B4JH 3F58L 2Z1PA 3K2UH 1LEIB 1YHPA 2Y5TB 3SCMD 2R23B 4X6DB 3BXNA 1HTYA 4PCKA 4Z1PA 3LNIA 1F2XK 4X9HA 4L8SA 3BCDA 5F9AC 1R46A 3MCKA 3WKNA 1MDAA 3ZIYA 5C08A 2IG2H 3MLUH 4BH7A 1LHZA 4M6OL 5DJ0B 5MHSE 2JJUA 3RRQA 1WFJA 3NA9L 3FC8A 1KIPB 4M3JA 2ODHA 1K8IA 1HYSC 4QXVA 3UJIH 2D7TL 4OVVA 5IW3A 2EYRA 3RWCB 2DD8H 2NYZA 5T3ZH 2IWFA 4WUKH 1RVFL 4YHIA 1KXHA 4KDTA 2DWTA 4JREC 2P7TB 3Q01A 1B2WL 2C9XA 2FQFA 2KS0A 4HK3N 2MPVA 4LSQH 4A2GA 3N1FC 4ZMXA 2J57A 5JW4R 1QI4A 3AREC 3KGSA 4WDIB 4XNXL 4JO4H 1BVKB 4UBDC 5EUOA 3L4VA 1KTRL 1F0LA 3THML 5I8EB 4H1LG 4M93B 1MRDH 3QXDB 2APWA 1IBFA 5DJ8A 5E2WH 3FQXA 1FYTB 2VABB 3U46A 2YRLA 3PDDA 3FU7A 4L29A 2RHEA 1XGPB 2OI9B 4QT5A 4PJCA 2F1BA 4PJEA 5F44A 3F7VB 5EC2B 4KFMA 4WO4B 4GXUM 1BD2A 1U91A 3OPZL 4JO2H 5CLXA 5J12B 3TH2T 1SN0A 3T1WA 5DQ9A 3D51A 2L4OA 4TUOA 4DKDC 1CVRA 2Y22A 1EJFA 1MF2L 2DIJA 2PO6D 2DLFL 5L6YH 4MXWL 4OIIH 3MLPA 2EAEA 3DOSB 3OVUB 1FBIH 5CMAB 1N10A 3V10A 3RU8L 1WAAE 3MX0A 3P0GB 4LEOB 4KROB 1L9RA 2ZSWB 1BQKA 1YYML 1JPST 2AQ1A 3HIZA 3MBXH 1OW0A 4N25A 5FCUH 3QDMD 3QJHB 5AYQA 3QDGE 5ECGA 4HUCA 4ZTPL 1CGTA 5F6HI 3L3DA 4IYKA 4LHQB 1UQSA 1UWEH 3QEHA 4YDIH 3QIBD 5CGTA 1GSMA 3PHSA 2BSCA 3TBYB 2IFFH 3GSNB 3BW9A 4Y8AA 5FS5A 2JB6A 3HNTH 4PV9A 3AM8A 1QVOB 3QZOA 3MLTA 5FKAB 4H7VA 2X4UA 3L5IA 4KXBA 3IDXL 1CQKA 1H3PL 3NFNB 2XKUA 3RIAF 1JZ6A 2ZYHA 1MNNA 5JO5A 3OMZA 2GEEA 5D6DA 3NESA 2CJ3A 3RLSA 3PJSA 4QF1A 3HAEA 3P0YL 2YGVA 5L7XL 2WSDA 2D4FA 3NJVA 2QR0A 4LPCA 2E4TA 2OQJB 1DO5A 4E9VA 1JPGB 1LILA 4U7SA 2X10A 4NQQA 2J73A 3E6FB 4UQ2A 4M3KB 3QDMA 4NKDB 3EO9H 5DHYB 1G7PA 3QA3A 4I3RL 4M43L 3V4PH 3KPTA 1ZT1B 2J8UF 4FJ6A 3SKUD 4IRZL 5ESVA 4I0PC 3UROR 3S96B 4G8GE 4WUUD 4JN1H 3GJFB 1CUOA 2X2JA 1ZT4B 4ANWA 4NQEB 1ETZB 1BYPA 5EU6E 1NMCC 4BZYA 2B1HL 1WFMA 1S8DB 2C7UB 1LMKA 1Q0YH 5JDJA 5B3JF 1SLWA 5C07B 4H26A 2WLNA 3HR5A 2A9CA 5F7AA 3I02B 3S4SA 2DY2A 5JDSA 3C08L 1TQBC 3Q8EA 2QADB 4GPVA 2HKAA 3ZZLA 4F8OA 1S9KC 2K1MA 5I1HH 3AT0A 2W0FA 3ABMB 5LG1A 4F9LA 5I1GL 4LL9A 1VRSA 2ZWKA 3TZVA 3DOSA 3ZDYF 4PJAF 3D09A 3L3HB 5JW4M 5FHAH 4YBHA 5A2AA 1YEKL 1X4ZA 2FX9L 3MN8A 4KRLB 3WFBH 1E9OA 1PAMA 1T4KB 4RRPG 3RYMA 5A16A 4K8RD 3TH3T 3VD2A 2X7LB 3FTUA 1ZV9A 1MI5E 4HDIA 2FO1A 4Q0XL 3M86A 4UTAA 1Z0MA 4N2OA 1UURA 5D1ZI 1A6AB 1RZKH 1BPVA 1LEGB 4OGXH 4X6CE 4OCSH 1U3ZA 2XQYK 3EO1A 4MMXB 5IMKA 2GUOA 5LBGA 3DYPA 3GMQB 1OARL 4ZUWA 3LZNA 1AH1A 1NM9A 4JANB 1C12A 2EEDA 2EE9A 3D0VB 3Q6GL 1A02N 3A6OA 3VMOA 1MCEA 1X9QA 4UB0L 1QNZL 4F1SA 3DXAA 4C4KT 1BVNP 4WW1B 1ZVSB 2PWHA 1JMZA 1AP2B 4U1KB 1ML0A 2X1PA 3UJJH 1ZLUH 4PJIF 2AS5M 3RZCA 2WPGA 3ZYZA 4U3SA 5G4OA 1KJ3H 5GGVH 4R9HA 2PKDA 4AOFA 1LK2A 3X11A 1WAAA 3HG2A 5IJDC 3TVMA 4ZO6A 2EVJA 1F3DH 2HX7A 2VISB 4X5LA 2NZ9C 4U7KA 4MBRA 3RG1C 2CZNA 4ODVL 5INDA 2ITEA 3HC4L 1TQUA 2GABA 4PJBE 3I6KA 1IBZA 5B38B 5CSBA 4XC1L 3N40P 5JIQA 1T7WA 3QZWA 4NN7B 3PGDA 5AVZB 3VB8A 5L2KA 1YJDC 4YZWA 3UCRA 1Z3GH 2WBWB 4WW1A 3HKFA 4DO6A 3ESUF 4EIZC 3V0VB 4AVIA 3GGWA 2KQMA 1TO5A 2ZUUA 3RWHA 3FT0A 2UVFA 3HC3H 2R7EB 4JHAL 1SY6L 4JRYE 1V55B 3LVEA 4Q9QH 2VM4A 1A7OL 3HS8A 4LPUA 4LAJH 3CHOA 1TYRA 5CLYA 4JB9H 5K9QI 2XCMC 2KLSA 5ICXA 5EU6A 2D0HA 3CBKB 1SXSA 2WY3B 3D48R 1SHSA 3DRQA 4F8NA 3G08A 4LHUG 2YK1H 3RA7L 4JQVC 1OF2B 1NCWH 2FB4L 5HYFA 3WKQA 5HXMA 5I73B 3CHXA 1MHEB 1XGYL 1M7DB 1J1OH 3II1A 1AI1L 2H47C 2CBOA 1J7VR 1HYRC 5ISZA 1LO5B 5MEQA 2HTLC 1I7TB 4PBXA 3AS0A 5GIRB 4JJ5A 1C5BL 1N6QL 2I5YH 4IS6B 1XL6A 2HLAA 2WB1A 3AS1A 3GLDA 4I88A 1XD1A 3HLAA 2FHBA 4LVEA 4GQ9H 3W9EB 3BH9A 1NICA 3UTSB 1OTUC 4A66A 3HHRB 3ZMEA 4MD0B 1COBA 2XWBB 4NNYA 2XVBA 3AXHA 1KTLA 3OKOB 1QR4A 3TX4A 3I6LE 3T5WA 3MLXH 4J27A 3CSTA 1WAAF 4KHTH 5IV2B 1FL6A 2O5YL 1HESA 3MLVH 4L9LB 1NC4A 3CDGB 2L7UA 3SDXE 3V0JA 2OZ4H 4KJQC 3AU1A 2YLKA 3LV3A 4GSUA 2AERT 3BD4A 2NT0A 2ZXWB 2Q2EB 1SXZA 4MNQB 4EIUA 4PJ5B 3VYOA 3O6LL 3MLVL 3QUZA 2H32H 1IARB 3IXAA 4HMCA 4M1DL 2F15A 3K4ZA 1SN2A 4OSUL 4RZKA 3IVKB 3FAWA 5FLUA 1KG0B 4MAUL 1YQVL 3UPRA 1E27A 2PYED 4D0CA 3QCTH 3BH8A 4RGNB 1F4WL 5TDPA 1L9MA 3UFIA 1KC5L 4Q6IA 5IW6B 2HH0H 2GTQA 3FUNA 3H7LA 1NCAL 4J23A 4Q56A 1V7NH 2VDPH 3W2DL 1TVDA 3QJFA 3WLWD 5HHPB 5BUPA 2WIIB 1X6NA 2BCKA 4N28A 1VFUA 5SWSE 1NGPL 2B5IC 5A2BA 4UV4L 3HRZA 4MQTB 4XPGL 1JK8B 2WCSA 4J3VA 4WEBL 4Q2ZB 3PAYA 4PREB 1NCNA 3F7LA 2PWEA 4JQVA 1NL0H 4XWGH 3RP1A 3VFOA 5IF0B 1JF6A 1EO7A 3D25A 4MJ6B 2C7FA 4HBCL 3MNZB 2EVHA 3I6SA 2PPCA 1A7OH 1U8CB 4O5LL 4PW4A 5A3ID 2WXNA 3QIBB 1JGUL 3CZFA 1P4LA 1DJGA 4XMTA 3FHQA 4X4YB 3A5VA 2EADA 4YPGA 4DT2A 3WDHA 1SFDA 2J2ZB 4IRZA 4DGYL 4GAYB 3SJVE 4ZNEA 3BKCH 3VFUA 2WWKT 4FFYA 1C1EH 4OIIL 4MWFB 1GIGL 5ALBL 5DEZA 3VFPA 3O6FB 2G4EA 1XCXA 4PLKD 5FYLL 1AZCA 4I18C 1PZBA 4YE4H 1MH5A 1UT2A 2GHZA 5AW5B 5I5JA 3PGCB 4N86A 4R0LB 2YGQA 3JWOC 2NTSP 1LTXA 4JY4B 1KENL 1M42A 1S9YB 5FYLD 2ZD0A 1JK8A 2DM7A 2OMYB 1NEZB 1TNMA 1O9VA 5ISZE 2PWDA 4KK9C 4LFHD 2H0EA 1IFHH 3VUAA 5F0PB 3S5ZA 1FZOB 5DHVH 2DLGA 4WO4D 3OJDB 1FAIH 1Z9SB 4OLVL 1AZBA 4N0FB 4N85A 3K5RA 2NY6C 3O3BB 4HSCX 4NXKA 1WCBA 4N5ED 4QUOA 1QLEB 2XQBL 5F7YC 3EOAB 1LEGA 2NY3C 4N22A 1KXQA 3MXVH 1ECYA 3MV11 1DBBH 5BMFL 5JW5B 4DZBB 4AT6A 2EICA 5DFTA 4XPTL 5G5DA 2ZUVA 4XP6H 4O02L 1E9PA 1JPFB 5AVXB 5JW4Q 1EZVY 5A6IA 1AXSB 5IJVB 5TTRA 3IMBA 2EDTA 1BVLA 1WRFA 2NUPA 4HAGA 5TFSL 3SO5A 4IKIA 4DQOH 3PFQA 4LEBA 4XNYH 1ASOA 2XSKA 4L8SB 3FFCD 4PRNB 4FYTA 3M1BB 1HN1A 1MFCH 5EIQA 4M61A 3UAEA 2PNDA 1B0WA 3SPGA 1LLAA 5IBUG 3PGFL 5IWLC 3CSYA 4NNXB 4RX4D 1DSYA 1FNGA 3P69A 2IG2L 3MLUL 4ONFL 4Q9RH 1AKJD 5E00A 4CSZA 1R3LB 2XTJC 4BSJA 2X42A 3MRCA 4CDHA 3EFFA 4Z7QB 1J8RA 4V1DA 1TEYA 3REVA 1JGVL 4XXCC 4QGTA 3V0FA 1G6VK 1HSAB 3MJ7A 4CW1A 5I8OL 3OKMB 5CN2A 2DWYA 4N8VA 1KSRA 3GD1C 3VH8A 3S3DB 3PREA 4F5CE 2EECA 5E4EC 3EH3B 4W68A 1OAUL 1WFTA 1A1NA 2HTKC 1UZ8B 5C0CB 4DVRH 2IBZX 2JQAA 5BQ7B 3IFLH 4WWPA 5DEGB 1SDDA 3Q2CA 3VMNA 3B1UA 1OANA 5DD6A 4RDQG 3QWQB 3KPOB 2XG4B 3D05A 4PVBA 1AR1B 3BZ4A 4FQCL 4A2MA 5DD1L 4GG6B 4ZFQA 1G9NC 1FNAA 2AQPA 4QRSA 2R8SH 1I4FB 5FFOA 1FV1A 4AEIL 3RAJL 1DVZA 3KHQA 2PTVA 1PF3A 3IAPA 1J11A 3OR7B 2V0AA 4QCIB 1S7SB 4GKOA 2JKNA 3ETTA 3U4EA 3LN5A 4CL7A 1MQ8A 3IFOA 1OL0A 5FYLH 2HRPL 2AAVA 1PZ5B 1QWHA 2X28A 4WHTA 4P3CH 3RVTC 1HCVA 3IDGB 1JZ3A 4G5ZH 3BWSA 3QQDA 1L9OA 1U0QA 3CSPA 4ACPA 2D3NA 2G5RA 4P07A 4KI5D 3IFNL 3G04A 3KL0A 4ODSL 4EKXA 2ZSWA 3UJJL 2ICEB 4G7YH 1P5VB 1QLRB 2A1WL 2L3BA 2XN0A 3ZVVA 1EVTC 2B2XL 2X40A 4NENA 3QUKA 1V3LA 4A2DA 5I0YA 4RRPM 1TFHA 1XGTB 4PV8A 4DP6X 1EHKB 1GGIL 1LO2L 4QIRA 2A5UA 5IFHL 1PD1A 3B3IA 3DMMB 4MMZB 5AKRA 3HNSL 3U4BL 4H40A 5HHNB 3MGTA 5LWYL 1ZHNA 2CR3A 1YEWA 4NAQA 4MDIB 3MU3A 4U3SB 1HXYB 5AB0A 5I8OH 1OW0C 1GGIH 1MHHB 2WVVB 3QEGL 5IF0A 2EXWD 2X2IA 1H5BB 1HT6A 1QLEL 5I18L 4CJ1A 2CNZA 2A9ML 3KPQA 1A6UH 1IM3A 1K8DB 3EGDB 3AS3A 4PRPA 2PW1B 5AOJA 2H2SD 1P7QB 3CFEA 4MNHA 5GGRB 3RB7A 2XWJA 4FLQA 3RVWD 1F00I 1OT1A 1NOAA 4LHUB 5I9QC 1IC5H 3GK8L 2VXQA 3AAZB 3UTPE 1IBGL 3GLZA 4G11A 1K72A 1TZGH 4JFZH 4N1EA 3ZHFA 4X4KA 5FA4B 2YUXA 4M1DH 5GRJH 1OCWL 4GLRH 4ATTA 4G7VL 1F13A 4CUCA 5HBBA 5KVEH 3D39E 2AK4E 1KOAA 3I50L 3ESNA 1MXGA 4X8CA 4D9QE 2EDOA 3B2MA 3G6DL 2C9VA 2CK0L 5KBLA 4PJBA 4K7PX 4MAYA 4X5XA 4FOMA 4UIKH 1RIHL 5F1IB 3JV6B 1DZBA 4MRCA 2DH3A 3OMNB 2JB5H 4NPYB 3OAYK 1UYWH 1Y6NR 4MMZC 5CLWA 5F8QC 1YG9A 1D9KB 2N3JA 4B97A 1I1YA 5KG9B 2R29A 1NBCA 5SX5K 2VRQA 3WFDL 4IIZA 3CN1A 4N2FA 5JXAH 2C9QA 2YRBA 4LIQE 5TH2A 3A67L 3UJTH 2DICA 3ZQWA 3SJVA 5ISZD 2X89D 4A7TA 5IUCA 1OZTG 2GSGA 4ONGH 4Z95H 2ZE0A 3HC4H 3ARYA 2KI6A 3QDGB 4A7QA 3GNML 3EXJA 2Z8RA 3PU7A 3RJOA 4QCIA 3BP6B 3MI6A 4PQXA 5KW9H 2GCYA 3LRLA 1AO7A 5I6OA 1JZJA 3MV9D 2E7LC 2HJLA 4BSWA 3SO3B 4D0BB 2VM3A 3CFCL 3M45A 2YMXL 5JQ6H 1NCJA 4YOKA 4NAMA 2IANE 1DANT 1MHEA 2Y1AA 4N20A 3V4VB 4OSUH 4H1LA 4OF3A 3DIDA 1KF9B 1PNCA 1LMIA 3FW6A 3NACL 2HVKA 2WBXA 1F97A 2W81C 4IMLA 1LO2H 4RA0C 5E6ID 2E59A 4MA3A 1H15B 4H2CA 4UM9A 4OCXL 5D1ZB 1ECZA 3BVWA 2J43A 1N64H 2C3WA 3UDWA 4Y0GA 4NQVB 1S46A 5GJTL 4E9XA 5I1LB 4H13C 5FK9B 1MWAA 3ASWA 1EZLA 1QI3A 3VACA 2VZSA 4Z7WE 1TJGH 1KGUA 3MDJA 3AU0A 1RZJC 2EYSB 2Z92A 5C0NC 1OTTD 2FJGA 2ZT9C 3T3ME 2EDXA 3HI1A 2O5NA 5JPMB 5CR8A 4OV6F 1KBGL 1RIUH 2HVBA 4BFOA 2J25A 1V10A 4G8FB 4EN3D 3U9UB 1RZ7L 4JFFE 3VDCA 3HN8A 3PHOB 3VU2A 1AE6L 2WK2A 3IDNB 1PLGL 4F7KA 3CLWA 3QUYA 1R9FA 4JRXE 1KY7A 2BSTA 1G6RL 2BVTA 4HPYL 4QD2E 3UJTL 2FNWA 2HPOA 2QVKA 3GXUB 4DP0X 4A6YA 2PXYD 3BSGA 5C2BL 5FO9A 1QLFB 1R34A 2QPSA 3ML8A 3RIAK 1SOSA 2RH0A 5D93C 1FO0H 2MOVA 3NN8B 1N67A 3GS4A 3RTQA 3L4CA 5C0DB 4Y16D 1FYHB 2F53B 4I1NB 2X9ZA 1G9HA 3OJMB 4HIJA 1P4BL 5HHQB 5DDHB 1JRHI 5IJKA 3O3BA 5C3IA 1JWMA 4Y2DA 1UM5L 4NO3A 4D7BA 2RB8A 4MQXD 5JIHA 1K4CB 4FZ8L 1YN7B 1IGJA 1U8NA 2BSEA 2E76C 4LCIH 3UX9B 1CU4H 1X5FA 5IB3A 2NXZB 2QV4A 3QUZC 1RUKH 1X3DA 1A66A 2IWKA 1JZHA 3WIHL 5T5FL 1RFDH 1OAYL 5B1BB 5BRPA 1CXKA 1S7VA 1JGIA 1PX8A 2BW5A 4LPWA 3OGOE 4KKAD 4NO0D 3WD5H 4ADJA 3GMQA 3Q1SH 4U1HA 4HEME 1NGZA 2ERJB 4P2YA 3BKJH 4W6YB 1MF2H 4KKAC 5BW7A 1HXYA 1OPGL 2QVMA 3KYAA 4GAFB 4TPRH 2A73B 2J8HA 2MWCA 1R24A 2X7LA 4PPTA 4X6FA 2JE8A 2E5EA 5D1XE 4GUOA 2EEXA 3BFWA 1HNGA 3IKKA 2GJZB 3IRZA 5KYUB 1ZTMA 4ANXA 4DOHE 3LX9A 3GBMH 3JBG7 2OR7A 2PPEA 3C6LC 4BFIB 4PU2A 5D1QA 4YSOA 1CL7L 4H4NA 1NH6A 3VWKD 3AUVA 3JT0A 1JS4A 4HZAA 4WV1B 5D93B 4J3OD 2O1AA 2P5WB 4HWBH 2BNQB 2UY7A 3GRWL 3VDBA 3N3EA 5DZLA 4HS6A 1PLAA 4P23C 5CJOH 4ZOAA 5AW8B 3V4VH 4Q2ZA 1IM9A 5I1IL 3RVTD 4Z76B 2OBGA 1E50A 4LCYB 4W6XB 1KLUA 4NZRL 4OKVB 4TUUA 1FJ1A 1MCPL 1FORL 3FQTB 3JWOL 2UZYA 4O02B 4YXKL 5IB2A 4BFFA 2R1XB 3L3GA 3EBHA 5ICYB 1H6UA 3CZSA 4PJFB 3VRLE 1UXWB 3O8XB 4H44C 5IQLA 1TTFA 2XDHA 3SOTA 5IHUH 4ALAL 4HQQH 4TVUA 1T2QH 3DYOA 5LNGA 1MW3A 1I3RB 2HKFL 4JKNA 5DJYB 4LCCA 4WTXA 3OTTA 2V3FA 5EWIH 5CZXC 5TDPB 5DJ2A 4FKEA 3TASA 2ALWA 4NN7C 3QUHA 3QJTB 2OMBA 5CIPA 1VFOA 5DZNA 4H1LB 4NQDE 4OLWH 3RILA 1LNUA 3BD3A 1ES0A 1I1AD 3WHXB 1YZZA 3LIUA 1ZLSL 2CUAA 5LCVL 4APQB 3K5SA 1I8LC 2B77A 4NPJA 5BQ7A 1YC8A 1OGSA 4KQ4L 3X3GL 2H7WA 1TLMA 4FQCH 4P3DA 4U1MB 4FZEH 5K9QG 4NRXB 4HMDA 3VFMA 4BDVA 4PRBB 1YECL 4KI5E 3VSUA 2EDLA 1TTAA 3LKOA 1A22B 4NUMA 1AXIB 5AUMA 3NIFB 2ICWA 2VE6A 3HZYA 1X5YA 4PY8J 1VFAB 3RVUD 4HOZA 3V6ZB 2J72A 5AB1A 1GPOL 1GZHC 5IMOA 5DHDA 2BZDA 3BDBA 3QZMA 1OEZW 4APQD 1RULH 4LSRH 4LSTH 6CGTA 2EIJB 2JJSC 1RQ5A 3CSBA 3FAXA 5JUEH 5L4JA 4JDZA 4MKMA 2CHDA 4M1CC 3KJ6L 4NM4H 4P2OC 4FXKC 3GXPA 1Q1JH 3DHJA 3M1BA 1IQDA 4PRHD 4WEEA 3VSTA 4AK2A 3WMQA 2AQNA 1MQKH 2BP0A 5IG7A 4XMPL 4BFNA 3W5NA 4J6RL 3TBSB 2CIKA 4N2EA 3INUH 1OQOA 3HN5A 3T6XA 3JV6A 2AW2A 2EDYA 1FYTE 3ISYA 3OZ9L 2ZF8A 3L1FA 4AH2B 2XYCA 4GAJH 1PU0A 4PJCB 4KK5C 1GOHA 4HS3A 4A39A 2R2BB 4XVJL 5J89A 5FOBA 3ZY7A 5CFHA 2A9AA 2W0KA 4YH6A 1BIIA 1NGZB 3Q0HA 4POZD 4CSPA 1XR9B 3HUJE 1XH3A 5DI8A 4G72B 3INOA 3M7FB 5DD1H 5E8NA 4QDGA 3BAEL 1TJMA 2LV4A 3FF8A 3RVXC 5JOFB 3ARBC 5EUOB 5FGSA 4U0RC 3FMGH 3FOMA 1R3IL 1IM3B 2DD8L 3L81A 1NSNL 3U0WH 2V37A 2Z8VC 1WG3A 3NJGA 1CI3M 1OD9A 2J6EL 4RDBA 2W8CA 1R3KA 3LKQA 4AM0B 1KJ2L 5INCB 1NEPA 1O9ZA 2CGRL 4Y1AB 4XH2B 5L2JA 4YHPB 4BSVA 1CI5A 1CLZH 2VXQL 4RFOH 1F4YL 3LRMA 2V8MA 1KWKA 4OFPA 2HJKB 4G8IB 3D39B 4KU1A 4KXZH 1P4LB 1YPZF 2VAAA 4GP4B 3HN3A 1CGUA 1JD9A 3N42F 1A5FL 3VFVA 3X13B 2Y23A 4B5ZA 3CDZA 1BV8A 4I0PA 3POHA 2VR6A 3FQ2A 2ICEA 4ODWA 4P2RA 4J5VA 4F7CB 5AVRB 3TT3L 2A74C 1B4JL 1P4IL 3DX6A 1TQCC 4RIRB 2O6CA 3AQXA 1X4YA 3KYKH 3VD7A 1UA3A 2XFGB 4WHTB 3FZUD 3QORD 3ZZSA 5BO1H 1WISA 2BDNH 5TGBB 2AJVL 2X3AA 4NQDD 3MODL 1KGIA 5F0JB 3STBA 4YHYB 1HOCA 3QWRA 2A77H 3R4DA 3EYOB 1MWAB 5KVFE 5A2IH 4FFVD 3ILPA 3FT1A 2YHGA 1OP4A 3QI9A 1LE5B 4HAKA 2COVD 1ZA3B 4G7QB 3LPFA 4HCGA 4Z3FA 1HI6B 4OCYL 4PY8I 5KOMC 4I18B 4TSAH 4GG6A 1LVEA 3NMEA 4NI3A 2WVTA 1DN2A 2J55A 4XP5L 1MG3C 3HE7C 3MRKA 3FSZA 4BZ2H 1HXMB 4XBPA 5E03A 4QRAA 3IEAA 1K4DA 3KLKA 2HRPH 4HOWA 2Y7SA 4GLRI 4R2GB 3RNQA 1TZAA 2XZCL 3AXLA 5EORH 5T1KA 1MJ7L 2OJEB 4QXUL 1LO0L 2LOEA 2OXGB 1JZ2A 2IAMA 4XVTH 1WITA 1WS7A 2FYVA 1EEUA 1XBRA 1JXFA 3OG6B 4JM0A 1A14L 1WD9A 3STZA 4JPWL 2FLRT 1ZA6B 3SE4C 5D7IE 4PB0H 4EO5A 4FN0A 4R8WL 2FE0A 4Y4FA 2PYEA 3R0NA 4Y5YA 5BRZA 3Q6GH 4OB5H 2VH5H 4OFQA 4NQXA 1XV8A 2A9DA 2GITB 2H3KA 1CWVA 5HYSB 1QUPA 5E0QA 5ESVB 3QUZD 4ZSOB 4H8PA 4NRXA 3ETSA 4MBOA 4WTZG 5A7EA 3RX8A 2YQBA 1JGDA 4TF4A 1B6UA 2GJ6E 2BRQA 3TT3H 3MTRA 1I85C 4KDWA 4IBYA 3FO0L 1L7TL 2V9QA 3GB7B 5F1IA 1JPGA 1O7DE 3BYYA 2PW2B 3L5WB 4WGVB 3WFEH 4M7KH 1S9VB 3SE4A 3IFPB 2HRGA 3P0VH 4OR1A 1NEUA 4TTGA 3K4AA 4A2LA 4C57C 3ERXA 3NJHA 3OHMB 3W0WB 3ZT6A 4LLUB 1OGAE 1T3FB 2XHNA 4H88L 1QVOA 1U3YA 5FKAA 3AAZA 4YPJA 2VLJE 3TBWB 4CBZA 3NRQA 2D3JA 2JCCE 1FQ9C 1QG3A 2HSIA 1AY1L 2Y6SC 4LDLB 5DFVC 3VFWB 5IGXL 4OY9A 5I0XA 4WFHD 4BWUA 3V0VA 1E4XL 1TKWB 1DQLH 3DX6B 3PAVA 4RIRA 4Z76A 1QEWA 3BPOB 5E2WL 4XAKE 3PGDB 3N41F 3MRPB 1U6AL 1SMOA 4D9LL 4KVCL 4DP7X 5BVPH 2VN5A 1QSFB 2H6OA 4DPCX 4DK3A 3VFPB 3I6KB 3DSFH 3ZTCC 2XYBA 1CFVL 5BV7H 3FN3A 5F6IB 2CH8A 4M9OA 3S35X 3SPIA 1PSKH 3MMEB 4YIQB 2I60L 5FB8A 2W88A 4CADB 4JLRB 3X13A 4ES9A 1JYVA 4OUUA 2EZ0D 3D8MA 5JPNC 3B9VA 1AD0B 2W9EL 4PJEB 3MBWB 2FEDD 1UB6A 1LK3H 4AC2A 4FEIA 2YBRA 4H0LC 4AIZA 3NA9H 4X80L 5D2NE 1A4BA 1SY6A 4FC3E 3MRPA 5AENA 2DM3A 5IVXE 4FXGA 4P5KA 4S1RH 4JVUA 2MNWA 3FQXB 3GUTB 1EH9A 1WFNA 5A3IC 3DX1A 3ZW3A 2GEQA 1YY9C 3BPCB 1XCTA 2HJFA 3FT2A 5IBLC 3ARDA 3OR7A 4NO3B 4L4VE 3C5JB 1I1RA 1JRHH 4FQIL 2XTJE 2OMUB 1Z0NA 1LO4H 1T66C 3BPOC 4P3WA 5EF3A 4U1GB 4ZMWA 5CJXA 4Y19E 4ZZKA 3EFOA 3O2VL 2E9WA 5GS1B 1ET5A 2WXJA 5IQ7H 4HIEB 3BN3B 5D7SH 3W0WA 2ZOLB 3GIZH 5EEUA 1N70A 1GTFA 1I8IB 3OB0H 4PRID 4JM2D 3P11L 5FO9B 2G5BB 5DHXB 3C5XA 4G1EA 2C1PA 1SY6H 3CLFH 3TIDB 1SJMA 1FFOB 1XZ0A 3DMMC 5LVEA 4L37B 1QQDA 1HC1A 3LPGA 4BA8A 4ENED 1TXKA 5IKCA 2J6WA 3OMAB 5D7IA 3MJ6A 4MGXA 4NDMB 5KYNA 4XO3A 2CHNA 3DJSA 2OI9C 2ZOOA 3GBML 5I15H 2VMFA 2IH1A 1FE8L 1A6TB 2ATAA 1FL6B 3I02A 2CKBL 3T2LA 5BS0D 3QXTA 3U83A 1MUJA 2X09A 2VZUA 1YMHA 3CFJB 3VYNA 1BF5A 4MD0A 5HVHC 3OAZH 4PJ8B 3P30H 5KBKA 2NY1C 5HYQB 3QJQB 4K2UL 4A7GF 4OGYH 3UTSA 5I30L 1ZK9A 4NNPH 3DRTB 1PG7H 3C8KA 3DTDA 2DEXX 2FJHB 1Q1JL 2WWMD 5GRVL 5IKCB 2OJEA 4ZODA 4G6ML 4PRHE 2F0CA 4AZ8B 5ITBH 1J5IA 3LNGA 4NKDA 4N0UB 1A7QL 3VXSD 3TIDA 3FOLA 3KW7A 2OJZL 2V7NB 3I85A 2OL3H 2ZSVB 1J5OH 4E9YA 4J4PD 1VCBC 1SHMA 4G70B 3ZDXB 2P5ED 3HAEB 3FT4A 4IRSD 3WN5B 2DQTL 2CE6A 3P9MB 4U1SA 2O4EA 4LSUH 2YD1A 4P2QA 1RPUA 2HXAA 3L1GA 3RGBA 5I8KH 4OCRL 1CR9H 4MJ2A 4P2OD 1OO2A 2VNCA 3CHSA 4CBPA 5BXFB 2Z9TA 1CD0A 4G7RB 3ILPB 1YNKH 3WUWG 2Y4SA 1OPOA 3B2DC 2GY7B 1ANUA 2A2QT 2HVJB 1UZ6F 3CXDL 5IB2B 4LCUB 3CDFA 1JI2A 1FO0A 2GTZA 2LT9A 4OF6A 4XMVA 5K59E 1BX2A 3ASNB 3L3DB 5HY9B 1DUZA 4XE5B 3HG1B 3MLWH 1JYXA 3RA7H 4AKQA 4R0LA 1KC5H 4PJ8C 2ATKA 3RI5F 4PJXE 4F7CA 4B41A 3UTPD 2H9GB 2KLRA 3WS3B 4BZ2L 5KVDH 4IDJL 1JERA 4YE0A 3MBWA 1BVNT 5GGVL 4QRUA 1JNJA 3ZLQC 5D7IF 2XETA 4GAYA 2MHAA 1ACYL 2AKRB 1VJSA 3CZFB 2MTPA 3CFIC 2FQDA 4GG8B 3S3SA 4L3CA 3X12A 2Y2YA 3ABLB 4C59B 4X6DF 4DEPC 4HV8A 5GGTL 1G0DA 3E3QC 3LS4L 32C2A 1P2CB 5GS2H 3LXBA 1S7WA 1QBLH 1JV5A 4F7PB 5I30H 1RJYB 1AGBB 3B2VH 2XZZA 3E7JA 3BRDA 1HYSD 3JTSB 5KUKA 1TETH 2VLLA 2GIMA 4J12A 4JEGB 4N4YB 3K6SB 4JN2B 4M4RB 1MCSA 2GI7A 3ZRCC 1BFTA 1S7VB 4AQ8A 4AYFB 4J7RA 4PS8A 1UATA 2WBJA 2NW3B 4MNGA 3P0YH 5L7XH 4NRYA 4XVSL 3EGDA 5T1JA 1BEYH 5JW3H 5AVSB 4R2GD 5TE6H 2F61A 1MVFA 4Y2DB 4JZOA 1RJLA 2DS4A 3BP7B 3MUGA 3L7FA 2J1ZA 3ARTA 4LDCA 1IGTB 1L7TH 3OHXB 4OLXL 3TS8A 2MQ3A 3U7AA 4K9EH 1KIRB 4AYEC 5IHLB 5IY5B 2ATPA 4LXFA 2R0LL 4OCYH 3L5JA 4TLKA 1JPSH 4ZT1A 1V05A 4AH2A 1AVAA 1GHFL 4XNXH 1CCZA 4G43B 3CQQA 4WI0B 4LKCA 1T4KA 2N7BA 3IETB 3HNSH 5C0BE 3QIWB 1GMIA 3A67H 3ZU8A 1MNUL 4S2SA 2Y3NA 1WV7T 2CIKB 5FCSH 4R5XA 1P6AB 4QXWA 3SOBH 1UVQA 5I0WA 4Q89A 5K1JA 3MCKB 2BRRH 3RTLA 3VH8G 2ERJC 5IJKC 5I71B 2HFFB 1NUFA 4FQPA 4KH9A 3S8FB 1S9WB 4S1QH 3FS9A 4X99B 5CEZE 3QUMH 2VDMB 1MIEH 2H6PA 2NY7L 1ZRUA 3B9DA 4X6EB 4U3HA 5TE6L 2VDKB 4HC1L 1FI8C 1WH0A 2DQCL 3L13A 4NJ9L 3VNZA 1MELA 1TZHB 2K8QA 4LCCC 5FFGA 3V9CA 3HHSB 2XFXB 1X5AA 4TNGA 1XAKA 1ZLUK 4GEIA 4RBPK 1LDPH 1XF1A 1KFAL 1ZGLB 2ZX7A 3TTSA 2F74A 2X4SA 3OHXC 4P57B 3B2VL 4QRRE 2OCCB 4HBQA 4HC1H 4KXZI 4ONHB 1THAA 5MEQB 4Y5XA 1HAUA 3ZKQD 1KGWA 1SBSL 1AMXA 4XO9A 1NANH 2SEBA 4F7MB 1T5WB 1BQHB 3FOLB 4Y9CA 2H26B 4KRPD 3C6LB 3QYNA 3ARPA 4N2LA 1FIGH 5AW1B 5ICXB 4B96A 5EF1A 1OOAA 2WINA 4D2NA 1OAQH 1DBKL 2EO7A 1AG6A 3UDWC 4KMTL 4N2IA 4EMZA 1KEGH 1RY7B 4PV9B 3VXUD 1FWXA 3PE9A 2J1WA 4U6XB 4YGVA 4MYWB 2QTVA 1CB4A 3O4OC 4D3CL 4DN3L 4PJ7A 3T3PE 1YMMD 2CCLA 5TGBA 1DLFH 3QFDA 2GHWB 5F3FA 3S36X 2YD2A 3FO2A 2R2EB 1S3KH 1E6JL 4HLZH 1H3VA 3AUWB 4L8DB 4TSCL 3ZL2A 1HHJB 5JMRA 3D3VD 4MQSB 5TDNB 4AYBA 5GGQH 1UH3A 3C9NA 1YAZA 3TA3C 1NLDL 3ROOB 3CMOH 3CX2A 1BQLH 4WGKA 3S5LB 1YY8B 4ODUB 4DQOL 1GZPB 3Q5YA 1NINA 2OV0A 4B5EA 3LQZA 4NFCA 3LHPH 5GGQL 4LOEA 3LRSA 5I76A 3KPMB 2I24N 2O72A 4HIHB 1Y0LA 1Q4NX 2APVA 4EOWL 1ADQH 2OTPA 1X4XA 3ULVL 1VZIA 4L2YA 3IYLW 2ADIB 2AJSL 1FIGL 4JHBA 4TNVF 4X50A 4Q9QL 3KM2A 4AVKA 4Q14A 4JL2A 3RTQC 1A6VL 3DXAE 4FTVB 3N9GH 3ZDYB 1KEGL 1WCBB 2LGNA 4FXKB 1RJLB 5KBPA 3UTTB 3BN9D 2WCGA 4WFED 9PCYA 2EC9T 2FX7L 2ROYA 2HJFB 2ZCHH 4PS4L 3PYCA 2XZAH 1NMCB 1I85A 2BIOA 1OT2A 2CBPA 1K8DA 3FBQA 4KQ4H 1U92A 2F54D 4EZMA 5IJCC 3BKMH 1JZDC 3MNVB 3FB8A 3U6RA 1R75A 1DSWA 2YPLB 3VJ6A 1UACL 3CC1A 4QHKI 3GMNA 2K9FB 1ZLDA 3I75B 4N0CD 5FV1L 3MKKA 2EDJA 1AE6H 3EJZD 4M6AA 4P59L 1JHKH 4BIKA 1VZGA 5JYMA 1QZNA 1L7IH 4YXHL 1JOIA 4BZ1H 4P2OB 3SKMB 4Y4FC 4OZIE 1L0QA 5JIPA 1WQVT 1BCIA 4X5WB 1URZA 2KH2B 2PWGA 5DT1H 1YNTA 4J3BA 1MCKA 3QDGD 4E9RA 4ZFOL 3A4DA 4LGPB 4X4ME 1E43A 2EDWA 2XWTA 3PWPA 5CAYB 4RNRB 1AGFB 1AS8A 3QG7L 5BVJA 3L3HA 2R69A 5DJ0A 1U8CA 2VDML 3D0LB 3TBSA 3O2WH 1E6JH 2DL2A 2X4OA 3GZPA 4PWHA 1NDTA 3ZBMA 1N0XL 1QSFA 4JFDD 1BMZA 1FSKC 4JFXA 4LOVA 4OZHB 4BK5C 2BVOB 3GSRB 4JO8A 5MEND 1NPJA 1ZEAL 2L0DA 2GK0A 4G6AC 5BZXA 3ULSB 1CFQA 5L9DH 4DF9A 1FO0B 4UAOC 4KKQA 2P5WD 1EEYA 2JKSA 3KPSA 4NT6B 1GC1H 4NQTA 2C7UA 3LN5B 1E2VA 3F62A 1G6RB 4YAQA 3ARBB 4V33A 5F9DC 4BXSV 4FQLL 4KO6A 3IF1B 2Y69B 4KMQA 1DCEA 1CIUA 3VFMB 4PD4K 1I4FA 4Q6IB 3KEDA 4MS6A 2P48B 4HKJA 1U4FA 2QPUA 5DHYA 2OKMA 5KJ4A 2XG4A 2PO6C 4G6AD 2X0UA 1BQHA 1UD3A 4ZMPA 2JTYA 4RMBA 2CKBB 4BFEA 3OSKA 4BRJA 1FGVL 3MA7B 5E9DA 1ES0B 2OMNA 1FNLA 4JFOB 3EG9A 4KUCD 3TNNA 4BSWB 1GIGH 4NHCL 3WL9B 2CMRL 2ICEC 3AMKA 2IGLA 4NUJA 5J6HB 2OW7A 2A4EA 2X6UA 2HN7A 1VEPA 3BVTA 4QLWA 1DE4B 3SGEI 3QNXB 1G7QA 3P77B 4DGVL 1MDTA 3QXUA 2VMCA 4LF3A 4O5LH 3H9HB 3OKOA 2XJKA 1XGUB 5A40E 4YHKL 1TVBA 1NBYB 2CD0A 4XNMA 1FNGB 5H94B 3TWYA 4JHWL 4JHVA 2CAKA 4H8UA 1Q9LB 4CMMB 1IGIL 1TUPA 2AJYL 5TQ0H 3VXOA 3L9RB 1Q72H 2GBUA 3P3TA 4F9LC 3FCSA 4YHNB 2XWRA 3KLHD 1MFNA 1SNRA 3ALXA 1I1YB 3WJJA 5A7BA 5FPIA 4K23L 1QQDB 1EO5A 2TRYA 1NAMB 3N85L 4XMZA 5IJVA 1AGFA 4ZTOH 4M8VA 4YHZH 4PJ5E 1IL1A 15C8H 2CXKA 3TGXA 2JKIS 4K94H 1ZE3H 4WFHE 3BGFB 3DGCR 4APQC 2ED6A 4U7MA 1YVLA 4MA8H 3ROLB 4AUUA 2A73A 2K4AA 3QCUH 3K6IA 5C0IB 4WU7B 2X6MA 3WY3A 2XQ0A 2E0PA 2NY5L 2ZXBA 4K55A 1T6VN 4O58L 2HG0A 2VXUH 5FM4A 3ILDA 1NFIB 4X8GA 3BUQA 4OM1H 4E9LA 2KZ1B 1FZOA 1XCTB 4WJ5A 1BQHG 4MVBD 1YEEL 2BERA 4NP4H 1CDCA 1HHKA 2E9IA 5IB3B 3EW3B 4HT1L 4TSBL 4AEFA 3NQIA 1DQQA 3WKML 2VLKB 4ZQKA 4Q74A 2NXZD 1Z9NA 4UTBL 1JWMB 4FXKA 1YEDA 4UNTA 2ZX6A 3QFJE 3C6EA 5EV7A 4ZTEA 1BYNA 1FPTL 4XOBA 1I9IL 1KEML 3G9VA 3N50A 1R3HA 4KDVA 2MRYA 5G4MA 3QDJA 4UINH 2XA8L 2P8MB 1HL9A 4WJKB 1R5IA 1ZHNB 4R5TA 4Z7AA 2Q8BH 4Y16B 2AI0H 3TPUB 1ZTXH 2YEZB 2DW5A 4GSRA 4K5NA 4OUUB 5KW9L 1ED3A 5EWIL 2Z35A 1QTPA 1HQRA 5E2TL 2L8AA 5E8OA 5C0GA 4A55A 1EO8H 3B8YA 4P2QD 3QJVB 4XMXA 3S36H 4ODVH 1PKQA 3NA4A 1WFOA 2NR6C 3MNZA 1TJGL 4AXWA 4MDRA 1R3KB 4JFHD 1AIFA 4J4PA 5ESAB 1YEDB 3O81A 2EE6A 2AQTA 1FDLH 4XCNA 5CINL 2F18A 3PG2A 4PVLA 3TYGL 2X1XR 1C8QA 2LLNA 2Y3AA 4YK4B 2GJPA 2H32B 3DX4A 4HUXA 4LSPH 3RX5A 3WFEL 5A2KH 1QFUH 4DCQA 4WJ5B 1SF5A 1HKLH 2D0FA 4F7EB 2BCKB 4QO1B 3BGMB 3IDYB 1UWFA 1XR9A 4DAGH 3FTZA 3MXWL 3VDAA 1FL3B 1N26A 1OARH 5LLIC 4NQVA 2Y9RT 5L2JB 5HI4C 5E99H 1SYVA 4G8GB 5FOBB 2X4RB 1YO4A 3EGSA 4W9IC 4ZD3H 5JA9A 3OX8B 5HDBF 3RUGF 5C0FB 4NOFA 2HPTA 3K2IA 1AXTL 3AT8A 3ETBJ 1G87A 4ELME 3L4XA 1CXHA 4AC4A 1HHIA 1O75A 3KPOA 3UPRB 1I8KB 2GTWB 5DRNA 5B7FA 2BVPB 1RURL 3PQYB 3N44B 3JTTA 5DEGA 2HKHH 3CXDH 1KIQB 3FFCA 4J3UA 4MDJA 2ENQA 5I66A 3C5ZD 1NKRA 1QPXA 5IR1A 1JYNA 3WELA 2E46A 3IN0A 3ULUC 3BPNB 4M02A 1MZYA 3AU1B 2ARJA 3KGUA 3C8KB 4MA7H 4FMFA 1J5DA 3WNPA 1MCWW 2NY3B 4OLEA 3RPIB 2CIIB 4XWOD 1E8XA 4YHMH 4X5RA 2ORBH 3AWGA 1EQWA 5I1KH 1FHNA 4GP5B 5BZZA 4HJGA 4JKMA 2CGZA 4TV3A 4ISVB 3G5VA 5HI3C 4HWZB 5IROC 4X6EA 1YMHB 4H8QA 3PQYD 4DAGL 2DYPD 3TJHC 2FIRT 2YD6A 4NCC2 1PZCA 1U8HB 1VA9A 1JN6A 2N0MA 2OMXA 4K7FA 4P05A 5GGTH 2DMGA 2VAJA 4GMSH 4PRBA 4YXLL 2E6PA 3VXMB 4JFPA 4OV5A 1IIKA 2IQ9H 5GIRA 4OGQC 4AYDC 5IHWA 4MZ2A 3K46A 3D87B 1N59A 2ZQKA 4Z78B 4MQ7A 5JHAA 1I75A 4MDJB 5CXPA 4ODSH 4ZK8A 5BZDA 5MENB 4KC3B 4UIKL 4Z7VE 3WIAA 3T2NL 4HWBL 5L88L 2YAOA 3KBFA 3CN3A 4QRTB 1X7QA 3DOIA 4QWWD 4R6UA 3HUJF 1LP9E 4H20H 4B9GA 3VTMA 4PWJA 1ZTXL 1XGZA 2WXIA 5MP6L 4MA7L 3KWWB 1U3HB 4KJQD 4Y1AD 4JPVH 3MRIB 5TPWH 4O00A 2Z8WC 3D12B 1WBXA 1PD0A 3GMRA 4PJ9A 4MZRA 1A9BA 4HOXA 3HMWL 3L4ZA 2XWJB 3N85H 1KBWA 3KPSB 2NNXA 2BNUA 2OS7A 3B2PA 4HJTA 3QUYC 1OLLA 1U8OB 3G3LA 4YNYB 1MCIA 3C60A 3V5DB 3CX5K 4IMKA 4L1BA 2P5EB 3ISWA 2P1YA 3GDCA 4XNAA 4NUPA 4JFXB 4OJCA 2B0SH 1RMFH 3MX0B 4DP8X 3L3JA 4Z3HA 3QHFL 3QJSB 1CXFA 5T3ZL 3SDXA 1PKQB 2ADYA 2BY2A 3MXWH 3FKUS 1AFVL 3NJXA 1ED3B 4JM4L 4MA1B 3BHBA 3DMMA 3CPLA 1OAZH 5MEOB 2FBRA 4LU5L 3LQAL 4JJHA 2IANA 4PUBH 1LK2B 1E0OB 2VC2B 1AS6A 1HCFX 3FHAA 2HYMA 3MBED 3O2WL 3SDXB 4TTDC 4Q9RL 4TVPL 5EOQH 1CYXA 3KPRE 1XGPA 4ZW5A 2YSSA 4EVNB 1J9SA 4GBXB 1HH9B 1QWNA 3PWVB 3U46B 1IT9H 2FO4A 1E8WA 1J0KA 3KH3A 4RAUA 2JELH 4YNYA 3GEFA 1C5CH 4OZ4A 5I6PA 3SYPA 3SD2A 2HUHA 2NNAB 2EH8H 3PV6B 1C5DA 1KBGH 5F7FA 3U4EB 1RUQH 1EFXB 5T3XH 1JFQH 4Z7QF 5BRZD 4QHNA 4HXBH 3MV7A 2Z65C 1V54B 5F6HJ 4UDUA 4DIXA 1NEZG 4HKZA 1RV6X 4UV7H 3S8GB 1DBBL 1N68A 1HEJC 1IE5A 1BLNB 4OD1L 4WWNA 3AG3B 1AFVH 5J9PB 1IKFL 4JKKA 2WLLB 4FL4C 4RMTA 3IFPA 1FCCA 2D7TH 2WLIB 5EOTB 5FCUL 1T22B 3QC5X 4GO6B 5KSVB 2DJ4A 4OQTH 3DVGB 5EEVA 2L7EA 3QQXA 4LIQH 3T4YB 4P9HH 5IBLD 5C08B 1TZIB 2D2OA 1E6OL 3B9AA 4AZ8A 2BP0B 4GFTB 3SCMB 3TP4A 2JKJA 5CGBA 2EVFA 1KMGA 2WQVA 1IAOA 1SQMA 3BP5B 4JHUA 2GJ6A 4BXVA 1QYGH 1SXNA 2ZCLL 3BOVA 4AE0A 3UL4A 3Q43A 4Y2OB 4YVUA 1S6NA 1BBDL 1HSAA 3AGWA 3VCLA 4PLJD 4Y4HD 2IH9A 4WSGA 3IGFA 3FO2B 3Q9QA 5TJWK 5EU6D 1KTLB 5C07A 1NDGA 5D8JH 1PY0A 3I9IA 1OXYA 3GSVA 3HMXA 4XNUL 1IGCL 4HHAA 1DDHB 1T0NA 4ZAKC 3BKYL 4LSTL 2BNRD 3QCTL 3UBXA 1ZLVH 1GGBL 3NIGF 3QWRD 5CZKA 4OCNC 3ZKNC 4BDVB 4F80A 2UZPA 1FVDB 1IBBA 3MR9B 4AY0A 1AR2A 1G7PB 3QA3B 2AABL 4L37A 4GW1B 5C92A 3KLHC 4AQZA 1U42A 2RQEA 3WAKA 5LKNA 2XQBH 4JPWH 4LVOB 4P2RD 2VERN 3RPBA 3LMJL 1CFVH 1M71B 3ZE0B 2ESVE 4XCCH 1IVLA 1D6EB 5FFLA 4I0PD 4TVPE 1FYTD 2MPAH 3F7QA 2JK5B 4GAJL 3B5GA 5AAWC 1N3NA 2J5LC 3KYKL 3NCBB 5KBNC 1EK3A 5C07E 4KNSA 3BZEB 4OD3L 5CF3A 4DN4H 1SN5A 4PGEA 2PLTA 1KB5H 4WNJA 4BZ1L 1L0XA 5J6GB 2UUDH 1K2DA 3ALPA 3SO3C 2BVEA 4QLRA 5CFAA 1F4AA 3QFJB 4YO0B 3JWDH 4K5PA 5CCJA 1HEZB 4Y89A 1DDTA 1KLUB 4KTDH 1U58B 4RAUB 4YDVB 3CH1B 2MQCA 4EPSA 4Z7IA 2XN9B 3RZCC 1TQWA 1ND0B 5J3HD 4LSSH 5AAMC 2HFFA 3EYUL 1JK9A 1UB6B 3JWDC 3CFUA 1YEIH 1MJUL 4PJXF 4X0KA 4BQBA 3WD5L 2X4OB 2FWSA 4N9GB 1M6OB 5I19H 4YDMA 3KWUA 5AZ2L 3IJSB 1S5HA 1WEJH 1BLIA 3V4VL 5GS0H 1M7UA 4HA1A 4NC2B 1OP5H 3ZE2B 1KLGA 2ALAA 4ZFOA 3DYMA 1JTOA 1W0VA 3GMOB 5EEWA 5DQ9B 4XZUA 1UZ6E 1U8PB 5HTSA 3QNZB 5DUJA 1DN0A 5TQ2H 2ATPB 4XBEH 5D7HA 5CCKH 1QW9A 1RKRA 2X1QA 4L3AA 4OLZH 3PWNA 4YFEA 1B90A 3NCYS 4PV1C 4B27A 3IJHB 4QXGH 4MD4B 1L9SA 5D1ZC 2I07A 1QEWB 5HDBE 3RUGE 4NP9A 3FQRB 3VI4A 3O11B 5I6LA 2A4CA 2XC8A 4HWEH 7PCYA 1KFGA 1S7XA 4L1DA 3WCYA 3KXFD 1HZKA 1MVUB 1BHGA 2EDKA 4MHHG 4JG0L 2R4SH 5TE4L 1KWGA 4RMQA 4A67A 1K4CA 1E8ZA 1Z7JA 3SBWC 8PAZA 1VENA 4S1DC 3OPUA 1AAJA 1TG8A 2WVVA 4BUHA 4XO8A 1FNHA 2F53E 4GXVL 2WNGA 3D07A 5DJXB 5CJXC 4F7PA 4YHIB 2V5SA 1QFWL 2NTFA 1I7RA 3GKWH 3KXFE 3Q8BA 4MMYA 3IAGC 1E7UA 1N5AA 3CG8A 1KXTB 1T7ZA 2XZQL 4FXLA 4XOAA 1PTZA 5IWLA 2Y07H 1EAOA 5GRZA 5ITBL 2ZWZA 4QRUB 5C6TH 4JPSA 2VN4A 4XT1C 3TZVB 3KYOA 4PWGA 1M9SA 2WZAA 1D2PA 3JQOB 3P2BA 2MCG1 2NZIA 4K7FB 5F96H 4F7TB 5F8RC 1RUMH 1SDAB 4L9LA 5JDSB 3MRGA 4HF5H 4U2ZA 3B34A 1UA6H 1WFIA 2V17L 2XWCA 3RIKA 3PWUB 4YO0A 3GM8A 4F58H 3BCFA 4JNXA 1NMBL 3UOAB 5JPNA 2VE6B 3HZYB 4AV4A 5D6DC 4F57L 4HJGB 2ZUSA 3MLZL 5J6GA 3WTSA 4HK0A 2P26A 1ILSA 2VWEC 5DC2A 3LKOB 2Z93A 4PJ8D 2Q3AA 2DBJA 3DVIA 4WV1C 3SBQA 1W72L 4LEXH 1THCA 5ESQB 4AVJA 4AK1A 2BSBA 3KGRA 3IGKA 4BWTA 3FRPG 5I1GH 2APXA 4PWFA 4PB9H 1MCJA 5D5MF 4JPIA 1A1NB 5C0CA 2BOCB 3B7SA 1FVDA 3KYNB 3QUXC 4ABQA 4E9SA 1CFBA 2X4RA 3EGSB 1PSKL 1BXVA 3HMXL 3AJ7A 4CW1B 1R47A 5HYQA 3PNRB 4ZXBC 2XOTA 2P46B 1HAWA 3GTTA 3BZFB 1Z6JT 2R1XA 3L3GB 3MRCB 4PWEA 5KVFL 4AQAB 3PWUA 5IEKA 3GGWB 3QIWD 1Q0XH 2VZTA 4M43H 3VXSA 3U82B 4PH8A 3I9GL 4M61B 4U6VL 1II4E 1DL7H 1ORQA 3SODB 1RK7A 2JIXD 1IC7H 2BSRA 4OD3H 5KG9A 2VM9A 2XA3A 2XQYA 3N42B 4GW5A 5KANG 3WOVA 4OCLC 4Y2DD 3FT3B 3H7BA 3ZIMA 2EDBA 4IGBA 5CZVH 4OM0H 2DQIL 1QTYT 4XWOC 3MJWA 1RUAH 1P9MA 1WZAA 2VR9A 4W4OA 4Y16A 2AJ3B 3ARGD 4YXLH 3RTQD 3HA0A 5GGSA 3VRJA 5EC2A 3NEXA 1PQZB 2XACC 5GS1A 3H0TB 3EOBA 3P9WB 4KDTC 2JF1A 5HJBA 3C5ZC 4WEUD 2GJ6D 1HEHC 3GHBL 5E99L 4LSVH 4XN8A 1M2VB 3NCCB 5KTEL 2B4CC 2YPLA 3VJ6B 2NX5B 5JOPE 5H8DA 4NO5B 5JOFA 3QCVL 2VDQB 2OMWA 2YN5A 5D7KD 4MNGB 5J1AA 5FGRA 3VD9A 4L4TB 2NX5A 3QXWA 5HI3D 3SQBA 3BAYA 4DZ8A 4DVBB 2XY1A 3SPHA 1E3FA 4PJGF 1G7HB 3H9SD 1DZ0A 2ZZUT 4MMXA 3MO1A 1M4KA 2VQ1B 3CFMA 3KHOA 1RZKL 3QB7C 4HIJB 4RGNC 3PPSA 4ZS7L 1S7WB 2G3ZA 2OMZA 4GKSB 2EUVA 3EOBB 3MV7D 5B7EA 5F7LB 1E5ZA 4QRQA 4F37F 1AD0A 2OCJA 2R0WH 2XTJB 5A16B 2BOBA 5C08E 2ROXA 3T6VA 1A64A 1MCRA 3EJRA 2OMTA 3LIZH 4HOMA 2BVQA 3LKNB 5T3ZE 4S0HA 4KHXL 5L9DL 3IJ7A 4A1RA 5MHSD 3QO0B 3N1MC 3IB4A 3N1GC 1ET8A 4FQXB 3BGFC 4XB7A 1ICTA 4DSYA 1D5IH 1EJ8A 2P80D 3V4UL 1FZJB 3W9DA 4FQHA 4HU2A 5CILL 1YYMH 2VLKD 3L3OC 5CUSH 4YX2H 5B3SB 3MV9E 5DUPH 3APNA 3Q8CA 2I32A 3BUTA 1YUKB 2X88A 4AQAA 5IEKB 4KUZH 2WYIA 4Y5XC 1Q0EA 3LPOA 4ZUSA 3NIFF 3AG2B 4JRYA 3JTBA 1OTTC 4KJPC 3V4PL 2Z0BA 3DGGB 1D5IL 3MRMB 1ZT4A 5HHPA 1G7MA 2J8UA 5SWQA 1XXFC 1NGWB 1URIA 3H3BC 4MD5A 1U3HA 1WP6A 4PJIE 1XF5A 5GJSL 3PJLA 4NERA 3GSXA 2ZG2A 1DQKA 2ZXEB 5FM8A 3T4AA 1WVZA 4Y4HC 4E42A 3BZ4B 2YPVL 3K7UA 3W5MA 4O51A 3AT9A 4QRTA 3O0RH 2YD3A 1I1CA 4IBLT 3J27A 4IU3A 4RQQA 6FABL 2UXFA 1IX2A 3UAJD 4HJ1A 5GZNC 1WBZA 3FH8A 4JDTH 4QXGL 3OWEA 2CNYA 3HEIB 4MNQA 2CDEA 4P57A 3IDYC 4M7JL 3LSOB 2QV2A 3MR9A 4DHLA 2K78A 4HUUB 3UG4A 5FYKH 4M7KL 1CE1H 2I9TB 3K0WA 3BT2H 4QHPA 4Z7WB 2AV1B 1R5WB 1Z32X 2AJUH 3MJ7B 1M1SA 4GKLA 4PRPE 5IFHH 3U36B 3V8OA 3WEOA 3T8XB 3C60C 1EPFA 4ZFZB 1P84J 3UZQA 3FTVA 4R96A 5ENWB 3MREA 4JFFB 1N5YH 1A6TA 1IJ9A 3MBXL 3VCLB 2LTQB 3QFGA 4NDMA 3T3PF 3GQFA 5D71H 3VO0A 3EH1A 3BP5A 3HBGA 2YPKA 4JFYA 3KLLA 3CJJA 2Y1VA 3MCG1 4N24A 1JF1A 2BM3A 4GIPD 5HHXL 3DI2B 5I66B 2NY3D 3BMVA 1A14H 1IU1A 5C0AA 1BVLB 2GC4C 5I1EL 4S2SB 4Z8FL 2QGCA 5H4YA 3PQYA 4HKBB 4PJEF 1EEZB 4LKCB 2V2XB 4MMYB 1GA2A 4XMKL 3Q2VA 4GNKB 2DKUA 3IU4H 4DKAA 2ARWA 3VRIB 3DRQB 1CURA 3SKMA 5B3NA 4OJDH 4M7ZC 4F91B 2VDRB 5I6XB 3W0WE 4HJJH 2E7MA 3GSOA 4L1HA 2A6JA 3IE9A 5I17B 1HJCA 4LO9A 4LHUA 2G3NA 1HE8A 2EQDA 4L48A 1F42A 1BAFL 4XPFL 4DWHA 5I28A 2PW1A 4C4BA 2SODB 3RKDC 2EH7L 4YEEA 3KJ4C 3P11H 5SV3A 1OWRM 5HHOD 3LXCA 5IROA 5BJTB 5IT2L 2W60A 3UTTA 4P5KB 1AR1C 3WEAA 4MD4A 1PZDA 4F15B 1MHHA 2Q3ZA 1AD9B 3DKHA 2IMMA 2J88L 1WAEA 1LM8V 3VFUB 3LHAA 3TURA 5KS9A 3U2SA 5E8OB 2C3VB 4LLYB 1AQKH 2EIBA 4XP9L 1YEGL 5B4MC 4MMZA 3D39A 2FBJL 3LRSB 1W0VB 3BHBB 3MV8E 3TPUA 5I76B 6TAAA 1DJSA 2BSTB 2GQHA 5D8JL 4U4BA 5IVZB 5CEZH 3WJLA 2WYTA 1M6OA 3DX0A 4R7VA 5BCAA 2FZ3B 3F05A 4KV5F 1CR9L 2W65B 4FHKA 5INCA 1BEYL 1F11B 4JS7A 2C9SA 5FHAL 2DEWX 4BCXA 5FW7A 1E3XA 3EXLA 1L9PA 3VFOB 2G2PA 1DJYA 5AL8A 4JKLA 5FYKD 4ACTA 1U8KB 2XN9A 3VWKB 5E56A 2HCZX 3SPCA 2GVYA 2QGEA 1QRNB 4QRRD 1BX2B 3A6CH 4BGDA 2X1OA 5MENE 5D7JA 3QFJA 2WWMC 2FEDC 4HCFA 1UWXK 4UQ3B 5D96C 5DSCB 5J06A 4JHAH 4UAHA 1A2YA 1ONQA 3QRGL 4I13B 3EDFA 4C56D 3T8MA 1WO2A 4NWUL 5FM5M 4W9HC 5KS9E 5HPMA 1EGJL 4KY1L 4DEPB 5G2NA 2VJ0A 1U8LA 4FMVA 5BXFA 2EINB 3KWWA 1YEHL 3QK0A 3ZO9A 3QO1A 2RFXB 4JY6A 5D1ZA 5BW7C 4HPOH 3BAEH 1NWPA 4I4WA 1A7PH 1SVZA 5EOCL 4F2EA 3DUSB 2AFNA 3VRIA 4NZ8A 2ITDB 1NCDL 2HVKB 4IMLB 4HJEA 3GSWA 5DS1A 3TNMB 4R3SB 5K1NA 2WQ8A 3AQDA 3NCMA 1AGDA 1MFMA 2QQLL 4NN5B 3JZ7A 3OXSA 4POZC 5HGAB 1IAMA 1A9VA 4O2CB 3RGVA 3B7YA 4KBPA 1ZLVK 3DDGA 3V0GA 1EBAA 2EE3A 2FJFA 1BD2E 2O6EA 1NIBA 4QEGA 3TO4C 3FSWA 1Q9LA 4N6QA 3CFKB 3SZKC 1EHNA 1FRGH 4WK4B 4Y5YB 5I6KA 3L95A 3KLAB 1B3IA 2YD0A 4HD5A 4XNMB 2YEQA 3NCXA 2VDPB 3K2MC 1D3CA 1TMCB 2BRRL 1CF8H 3OF6D 1DLFL 4HGMA 1AANA 3HB3C 3P4OA 4PTTA 1E5UI 1IVTA 4Y9BA 5ADOL 1X7SA 3PXLA 1M7IB 2IAMB 2YKKA 2W92A 5ECJE 1EJOL 1NANI 2APTA 4N8PA 2VL5B 4HVBA 5I6NA 4PGDB 2ZONA 4OGXL 1JTPA 3WXWH 1T03H 3MJ8A 1AQHA 5TD4A 2H1PH 2KL6A 4G1EB 4APQA 5DXWA 4GQ9L 2CKBA 4TS6A 4PJBB 2B2XH 3VA2C 3B6SA 1P84K 5IW1A 1OCOB 5HSFA 3GBNH 4FXGC 3C8HA 4E42B 1FCGA 4OGYL 3CBJB 4NN5C 5I5MA 2TRHA 1QUNA 2B9BA 2ZXDA 4CNIB 4LCCB 3FUFA 4WWID 2L7QA 4HKZB 1XF5B 4G6JH 4ETQB 5IZ7A 4NQCB 4UQEA 5FA4A 1OQXA 1JCKA 1X5GA 5AVTB 3U7WL 3MUGB 4KZ0A 3W2DH 2BWIA 2F9BT 2RBLA 4PRDB 4AKOA 3MRMA 1G9NL 5F7BA 3DO7B 3OJDA 2FJUB 2AEQL 2WTPA 5FV2A 5I1EH 2DKMA 4ZUSB 4FTVE 1UCBL 5C3LD 4K0OA 1N7ML 5DVNA 2IPTH 3ZXAC 5DURD 3R1GL 4MKTA 2W0LA 3ULSA 3MOAH 5KSBB 3IGAB 4BELD 1XIWB 2J7LA 3FTGB 4XP6L 4R7NA 3BDXA 1HH9A 4HWUA 2E7BA 4N1HB 2KZKA 1DTUA 3FU6A 5BVPL 3ULUF 2E7LA 2ZOTA 2BNQA 2UY7B 2XN9E 3ZJAA 4JGNA 1CGXA 3UP6A 3PHAA 3RPKA 2ZAGA 3Q5OA 3AY4C 3IWUA 5B7MA 4ZNCD 5C0GB 5BVJB 4KKBC 1H6EA 3DX9B 1RZFH 2X05A 3MPCA 2EVIA 2J1XA 4NKOA 1E8YA 2C26A 1KCSL 5AW2B 1BD2B 1U91B 3GO1H 5FB8B 1C5CL 1BQUA 3VAEA 8FABB 1AOZA 1ESOA 1IM9D 1NGPH 3HFMH 4FD0A 4OJFL 1OGPA 2JI2A 3WS3A 1F58L 1USZA 5DGRA 3K72A 5F2FA 2X9XA 1YEJH 1UGNA 2WUCH 5F88A 4BZ2A 4N2MA 3S88H 1JV2B 4QRPE 3WFCL 3KDPB 3W56A 3WENA 2O30A 2PTTB 2FX9H 3WFBL 1OPGH 2HH0L 4FQ1L 5EPMA 1FGNH 1I82A 1F58H 3D0VA 3IFOB 3OB0K 1K5WA 1OOWA 1A9BB 7PAZA 5LJYH 1NC4D 4AYFA 4N3TA 4Z95L 2GUOB 3GLEA 5KTEH 4D7PA 1HZHH 5D1XB 4UYQA 4I2XE 3RUGA 3QHFH 4YBLB 2DLTA 2E4FA 5C0DA 4P2CG 4WUUB 1LGVA 3O2VH 4TN9A 3AACA 3ROLA 4BK5A 3HW7A 3U25A 3CAFA 2IGFH 1RAMA 4D0CB 1O6VA 4KKCC 2F19L 4WEBH 3WTXA 1Y0LB 2WGXA 1OP9A 1EEZA 2NXYD 3ASOB 3QEQA 5JNYA 3IXAB 5CJOL 1I8UA 1NAMA 3GBLA 1TCRB 4EI5A 4JM2B 5GGSY 1KTJA 2QKIC 3S34H 4GXFA 1RSYA 3B4NA 4JFPB 4LMQI 4LQ1A 3CHRA 4OAWA 5CKGA 1SBSH 1ORQB 5D4IA 4B9IA 2FJHA 3EH5B 2YBGA 4HGWA 2E27H 4MJIE 2WUCL 2WVSA 4U6VH 3BFOA 3HPLB 3OG4B 5DJDB 2WLJA 1O0VA 1NC4B 3MGOB 2FD6H 5I15L 2VR5A 4TRPL 4XMLL 3WLWC 4C4UA 1A4KB 2YGPA 4TXVB 1NBYA 2TSAA 3B5TA 4M7LL 5KANI 4AM0Q 4PMEA 2Y06H 4HWZA 1JVOA 4ODTL 1FG9C 4K9EC 4PJDB 1G9MC 1GVIA 5HVGB 1MCQA 2V6HA 5E5RB 1VADA 4AUJA 2X0WA 2DQJL 2DYPA 3HLAB 4GAAA 4OLUH 3NJFA 1XR8A 3S37X 3FB7A 3SGDH 5HJGA 4ALAC 1XCQA 3E8UH 3F6LA 4Z7NF 5I1CH 3MBEC 2RCSH 3EG9B 4JPIB 1Q9OA 1JGUH 1D7CA 4NC1E 1XGQA 3REWB 3TNNB 5ISZB 5DLMH 5IVXF 2VLJD 1JRHL 3EJCA 5BQDA 3WKMH 4AVHA 4FA7B 4EZJA 1DEEA 4TQPA 4PGCB 5B8CA 1T83C 1XF3A 4O2FB 3VG9B 4GXVH 1OB1A 3EFOB 4KRNA 2P49B 4M5ZH 2Y24A 2V7HA 3C5JA 1FNFA 2GFBB 3IGLA 4MZIA 5DS2A 2DLFH 5F89A 1B4LA 4NS0A 5I1DA 1DJIA 4TL5A 4PJFA 1KT2A 1ODAA 1SLUA 1GJWA 3MKGA 1GMEA 2Z6FA 3IRPX 4ODTH 1TJIL 3QEHB 1AI1H 2AQ3A 4ZPTB 4K23H 4JO5A 2EILB 2H32A 1S2EA 4HUXB 4KPHH 5I5IA 5IUSA 4IKKA 3BVNA 4M48H 3FN0H 3V7AG 5I8CB 1HVXA 2ZICA 3H6AA 1E2WA 4XCNB 2FH6A 1QAWA 2F58L 2YBRB 4AIZB 2EDRA 3MV9A 3R06A 4FA8A 3CXHK 4APXA 2XUWA 1NTDA 3BLBA 4RAVB 5F0MB 3E1F1 4NPYA 1J5HA 2A38A 3SY6A 1J8KA 1XF2B 4G9FB 1UG9A 4BK4A 1DQDH 4FG0A 3L9BA 4MAYB 4NCC1 4X5XB 3VWJB 2FEEI 5KZCD 4XCCL 3VG0H 1WWAX 5FOJA 4JKPL 2QSQA 2E75C 2CJTA 4TQHA 5AAPA 1JNNH 4JQIH 1R24B 2FUTA 1Z3GL 3CFBA 2P8MA 4N2CA 1H0DA 4OLVH 2Y7QA 3I50H 1UD6A 3OHXA 4R83A 4LCWE 3UC2A 3NQKA 1NDMB 5A6MA 1PFOA 3FQNA 2FQGA 2F53D 3GJEA 4ERSL 4P23D 1WLHA 1F41A 2DJSA 3G6AB 5FHBL 5JHDE 1XT5A 3HRZB 5GGRA 1SF3A 3MVSA 3OAWA 3CVHB 4KUCF 4ZFFB 5HYJB 1S7XB 1JGVH 5EDSA 2Z91B 3D4YA 2YEVB 2VXSL 4IK6A 1SDYA 3TBWA 5FR3A 1QFWM 2KLTA 4H25B 1GYCA 4GXUN 5DR5L 5E7BA 2AXJA 5HHQA 2IDSA 3F2LA 2YPLE 2JJSA 1ZVYA 2WW8A 3RTQB 4MDIA 3QHZL 2ADIA 2R39A 3O41A 4RISH 3GBNL 2DMHA 2F1EA 5E2UL 3PDOA 1E27B 4AGLA 1ZHLA 2WN2A 4G1MB 4F3FB 3RNKA 2VRAA 4GG6E 2Q8AH 3VFNA 1C8PA 1XH0A 1GZPA 1MNUH 5F0LB 1S7TA 4PJ5A 4XBEL 3TVMC 5CCKL 1TTUA 1BGXH 4QKTA 1HZHL 4OGZA 1SJVA 1MCNA 1BM3L 2NY5H 2GITA 5HI4D 3PXHA 4EDXB 4J28A 3GTNA 3SDDD 4UV7L 3WNKA 2Q5BA 2X0VA 4QNPF 3RVVD 4JVPA 5C0JA 1LEIA 4L0ZA 5FUCE 4N2KA 4ZS6D 3OC8A 1W72H 4LEXL 4PYHA 5F1NB 1E67A 1LP9F