2DMHA

Solution structure of the first c2 domain of human myoferlin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
140
structure length
140
Chain Sequence
GSSGSSGMLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDFSSSLGIIVKDFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myoferlin
publication title Solution structure of the first C2 domain of human myoferlin
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 11
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2dmhA00
2A4ZA 3RDJA 3ZIMA 3ENEA 4EZJA 1BYNA 4PS7A 3L54A 5KJ7E 4WWNA 4Y1SA 1E8YA 1V27A 1DSYA 3PS6A 4J6IA 4DK5A 4OVVA 3GPEA 1TJXA 3LJ3A 1E8ZA 4XE0A 3ZVVA 2ENPA 3QARA 3QR1A 2WXNA 4BFRA 4F93B 4EZLA 1RSYA 4ICXA 2JQZA 1E8XA 4NS0A 3KWTA 5H4YA 5JHBA 1UOVA 2BWQA 4KZCA 2CJSA 2WXMA 2K45A 3F00A 3DPDA 4F1SA 1E8WA 2K3HA 1RLWA 2DMGA 3QR0A 4WEEA 2X38A 3L17A 2NQ3A 3W57A 2NCEA 1W16A 1DJIA 2CHWA 3N5AA 1WFMA 1W15A 3L4CA 3QK0A 4ANWA 4G11A 2YOAA 4TV3A 4KITB 4NPJA 2WXFA 3P2BA 3CSTA 3PFQA 2LHAA 4V11A 4A55A 3ML9A 3OAWA 3RPBA 2FK9A 1BCIA 2WXKA 3W56A 4TUUA 4L2YA 3OHMB 2KI6A 2QZ5A 1QATA 2N1TE 1UOWA 5CCJA 3M7FB 2WXJA 4FHKA 3QJZA 3TWYA 4ICWA 4AJWA 2RD0A 4OVUA 4TS6A 3SD5A 3TL5A 1HE8A 1TJMA 1RH8A 1YRKA 2CHDA 2ZKMX 3PYCA 3FDWA 4LCVA 4LT7A 3TJPA 1DQVA 3ZW3A 3IM1A 2FJUB 2WXOA 4FADA 2CM6A 3NSJA 2ENJA 3HIZA 1DJZA 1QASA 2YRBA 2CM5A 2CJTA 3FBKA 3HN8A 2ISDA 3R7QA 2NSQA 3JZYA 3T8MA 3MJWA 4PS3A 3CSFA 4ANXA 4EZKA 4PS8A 4GB9A 1CJYA 2K4AA 5H4ZA 2Q3XA 3HHMA 4F91B 4QAMB 2WXLA 4LDCA 5T8IA 1DJWA 4WAFA 4FHJA 4FJZA 4NP9A 4KZ0A 3F01A 1E90A 1E7VA 1A25A 4FA6A 3L16A 5G55A 3NZUA 2ENQA 3L13A 1BDYA 5CCHE 3R7RA 3PRZA 3IBEA 2CHZA 4Y1TA 3DBSA 1DJHA 2R83A 4URKA 3APDA 4QJ3B 1WFJA 4FULA 4IQHA 3F05A 2CHXA 4HLEA 2WXRA 3PREA 2Y3AA 4L1BA 4HVBA 4DNLA 1DJYA 2WXPA 3KWUA 2UZPA 1E7UA 4GNKB 5JHAA 4JPSA 3L9BA 2Z0UA 3QAQA 4IHBA 2DMHA 3L08A 4QJ5B 4F92B 1K5WA 2WXIA 2WXHA 2WXQA 5EDSA 3APFA 1DJGA 2D8KA 2EP6A 4NPKA 4WWOA 2B3RA 3B7YA 4XX5A 3S2AA 1DJXA 3F04A 4XZ4A 4FLHA 1UGKA 5CCGE 2Q0ZX 2K8MA 4ANUA 4FJYA 4L1LA 1GMIA 3NZSA 4BGDA 5G2NA 4AOFA 4QJ4B 2V4LA 3ML8A 2WXGA 4MJJA 2A5UA 4WWPA 4ANVA 3APCA 4L23A 2QZQA
chains in the Genus database with same CATH superfamily
1IBDA 4WHTA 4WI2A 2ITCA 2LE9A 4AGPA 2B9AA 2H45A 2F74A 5C0ND 4TVPD 3WEMA 2J44A 3I9GH 2Z4TA 1F8TH 3MBWB 4L8DA 3BD5A 1DN2A 3L3JA 4KMTH 3ZVVA 1WK0A 4F93B 4HUUA 1WHOA 2JELL 4MDJA 4F5CA 5H4YA 2FJFB 5ALCL 3AT0A 4HC1H 2UZIH 4K5OA 3K6FA 4HF5H 1OV8A 1U58A 4PJCB 4XBMA 4JZJC 1BIIA 3SDYH 1JRHL 2DQFB 2V33A 1F6FB 1RKRA 1WFTA 4WI8A 2GBTA 1JIBA 1R33A 4WI5A 43C9B 4EPSA 4GRMA 2EDYA 5LGHH 4QHMB 3VD1A 5TFSL 4Y5YA 4DPRA 1UWFA 2AP2A 4RBPK 5HVHB 3DX8A 4AMXA 3QQ4A 3M1OA 3GDBA 3S5LA 2D7TL 1BCIA 1XSIA 2XX1A 4YMPA 3OPZH 5F7YC 3CX5J 3IYLW 3VM5A 1X9UA 2FGZA 5I5MA 2VDKH 2NY5C 2UX7A 4ZPTA 2ZX9A 3JT2A 2BIPA 3PWPD 1AGFA 1XGYH 3ARBA 1HAWA 1P2CB 4HJTA 3JTTB 1YNKH 3TIDB 4LRIA 4XBPB 2VRAA 5HYJD 1C8PA 2V5RA 3NCYP 5HY9A 1SLXA 2Q86B 4QXGH 1TZOA 1DQMH 2G5BA 2NXZB 5GGVH 3FQ4A 4P0DA 1A9BB 3C8DA 4IBSA 4AIOA 5F7WC 2N7SA 4WU7B 1ERNA 2FD6L 1WWWX 1CFTB 3W9EA 4BFIA 5E99L 4JHVA 4OCMC 4HIXL 4Z7VE 5SX5H 4Y88A 4ETYA 1J7VR 3JWOC 4MWFB 4O5LL 4WAFA 1ETB1 3QPQD 5JHMA 3AABA 3GMOB 1UD5A 1FNGB 5B1BB 5D7LB 4OR1A 4HLZH 2JB6A 3UG4A 2UUDK 1GVIA 2ITDB 2PP8A 1LGVA 4BE5A 4CKVX 3N43F 2A9DA 4NIYE 4MA3B 5FW8A 1TU2B 3AG1B 3VMOA 1JE6A 1M6OB 2FWUA 3NIGB 1JHKL 4I4WB 2RCSH 4YHML 3CLEL 3FUNA 4V2CB 4DNLA 2GC7C 2WP3O 4F2FA 3EDEA 4XVSL 5CEYB 2MEJB 2OZ4A 1QLFB 3RAJL 4AV5A 2N0KA 2ZF9A 5EU5A 3WIAA 1CC3A 4C4BA 4MD4B 4CC4C 4WFHE 3FB8A 4LLQB 1QW8A 1NCCL 2EYSA 2XG5B 3O9WB 3S36L 4EOWH 5EUOA 1G6RB 3AS0A 3CLFH 2XT1B 3U48A 3DO4A 3TVMB 2DWDB 3FHQA 4AQAA 3S37X 5BMFL 4GKLA 1E27A 1KXQA 2ICEB 4JZNA 3SPCA 4HKXA 1IAMA 4N68A 3ABZA 3V5DB 3BQUC 1KN4L 3OJDB 1U8MA 2A0LC 2HPOA 2EDKA 1X4YA 2X1OA 1AR1C 5I1AA 2J6WA 3QXAA 2HUEA 3MLWH 2JJVA 2VLLB 1XEUA 2XWRA 5HHME 5TDOB 1NSNL 1WCQA 3STBA 4GG6E 3UTZA 1XWVA 2K3HA 5GRUH 1VEPA 4LOUD 1KACB 2PNDA 1U8NA 4G43A 1MHPL 2QGCA 1ES0B 3RHWK 5EF2A 4W6XB 5HHVH 5I75B 3FN3A 3L2NA 5BQDA 4K94H 4M5ZH 2F58L 1KTDB 5D7SH 1NAMA 2BSSB 3QT2A 1NCGA 1O7VA 2HZHA 3H6AA 3VWKC 4GXFA 3DPBA 4PTUA 2Q3ZA 5BZWB 5JORA 4RGOH 1UENA 2V7HB 2I07A 3BKCL 5GGRY 5LAXB 5K9OA 4DOHE 3TZVC 1MW3A 2Y07H 5T5FA 4GFTB 3T65B 1KLUA 4D9RE 4WHCA 4HWEL 3NJJA 5HJ3A 3J07A 5FIEA 5DD3H 3RNKA 3VGDA 3G6AB 2YPLD 3Q9PA 5T1KA 5FFGA 1OKEA 3JTSB 3MRBA 2DEYX 4XB3A 5EDXA 3LKPB 1IFHH 2IOIA 5EA0H 4LAJH 1PZUB 3CZFA 2LU3A 4HK3N 3BW9A 3SE4A 1V3MA 3DDGA 4PREB 5DJCA 5HYQB 5IMMB 3VYNA 3FFOA 4I0PA 2XVLA 3GXPA 5FYLD 3NGBB 4F2MA 4NZRL 1V3LA 4Z7VB 2UY7B 2V5YA 3L3HA 1I9EA 2HMID 2BVOB 4M7KL 1Z3GH 2WBXA 3QQ9D 1REIA 1UVQA 2FDBP 4L1BA 4E2OA 1RV6X 2JI3A 4GKNB 1KGYE 2WLLB 2VZUA 2OXGB 3SPIA 2NR6D 4NDMA 5IWLC 1AD9B 1HKLL 5IJDC 4ZAKA 3L08A 4I18A 4HEME 2IIJA 3AY4A 4O51B 2BCMA 5D2LE 4P23C 1R0AL 3BIBX 4M00A 4XX5A 5EOQL 3HAEB 3SE8H 1T7YA 3VXMA 2NY0D 1KELH 1J0IA 2BSTB 5D71L 4G6JH 2NNAB 4JRXE 4OGQC 1P7QD 3WKPA 2BVPB 4DGWC 1TJHL 1IAIL 3QNYA 5AWNL 3DHMA 4PLKD 5IQNA 3RX9A 4P5TA 1ETJA 4U6XB 4S1SL 3HAEG 2EDTA 2YAOA 3OKOA 1H3PL 1E28A 1S7VA 4W81A 4LPYA 3IPEA 2IOOA 4H5SA 4N0UA 4BE6A 4FQXA 5IW6A 5MP6H 4KXAA 1CE6A 5HJBA 2MNWA 4F8NA 4D94A 4UB0H 3E80A 2X44D 3DPDA 3VD7A 5KVMC 1CLVA 3GMQB 3EJPA 5T5NF 1IGCH 1MJJB 4G8IB 4OLWH 5ERWB 3TYGL 3P73A 3N5AA 3R4DA 3MOAH 1YN6A 3T4YB 3QDJE 4HSCX 5BRZE 4TYUA 5HHMB 4O2CB 2CBMA 4GG6B 4LPVA 3L3KA 3ZQ9A 1ETZB 3QIUC 4K2UH 4OKDA 4PCKA 3FQTB 3A4EA 2J25A 2NTFB 2DD8L 3IDYB 2Z34A 1ZMYA 4A7GF 2P5WE 4H1LB 4PV8A 4Y5VB 5CJ8A 2DQHH 4JQXC 1WS7A 3LMJH 5FKAB 2COVD 2VB5A 1R3HA 4XAWH 1TZGH 4P4KB 2XIIA 1HHGB 3HN8A 3OX8B 3VE0B 2EZ0C 5L88L 2O6EA 5KYUA 1N70A 1DQLL 2GJZB 4HUXB 1Y0LB 4LCWE 4FL4B 4U4BA 3EO0B 4DOHB 3L48A 1NDMB 5D9SB 4H1LG 4K8RC 4N5EC 3X3GL 1S78C 2OM5A 2WSKA 4IRZL 4XB7A 3MRLB 1BZOA 5EV7A 2J8UB 4QR7A 1I7ZA 1M1XB 3P4LA 1CLOH 3HZYB 3QUYC 3UTPD 4FFVD 2O5ZL 1BDYA 1G7IA 4PJ8A 1ZK9A 2O72A 4L4TE 3C5SA 3EBHA 4ZXBD 3V4UH 4WWKA 4OT1H 1XH3B 4ZFGL 1E40A 2W60A 4ZDHA 3G08B 2F0CA 5CZVH 1JERA 1L3NA 3CNKA 3K6SB 4AYFB 1W0WB 4LFHD 4R5VA 2X05A 2VC2L 5BXFA 5DK2A 3T71A 4J3VA 3TA3D 4RZCB 3G5YA 4A04A 1WE5A 2JXMA 4PJ9B 1GCFA 4QOKE 5GJTH 4EN3D 1X5LA 4TSAH 3OJVC 4AC4A 2Z7WA 2Z1PA 2NY3C 3IMUA 4JM2A 2CQVA 1RVFL 3CDGA 3DGDA 3M1BB 3ZKSD 3VFOA 2ATPA 5IB5A 2V17L 2X0VA 1HXYB 3B7UX 3MCG1 2B20A 1MVUB 5D2LB 2G75A 3WNKA 4A7VA 3QB7C 3RU8H 3FOLA 4PRID 1A22B 1T6BX 1CFSA 3HVDA 3GHBH 1PLCA 3FQ1A 3L9EA 4GEIA 4U2YA 5FYKD 4JRXB 4F8QA 2X1PA 1G6RH 2OZNA 2FR4A 2J2ZB 2Z4QB 4NT6A 5F21B 3S3SA 5JIMA 5TQ2L 3BAEL 4OFQA 4ZNEE 2BRQA 2CK0L 4AX3A 3D07A 4BK5A 2ICWJ 1HZLA 2GSGB 5C0AE 4IIQA 5HDWA 5IJVB 4LCCB 3VVVA 4EI0A 3QR2A 3LPFA 2X2JA 3ZL2A 2IADA 4N6RB 3D25A 5AOLA 4GKZB 4OJEH 2D7PA 1KTLA 4WUKL 4XPGH 1M2VB 5DJZA 5DRZB 4FXGC 1CF8H 1Q9OB 3FO9B 4KJQC 1CYXA 2AS5M 1ZHNB 3F5WA 1SHMA 3W56A 5DJ2A 3QCVH 1VPOH 1OAKL 4TUOA 2C7UA 1CFQB 3DX0A 3C5JA 5IJCC 3H7BA 3QORA 3N91A 4UAOB 3VCLB 4P3DB 2V7NB 1E6OH 1TIUA 4F7MB 4PJ7E 5CO1A 3QDJB 1FP5A 5IBLC 5BRZB 1QTSA 3O3DA 4O2EB 4Y1AA 2M8XA 4G7SB 4XBGA 3UGXA 4KOCA 1EDHA 1CDUA 1MF2H 2CM6A 2DQGL 3STZA 4PRHA 1U8IA 2JE8A 5AUMA 3KJ6H 3MPCA 3VXQA 3JZYA 2XV6B 2WOYA 4Y4HC 1IC5H 2EH7H 3C6LD 4UTCA 4JFED 1YVLA 3K8KA 3KLSA 2P5WB 3AQDA 4YR6B 2IGFH 1TPXC 4B9GA 1KPVA 3EXJA 1HSBB 2FEDC 4LF3A 5ABDE 4DEPC 4R4NC 1NMCC 2FRGP 3GS0A 4XVJH 5CEZL 1G1YA 3LV3B 1UH2A 1NBCA 1MCBA 1ZHBB 2LTQC 1JNNL 5IW3A 1F1GA 4HJGA 4N0YH 3TBCA 1AZRA 1SQMA 4KHTH 4YVNA 2Q7NA 4K5NA 4F9LC 3M17A 3APNA 2VLRE 3FUIA 4GXVH 2D3JA 1O9WA 3AREB 4QRSA 3QG7L 2A1WL 1T66D 3TGXA 4EKJA 7TAAA 3CPLB 4L4TB 4NQQA 3BH8B 1QSVA 1AQDB 3R19A 4M5SA 4ANUA 4FAAB 1MHHA 1HC1A 3GMLA 3U30B 3U0WH 2YPKA 1PLAA 2VMCA 4QOKB 1JGIA 4LSTL 4NHUA 2LT9A 3TBYA 4AKOA 1PVHA 3HAEH 4RX4A 3MRJA 4KQ3H 1ACZA 2K6ZA 4XVTL 5GGVY 2ORBH 4ALAL 3P3TA 1EZVY 4FFZL 3WJJC 1QUNB 3WXVL 3QI9B 3K4AA 2WIIA 4NQCE 2IBGA 5D5MB 1BFOB 2AJ3B 5I16B 5BV7B 4G42B 4NN7B 5K39A 3O2WH 1G9ML 5F3BB 3U0TB 2VERN 4P46C 2BSED 3ZDXE 2EE9A 1DFBH 4PWKA 5IF0B 3RB5A 4H4NA 5HYFA 1NUDA 5JR1L 3MRCA 5J13B 1A3RL 4TUKL 5C0AB 1OT4A 1D7BA 4L2YA 4PJGA 1MCOL 1ZVYA 5I71C 3GIVA 4K5MA 1IM3D 2QSTA 3NAAH 3P4OB 4ZMTA 3T2NL 1RULL 2GKIA 2DWEA 4UINL 3IMSA 2PMZA 4AQ8A 3KJ4C 5F6IC 5SV4A 3RWFA 3WTXA 1S9YA 3M6DA 1SXBA 2XHNA 2ZUQB 5HYJE 1HH6B 2PR4L 3V6OE 1UM5L 3IXAA 3RDTC 2QGDA 2ZX5A 3QFJD 3WUWA 4U0RB 5KYYA 4IDLA 2Z92B 1Z66A 4U1JB 4Z3EA 2OMUB 1FYTE 1ZHLA 4J4PC 4YDVA 3QAZB 4GIOA 4GMSL 5KBNC 4H1LH 1CFBA 1Q9KA 4JFSA 5I9QC 4W1TA 3IDUA 2EKSB 3LQAC 2PW1B 4B9CA 5SV3A 3P11H 4U1IA 1HS6A 3RGVC 4HOWA 43CAB 2WTPA 4OIIL 1A4JA 4LSSH 1A7RL 1SOSA 2UZXB 3Q48A 4WUUA 4U1SB 2VXVH 2VSKB 3KWWB 1HK6A 5EEXA 1ADWA 3HNTH 2WXRA 3OXSA 1Y6MR 1MVYA 4ODVH 4XCFH 4XX1E 1NUNB 4KDTC 3L4TA 4BDVA 3PGDA 1R75A 2GT9B 3H4FA 3V0FA 2EXSA 3L9BA 5E6YA 2H1LM 1BBDH 5GSVB 5AG8A 1OW0A 1T0PB 3MUUA 4IU3A 4HU2A 3FFCA 1S7SA 4I48A 3S2AA 2XFXB 3UYRH 4LCIH 1HKFA 1WAAA 5D7IF 3VWJB 1RIVL 3FNKA 3PNWB 3RA7H 1PDKB 1KJ2A 4PYGA 1U8OB 4QO1A 2VLRB 4MJID 4WWPA 1FZMB 2WMPB 4YHKH 4AUUA 5CWSA 5H37A 4RMTA 4TQEH 4G6MH 4ES8A 5ICXA 1K6QH 3BSZH 4W93A 3PU7A 1RMFH 1B3IA 3B5GA 1NGYA 2OAAA 4FFWC 5DA4A 2ZJSH 1MJ7L 5I0VA 2Z1KA 5GS1B 2K70A 5EUKB 3B7RL 4PVMA 4Z3TA 2JVUA 3NRFA 1OOWA 2C3XA 3N1PC 4J3OF 5T3XD 3T77B 3NACL 3MNVA 2FO4B 3QJFB 1WZLA 2HFEA 3O11B 1VKXB 5IP4A 1JTTA 3O2VL 4LHJB 4BCZA 1DL7H 4HUVA 5ESQB 1USQA 2LLNA 2QHLA 3DX9B 4QF1B 4WI0A 2FEEI 4UOJA 2MCPH 4FQHA 2NY1B 4NQCB 4ODTL 3QJHA 2BM3A 2H1XA 4GUPA 1NCWH 2PXYD 4QXUL 4FX5A 4N22A 1S8DB 1WPCA 3ZDXB 4U1MB 3TH3T 1U91A 2X4SA 1JS4A 3IDXL 4L5FE 5EFIA 5K5YA 3CV5A 4HCRA 2FX8H 4ZFZA 4XPTH 5DZOA 1MHCA 1AO7A 4LNRA 1MIEH 2WKOA 5HVFB 2ZCHL 3OC5A 2F54D 3D69A 4NSKA 2YOCA 3C2AH 3BWUC 1CL7I 4ONGL 4QTHB 3KW8A 3BZ5A 4D3CL 5C7XL 5SWSA 5BQ7B 2GW5A 4QY8A 3LH9A 2YPLE 2EE6A 1AQ8A 4JKKA 3KAAA 4KX8A 4QAMB 1X5JA 2J5LB 5HYJB 2JSFA 2B1AH 3IMRA 1A1NA 3MRIB 4FJZA 4GI8A 4RDQG 25C8L 4QYOA 4D9LL 3G9VA 3ILPB 3NJVA 3KZ8A 2QQKL 4W9IC 1NBZB 4MMXB 4E42A 2OR9L 1FYTB 4KWUA 2NYYC 5FYLE 4HAKA 2YRLA 2A74A 3F05A 4NQVB 1IGIH 2KS0A 2B1HH 4YSPA 1QQDA 1ZANH 4DETA 3LNGA 2VLJE 3WLWC 5MHSE 1UQSA 4OZ4B 4AENB 3QUXA 1T5XA 1YPZF 4G6AD 1NFDF 1T0NB 5F71A 1TYRA 5ADOH 4ZOAA 1JWSA 2YGQA 1JV2B 1ZV2A 2VCOA 1QX1A 2P26A 4RRPM 1C12A 1M7IB 3MYJA 3OKMB 4ZMVA 3P77B 4YJZL 4I3RH 4LLVA 1PJWA 1TCRB 2EDHA 2WZPD 3UEZA 3IVKB 2BHZA 1Z7JA 1IRAY 2CG9X 4N2EA 5FAAA 4L8SA 1DDHB 1GC1L 4ZZFA 3EOTL 3EKCA 4W9FC 1F3DH 3RIFF 4XX1G 2FJHB 2YPVL 2JCCF 4KK9D 4JO2H 4Z7UF 1AGEB 2WD0A 1KNOA 2G9HA 3LKOB 3MRHB 3EYVB 4HKJB 4PY8I 1DBBH 2ZP9A 1LNUB 1EMTH 4H0IA 3VJ6A 4PV9A 5E8PA 1K2DB 3W39B 2EDLA 4Y16B 3MKKA 3V0JA 1L9RA 4CMMA 4RAHA 3NTCH 3WTUA 2AVFA 2VYRE 4FXTA 3V5KA 2SEBB 5BV7H 1DBJH 1AGCA 2FSEB 2XN0A 3P4NB 2WYIA 3OZLA 4XN2A 2EECA 3B2VH 5L8JB 4XXDA 4H25B 5BW7C 3A6BH 1BVNT 1B0GA 5DJXA 5EIIB 3BRGC 3PQYD 5BJTA 4XTRC 4BXVA 3EYOA 2RD0A 3T0ED 5JW5A 3K81A 3L7FB 4MCMA 5F7BA 2DWXA 5LN8A 4Q9QH 3H53A 2UWEA 4WW2F 2V3FA 4ODSH 4X6DE 5HGHA 3AGWA 4AL8C 1RJCA 3BKYL 1IQWH 4S11A 1ZTXE 1YECL 3VRJB 4K3JL 2YQGA 3J27A 1I1AA 1JVOA 3PIQB 3FN0H 5I1EL 5KAQF 5IESH 1S5IH 1L0PA 3F7YB 3KL5A 1U8LA 4NAMA 4WFFE 2HWZH 4ZO6A 2Q3XA 4Z95H 2YBRA 5EIIG 3U9PL 1BOYA 4YX2L 4U6VH 4MA7L 2ZD0A 3T4AA 3SODB 3WNOA 5IB2B 5IBTL 1J0ZA 4CILA 3U46B 4NP9A 1XCTB 4EXKA 2VE6A 2VABA 3PJSB 5EO0A 1EAQA 3UJIH 4W6WB 4FNPA 1WFOA 3W11C 5GIRA 2K7PA 1NTDA 2YPLB 3SCMD 4A6YA 4DP0X 3MRPA 4BEIA 1L0XA 5C0CA 1IBGL 5CM1A 4YSRA 3CSYA 1IV8A 4NKIL 2I60L 4YHZL 1H5BA 1FFRA 1EHAA 1H3UA 3ECBA 3ZHNA 4LLMB 1CXIA 4X6CA 4XO3A 4Z77A 3HZ3A 5GS0H 1CVSC 1NGZA 3SQRA 4OCSL 3D12B 2VDQB 1KXVC 1DLHB 1R5WA 4IRSB 5I8CA 3D9AL 4XT1C 4I77L 1RZ7L 2HRHA 4BCXA 5LGJA 1MOEA 1GGIL 1RUPL 3W5NA 2VLJB 4HKBA 5I6XC 4ONHB 2FIKA 3C60C 2CBOA 2YK1L 5I5IA 2VWEE 1ACYL 3WN5B 3UBFA 3K72B 1O9VA 3DOIA 4EMZA 1AG6A 2OW7A 1FC2D 4GBXA 3R06B 5E8OB 3MJ9H 1VERA 3EJTA 2NY0B 1MQKH 4DK5A 1TJXA 3WLBA 1P7QB 4NRXB 1NWPA 4ENED 2XPGA 2YMXL 2OMBA 1MFBH 2ZF8A 5DUPH 4HCGA 5CGBA 4G5AA 4RAVB 1IKFL 2LLGA 5IVZA 3WTWA 2ZX6A 3DMMA 2Z7YA 5K9QI 3FCSA 1VRSA 2IALB 3MLYH 4MQTB 5D1ZI 3L81A 7CGTA 1SEQH 5H35A 5C0BA 4OQTA 3SY6A 1ZV5A 2ZP8A 5M7QA 1JGEA 5E5MA 5KVFL 2NZ9D 4PVBA 2XZQL 4UWQB 4LCYA 1AXIB 1JGDA 4X4YA 2OMNA 1HL4A 1NBVL 4AIXA 5FFLA 5L2KA 1GTFA 3QEHA 1RZ8B 4I3GA 3BMVA 1S9XB 1JCVA 1IAIM 1S7UB 2VXTL 4G6FD 3OXRA 4MQXC 3GMRB 2X53A 2HVKA 4O4YL 5JW3H 4AY0A 4LT7A 2XXGA 3FCUB 2FL5A 5EIQA 2CK2A 5E4EC 3QQDB 3KDMB 3PL6D 1CZ8H 2OR7A 3B6SA 4NO0A 4LSRL 5D70L 2IH9A 5JNYA 2EYTA 1E5ZA 3NSCA 1CR9H 1EX0A 3QRGL 1FO0B 2QQLH 2VLMD 3LXBA 4JFEE 5D2NA 3HG1D 4M56A 2X4UB 2D7QA 3KM1A 4X6DB 1XR9B 1XAKA 4M61B 1IU1A 1S7WA 2WK2A 3QWRD 2XJKA 1BBJB 2VMEA 4RWHA 3UEQA 3ASOB 1C08A 4EIBA 4PJXA 4U33A 4YDJB 3R7RA 3MJ8B 4Y8DC 3NVQA 5F1IB 3RI5K 1KLFB 1B4LA 4NQDD 5ES4B 2C8NA 1OD7A 3FO1B 1UD2A 3ARDB 1GMEA 3LKNA 1G43A 4FNLH 4HZLA 5ENWB 5DCCA 4JFYB 5C09A 3W0WE 5E8EB 3WFZA 5AVVB 1QZNA 1E3XA 3QRBA 4GG8B 4G59C 5D4JA 5FXCH 4UOQA 4FMFA 3ARGD 1Q90A 2OR8A 5GZND 5E5RB 2CUIA 1AI1L 2OYLA 4P5MB 3GSWB 5GHWH 3F04A 1JPGA 2YKLL 4Q97A 4YLQT 2GY7B 4KO5A 1BQHB 5AQ0A 4U3SB 1VENA 3VFWA 3ALXA 3APCA 1HCVA 1E30A 4NM8L 4HWZB 4JPVL 4NJ9L 1CFNB 3VFGH 2NNCA 2ERJB 3OTTA 2WSDA 2HCZX 1I9RH 1RZFL 4DCQA 2ZCKH 3ZL1A 4BYHA 4QRUA 4D0CB 3CX2A 1KPRA 3HLKA 4PRDA 4LVNC 4WHYG 3T0DA 1BQHG 4NCC1 3BGMA 4JDEB 3KWTA 3DUSA 5DFVD 2I9TA 2XQBH 4X50A 3QIBD 4AEFA 3UAFA 3FT4A 5IOPB 5FUOL 1V8HA 3GSXB 1VESA 1CK0L 1T21B 3IJ9A 1OHZA 1WFNA 4YPGB 5CJQL 3KPOB 3QUHA 4KQ4L 4CSZA 2OTUA 4TNEA 5CXPA 3WHXA 3GMNB 3ASWA 3FRPB 4AWJC 1B6DA 5I18H 3FB5A 3MXVL 3NCYS 1EZVX 4GS7C 5EC1B 3Q2VA 4I5BA 4IK6A 4XCEA 4AVIA 1JGUH 3FRUB 4IGBB 2Q76B 4ODHL 2BMKB 3B1TA 3V0EA 2R0KH 5ILTH 3O6FB 4DGYL 5L4JA 3ATBA 4JPKL 1DJSA 5EORH 2HJFB 4FFYA 3SJVA 2FQDA 2YIHA 5IHBA 1A3QA 3UBXG 4LRNH 3FRPG 4JNXA 1KV7A 2DYPD 3BT2H 2JTDA 4B9PA 5DQ9B 1K5NB 3IXTB 1T0MB 3C12A 4HFWB 4GRLD 2F1BA 3GSUA 1BZ7B 3Q43A 3QFJE 3PDGA 1KFGA 2GUOA 3I9GL 2YAHA 1QLRA 1FFQA 1OCZB 2AJXH 2IFFH 3FJTA 4KMTL 4G8GA 3LNEA 3DO3A 3I9AA 3II2A 1IGYB 1T5WA 4HJ0C 1LO5A 2GAZA 1SHXA 1EAJA 4HC1L 4UOW1 1BWWA 2FECL 1HSAA 2UZIL 3OC8A 4HF5L 4Y5XC 5F7KC 3W37A 2P49B 4OFPA 3SDYL 4V1DD 4JFEB 1I7UA 1T80A 4P2QD 1TEGA 3Q6FA 3K6NA 1F02I 4CC4A 1JPFB 2KUTA 5LGHL 1A6UH 5H94B 4B50A 1SXCA 4U1GC 5C0DB 4K71C 4KVPA 4KKBC 4L8DB 2K9UA 1K5WA 3JBG7 2X87A 4BZ2H 3GBEA 1KYAA 1JI1A 2KERA 3OPZL 1KIQB 3GRWH 1KBVA 2FJSA 2VDKL 4IMLB 1UT1A 3TA4D 4KI5F 1M71A 1XGYL 5L2JB 2BOCA 2ZG1A 1U8CB 1YNKL 3DV4A 3W0WB 3PP3K 1N67A 4BJLA 3DC0A 3OPUA 4NXKA 4QXGL 1DQML 4GRMB 5GGVL 3OF6D 2VDQH 4Y5YB 3S3PA 3MSPA 5DC9B 4PJCF 5FYLH 2Y6SD 2CBTA 3BPOB 3EO1A 4JRWA 3CHQA 4JG5A 1RZGA 1DE4B 2OSWA 3QEGH 4KHXH 1F5WA 1QSFD 3QFDB 2OMTB 4FYSA 4ZPTB 2AKRA 1LD9A 5F9JA 2Y5EA 2IJ0C 2IAND 3GJFB 4K94C 4WVRA 4XWOC 3CTTA 2E3VA 5DHVA 5HY9B 4LL9A 3MRFA 5JPMB 2RCSL 3VWKA 2G5BB 3DO7A 3DOSB 2H26A 2X4RB 5CKAA 2MQ0A 3TS8A 4MAYA 1GZHA 1ROCA 2B16A 1IJ9A 2MPAH 4PUBH 5ISZE 1MCWM 3CN4A 3OKDA 3VFPB 1I53A 4HIEB 3HMXA 3LH2H 5B1KA 4TULH 3F6IA 3TZVA 1VFBB 4ZJ9A 1CGSL 4IHOB 4NQUA 4EOWL 4IIZA 4Z7WA 4WO0A 1PZ3A 1OF2B 2ALWA 5JXEA 2WVTA 4NLHA 3CLFL 1H9VA 2C9UA 1OM9A 5IEKB 3AM8A 4YSCA 4M8VA 1YDPA 5LUMA 2FBJH 1NM4A 5JW4R 2QADD 3KHOA 4PGBB 1WIOA 4CU8A 2QHRH 1MWOA 1SPDA 4U1LA 1IM3B 4NBZB 4QHLA 2K4AA 1WICA 4R97B 5C9JA 3QRLA 3MDJA 4OIAA 3ESNA 3WXWH 2FH6A 3MLWL 3NEEA 4GO8A 3IDJA 4CUCA 5DO2C 4U6YA 4X0NA 2P46B 4KKAC 5DSCB 3OLEA 3STLA 1R3KA 1A0QH 1BVKB 2R0WH 3D5OF 3ULUE 3CAFA 5GRUL 3OHXC 3QFJB 1LTXA 5GS2D 5K1NA 2V2TA 2M26A 4AQAB 5IWLA 4IOSD 1FO0H 4HPYH 4AQ1A 1W0VB 1N3NA 1HOCB 1LEGB 5HHVL 1PFCA 4GUCA 1EH9A 4K94L 4M5ZL 1GSMA 2AXGA 5D7SL 1ZTXH 1KIPA 4WI4A 5F7MC 1M1SA 3VMNA 3QXAB 1S2EA 4ZO9A 4J8RB 5LGKA 5A16B 2OMXB 5FW7A 4EI5D 5L9DH 1C9SA 4H20H 4RGOL 4LGSB 2ZCLH 4BBWA 1QEWA 4FG6D 2YQ2A 4JHWL 4Z7NF 1A6PA 1UXWB 2EC8A 2Y07L 3OKEB 1OLLA 5E6ID 1RD6A 4AM0A 3KPMB 1AXTH 3US1A 5DD3L 1J1PH 3K2UH 3DIFB 4F3FA 2NOYA 1IC0A 3AQYA 5GGTH 4GIPD 1USZA 2E6PA 4KC3B 3O4OB 1FRGH 4ZUVA 4LESA 4W9LC 2DLFH 2VR3A 4WHYH 4XXCA 3B9DA 2C9VA 3BSGA 4KY1H 3ZE1E 1IFHL 3MCLH 5EA0L 1S5HB 4M3HA 1LMKA 5CUSL 2EUWA 4L1TA 5CP3H 4H8WC 1A7NH 2H5UA 2CIIB 3N9GH 4HZAA 4ZOEA 2JJTC 3EFFB 4GFXA 3JWNE 4IRJD 3UFIA 4UNUA 3IT8D 3OSKA 4TL4A 1Z3GL 1JPEA 2B5IB 2IC2A 4TNVK 4WTQA 3CFDA 1ZWIA 2WHVA 3KYOB 2CRYA 5D7JC 3SDDC 4LP5A 3T0XA 4Z8FH 2Y7MA 4FXKB 1D7CA 2UX6A 4DN4H 4NO3A 4YFLI 3SE8L 3SDAD 3EJCA 3C6SB 5I17A 1KELL 3NSYA 1BAWA 2X12A 4G6JL 5I19H 3PQYE 3FUHA 4I0PB 1PTZA 5F9OH 1PZAA 4HK0A 1TTRA 3T0EE 1A4CA 4HJSA 1MCQA 3RZCB 5ISZB 5AAWA 1GOHA 3RFZB 1GPOH 4S1DC 1O5PA 4F2MB 3WNMA 3LKQB 5AB9A 1T7VA 1EEUA 3SY0B 1J87A 1TCMA 2OMYB 1AD0B 4NDMB 4ZAKB 3FFDA 3HPJA 4Z7VF 3SDCA 3KXFA 4UT6H 5MP6L 1X9QA 3NSDA 2FX7H 4UB0L 4UMGA 4KKCC 3GIZH 1J9SA 3OL2A 4UNTA 1IGCL 1UJ3A 2Y1YA 3B2MA 4FQPA 4X98B 4OLWL 5C71A 1UWYA 1FGVH 4URKA 3TBVA 4KMQA 3MOAL 3VA2C 2Z31C 4YHLH 1KGJA 3CSBA 4U0QB 3DGGA 3KBEA 5IMOB 1IAKB 4ZW5A 4TLTA 2VAAB 4KUCD 3MUJA 4K2UL 1CE6B 5LXGH 2A6IB 2Q6WB 3O8XA 5GQBA 1RPKA 1IQDB 2ALAA 4FNQA 4L9LC 1SNRA 6FABH 4GO6B 3GRBA 4FTVA 2P5EA 5DC4B 1Z2KA 2DQHL 3A23A 2MCAA 1KIRA 3LMJL 4B95C 2C34A 4XAWL 3IB4A 3ZTNH 3QNZA 4BSWB 5JA9A 3G6JE 1TZGL 2WC7A 3FH7A 1FLTX 3BAKA 2VZTA 2O61A 1NFIA 2RMNA 2PABA 5JIPA 5IB3B 3C9NB 2D31B 4OJYA 4M6NL 4HV8A 4OLEA 1AYOA 2LOEA 3AJ7A 2MFNA 1BFVH 2TAAA 3HI5H 4PSRA 4C57C 4EZMA 1F56A 4LP8A 1CLOL 3HRZC 1T04B 1MXDA 3D30A 4CMHC 2DMGA 4N2CA 3GS7A 1D3CA 1Q4NX 3BZ4B 4DZ8A 2GQHA 4LCUB 1G7JA 1CMOA 3V4UL 3ZE1B 4OZGA 4OT1L 4YO0A 3KPQB 3MNWA 3RRQA 5JMRA 4JG9A 1TQBC 5CZVL 3LRMA 1T3FB 2PYFB 1ZXQA 3E6HB 1IL1B 4UDTA 3ZGIA 1IT9H 2BWDA 2A6DA 3GJFH 3LRKA 4CGTA 4ABWA 5KBPA 5GJTL 4Z7OB 2Q5BA 1X4XA 3MV9D 5GSRA 1T1WA 5AAPA 4TSAL 4ELDA 3MBEA 1AHWB 4ZMNA 1TVDA 5E6RB 5JOEA 5D1ZB 4FFZA 1RH8A 5F89A 4LU5H 3PYCA 4PJ8B 1LEKB 2DL9A 3QEUB 4MJ5B 5B4MD 4M8QB 2DQDH 2J88H 5JW4M 2J8UF 2W60B 4CW1A 3RU8L 5D6CA 1P7KA 1EZLA 2FYYB 5J8OA 3HG0A 3JWNG 3GHBL 3VFTA 3TN0D 9CGTA 5FHBH 2P3YA 5E4AA 1SGKA 3PQYB 5K9QG 5BXFB 1G6RL 2VLME 1QPKA 1JF6A 1MN4A 1PSKH 3T0EB 3VFVA 3CUPA 3VXNA 3HG1E 2WYTA 2YZ1A 4JFFD 4LB8A 3FL7A 4MB3A 5T8IA 1B2YA 2WOBA 4N2GA 2QPFA 1FL6B 2GABA 3BO8A 3HE6B 4M62H 3F7PC 4A68A 4F9LA 2PW2B 3FCTA 4CGUB 3HE7D 2WANA 2OZ4H 4HH8A 1FLRH 4UILH 1D6EB 4YDLC 4WEMB 1KYFA 2CR0A 3BFQG 3V2AR 3DUUB 2YGVA 4XPGL 2CDEB 5DS2A 2HTKD 5EPMA 4GEJA 1CF8L 1KXHA 2ZYHA 2EDWA 4O2FA 4PJHE 4Y9CA 5J11C 3VI4A 1BD2D 3AMLA 4D7BA 3QCVL 1VPOL 2BWIA 2WKLA 1ZA6A 4BWUA 4G2AA 1CL7H 1HNGA 3DURB 4FQ1H 1CD0A 1E6OL 3KD4A 3TCXA 4EN2A 2HFTA 4IIQB 4UT9H 2AV1A 4XN4A 1TTGA 4W4OA 5KSUB 1UXLA 2A5UA 3ILEA 2GI7A 2ZKHH 3QUKA 3QWNA 2HG5A 5FGBA 4OM0H 3S3BB 1MF2L 5D1QD 2HG0A 2OJZH 4DO5A 4ZMQA 3KJ6L 1J1XH 3OB0K 1EA9C 4MMYA 3A4AA 4Q0XH 3RVWC 5AKTA 3WJJA 1XR8A 1DVFD 1IC5L 2EH7L 5LVEA 1CDGA 4JUTA 1GS8A 2IGFL 3B83A 1E5BA 1LEIB 3KM2A 1ZT4B 1CE1H 4Y2DA 4P46A 4IOFC 3FO2B 5KVGE 4WTZA 4HOXA 3G6JB 4UQ9A 1V10A 3L3IB 5HJDA 4PRNA 1WC7A 2QMKA 3WO3B 3BWSA 1IZKA 5E7FA 3P9LB 2CJUH 4UM8A 4XVJL 2ZOTA 3IU3B 4OFYA 3PHSA 4KRLB 3FHEA 4C83A 4GI9A 4DN3H 5AYTA 3W9DA 3UH8A 2VQ1A 4N0YL 1T1ZA 2R1XA 3VXQB 1U33A 4KHTL 5HPMA 2R39A 1J5IA 3MRKA 4GXVL 4UM9D 1R17A 4ZMAT 4F8TA 2BVQB 4DVBA 3BP7B 3BD4A 2RH0A 5FWQA 2XUWA 1A5FH 1B4JH 2JI2A 3CZUB 1XFPA 2NQDA 4Y4FB 4JG0H 1BREA 3U0WL 5TF1H 2I27N 1E4JA 1YHPA 2JKNA 1I1RA 1NWOA 5I24A 2EEBA 4PBXA 3RIFK 1A9VA 4MNHA 1M7DA 4KQ3L 1I7RA 4G6FB 4NKOA 2CALA 2Y5TA 2F9BT 4I2XA 2ORBL 3LDBC 1QD0A 4CSPA 2GHZA 3GLAA 1FFOA 2PWFA 1NUGA 1EHNA 5DQJB 4MMZB 1M56B 3AU1B 3O2WL 1UT9A 4X7CC 3IBEA 2IXQB 3H9ZA 1BG1A 1D5RA 2KLSA 2D03L 1QP1A 3UGUA 4DT2A 1DFBL 4WO4D 4V1DE 1E65A 4AH2A 2YPKB 4GW4A 3RVTC 5IB1B 3HG1B 2NXYB 1YYMH 3DRTA 2FWLB 1I3UA 5KS9E 3GBLA 5AFAA 5DMKB 4HHAB 1KWKA 1NDGA 5J7CC 4WW1B 1L6XA 3GSNB 5HGDA 3UOAB 2XWXA 2BP3A 3DJTA 3NBNA 1R34A 2V9QA 3QSKB 4AC2A 3NAAL 1D5BA 3VO0A 3WFDH 3CFEA 2Z8VC 3BN9D 5AZEH 1SYSA 1D9KA 3QE5A 2XN1A 4JRLA 4PRPD 1T1XA 5HD8C 2K6WA 1MIMH 5D5MF 3ULUH 2Y9RT 2NZIA 4LPTA 4JY5H 1ZS8A 4OAWB 3QH3B 5EEVA 4X5LA 1HVXA 3MVSA 3ARFD 4W9EC 2BXZA 3VNZA 3QZNA 1CD8A 2QR0A 1NCDH 5J9PA 3FSOA 1PYWB 5C07D 4KKLC 5SWSE 2WQUA 4JHZA 4KKNA 2FLBT 2Y22A 3P11L 3MRDB 1NBYB 3PWVB 4LEBA 1NGPH 4XMLH 4QNPE 3UAAA 1XF3B 4LSSL 3J7HA 1I8UA 1XGTA 2GFBB 1H15B 3O4LD 2VXVL 2E7DA 3K46A 3HNTL 5EOTA 4PJ5D 3W2DH 3H2WA 3Q5TA 4K9JA 4LVOC 4ODVL 4XCFL 4Y89A 1BGXH 3FCBA 1RUQH 3GMPA 4N0RA 3WNIA 4ECNA 3OAWA 1ZHLB 1BBDL 2P8LB 3IJYB 2QKSA 4F15B 3LS4H 1Q9KB 4NO5B 2N1TE 3NJMA 1MI5A 1EAPB 2FAUA 4YAQB 1CG9A 1KGWA 1TZHB 1BM3H 3UYRL 1FHGA 4LCIL 2YPVA 3DUHA 3SDXE 4F20A 5MENE 4JK0D 3RA7L 3W82A 2WAHA 3HZMA 4XPBH 2E75C 1YMMA 4ZFQA 2ADJA 4OFVA 4YHKL 3MNZA 3OXSB 2XV2A 1V55B 4TQEL 4NAQA 1N8ZB 2JIXD 3OKLB 1KCRH 4G6ML 4M1CC 5T1MA 1K6QL 1R46A 3I9IA 3TYFA 3BSZL 3JWNH 4BDVB 1JF1A 1RMFL 5D96C 3ZE0F 4YEFA 2E9GA 3O3BB 5DJDA 2GJ6D 1BHGA 2ZJSL 2JK5B 1CXHA 4NRZA 5JZ7D 1NDTA 2BHUA 3IDNB 1UATA 4LK4A 5F7HA 4I48B 1JOIA 2W07B 1SVCP 4K4KA 5GGRA 1KIUA 4Z9KB 5HHPB 3GRGA 3F7VA 2IPTH 1GGTA 4KROC 1KJ2B 2Z9TA 1I8AA 1O6TA 3RBGA 3DYMA 3D0VB 3DETC 1J9TA 1DL7L 5KN5A 5SX5K 2BCKA 2UXVA 3T5WA 5CLZA 2MCPL 1A65A 3NK4A 1OP5H 1NCWL 2ZUTA 1K4CB 2XNAA 1VFMA 2EICA 2RR3A 3FQXA 4OM1H 4B0MM 2D7MA 1F4WH 3F84A 3MGOB 1II4E 3QIUD 1AGDA 4HPHA 5GGUB 5B8CB 5CS7A 2XCMC 3TESA 5C0IA 2FX8L 2CCWA 4XPTL 5TF0A 3ZQWA 1NGXA 1MIEL 4U1HB 5KS9B 4P2YA 2G9KA 1T0OA 2DLTA 3C2AL 4HUVB 4DPAX 4JAMA 4KVNH 4BKLA 5K9KB 2VSMB 1EAOA 4L0PB 1XIWC 1OGTB 2AXWA 4J27A 5D7IA 4X80H 4KO6A 2CU9A 3B37A 4L37B 4J2QA 4Z6AT 4ZUUA 1C5DA 5F7DA 3GB7A 2O26U 2D4DA 1J8HA 3QXDB 4NS0A 4E9TA 4ZMXA 1HHHB 4NRYA 2B1AL 1BYOA 3I6GA 1Q9WA 2NDFA 4XN9A 3BT0A 1JFQH 1QHOA 3CPUA 2GK2A 3ESVF 2JCWA 1LDSA 1OK8A 1QMUA 5ABZA 1TF4A 2IAAC 1X6NA 3D69B 3WHE0 3ZDXF 1INQA 4H13C 4Z5RA 1DBMH 1MUJA 2CD0A 5E1QA 3G04A 2UUDH 1ZLUH 1IGIL 4P2CG 2B1HL 3SHSA 3EJJX 4P57B 1C16B 2ZP0T 1ZANL 5SWSB 1CI3M 5MEOA 2QPEB 3CSTA 1BAFH 4Y2OB 4RDQF 5AL0A 4ZX6A 5HI4D 4IKJA 2H0JA 4IMKA 4KUCF 2CH8A 5ADOL 1ZAGA 5J13C 1LHZA 1JXFA 4MZIA 5IG7A 3G3LA 1W91A 2EC9U 4XNMB 4ELMA 2R9HD 2CO2A 3ELAT 3X14A 2FB4H 4JN2A 4X7FC 1JK8A 3FONA 5K9JH 2JV6A 4FLQA 4JEGB 4I3RL 4FADA 2YLKA 2MJWA 4HIJA 1WFIA 1QTYT 2J56A 4BM7A 2CJTA 3H9HA 5DEZA 3TONA 5JPNC 2A38A 1PIGA 5EU3B 3ARBD 2E76C 2PYEE 4YSQA 5IROD 1QFOA 1G4MA 2VJ0A 3QIWD 2WVSA 4APQA 4B3EA 5MENB 3SDXB 3RWJA 1MFVA 2YEZB 5FFOA 1Q94A 3L3DA 1WBXA 3WJLC 5DMGC 1MCLA 4MS6A 3WD5H 3ZZLA 4GH7B 3CZEA 4JO2L 5DVKA 4MD5A 1QSEA 3QAZC 1ZE3H 3OV6A 2QADB 3AQXA 2XXMB 4NQTA 5DFWH 1CCZA 2WNXA 1DBBL 3P69A 2E7BA 3ZRFC 4N0FA 1EMTL 4TN9A 1GGBH 1R3LA 2BSRB 5HGBB 3CFBA 1NQBA 2IPUG 1BPLB 3BCFA 5DVLA 4FGMA 2AZUA 1UB6B 4ETQB 3NTCL 4JB9H 4CKQA 3VD2A 2WBJC 4XNDA 3T6QC 5LBSH 4HBQA 4L8SB 5AKVA 5ESAA 2WQAA 5BV7L 5D4IA 3CG8A 1DBJL 5INCA 4KJYA 1LK3H 4YFDB 1CGUA 1UWEH 3VXRD 3B2VL 1IEBA 3A6BL 3KPPA 3MV7D 1TO4A 4I89A 3X1FA 2XKUA 5I1LA 2DQCH 1U36A 1J0JA 1FIEA 1L7IH 3MX0B 1YPZA 2ICCA 4ZS6D 4Q9QL 1A7PH 4ODSL 2QL1A 2DOCA 3H9SD 1JZHA 3GSNH 2CO7A 1IQWL 1U2YA 3UZVB 1PLGH 2IWGA 4JREB 3TJHD 2ZTBA 3FN0L 4EI5B 5IESL 2BFVH 4WFGD 5F9DC 1YSOA 1TVBA 1ND0A 1S5IL 1CDHA 3TFKD 3PPSA 3SE6A 1BF2A 2HWZL 1AGCB 4Z95L 3KH3A 3GMMB 4U6VL 1JFHA 4QD2E 2FEDD 1IAOB 3HB3D 1BOGA 4R4ND 2YMTA 5I66A 4CNIB 3IKCA 4JVUA 3UJIL 3BZEA 1JK9A 1S7RA 5AOIA 1SN2A 2BLFA 4QWWD 5HGHB 3D3VD 1QLEB 2XRAH 3FMGH 1IILE 2IPKA 1EPFA 1I8MB 1I1AB 2YOAA 1CGYA 3QHZH 3BIKA 5KOMC 1I85C 3GM0A 4LGRB 2FK9A 2G2RB 2AK1H 1T7WA 4PGEB 5FO8B 5GS0L 1EZUA 3V4VB 3SE9H 4J12A 1BWMA 3QZWA 3V0WH 2X89A 4XCNA 2GTWA 3ZMEA 4HJJH 4KO7A 5KVGH 5HHQB 3RY6C 2EEXA 3ZDZE 4YHNA 2OQJB 4PGZA 3FQNB 5ELIA 1YMHA 3QWQB 3ULVF 1Q9LA 1YEIH 2EYRA 1F42A 1NH6A 1R19A 2VN3A 5T1DH 1P5UB 4CBPA 4HULB 3MBXH 1H5BB 3MJ9L 4ZI8A 4NOFA 3Q05A 1MQKL 3HHMA 3DOHA 3LY6A 4WJ5B 3LPOA 1VDGA 3QULA 3WEXA 2HLFD 1MFBL 5DUPL 4GAFB 1KWGA 4JO8A 4XGZB 5T1KD 2J1KA 4JGNA 2J6EH 4HKBB 1XX9C 1RSFA 1IC1A 2PYEB 3W81A 3MLYL 2FIKB 1SEQL 2EAEA 3V6OC 3DLQR 4QT5B 5FK9B 3SKMA 1BMZA 2AQQA 4MMXC 1DJYA 5C7ZA 4GBXB 5ICUA 3FU6A 1OZUA 3L3OB 1TKWB 1T7ZA 3SN6N 2JKLA 1BD2E 2ZUUA 1KJ2H 2H3NB 3VFNB 1CBJA 3QPQC 3D48R 4H8HA 3UTSD 4KGLA 2Q0ZX 3CVIH 5JW3L 4GAYB 4Y9EA 1YNTA 5GS3A 4BRVA 4XO8A 5FA3A 5C0BB 4HC1A 1UZ8B 2AEQH 2MOQA 1CZ8L 2R2EA 3VXMD 1OGAA 1AS8A 3L54A 5D1QE 3RGHA 1CR9L 2XBZA 1FFTB 3Q8CA 2QQLL 3GPEA 3P3SA 5IVOA 2WQSA 4M02A 1FH2A 4Z7QF 2RAMA 3FT1A 3MUGB 5F9WC 4TLSA 1U8KB 3NESA 3K3QA 5L2KB 4QRRA 4E9XA 3T3PB 4CU7A 5GRJH 4P5TD 3SKJH 5K69A 2R8SH 3OXRB 3TCLB 3VSVA 1NOLA 2ESVD 3V0VA 4LSDA 3X3FH 2H32B 3P4MB 4OGZA 1WQVT 3JYCA 3B6SB 4N2BA 4NO0B 1ZEAH 2WINA 4DERA 4JHBA 1U3HA 4NAJA 3PUUA 4FNLL 3PFQA 1F4AA 4UOZA 1WBYA 1ZDSA 1DUYA 3MFGB 1JZEA 2XWEA 4FQJH 4N1EA 4Z3HA 1TMQA 3KPTA 2XWTA 3MOBH 3OR7B 1DN0B 4GP5B 2W0PA 1T7XA 5JDSA 4E41E 1HILB 4X6BB 4P07A 4QRTB 1JMXA 2EEAA 5GHWL 5SWQA 2DPKA 4OVUA 4H88H 3L9RB 4LOUC 4LCVA 5E8NB 1KEMH 4I1PA 3BIAX 1MH5A 2YC1A 1KLGB 3NJLA 4X6DF 5CP7B 3FUFA 1CXFA 3EJYD 3VACA 3WTVA 5F3HB 3DX7B 4BQCA 1YO4A 2AMGA 2NSQA 5I2IA 4CVXB 3VFGL 3CVDA 4Q2ZA 3SPJA 1QR1A 1I9RL 2H4EA 1FNEB 4MCNA 4FFWD 2ZCKL 5BPPA 4D9QD 4ZODA 4F91B 3VTMA 3P02A 3S35H 2LU5A 2PWEA 1PAZA 4PBVC 3ZDZB 1DJWA 1YEDA 3RIKA 2E7LC 3UO8B 2R2HA 1E90A 1RK7A 4X99A 2XQBL 3OGOE 2C1OA 5EZIH 2KZ1B 3HRPA 4JY4B 2XZAH 4DQAA 4CVWA 3DSNB 1UFGA 1U3ZA 3IS0X 3TN0B 3VXUD 3IRZA 4RAUA 3TNMB 1HDMA 1G9NC 4N9GA 4OZHA 3LZOA 1TO5A 4YNYA 5BS0D 3F2LA 4NKDA 2WP3T 3ETBF 3C8KB 5I18L 1M6UA 1WO2A 1KPRB 4JO4H 1S7XA 1YEFH 2FJGB 3M46A 4P9HH 4JZJB 5E2JA 2NT1A 2ILLA 3FH8A 5EO1A 1JGUL 3ELQA 4JBSA 3VI3F 3BGMB 3AT8A 2L7QA 3CZNA 3B9VA 2R0KL 5ILTL 4MKMA 4KMLB 2AK4A 3VXOA 4X9HA 4BKSC 1TTBA 1YJDH 3Q3GA 5E03A 2FQEA 1P4IH 2YO3A 3DKHA 1TQCB 1E3ZA 3N55A 4LRNL 1BD2B 4PRPE 2AABH 2HMIC 3BT2L 3QQ9C 2EUVA 2D0HA 1ZT1A 3E2HC 2OTUB 1CICD 1N7MH 1KBKA 3GEFA 2NR6C 3FSZA 4K7FB 4W68A 2ADGA 1A6TB 5CILH 2GTZB 5KYNA 5D6DA 2V5MA 1TTUA 1TJGH 2AJXL 4XCEB 2IFFL 3D39E 4FABH 1SJVA 2PWGA 5DI8A 2NY0C 1N59A 5D1QB 1AMYA 4DPBX 4LBEB 3GJEA 1JYXA 4U1KA 2B59A 3IKKA 2NYYD 3FUMA 4PJBF 3POCA 4M5YH 4PLKC 3O4LE 5JHDD 3CFJA 1A6UL 4H2CA 4HGWA 4PJ5E 3BQVA 4NNXB 1B3JA 3CIAA 3ZU8A 3UTTA 1P53A 1QLRB 4I13B 4TKWA 5CD3B 4YDMA 2ZOKA 4BZ2L 2I25N 3U1PA 5K59F 1MLBB 3AXLB 3GRWL 4NC0B 2BY1A 1QLEH 2G4GA 3A67H 3B8SA 4LKCB 3WIHH 1I3RA 1OB1A 3RWCA 3G9AB 2G0KA 3PV6B 2R15A 1J5OH 1HCZA 2BVEA 4YGVB 1EANA 5IVXE 4UM9B 1XH2A 1S9KC 3BP6A 1U95A 3T0WA 1BW8A 3CC5A 3CHOA 3V4VH 5INDB 2VDQL 4QDGA 4E41B 4YPJA 4AQOA 3E0GA 4Y1AD 5FYLL 2CRMA 3NCMA 1C1EH 3CFKB 3QBTB 4OUUA 5CIPB 5GRYA 1U6AH 1IZJA 2GJ6E 3EYQD 4PRHD 1GOFA 3OHXA 3PP4H 3QEGL 4KHXL 3DTUB 1ZCRA 3EH5B 3OMAB 4HAFA 3JV4B 3FU7A 3BQUB 1PFOA 2OJEA 2BOCB 2UYLA 1QI4A 2CKBA 1FPTH 2WLYA 5IM7B 1HXMA 3DBSA 1A6ZB 3CMGA 1AR1B 1F00I 4ADGA 1HTYA 1R1CA 3VB8A 5T3ZE 5F6HI 1HL8A 3VD5A 1NMBH 1X6LA 1WD8A 3ME0B 5H2BA 3U0PA 3WTSA 1AZUA 4FLRA 2MPAL 4PUBL 2ARJQ 4PBWD 5CR8A 4B9KC 2C9XA 5HHOA 1RZGB 1SJXA 1J5CA 4XZUA 1N5AA 3VXTB 3BVXA 1GJWA 3LH2L 4TULL 3WKNA 1PY0A 4E9SA 2VUOA 4HDIA 4NHCH 1LMIA 2O1AA 3KYKH 2VMFA 3LNHA 2KDYA 1LD9B 2CWRA 2AC0A 1KOAA 3EJQA 4FFVC 5E2UH 3QDGD 2YUXA 2EIEA 2VDLB 4FZ8H 2EJ1A 2TSAA 3ECWA 4XN1A 4ZXBC 4FTDA 2XQYG 2FBJL 1N4XH 2Q87A 2IBZY 4YL9A 2H26B 2LU7A 2QHRL 2OTWA 3B3IB 3U1SH 4WK4B 4UYPA 4K55A 1XZWA 3P3RA 2L3BA 3RPIA 3TA3C 3W5MA 3FQUB 4XAKD 1BZDA 4BQBA 3KVPA 3WXWL 1BEYH 2FJFA 4EN3C 5IHLB 1NFAA 4PRPB 2B8OT 2EDNA 1EGJH 1DLFH 1SDDA 2WJ5A 2ZG2A 4RX4D 4JGUA 3O6KH 2X3BA 3W11D 1FN4B 1U93B 4EXPX 1A0QL 1SXAA 2R0WL 2DQFA 5D7JA 3JSSA 4X5PA 3SGEI 4QLWA 4R6UA 3IFLH 5CZRA 1EHXA 1X5YA 1FO0L 4GSRA 4HPYL 43C9A 3ZR5A 3QVAA 3UIYA 4JFQB 3CH8A 4QHMA 2BIHA 3C75A 3VH8B 2IAMD 3D39B 3KH4A 4P2OC 4BZ1H 1AFVH 4MASA 4OF6A 5C86A 1ZTXL 2AQTA 4MA1C 2O93L 4TXVB 1EFQA 2UVEA 1KG0B 2H32H 3T6VA 5L9DL 4H20L 3GBMH 3O4LB 2ZCLL 4P2RD 3RX7A 1EJFA 4PJ5B 3TIDA 4TOYH 3VH8G 4XBPA 4NNPH 4Q9CA 2V2TB 2Q86A 1XF4B 1WA0X 1AXTL 1N3NB 1Y18B 5EUOF 1A9BA 2FLMA 2WQ8A 4WU7A 1J1PL 1WVZA 4P23B 3K2UL 1CFTA 5GGTL 2MQ3A 4FN0A 5FDWB 1KIPB 4P2AA 5T1LB 5C6PB 3ZMNA 1FRGL 2CCVA 3E3QC 3MAWA 2DLFL 2VSCA 4QHUB 3VQ2C 3WL9A 1EFXD 4KY1L 3M7OA 2C3GA 3MCLL 3GMOA 4JFDA 4HHWA 1BXUA 4UV7H 1FNGA 4ZX5A 5D7LA 5IVXB 1NC4A 4A2DA 3I2CH 5EMYA 1A7NL 4QRPD 3L16A 3NZUA 4ATTA 3NUKA 3N9GL 1UURA 1TU2A 4MA3A 1M6OA 3FTGB 2DM7A 4KV5F 3MODH 4I4WA 2VLKD 4WV1C 4QJ3B 1J9CT 1CD1B 2FD6H 3VD9A 3RTQD 1ML0A 5CEYA 3C6LC 1QLFA 1T89C 5F7NC 2H41A 4WUUD 4MD4A 4UBDD 1JD9A 1K8DB 2CRZA 4LEXH 4EJ1C 4Z8FL 2IWEA 4LLQA 3TLRA 2XG5A 3O9WA 4OZGE 4DN4L 3VXRE 1MPAH 1RJLB 5IR1B 2DS4A 1G6RA 5B1JC 1E9OB 3L1OH 4AZUA 3MV7E 3O2DH 5I19L 3TVMA 4X4MA 5F9OL 2V4LA 1NPUA 2DWDA 2ICEA 3FFCD 1RURH 1SHWA 3L5JA 2BS71 5KSAC 3H9SE 3OJDA 1KB5B 4K3GA 3QIUB 2CIKB 4DP8X 3JZ7A 1X5XA 4G7YH 5C0GA 2IMNA 3RAJH 3VFMB 5C08E 4WFGE 1I8IB 4XNQA 1T66C 2VLLA 3WE6B 2E8YA 4UT6L 3ATFA 2Y1ZA 5TDOA 4FQCH 2FX7L 5DD0H 5KOVC 1KGCE 3GUFA 3GIZL 1FNSH 4ISVA 1ES0A 4POZD 2NY5H 2XG4B 1FGVL 3ROLB 5D1XC 4NQED 2AEOA 3D3VE 3RQ3A 4MB4A 3UPCA 1Y07A 1KTDA 4YHLL 2BSSA 3TV8A 1CLYH 3KVDD 1Z5YD 3QUYB 3FFDB 3HPJB 1BF5A 3NJHA 1CUOA 1G4RA 1GKEA 1HEZB 1I9IH 1PD6A 2NCMA 3B9AA 2DKMA 1R3JA 4FFYH 4QTFA 5LXGL 2J4WH 2H1PH 2V7HA 4ICWA 1FZOB 5LAXA 5LAPA 6FABL 4AZ8B 4NGHH 3T65A 3JWOH 3OM3B 3H6JA 1H6EA 3CQFA 4X8XA 1XGUB 1MFMA 2HT2D 3SBRA 2MOGA 3ZTNL 1Y1UA 3SYOA 1QASA 1HZHH 1NBQA 4OSUH 4A67A 2ZWZA 3CHSA 1AO7D 1PCXA 3JTSA 3QJQB 1Q0EA 2VZ3A 4QHKI 2NY3B 2XU9A 3VGHA 3GF8A 3LKPA 4QAWA 4TTGA 4JO1H 4ZYKB 3AT9A 3MROB 1SQ2N 4PREA 5HYQA 1BFVL 1E7VA 3HI5L 4N2MA 1RK1B 4PH8A 2RTTA 3ZZSA 1M05B 1ETA1 3ULUF 1JG9A 2Z35B 3KLLA 5JOPE 4Z7VA 2UY7A 3IWVA 3QNZB 5FF6B 2BVOA 5CIPH 4CA4A 3PREA 4JKPH 1Z0MA 1NFIB 3FKUS 3HC4H 1URZA 4GKNA 2WLLA 4MZ2A 2OXGA 5A7EA 1AD9A 4IKIA 4RIRB 1GA2A 4I0KA 4O51A 4NX0A 4DPCX 1IT9L 3ROOB 3VVWA 2YUZA 3QO1B 1QUPA 3HAEA 3I6LE 4L4VE 1DJXA 2BSTA 2NNAA 1KCLA 2BVPA 3P1VA 3S37H 3UTSE 2A6JB 4DFIA 4FXGB 4LU5L 4YC2C 1GGCH 2A7BA 1YNLH 2IWFA 3P0GB 3V0DA 3ZIMA 4DKFH 5JQIB 2DQDL 2J88L 4PWGA 4OZGB 4OI8A 1T5KA 4NLAA 4U6XA 5BVPH 3SD2A 2C4FU 2W0FB 1BM7A 3PS6A 2BK8A 5FHBL 4N2KA 3L5XH 4EVNB 3BUBA 1PSKL 4D8PB 4KXCA 5MEQB 1R24A 1JDDA 2VDLH 2XQ0A 5G4MA 3T3ME 1S7TB 3FTWA 3UJTH 3G5VB 5DD1H 1UH4A 3MN8A 3HUJE 5C6TH 3H9SB 3GMQA 2FEEL 1MW1A 3H54A 1MJJA 4G8IA 4M62L 5ESVB 5F89B 5ERWA 4Y4HB 2ESVE 5C08B 5FOJA 3ZZQA 4Z7OF 2WJ7A 1FLRL 4UILL 1E4WH 4UT7H 1TPXB 1AKJB 3HMXH 4OU3A 3T4YA 1S9VA 4S1SH 4O2CA 4N1HB 1KY6A 4A7TA 2ATKB 1DCEA 4UAHA 3TO4D 4DEPB 4GG6A 3EGXB 4TVSa 5KVEE 4ZMPA 1ETZA 1KZQA 1NMCB 3IJ8A 3AUVA 3FQTA 4PW9A 3ARZA 5I6MA 1QATA 3QNXB 2NTFA 4R90H 1RK0B 5CSGA 2LTQB 1CL7L 4FQ1L 4EEEA 3D3VB 4H1LA 5A2LH 4K73A 4Y5VA 2WZ5A 4FXKC 1MSPA 4UT9L 4CL7A 2GC4C 2VZSA 3UACA 3K71B 1TQVA 3LNDA 2I7OA 2JWYA 2ZOWA 3HG4A 1GY2A 4P4KA 2F7PA 2ZKHL 3S97C 4OM0L 3VE0A 3HIZA 1JZ4A 1LQSR 2CM5A 4JM2F 2ISDA 1HJBC 2OJZL 3OG6B 2GJZA 2YD8A 4HUXA 1J1XL 1Y0LA 4LXFA 4Q0XL 3ZO0A 3MLPA 1N10A 4TL5A 2PXYC 1CJYA 4HMCA 5KUKA 3EO0A 1IB5A 1SJHB 1TTAA 5D9SA 1NDMA 3AW5A 4KKRA 3V6ZB 4BFFA 4D9QE 2ZQKA 2QV2A 5ALBH 3UTOA 3VG9B 1CE1L 3BUIA 5E9AA 4J3SA 3RPKA 2R1WA 1M1XA 1SLVA 3HZYA 5ICYB 4XWOD 4WKZB 2ENQA 2B1OA 2CJUL 1SMOA 1OAQH 2I85A 4F7TB 1KCBA 1EO7A 5JA8B 1CDBA 3QUKB 3HCVB 3UYPB 4GJTB 1XH3A 1RU9H 3VXUE 3HJ0A 3KWXA 4RMVA 1PPIA 4DN3L 1OT2A 3QXUA 1ZJAA 3G08A 3K6SA 1XR8B 5BS0E 4GNKB 4AYFA 3MREB 1W0WA 1ZHKB 2YD9A 5KBKA 4EO5A 4PJ9A 3KCPB 3BSZA 3APFA 2OCFD 1LM8V 3I74A 1WLHA 5CCKH 1A5FL 1B4JL 4LLDB 4PRNB 1ASQA 2E7HA 3G7TA 3M1BA 2Z0BA 5K1VA 1NCAH 2KPNA 4AYBA 2BNRE 2QVMA 4X7SH 4JG0L 4HEMA 5D2LA 5TF1L 4ODXA 5A7BA 3W9DB 1SY6A 5I71B 2R1XB 4L4VB 5FEBA 1A21A 3RWHB 4JRXA 5DRXA 4WTZG 1E9QB 2GI0A 4HHGA 3UTSB 1FHNA 2J2ZA 2Z4QA 3DVIA 4PJ6A 5T3ZH 2X6VA 4GSUA 2A9NH 3BCDA 3KJ4B 5F6IB 4NUQA 2EACA 1D5ZA 2PTUA 1RZJC 4R2GD 2VNCA 4LCCA 2VZOA 4M7LT 3RDTB 5HHXH 1KB5H 3NP3A 1RLWA 3D4CA 2IGLA 2KKQA 3GLZA 2TSBA 4N6RA 5IQ9B 4OZIE 4GKZA 4MBOA 2EIDA 1I31A 5IW1B 1XEDA 5I15H 1WFMA 3B5TA 5I9QB 1M2VA 4XO5A 1X3DA 3DMMD 5DRZA 1YYML 3RG1C 1HQRB 2XA3A 5JHDE 3T3MB 1Q9OA 3FO9A 1H8SA 3HUJB 3BMWA 1ZHNA 3PGFH 2OS7A 4MNHB 1OM3H 3RGVB 4RFEA 3SPVA 1CFQA 1KTJA 4LPUA 2ESVB 2WPGA 3VCLA 2IEPA 2CO6B 2VW4A 4P3DA 2V7NA 4KK8D 4U3HA 1P4BH 4QGYA 4F7MA 1FFOB 1NL0H 3QDJA 3WFDL 2DWYA 4ODUB 4K8RH 5BRZA 5AZEL 4O2EA 4M3KB 4A39A 5CD5D 2MMXA 4WUKH 4GW4B 1MIML 1BV8A 2PPDA 3ULUL 1UA6H 4FLSA 4JY5L 3IJHB 3P9WB 2P5WA 4YR6A 3MJ6A 5HHNB 1F4XH 4NC1C 3R0NA 4MNQE 4JKWA 1NCDL 1HSBA 3R4RA 2DMCA 3N1FC 3LN5A 3ZHKA 3T0EC 2KQNA 1NGPL 4LCWA 4XMLL 5LN4A 4V33A 2HPTA 3OR6B 4Q6IC 4S10A 4AE0A 5C0EB 1ZHBA 4XRCB 1UHVA 1ZGLM 1VZHA 5D93C 5DEFB 4HPOH 1P1ZB 4G82A 1RZJL 1NLDH 3K5SA 3O45B 5J3HD 1FFPB 4UANA 3LKRB 3W2DL 4XOEA 4X6FA 3SDDD 1BGXL 1RUQL 4MX7A 2ZUWA 3AREA 3TFKC 5LG1A 1AXSB 3RWEB 5B3JF 5FW6A 3ZHLA 2YXWA 3IMTA 3TP4A 3CPLA 3LS4L 4L4TA 4ONOA 1UC6A 3NH7H 3BH8A 1JXKA 5EB9A 4B9JA 4JDZB 3VXUB 1BM3L 1XIWA 4DO4A 4WEBH 5BS0B 4PJGF 2WXGA 3SCMC 4XPBL 3QDGE 5DFAA 3US0A 5CSZB 4QOKA 1QHPA 1UM6H 1L6PA 1KCRL 1QR4A 4HX1B 2V9UA 4ZT1A 2UY6B 2EDRA 4OD2B 4DWHA 5IFHH 1OPGH 2BNUB 1N68A 2QQQA 2BNRB 1QUNA 4XAKE 3QI9A 1UADC 1I3VA 4OD3H 3QZMA 2AJ3A 4KGJA 1CG9B 2WCSA 5I16A 1G84A 4G42A 4EDWH 1HU8A 2I32A 2IG2H 4Z1PA 1QWNA 2IOMA 1F3JB 3B3BA 5C2BH 5F3BA 2VDRB 2IPTL 2FNWA 1CICB 4MCYA 2IBZX 1T1YB 5IF0A 1HOEA 1RIUH 3MNZB 2F6AA 4LSTH 1QSEE 2GK0B 4FXLA 4ZNEA 1CWVA 3BJLA 2GBVA 5FA4B 3TYFB 5ETUA 5C0AA 1LE5B 3MR9B 3VSTA 5DJDB 4OM1L 4ENEC 1F4WL 4QRFA 4OZIB 3P4OA 4RMQA 1H8NA 4JE0A 3LVEA 3QNFA 3OLDA 4P2RE 1BFSA 3T8XB 5JHDB 3IJSB 3FDWA 1BJ8A 1HH6A 1JXGA 3FF8A 2C9AA 5E4OA 4BWWA 2YN5A 3B2PA 4KVNL 4DGUA 5HPOA 1WAAF 2OX5A 4OGXH 4IBUA 3V5HB 4U1JA 1TXKA 1E4HA 1ZPLA 2GB2A 2OMUA 2WTRB 1JVKA 2Z92A 3ECQA 4PJ7A 4X80L 2NZ9C 5EU6E 3BH9B 3SJVD 4GT0A 2XNAB 1BXVA 2EKSA 5JO5B 2PW1A 2YA0A 1DVTA 1WG3A 5TK4A 43CAA 2HLAB 1JFQL 3F65A 3IFOB 1MELA 3ISRA 4NOBA 4QRPE 1WJ3A 2UZXA 5JW4N 4U1SA 4G8GD 3KWWA 3TWCH 4MNQB 1KSRA 1DBML 3PL6C 4MMZC 2VLKE 4B9IA 3K7UA 2P8MB 2P44B 4E9YA 2GT9A 4QHNB 3NIDE 3ZE2E 3NEXA 1P1VA 1BAFL 5GSVA 1YY8B 3A5VA 4KJWD 3HBZA 2UZYB 1XH0A 4JDVA 4JVPA 5GJSH 1J8HB 2XFXA 3MJ9A 5IVNA 3IGUA 4GP8B 3I6GB 4UQ2A 5AAMA 3VWJA 3PNWA 1GHFH 2DQEH 4YFEA 4PLOB 5IZ7A 1U8OA 2J21A 4ZW7A 2VLRA 5L6YH 2FB4L 3C08H 2BY2A 3C6EA 3ETSA 1FZMA 1RIHH 4ZZKA 5K9JL 3QDMD 4PHXA 3S6CA 1NOFA 4XOBA 3EFOA 1OGPA 3WELA 2DMKA 3WO4B 3BZFB 5MEOB 1UD3A 1TYEB 2WKOF 4PJFE 3CVHB 1N8OE 4PWEA 3ARGC 3WD5L 2IH8A 1DP0A 2QDVA 3QDGB 5EUKA 5GS1A 5GZNC 3RL2B 4KZCA 2WNKA 5DJYB 3FXIC 5DMJB 3T77A 3RNQB 3O11A 1I85A 2O5XH 1VKXA 1ZLVH 2R7EB 1GGBL 4OCLC 4PB0H 5ESQA 5G5DB 2EXYC 3DX9A 2FGWH 4FP8H 4QF1A 4HXAH 2FEJA 1JBJA 4N8PA 4NQCA 1DCLA 4NQEE 2WXFA 4JB9L 2Q7YB 5LBSL 1W72A 4PJIE 4RSVA 5JIIA 3FTUA 1ZLWH 1WBXB 1S8DA 3KEHA 3C5ZC 2QZ5A 3RKDC 1LK3L 2DIBA 1UWEL 3MCYA 4U1MA 3OKNB 2PTTB 4MAYD 5DFVC 3MRGB 1QSEB 4FCHA 3ZDYE 1HX0A 2R1YB 2P43B 3PAYA 2DQCL 2NX5D 4FERA 3QIBC 3UO1H 1L7IL 2IAMB 5HI5C 3LQAH 3IPBA 3OBAA 1A7PL 3GYRA 4QTHA 4YDNA 1AC6A 12E8H 3GSNL 3NA9H 5HTSA 4NCDA 3RVWD 2VR7A 1JTPA 1PLGL 5I8KH 2HTLC 1S9WB 1QRKA 4PS8A 1Z0NA 2BFVL 4F37K 1HEJC 2EUZA 2NY4D 2LABA 4IEFB 5I6XB 1FBIH 5HYJA 1D7DA 2F15A 3C60B 2ZSWB 4LVHC 3V6OA 3KPLB 3X1BA 2EO1A 3ILPA 2FSDA 1NBZA 4MMXA 3E38A 5EU6B 1FYTA 3OWEA 3GSRB 3SZKC 2DWTA 2HA1A 4NQVA 2YQBA 2CO7B 2LAAA 2XRAL 3FMGL 1AC0A 3F64A 2IVFC 1EFXB 1FCCA 2XETA 2DV6A 4OZ4A 3QHZL 4GRLC 5AALA 4AENA 4XP5H 2Q8AH 1TVBB 1HJCA 1T0NA 3BPNC 4QRPB 3S98A 2AK1L 1JWMB 4RGMC 4JVWA 3SE9L 3DTXB 4TUJA 4ZS7H 1THAA 2VLKB 1MCSA 1M7IA 1QFHA 3V0WL 3IKCB 2Y7OA 1C8QA 4QRQB 3OKMA 4HJJL 1EIBA 5IB4B 3NIDB 2R23A 5KVGL 2Y7QB 3P77A 2WIMA 3MV8D 3O6LH 5FECB 3N1QC 4PJDE 1IVTA 1TCRA 3V95A 3A6CH 1RLBA 4NI3A 2E9IA 4X4XB 1YEIL 5T1DL 4X9IA 2OSXA 1IX2A 1DDHA 1SF3A 2GJRA 3MBXL 2FJHA 3UZEC 2FBOJ 3D2UD 3K6OA 3K4DA 5JIDA 1AGEA 1IKOP 5E4EB 2AQPA 1T22B 2YJQA 3MRHA 5J12C 4JY6B 5CBEB 5EZJB 4XCNB 1LNUA 4E5XB 2VISB 4LLYB 2J6EL 5TJWK 4G9FD 5E24E 3QCTH 4N9OB 4PJFB 4R84A 1RAMA 5AOZA 1K2DA 3AC0A 2ZKWA 3W39A 3L6FB 4Y16A 4F8OA 5MEPB 3S3DB 1Q9LB 3CGTA 3BUPA 4P04A 2SEBA 2Y6SC 3WIFB 1KCWA 3P4NA 2FSEA 2ATAA 3MJ7B 4YSAA 4HSQA 2DF3A 4H25A 1QNZH 2VDRH 3QULB 1KJ2L 2IWKA 2J71A 5EIIA 1ASOA 3LB6D 1IJNA 2IQAA 3S35X 1TQWA 4PD4K 2AJSH 5AVUB 3CVIL 5BUAA 1OSZB 3L4ZA 2O6PA 1JZ2A 5HD8D 3KL0A 4PJIB 5CLWA 3AG2B 1OSYA 4ZRGA 3GJFK 5I6OA 3VRJA 2AEQL 3BLKA 2DH2A 3PIQA 1UOKA 3GHEH 5I1CH 4EI6A 3F7YA 3DHPA 3ZDYB 3NA4A 5DZPA 2D3NA 5IB2A 2NW3B 3SGEH 2WQWA 3U46A 4C59B 3BRDA 5AB1A 3DX4A 1XCTA 3PJSA 5GRJL 2AERT 3SKJL 1N6UA 3F01A 3I3DA 4ODWA 4BZ2A 2R8SL 3RX5A 4FCAA 2YPLA 3M86A 3GRWA 4ODBD 4APXB 1NCBH 3N40P 3SDCD 3KXFD 3TV3H 3X3FL 1QSZA 3V0IA 1XAUA 1IKNC 4LVNB 1OGAB 1ZEAL 3TBWA 3SPHA 2YRZA 2YLHA 4LLMA 4A2GA 1XHHA 1A4AA 2NNFA 3DHJA 3LQZB 4NZFA 4FQJL 5J1AB 5KBDA 2VSDA 3LXUX 4R7NB 5CR1A 1DLHA 1KCSH 4IRSA 4JL2A 5ANHA 3MOBL 5F72S 4TPRH 4POYA 2LV4A 1V3JA 1XZ0B 2EQDA 2VLJA 3WY4A 5FYJE 2W95A 4H88L 4PN6A 4ONHA 2Y25A 2ADYA 1Z9MA 4OF0A 1KEML 3X1NA 5E95B 4AK1A 4KJPD 3DX2A 4GS7B 3WN5A 2NYZA 3T3PF 3O8XD 3D0LB 2ZX8A 5CEXA 3R06A 5E8OA 1E8YA 4C55A 1F11B 3WYRA 1HWWA 1WBYB 3A4DA 1P7QA 4NRXA 1TUPA 4F33A 2BNQD 3RUGE 3S35L 4Q58C 4EI5C 3KLKA 1WCBB 4RAVA 4PJDB 4PG9B 1UOVA 1GY1A 2D73A 9PCYA 5DDHA 4FG6C 5SWQB 2Z8RA 3NCBB 2IALA 3GGWB 1KJVA 5EZIL 2XZAL 2JKTM 5E6IC 5IKCB 2AGJH 3K5RA 3CVHH 4P8QA 4ZUWB 5F2FA 2QJDA 5DTFB 5FM5O 5C8JB 2NNXA 3OKKB 1MJUH 5DC0A 5F44A 4TSBH 1UTDA 4Q2ZB 3D85B 4PJXF 5I76B 1YYLH 2FATH 4P48A 4GLRI 2NPLX 3R1GH 4AL8H 3MUY1 4H44C 3FHAA 2ZWYA 4JO4L 4Y5XB 1YEFL 5KVDE 4P9HL 15C8H 3BDXA 2MHAB 1S9XA 4Z18A 3EYFB 2PCFB 2R2HB 3GMRA 3SD5A 2HRPH 1IM9B 3N40F 2C1OB 1OTUD 2VXSH 1YJDL 3KPSD 4U1GB 3QQDA 4IRJC 3ZDZF 4K71B 1P4IL 3KDMA 4GOSA 1I8KB 2AABL 3MBED 3TPKA 4OFIA 4BFKA 1QZ1A 1UG9A 2QDWA 4O02B 5J89A 3G5XB 1N7ML 1FO0A 1L9OA 3TBTB 1X9RA 4JG1H 1F97A 5CILL 1NLBH 2X4UA 1I1FB 1NJ9B 1DQJB 3B9KC 2WZ0A 1TJGL 4X6DA 1SXNA 1XR9A 3EO9H 3OB0H 4P05A 5CINH 4M61A 5D7EA 4P59H 4G9DB 3SDAC 1PJ9A 4F7PB 5TQ0H 4FABL 1BBJA 1DANT 2HRGA 4X4KA 3V79C 3GK8H 3BDBA 4W9JC 4YDJA 1AOZA 3MJ8A 2FCBA 3CXDH 1KLFA 5C1MB 2QQNH 3NP4A 5K33A 3WNLA 1VCBC 2JMRA 2VRKA 2FT7A 2CAKA 2DM3A 1TYJA 3DX6B 4M5YL 5D70H 3ARDA 6TAAA 1CD9B 4AQZA 5ENWA 4JFYA 2WXPA 1J05B 5E8EA 1PX4A 2YS4A 4GG8A 4MYPA 4Y9GA 1XO8A 3QJXA 5GGTA 3CVCA 4FQIH 3GSWA 2HH0H 4GQPH 4XHQA 2J57A 1QLEL 1CGTA 1N59B 3A67L 3AGVA 3WIHL 1BQHA 3K91A 4U3SA 8PAZA 2J8OA 3G5WA 1A4BA 5DJ8B 5CP3A 1AAJA 2IDUA 5IOKA 4HWZA 2OMWB 3Q44A 4B5ZA 3V4VL 3EOBB 4D0CA 2C3HA 2XN2A 2CMRH 4J6IA 1C1EL 1NIEA 5IHZB 2X4QA 5SWZD 2ENPA 1U6AL 4Q14A 5AENA 1FG2B 3PP4L 1RP9A 1BJ1H 1LO4H 4IBTA 1D5XB 3GSQB 3L3GB 1XGZA 1NCJA 1FPTL 4N24A 3JWDC 5IOPA 3GSXA 5I0DA 1T21A 5GGQH 3H2QA 4YPGA 4X42A 3RUGB 1QRNE 1U95B 2F5BH 3CX5K 3KPOA 4G11A 2X2HA 4CRPA 3QEQD 2FWSA 1NMBL 3GMNA 4DFHA 3FRPA 2ZT9C 5EC1A 2H6PB 4OFYD 2DI7A 4A2MA 1WT5C 3H3PH 4MB5A 4IGBA 2Q76A 3AMKA 2BMKA 4NHCL 3KYKL 4DJMA 3O6FA 4Y2LA 2CUMA 2M2DA 1PQZB 2A6KB 2XZCH 2HJFA 4UT6A 2CKBB 3HW7A 5E2UL 1BA9A 1FVEB 1HXMB 4FZ8L 3KPRE 1MNUH 2X4PB 4NJAH 5K1JA 1N4XL 1K5NA 4HFWA 1FL3A 1RHHB 3T8MA 1BZ7A 3U1SL 1B0RB 2WO2B 3NFPB 4F8PA 3ZHDA 1F4HA 5HHOB 5HJGA 1W6LA 2LLLA 4K7PH 1HHJB 4PRAB 4PTTB 3MNDA 1HH9B 1IGYA 5I6KA 1BEYL 4OJCA 3GUTB 2KLTA 4WV1A 3WMQA 1EGJL 1DLFL 1MAJA 4JX0A 2AV7B 1KC5H 3O6KL 5AG9A 1EEYB 1TZIA 2QV4A 4OLVH 1A2YB 3TH4T 4JFEA 5B4MC 5GRZA 3IFLL 1IIKA 3Q0HA 1JPFA 4FFTA 3DV6B 1QFWI 3GSOB 3WAJA 5H94A 2BOBB 2OTWB 1E2WA 4AV4A 3KWUA 5C0DA 4BZ1L 3TN0C 4GKSB 1AFVL 2VDPB 4JR9H 3GEWB 3RPIB 1L9SA 1WRFA 2WXHA 4MDRA 1KIQA 32C2B 1SXZA 5IQ7H 3S8GB 2ZUVA 4IMLA 2AEPH 3SE3A 1SDDB 2PO6D 3GBML 5L2JA 3GXTA 5DGRA 1U8CA 4KXZH 4BGDA 3S8WA 3VFSB 1XGRB 2CNZA 4TOYL 3FQYA 5D7JB 1VEOA 1OP5K 3W0WA 4NNPL 3SDDB 4AOFA 4BELD 2ZX7A 3ZXAC 3HE7C 1E4KA 1ECZA 5EOCH 3NJXA 2UXGA 3QDME 4Z7WF 3AWFA 2QSVA 4ZPVB 2HTKC 3DJZA 1D9KD 3NJIA 1TQCC 4X5RA 2IDQA 5GRWA 1DE4A 3CHXA 4JN1H 5L7XH 3BP4A 3QFDA 2OMTA 4KKZA 2QSCH 3I85A 1OT1A 4UV7L 4XXWC 1X7QB 2KH2B 4DKAA 3GJFA 3I2CL 4FQLH 3OZ9H 3O3EB 5MI0C 2X38A 4FD0A 1WIUA 3P0YL 1IGJB 5ID0B 4RWYH 3FQWA 3MODL 4PIRF 5JPMA 4RRPG 1OP3H 5D1QC 3DOSA 2X4RA 1QABA 3HLAB 3UDWA 3T2PA 3IK2A 4UNIA 1DVFC 1FVCB 5L4IA 1DQIA 4NUGH 3VFPA 1GYAA 4HIEA 3PV7A 4LEXL 3WL9B 1VFBA 4EDXB 2F1EA 4ENZA 1QTPA 4IHOA 4JQVC 4J3BA 4HS8H 3MXWH 4JFDB 1C5CH 1MPAL 3TBSA 1ZLUK 1OF2A 1QRNB 1NC4B 3WI9A 3L1OL 3O2DL 2Z31B 2P5PA 2QKIC 4PWJA 3SKOA 3MCKB 2NLJB 2X9WA 1NAKH 2NX5E 1IGTB 4NZ8A 1WYJA 1MI5D 1RURL 4PGBA 1CI5A 5DS8B 2Z91B 4F7EB 1IM3A 4G7YL 4JPIB 5E8DH 1DVQA 2VN4A 3OKYA 4L9LB 1ZA3B 4AVJA 1YMMD 3GBDA 3PG2A 1UKTA 1CGSH 1K85A 1QBMH 3IF1A 3KPRB 4YVUA 5DSCA 3NFNB 5C0JB 3V4LA 4GUQA 4FQCL 4QKXB 3GI9H 3SO3C 5DD0L 1BVKA 4D8OA 3ZLQC 1OAYH 3QC6X 5BCAA 4O02H 3QFJA 1FNSL 1KYDA 4L29B 3IE4A 2NY5L 2R51A 1W0VA 3CD4A 1HOCA 1LEGA 2HT3D 5DWUH 2ZPKH 3PDDA 4UT9A 3SBWC 4AJ0A 1MNNA 2GVYA 3Q8AA 2CZNA 4IBWA 1BZEA 1KBGH 5C0GB 4H2AA 4YS4A 5AVXB 3HC0A 1ASPA 1CLYL 3IJEB 5IQOA 1DZBA 4LSPH 1RZIB 1TQTA 3HRZB 4XNQB 4CMHB 4J8RA 1I9IL 5A16A 2OMXA 1VF5C 1MCFA 2BHFA 4FFYL 4JS7A 1MEXH 5C97A 2VN6A 3LEYH 2HKAA 2J4WL 4I9WE 2H1PL 2IH1B 2EILB 1LLAA 2LAGB 3OKEA 1UXWA 3FT2B 4NGHL 5ITFB 1TQBB 4ISVB 1RZQA