2DMLA

The solution structure of the first thioredoxin domain of mouse protein disulfide-isomerase a6
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
130
Chain Sequence
GSSGSSGAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase A6
publication title The solution structure of the first thioredoxin domain of mouse Protein disulfide-isomerase A6
rcsb
source organism Mus musculus
molecule tags Isomerase
total genus 24
structure length 130
sequence length 130
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2006-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dmlA01
3F4RA 2CQ9A 3G7IA 2CX4A 4KGIA 4N0ZA 5EL8A 1SL1B 3EINA 4J56E 4TN8A 5JCWA 2LRTA 4WBRD 2IN3A 1BYEA 2CT6A 5IPGA 2N5BA 1K0AA 2MBTA 4E8EA 1AUCA 2DJJA 4NXIA 2OBIA 4TW5A 2EIQA 3KTBA 1YEPA 4AJ8A 3WD6A 4GRFA 5EY6A 5F05A 5JCUA 4WKWA 2HSYA 4G9HA 2H1AA 4V2NA 4HDEA 1U88A 2H76A 2H01A 6GSSA 4KDUA 4RQRA 5ECNB 3VK9A 2X99A 3HY2A 4IS0A 19GSA 2AAWA 5FT3A 4ZL9A 1GLPA 1JZRA 5IMCA 4LA1A 2AV4A 3ZVJD 2B5YA 5J4UA 1N8JA 2L57A 4LMWA 4EL1A 3Q74A 1PMTA 1BJXA 2GDRA 2KP2A 4KCAA 2J9HA 2VCZA 3ZLPA 5IMFA 4JR4A 2IL3A 1XFLA 2H30A 3APOA 1F3BA 1HNBA 1T3BA 3L9SA 4HU7A 3UIWA 4BL7A 2VAFA 2VD0A 1NW2A 3C1SA 3C7MA 2B5EA 2X8CA 2R3XA 3D21A 5IPHA 5ELGA 2HXKA 1AQVA 2PVQA 2FNOA 4AJ6A 2HRFA 5FHIA 3D4TA 4MJEA 4CDOA 1MD4A 3R2QA 3FR3A 1XWCA 4O5RA 1X5EA 3QAVA 5J5NA 1TI3A 2H0HA 3TJJA 3LXTA 4L5OA 3TRXA 4YQVA 4ZBBA 1A8YA 1GL8A 1T4ZA 2G0FA 1SKSB 1A2JA 2X8GA 4AF2A 4HZ2A 1VF1A 3KEBA 4EO3A 3WGEA 4G2EA 3GIXA 1DUGA 3F4SA 2JADA 3HA9A 4NV5A 1HD2A 4ECCA 3H4KA 2C3QA 2P31A 2PMTA 4D73A 2PBJA 2BTOT 3RHBA 1GSQA 1WJKA 4MJAA 4XS4B 3M8NA 4JE1A 1FG4A 2GVPA 2VD1A 4TKYA 1O73A 3TJFA 3KP9A 1Q4JA 3DMLA 4ZL8A 4ACSA 3BJ5A 3GKMA 4O32A 4WBJA 4WF4A 4ZXGA 2PWJA 5J9BA 3SWLA 4JRRA 1A23A 1G7EA 4ZB8A 2H19A 1ST9A 3EYTA 1MEKA 1TRVA 5D9TA 5CREA 3BCIA 1AQWA 1YF1A 2YOIA 1R26A 1M0UA 4RI7A 5HQPA 3KMNA 5DBQA 1T8EB 2DBCA 1SKWB 4QL9A 1U6TA 1U87A 4BPYA 1K0NA 2LQOA 4XTSA 1NSWA 3TJKA 3GYKA 2ES7A 5D9WA 1BX9A 4AGSA 1XOAA 3BBYA 2OE0A 4I5QA 3FR6A 1GNEA 3ZITA 3KXOA 3TKSC 3I69A 4HU9A 2HZFA 4MJBA 1Z9HA 2WB9A 3UOMA 4I2TA 1ZZYA 2NBSA 2PERA 4O7HA 4PURA 2H66A 3H79A 3CTGA 2C4JA 2R37A 4PGTA 5DVBA 2H8LA 1R5PA 1QQ2A 1Z3EA 5G30A 4WF5A 3LSZA 2YWIA 4Q5QA 5D96A 3QR6A 4MCUA 3KMOA 2ON5A 5E59A 5KN3A 3UEMA 1WOUA 4IQ1A 2LJAA 1DBYA 2MBSA 2KLXA 2TRCP 2EIRA 1T00A 3ZREA 4HZ4A 1SD8A 4PXOA 3ME8A 2YZUA 3KTLA 3TJGA 1HNCA 1USBA 1EP8A 1GUMA 3WT2A 1G0TA 2HE3A 2YWNA 3GMFA 3L4NA 2GSTA 4TXOB 1G7OA 2VLUA 1YDKA 5ECOB 3ME7A 3DKSA 4GXZA 1UVZA 1KEBA 4ULXA 2VCXA 2VCWA 2CZ2A 3HD5A 1M9AA 2H6ZA 4EC0A 4WR4A 4XHMA 1ERWA 1GTIA 4FYCA 4EXJA 1HYUA 1TU8A 4NHZA 2HZEA 2KP1A 2B7KA 1JLVA 1XWKA 2XBIA 3LWAA 1TOFA 1NHYA 1Z7RA 5IM9A 3WYWA 3IXRA 4J57E 2CZ3A 3TGZA 3IOSA 3BOAA 1HNAA 3ERGA 4J2FA 1CQGA 3ZL5A 2DJ0A 2VM1A 2LJRA 4OD7A 3CMIA 2C8UA 2K9FA 2R6KA 4ML1A 1JZOA 3IR4A 2L4CA 4MF7A 10GSA 6GSYA 4X43A 4K8MA 1YY7A 5A4WA 2B7JA 1PL2A 3QAWA 3F3RA 5G1KA 3ZYWA 2VCTA 4CW9A 3W8SA 4IKHA 2E7PA 4MDCA 3A3TA 3L9VA 5ELAA 4ILFA 5HFGA 3IA1A 5KN0A 4N10A 1ERVA 3IAS2 2GZYA 2C3TA 1LBKA 1V2AA 5CYYA 3F63A 3IDVA 1FHEA 4XS4A 4AJ7A 5AISA 1K0OA 2R5GA 4MP4A 1DSBA 1GSFA 2V6KA 5DALB 1T4YA 3ERFA 1VF2A 4L0UA 1XW6A 1QMVA 5CAXA 3QAGA 1O81A 2L6DA 1X0RA 2AB6A 2QKEA 1WPIA 1OC9B 2MMZA 2PVOC 3H8QA 4OCEA 4ECJA 4YQMA 3GHAA 2YV7A 2JACA 2LJKA 2CVBA 1RK4A 2RLIA 4OWYA 4I2UA 4DVCA 5G31A 5IOWA 2YNXA 2XC2A 1T7PB 2RM5A 4HUAA 2HI7A 3MDKA 3APQA 1X9MB 4EVMA 14GSA 5B8BA 2FUG2 2CAQA 5ECHB 1TRWA 2J23A 5A5KA 3DXBA 1ZGNA 4NV2A 3ERWA 4KUNA 4H86A 1SYXA 2LSTA 2OE1A 1R7HA 2GQKA 1PQNA 3VWVA 3W8JA 1M9BA 1Y25A 1O8XA 3CBUA 5KEJA 4MK3A 2IMKA 2OE3A 4P3YB 5GAPD 2BMXA 1EV9A 1ML6A 1V40A 2FCHA 4F0CA 1EWXA 2V41A 4LL1B 2C3NA 1SJZA 4X1UA 1GTBA 2HT9A 1MD3A 3Q6OA 3EU3A 2YJ7A 4HS1A 2DLXA 2GTUA 4PQ1A 4EE0A 2IPAA 4DEJA 2ZUPA 5DAKB 1XWBA 3KCMA 4F03A 4MPFA 1YKCA 1E2YA 5LCZA 3CYNA 4PNFA 3TJBA 9GSSA 3HJMA 5IMAA 5J9CA 1OC8A 3GL5A 3SBCA 3HKRA 3BCKA 4ZBDA 4MJCA 3ZTLA 1C72A 1ILOA 3WGXA 3GSTA 4ML6A 1WE0A 5ID2B 3GL3A 1GSUA 1MDJA 2ON7A 2PN8A 4ECBA 3H93A 1ZYEA 2E2MA 2YZHA 3EC3A 2LTKA 4WXTA 1JLWA 2L5LA 2B1KA 3Q18A 1WIKA 3VPQA 2LUSA 5A4UA 12GSA 3GTUB 1I5GA 3E9JB 3FK8A 1A2MA 2NVLA 4TXOA 1VGLA 1X9SB 1FVKA 2OJLA 4XS1A 5C04A 1E6BA 2JL4A 1IYHA 1XOBA 3I9V2 3QOUA 1RW1A 2HSHA 1XCCA 3KH9A 5AN1A 1BG5A 1XW5A 4V1Ag 2GSSA 3A2WA 2JU5A 4YH2A 5GAND 3D5JA 1LU4A 4JU5A 4MABA 1EGRA 4PX1A 2IMFA 1FB0A 1KNGA 4YAPA 3TOUA 2YANA 5HR0A 4PQHA 4FIWA 3MSZA 4F82A 5JWQB 1FO5A 3N9JA 2AUVA 1X9WB 2C0FA 17GSA 2REMA 5AIVA 1B48A 3TKSE 1PX7A 2I9HA 2FD3A 2CVKA 2LRNA 2VO4A 4TR4A 3C8EA 4PQIA 3F6FA 1V57A 1T1VA 1U3AA 3GX8A 2H71A 3I6AA 4ZB9A 1TKDB 2MYGA 3LQ7A 1TRUA 3TKRA 1SKRB 3VPTA 3U6VA 3HZ4A 1WMJA 2DIZA 2GT6A 5EVOA 1NM3A 2PPTA 1SU9A 3TUEA 1Z7PA 3KJYA 4JEDA 3F6DA 4MPGA 2H74A 1TK5B 3TB2A 1SENA 2GQLA 2FHEA 3F9UA 2VM2A 3VWXA 4GQFA 3HCZA 4N0VA 2YN1A 3IV4A 1KBNA 5DALA 2GZZA 4POKA 1XW9A 2ZCTA 1BEDA 2ZNMA 3UJ1A 3LFLA 2DIYA 4DSSA 1SK2A 1OC9A 1THXA 1QGVA 5IO2A 5ECLB 1TJDA 2IMIA 2CVDA 3GA4A 3LJRA 3EVIA 4HI7A 3L0HA 2XBQA 3H1NA 2B1LA 4MZCA 5ECKB 3ED3A 3ZVJA 1JZWA 2JSYA 1YF0A 2YPMA 3A2VA 3C73A 4XIHA 4KNDA 3IHQA 1GP1A 2KHPA 4K7IA 2QGVA 3KP8A 1AQXA 5DJLA 2A4VA 4MZWA 4OFTA 1XVWA 3HHVA 3UMAA 2VOCA 1A24A 4KAEA 3ZFLA 2OADA 4I6XA 4OFNA 2VUPA 6GSXA 1WWJA 2FA8A 3LYPA 1AC1A 4ZB6A 5JWRB 3FZ4A 5ECSA 1EEJA 3I43A 5B8AA 1EEMA 1PKWA 2DJKA 4I97A 2DMLA 5G5EA 5C00A 1K3YA 3RPPA 3GX0A 5F8BA 1SL0B 2KOKA 1BAYA 4POMA 4IELA 2JZTA 1ZL9A 4LL4B 2N5AA 2QSIA 1K0CA 3WGDA 1B9YC 3BD2A 4O92A 5INYA 1EP7A 2EIOA 1ERTA 3DRNA 1URMA 4K0GA 4RQXA 1TP9A 3FHKA 2L6CA 1Z6MA 3GV1A 3P7XA 1W89A 3F4TA 1GSDA 3LG6A 1XIYA 4FYBA 3CRUA 3D6IA 1MDKA 1PSQA 3OR5A 1EGOA 1SL2B 1MDIA 1B8XA 5HFKA 2YV9A 1G6YA 3EU4A 1EOGA 3M9KA 3IPZA 8GSSA 2RUFA 2GSQA 4HJMA 3GTUA 1GNWA 4KCEA 1GTUA 2X64A 1S3CA 3VI5A 2DSAA 6GSTA 3GN3A 1TTZA 3IAM2 3QMXA 4KE3A 3JCML 2X8HA 2G2QA 2V32A 5CNWA 1YEXA 2FWHA 3KM6A 1QUWA 1NHOA 3O76A 3KH7A 1OAZA 4KB3A 3UL3A 5D9XA 22GSA 1H4OA 1PN9A 3FZ9A 3P90A 3US3A 4DSRA 3QFBC 1PKZA 1ACVA 1K0DA 20GSA 1V9WA 4MF6A 4IQAA 5FWGA 13GSA 3KD0A 3RAZA 3J7Yk 5IOXA 3CXGA 3DWVA 4KA0A 3IK9A 1GUHA 5IQYA 3GKKA 2VLTA 1VRSD 3HJOA 1XWGA 4JZQA 4K2DA 5E4WA 4DSQA 5AIXA 3QPMA 3P8WA 4V2LA 4QQ7A 5HR2A 1M2BA 4V2MA 4MLYA 1DE1A 3TCOA 3D4MA 3EWLA 4GCIA 2H6XA 5CRHA 2YP6A 3MNGA 2VCQA 3TKSA 4L5LA 3EE2A 2MMOA 4ZBAA 4L8EA 2H73A 4KW6A 3V1WA 1JHBA 1XZOA 3DGQA 3LXZA 2HNLA 3PGTA 4ZL7A 5KN1A 5JCGA 2WDUA 4YQUA 3DYRA 1PL1A 1FW1A 4YAVA 4GWRA 5HFIA 3IE3A 2ALBA 1JZDA 2F8FA 16GSA 3GKNA 2I81A 3GURA 1THOA 1AIUA 2KUCA 1XBSA 4GSSA 2H6YA 3J7Yb 1SK1A 4IHUA 4E8HA 1I9DA 4ISDA 2VL3A 2P5QA 5ECRB 2I1UA 3HVXA 1GULA 2DC5A 2PUKC 4Q5RA 5J3RA 1GSYA 5IMZA 5HR3A 5B6MA 5ECQB 2LNSA 3FRCA 3VURA 2P0GA 3FR9A 3ZMLA 1S3AA 3M3MA 5D8IA 3GH9A 2C1YA 4NHWA 1K3LA 5H5SA 1SD9A 2CV4A 5D73A 2N5FA 3HVSA 4JR6A 3CSIA 3GFKA 4V1Ap 4EUYA 1AAZA 3GKXA 4TOPA 5CP1A 1M7TA 2OBKA 4GF0A 4WR5A 1F6MC 2WJUA 1SK0A 2GQMA 2VL2A 1R4WA 1XVQA 3CSHA 1ABAA 3ZZXA 4RI6A 4PNGA 4EKZA 1TW9A 2OKAA 2V2GA 3NIVA 3ZIJA 5CRWA 3A5WA 4K9ZA 2K8SA 4G19A 1XPVA 2F51A 4MH3A 1J08A 5L71A 1TRSA 3F8UA 3D0ZA 1UN2A 1U3IA 1OYJA 2VCVA 4N11A 4TR3A 11GSA 1FOVA 3G7JA 3Q19A 3G7YA 4OO4A 3NZNA 4K7NA 3RHCA 1Z5YE 4I8BA 4TR1B 1Z6NA 3MWHA 2FA4A 4WEYA 3EMPA 3DIEA 2DJ1A 5ENUA 4POLA 2WZ9A 1TXXA 3A2XA 2WFCA 4XRDA 2H1GA 3TRPA 2HFDA 4NAXA 5EPFA 1K0MA 2IIYA 3EURA 1X5DA 3GRXA 2IJYA 2LNTA 1M2AA 1K3OA 3QFAC 2IMDA 3U5RE 4BWQA 3L78A 1F9MA 4QL7A 2JZRA 1GTAA 2MZCA 1ZMAA 1G6WA 3VI7A 4F0BA 2F8AA 2WCIA 1TI1A 1LJRA 3UVHA 1QK8A 3LEFA 5COHA 3TKQA 4L0WA 3GSSA 4TR0A 3FKFA 1PGTA 2TIRA 4OO5A 3UBLA 2H70A 1O8WA 1O7UA 2LV3A 4GLTA 1YZXA 5G1LA 2R4VA 5H5RA 4MA9A 3CTFA 2O87A 2DJ3A 2LKUA 2PGTA 5DCHA 4GQCA 6GSWA 2V6OA 3G9BA 2AJQB 2MMAA 1PA3A 4FO5A 1SYRA 4HOJA 5CRGA 3IRAA 5ABRA 4GSNA 3AY8A 2B5XA 3ZRDA 1ERUA 2RM6A 1Y6EA 3TKPA 3NOFA 2HYXA 3M1GA 1B9XC 4IJIA 3RDWA 1OC3A 4OMVA 1RQMA 4HQZA 5DJMA 1UC7A 1AW9A 2YJHA 1QFNA 2GZPA 3E3EA 1CQHA 2C0DA 3HXSA 5DQYA 4TRXA 2HZEB 5CRDA 3FW2A 3PH9A 4BVYA 1VF4A 4XRAA 5IMDA 4N30A 2IFQB 2I3YA 1V58A 5IO0A 5IIZA 1OE8A 4BVXA 2FWEA 1O6JA 2I4AA 1W4VA 3FYGA 4EDYA 2D2ZA 4ZIJA 5LNKe 3DEXA 3DVXA 2O85A 3VFIA 1FAAA 2C80A 4OCFA 2F9SA 3UARA 4HQSA 4K6XA 1EV4A 2L59A 2F3MA 5HR1A 3FZAA 2QC7A 4Z7XA 1F3AA 4Q5NA 2FWGA 4K1FA 5GZZB 3FEUA 1EOHA 2O89A 2M46A 1TK8B 2GT5A 1GSSA 1V98A 3M9JA 3GH6A 2H72A 4IP1A 4CHSA 2VIMA 2E2GA 5GSTA 2YWMA 2WGRA 3CRTA 4PUFC 2FWFA 5JWOB 2B6MA 3M0FA 3KIJA 4NMUA 5D93A 1F37A 2OACA 3QDNA 2WS2A 1QXHA 3UBKA 3S9FA 4X0XA 1TDIA 2BJXA 3ISOA 3C71A 4TVEA 2C0EA 2RUEA 2GS3A 1GUKA 2LRCA 3QCPA 4HEA2 3TRQA 2YCDA 3LGCA 2WULA 1A0RP 4EF0A 1A2LA 3P2AA 4TXVA 4RUVA 4IGJA 5G5FA 5DAKA 5DCGA 4TR1A 5F07A 5CO3A 5H5QA 4PUAA 2LQQA 2OA7A 2XPEA 2L5OA 3PINA 1R5AA 1GRXA 5ECPB 5B7CA 4ZILA 2VL9A 5ID2A 4MH2A 2C0GA 4FYUA 1SJ6A 2CAIA 5J41A 3HDCA 4IJ3A 2TRXA 1A8LA 3VWWA 1IYIA 3APSA 1YKAA 2YWOA 4GTUA 2LS5A 3KZQA 3F0IA 2NTOA 3E0UA 2GSRA 5GSSA 3IC4A 3PR8A 1GH2A 4KDYA 2RIIA 2PU9C 1OE7A 2IWTA 4KSOA 5G2ZA 1WRYA 1OVNA 3F3QA 1TU7A 5LD0A 1EZKA 5B6NA 3HZ8A 1OKTA 3O3TA 2H0GA 1BQ7A 3TOTA 1S3DA 1YQ1A 4LLRA 1OKDA 2EC4A 4KSMA 3VWUA 2P5RA 6GSVA 2H1BA 4GSTA 4BA7A 4FH8A 4IW9A 1MTCA 1FVJA 3QD9A 4IN0A 3ZFBA 3CSJA 2M80A 1AXDA 1XWAA 4IVFA 4NPBA 3UVTA 2H75A 1XXUA 4MF5A 2V1MA 1ON4A 4IBPA 3IBHA 5D9VA 2IMEA 4XS6A 2JZSA 1N2AA 2VL2C 1Q98A 1H75A 2IFQA 5F06A 1GSEA 4HJ2A 3HVVA 4KH7A 5AGYA 2NPBA 3HYPA 18GSA 4POBA 1KTEA 1HQOA 3FZ5A 1F2EA 2VLVA 2MMNA 3GUSA 2K18A 3C1RA 4K7OA 2CA8A 3LORA 2H0IA 1PRXA 4EDZA 4KX4A 6GSUA 3EMXA 1J0FA 2FLSA 3FY7A 3K8NA 2HLSA 4K0NA 4BWSA 1ZOFA 5DQSA 1J9BA 4WETA 5A4VA 2O8VB 4JBBA 3LYKA 2DJ2A 1X5CA 1SJIA 3TDGA 2HRNA 2A2RA 2AHEA 2H1DA 4NWYA 3VLNA 5F0GA 3MAKA 2A2SA 3L9UA 1VF3A 2XHFA 2AYTA 2DMMA 3RBTA 1M99A 4D73B 4F2IA 3WT1A 2B3SA 2FY6A 1DE2A 1O85A 3D22A 4ECIA 4ID0A 2GGTA 4LMVA 2FGXA 1FB6A 1ZYQB 1ZCPA 4DSSB 2NDOA 5IMVA 2E0QA 3ZIVA 1TK0B 2XPDA 4G10A 3O6TA 1B4PA 2JSZA 3KGKA 2GLRA 1JFUA 1K0BA 3HJPA 2Z9SA 2K8VA 3RPNA 3UAPA 5ECMB 3N5OA 1B4QA 4XCSA 4F9ZA 3DD3A 4OFMA 5KN2A 1M2DA 3W6GA 2CX3A 4IP6A 4MMMA 1YJ6A 2M72A 1UA5A 1GLQA 4Q5FA 3DVWA 5ECIB 1WP0A 1GWCA 2WRTA 5DDLA 3GNJA 4KDXA 2R2JA 2L4QA 1A0FA 2K6VA 2LEGA 7GSSA 3ZMKA 3IK7A 1PD21 1PX6A 4MZBA 2O7KA
chains in the Genus database with same CATH superfamily
3F4RA 2CQ9A 3G7IA 2CX4A 4KGIA 4N0ZA 5EL8A 1SL1B 2DKIA 3EINA 4J56E 4TN8A 5JCWA 2LRTA 4WBRD 2IN3A 1BYEA 2CT6A 5IPGA 2N5BA 1K0AA 2MBTA 4E8EA 1AUCA 2DJJA 4NXIA 2OBIA 4TW5A 2EIQA 3KTBA 1YEPA 4AJ8A 3WD6A 4GRFA 5EY6A 5F05A 5JCUA 4WKWA 2HSYA 4G9HA 4G0IA 2H1AA 4V2NA 4HDEA 1U88A 2H76A 2H01A 6GSSA 4KDUA 4RQRA 5ECNB 3VK9A 2X99A 3HY2A 4IS0A 19GSA 2AAWA 5FT3A 4ZL9A 1GLPA 1JZRA 5IMCA 4LA1A 2AV4A 3ZVJD 2B5YA 5J4UA 1N8JA 2L57A 4LMWA 4EL1A 3Q74A 1PMTA 2HRAA 1BJXA 2GDRA 2KP2A 4KCAA 2J9HA 2VCZA 3ZLPA 5IMFA 4JR4A 2IL3A 1XFLA 2H30A 3APOA 1F3BA 1HNBA 1T3BA 3L9SA 4HU7A 3UIWA 4BL7A 2VAFA 2VD0A 1NW2A 3FMWA 3C1SA 3C7MA 2B5EA 2X8CA 2R3XA 3D21A 5IPHA 5ELGA 1XG8A 2HXKA 1AQVA 2PVQA 2FNOA 4AJ6A 2HRFA 5FHIA 3D4TA 4MJEA 4CDOA 1MD4A 3R2QA 3FR3A 1XWCA 4O5RA 1X5EA 3QAVA 5J5NA 1TI3A 2H0HA 3TJJA 3LXTA 4L5OA 3TRXA 4YQVA 4ZBBA 1A8YA 3MYDA 1GL8A 1T4ZA 4Z2RA 2G0FA 1SKSB 1A2JA 2X8GA 4AF2A 4HZ2A 1VF1A 3KEBA 4EO3A 3WGEA 4G2EA 3GIXA 1DUGA 4YKFA 3F4SA 2JADA 3HA9A 4NV5A 1HD2A 4ECCA 3H4KA 2C3QA 2P31A 2PMTA 4D73A 2PBJA 2BTOT 3RHBA 1GSQA 1WJKA 4MJAA 4XS4B 3M8NA 4JE1A 1FG4A 2GVPA 2VD1A 4TKYA 1O73A 3TJFA 3KP9A 1Q4JA 3DMLA 4ZL8A 4ACSA 4EIQA 3BJ5A 3GKMA 4O32A 4WBJA 4WF4A 4ZXGA 2PWJA 5J9BA 3SWLA 2R0CA 4JRRA 1A23A 1G7EA 4ZB8A 2H19A 1ST9A 3EYTA 1MEKA 1TRVA 5D9TA 5CREA 3BCIA 1AQWA 1YF1A 2YOIA 1R26A 1M0UA 4RI7A 5HQPA 3KMNA 5DBQA 1T8EB 2DBCA 1SKWB 4QL9A 1U6TA 1U87A 4BPYA 1K0NA 2LQOA 4XTSA 1NSWA 3TJKA 3GYKA 2ES7A 5D9WA 1BX9A 4AGSA 1XOAA 3BBYA 2OE0A 4I5QA 4Z2TA 3FR6A 1GNEA 3ZITA 3KXOA 3TKSC 3I69A 4HU9A 2HZFA 4MJBA 1Z9HA 2WB9A 3UOMA 4I2TA 1ZZYA 2NBSA 2PERA 4O7HA 4PURA 2H66A 3H79A 3CTGA 2C4JA 2R37A 4PGTA 5DVBA 2H8LA 1R5PA 4BIKA 1QQ2A 1Z3EA 5G30A 4WF5A 3LSZA 2YWIA 1S3RA 4Q5QA 5D96A 3QR6A 4MCUA 3KMOA 2ON5A 5E59A 5KN3A 3UEMA 1WOUA 4IQ1A 2LJAA 1DBYA 2MBSA 2KLXA 2TRCP 2EIRA 1T00A 3ZREA 4EIPA 4HZ4A 1SD8A 4PXOA 3ME8A 2YZUA 3KTLA 3TJGA 1HNCA 1USBA 1EP8A 1GUMA 3WT2A 1G0TA 2HE3A 2YWNA 3GMFA 3L4NA 2GSTA 4TXOB 1G7OA 2VLUA 1YDKA 5ECOB 3ME7A 3DKSA 4GXZA 1UVZA 1KEBA 4ULXA 2VCXA 2VCWA 2DKHA 2CZ2A 3HD5A 1M9AA 2H6ZA 4EC0A 4WR4A 4XHMA 1ERWA 1GTIA 4FYCA 4EXJA 1HYUA 1TU8A 4NHZA 2HZEA 2KP1A 2B7KA 1JLVA 1XWKA 2XBIA 3LWAA 1TOFA 1NHYA 1Z7RA 5IM9A 3WYWA 3IXRA 4J57E 2CZ3A 3TGZA 3IOSA 3BOAA 1HNAA 3ERGA 4J2FA 1CQGA 3ZL5A 2DJ0A 2VM1A 2LJRA 4OD7A 3CMIA 2C8UA 2K9FA 2R6KA 4ML1A 1JZOA 3IR4A 2L4CA 4MF7A 10GSA 6GSYA 2R0PA 4X43A 4K8MA 1YY7A 5A4WA 2B7JA 1PL2A 3QAWA 3F3RA 5G1KA 3ZYWA 2VCTA 4CW9A 3W8SA 4IKHA 2E7PA 4MDCA 3A3TA 3L9VA 5ELAA 4BVXB 4ILFA 5HFGA 3IA1A 5KN0A 4N10A 4O5QA 1ERVA 3IAS2 2GZYA 2C3TA 1LBKA 1V2AA 5CYYA 3F63A 3IDVA 1FHEA 4XS4A 4AJ7A 5AISA 1K0OA 2R5GA 4MP4A 1DSBA 1GSFA 2V6KA 5DALB 1T4YA 3ERFA 1VF2A 4L0UA 1XW6A 1QMVA 5CAXA 3QAGA 1O81A 2L6DA 1X0RA 2AB6A 2QKEA 1WPIA 1OC9B 2MMZA 2PVOC 3H8QA 4OCEA 2HRKA 4ECJA 4YQMA 3GHAA 2YV7A 2JACA 2LJKA 2CVBA 4K5RA 1RK4A 2RLIA 4OWYA 4I2UA 4DVCA 5G31A 5IOWA 2YNXA 2XC2A 1T7PB 2RM5A 4HUAA 2HI7A 3MDKA 3APQA 1X9MB 4EVMA 14GSA 5B8BA 2FUG2 2CAQA 5ECHB 1TRWA 2X49A 2J23A 5A5KA 3DXBA 1ZGNA 4NV2A 3ERWA 4KUNA 4H86A 1SYXA 2LSTA 2OE1A 1R7HA 2GQKA 1PQNA 3VWVA 3W8JA 1M9BA 1Y25A 1O8XA 3CBUA 5KEJA 4MK3A 2IMKA 2OE3A 4P3YB 5GAPD 2BMXA 1EV9A 1ML6A 1V40A 2FCHA 4F0CA 1EWXA 2V41A 4LL1B 2C3NA 1SJZA 4X1UA 1GTBA 2HT9A 1MD3A 3Q6OA 3EU3A 2YJ7A 4HS1A 2DLXA 2GTUA 4PQ1A 4EE0A 2IPAA 4DEJA 2ZUPA 5DAKB 1XWBA 3KCMA 4F03A 4MPFA 1YKCA 1E2YA 5LCZA 3CYNA 4PNFA 3TJBA 9GSSA 3HJMA 5IMAA 5J9CA 1OC8A 3GL5A 3SBCA 3HKRA 3BCKA 4ZBDA 4MJCA 3ZTLA 1C72A 1ILOA 3WGXA 3GSTA 4ML6A 1WE0A 5ID2B 3GL3A 1GSUA 1MDJA 2ON7A 2PN8A 4ECBA 3H93A 1ZYEA 2E2MA 2YZHA 3EC3A 2LTKA 4WXTA 1JLWA 2L5LA 2B1KA 3Q18A 1WIKA 3VPQA 2LUSA 4KF9A 5A4UA 12GSA 3GTUB 1I5GA 3E9JB 3FK8A 1A2MA 2NVLA 4TXOA 1VGLA 1X9SB 1FVKA 2OJLA 4XS1A 5C04A 1E6BA 4O5UA 2JL4A 1IYHA 1XOBA 3I9V2 3QOUA 1RW1A 2HSHA 1XCCA 3KH9A 5AN1A 1BG5A 1XW5A 4V1Ag 2GSSA 3A2WA 2JU5A 4YH2A 5GAND 3D5JA 1LU4A 4JU5A 4MABA 4MNNA 4K5SA 1EGRA 4PX1A 2IMFA 1FB0A 3IHGA 1KNGA 4G0KA 4YAPA 3TOUA 2YANA 5HR0A 4PQHA 4FIWA 3MSZA 4F82A 5JWQB 1FO5A 3N9JA 2AUVA 1X9WB 2C0FA 17GSA 2REMA 5AIVA 1B48A 3TKSE 1PX7A 2I9HA 2FD3A 2CVKA 2LRNA 4X4JA 2VO4A 4TR4A 3C8EA 4PQIA 3F6FA 1V57A 1T1VA 1U3AA 3GX8A 4ICYA 2H71A 3I6AA 3PPUA 4ZB9A 1TKDB 2MYGA 3LQ7A 1TRUA 3TKRA 1SKRB 3VPTA 3U6VA 3HZ4A 1WMJA 2DIZA 2GT6A 5KOWA 5EVOA 1NM3A 2PPTA 1SU9A 3TUEA 1Z7PA 3KJYA 4JEDA 2UZ8A 3F6DA 4MPGA 2H74A 1TK5B 3TB2A 1SENA 2GQLA 2FHEA 3F9UA 2VM2A 3VWXA 4GQFA 3HCZA 4N0VA 2YN1A 3IV4A 3R3EA 1KBNA 5DALA 2GZZA 4POKA 1XW9A 2ZCTA 1BEDA 2ZNMA 3UJ1A 3LFLA 2DIYA 4DSSA 1SK2A 1OC9A 1THXA 1QGVA 5IO2A 5ECLB 1TJDA 2IMIA 2CVDA 3GA4A 3LJRA 3EVIA 4HI7A 3L0HA 2XBQA 3H1NA 2B1LA 4MZCA 5ECKB 3ED3A 4YKGA 3ZVJA 1JZWA 2JSYA 1YF0A 2YPMA 3A2VA 3C73A 4XIHA 4KNDA 3IHQA 1GP1A 4USSA 2KHPA 2A2PA 4K7IA 4FQUA 2QGVA 2HSMA 1AQXA 3KP8A 5DJLA 2A4VA 4MZWA 4OFTA 1XVWA 3HHVA 3UMAA 2VOCA 1A24A 4KAEA 3ZFLA 2OADA 4I6XA 4OFNA 2VUPA 6GSXA 1WWJA 2FA8A 3LYPA 1AC1A 4ZB6A 5JWRB 3FZ4A 5ECSA 1EEJA 3I43A 5B8AA 1EEMA 1PKWA 2DJKA 4I97A 2DMLA 5G5EA 5C00A 1K3YA 3RPPA 3GX0A 5F8BA 1SL0B 2KOKA 1BAYA 4POMA 4IELA 2JZTA 1ZL9A 4LL4B 2N5AA 2QSIA 1K0CA 3WGDA 1B9YC 3BD2A 4O92A 5INYA 1EP7A 2EIOA 1ERTA 3DRNA 1URMA 4K0GA 4RQXA 1TP9A 3FHKA 2L6CA 1Z6MA 3GV1A 3P7XA 1W89A 3F4TA 1GSDA 3LG6A 1XIYA 4FYBA 3CRUA 3D6IA 1MDKA 1PSQA 3OR5A 1EGOA 1SL2B 1MDIA 1B8XA 5HFKA 2YV9A 1G6YA 3EU4A 1EOGA 3M9KA 3IPZA 8GSSA 2RUFA 2GSQA 4HJMA 3GTUA 1GNWA 4KCEA 1GTUA 2X64A 1S3CA 3VI5A 2DSAA 6GSTA 3GN3A 1TTZA 3IAM2 3QMXA 4KE3A 3JCML 2X8HA 2G2QA 2V32A 5CNWA 1YEXA 2FWHA 3KM6A 1QUWA 1NHOA 3O76A 3KH7A 1OAZA 4KB3A 3UL3A 5D9XA 22GSA 1H4OA 1PN9A 3FZ9A 3P90A 3US3A 4DSRA 3MIXA 3QFBC 1PKZA 1ACVA 1K0DA 20GSA 1V9WA 4MF6A 4IQAA 5FWGA 13GSA 3KD0A 3RAZA 3J7Yk 5IOXA 3CXGA 3DWVA 4KA0A 3IK9A 1GUHA 5IQYA 3GKKA 2VLTA 1VRSD 3HJOA 1XWGA 4JZQA 4K2DA 5E4WA 4DSQA 5AIXA 3QPMA 3P8WA 4V2LA 4QQ7A 5HR2A 4CY6A 1M2BA 4V2MA 4MLYA 1DE1A 3TCOA 3D4MA 3EWLA 4GCIA 2H6XA 5CRHA 2YP6A 3MNGA 2VCQA 3TKSA 3LW9A 4L5LA 3EE2A 4BVYB 2MMOA 4ZBAA 4L8EA 2H73A 4KW6A 3V1WA 1JHBA 1XZOA 3DGQA 3LXZA 2HNLA 3PGTA 1ZYPA 4ZL7A 5KN1A 5JCGA 1ZYNA 2WDUA 4YQUA 3DYRA 1PL1A 1FW1A 4YAVA 4GWRA 5HFIA 3IE3A 2ALBA 1JZDA 2F8FA 16GSA 3GKNA 2I81A 3GURA 1THOA 1AIUA 2KUCA 1XBSA 4GSSA 2H6YA 3J7Yb 1SK1A 4IHUA 4E8HA 1I9DA 4ISDA 2VL3A 2P5QA 5ECRB 2I1UA 3HVXA 1GULA 2DC5A 3HVNA 2PUKC 4Q5RA 5J3RA 1GSYA 5IMZA 5HR3A 5B6MA 5ECQB 2LNSA 3FRCA 3VURA 2P0GA 3FR9A 3ZMLA 1S3AA 3M3MA 5D8IA 3GH9A 2C1YA 4NHWA 1K3LA 5H5SA 1SD9A 2CV4A 5D73A 2N5FA 3HVSA 4JR6A 3CSIA 3GFKA 4V1Ap 4EUYA 1AAZA 2A4HA 3GKXA 4TOPA 5CP1A 1M7TA 2OBKA 4GF0A 4WR5A 1F6MC 2WJUA 1SK0A 2GQMA 2VL2A 1R4WA 4Z2UA 1XVQA 3CSHA 1ABAA 3ZZXA 4RI6A 4PNGA 4EKZA 1TW9A 2OKAA 2V2GA 3NIVA 3ZIJA 5CRWA 3A5WA 4K9ZA 2K8SA 4G19A 1XPVA 2F51A 4MH3A 1J08A 5L71A 1TRSA 3F8UA 3D0ZA 1UN2A 1U3IA 1OYJA 2VCVA 4N11A 4TR3A 3A5IA 11GSA 1FOVA 3G7JA 3Q19A 3G7YA 4OO4A 3NZNA 4K7NA 3RHCA 1Z5YE 4I8BA 4TR1B 1Z6NA 3MWHA 2FA4A 4WEYA 3EMPA 3DIEA 2DJ1A 5ENUA 4POLA 1PFOA 2WZ9A 1TXXA 3A2XA 2WFCA 4XRDA 2H1GA 3TRPA 2HFDA 4NAXA 5EPFA 1M3IA 1K0MA 2IIYA 3EURA 1X5DA 3GRXA 2IJYA 2LNTA 1M2AA 1K3OA 3QFAC 2IMDA 3U5RE 4BWQA 3L78A 1F9MA 4QL7A 4G0LA 2JZRA 1GTAA 2MZCA 1ZMAA 1G6WA 3VI7A 4F0BA 2F8AA 2WCIA 1TI1A 1LJRA 3UVHA 1QK8A 3LEFA 5COHA 3TKQA 4L0WA 3GSSA 4TR0A 3FKFA 1PGTA 2TIRA 4OO5A 3UBLA 2H70A 1O8WA 1O7UA 2LV3A 4GLTA 1YZXA 5G1LA 3EPTA 2R4VA 5H5RA 4MA9A 3CTFA 2O87A 2DJ3A 2LKUA 2PGTA 5DCHA 4GQCA 6GSWA 2V6OA 3G9BA 2AJQB 2MMAA 1PA3A 4FO5A 1SYRA 4HOJA 5CRGA 4CY8A 3IRAA 5ABRA 4GSNA 3AY8A 2B5XA 3ZRDA 1ERUA 2RM6A 1Y6EA 3TKPA 1M3JA 3NOFA 2HYXA 3M1GA 1B9XC 4IJIA 3RDWA 1OC3A 4OMVA 1RQMA 4HQZA 5DJMA 1UC7A 1AW9A 3IC8A 2YJHA 1QFNA 2GZPA 3E3EA 1CQHA 2C0DA 3HXSA 5DQYA 4A5PA 4TRXA 2HZEB 5CRDA 3FW2A 3PH9A 4BVYA 1VF4A 4XRAA 5IMDA 4N30A 2IFQB 2I3YA 1V58A 5IO0A 5IIZA 1OE8A 4BVXA 2FWEA 1O6JA 2I4AA 1W4VA 3FYGA 4EDYA 2D2ZA 1PN0A 4ZIJA 5LNKe 3DEXA 3DVXA 2O85A 3VFIA 1FAAA 2C80A 4OCFA 2F9SA 3UARA 4HQSA 4K6XA 1EV4A 2L59A 2F3MA 5HR1A 3FZAA 2QA2A 2QC7A 4Z7XA 1F3AA 4Q5NA 2FWGA 4K1FA 5GZZB 3FEUA 1EOHA 2O89A 2M46A 1TK8B 2GT5A 1GSSA 1V98A 3M9JA 3GH6A 2H72A 4IP1A 4CHSA 2VIMA 2E2GA 5GSTA 2YWMA 2WGRA 3CRTA 4PUFC 2FWFA 5JWOB 2B6MA 3M0FA 3KIJA 4NMUA 5D93A 1F37A 2OACA 5BRTA 3QDNA 2WS2A 1QXHA 3UBKA 3S9FA 4X0XA 1TDIA 2BJXA 3ISOA 3C71A 3CQFA 4TVEA 2C0EA 2RUEA 2GS3A 1GUKA 2LRCA 3QCPA 4HEA2 3TRQA 2YCDA 3LGCA 2WULA 1A0RP 4EF0A 1A2LA 3P2AA 4TXVA 4RUVA 4IGJA 5G5FA 5DAKA 5DCGA 4TR1A 5F07A 5CO3A 5H5QA 4PUAA 2LQQA 2OA7A 2XPEA 4HSCX 2L5OA 3PINA 1R5AA 1GRXA 5ECPB 5B7CA 4ZILA 2VL9A 5ID2A 4MH2A 2C0GA 4FYUA 2QA1A 1SJ6A 2CAIA 5J41A 3HDCA 4IJ3A 2TRXA 1A8LA 3VWWA 1IYIA 3APSA 1YKAA 2YWOA 4GTUA 2LS5A 3KZQA 3F0IA 2NTOA 3E0UA 2GSRA 5GSSA 3IC4A 3PR8A 1GH2A 4KDYA 2RIIA 2PU9C 1OE7A 2IWTA 4KSOA 5G2ZA 1WRYA 1OVNA 3F3QA 1TU7A 5LD0A 1EZKA 2X4AA 5B6NA 3HZ8A 1OKTA 3O3TA 2H0GA 1BQ7A 3TOTA 1S3DA 1YQ1A 4LLRA 1OKDA 2EC4A 4KSMA 3VWUA 2P5RA 6GSVA 2H1BA 4GSTA 4BA7A 4FH8A 4IW9A 1MTCA 1FVJA 3QD9A 4K2XA 4IN0A 3ZFBA 3CSJA 2M80A 1AXDA 1XWAA 4IVFA 4NPBA 3UVTA 2H75A 1XXUA 4MF5A 2V1MA 1ON4A 4IBPA 3IBHA 5D9VA 2IMEA 4BL7B 4XS6A 2JZSA 1N2AA 2VL2C 1Q98A 1H75A 2IFQA 1GSEA 5F06A 4HJ2A 3HVVA 4KH7A 5AGYA 2NPBA 3HYPA 18GSA 4POBA 1KTEA 1HQOA 3FZ5A 1F2EA 2VLVA 2MMNA 3GUSA 2K18A 3C1RA 4K7OA 2CA8A 3LORA 2R0GA 2H0IA 1PRXA 4EDZA 4KX4A 6GSUA 3EMXA 1J0FA 2FLSA 3FY7A 3K8NA 2HLSA 4K0NA 4BWSA 1ZOFA 5DQSA 1J9BA 4WETA 5A4VA 2O8VB 4PTSA 4JBBA 3LYKA 2DJ2A 1X5CA 1SJIA 3TDGA 2HRNA 2A2RA 2AHEA 2H1DA 4NWYA 3VLNA 5F0GA 3MAKA 2A2SA 3L9UA 1VF3A 2XHFA 2AYTA 2DMMA 3RBTA 1M99A 4D73B 4F2IA 3WT1A 2B3SA 2FY6A 1DE2A 1O85A 3D22A 4ECIA 4ID0A 2GGTA 4LMVA 2FGXA 1FB6A 1ZYQB 1ZCPA 4DSSB 2NDOA 5IMVA 2E0QA 3ZIVA 1TK0B 2XPDA 4G10A 3O6TA 1B4PA 2JSZA 3KGKA 2GLRA 1JFUA 1K0BA 3HJPA 2Z9SA 2K8VA 3RPNA 3UAPA 5ECMB 3N5OA 1B4QA 4XCSA 4F9ZA 3DD3A 5BMUA 4OFMA 5KN2A 1M2DA 3W6GA 2CX3A 4IP6A 4MMMA 1YJ6A 2M72A 1UA5A 1GLQA 4Q5FA 3DVWA 5ECIB 1WP0A 1GWCA 2WRTA 5KOXA 5DDLA 3GNJA 4KDXA 2R2JA 1FOHA 2L4QA 1A0FA 2K6VA 2LEGA 7GSSA 3ZMKA 3IK7A 1PD21 1PX6A 4MZBA 2O7KA
chains in the Genus database with same CATH topology
3F4RA 2CQ9A 3G7IA 2CX4A 4KGIA 4N0ZA 5EL8A 1SL1B 2DKIA 3EINA 4J56E 4TN8A 5JCWA 2LRTA 4WBRD 2IN3A 1BYEA 2CT6A 5IPGA 2N5BA 1K0AA 2MBTA 4E8EA 1AUCA 2DJJA 4NXIA 2OBIA 4TW5A 2EIQA 3KTBA 1YEPA 4AJ8A 3WD6A 4GRFA 5EY6A 5F05A 5JCUA 4WKWA 2HSYA 4G9HA 4G0IA 2H1AA 4V2NA 4HDEA 1U88A 2H76A 2H01A 6GSSA 4KDUA 4RQRA 5ECNB 3VK9A 2X99A 3HY2A 4IS0A 19GSA 2AAWA 5FT3A 4ZL9A 1GLPA 1JZRA 5IMCA 4LA1A 2AV4A 3ZVJD 2B5YA 5J4UA 1N8JA 2L57A 4LMWA 4EL1A 3Q74A 1PMTA 2HRAA 1BJXA 2GDRA 2KP2A 4KCAA 2J9HA 2VCZA 3ZLPA 5IMFA 4JR4A 2IL3A 1XFLA 2H30A 3APOA 1F3BA 1HNBA 1T3BA 3L9SA 4HU7A 3UIWA 4BL7A 2VAFA 2VD0A 1NW2A 3FMWA 3C1SA 3C7MA 2B5EA 2X8CA 2R3XA 3D21A 5IPHA 5ELGA 2HXKA 1AQVA 2PVQA 2FNOA 4AJ6A 2HRFA 5FHIA 3D4TA 4MJEA 4CDOA 1MD4A 3R2QA 3FR3A 1XWCA 4O5RA 1X5EA 3QAVA 5J5NA 1TI3A 2H0HA 3TJJA 3LXTA 4L5OA 3TRXA 4YQVA 4ZBBA 1A8YA 3MYDA 1GL8A 1T4ZA 4Z2RA 2G0FA 1SKSB 1A2JA 2X8GA 4AF2A 4HZ2A 1VF1A 3KEBA 4EO3A 3WGEA 4G2EA 3GIXA 1DUGA 4YKFA 3F4SA 2JADA 3HA9A 4NV5A 1HD2A 4ECCA 3H4KA 2C3QA 2P31A 2PMTA 4D73A 2PBJA 2BTOT 3RHBA 1GSQA 1WJKA 4MJAA 4XS4B 3M8NA 4JE1A 1FG4A 2GVPA 2VD1A 4TKYA 1O73A 3TJFA 3KP9A 1Q4JA 3DMLA 4ZL8A 4ACSA 4EIQA 3BJ5A 3GKMA 4O32A 4WBJA 4WF4A 4ZXGA 2PWJA 5J9BA 3SWLA 2R0CA 4JRRA 1A23A 1G7EA 4ZB8A 2H19A 1ST9A 3EYTA 1MEKA 1TRVA 5D9TA 5CREA 3BCIA 1AQWA 1YF1A 2YOIA 1R26A 1M0UA 4RI7A 5HQPA 3KMNA 5DBQA 1T8EB 2DBCA 1SKWB 4QL9A 1U6TA 1U87A 4BPYA 1K0NA 2LQOA 4XTSA 1NSWA 3TJKA 3GYKA 2ES7A 5D9WA 1BX9A 4AGSA 1XOAA 3BBYA 2OE0A 4I5QA 4Z2TA 3FR6A 1GNEA 3ZITA 3KXOA 3TKSC 3I69A 4HU9A 2HZFA 4MJBA 1Z9HA 2WB9A 3UOMA 4I2TA 1ZZYA 2NBSA 2PERA 4O7HA 4PURA 2H66A 3H79A 3CTGA 2C4JA 2R37A 4PGTA 5DVBA 2H8LA 1R5PA 1QQ2A 1Z3EA 5G30A 4WF5A 3LSZA 2YWIA 4Q5QA 5D96A 3QR6A 4MCUA 3KMOA 2ON5A 5E59A 5KN3A 3UEMA 1WOUA 4IQ1A 2LJAA 1DBYA 2MBSA 2KLXA 2TRCP 2EIRA 1T00A 3ZREA 4EIPA 4HZ4A 1SD8A 4PXOA 3ME8A 2YZUA 3KTLA 3TJGA 1HNCA 1USBA 1EP8A 1GUMA 3WT2A 1G0TA 2HE3A 2YWNA 3GMFA 3L4NA 2GSTA 4TXOB 1G7OA 2VLUA 1YDKA 5ECOB 3ME7A 3DKSA 4GXZA 1UVZA 1KEBA 4ULXA 2VCXA 2VCWA 2DKHA 2CZ2A 3HD5A 1M9AA 2H6ZA 4EC0A 4WR4A 4XHMA 1ERWA 1GTIA 4FYCA 4EXJA 1HYUA 1TU8A 4NHZA 2HZEA 2KP1A 2B7KA 1JLVA 1XWKA 2XBIA 3LWAA 1TOFA 1NHYA 1Z7RA 5IM9A 3WYWA 3IXRA 4J57E 2CZ3A 3TGZA 3IOSA 3BOAA 1HNAA 3ERGA 4J2FA 1CQGA 3ZL5A 2DJ0A 2VM1A 2LJRA 4OD7A 3CMIA 2C8UA 2K9FA 2R6KA 4ML1A 1JZOA 3IR4A 2L4CA 4MF7A 10GSA 6GSYA 2R0PA 4X43A 4K8MA 1YY7A 5A4WA 2B7JA 1PL2A 3QAWA 3F3RA 5G1KA 3ZYWA 2VCTA 4CW9A 3W8SA 4IKHA 2E7PA 4MDCA 3A3TA 3L9VA 5ELAA 4BVXB 4ILFA 5HFGA 3IA1A 5KN0A 4N10A 4O5QA 1ERVA 3IAS2 2GZYA 2C3TA 1LBKA 1V2AA 5CYYA 3F63A 3IDVA 1FHEA 4XS4A 4AJ7A 5AISA 1K0OA 2R5GA 4MP4A 1DSBA 1GSFA 2V6KA 5DALB 1T4YA 3ERFA 1VF2A 4L0UA 1XW6A 1QMVA 5CAXA 3QAGA 1O81A 2L6DA 1X0RA 2AB6A 2QKEA 1WPIA 1OC9B 2MMZA 2PVOC 3H8QA 4OCEA 2HRKA 4ECJA 4YQMA 3GHAA 2YV7A 2JACA 2LJKA 2CVBA 4K5RA 1RK4A 2RLIA 4OWYA 4I2UA 4DVCA 5G31A 5IOWA 2YNXA 2XC2A 1T7PB 2RM5A 4HUAA 2HI7A 3MDKA 3APQA 1X9MB 4EVMA 14GSA 5B8BA 2FUG2 2CAQA 5ECHB 1TRWA 2X49A 2J23A 5A5KA 3DXBA 1ZGNA 4NV2A 3ERWA 4KUNA 4H86A 1SYXA 2LSTA 2OE1A 1R7HA 2GQKA 1PQNA 3VWVA 3W8JA 1M9BA 1Y25A 1O8XA 3CBUA 5KEJA 4MK3A 2IMKA 2OE3A 4P3YB 5GAPD 2BMXA 1EV9A 1ML6A 1V40A 2FCHA 4F0CA 1EWXA 2V41A 4LL1B 2C3NA 1SJZA 4X1UA 1GTBA 2HT9A 1MD3A 3Q6OA 3EU3A 2YJ7A 4HS1A 2DLXA 2GTUA 4PQ1A 4EE0A 2IPAA 4DEJA 2ZUPA 5DAKB 1XWBA 3KCMA 4F03A 4MPFA 1YKCA 1E2YA 5LCZA 3CYNA 4PNFA 3TJBA 9GSSA 3HJMA 5IMAA 5J9CA 1OC8A 3GL5A 3SBCA 3HKRA 3BCKA 4ZBDA 4MJCA 3ZTLA 1C72A 1ILOA 3WGXA 3GSTA 4ML6A 1WE0A 5ID2B 3GL3A 1GSUA 1MDJA 2ON7A 2PN8A 4ECBA 3H93A 1ZYEA 2E2MA 2YZHA 3EC3A 2LTKA 4WXTA 1JLWA 2L5LA 2B1KA 3Q18A 1WIKA 3VPQA 2LUSA 4KF9A 5A4UA 12GSA 3GTUB 1I5GA 3E9JB 3FK8A 1A2MA 2NVLA 4TXOA 1VGLA 1X9SB 1FVKA 2OJLA 4XS1A 5C04A 1E6BA 4O5UA 2JL4A 1IYHA 1XOBA 3I9V2 3QOUA 1RW1A 2HSHA 1XCCA 3KH9A 5AN1A 1BG5A 1XW5A 4V1Ag 2GSSA 3A2WA 2JU5A 4YH2A 5GAND 3D5JA 1LU4A 4JU5A 4MABA 4MNNA 4K5SA 1EGRA 4PX1A 2IMFA 1FB0A 3IHGA 1KNGA 4G0KA 4YAPA 3TOUA 2YANA 5HR0A 4PQHA 4FIWA 3MSZA 4F82A 5JWQB 1FO5A 3N9JA 2AUVA 1X9WB 2C0FA 17GSA 2REMA 5AIVA 1B48A 3TKSE 1PX7A 2I9HA 2FD3A 2CVKA 2LRNA 4X4JA 2VO4A 4TR4A 3C8EA 4PQIA 3F6FA 1V57A 1T1VA 1U3AA 3GX8A 4ICYA 2H71A 3I6AA 3PPUA 4ZB9A 1TKDB 2MYGA 3LQ7A 1TRUA 3TKRA 1SKRB 3VPTA 3U6VA 3HZ4A 1WMJA 2DIZA 2GT6A 5KOWA 5EVOA 1NM3A 2PPTA 1SU9A 3TUEA 1Z7PA 3KJYA 4JEDA 2UZ8A 3F6DA 4MPGA 2H74A 1TK5B 3TB2A 1SENA 2GQLA 2FHEA 3F9UA 2VM2A 3VWXA 4GQFA 3HCZA 4N0VA 2YN1A 3IV4A 3R3EA 1KBNA 5DALA 2GZZA 4POKA 1XW9A 2ZCTA 1BEDA 2ZNMA 3UJ1A 3LFLA 2DIYA 4DSSA 1SK2A 1OC9A 1THXA 1QGVA 5IO2A 5ECLB 1TJDA 2IMIA 2CVDA 3GA4A 3LJRA 3EVIA 4HI7A 3L0HA 2XBQA 3H1NA 2B1LA 4MZCA 5ECKB 3ED3A 4YKGA 3ZVJA 1JZWA 2JSYA 1YF0A 2YPMA 3A2VA 3C73A 4XIHA 4KNDA 3IHQA 1GP1A 4USSA 2KHPA 2A2PA 4K7IA 4FQUA 2QGVA 2HSMA 1AQXA 3KP8A 5DJLA 2A4VA 4MZWA 4OFTA 1XVWA 3HHVA 3UMAA 2VOCA 1A24A 4KAEA 3ZFLA 2OADA 4I6XA 4OFNA 2VUPA 6GSXA 1WWJA 2FA8A 3LYPA 1AC1A 4ZB6A 5JWRB 3FZ4A 5ECSA 1EEJA 3I43A 5B8AA 1EEMA 1PKWA 2DJKA 4I97A 2DMLA 5G5EA 5C00A 1K3YA 3RPPA 3GX0A 5F8BA 1SL0B 2KOKA 1BAYA 4POMA 4IELA 2JZTA 1ZL9A 4LL4B 2N5AA 2QSIA 1K0CA 3WGDA 1B9YC 3BD2A 4O92A 5INYA 1EP7A 2EIOA 1ERTA 3DRNA 1URMA 4K0GA 4RQXA 1TP9A 3FHKA 2L6CA 1Z6MA 3GV1A 3P7XA 1W89A 3F4TA 1GSDA 3LG6A 1XIYA 4FYBA 3CRUA 3D6IA 1MDKA 1PSQA 3OR5A 1EGOA 1SL2B 1MDIA 1B8XA 5HFKA 2YV9A 1G6YA 3EU4A 1EOGA 3M9KA 3IPZA 8GSSA 2RUFA 2GSQA 4HJMA 3GTUA 1GNWA 4KCEA 1GTUA 2X64A 1S3CA 3VI5A 2DSAA 6GSTA 3GN3A 1TTZA 3IAM2 3QMXA 4KE3A 3JCML 2X8HA 2G2QA 2V32A 5CNWA 1YEXA 2FWHA 3KM6A 1QUWA 1NHOA 3O76A 3KH7A 1OAZA 4KB3A 3UL3A 5D9XA 22GSA 1H4OA 1PN9A 3FZ9A 3P90A 3US3A 4DSRA 3MIXA 3QFBC 1PKZA 1ACVA 1K0DA 20GSA 1V9WA 4MF6A 4IQAA 5FWGA 13GSA 3KD0A 3RAZA 3J7Yk 5IOXA 3CXGA 3DWVA 4KA0A 3IK9A 1GUHA 5IQYA 3GKKA 2VLTA 1VRSD 3HJOA 1XWGA 4JZQA 4K2DA 5E4WA 4DSQA 5AIXA 3QPMA 3P8WA 4V2LA 4QQ7A 5HR2A 4CY6A 1M2BA 4V2MA 4MLYA 1DE1A 3TCOA 3D4MA 3EWLA 4GCIA 2H6XA 5CRHA 2YP6A 3MNGA 2VCQA 3TKSA 3LW9A 4L5LA 3EE2A 4BVYB 2MMOA 4ZBAA 4L8EA 2H73A 4KW6A 3V1WA 1JHBA 1XZOA 3DGQA 3LXZA 2HNLA 3PGTA 1ZYPA 4ZL7A 5KN1A 5JCGA 1ZYNA 2WDUA 4YQUA 3DYRA 1PL1A 1FW1A 4YAVA 4GWRA 5HFIA 3IE3A 2ALBA 1JZDA 2F8FA 16GSA 3GKNA 2I81A 3GURA 1THOA 1AIUA 2KUCA 1XBSA 4GSSA 2H6YA 3J7Yb 1SK1A 4IHUA 4E8HA 1I9DA 4ISDA 2VL3A 2P5QA 5ECRB 2I1UA 3HVXA 1GULA 2DC5A 2PUKC 4Q5RA 5J3RA 1GSYA 5IMZA 5HR3A 5B6MA 5ECQB 2LNSA 3FRCA 3VURA 2P0GA 3FR9A 3ZMLA 1S3AA 3M3MA 5D8IA 3GH9A 2C1YA 4NHWA 1K3LA 5H5SA 1SD9A 2CV4A 5D73A 2N5FA 3HVSA 4JR6A 3CSIA 3GFKA 4V1Ap 4EUYA 1AAZA 2A4HA 3GKXA 4TOPA 5CP1A 1M7TA 2OBKA 4GF0A 4WR5A 1F6MC 2WJUA 1SK0A 2GQMA 2VL2A 1R4WA 4Z2UA 1XVQA 3CSHA 1ABAA 3ZZXA 4RI6A 4PNGA 4EKZA 1TW9A 2OKAA 2V2GA 3NIVA 3ZIJA 5CRWA 3A5WA 4K9ZA 2K8SA 4G19A 1XPVA 2F51A 4MH3A 1J08A 5L71A 1TRSA 3F8UA 3D0ZA 1UN2A 1U3IA 1OYJA 2VCVA 4N11A 4TR3A 3A5IA 11GSA 1FOVA 3G7JA 3Q19A 3G7YA 4OO4A 3NZNA 4K7NA 3RHCA 1Z5YE 4I8BA 4TR1B 1Z6NA 3MWHA 2FA4A 4WEYA 3EMPA 3DIEA 2DJ1A 5ENUA 4POLA 2WZ9A 1TXXA 3A2XA 2WFCA 4XRDA 2H1GA 3TRPA 2HFDA 4NAXA 5EPFA 1K0MA 2IIYA 3EURA 1X5DA 3GRXA 2IJYA 2LNTA 1M2AA 1K3OA 3QFAC 2IMDA 3U5RE 4BWQA 3L78A 1F9MA 4QL7A 4G0LA 2JZRA 1GTAA 2MZCA 1ZMAA 1G6WA 3VI7A 4F0BA 2F8AA 2WCIA 1TI1A 1LJRA 3UVHA 1QK8A 3LEFA 5COHA 3TKQA 4L0WA 3GSSA 4TR0A 3FKFA 1PGTA 2TIRA 4OO5A 3UBLA 2H70A 1O8WA 1O7UA 2LV3A 4GLTA 1YZXA 5G1LA 3EPTA 2R4VA 5H5RA 4MA9A 3CTFA 2O87A 2DJ3A 2LKUA 2PGTA 5DCHA 4GQCA 6GSWA 2V6OA 3G9BA 2AJQB 2MMAA 1PA3A 4FO5A 1SYRA 4HOJA 5CRGA 4CY8A 3IRAA 5ABRA 4GSNA 3AY8A 2B5XA 3ZRDA 1ERUA 2RM6A 1Y6EA 3TKPA 3NOFA 2HYXA 3M1GA 1B9XC 4IJIA 3RDWA 1OC3A 4OMVA 1RQMA 4HQZA 5DJMA 1UC7A 1AW9A 3IC8A 2YJHA 1QFNA 2GZPA 3E3EA 1CQHA 2C0DA 3HXSA 5DQYA 4A5PA 4TRXA 2HZEB 5CRDA 3FW2A 3PH9A 4BVYA 1VF4A 4XRAA 5IMDA 4N30A 2IFQB 2I3YA 1V58A 5IO0A 5IIZA 1OE8A 4BVXA 2FWEA 1O6JA 2I4AA 1W4VA 3FYGA 4EDYA 2D2ZA 1PN0A 4ZIJA 5LNKe 3DEXA 3DVXA 2O85A 3VFIA 1FAAA 2C80A 4OCFA 2F9SA 3UARA 4HQSA 4K6XA 1EV4A 2L59A 2F3MA 5HR1A 3FZAA 2QA2A 2QC7A 4Z7XA 1F3AA 4Q5NA 2FWGA 4K1FA 5GZZB 3FEUA 1EOHA 2O89A 2M46A 1TK8B 2GT5A 1GSSA 1V98A 3M9JA 3GH6A 2H72A 4IP1A 4CHSA 2VIMA 2E2GA 5GSTA 2YWMA 2WGRA 3CRTA 4PUFC 2FWFA 5JWOB 2B6MA 3M0FA 3KIJA 4NMUA 5D93A 1F37A 2OACA 5BRTA 3QDNA 2WS2A 1QXHA 3UBKA 3S9FA 4X0XA 1TDIA 2BJXA 3ISOA 3C71A 4TVEA 2C0EA 2RUEA 2GS3A 1GUKA 2LRCA 3QCPA 4HEA2 3TRQA 2YCDA 3LGCA 2WULA 1A0RP 4EF0A 1A2LA 3P2AA 4TXVA 4RUVA 4IGJA 5G5FA 5DAKA 5DCGA 4TR1A 5F07A 5CO3A 5H5QA 4PUAA 2LQQA 2OA7A 2XPEA 2L5OA 3PINA 1R5AA 1GRXA 5ECPB 5B7CA 4ZILA 2VL9A 5ID2A 4MH2A 2C0GA 4FYUA 2QA1A 1SJ6A 2CAIA 5J41A 3HDCA 4IJ3A 2TRXA 1A8LA 3VWWA 1IYIA 3APSA 1YKAA 2YWOA 4GTUA 2LS5A 3KZQA 3F0IA 2NTOA 3E0UA 2GSRA 5GSSA 3IC4A 3PR8A 1GH2A 4KDYA 2RIIA 2PU9C 1OE7A 2IWTA 4KSOA 5G2ZA 1WRYA 1OVNA 3F3QA 1TU7A 5LD0A 1EZKA 2X4AA 5B6NA 3HZ8A 1OKTA 3O3TA 2H0GA 1BQ7A 3TOTA 1S3DA 1YQ1A 4LLRA 1OKDA 2EC4A 4KSMA 3VWUA 2P5RA 6GSVA 2H1BA 4GSTA 4BA7A 4FH8A 4IW9A 1MTCA 1FVJA 3QD9A 4K2XA 4IN0A 3ZFBA 3CSJA 2M80A 1AXDA 1XWAA 4IVFA 4NPBA 3UVTA 2H75A 1XXUA 4MF5A 2V1MA 1ON4A 4IBPA 3IBHA 5D9VA 2IMEA 4BL7B 4XS6A 2JZSA 1N2AA 2VL2C 1Q98A 1H75A 2IFQA 1GSEA 5F06A 4HJ2A 3HVVA 4KH7A 5AGYA 2NPBA 3HYPA 18GSA 4POBA 1KTEA 1HQOA 3FZ5A 1F2EA 2VLVA 2MMNA 3GUSA 2K18A 3C1RA 4K7OA 2CA8A 3LORA 2R0GA 2H0IA 1PRXA 4EDZA 4KX4A 6GSUA 3EMXA 1J0FA 2FLSA 3FY7A 3K8NA 2HLSA 4K0NA 4BWSA 1ZOFA 5DQSA 1J9BA 4WETA 5A4VA 2O8VB 4PTSA 4JBBA 3LYKA 2DJ2A 1X5CA 1SJIA 3TDGA 2HRNA 2A2RA 2AHEA 2H1DA 4NWYA 3VLNA 5F0GA 3MAKA 2A2SA 3L9UA 1VF3A 2XHFA 2AYTA 2DMMA 3RBTA 1M99A 4D73B 4F2IA 3WT1A 2B3SA 2FY6A 1DE2A 1O85A 3D22A 4ECIA 4ID0A 2GGTA 4LMVA 2FGXA 1FB6A 1ZYQB 1ZCPA 4DSSB 2NDOA 5IMVA 2E0QA 3ZIVA 1TK0B 2XPDA 4G10A 3O6TA 1B4PA 2JSZA 3KGKA 2GLRA 1JFUA 1K0BA 3HJPA 2Z9SA 2K8VA 3RPNA 3UAPA 5ECMB 3N5OA 1B4QA 4XCSA 4F9ZA 3DD3A 5BMUA 4OFMA 5KN2A 1M2DA 3W6GA 2CX3A 4IP6A 4MMMA 1YJ6A 2M72A 1UA5A 1GLQA 4Q5FA 3DVWA 5ECIB 1WP0A 1GWCA 2WRTA 5KOXA 5DDLA 3GNJA 4KDXA 2R2JA 1FOHA 2L4QA 1A0FA 2K6VA 2LEGA 7GSSA 3ZMKA 3IK7A 1PD21 1PX6A 4MZBA 2O7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F4R A;  2CQ9 A;  3G7I A;  2CX4 A;  4KGI A;  4N0Z A;  5EL8 A;  1SL1 B;  3EIN A;  4J56 E;  4TN8 A;  5JCW A;  2LRT A;  4WBR D;  2IN3 A;  1BYE A;  2CT6 A;  5IPG A;  2N5B A;  1K0A A;  2MBT A;  4E8E A;  1AUC A;  2DJJ A;  4NXI A;  2OBI A;  4TW5 A;  2EIQ A;  3KTB A;  1YEP A;  4AJ8 A;  3WD6 A;  4GRF A;  5EY6 A;  5F05 A;  5JCU A;  4WKW A;  2HSY A;  4G9H A;  2H1A A;  4V2N A;  4HDE A;  1U88 A;  2H76 A;  2H01 A;  6GSS A;  4KDU A;  4RQR A;  5ECN B;  3VK9 A;  2X99 A;  3HY2 A;  4IS0 A;  19GS A;  2AAW A;  5FT3 A;  4ZL9 A;  1GLP A;  1JZR A;  5IMC A;  4LA1 A;  2AV4 A;  3ZVJ D;  2B5Y A;  5J4U A;  1N8J A;  2L57 A;  4LMW A;  4EL1 A;  3Q74 A;  1PMT A;  1BJX A;  2GDR A;  2KP2 A;  4KCA A;  2J9H A;  2VCZ A;  3ZLP A;  5IMF A;  4JR4 A;  2IL3 A;  1XFL A;  2H30 A;  3APO A;  1F3B A;  1HNB A;  1T3B A;  3L9S A;  4HU7 A;  3UIW A;  4BL7 A;  2VAF A;  2VD0 A;  1NW2 A;  3C1S A;  3C7M A;  2B5E A;  2X8C A;  2R3X A;  3D21 A;  5IPH A;  5ELG A;  2HXK A;  1AQV A;  2PVQ A;  2FNO A;  4AJ6 A;  2HRF A;  5FHI A;  3D4T A;  4MJE A;  4CDO A;  1MD4 A;  3R2Q A;  3FR3 A;  1XWC A;  4O5R A;  1X5E A;  3QAV A;  5J5N A;  1TI3 A;  2H0H A;  3TJJ A;  3LXT A;  4L5O A;  3TRX A;  4YQV A;  4ZBB A;  1A8Y A;  1GL8 A;  1T4Z A;  2G0F A;  1SKS B;  1A2J A;  2X8G A;  4AF2 A;  4HZ2 A;  1VF1 A;  3KEB A;  4EO3 A;  3WGE A;  4G2E A;  3GIX A;  1DUG A;  3F4S A;  2JAD A;  3HA9 A;  4NV5 A;  1HD2 A;  4ECC A;  3H4K A;  2C3Q A;  2P31 A;  2PMT A;  4D73 A;  2PBJ A;  2BTO T;  3RHB A;  1GSQ A;  1WJK A;  4MJA A;  4XS4 B;  3M8N A;  4JE1 A;  1FG4 A;  2GVP A;  2VD1 A;  4TKY A;  1O73 A;  3TJF A;  3KP9 A;  1Q4J A;  3DML A;  4ZL8 A;  4ACS A;  3BJ5 A;  3GKM A;  4O32 A;  4WBJ A;  4WF4 A;  4ZXG A;  2PWJ A;  5J9B A;  3SWL A;  4JRR A;  1A23 A;  1G7E A;  4ZB8 A;  2H19 A;  1ST9 A;  3EYT A;  1MEK A;  1TRV A;  5D9T A;  5CRE A;  3BCI A;  1AQW A;  1YF1 A;  2YOI A;  1R26 A;  1M0U A;  4RI7 A;  5HQP A;  3KMN A;  5DBQ A;  1T8E B;  2DBC A;  1SKW B;  4QL9 A;  1U6T A;  1U87 A;  4BPY A;  1K0N A;  2LQO A;  4XTS A;  1NSW A;  3TJK A;  3GYK A;  2ES7 A;  5D9W A;  1BX9 A;  4AGS A;  1XOA A;  3BBY A;  2OE0 A;  4I5Q A;  3FR6 A;  1GNE A;  3ZIT A;  3KXO A;  3TKS C;  3I69 A;  4HU9 A;  2HZF A;  4MJB A;  1Z9H A;  2WB9 A;  3UOM A;  4I2T A;  1ZZY A;  2NBS A;  2PER A;  4O7H A;  4PUR A;  2H66 A;  3H79 A;  3CTG A;  2C4J A;  2R37 A;  4PGT A;  5DVB A;  2H8L A;  1R5P A;  1QQ2 A;  1Z3E A;  5G30 A;  4WF5 A;  3LSZ A;  2YWI A;  4Q5Q A;  5D96 A;  3QR6 A;  4MCU A;  3KMO A;  2ON5 A;  5E59 A;  5KN3 A;  3UEM A;  1WOU A;  4IQ1 A;  2LJA A;  1DBY A;  2MBS A;  2KLX A;  2TRC P;  2EIR A;  1T00 A;  3ZRE A;  4HZ4 A;  1SD8 A;  4PXO A;  3ME8 A;  2YZU A;  3KTL A;  3TJG A;  1HNC A;  1USB A;  1EP8 A;  1GUM A;  3WT2 A;  1G0T A;  2HE3 A;  2YWN A;  3GMF A;  3L4N A;  2GST A;  4TXO B;  1G7O A;  2VLU A;  1YDK A;  5ECO B;  3ME7 A;  3DKS A;  4GXZ A;  1UVZ A;  1KEB A;  4ULX A;  2VCX A;  2VCW A;  2CZ2 A;  3HD5 A;  1M9A A;  2H6Z A;  4EC0 A;  4WR4 A;  4XHM A;  1ERW A;  1GTI A;  4FYC A;  4EXJ A;  1HYU A;  1TU8 A;  4NHZ A;  2HZE A;  2KP1 A;  2B7K A;  1JLV A;  1XWK A;  2XBI A;  3LWA A;  1TOF A;  1NHY A;  1Z7R A;  5IM9 A;  3WYW A;  3IXR A;  4J57 E;  2CZ3 A;  3TGZ A;  3IOS A;  3BOA A;  1HNA A;  3ERG A;  4J2F A;  1CQG A;  3ZL5 A;  2DJ0 A;  2VM1 A;  2LJR A;  4OD7 A;  3CMI A;  2C8U A;  2K9F A;  2R6K A;  4ML1 A;  1JZO A;  3IR4 A;  2L4C A;  4MF7 A;  10GS A;  6GSY A;  4X43 A;  4K8M A;  1YY7 A;  5A4W A;  2B7J A;  1PL2 A;  3QAW A;  3F3R A;  5G1K A;  3ZYW A;  2VCT A;  4CW9 A;  3W8S A;  4IKH A;  2E7P A;  4MDC A;  3A3T A;  3L9V A;  5ELA A;  4ILF A;  5HFG A;  3IA1 A;  5KN0 A;  4N10 A;  1ERV A;  3IAS 2;  2GZY A;  2C3T A;  1LBK A;  1V2A A;  5CYY A;  3F63 A;  3IDV A;  1FHE A;  4XS4 A;  4AJ7 A;  5AIS A;  1K0O A;  2R5G A;  4MP4 A;  1DSB A;  1GSF A;  2V6K A;  5DAL B;  1T4Y A;  3ERF A;  1VF2 A;  4L0U A;  1XW6 A;  1QMV A;  5CAX A;  3QAG A;  1O81 A;  2L6D A;  1X0R A;  2AB6 A;  2QKE A;  1WPI A;  1OC9 B;  2MMZ A;  2PVO C;  3H8Q A;  4OCE A;  4ECJ A;  4YQM A;  3GHA A;  2YV7 A;  2JAC A;  2LJK A;  2CVB A;  1RK4 A;  2RLI A;  4OWY A;  4I2U A;  4DVC A;  5G31 A;  5IOW A;  2YNX A;  2XC2 A;  1T7P B;  2RM5 A;  4HUA A;  2HI7 A;  3MDK A;  3APQ A;  1X9M B;  4EVM A;  14GS A;  5B8B A;  2FUG 2;  2CAQ A;  5ECH B;  1TRW A;  2J23 A;  5A5K A;  3DXB A;  1ZGN A;  4NV2 A;  3ERW A;  4KUN A;  4H86 A;  1SYX A;  2LST A;  2OE1 A;  1R7H A;  2GQK A;  1PQN A;  3VWV A;  3W8J A;  1M9B A;  1Y25 A;  1O8X A;  3CBU A;  5KEJ A;  4MK3 A;  2IMK A;  2OE3 A;  4P3Y B;  5GAP D;  2BMX A;  1EV9 A;  1ML6 A;  1V40 A;  2FCH A;  4F0C A;  1EWX A;  2V41 A;  4LL1 B;  2C3N A;  1SJZ A;  4X1U A;  1GTB A;  2HT9 A;  1MD3 A;  3Q6O A;  3EU3 A;  2YJ7 A;  4HS1 A;  2DLX A;  2GTU A;  4PQ1 A;  4EE0 A;  2IPA A;  4DEJ A;  2ZUP A;  5DAK B;  1XWB A;  3KCM A;  4F03 A;  4MPF A;  1YKC A;  1E2Y A;  5LCZ A;  3CYN A;  4PNF A;  3TJB A;  9GSS A;  3HJM A;  5IMA A;  5J9C A;  1OC8 A;  3GL5 A;  3SBC A;  3HKR A;  3BCK A;  4ZBD A;  4MJC A;  3ZTL A;  1C72 A;  1ILO A;  3WGX A;  3GST A;  4ML6 A;  1WE0 A;  5ID2 B;  3GL3 A;  1GSU A;  1MDJ A;  2ON7 A;  2PN8 A;  4ECB A;  3H93 A;  1ZYE A;  2E2M A;  2YZH A;  3EC3 A;  2LTK A;  4WXT A;  1JLW A;  2L5L A;  2B1K A;  3Q18 A;  1WIK A;  3VPQ A;  2LUS A;  5A4U A;  12GS A;  3GTU B;  1I5G A;  3E9J B;  3FK8 A;  1A2M A;  2NVL A;  4TXO A;  1VGL A;  1X9S B;  1FVK A;  2OJL A;  4XS1 A;  5C04 A;  1E6B A;  2JL4 A;  1IYH A;  1XOB A;  3I9V 2;  3QOU A;  1RW1 A;  2HSH A;  1XCC A;  3KH9 A;  5AN1 A;  1BG5 A;  1XW5 A;  4V1A g;  2GSS A;  3A2W A;  2JU5 A;  4YH2 A;  5GAN D;  3D5J A;  1LU4 A;  4JU5 A;  4MAB A;  1EGR A;  4PX1 A;  2IMF A;  1FB0 A;  1KNG A;  4YAP A;  3TOU A;  2YAN A;  5HR0 A;  4PQH A;  4FIW A;  3MSZ A;  4F82 A;  5JWQ B;  1FO5 A;  3N9J A;  2AUV A;  1X9W B;  2C0F A;  17GS A;  2REM A;  5AIV A;  1B48 A;  3TKS E;  1PX7 A;  2I9H A;  2FD3 A;  2CVK A;  2LRN A;  2VO4 A;  4TR4 A;  3C8E A;  4PQI A;  3F6F A;  1V57 A;  1T1V A;  1U3A A;  3GX8 A;  2H71 A;  3I6A A;  4ZB9 A;  1TKD B;  2MYG A;  3LQ7 A;  1TRU A;  3TKR A;  1SKR B;  3VPT A;  3U6V A;  3HZ4 A;  1WMJ A;  2DIZ A;  2GT6 A;  5EVO A;  1NM3 A;  2PPT A;  1SU9 A;  3TUE A;  1Z7P A;  3KJY A;  4JED A;  3F6D A;  4MPG A;  2H74 A;  1TK5 B;  3TB2 A;  1SEN A;  2GQL A;  2FHE A;  3F9U A;  2VM2 A;  3VWX A;  4GQF A;  3HCZ A;  4N0V A;  2YN1 A;  3IV4 A;  1KBN A;  5DAL A;  2GZZ A;  4POK A;  1XW9 A;  2ZCT A;  1BED A;  2ZNM A;  3UJ1 A;  3LFL A;  2DIY A;  4DSS A;  1SK2 A;  1OC9 A;  1THX A;  1QGV A;  5IO2 A;  5ECL B;  1TJD A;  2IMI A;  2CVD A;  3GA4 A;  3LJR A;  3EVI A;  4HI7 A;  3L0H A;  2XBQ A;  3H1N A;  2B1L A;  4MZC A;  5ECK B;  3ED3 A;  3ZVJ A;  1JZW A;  2JSY A;  1YF0 A;  2YPM A;  3A2V A;  3C73 A;  4XIH A;  4KND A;  3IHQ A;  1GP1 A;  2KHP A;  4K7I A;  2QGV A;  3KP8 A;  1AQX A;  5DJL A;  2A4V A;  4MZW A;  4OFT A;  1XVW A;  3HHV A;  3UMA A;  2VOC A;  1A24 A;  4KAE A;  3ZFL A;  2OAD A;  4I6X A;  4OFN A;  2VUP A;  6GSX A;  1WWJ A;  2FA8 A;  3LYP A;  1AC1 A;  4ZB6 A;  5JWR B;  3FZ4 A;  5ECS A;  1EEJ A;  3I43 A;  5B8A A;  1EEM A;  1PKW A;  2DJK A;  4I97 A;  2DML A;  5G5E A;  5C00 A;  1K3Y A;  3RPP A;  3GX0 A;  5F8B A;  1SL0 B;  2KOK A;  1BAY A;  4POM A;  4IEL A;  2JZT A;  1ZL9 A;  4LL4 B;  2N5A A;  2QSI A;  1K0C A;  3WGD A;  1B9Y C;  3BD2 A;  4O92 A;  5INY A;  1EP7 A;  2EIO A;  1ERT A;  3DRN A;  1URM A;  4K0G A;  4RQX A;  1TP9 A;  3FHK A;  2L6C A;  1Z6M A;  3GV1 A;  3P7X A;  1W89 A;  3F4T A;  1GSD A;  3LG6 A;  1XIY A;  4FYB A;  3CRU A;  3D6I A;  1MDK A;  1PSQ A;  3OR5 A;  1EGO A;  1SL2 B;  1MDI A;  1B8X A;  5HFK A;  2YV9 A;  1G6Y A;  3EU4 A;  1EOG A;  3M9K A;  3IPZ A;  8GSS A;  2RUF A;  2GSQ A;  4HJM A;  3GTU A;  1GNW A;  4KCE A;  1GTU A;  2X64 A;  1S3C A;  3VI5 A;  2DSA A;  6GST A;  3GN3 A;  1TTZ A;  3IAM 2;  3QMX A;  4KE3 A;  3JCM L;  2X8H A;  2G2Q A;  2V32 A;  5CNW A;  1YEX A;  2FWH A;  3KM6 A;  1QUW A;  1NHO A;  3O76 A;  3KH7 A;  1OAZ A;  4KB3 A;  3UL3 A;  5D9X A;  22GS A;  1H4O A;  1PN9 A;  3FZ9 A;  3P90 A;  3US3 A;  4DSR A;  3QFB C;  1PKZ A;  1ACV A;  1K0D A;  20GS A;  1V9W A;  4MF6 A;  4IQA A;  5FWG A;  13GS A;  3KD0 A;  3RAZ A;  3J7Y k;  5IOX A;  3CXG A;  3DWV A;  4KA0 A;  3IK9 A;  1GUH A;  5IQY A;  3GKK A;  2VLT A;  1VRS D;  3HJO A;  1XWG A;  4JZQ A;  4K2D A;  5E4W A;  4DSQ A;  5AIX A;  3QPM A;  3P8W A;  4V2L A;  4QQ7 A;  5HR2 A;  1M2B A;  4V2M A;  4MLY A;  1DE1 A;  3TCO A;  3D4M A;  3EWL A;  4GCI A;  2H6X A;  5CRH A;  2YP6 A;  3MNG A;  2VCQ A;  3TKS A;  4L5L A;  3EE2 A;  2MMO A;  4ZBA A;  4L8E A;  2H73 A;  4KW6 A;  3V1W A;  1JHB A;  1XZO A;  3DGQ A;  3LXZ A;  2HNL A;  3PGT A;  4ZL7 A;  5KN1 A;  5JCG A;  2WDU A;  4YQU A;  3DYR A;  1PL1 A;  1FW1 A;  4YAV A;  4GWR A;  5HFI A;  3IE3 A;  2ALB A;  1JZD A;  2F8F A;  16GS A;  3GKN A;  2I81 A;  3GUR A;  1THO A;  1AIU A;  2KUC A;  1XBS A;  4GSS A;  2H6Y A;  3J7Y b;  1SK1 A;  4IHU A;  4E8H A;  1I9D A;  4ISD A;  2VL3 A;  2P5Q A;  5ECR B;  2I1U A;  3HVX A;  1GUL A;  2DC5 A;  2PUK C;  4Q5R A;  5J3R A;  1GSY A;  5IMZ A;  5HR3 A;  5B6M A;  5ECQ B;  2LNS A;  3FRC A;  3VUR A;  2P0G A;  3FR9 A;  3ZML A;  1S3A A;  3M3M A;  5D8I A;  3GH9 A;  2C1Y A;  4NHW A;  1K3L A;  5H5S A;  1SD9 A;  2CV4 A;  5D73 A;  2N5F A;  3HVS A;  4JR6 A;  3CSI A;  3GFK A;  4V1A p;  4EUY A;  1AAZ A;  3GKX A;  4TOP A;  5CP1 A;  1M7T A;  2OBK A;  4GF0 A;  4WR5 A;  1F6M C;  2WJU A;  1SK0 A;  2GQM A;  2VL2 A;  1R4W A;  1XVQ A;  3CSH A;  1ABA A;  3ZZX A;  4RI6 A;  4PNG A;  4EKZ A;  1TW9 A;  2OKA A;  2V2G A;  3NIV A;  3ZIJ A;  5CRW A;  3A5W A;  4K9Z A;  2K8S A;  4G19 A;  1XPV A;  2F51 A;  4MH3 A;  1J08 A;  5L71 A;  1TRS A;  3F8U A;  3D0Z A;  1UN2 A;  1U3I A;  1OYJ A;  2VCV A;  4N11 A;  4TR3 A;  11GS A;  1FOV A;  3G7J A;  3Q19 A;  3G7Y A;  4OO4 A;  3NZN A;  4K7N A;  3RHC A;  1Z5Y E;  4I8B A;  4TR1 B;  1Z6N A;  3MWH A;  2FA4 A;  4WEY A;  3EMP A;  3DIE A;  2DJ1 A;  5ENU A;  4POL A;  2WZ9 A;  1TXX A;  3A2X A;  2WFC A;  4XRD A;  2H1G A;  3TRP A;  2HFD A;  4NAX A;  5EPF A;  1K0M A;  2IIY A;  3EUR A;  1X5D A;  3GRX A;  2IJY A;  2LNT A;  1M2A A;  1K3O A;  3QFA C;  2IMD A;  3U5R E;  4BWQ A;  3L78 A;  1F9M A;  4QL7 A;  2JZR A;  1GTA A;  2MZC A;  1ZMA A;  1G6W A;  3VI7 A;  4F0B A;  2F8A A;  2WCI A;  1TI1 A;  1LJR A;  3UVH A;  1QK8 A;  3LEF A;  5COH A;  3TKQ A;  4L0W A;  3GSS A;  4TR0 A;  3FKF A;  1PGT A;  2TIR A;  4OO5 A;  3UBL A;  2H70 A;  1O8W A;  1O7U A;  2LV3 A;  4GLT A;  1YZX A;  5G1L A;  2R4V A;  5H5R A;  4MA9 A;  3CTF A;  2O87 A;  2DJ3 A;  2LKU A;  2PGT A;  5DCH A;  4GQC A;  6GSW A;  2V6O A;  3G9B A;  2AJQ B;  2MMA A;  1PA3 A;  4FO5 A;  1SYR A;  4HOJ A;  5CRG A;  3IRA A;  5ABR A;  4GSN A;  3AY8 A;  2B5X A;  3ZRD A;  1ERU A;  2RM6 A;  1Y6E A;  3TKP A;  3NOF A;  2HYX A;  3M1G A;  1B9X C;  4IJI A;  3RDW A;  1OC3 A;  4OMV A;  1RQM A;  4HQZ A;  5DJM A;  1UC7 A;  1AW9 A;  2YJH A;  1QFN A;  2GZP A;  3E3E A;  1CQH A;  2C0D A;  3HXS A;  5DQY A;  4TRX A;  2HZE B;  5CRD A;  3FW2 A;  3PH9 A;  4BVY A;  1VF4 A;  4XRA A;  5IMD A;  4N30 A;  2IFQ B;  2I3Y A;  1V58 A;  5IO0 A;  5IIZ A;  1OE8 A;  4BVX A;  2FWE A;  1O6J A;  2I4A A;  1W4V A;  3FYG A;  4EDY A;  2D2Z A;  4ZIJ A;  5LNK e;  3DEX A;  3DVX A;  2O85 A;  3VFI A;  1FAA A;  2C80 A;  4OCF A;  2F9S A;  3UAR A;  4HQS A;  4K6X A;  1EV4 A;  2L59 A;  2F3M A;  5HR1 A;  3FZA A;  2QC7 A;  4Z7X A;  1F3A A;  4Q5N A;  2FWG A;  4K1F A;  5GZZ B;  3FEU A;  1EOH A;  2O89 A;  2M46 A;  1TK8 B;  2GT5 A;  1GSS A;  1V98 A;  3M9J A;  3GH6 A;  2H72 A;  4IP1 A;  4CHS A;  2VIM A;  2E2G A;  5GST A;  2YWM A;  2WGR A;  3CRT A;  4PUF C;  2FWF A;  5JWO B;  2B6M A;  3M0F A;  3KIJ A;  4NMU A;  5D93 A;  1F37 A;  2OAC A;  3QDN A;  2WS2 A;  1QXH A;  3UBK A;  3S9F A;  4X0X A;  1TDI A;  2BJX A;  3ISO A;  3C71 A;  4TVE A;  2C0E A;  2RUE A;  2GS3 A;  1GUK A;  2LRC A;  3QCP A;  4HEA 2;  3TRQ A;  2YCD A;  3LGC A;  2WUL A;  1A0R P;  4EF0 A;  1A2L A;  3P2A A;  4TXV A;  4RUV A;  4IGJ A;  5G5F A;  5DAK A;  5DCG A;  4TR1 A;  5F07 A;  5CO3 A;  5H5Q A;  4PUA A;  2LQQ A;  2OA7 A;  2XPE A;  2L5O A;  3PIN A;  1R5A A;  1GRX A;  5ECP B;  5B7C A;  4ZIL A;  2VL9 A;  5ID2 A;  4MH2 A;  2C0G A;  4FYU A;  1SJ6 A;  2CAI A;  5J41 A;  3HDC A;  4IJ3 A;  2TRX A;  1A8L A;  3VWW A;  1IYI A;  3APS A;  1YKA A;  2YWO A;  4GTU A;  2LS5 A;  3KZQ A;  3F0I A;  2NTO A;  3E0U A;  2GSR A;  5GSS A;  3IC4 A;  3PR8 A;  1GH2 A;  4KDY A;  2RII A;  2PU9 C;  1OE7 A;  2IWT A;  4KSO A;  5G2Z A;  1WRY A;  1OVN A;  3F3Q A;  1TU7 A;  5LD0 A;  1EZK A;  5B6N A;  3HZ8 A;  1OKT A;  3O3T A;  2H0G A;  1BQ7 A;  3TOT A;  1S3D A;  1YQ1 A;  4LLR A;  1OKD A;  2EC4 A;  4KSM A;  3VWU A;  2P5R A;  6GSV A;  2H1B A;  4GST A;  4BA7 A;  4FH8 A;  4IW9 A;  1MTC A;  1FVJ A;  3QD9 A;  4IN0 A;  3ZFB A;  3CSJ A;  2M80 A;  1AXD A;  1XWA A;  4IVF A;  4NPB A;  3UVT A;  2H75 A;  1XXU A;  4MF5 A;  2V1M A;  1ON4 A;  4IBP A;  3IBH A;  5D9V A;  2IME A;  4XS6 A;  2JZS A;  1N2A A;  2VL2 C;  1Q98 A;  1H75 A;  2IFQ A;  5F06 A;  1GSE A;  4HJ2 A;  3HVV A;  4KH7 A;  5AGY A;  2NPB A;  3HYP A;  18GS A;  4POB A;  1KTE A;  1HQO A;  3FZ5 A;  1F2E A;  2VLV A;  2MMN A;  3GUS A;  2K18 A;  3C1R A;  4K7O A;  2CA8 A;  3LOR A;  2H0I A;  1PRX A;  4EDZ A;  4KX4 A;  6GSU A;  3EMX A;  1J0F A;  2FLS A;  3FY7 A;  3K8N A;  2HLS A;  4K0N A;  4BWS A;  1ZOF A;  5DQS A;  1J9B A;  4WET A;  5A4V A;  2O8V B;  4JBB A;  3LYK A;  2DJ2 A;  1X5C A;  1SJI A;  3TDG A;  2HRN A;  2A2R A;  2AHE A;  2H1D A;  4NWY A;  3VLN A;  5F0G A;  3MAK A;  2A2S A;  3L9U A;  1VF3 A;  2XHF A;  2AYT A;  2DMM A;  3RBT A;  1M99 A;  4D73 B;  4F2I A;  3WT1 A;  2B3S A;  2FY6 A;  1DE2 A;  1O85 A;  3D22 A;  4ECI A;  4ID0 A;  2GGT A;  4LMV A;  2FGX A;  1FB6 A;  1ZYQ B;  1ZCP A;  4DSS B;  2NDO A;  5IMV A;  2E0Q A;  3ZIV A;  1TK0 B;  2XPD A;  4G10 A;  3O6T A;  1B4P A;  2JSZ A;  3KGK A;  2GLR A;  1JFU A;  1K0B A;  3HJP A;  2Z9S A;  2K8V A;  3RPN A;  3UAP A;  5ECM B;  3N5O A;  1B4Q A;  4XCS A;  4F9Z A;  3DD3 A;  4OFM A;  5KN2 A;  1M2D A;  3W6G A;  2CX3 A;  4IP6 A;  4MMM A;  1YJ6 A;  2M72 A;  1UA5 A;  1GLQ A;  4Q5F A;  3DVW A;  5ECI B;  1WP0 A;  1GWC A;  2WRT A;  5DDL A;  3GNJ A;  4KDX A;  2R2J A;  2L4Q A;  1A0F A;  2K6V A;  2LEG A;  7GSS A;  3ZMK A;  3IK7 A;  1PD2 1;  1PX6 A;  4MZB A;  2O7K A; 
#chains in the Genus database with same CATH topology
 3F4R A;  2CQ9 A;  3G7I A;  2CX4 A;  4KGI A;  4N0Z A;  5EL8 A;  1SL1 B;  2DKI A;  3EIN A;  4J56 E;  4TN8 A;  5JCW A;  2LRT A;  4WBR D;  2IN3 A;  1BYE A;  2CT6 A;  5IPG A;  2N5B A;  1K0A A;  2MBT A;  4E8E A;  1AUC A;  2DJJ A;  4NXI A;  2OBI A;  4TW5 A;  2EIQ A;  3KTB A;  1YEP A;  4AJ8 A;  3WD6 A;  4GRF A;  5EY6 A;  5F05 A;  5JCU A;  4WKW A;  2HSY A;  4G9H A;  4G0I A;  2H1A A;  4V2N A;  4HDE A;  1U88 A;  2H76 A;  2H01 A;  6GSS A;  4KDU A;  4RQR A;  5ECN B;  3VK9 A;  2X99 A;  3HY2 A;  4IS0 A;  19GS A;  2AAW A;  5FT3 A;  4ZL9 A;  1GLP A;  1JZR A;  5IMC A;  4LA1 A;  2AV4 A;  3ZVJ D;  2B5Y A;  5J4U A;  1N8J A;  2L57 A;  4LMW A;  4EL1 A;  3Q74 A;  1PMT A;  2HRA A;  1BJX A;  2GDR A;  2KP2 A;  4KCA A;  2J9H A;  2VCZ A;  3ZLP A;  5IMF A;  4JR4 A;  2IL3 A;  1XFL A;  2H30 A;  3APO A;  1F3B A;  1HNB A;  1T3B A;  3L9S A;  4HU7 A;  3UIW A;  4BL7 A;  2VAF A;  2VD0 A;  1NW2 A;  3FMW A;  3C1S A;  3C7M A;  2B5E A;  2X8C A;  2R3X A;  3D21 A;  5IPH A;  5ELG A;  1XG8 A;  2HXK A;  1AQV A;  2PVQ A;  2FNO A;  4AJ6 A;  2HRF A;  5FHI A;  3D4T A;  4MJE A;  4CDO A;  1MD4 A;  3R2Q A;  3FR3 A;  1XWC A;  4O5R A;  1X5E A;  3QAV A;  5J5N A;  1TI3 A;  2H0H A;  3TJJ A;  3LXT A;  4L5O A;  3TRX A;  4YQV A;  4ZBB A;  1A8Y A;  3MYD A;  1GL8 A;  1T4Z A;  4Z2R A;  2G0F A;  1SKS B;  1A2J A;  2X8G A;  4AF2 A;  4HZ2 A;  1VF1 A;  3KEB A;  4EO3 A;  3WGE A;  4G2E A;  3GIX A;  1DUG A;  4YKF A;  3F4S A;  2JAD A;  3HA9 A;  4NV5 A;  1HD2 A;  4ECC A;  3H4K A;  2C3Q A;  2P31 A;  2PMT A;  4D73 A;  2PBJ A;  2BTO T;  3RHB A;  1GSQ A;  1WJK A;  4MJA A;  4XS4 B;  3M8N A;  4JE1 A;  1FG4 A;  2GVP A;  2VD1 A;  4TKY A;  1O73 A;  3TJF A;  3KP9 A;  1Q4J A;  3DML A;  4ZL8 A;  4ACS A;  4EIQ A;  3BJ5 A;  3GKM A;  4O32 A;  4WBJ A;  4WF4 A;  4ZXG A;  2PWJ A;  5J9B A;  3SWL A;  2R0C A;  4JRR A;  1A23 A;  1G7E A;  4ZB8 A;  2H19 A;  1ST9 A;  3EYT A;  1MEK A;  1TRV A;  5D9T A;  5CRE A;  3BCI A;  1AQW A;  1YF1 A;  2YOI A;  1R26 A;  1M0U A;  4RI7 A;  5HQP A;  3KMN A;  5DBQ A;  1T8E B;  2DBC A;  1SKW B;  4QL9 A;  1U6T A;  1U87 A;  4BPY A;  1K0N A;  2LQO A;  4XTS A;  1NSW A;  3TJK A;  3GYK A;  2ES7 A;  5D9W A;  1BX9 A;  4AGS A;  1XOA A;  3BBY A;  2OE0 A;  4I5Q A;  4Z2T A;  3FR6 A;  1GNE A;  3ZIT A;  3KXO A;  3TKS C;  3I69 A;  4HU9 A;  2HZF A;  4MJB A;  1Z9H A;  2WB9 A;  3UOM A;  4I2T A;  1ZZY A;  2NBS A;  2PER A;  4O7H A;  4PUR A;  2H66 A;  3H79 A;  3CTG A;  2C4J A;  2R37 A;  4PGT A;  5DVB A;  2H8L A;  1R5P A;  4BIK A;  1QQ2 A;  1Z3E A;  5G30 A;  4WF5 A;  3LSZ A;  2YWI A;  1S3R A;  4Q5Q A;  5D96 A;  3QR6 A;  4MCU A;  3KMO A;  2ON5 A;  5E59 A;  5KN3 A;  3UEM A;  1WOU A;  4IQ1 A;  2LJA A;  1DBY A;  2MBS A;  2KLX A;  2TRC P;  2EIR A;  1T00 A;  3ZRE A;  4EIP A;  4HZ4 A;  1SD8 A;  4PXO A;  3ME8 A;  2YZU A;  3KTL A;  3TJG A;  1HNC A;  1USB A;  1EP8 A;  1GUM A;  3WT2 A;  1G0T A;  2HE3 A;  2YWN A;  3GMF A;  3L4N A;  2GST A;  4TXO B;  1G7O A;  2VLU A;  1YDK A;  5ECO B;  3ME7 A;  3DKS A;  4GXZ A;  1UVZ A;  1KEB A;  4ULX A;  2VCX A;  2VCW A;  2DKH A;  2CZ2 A;  3HD5 A;  1M9A A;  2H6Z A;  4EC0 A;  4WR4 A;  4XHM A;  1ERW A;  1GTI A;  4FYC A;  4EXJ A;  1HYU A;  1TU8 A;  4NHZ A;  2HZE A;  2KP1 A;  2B7K A;  1JLV A;  1XWK A;  2XBI A;  3LWA A;  1TOF A;  1NHY A;  1Z7R A;  5IM9 A;  3WYW A;  3IXR A;  4J57 E;  2CZ3 A;  3TGZ A;  3IOS A;  3BOA A;  1HNA A;  3ERG A;  4J2F A;  1CQG A;  3ZL5 A;  2DJ0 A;  2VM1 A;  2LJR A;  4OD7 A;  3CMI A;  2C8U A;  2K9F A;  2R6K A;  4ML1 A;  1JZO A;  3IR4 A;  2L4C A;  4MF7 A;  10GS A;  6GSY A;  2R0P A;  4X43 A;  4K8M A;  1YY7 A;  5A4W A;  2B7J A;  1PL2 A;  3QAW A;  3F3R A;  5G1K A;  3ZYW A;  2VCT A;  4CW9 A;  3W8S A;  4IKH A;  2E7P A;  4MDC A;  3A3T A;  3L9V A;  5ELA A;  4BVX B;  4ILF A;  5HFG A;  3IA1 A;  5KN0 A;  4N10 A;  4O5Q A;  1ERV A;  3IAS 2;  2GZY A;  2C3T A;  1LBK A;  1V2A A;  5CYY A;  3F63 A;  3IDV A;  1FHE A;  4XS4 A;  4AJ7 A;  5AIS A;  1K0O A;  2R5G A;  4MP4 A;  1DSB A;  1GSF A;  2V6K A;  5DAL B;  1T4Y A;  3ERF A;  1VF2 A;  4L0U A;  1XW6 A;  1QMV A;  5CAX A;  3QAG A;  1O81 A;  2L6D A;  1X0R A;  2AB6 A;  2QKE A;  1WPI A;  1OC9 B;  2MMZ A;  2PVO C;  3H8Q A;  4OCE A;  2HRK A;  4ECJ A;  4YQM A;  3GHA A;  2YV7 A;  2JAC A;  2LJK A;  2CVB A;  4K5R A;  1RK4 A;  2RLI A;  4OWY A;  4I2U A;  4DVC A;  5G31 A;  5IOW A;  2YNX A;  2XC2 A;  1T7P B;  2RM5 A;  4HUA A;  2HI7 A;  3MDK A;  3APQ A;  1X9M B;  4EVM A;  14GS A;  5B8B A;  2FUG 2;  2CAQ A;  5ECH B;  1TRW A;  2X49 A;  2J23 A;  5A5K A;  3DXB A;  1ZGN A;  4NV2 A;  3ERW A;  4KUN A;  4H86 A;  1SYX A;  2LST A;  2OE1 A;  1R7H A;  2GQK A;  1PQN A;  3VWV A;  3W8J A;  1M9B A;  1Y25 A;  1O8X A;  3CBU A;  5KEJ A;  4MK3 A;  2IMK A;  2OE3 A;  4P3Y B;  5GAP D;  2BMX A;  1EV9 A;  1ML6 A;  1V40 A;  2FCH A;  4F0C A;  1EWX A;  2V41 A;  4LL1 B;  2C3N A;  1SJZ A;  4X1U A;  1GTB A;  2HT9 A;  1MD3 A;  3Q6O A;  3EU3 A;  2YJ7 A;  4HS1 A;  2DLX A;  2GTU A;  4PQ1 A;  4EE0 A;  2IPA A;  4DEJ A;  2ZUP A;  5DAK B;  1XWB A;  3KCM A;  4F03 A;  4MPF A;  1YKC A;  1E2Y A;  5LCZ A;  3CYN A;  4PNF A;  3TJB A;  9GSS A;  3HJM A;  5IMA A;  5J9C A;  1OC8 A;  3GL5 A;  3SBC A;  3HKR A;  3BCK A;  4ZBD A;  4MJC A;  3ZTL A;  1C72 A;  1ILO A;  3WGX A;  3GST A;  4ML6 A;  1WE0 A;  5ID2 B;  3GL3 A;  1GSU A;  1MDJ A;  2ON7 A;  2PN8 A;  4ECB A;  3H93 A;  1ZYE A;  2E2M A;  2YZH A;  3EC3 A;  2LTK A;  4WXT A;  1JLW A;  2L5L A;  2B1K A;  3Q18 A;  1WIK A;  3VPQ A;  2LUS A;  4KF9 A;  5A4U A;  12GS A;  3GTU B;  1I5G A;  3E9J B;  3FK8 A;  1A2M A;  2NVL A;  4TXO A;  1VGL A;  1X9S B;  1FVK A;  2OJL A;  4XS1 A;  5C04 A;  1E6B A;  4O5U A;  2JL4 A;  1IYH A;  1XOB A;  3I9V 2;  3QOU A;  1RW1 A;  2HSH A;  1XCC A;  3KH9 A;  5AN1 A;  1BG5 A;  1XW5 A;  4V1A g;  2GSS A;  3A2W A;  2JU5 A;  4YH2 A;  5GAN D;  3D5J A;  1LU4 A;  4JU5 A;  4MAB A;  4MNN A;  4K5S A;  1EGR A;  4PX1 A;  2IMF A;  1FB0 A;  3IHG A;  1KNG A;  4G0K A;  4YAP A;  3TOU A;  2YAN A;  5HR0 A;  4PQH A;  4FIW A;  3MSZ A;  4F82 A;  5JWQ B;  1FO5 A;  3N9J A;  2AUV A;  1X9W B;  2C0F A;  17GS A;  2REM A;  5AIV A;  1B48 A;  3TKS E;  1PX7 A;  2I9H A;  2FD3 A;  2CVK A;  2LRN A;  4X4J A;  2VO4 A;  4TR4 A;  3C8E A;  4PQI A;  3F6F A;  1V57 A;  1T1V A;  1U3A A;  3GX8 A;  4ICY A;  2H71 A;  3I6A A;  3PPU A;  4ZB9 A;  1TKD B;  2MYG A;  3LQ7 A;  1TRU A;  3TKR A;  1SKR B;  3VPT A;  3U6V A;  3HZ4 A;  1WMJ A;  2DIZ A;  2GT6 A;  5KOW A;  5EVO A;  1NM3 A;  2PPT A;  1SU9 A;  3TUE A;  1Z7P A;  3KJY A;  4JED A;  2UZ8 A;  3F6D A;  4MPG A;  2H74 A;  1TK5 B;  3TB2 A;  1SEN A;  2GQL A;  2FHE A;  3F9U A;  2VM2 A;  3VWX A;  4GQF A;  3HCZ A;  4N0V A;  2YN1 A;  3IV4 A;  3R3E A;  1KBN A;  5DAL A;  2GZZ A;  4POK A;  1XW9 A;  2ZCT A;  1BED A;  2ZNM A;  3UJ1 A;  3LFL A;  2DIY A;  4DSS A;  1SK2 A;  1OC9 A;  1THX A;  1QGV A;  5IO2 A;  5ECL B;  1TJD A;  2IMI A;  2CVD A;  3GA4 A;  3LJR A;  3EVI A;  4HI7 A;  3L0H A;  2XBQ A;  3H1N A;  2B1L A;  4MZC A;  5ECK B;  3ED3 A;  4YKG A;  3ZVJ A;  1JZW A;  2JSY A;  1YF0 A;  2YPM A;  3A2V A;  3C73 A;  4XIH A;  4KND A;  3IHQ A;  1GP1 A;  4USS A;  2KHP A;  2A2P A;  4K7I A;  4FQU A;  2QGV A;  2HSM A;  1AQX A;  3KP8 A;  5DJL A;  2A4V A;  4MZW A;  4OFT A;  1XVW A;  3HHV A;  3UMA A;  2VOC A;  1A24 A;  4KAE A;  3ZFL A;  2OAD A;  4I6X A;  4OFN A;  2VUP A;  6GSX A;  1WWJ A;  2FA8 A;  3LYP A;  1AC1 A;  4ZB6 A;  5JWR B;  3FZ4 A;  5ECS A;  1EEJ A;  3I43 A;  5B8A A;  1EEM A;  1PKW A;  2DJK A;  4I97 A;  2DML A;  5G5E A;  5C00 A;  1K3Y A;  3RPP A;  3GX0 A;  5F8B A;  1SL0 B;  2KOK A;  1BAY A;  4POM A;  4IEL A;  2JZT A;  1ZL9 A;  4LL4 B;  2N5A A;  2QSI A;  1K0C A;  3WGD A;  1B9Y C;  3BD2 A;  4O92 A;  5INY A;  1EP7 A;  2EIO A;  1ERT A;  3DRN A;  1URM A;  4K0G A;  4RQX A;  1TP9 A;  3FHK A;  2L6C A;  1Z6M A;  3GV1 A;  3P7X A;  1W89 A;  3F4T A;  1GSD A;  3LG6 A;  1XIY A;  4FYB A;  3CRU A;  3D6I A;  1MDK A;  1PSQ A;  3OR5 A;  1EGO A;  1SL2 B;  1MDI A;  1B8X A;  5HFK A;  2YV9 A;  1G6Y A;  3EU4 A;  1EOG A;  3M9K A;  3IPZ A;  8GSS A;  2RUF A;  2GSQ A;  4HJM A;  3GTU A;  1GNW A;  4KCE A;  1GTU A;  2X64 A;  1S3C A;  3VI5 A;  2DSA A;  6GST A;  3GN3 A;  1TTZ A;  3IAM 2;  3QMX A;  4KE3 A;  3JCM L;  2X8H A;  2G2Q A;  2V32 A;  5CNW A;  1YEX A;  2FWH A;  3KM6 A;  1QUW A;  1NHO A;  3O76 A;  3KH7 A;  1OAZ A;  4KB3 A;  3UL3 A;  5D9X A;  22GS A;  1H4O A;  1PN9 A;  3FZ9 A;  3P90 A;  3US3 A;  4DSR A;  3MIX A;  3QFB C;  1PKZ A;  1ACV A;  1K0D A;  20GS A;  1V9W A;  4MF6 A;  4IQA A;  5FWG A;  13GS A;  3KD0 A;  3RAZ A;  3J7Y k;  5IOX A;  3CXG A;  3DWV A;  4KA0 A;  3IK9 A;  1GUH A;  5IQY A;  3GKK A;  2VLT A;  1VRS D;  3HJO A;  1XWG A;  4JZQ A;  4K2D A;  5E4W A;  4DSQ A;  5AIX A;  3QPM A;  3P8W A;  4V2L A;  4QQ7 A;  5HR2 A;  4CY6 A;  1M2B A;  4V2M A;  4MLY A;  1DE1 A;  3TCO A;  3D4M A;  3EWL A;  4GCI A;  2H6X A;  5CRH A;  2YP6 A;  3MNG A;  2VCQ A;  3TKS A;  3LW9 A;  4L5L A;  3EE2 A;  4BVY B;  2MMO A;  4ZBA A;  4L8E A;  2H73 A;  4KW6 A;  3V1W A;  1JHB A;  1XZO A;  3DGQ A;  3LXZ A;  2HNL A;  3PGT A;  1ZYP A;  4ZL7 A;  5KN1 A;  5JCG A;  1ZYN A;  2WDU A;  4YQU A;  3DYR A;  1PL1 A;  1FW1 A;  4YAV A;  4GWR A;  5HFI A;  3IE3 A;  2ALB A;  1JZD A;  2F8F A;  16GS A;  3GKN A;  2I81 A;  3GUR A;  1THO A;  1AIU A;  2KUC A;  1XBS A;  4GSS A;  2H6Y A;  3J7Y b;  1SK1 A;  4IHU A;  4E8H A;  1I9D A;  4ISD A;  2VL3 A;  2P5Q A;  5ECR B;  2I1U A;  3HVX A;  1GUL A;  2DC5 A;  3HVN A;  2PUK C;  4Q5R A;  5J3R A;  1GSY A;  5IMZ A;  5HR3 A;  5B6M A;  5ECQ B;  2LNS A;  3FRC A;  3VUR A;  2P0G A;  3FR9 A;  3ZML A;  1S3A A;  3M3M A;  5D8I A;  3GH9 A;  2C1Y A;  4NHW A;  1K3L A;  5H5S A;  1SD9 A;  2CV4 A;  5D73 A;  2N5F A;  3HVS A;  4JR6 A;  3CSI A;  3GFK A;  4V1A p;  4EUY A;  1AAZ A;  2A4H A;  3GKX A;  4TOP A;  5CP1 A;  1M7T A;  2OBK A;  4GF0 A;  4WR5 A;  1F6M C;  2WJU A;  1SK0 A;  2GQM A;  2VL2 A;  1R4W A;  4Z2U A;  1XVQ A;  3CSH A;  1ABA A;  3ZZX A;  4RI6 A;  4PNG A;  4EKZ A;  1TW9 A;  2OKA A;  2V2G A;  3NIV A;  3ZIJ A;  5CRW A;  3A5W A;  4K9Z A;  2K8S A;  4G19 A;  1XPV A;  2F51 A;  4MH3 A;  1J08 A;  5L71 A;  1TRS A;  3F8U A;  3D0Z A;  1UN2 A;  1U3I A;  1OYJ A;  2VCV A;  4N11 A;  4TR3 A;  3A5I A;  11GS A;  1FOV A;  3G7J A;  3Q19 A;  3G7Y A;  4OO4 A;  3NZN A;  4K7N A;  3RHC A;  1Z5Y E;  4I8B A;  4TR1 B;  1Z6N A;  3MWH A;  2FA4 A;  4WEY A;  3EMP A;  3DIE A;  2DJ1 A;  5ENU A;  4POL A;  1PFO A;  2WZ9 A;  1TXX A;  3A2X A;  2WFC A;  4XRD A;  2H1G A;  3TRP A;  2HFD A;  4NAX A;  5EPF A;  1M3I A;  1K0M A;  2IIY A;  3EUR A;  1X5D A;  3GRX A;  2IJY A;  2LNT A;  1M2A A;  1K3O A;  3QFA C;  2IMD A;  3U5R E;  4BWQ A;  3L78 A;  1F9M A;  4QL7 A;  4G0L A;  2JZR A;  1GTA A;  2MZC A;  1ZMA A;  1G6W A;  3VI7 A;  4F0B A;  2F8A A;  2WCI A;  1TI1 A;  1LJR A;  3UVH A;  1QK8 A;  3LEF A;  5COH A;  3TKQ A;  4L0W A;  3GSS A;  4TR0 A;  3FKF A;  1PGT A;  2TIR A;  4OO5 A;  3UBL A;  2H70 A;  1O8W A;  1O7U A;  2LV3 A;  4GLT A;  1YZX A;  5G1L A;  3EPT A;  2R4V A;  5H5R A;  4MA9 A;  3CTF A;  2O87 A;  2DJ3 A;  2LKU A;  2PGT A;  5DCH A;  4GQC A;  6GSW A;  2V6O A;  3G9B A;  2AJQ B;  2MMA A;  1PA3 A;  4FO5 A;  1SYR A;  4HOJ A;  5CRG A;  4CY8 A;  3IRA A;  5ABR A;  4GSN A;  3AY8 A;  2B5X A;  3ZRD A;  1ERU A;  2RM6 A;  1Y6E A;  3TKP A;  1M3J A;  3NOF A;  2HYX A;  3M1G A;  1B9X C;  4IJI A;  3RDW A;  1OC3 A;  4OMV A;  1RQM A;  4HQZ A;  5DJM A;  1UC7 A;  1AW9 A;  3IC8 A;  2YJH A;  1QFN A;  2GZP A;  3E3E A;  1CQH A;  2C0D A;  3HXS A;  5DQY A;  4A5P A;  4TRX A;  2HZE B;  5CRD A;  3FW2 A;  3PH9 A;  4BVY A;  1VF4 A;  4XRA A;  5IMD A;  4N30 A;  2IFQ B;  2I3Y A;  1V58 A;  5IO0 A;  5IIZ A;  1OE8 A;  4BVX A;  2FWE A;  1O6J A;  2I4A A;  1W4V A;  3FYG A;  4EDY A;  2D2Z A;  1PN0 A;  4ZIJ A;  5LNK e;  3DEX A;  3DVX A;  2O85 A;  3VFI A;  1FAA A;  2C80 A;  4OCF A;  2F9S A;  3UAR A;  4HQS A;  4K6X A;  1EV4 A;  2L59 A;  2F3M A;  5HR1 A;  3FZA A;  2QA2 A;  2QC7 A;  4Z7X A;  1F3A A;  4Q5N A;  2FWG A;  4K1F A;  5GZZ B;  3FEU A;  1EOH A;  2O89 A;  2M46 A;  1TK8 B;  2GT5 A;  1GSS A;  1V98 A;  3M9J A;  3GH6 A;  2H72 A;  4IP1 A;  4CHS A;  2VIM A;  2E2G A;  5GST A;  2YWM A;  2WGR A;  3CRT A;  4PUF C;  2FWF A;  5JWO B;  2B6M A;  3M0F A;  3KIJ A;  4NMU A;  5D93 A;  1F37 A;  2OAC A;  5BRT A;  3QDN A;  2WS2 A;  1QXH A;  3UBK A;  3S9F A;  4X0X A;  1TDI A;  2BJX A;  3ISO A;  3C71 A;  3CQF A;  4TVE A;  2C0E A;  2RUE A;  2GS3 A;  1GUK A;  2LRC A;  3QCP A;  4HEA 2;  3TRQ A;  2YCD A;  3LGC A;  2WUL A;  1A0R P;  4EF0 A;  1A2L A;  3P2A A;  4TXV A;  4RUV A;  4IGJ A;  5G5F A;  5DAK A;  5DCG A;  4TR1 A;  5F07 A;  5CO3 A;  5H5Q A;  4PUA A;  2LQQ A;  2OA7 A;  2XPE A;  4HSC X;  2L5O A;  3PIN A;  1R5A A;  1GRX A;  5ECP B;  5B7C A;  4ZIL A;  2VL9 A;  5ID2 A;  4MH2 A;  2C0G A;  4FYU A;  2QA1 A;  1SJ6 A;  2CAI A;  5J41 A;  3HDC A;  4IJ3 A;  2TRX A;  1A8L A;  3VWW A;  1IYI A;  3APS A;  1YKA A;  2YWO A;  4GTU A;  2LS5 A;  3KZQ A;  3F0I A;  2NTO A;  3E0U A;  2GSR A;  5GSS A;  3IC4 A;  3PR8 A;  1GH2 A;  4KDY A;  2RII A;  2PU9 C;  1OE7 A;  2IWT A;  4KSO A;  5G2Z A;  1WRY A;  1OVN A;  3F3Q A;  1TU7 A;  5LD0 A;  1EZK A;  2X4A A;  5B6N A;  3HZ8 A;  1OKT A;  3O3T A;  2H0G A;  1BQ7 A;  3TOT A;  1S3D A;  1YQ1 A;  4LLR A;  1OKD A;  2EC4 A;  4KSM A;  3VWU A;  2P5R A;  6GSV A;  2H1B A;  4GST A;  4BA7 A;  4FH8 A;  4IW9 A;  1MTC A;  1FVJ A;  3QD9 A;  4K2X A;  4IN0 A;  3ZFB A;  3CSJ A;  2M80 A;  1AXD A;  1XWA A;  4IVF A;  4NPB A;  3UVT A;  2H75 A;  1XXU A;  4MF5 A;  2V1M A;  1ON4 A;  4IBP A;  3IBH A;  5D9V A;  2IME A;  4BL7 B;  4XS6 A;  2JZS A;  1N2A A;  2VL2 C;  1Q98 A;  1H75 A;  2IFQ A;  1GSE A;  5F06 A;  4HJ2 A;  3HVV A;  4KH7 A;  5AGY A;  2NPB A;  3HYP A;  18GS A;  4POB A;  1KTE A;  1HQO A;  3FZ5 A;  1F2E A;  2VLV A;  2MMN A;  3GUS A;  2K18 A;  3C1R A;  4K7O A;  2CA8 A;  3LOR A;  2R0G A;  2H0I A;  1PRX A;  4EDZ A;  4KX4 A;  6GSU A;  3EMX A;  1J0F A;  2FLS A;  3FY7 A;  3K8N A;  2HLS A;  4K0N A;  4BWS A;  1ZOF A;  5DQS A;  1J9B A;  4WET A;  5A4V A;  2O8V B;  4PTS A;  4JBB A;  3LYK A;  2DJ2 A;  1X5C A;  1SJI A;  3TDG A;  2HRN A;  2A2R A;  2AHE A;  2H1D A;  4NWY A;  3VLN A;  5F0G A;  3MAK A;  2A2S A;  3L9U A;  1VF3 A;  2XHF A;  2AYT A;  2DMM A;  3RBT A;  1M99 A;  4D73 B;  4F2I A;  3WT1 A;  2B3S A;  2FY6 A;  1DE2 A;  1O85 A;  3D22 A;  4ECI A;  4ID0 A;  2GGT A;  4LMV A;  2FGX A;  1FB6 A;  1ZYQ B;  1ZCP A;  4DSS B;  2NDO A;  5IMV A;  2E0Q A;  3ZIV A;  1TK0 B;  2XPD A;  4G10 A;  3O6T A;  1B4P A;  2JSZ A;  3KGK A;  2GLR A;  1JFU A;  1K0B A;  3HJP A;  2Z9S A;  2K8V A;  3RPN A;  3UAP A;  5ECM B;  3N5O A;  1B4Q A;  4XCS A;  4F9Z A;  3DD3 A;  5BMU A;  4OFM A;  5KN2 A;  1M2D A;  3W6G A;  2CX3 A;  4IP6 A;  4MMM A;  1YJ6 A;  2M72 A;  1UA5 A;  1GLQ A;  4Q5F A;  3DVW A;  5ECI B;  1WP0 A;  1GWC A;  2WRT A;  5KOX A;  5DDL A;  3GNJ A;  4KDX A;  2R2J A;  1FOH A;  2L4Q A;  1A0F A;  2K6V A;  2LEG A;  7GSS A;  3ZMK A;  3IK7 A;  1PD2 1;  1PX6 A;  4MZB A;  2O7K A; 
#chains in the Genus database with same CATH homology
 3F4R A;  2CQ9 A;  3G7I A;  2CX4 A;  4KGI A;  4N0Z A;  5EL8 A;  1SL1 B;  2DKI A;  3EIN A;  4J56 E;  4TN8 A;  5JCW A;  2LRT A;  4WBR D;  2IN3 A;  1BYE A;  2CT6 A;  5IPG A;  2N5B A;  1K0A A;  2MBT A;  4E8E A;  1AUC A;  2DJJ A;  4NXI A;  2OBI A;  4TW5 A;  2EIQ A;  3KTB A;  1YEP A;  4AJ8 A;  3WD6 A;  4GRF A;  5EY6 A;  5F05 A;  5JCU A;  4WKW A;  2HSY A;  4G9H A;  4G0I A;  2H1A A;  4V2N A;  4HDE A;  1U88 A;  2H76 A;  2H01 A;  6GSS A;  4KDU A;  4RQR A;  5ECN B;  3VK9 A;  2X99 A;  3HY2 A;  4IS0 A;  19GS A;  2AAW A;  5FT3 A;  4ZL9 A;  1GLP A;  1JZR A;  5IMC A;  4LA1 A;  2AV4 A;  3ZVJ D;  2B5Y A;  5J4U A;  1N8J A;  2L57 A;  4LMW A;  4EL1 A;  3Q74 A;  1PMT A;  2HRA A;  1BJX A;  2GDR A;  2KP2 A;  4KCA A;  2J9H A;  2VCZ A;  3ZLP A;  5IMF A;  4JR4 A;  2IL3 A;  1XFL A;  2H30 A;  3APO A;  1F3B A;  1HNB A;  1T3B A;  3L9S A;  4HU7 A;  3UIW A;  4BL7 A;  2VAF A;  2VD0 A;  1NW2 A;  3FMW A;  3C1S A;  3C7M A;  2B5E A;  2X8C A;  2R3X A;  3D21 A;  5IPH A;  5ELG A;  2HXK A;  1AQV A;  2PVQ A;  2FNO A;  4AJ6 A;  2HRF A;  5FHI A;  3D4T A;  4MJE A;  4CDO A;  1MD4 A;  3R2Q A;  3FR3 A;  1XWC A;  4O5R A;  1X5E A;  3QAV A;  5J5N A;  1TI3 A;  2H0H A;  3TJJ A;  3LXT A;  4L5O A;  3TRX A;  4YQV A;  4ZBB A;  1A8Y A;  3MYD A;  1GL8 A;  1T4Z A;  4Z2R A;  2G0F A;  1SKS B;  1A2J A;  2X8G A;  4AF2 A;  4HZ2 A;  1VF1 A;  3KEB A;  4EO3 A;  3WGE A;  4G2E A;  3GIX A;  1DUG A;  4YKF A;  3F4S A;  2JAD A;  3HA9 A;  4NV5 A;  1HD2 A;  4ECC A;  3H4K A;  2C3Q A;  2P31 A;  2PMT A;  4D73 A;  2PBJ A;  2BTO T;  3RHB A;  1GSQ A;  1WJK A;  4MJA A;  4XS4 B;  3M8N A;  4JE1 A;  1FG4 A;  2GVP A;  2VD1 A;  4TKY A;  1O73 A;  3TJF A;  3KP9 A;  1Q4J A;  3DML A;  4ZL8 A;  4ACS A;  4EIQ A;  3BJ5 A;  3GKM A;  4O32 A;  4WBJ A;  4WF4 A;  4ZXG A;  2PWJ A;  5J9B A;  3SWL A;  2R0C A;  4JRR A;  1A23 A;  1G7E A;  4ZB8 A;  2H19 A;  1ST9 A;  3EYT A;  1MEK A;  1TRV A;  5D9T A;  5CRE A;  3BCI A;  1AQW A;  1YF1 A;  2YOI A;  1R26 A;  1M0U A;  4RI7 A;  5HQP A;  3KMN A;  5DBQ A;  1T8E B;  2DBC A;  1SKW B;  4QL9 A;  1U6T A;  1U87 A;  4BPY A;  1K0N A;  2LQO A;  4XTS A;  1NSW A;  3TJK A;  3GYK A;  2ES7 A;  5D9W A;  1BX9 A;  4AGS A;  1XOA A;  3BBY A;  2OE0 A;  4I5Q A;  4Z2T A;  3FR6 A;  1GNE A;  3ZIT A;  3KXO A;  3TKS C;  3I69 A;  4HU9 A;  2HZF A;  4MJB A;  1Z9H A;  2WB9 A;  3UOM A;  4I2T A;  1ZZY A;  2NBS A;  2PER A;  4O7H A;  4PUR A;  2H66 A;  3H79 A;  3CTG A;  2C4J A;  2R37 A;  4PGT A;  5DVB A;  2H8L A;  1R5P A;  1QQ2 A;  1Z3E A;  5G30 A;  4WF5 A;  3LSZ A;  2YWI A;  4Q5Q A;  5D96 A;  3QR6 A;  4MCU A;  3KMO A;  2ON5 A;  5E59 A;  5KN3 A;  3UEM A;  1WOU A;  4IQ1 A;  2LJA A;  1DBY A;  2MBS A;  2KLX A;  2TRC P;  2EIR A;  1T00 A;  3ZRE A;  4EIP A;  4HZ4 A;  1SD8 A;  4PXO A;  3ME8 A;  2YZU A;  3KTL A;  3TJG A;  1HNC A;  1USB A;  1EP8 A;  1GUM A;  3WT2 A;  1G0T A;  2HE3 A;  2YWN A;  3GMF A;  3L4N A;  2GST A;  4TXO B;  1G7O A;  2VLU A;  1YDK A;  5ECO B;  3ME7 A;  3DKS A;  4GXZ A;  1UVZ A;  1KEB A;  4ULX A;  2VCX A;  2VCW A;  2DKH A;  2CZ2 A;  3HD5 A;  1M9A A;  2H6Z A;  4EC0 A;  4WR4 A;  4XHM A;  1ERW A;  1GTI A;  4FYC A;  4EXJ A;  1HYU A;  1TU8 A;  4NHZ A;  2HZE A;  2KP1 A;  2B7K A;  1JLV A;  1XWK A;  2XBI A;  3LWA A;  1TOF A;  1NHY A;  1Z7R A;  5IM9 A;  3WYW A;  3IXR A;  4J57 E;  2CZ3 A;  3TGZ A;  3IOS A;  3BOA A;  1HNA A;  3ERG A;  4J2F A;  1CQG A;  3ZL5 A;  2DJ0 A;  2VM1 A;  2LJR A;  4OD7 A;  3CMI A;  2C8U A;  2K9F A;  2R6K A;  4ML1 A;  1JZO A;  3IR4 A;  2L4C A;  4MF7 A;  10GS A;  6GSY A;  2R0P A;  4X43 A;  4K8M A;  1YY7 A;  5A4W A;  2B7J A;  1PL2 A;  3QAW A;  3F3R A;  5G1K A;  3ZYW A;  2VCT A;  4CW9 A;  3W8S A;  4IKH A;  2E7P A;  4MDC A;  3A3T A;  3L9V A;  5ELA A;  4BVX B;  4ILF A;  5HFG A;  3IA1 A;  5KN0 A;  4N10 A;  4O5Q A;  1ERV A;  3IAS 2;  2GZY A;  2C3T A;  1LBK A;  1V2A A;  5CYY A;  3F63 A;  3IDV A;  1FHE A;  4XS4 A;  4AJ7 A;  5AIS A;  1K0O A;  2R5G A;  4MP4 A;  1DSB A;  1GSF A;  2V6K A;  5DAL B;  1T4Y A;  3ERF A;  1VF2 A;  4L0U A;  1XW6 A;  1QMV A;  5CAX A;  3QAG A;  1O81 A;  2L6D A;  1X0R A;  2AB6 A;  2QKE A;  1WPI A;  1OC9 B;  2MMZ A;  2PVO C;  3H8Q A;  4OCE A;  2HRK A;  4ECJ A;  4YQM A;  3GHA A;  2YV7 A;  2JAC A;  2LJK A;  2CVB A;  4K5R A;  1RK4 A;  2RLI A;  4OWY A;  4I2U A;  4DVC A;  5G31 A;  5IOW A;  2YNX A;  2XC2 A;  1T7P B;  2RM5 A;  4HUA A;  2HI7 A;  3MDK A;  3APQ A;  1X9M B;  4EVM A;  14GS A;  5B8B A;  2FUG 2;  2CAQ A;  5ECH B;  1TRW A;  2X49 A;  2J23 A;  5A5K A;  3DXB A;  1ZGN A;  4NV2 A;  3ERW A;  4KUN A;  4H86 A;  1SYX A;  2LST A;  2OE1 A;  1R7H A;  2GQK A;  1PQN A;  3VWV A;  3W8J A;  1M9B A;  1Y25 A;  1O8X A;  3CBU A;  5KEJ A;  4MK3 A;  2IMK A;  2OE3 A;  4P3Y B;  5GAP D;  2BMX A;  1EV9 A;  1ML6 A;  1V40 A;  2FCH A;  4F0C A;  1EWX A;  2V41 A;  4LL1 B;  2C3N A;  1SJZ A;  4X1U A;  1GTB A;  2HT9 A;  1MD3 A;  3Q6O A;  3EU3 A;  2YJ7 A;  4HS1 A;  2DLX A;  2GTU A;  4PQ1 A;  4EE0 A;  2IPA A;  4DEJ A;  2ZUP A;  5DAK B;  1XWB A;  3KCM A;  4F03 A;  4MPF A;  1YKC A;  1E2Y A;  5LCZ A;  3CYN A;  4PNF A;  3TJB A;  9GSS A;  3HJM A;  5IMA A;  5J9C A;  1OC8 A;  3GL5 A;  3SBC A;  3HKR A;  3BCK A;  4ZBD A;  4MJC A;  3ZTL A;  1C72 A;  1ILO A;  3WGX A;  3GST A;  4ML6 A;  1WE0 A;  5ID2 B;  3GL3 A;  1GSU A;  1MDJ A;  2ON7 A;  2PN8 A;  4ECB A;  3H93 A;  1ZYE A;  2E2M A;  2YZH A;  3EC3 A;  2LTK A;  4WXT A;  1JLW A;  2L5L A;  2B1K A;  3Q18 A;  1WIK A;  3VPQ A;  2LUS A;  4KF9 A;  5A4U A;  12GS A;  3GTU B;  1I5G A;  3E9J B;  3FK8 A;  1A2M A;  2NVL A;  4TXO A;  1VGL A;  1X9S B;  1FVK A;  2OJL A;  4XS1 A;  5C04 A;  1E6B A;  4O5U A;  2JL4 A;  1IYH A;  1XOB A;  3I9V 2;  3QOU A;  1RW1 A;  2HSH A;  1XCC A;  3KH9 A;  5AN1 A;  1BG5 A;  1XW5 A;  4V1A g;  2GSS A;  3A2W A;  2JU5 A;  4YH2 A;  5GAN D;  3D5J A;  1LU4 A;  4JU5 A;  4MAB A;  4MNN A;  4K5S A;  1EGR A;  4PX1 A;  2IMF A;  1FB0 A;  3IHG A;  1KNG A;  4G0K A;  4YAP A;  3TOU A;  2YAN A;  5HR0 A;  4PQH A;  4FIW A;  3MSZ A;  4F82 A;  5JWQ B;  1FO5 A;  3N9J A;  2AUV A;  1X9W B;  2C0F A;  17GS A;  2REM A;  5AIV A;  1B48 A;  3TKS E;  1PX7 A;  2I9H A;  2FD3 A;  2CVK A;  2LRN A;  4X4J A;  2VO4 A;  4TR4 A;  3C8E A;  4PQI A;  3F6F A;  1V57 A;  1T1V A;  1U3A A;  3GX8 A;  4ICY A;  2H71 A;  3I6A A;  3PPU A;  4ZB9 A;  1TKD B;  2MYG A;  3LQ7 A;  1TRU A;  3TKR A;  1SKR B;  3VPT A;  3U6V A;  3HZ4 A;  1WMJ A;  2DIZ A;  2GT6 A;  5KOW A;  5EVO A;  1NM3 A;  2PPT A;  1SU9 A;  3TUE A;  1Z7P A;  3KJY A;  4JED A;  2UZ8 A;  3F6D A;  4MPG A;  2H74 A;  1TK5 B;  3TB2 A;  1SEN A;  2GQL A;  2FHE A;  3F9U A;  2VM2 A;  3VWX A;  4GQF A;  3HCZ A;  4N0V A;  2YN1 A;  3IV4 A;  3R3E A;  1KBN A;  5DAL A;  2GZZ A;  4POK A;  1XW9 A;  2ZCT A;  1BED A;  2ZNM A;  3UJ1 A;  3LFL A;  2DIY A;  4DSS A;  1SK2 A;  1OC9 A;  1THX A;  1QGV A;  5IO2 A;  5ECL B;  1TJD A;  2IMI A;  2CVD A;  3GA4 A;  3LJR A;  3EVI A;  4HI7 A;  3L0H A;  2XBQ A;  3H1N A;  2B1L A;  4MZC A;  5ECK B;  3ED3 A;  4YKG A;  3ZVJ A;  1JZW A;  2JSY A;  1YF0 A;  2YPM A;  3A2V A;  3C73 A;  4XIH A;  4KND A;  3IHQ A;  1GP1 A;  4USS A;  2KHP A;  2A2P A;  4K7I A;  4FQU A;  2QGV A;  2HSM A;  1AQX A;  3KP8 A;  5DJL A;  2A4V A;  4MZW A;  4OFT A;  1XVW A;  3HHV A;  3UMA A;  2VOC A;  1A24 A;  4KAE A;  3ZFL A;  2OAD A;  4I6X A;  4OFN A;  2VUP A;  6GSX A;  1WWJ A;  2FA8 A;  3LYP A;  1AC1 A;  4ZB6 A;  5JWR B;  3FZ4 A;  5ECS A;  1EEJ A;  3I43 A;  5B8A A;  1EEM A;  1PKW A;  2DJK A;  4I97 A;  2DML A;  5G5E A;  5C00 A;  1K3Y A;  3RPP A;  3GX0 A;  5F8B A;  1SL0 B;  2KOK A;  1BAY A;  4POM A;  4IEL A;  2JZT A;  1ZL9 A;  4LL4 B;  2N5A A;  2QSI A;  1K0C A;  3WGD A;  1B9Y C;  3BD2 A;  4O92 A;  5INY A;  1EP7 A;  2EIO A;  1ERT A;  3DRN A;  1URM A;  4K0G A;  4RQX A;  1TP9 A;  3FHK A;  2L6C A;  1Z6M A;  3GV1 A;  3P7X A;  1W89 A;  3F4T A;  1GSD A;  3LG6 A;  1XIY A;  4FYB A;  3CRU A;  3D6I A;  1MDK A;  1PSQ A;  3OR5 A;  1EGO A;  1SL2 B;  1MDI A;  1B8X A;  5HFK A;  2YV9 A;  1G6Y A;  3EU4 A;  1EOG A;  3M9K A;  3IPZ A;  8GSS A;  2RUF A;  2GSQ A;  4HJM A;  3GTU A;  1GNW A;  4KCE A;  1GTU A;  2X64 A;  1S3C A;  3VI5 A;  2DSA A;  6GST A;  3GN3 A;  1TTZ A;  3IAM 2;  3QMX A;  4KE3 A;  3JCM L;  2X8H A;  2G2Q A;  2V32 A;  5CNW A;  1YEX A;  2FWH A;  3KM6 A;  1QUW A;  1NHO A;  3O76 A;  3KH7 A;  1OAZ A;  4KB3 A;  3UL3 A;  5D9X A;  22GS A;  1H4O A;  1PN9 A;  3FZ9 A;  3P90 A;  3US3 A;  4DSR A;  3MIX A;  3QFB C;  1PKZ A;  1ACV A;  1K0D A;  20GS A;  1V9W A;  4MF6 A;  4IQA A;  5FWG A;  13GS A;  3KD0 A;  3RAZ A;  3J7Y k;  5IOX A;  3CXG A;  3DWV A;  4KA0 A;  3IK9 A;  1GUH A;  5IQY A;  3GKK A;  2VLT A;  1VRS D;  3HJO A;  1XWG A;  4JZQ A;  4K2D A;  5E4W A;  4DSQ A;  5AIX A;  3QPM A;  3P8W A;  4V2L A;  4QQ7 A;  5HR2 A;  4CY6 A;  1M2B A;  4V2M A;  4MLY A;  1DE1 A;  3TCO A;  3D4M A;  3EWL A;  4GCI A;  2H6X A;  5CRH A;  2YP6 A;  3MNG A;  2VCQ A;  3TKS A;  3LW9 A;  4L5L A;  3EE2 A;  4BVY B;  2MMO A;  4ZBA A;  4L8E A;  2H73 A;  4KW6 A;  3V1W A;  1JHB A;  1XZO A;  3DGQ A;  3LXZ A;  2HNL A;  3PGT A;  1ZYP A;  4ZL7 A;  5KN1 A;  5JCG A;  1ZYN A;  2WDU A;  4YQU A;  3DYR A;  1PL1 A;  1FW1 A;  4YAV A;  4GWR A;  5HFI A;  3IE3 A;  2ALB A;  1JZD A;  2F8F A;  16GS A;  3GKN A;  2I81 A;  3GUR A;  1THO A;  1AIU A;  2KUC A;  1XBS A;  4GSS A;  2H6Y A;  3J7Y b;  1SK1 A;  4IHU A;  4E8H A;  1I9D A;  4ISD A;  2VL3 A;  2P5Q A;  5ECR B;  2I1U A;  3HVX A;  1GUL A;  2DC5 A;  2PUK C;  4Q5R A;  5J3R A;  1GSY A;  5IMZ A;  5HR3 A;  5B6M A;  5ECQ B;  2LNS A;  3FRC A;  3VUR A;  2P0G A;  3FR9 A;  3ZML A;  1S3A A;  3M3M A;  5D8I A;  3GH9 A;  2C1Y A;  4NHW A;  1K3L A;  5H5S A;  1SD9 A;  2CV4 A;  5D73 A;  2N5F A;  3HVS A;  4JR6 A;  3CSI A;  3GFK A;  4V1A p;  4EUY A;  1AAZ A;  2A4H A;  3GKX A;  4TOP A;  5CP1 A;  1M7T A;  2OBK A;  4GF0 A;  4WR5 A;  1F6M C;  2WJU A;  1SK0 A;  2GQM A;  2VL2 A;  1R4W A;  4Z2U A;  1XVQ A;  3CSH A;  1ABA A;  3ZZX A;  4RI6 A;  4PNG A;  4EKZ A;  1TW9 A;  2OKA A;  2V2G A;  3NIV A;  3ZIJ A;  5CRW A;  3A5W A;  4K9Z A;  2K8S A;  4G19 A;  1XPV A;  2F51 A;  4MH3 A;  1J08 A;  5L71 A;  1TRS A;  3F8U A;  3D0Z A;  1UN2 A;  1U3I A;  1OYJ A;  2VCV A;  4N11 A;  4TR3 A;  3A5I A;  11GS A;  1FOV A;  3G7J A;  3Q19 A;  3G7Y A;  4OO4 A;  3NZN A;  4K7N A;  3RHC A;  1Z5Y E;  4I8B A;  4TR1 B;  1Z6N A;  3MWH A;  2FA4 A;  4WEY A;  3EMP A;  3DIE A;  2DJ1 A;  5ENU A;  4POL A;  2WZ9 A;  1TXX A;  3A2X A;  2WFC A;  4XRD A;  2H1G A;  3TRP A;  2HFD A;  4NAX A;  5EPF A;  1K0M A;  2IIY A;  3EUR A;  1X5D A;  3GRX A;  2IJY A;  2LNT A;  1M2A A;  1K3O A;  3QFA C;  2IMD A;  3U5R E;  4BWQ A;  3L78 A;  1F9M A;  4QL7 A;  4G0L A;  2JZR A;  1GTA A;  2MZC A;  1ZMA A;  1G6W A;  3VI7 A;  4F0B A;  2F8A A;  2WCI A;  1TI1 A;  1LJR A;  3UVH A;  1QK8 A;  3LEF A;  5COH A;  3TKQ A;  4L0W A;  3GSS A;  4TR0 A;  3FKF A;  1PGT A;  2TIR A;  4OO5 A;  3UBL A;  2H70 A;  1O8W A;  1O7U A;  2LV3 A;  4GLT A;  1YZX A;  5G1L A;  3EPT A;  2R4V A;  5H5R A;  4MA9 A;  3CTF A;  2O87 A;  2DJ3 A;  2LKU A;  2PGT A;  5DCH A;  4GQC A;  6GSW A;  2V6O A;  3G9B A;  2AJQ B;  2MMA A;  1PA3 A;  4FO5 A;  1SYR A;  4HOJ A;  5CRG A;  4CY8 A;  3IRA A;  5ABR A;  4GSN A;  3AY8 A;  2B5X A;  3ZRD A;  1ERU A;  2RM6 A;  1Y6E A;  3TKP A;  3NOF A;  2HYX A;  3M1G A;  1B9X C;  4IJI A;  3RDW A;  1OC3 A;  4OMV A;  1RQM A;  4HQZ A;  5DJM A;  1UC7 A;  1AW9 A;  3IC8 A;  2YJH A;  1QFN A;  2GZP A;  3E3E A;  1CQH A;  2C0D A;  3HXS A;  5DQY A;  4A5P A;  4TRX A;  2HZE B;  5CRD A;  3FW2 A;  3PH9 A;  4BVY A;  1VF4 A;  4XRA A;  5IMD A;  4N30 A;  2IFQ B;  2I3Y A;  1V58 A;  5IO0 A;  5IIZ A;  1OE8 A;  4BVX A;  2FWE A;  1O6J A;  2I4A A;  1W4V A;  3FYG A;  4EDY A;  2D2Z A;  1PN0 A;  4ZIJ A;  5LNK e;  3DEX A;  3DVX A;  2O85 A;  3VFI A;  1FAA A;  2C80 A;  4OCF A;  2F9S A;  3UAR A;  4HQS A;  4K6X A;  1EV4 A;  2L59 A;  2F3M A;  5HR1 A;  3FZA A;  2QA2 A;  2QC7 A;  4Z7X A;  1F3A A;  4Q5N A;  2FWG A;  4K1F A;  5GZZ B;  3FEU A;  1EOH A;  2O89 A;  2M46 A;  1TK8 B;  2GT5 A;  1GSS A;  1V98 A;  3M9J A;  3GH6 A;  2H72 A;  4IP1 A;  4CHS A;  2VIM A;  2E2G A;  5GST A;  2YWM A;  2WGR A;  3CRT A;  4PUF C;  2FWF A;  5JWO B;  2B6M A;  3M0F A;  3KIJ A;  4NMU A;  5D93 A;  1F37 A;  2OAC A;  5BRT A;  3QDN A;  2WS2 A;  1QXH A;  3UBK A;  3S9F A;  4X0X A;  1TDI A;  2BJX A;  3ISO A;  3C71 A;  4TVE A;  2C0E A;  2RUE A;  2GS3 A;  1GUK A;  2LRC A;  3QCP A;  4HEA 2;  3TRQ A;  2YCD A;  3LGC A;  2WUL A;  1A0R P;  4EF0 A;  1A2L A;  3P2A A;  4TXV A;  4RUV A;  4IGJ A;  5G5F A;  5DAK A;  5DCG A;  4TR1 A;  5F07 A;  5CO3 A;  5H5Q A;  4PUA A;  2LQQ A;  2OA7 A;  2XPE A;  2L5O A;  3PIN A;  1R5A A;  1GRX A;  5ECP B;  5B7C A;  4ZIL A;  2VL9 A;  5ID2 A;  4MH2 A;  2C0G A;  4FYU A;  2QA1 A;  1SJ6 A;  2CAI A;  5J41 A;  3HDC A;  4IJ3 A;  2TRX A;  1A8L A;  3VWW A;  1IYI A;  3APS A;  1YKA A;  2YWO A;  4GTU A;  2LS5 A;  3KZQ A;  3F0I A;  2NTO A;  3E0U A;  2GSR A;  5GSS A;  3IC4 A;  3PR8 A;  1GH2 A;  4KDY A;  2RII A;  2PU9 C;  1OE7 A;  2IWT A;  4KSO A;  5G2Z A;  1WRY A;  1OVN A;  3F3Q A;  1TU7 A;  5LD0 A;  1EZK A;  2X4A A;  5B6N A;  3HZ8 A;  1OKT A;  3O3T A;  2H0G A;  1BQ7 A;  3TOT A;  1S3D A;  1YQ1 A;  4LLR A;  1OKD A;  2EC4 A;  4KSM A;  3VWU A;  2P5R A;  6GSV A;  2H1B A;  4GST A;  4BA7 A;  4FH8 A;  4IW9 A;  1MTC A;  1FVJ A;  3QD9 A;  4K2X A;  4IN0 A;  3ZFB A;  3CSJ A;  2M80 A;  1AXD A;  1XWA A;  4IVF A;  4NPB A;  3UVT A;  2H75 A;  1XXU A;  4MF5 A;  2V1M A;  1ON4 A;  4IBP A;  3IBH A;  5D9V A;  2IME A;  4BL7 B;  4XS6 A;  2JZS A;  1N2A A;  2VL2 C;  1Q98 A;  1H75 A;  2IFQ A;  1GSE A;  5F06 A;  4HJ2 A;  3HVV A;  4KH7 A;  5AGY A;  2NPB A;  3HYP A;  18GS A;  4POB A;  1KTE A;  1HQO A;  3FZ5 A;  1F2E A;  2VLV A;  2MMN A;  3GUS A;  2K18 A;  3C1R A;  4K7O A;  2CA8 A;  3LOR A;  2R0G A;  2H0I A;  1PRX A;  4EDZ A;  4KX4 A;  6GSU A;  3EMX A;  1J0F A;  2FLS A;  3FY7 A;  3K8N A;  2HLS A;  4K0N A;  4BWS A;  1ZOF A;  5DQS A;  1J9B A;  4WET A;  5A4V A;  2O8V B;  4PTS A;  4JBB A;  3LYK A;  2DJ2 A;  1X5C A;  1SJI A;  3TDG A;  2HRN A;  2A2R A;  2AHE A;  2H1D A;  4NWY A;  3VLN A;  5F0G A;  3MAK A;  2A2S A;  3L9U A;  1VF3 A;  2XHF A;  2AYT A;  2DMM A;  3RBT A;  1M99 A;  4D73 B;  4F2I A;  3WT1 A;  2B3S A;  2FY6 A;  1DE2 A;  1O85 A;  3D22 A;  4ECI A;  4ID0 A;  2GGT A;  4LMV A;  2FGX A;  1FB6 A;  1ZYQ B;  1ZCP A;  4DSS B;  2NDO A;  5IMV A;  2E0Q A;  3ZIV A;  1TK0 B;  2XPD A;  4G10 A;  3O6T A;  1B4P A;  2JSZ A;  3KGK A;  2GLR A;  1JFU A;  1K0B A;  3HJP A;  2Z9S A;  2K8V A;  3RPN A;  3UAP A;  5ECM B;  3N5O A;  1B4Q A;  4XCS A;  4F9Z A;  3DD3 A;  5BMU A;  4OFM A;  5KN2 A;  1M2D A;  3W6G A;  2CX3 A;  4IP6 A;  4MMM A;  1YJ6 A;  2M72 A;  1UA5 A;  1GLQ A;  4Q5F A;  3DVW A;  5ECI B;  1WP0 A;  1GWC A;  2WRT A;  5KOX A;  5DDL A;  3GNJ A;  4KDX A;  2R2J A;  1FOH A;  2L4Q A;  1A0F A;  2K6V A;  2LEG A;  7GSS A;  3ZMK A;  3IK7 A;  1PD2 1;  1PX6 A;  4MZB A;  2O7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...