2DMUA

Solution structure of the homeobox domain of homeobox protein goosecoid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GSSGSSGRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the homeobox domain of Homeobox protein goosecoid
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Homeobox protein goosecoid
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dmuA01
3HOVJ 3ZQCA 3S14J 3HGGA 2ECBA 1ETWA 1HLVA 1GVDA 3MN2A 1BA5A 5K7HA 1K83J 4XRSG 4A3KJ 1ETXA 2ELKA 1WGXA 1JKOC 4CYCA 1GDTA 5IP9J 2DJNA 5IOYA 1Q1VA 2KT0A 1DU0A 3PO2J 1X58A 4UUSB 5M3MJ 2E1OA 4HNVA 2Y2ZA 3BR3A 1GV5A 1TWFJ 3O8HA 1MH4A 1MH3A 3FK7A 1JKPC 3GTQJ 1TWCJ 1WCMJ 5EYRA 3JREA 3C2BA 3RZOJ 1MBGA 3PM1A 1XC5A 3BTCA 2K40A 3K7AJ 1WH5A 2WB1N 1FIPA 2MSYA 2B63J 2CQQA 5J1UA 4D7MA 5EG0A 4XIDA 3FKIJ 2NVXJ 2ME6A 2LFBA 5GPAA 2XB5A 3LOCA 4QSHA 2EZKA 3QPLA 4FE7A 3NARA 3S2DJ 3QQAA 2IBDA 2E2JJ 2K9QA 2M34A 2G0EA 4CYCB 5F0FA 1PUFB 3HEFA 3RZDJ 1LE8A 1RKWA 2X9DA 5E3NA 2JWTA 4JP0A 2MW8A 3JRFA 2CUFA 4Y7NJ 1I6HJ 5IP6A 4M3BA 2DTZA 3TP3A 5EEAA 4I6ZA 3GBGA 4C2MJ 4IHXA 1JT6A 2YS9A 4JX4A 1SFOJ 1IV6A 2L0KA 3ZQIA 1MBHA 4A3CJ 1QVUA 1TC3C 2O7OA 3GTPJ 2JA7J 4MFEA 2M8GX 2XGEA 3S1QJ 1QPIA 3PO3J 3M3YJ 1IC8A 2DA5A 2COBA 3H0GJ 2R7ZJ 1VNDA 9ANTA 2Y9YA 2TCTA 4B1RA 4AUXA 4MLOA 1H89C 4DZPA 1VFCA 2DA2A 4W1UA 2PMZN 4BBRJ 4Y52J 2AO9A 2M2EA 1H88C 1U9OA 1OJLA 4BKXA 2N8GA 1ORKA 2EZHA 4G12A 1A5JA 2X6OA 1F36A 2JA8J 1U9NA 1T33A 3CDLA 3TW6A 1EF4A 3HM5A 2AHQA 4ABZA 3JRGA 4FTHA 1DU6A 2R0QC 5M3FJ 5FKMA 3TW7A 1GUUA 2NS8A 4FCYA 5E3LA 3FISA 2FQ4A 2NS7A 1G2HA 4XK4A 2LVSA 3CMYA 1AHDP 3GTLJ 3FK6A 3A01A 4D5CA 1X2NA 1AU7A 1R9TJ 2Y0SN 2LTPA 3HOYJ 3IH2A 1ETQA 1LFUP 2XRLA 4UUTA 2DMQA 2HI3A 1XG1A 3Q0UA 4QIWN 5C3EJ 4RDUA 2XPWA 5M5XJ 1LE8B 2X48A 2LLKA 2HXIA 5FKOA 3M4OJ 2CU7A 5IP7J 1MBJA 4JYKA 4UUSA 4A3IJ 5EGOA 2ME0A 1IJWC 5K7ZA 3ZQLA 4AC0A 3A03A 5E3MA 2HOAA 3NAUA 2VI6A 1GV2A 1I3QJ 4M6VA 3G1OA 3IH4A 2H8RA 2HOSA 1HDDC 1FTZA 1K61A 2Y31A 3BR6A 4XRSA 2E19A 3JRDA 2FD5A 4X1EA 4A3EJ 1ETYA 3TP0A 1FIAA 3HB9A 1ZGWA 5J1YA 3Q3SA 3CQZJ 3SDGA 2JA5J 1E3OC 3JRIA 2LD5A 1JUPA 2EZIA 2WAQN 1A6IA 1RPWA 5EDNA 3G1LA 3OSFA 5FLVA 3RQIA 5IOZA 2HYJA 2HOTA 2GLOA 4BXXJ 1FEXA 1NK3P 1ZR2A 1JUMA 2ZB9A 3BTIA 3G1MA 4W97A 1AKHA 4D5FA 1JJ8C 2L7FP 1ENHA 3GTGJ 4S0HB 4V2FA 2JN6A 4DYRA 2XGDA 5HODA 4AYBN 2W48A 3BT9A 1CQTA 4NDLA 3L1PA 2XGCA 2IEKA 5FKKA 3HOXJ 3DCFA 3B6CA 3JRBA 3GTMJ 3SFIA 4L5EA 2XPUA 1ZK8A 1H8AC 3LSPA 1Z77A 2DMTA 2KDZA 1NTCA 2R5YB 2O8KA 1Y1VJ 1QVTA 2DMUA 4DZJA 3BR2A 1IG7A 3ZOBA 1ZKGA 2DMPA 4A3LJ 3HOWJ 5E3OA 3BR1A 2EQRA 1ZTRA 4BBSJ 2E2HJ 4IEJA 1MBEA 4LOCA 5DTDA 1IDZA 2ID3A 1X2MA 3IH3A 5IYDJ 1JGGA 3I4NJ 1FTTA 2P81A 2H1KA 3OOUA 1JTXA 4A3BJ 1RR7A 1BJZA 1I50J 2L7ZA 3VPRA 5FLMJ 4C3HJ 2JK3A 3FIWA 1Z0XA 3OSGA 5JLXA 1GT0C 3LSGA 1BW6A 5DS9A 2QF7A 1W0UA 5F08A 5GPCA 4M3GA 1JTYA 5FKLA 4A93J 1ETKA 4JX6A 5J3LA 2JJ7A 5IPAA 3A02A 5J1RA 4GFBA 2XSDC 3E7LA 5EGOB 5F04A 4X6AJ 1LFBA 3WHBA 5EG0B 3QPSA 2HXOA 4FE4A 1MBKA 1RKTA 1U78A 2DA4A 3HKZN 3ZQHA 1HDPA 1POGA 3S2HJ 5EF6A 2LR8A 2DA6A 2DA7A 2VKVA 2QCOA 1T56A 1NK2P 1RESA 3LSJA 2L7MP 3BTLA 4M3EA 5F27A 3D1NI 1BL0A 1JKRC 3S1NJ 2ECCA 3O8GA 3TEDA 1B8IA 1UMQA 1VF9A 2K9SA 5BNGA 1OCTC 2I10A 1B8IB 1YRNB 3HBLA 2VKEA 1B72A 1YRNA 1MBFA 4XICA 2Y30A 3H3VK 4C3JJ 1B72B 1ETOA 2VPRA 2ID6A 2TRTA 4I76A 3CCYA 2JMWA 1U8BA 1ITYA 2YU9J 3ZQFA 1F43A 2DA3A 3BR5A 1JKQC 3S16J 1JJ6C 1WPKA 4EEFG 2LP0A 2EZLA 2M9HA 5IYBJ 3S1RJ 2JA6J 4IHYA 3WHCA 1XS9A 2XB0X 2EBIA 4C3IJ 1BW5A 3JRAA 3GTKJ 4B3AA 3BG3A 3S17J 4QTRA 1P7IA 5C44J 2IAIA 1IUFA 2R5YA 2FJ1A 1O4XA 5IYCJ 3OIOA 4DYCA 2CJJA 1WI3A 3BR0A 3F0CA 2DA1A 1S7EA 3JRCA 4B4CA 5JLWA 1ETVA 2CQXA 2GBYA 2L9RA 5EZGA 3B6AA 1TWGJ 4V2GA 4J19A 1SANA 5C4JJ 2MGQA 2EH3A 3HOZJ 2NOGA 3RKQA 3BQYA 2NVTJ 2XPVA 3GTJJ 1QRYA 4A3FJ 2LK2A 2OF7A 2YUSA 4MO7A 2E2IJ 1TWHJ 5K7FA 3BQZA 3IV5A 5C4XJ 3DEWA 3HOUJ 1HCRA 1HOMA 2WV1A 2OPTA 4JX5A 3HGYA 2RAEA 4BY7J 2VUMJ 5GP9A 2M0CA 4XRMA 2D5VA 1HF0A 1IGNA 4FISA 2DN0A 3JRHA 3A01B 1JUSA 1MSEC 1TWAJ 4DW6A 4DYQA 2CRGA 4BY1J 1FJLA 1MNMC 2HDDA 1AKHB 5FJ8J 2R5ZB 2NVYJ 2LKXA 3S15J 4A3JJ 4A3MJ 1OCPA 2FX0A 4M3FA 3LSRA 2HQ5A 3HDDA 1W0TA 1PUFA 1UHSA 3MVPA 3UKGA 4A3GJ 2MG4A 3Q0WA 2R92J 1APLC 2GM4A 5M5WJ 2NVQJ 2R5ZA 3I4MJ 1VI0A 5F0HA 4MFDA 1ZR4A 2LY9A 2DMNA 3JR9A 3SJMA 3Q0VA 3BG5A 1D5YA 4M3DA 1Y1WJ 1WH7A 5EZHA 1UG2A 3GTOJ 4IHWA 3MKLA 4A3DJ 1RETA 4IHVA 1MSFC 3K2AA 2K9NA 3BG9A 3ZQGA 1IRZA 5FKNA 1IDYA 2Y9ZA 2R93J 1OFCX 1JT0A 4RBOA 1ZQ3P 5F0CA 3S1MJ 3LNQA 4D7NA 2O9LA 4MIMA 3W6VA 4A69C 2CUEA 1P7JA 5F1JA 5M5YJ 3BTJA
chains in the Genus database with same CATH superfamily
3HOVJ 3ERED 3S14J 3HGGA 1ZLJA 2VKDA 4L9TA 1HXDA 1SD6A 3CMMA 4KT6A 2CG4A 1BA5A 5LHGA 2ELKA 1WGXA 2HDWA 2NRAC 5FFXA 3DKYA 4CYCA 3AAFA 3D5SC 1GDTA 3PIOF 4P9UA 4Y15A 3V8JA 2CW0F 5D6FA 2E1OA 2P5KA 1GV5A 4JQFA 2KLOA 2KIMA 1KGSA 2K85A 1P4WA 4A2UA 4AIDA 1WJBA 3FK7A 1JKPC 3CCQI 4ESJA 1TWCJ 2O0YA 5EYRA 3BP8A 5E17F 2XGXA 3A0HC 3C2BA 1MBGA 1E3PA 1PP7U 2RNJA 2ISYA 3KEQA 2M5WA 3K7AJ 4IQJA 4ON0A 1S7AA 1FIPA 3LAPA 3CUQB 3KP4A 4RA2A 4D7MA 3X2QH 3FKIJ 2O8XA 4XKCA 5CPRB 3OS0A 1SVOA 3DWLE 1CF7B 2HQRA 3LOCA 4GDFA 3NARA 1ZG1A 3DBRB 5KCMA 3CDIA 5JHFA 1YE9A 2IBDA 1ZLKA 3IWZA 4YFNF 3GZ5A 2QKMB 1HC8A 1U5TC 1HSJA 1KYWA 1PUFB 3HEFA 3RZDJ 3HPHA 5F6FA 4U7BA 1LE8A 4C2UA 2GZWA 2JWTA 2W4SA 1IN7A 1BN5A 2IA0A 5ICEA 1K6OA 3OIPA 1OLTA 2HQNA 1ERDA 2ADUA 2DTZA 4NC7A 4BQOA 2XDVA 4IHXA 1WJAA 3L2UA 5A2QK 2JA2A 4RB1A 5LGUA 1X1CA 3EYYA 4JOMA 1IV6A 2L0KA 3ZQIA 2O6GE 1QVUA 3JTHA 1TC3C 3DEEA 4M72A 3WTYC 3HOSA 2CV2A 3S1QJ 1QPIA 3M3YJ 5BQTA 3COAC 2R7ZJ 1VNDA 3H9JA 2BY3A 3FXJA 2UZKA 3LA2A 2TCTA 4B1RA 1H89C 1UFMA 3TO6A 3B73A 1WI9A 2DA2A 1OR7C 4LGWA 1LDJA 2AO9A 2R3SA 3VFZA 3RSNA 2QSHX 2VODA 1E2XA 3MZHA 2VXZA 2XAJA 1F36A 1O7LA 1SFXA 1U9NA 3JSPA 1T33A 1FNNA 4RAYA 3PQKA 2ZJQF 2FNPA 3HM5A 3MZYA 2AHQA 1Z1DA 2R0QC 4BXFA 1BR2A 2QENA 5FKMA 2M3AA 4II2A 1XCVA 3TW7A 1Z21A 2NS8A 2V6CA 2XUBA 2M7AA 3QYBA 2ZO4A 3DU6A 4LLLA 2W00A 1MNDA 2PMHA 3ABMH 1YJWI 4L0ZB 2LVSA 4EQQA 4LITA 1MMGA 1S7OA 4FQGA 1X2NA 3TDZC 3CO7C 3AG3H 3IH2A 3U1KA 3ULQB 2XRLA 4UUTA 5GTHC 1XG1A 5H2FC 4RGSA 4RDUA 4IXAA 4Z2YA 3I59A 2XPWA 5M5XJ 1YS7A 2OC6A 2LDUA 3REOA 2LKSA 3VEPA 2DFEA 2HXIA 5FKOA 2H6BA 2HR3A 3OYIA 1MMDA 5IP7J 3E6DA 4HQMA 2L9VA 3BDDA 4LFUA 4J00A 3ZQLA 5E3MA 2HOAA 3NAUA 1TNSA 3QYEA 1X3WB 2V79A 3FM5A 4M6VA 1KU3A 3F8BA 2OTLI 3DTKA 3BJAA 3M7GA 1ULYA 4XRSA 5KAFC 2ZNYA 3S32A 1FIAA 1W7PA 1YO5C 3L00A 3SDGA 2OQGA 3P5JA 4OU0A 5EJCA 4NUBA 2W24A 3ZXSA 3TL4X 2OTJI 4YIRX 3OSFA 2YR2A 2DK5A 2KL4A 1B59A 4HF0A 2RVCA 5IOZA 1QHGA 4OIPF 2M4GA 1HQCA 5LBQA 5HLGA 2EFOA 1SEUA 1X19A 5ED4A 1FEXA 1WJEA 4HDUA 2ZMEC 1OR7A 2QA4I 1JUMA 1ZRDA 4WXCA 3DTEA 2ZB9A 3DF8A 3G73A 2LREA 1X1BA 1JJ8C 3FBNB 1JI8A 3GTGJ 1ENHA 3R60A 2L3DA 5B66C 2FQ3A 4V2FA 2DCEA 2JN6A 1R7JA 1PP8F 1FMWA 2L9SA 2JVGA 1V54H 2A68F 2H1LA 2W48A 5FGMA 4NDLA 1YG2A 4M9ZA 3IRQA 1L3LA 3TKYA 5EEGA 2FOKA 4AYBA 3NEUA 5IT9Z 3TGNA 3G2BA 3SXYA 2KDZA 2V1DA 4ZTFA 4OIOF 2AS5F 5J8FA 1QVTA 2W25A 3BZCA 3H36A 4R79A 2AQFA 3VYRB 3ZMZA 1ONVA 2BXYA 3IC7A 4RM3A 2DMPA 1XGOA 2JVHA 4A3LJ 5J4VA 3WGIA 5E3OA 4XRFA 1XPXA 2L4MA 3HPGA 4IEJA 1MBEA 4PJMA 1R1TA 3IH3A 2V9PA 2WC2A 2P81A 1WJ5A 2IGOA 3AG1H 1RR7A 4XLNF 1I50J 4ANJA 5HDGA 4KMFA 3CC2I 3F21A 3JTGA 4L9VA 4MTEA 5JLXA 1BW6A 4MQ9F 4EGYA 2QF7A 1R1UA 1G59A 3VB2A 1JHFA 1W0UA 3H5NA 4IOAF 2LBFA 2GOXB 4HV5A 5ICGA 5KVRA 5JFRA 2E35A 2HYFA 4I0BA 5DD4A 5IPAA 2DU9A 3I9V2 3E7LA 2FE3A 3K4JA 4X6AJ 4ZYAA 2A05A 3KP7A 3WHBA 5EG0B 3SZTA 2HXOA 2Z33A 3CJRB 2R7SA 5L3EA 3N4MA 3ZQHA 3L9FA 2K27A 4KMUX 3MCZA 3HZJA 4UHTA 4MTDA 1RRJA 3QRFF 2QSGX 5FROA 5EF6A 3CC7I 4I09A 1B4AA 1FP2A 4LD5A 3BROA 3CJNA 2QCOA 4A12A 3GW2A 4ZDLA 4XBFA 4CA0A 1NK2P 1R00A 1RESA 1Y8QB 2LG4A 3FMRA 3BTLA 2OCCH 4KT5C 4M9SA 5JI6A 2FMLA 4ZTJA 3S1NJ 1TNTA 2PX9A 2G7UA 3ABTA 2K9SA 5FFZA 5E18F 3FXUA 2I10A 3BCBA 5AONA 4LJZF 1R49A 1MBFA 3EUHA 2ZFWA 1XB4A 4C3JJ 1R4NB 3CCLI 5KK1A 3DBLB 2DOAA 1MJBA 1FSEA 1LDDA 3FWEA 4OAZA 4R1HA 3F6VA 4NHJA 5ICCA 5DV5A 4BYYA 2H94A 1F43A 3KCCA 2DA3A 1XSXA 2DXIA 3F22A 1WPKA 4EEFG 2M9HA 4GYIA 3S1RJ 4EJTA 4IHYA 1EV7A 1OCZH 3WHCA 2QEXI 4OIRF 1XS9A 3K6GA 2XB0X 2D1HA 4PUSA 4DNCA 1SMTA 2MC4A 1BW5A 3CMEI 1NH3A 2L4AA 2NS0A 2X1DA 2XRNA 3GYHX 1U3EM 3QWLA 3S17J 2WA0A 3V42A 2CH0A 3L2QA 2DJIA 4QTRA 2IA2A 3AKZA 1W7PD 1P7IA 5C44J 1FBSA 4XKBA 4EM1A 5D5XB 5TGTA 3BG6A 1O4XA 4A6DA 1DGWY 2JSCA 4PZJA 4IKFA 2CJJA 1WRJA 3SHFA 3W6KB 3MKZA 3K4MA 3TOBA 3RTRA 3GO5A 2FUG2 4UNOA 3JRCA 1IRFA 1IRXA 2CQXA 2MD0A 4IVNA 4PJNA 2GOMA 3B6AA 1TWGJ 2VJ5A 3MEXA 4HNUA 1SC7A 3O2PE 1IXCA 3C1DA 2IA1A 1QRYA 2WADA 4LB5A 3LQQA 2A3SA 2OF7A 2YUSA 2E2IJ 2P4WA 2IS1A 5JHUA 3O3KA 3IV5A 4E7LA 1OPCA 1OISA 1YTYA 2WTEA 1A31A 1HOMA 4Y17A 3HGYA 2OBPA 4OAYA 2BVMA 6PAXA 5GP9A 4XRMA 4DBQA 1YHQI 1IGNA 3SYTA 4M6XA 4RB2C 2BY1A 2L02A 2QM3A 2R7OA 4I99C 4DOZA 1B9NA 2FF4A 3HHGA 4KN4X 1IZ1A 1TWAJ 3IKVA 3A01B 5L3CA 4A5NA 2CRGA 2EB7A 2QLZA 5LD2C 4BY1J 1Y8RB 3E5QA 5B1AH 3U2RA 2R5ZB 2LKXA 3S15J 3MMYB 3R0AA 3S2WA 1OCPA 2VBXA 3PL8A 4CHUA 1SFEA 2HQ5A 4BXUA 2W7NA 2AXTC 3T8TA 2EFNA 1G3YA 1YW7A 1FOYA 1X1PA 1Z67A 2XSJC 2K5CA 3UKGA 4PSXA 4A3GJ 2R7XA 1FWZA 1WFXA 3VSKA 2CFXA 2GM4A 5D5VB 1U5TA 2R5ZA 3K4NA 4DJAA 4WXDA 5F0HA 4ENMA 2FMYA 2H8WA 4N4NB 2KPMA 2DMNA 2Z3YA 3JR9A 3K4CA 4HAMA 3R6SA 3PFIA 1Y1WJ 1UG2A 3PQJA 2GA1A 3DEUA 4ZYDA 3BPVA 2OUMA 3UNGC 5KNLA 4ESBA 1LFPA 4A3DJ 4IHVA 1MSFC 2CYYA 5GAGJ 4B47A 2CS3A 2M30A 2HEOA 4OINF 5FRMA 1IRZA 5L3GA 2R93J 1YOVB 1JT0A 3EQLF 1JHHA 2FU4A 2HDCA 4YFXF 3LNQA 2VONA 4HPQA 3RYRA 3JCUC 4YIIA 4IPAA 5LGNA 1P7JA 5HS7A 2XROA 4CUGA 3OYMA 5CVJA 2KHMA 4RAZA 2ECBA 4NQWB 3RJPA 1HLVA 1GVDA 2C6YA 4BEHA 2WAFA 4GGGA 1OMIA 2JTVA 1C0WA 1UJ8A 1OYIA 4XRSG 2L9NA 4HF2A 3HSRA 3LFKA 1JKOC 1Q1HA 3A0BC 4B3XA 3JAMK 3E0JB 3DPLC 3K4LA 3E1SA 2HPMA 2HZTA 1K79A 3G71I 3PO2J 4UUSB 1RUNA 2Y2ZA 3BR3A 1TWFJ 2BEOA 2EK5A 3MKYB 4CYDA 5DD8A 2HQAA 2X51A 3FMSA 2VBWA 2BE5F 1XDSA 4RLFA 3JREA 3WODF 3MZ8A 4O6JA 3RZOJ 1NG7A 1U0JA 2F6CA 4HW0A 4AD9A 5GADJ 4IO9F 2E1MB 3QU3A 1L0OC 1DDNA 3KPHA 2NVXJ 1MW7A 5JVGF 2BGCA 4HG2A 2ESNA 1E0EA 2HKOA 4G9YA 4JBAA 3CJTB 1CGPA 1YJNI 2OCEA 1J2XA 1VQLI 4IRHA 2GXAA 2M34A 2XASA 2G0EA 2UV1A 2ZMEA 4P9FA 5E3NA 3JW4A 3V4GA 1CF7A 3PSFA 1HBXG 4D0PA 4Y7NJ 3IRRA 5IP6A 4KYWA 5EEAA 2ZMEB 1JT6A 4I02A 2LKPA 2YS9A 4JX4A 2XAQA 4KICA 1SFOJ 1ZN2A 1REPC 3H9QA 4A3CJ 2JUGA 4M6YA 4FT8A 3ZMUA 1IC8A 5ILVA 3H0GJ 2JRTA 2MH2A 2RQPA 2IS2A 2P7VB 3WTZA 1MJ9A 2L54A 4OMZA 1WSUA 1QA6A 3FXKA 4G7OF 2PMZN 4ZYHA 4BQAA 2RNGA 2MABA 2M2EA 1U9OA 4GCVA 1MJAA 1OJLA 4XLEA 4BKXA 1VQ5I 1YX3A 2EZHA 1A5JA 4G6TB 2W57A 2VBZA 5M5YJ 2JA8J 3VYTB 4HSTA 3CDLA 1FYLA 4F3QA 4CGZA 1J59A 3HC7A 3EYIA 2F5FA 5EEHA 5DCFA 4ABZA 5FB2A 4FTHA 4ASNA 4HX8A 4KNYA 5M3FJ 1AWCA 2XVCA 2ESHA 1WVRA 1UHWA 1Z91A 2IVMA 3I71A 4Q5SF 2K9MA 4IOCF 2NS7A 1N75A 3V7SA 4FX4A 1DQUA 3P9KA 2NVUB 3CMYA 1AHDP 1K4TA 3OWTA 3GTLJ 2E1CA 2VQCA 1ZGAA 2KZVA 4D5CA 1R9TJ 2EIJH 1T2KA 1Z3YA 2VE8A 2DFIA 4M9XA 3W3CA 2DMQA 4BEHB 2HI3A 1GHCA 1DP3A 2MH9A 3K69A 4BGDA 2IJLA 3OS2A 3KZIC 2F5VA 2X48A 5B1BH 4ITVA 4I0AA 4U0VA 1BR4A 2E36A 1XGNA 4O3MA 1FOWA 3HL2A 1QO0D 2OZ6A 3HHHA 2CU7A 2XKPA 2DT6A 1MBJA 1XGSA 2YPRA 4L9JA 4UUSA 2M1BA 1IJWC 2ACJA 4U88A 3A03A 2DK8A 1BBYA 1SD5A 4RGXA 2K3FA 1GV2A 1KU9A 1WKMA 1SAXA 1KYZA 2K02A 3G1OA 1WJDA 2H8RA 4V19K 2A6HF 4UXNA 1HDDC 1FTZA 1K61A 4UV9A 2EWNA 3J7AY 1N77A 2DBBA 3VOEA 4BJTA 1ZGWA 3CP8A 2M0MA 3TBIA 3DKXA 3ZQQA 2JA5J 1JUPA 3WTSC 1A6IA 1BI1A 5K5QA 2EFWA 2E5ZA 1U5TB 3GLXA 3W2AA 3HOTA 2PMZA 3RQIA 3AG4H 3KLOA 1UAAA 3MAJA 4E7KA 1ZH5A 4MEXF 1O57A 2GLOA 4XKWA 1Z05A 4HDVA 1T39A 3OYCA 4BXXJ 5J4YA 2F5DA 1NK3P 1D1BA 1ZR2A 4PGGA 3ISPA 3DQVC 2NNNA 3IAS2 2X0LA 3BTIA 3G1MA 3M8FA 4FETA 1IV8A 3CESA 4BHCA 2NOJB 3HTUA 2L7FP 2WWYA 1BC8C 4S0HB 3HUGA 4Q47A 3IHUA 5HNHA 3OYKA 4HEA2 5HODA 1STZA 1BIBA 4E7ZA 3LA7A 2LY1A 2OAZA 3JRBA 4LB6B 1T0FC 4BNCA 3GTMJ 5D4RA 2ZBKA 1FOKA 1H8AC 1ZK8A 2L2OA 3GFIA 2DMTA 2VOPA 4B44A 2Z99A 3TO9A 5DYMA 3ZMSA 2O8KA 1Y1VJ 3VYUB 1OYWA 2DMUA 1S5LC 3S3NA 2QZ8A 3CTAA 4PCQA 2LBFB 1U6GA 2HGCA 3M07A 2BW3A 3JAMZ 2L7KA 3BR1A 1FC3A 2EQRA 5H6RA 3RCOA 2E2HJ 2STWA 4LOCA 5IYDJ 4RGUA 1JGGA 3I4NJ 4ZYEA 3FXOA 1ODDA 3OOUA 1TBXA 2B0LA 4F91B 5L3FA 4C3HJ 5D5UB 3ASNH 4EJOA 3F6OA 3RKYA 1P2FA 1PJRA 1J7KA 5DS9A 5KAIC 3WTVC 4AM3A 3F9KA 3WGGA 1QPMA 2E1NA 2V6EA 2OD5A 1E17A 2HOEA 1R71A 3CCEI 1JTYA 2Q2EA 4A93J 4XLPF 4O5VA 4IHTA 1SFKA 4S05A 3HIFA 4PJJA 4TV7A 1FSHA 1LNWA 2D2WA 1QHHD 3SQNA 4CXFA 2IW5A 5J1RA 3EETA 1V5EA 3EUHC 4BE2A 4HBLA 1VQMI 5ILUA 3FKJA 4FE4A 1U78A 3FM3A 2CWEA 3OR2C 1XD7A 5LHIA 3S8PA 3KZYA 1W5SA 1POGA 1S3JA 2KIUA 2O3FA 3V8LA 2KRCA 4GYGA 5LRRA 2E1MC 2CUZA 1UB9A 1KQ0A 4BL0B 3U1DA 5DCMB 3D1NI 1Y56A 1WZ2A 2JRMA 3O8GA 3G6EI 3DPUA 1W36C 5E1WA 2CV0A 4XICA 1R6RA 3HSEA 3H3VK 2JPCA 2A6TA 3M1CA 2LF7A 2VPRA 2MC3A 3RKWA 2A69F 2CW7A 1HW1A 4FX0A 3A4CA 3CO6C 1F9NA 4I76A 1FBQA 2JPBA 3FZVA 2FOWA 1JKQC 3CLQA 2LP0A 3K1NA 2JA6J 2XHKA 4EGZA 1Z6TA 3KX2A 5J8CA 1W1WE 1QNTA 1SVMA 1YS6A 3IWFA 4KDPA 2ZCWA 4C3IJ 5FD5A 2R7QA 3LSIA 3CF2A 3GXOA 4CICA 2NAZA 1TQIA 2DQLA 5ILSA 3CZ6A 3HRUA 3WU2C 2K4BA 3SZGA 1OYYA 2PBIA 2G9WA 5TJJA 4UB6C 3OIOA 4DYCA 2EIMH 1WI3A 4S04A 1Z3XA 1YIJI 4KFCA 2DA1A 4BQQA 3CJQB 2X85A 2CO5A 3I0TA 5HNFA 1D1CA 3AL0B 3J81Z 4J19A 4ZC3A 2DFFA 2YX7A 1SANA 2DOEA 3WTUC 3HOZJ 3RKQA 4PGHA 2DFHA 4D9JA 4A3FJ 1WJCA 1VQKI 2P7CB 1ZELA 3GZNB 3OS1A 2VC1A 4QLCU 5K7FA 2GXBA 1QZZA 3BQZA 5CQEA 3QPTA 1QBJA 2LYCA 3HOUJ 3KYDB 1V3FA 2MBFA 2I8DA 4HV6A 4I01A 2YX4A 2D5VA 4ZDOA 2DN0A 2QSFX 3DTIA 1JUSA 4DW6A 4DYQA 2UUZA 5TRDA 3I3LA 2R7RA 1J9IA 3M8JA 3K2ZA 1MNMC 3S93A 2NVYJ 4A3JJ 1OCCH 3C3WA 2FX0A 4WWCA 4N0BA 2RGVA 3EDPA 3LSRA 1W0TA 1H9GA 1Z7UA 2JUCA 3H92A 3GF2A 3MVPA 2WBMA 1EH6A 1EH8A 2RREA 2MG4A 3Q0WA 2A6EF 2PEXA 2R92J 4PSWA 1APLC 2NVQJ 2O03A 3ZPLA 4QPOA 2FBIA 4MFDA 2Z2SB 2PQ8A 2LY9A 4HYEA 4BJ6C 3SJMA 1D5YA 1F1ZA 1Y0UA 4M3DA 1WH7A 2EV0A 1G6NA 5F1RA 4HLXA 3GTOJ 4F93B 3OYLA 1W36D 4IHWA 1BI0A 2Q0OA 4CCLA 2BYVE 4F7ZA 3LSHA 3CC4I 1VQ8I 4YEJA 4E70A 1S9HA 3K2AA 1XMAA 3ZQGA 2EINH 1D8JA 1G4DA 1IDYA 4L5JA 2Y9ZA 4I2OA 2VJIA 2XAGA 4RBOA 4XLFA 1NG6A 3S1MJ 4CZCA 5K1YA 2KJBA 4YG2F 4D7NA 3FXMA 2O9LA 3L7WA 3H1CA 2Z16A 2OQRA 4A69C 3DLLF 4BQNA 3FXQA 5F1JA 1T38A 3BTJA 5IT9K 3QYFA 2X6YA 1EA3A 1ETWA 3FBIB 2FBHA 3F72A 5JR3A 3MN2A 5JVTA 4DQ2A 5K7HA 1K83J 3SEQA 4EJVA 3CCMI 1ETXA 1XMKA 4LIUA 4MQVA 2BOLA 4MGRA 3EUAA 3V8KA 1WHUA 5IP9J 3RPUA 4XSXF 3KLNA 1IUYA 2XAHA 1JE8A 3VWBA 5LLQA 2VB6A 3OY9A 4HNVA 5E20A 2VJJA 3O8HA 1MH4A 4OWRB 1MH3A 1FPQA 1BI3A 3DV8A 1G3TA 1P92A 1WCMJ 3H0DA 2BBYA 3H9GA 3IUOA 3KZZA 4RAGA 3J7YJ 2VQGA 2EIKH 5DM7F 3KP6A 3PM1A 3U21A 1IO2A 1XC5A 3BTCA 4XLHA 1WH5A 2WB1N 1IN4A 4CCNA 3J81K 4EJWA 2B63J 2CGPA 4BHBA 2CQQA 3M8EA 5J1UA 2MFZA 2ICWG 1Y0NA 2HS5A 2ZSIB 2XKOA 2XB5A 3QODA 1S8NA 2WV0A 4QSHA 2EZKA 1RIOH 2Y69H 2K9QA 3K4KA 3T1BA 5D8LB 4BS9A 4CYCB 3GWZA 5F0FA 1VQ7I 1XTAA 4ENNA 1RKWA 1ZG5A 1I1SA 2X9DA 1YJ9I 3LFUA 1DPRA 3TQNA 2XAUA 4JP0A 2MW8A 3OYHA 4BJ5C 4B43A 1BOAA 2R7DA 3WTWC 3AL0C 3WU0A 3OOPA 4I6ZA 2X6XA 4C2MJ 3KFWX 1OCRH 1TZLA 4IQ4A 2LMDA 4EM0B 1HW2A 1RR8C 1USTA 4KISA 1MBHA 1ON2A 1P6RA 3P9IA 5BPIA 2O7OA 1FMVA 2X6WA 2JA7J 2LH9A 4MFEA 2XGEA 3PO3J 2CUJA 2Y9YA 2V9VA 4BDYA 1LQ1A 1BJAA 2R7FA 1BC7C 1RC9A 2QGUA 2IGKA 4W1UA 3Q5FA 2KFDA 3LA3A 3I56I 4E7JA 2ZXWH 1TW3A 2DPUA 1ORKA 1TT5B 4EMSA 2DPDA 2F48A 1XX5A 2KP6A 1MNEA 2AXLA 1X1DA 3F8NA 4LMYA 1EF4A 1PVEA 4BACA 3ZP5A 3JRGA 1ZRCA 3H35A 4XN0A 1A35A 2VT3A 4HQEA 1YLFA 4ZZDA 5E3LA 4Z6YA 3GEZA 3S3OA 1QGPA 3FISA 2FQ4A 2RC4A 3EPZA 3F3XA 4XK4A 5TISC 3ZN1A 3FK6A 4N4OB 1XCBA 2QQBA 1AU7A 1GLNA 1NHAA 2LTPA 2P6TA 2Y0SN 3HOYJ 2DDAA 1ETQA 1LFUP 4Q4ZF 1F4KA 5FD6A 3O6BB 2F2EA 1P9QC 3Q0UA 3PJRA 3ZN0A 1LE8B 2QBYA 1TQPA 1ACIA 2MD5A 1T08B 2LLKA 1XSVA 4Y33A 3R61A 5CVIA 2H09A 1JXSA 2GWRA 4JYKA 2K9LA 4A3IJ 2COMA 2JQ7A 3A2KA 3R4KA 4A0ZA 5EGOA 2ME0A 1VQNI 5K7ZA 2RV8A 3BJ6A 2R7VA 1VTNC 1FYMA 2ZXJA 1IRGA 3ZRGA 2MLKA 2KQRA 2VQLA 2QBYB 1R22A 3E5UA 3RDIA 1GXQA 4G7ZF 3I58A 2HOSA 2TDXA 4YELA 2A61A 2X4HA 4UVCA 3J7AO 2O61A 3U9GA 2E19A 1D3YA 3JRDA 2FD5A 2DOFA 3MQ0A 4II3A 3TP0A 3HB9A 3SDBA 5J1YA 2PJRB 3ASOH 1AA7A 2HPIA 1E3OC 4N9HA 3F8CA 3ZGKA 5EDNA 4J01A 2VL8A 1TTYA 5FLVA 4E7SA 3BLYA 2VE9A 1KQ9A 4D1QA 3RPQA 2HYJA 2ZNZA 2V4JC 3WG7H 2D45A 3E6BA 1ON1A 3OYNA 3BZKA 2HZDA 2H27A 3L2VA 1N25A 4W97A 4A0XA 1FYKA 1AKHA 4XMYA 4D5FA 3AG2H 5D8KB 5HDNA 2DQRA 3OYDA 3FXRA 2ELJA 3IP4B 2MLGA 1FOXA 2XGDA 3CUOA 4AYBN 4XR6A 2QUFA 3BT9A 4HNTA 1CQTA 1R1VA 2IEKA 3ZMTA 1YW9A 4HX4A 3DCFA 3B6CA 3K4BA 4CH7A 3SFIA 2BHYA 1V55H 4OOIA 3LSPA 1Z77A 3BY6A 1S29A 1NTCA 5HLHA 5HLIA 1VQ6I 1ZRFA 3LSKA 4DZJA 2VKHA 1ZG3A 3BR2A 3K1PA 3J7ZI 1WWXA 2F4MB 1ZKGA 3HRMA 4XLAA 5CJ9A 4HA8A 3HOWJ 1WJFA 1ZTRA 4RAFA 1BI2A 2BY0A 4XOPA 1X2MA 1FTTA 2IGMA 2QKLB 1JTXA 4A3BJ 3F8MA 4M73A 1IXSB 1G3WA 2L7ZA 5FLMJ 3WE2A 3KP2A 2JK3A 3FIWA 3A1YA 1Z0XA 3OSGA 1GT0C 4A6EA 2WY8Q 4AIHA 2HVRA 1KQ8A 2HTJA 3OMYA 1XSDA 3C2HA 3PIPF 5F08A 1VQOI 1O3RA 1X3UA 5FKLA 2P5VA 3K9TA 3W6JB 4ZZLA 2OU2A 1MDMB 4JX6A 4IX7A 2JJ7A 4BU2A 2B7EA 2EA2A 3A02A 5DUIA 4GFBA 2XSDC 4Y4RA 1ZGJA 2E7XA 2XV4S 5F04A 2LF8A 2ELHA 1RKTA 5FO5A 1QQIA 2DA4A 2LSOA 2KJCA 3I64A 2DYSH 1OCOH 2DW4A 3OL3A 4I98B 2P6SA 2DA6A 2RDPA 2DA7A 3DBHB 3ABUA 1T8IA 3WTTC 2VKVA 3MWMA 1RNLA 4WK8F 1YYVA 4CCKA 3PFYA 3J80Z 1LKXA 3FX3A 2W82A 3LSJA 1J09A 4KIFA 2L7MP 1K4SA 5F27A 4L5IA 1JKRC 1J0RA 2ECCA 3TEDA 1B8IA 4QWQA 3OV8A 2E71A 5BNGA 1OCTC 1B8IB 2CFOA 5CVRA 3HBLA 2VKEA 1YRNA 4RB0A 5E8IA 5A2QZ 1Z7LA 4CZZA 1ETOA 1FBUA 1MD0A 3ELKA 2ID6A 3NWTA 5LRSA 1R5HA 2RKHA 1LEBA 3KP5A 5DCMA 3MFKA 1A04A 2LRDA 4AIJA 3CCYA 5ICFA 2JMWA 1U8BA 5LGTA 1ITYA 2YU9J 2O5RA 3ZQFA 3BR5A 4U7DA 3Q9VA 2EZLA 1UZCA 2L5QA 4XNFA 2NNYA 2FNAA 5GTIC 2QQ8A 3RI4A 2FXAA 2EBIA 3QU6A 1J5YA 3JRAA 3GTKJ 1QZEA 2VC0A 2KIFA 4LG3A 2KRFA 2IAIA 4LLNA 2FJ1A 1O3SA 5IYCJ 3OYJA 1IN6A 2GA2A 2NXNB 4YRVA 1LVKA 3IAM2 1V4RA 4AWXB 4E7HA 1GVJA 2EILH 4H0EA 2BZTA 1X4OA 4HSRA 4NC8A 4B4CA 5JLWA 2HFHA 1ETVA 3H3ZA 2GBYA 2ETHA 2L9RA 5EZGA 4AVPA 2A07F 2BW3B 4LIVA 1MZBA 3CUQA 2F5CA 4IF4A 4V2GA 1YITI 3LWFA 2MGQA 2IS6A 4ZYGA 2EH3A 2M87A 2NOGA 3E6MA 3BQYA 5HS9A 3OYGA 2NVTJ 4XORA 2ZFUA 2LK2A 4E4HA 3GX4X 1KA8A 2E5NA 4MO7A 3KIOA 1R58A 2EPFA 1TWHJ 2CV1A 1YI2I 1IW7F 2DAOA 3DEWA 3K70D 1N78A 3I5UA 3GFMA 1K7AA 3J80K 1HCRA 3FF5A 4XM3A 4BY7J 2DTRA 2RAEA 2R7WA 1SD4A 2VUMJ 3GFJA 2CQ7A 2XAFA 3BWGA 3H5AA 1K78A 1HF0A 2ZJ2A 3BOQA 2IS4A 2KDOA 5LEJA 2CSOA 3UR3C 2XC7A 5KHDA 1MSEC 3H5RA 2P0WA 4KA4A 1FJLA 2W85A 3ONQA 4A3MJ 2VPLA 1IF1A 4ZH4F 3WGHA 2V9KA 3F23A 4M3FA 2XF7A 3D0SA 2GIZA 3HDDA 1MMNA 2XF5A 2FSWA 4RLQA 3HKZA 1F5TA 1FZPB 4WX9A 5ERIA 1P4XA 3HRSA 2V1UA 3HRTA 4HLYA 2Y48A 1R36A 1ZR4A 1TL8A 3I55I 1MKMA 2WB1A 1B9MA 4ETSA 4WXHA 3HUGB 5LFAA 1H0MA 1LEAA 2M8EA 3L2WA 1PDNC 3BG5A 4G6DA 1QZYA 4EM2A 2Z9OA 5CLSA 3WE3A 4A5MA 1R23A 2K9NA 3BG9A 4ENJA 2Z5UA 3G4SI 2KZGA 1KONA 5FKNA 2CQNA 3VYSB 3NRVA 4K2EA 1FLIA 1ZREA 5HS8A 1OFCX 3Q9SA 2D1VA 2HVQA 1S72I 2W1OA 4L18B 3OYFA 1EKEA 2FA5A 4XKVA 1X4PA 3W2VA 1MMAA 2PLYA 2V7FA 4UV8A 1TW2A 1BM9A 2Q2EB 2XF6A 3SEZA 3W6VA 3WG9A 1J75A 4UUVA 1ZARA 4P1WA 2E60A 3QOEA 3NQOA 3ZQCA 4EATA 1WQ2A 2PG4A 4U87A 1XMXA 2M7BA 5F64A 4NB5A 2BV6A 2IPQX 2W84A 3TMOA 1KU2A 5K5OA 2ZJRF 4A3KJ 2H6CA 2VASA 5HVQC 3HSFA 2EJRA 4DBRA 3LSMA 4NNJA 4GXOA 2DJNA 5IOYA 1Q1VA 2KT0A 2F4IA 5D6EA 3ZCOA 1DU0A 4OMYA 1DPUA 5HDKA 4IRGA 5LHHA 2PN6A 1X58A 1Z6RA 5M3MJ 2LY2A 1ZAOA 1I1GA 3GVAA 1AOYA 4KITB 2EFQA 3GTQJ 1SAUA 1W4MA 3DFGA 4XN3A 3E6CC 3LQRA 3AFHA 3B02A 1KU7A 3E5XA 1IAWA 2EV6A 3PSIA 3IL2A 1M1EB 2K40A 3I59B 1K78B 1R5ID 4A0YA 2MSYA 2OJED 1XGMA 4HX7A 5EG0A 4XIDA 1GXPA 5GAHJ 2ME6A 2F4OB 2LFBA 5GPAA 5L3BA 3QPLA 4FE7A 1RUOA 3S2DJ 3M9AA 3CCVI 3QQAA 1HKTA 2E2JJ 3KE2A 4RS8A 3ECHA 5IY5H 4BH9A 3E97A 1BOBA 3TOAA 1HW5A 3JSOA 3JRFA 2CUFA 3QP6A 1EJ9A 2R4GA 2Q8KA 1I6HJ 2JSPA 1YIOA 1ZYRF 4Y3OA 5L3DA 1I39A 1K6YA 1V5FA 4M3BA 4B09A 3TP3A 3KYLA 3GBGA 1SMYF 3WTXC 2KISA 3BG7A 3WU1B 3LMMA 4G8XA 3N97A 1D0ZA 3I4PA 3ABLH 2Y75A 5BS6A 4KUMA 2K4JA 3KETA 3GTPJ 2Q1ZB 5BMZA 5DM6F 2M8GX 1O3TA 3T0YA 4IRIA 2DA5A 2COBA 2IGNA 9ANTA 2A5YB 2YSRA 1UG0A 2WAQA 1D0YA 3PNVA 4C30A 4MLOA 4AUXA 4DZPA 2UWMA 4MNUA 1VFCA 3V7RA 5BPDA 3CCSI 3OIQA 3L09A 4BBRJ 1DGRM 3TO7A 4Y52J 4PDKA 1H88C 2A5WA 4ZJZA 2N8GA 4G12A 2X6OA 1SFUA 1RZ4A 4Y13A 1T6SA 2IRFG 2JT1A 3GCMA 4RMNA 3TW6A 1JGSA 2VJ4A 1I5ZA 1U2WA 2DYRH 5AIQA 4L0YB 2K86A 1DU6A 1ZHFA 1XN7A 4HOBA 2WAEA 1MIJA 3KP3A 2ZXIA 4FCYA 1GUUA 3FDYA 1O3QA 4B48A 3GFLA 4P55A 1G2HA 4FASD 3D5RC 5CVUA 4C2TA 2MA3A 1Y39A 4IHSA 4XL9A 3ESWB 1OQYA 3A01A 1R4MB 2R7TA 4GO1A 1QU3A 4EVIA 1E3HA 4QIWN 3E3VA 5C3EJ 4KIGA 1LB2A 4PJ0C 3CF5F 1YQAA 3G3ZA 2PMUA 3DXJF 3M4OJ 2ZXHA 4G94A 2CQKA 1FY7A 2J5PA 4BDZA 1D0XA 1PUEE 3HG9A 5DUKA 5FLXK 4AC0A 1T95A 3RIRA 1YW8A 2Y0MA 4BE0A 4QPQA 4OIQF 2VI6A 2VQHA 1FT9A 1I3QJ 3HYIA 1UHMA 2DLLA 5E79C 4M74A 4CSWA 3IH4A 1DP7P 2ZKZA 4YFKF 3L2RA 2BHZA 3I53A 1G3SA 5H20A 2Y31A 2KRHA 3BR6A 1T98A 4HZFA 4X1EA 4A3EJ 1ETYA 3KEOA 4G7HF 3RQ4A 4UY8I 3BPXA 3Q3SA 3CQZJ 5GAEJ 2HVSA 3TDUC 3JRIA 2LD5A 2WAQN 2EZIA 1H9TA 1RPWA 2QQAA 4P5OA 3G1LA 4C9YA 2ZSHB 3BC8A 3H3UA 3KYCB 4DIQA 1X3ZB 4CCOA 5FRNA 5D4SA 1TT0A 2KMUA 2PFBA 2CMPA 2HOTA 1YFHA 3ROUA 4AVZA 3SFZA 4GRIA 3MKWB 1RI7A 1TLHB 2OZUA 3CCUI 2RQQA 2YU3A 4KIBA 3QAHA 4JK1X 4I7HA 3ZR8X 2ZJPF 3OL4A 3QP5A 4MEYF 4LK0F 3LSTA 4DYRA 2AQEA 1LVAA 1D5VA 1PYVA 3L1PA 2XGCA 4CDGA 3S3MA 5FKKA 3HOXJ 1LDKB 1FP1D 3N05A 1LUJB 3QOPA 2LOOA 3C2GA 4L5EA 1YX5A 2XPUA 3OYBA 5B5EC 3CCJI 3I54A 2VN2A 2R5YB 4PJLA 5HOOA 1A36A 2V1XA 3DP7A 2VT2A 1HKQA 3VSLA 3MD2A 4U0YA 1IG7A 1EH7A 3ZOBA 1VQPI 1UELB 5CYVA 4EV0A 2HKXA 2EFPA 3CCRI 3IKTA 4BBSJ 5DTDA 2ISZA 3GMEA 2ID3A 4AU7A 4U0WA 5J6XA 1IDZA 3DKWA 4LG0A 1S6LA 2H1KA 3CD6I 1BJZA 4F92B 3VPRA 2PJRA 3FMQA 1IN5A 4YIFA 3LSGA 1OKRA 4IL6C 3SZPA 2FRHA 1VQ9I 2LNBA 5GPCA 1KZHA 4M3GA 2K7LA 3CP2A 2PJPA 1ETKA 2QWWA 5CQGA 5J3LA 2EV5A 5AIPA 2LC2A 3GUDA 1G8XA 2HTSA 2HYGD 2K3PA 3ECOA 5EGOB 1LFBA 2Z1DA 3QPSA 1I6XA 2UXXA 4RM2A 1MBKA 2I5UA 2MYSA 2JZYA 4PFPA 3HKZN 3ABKH 3BZ6A 3VDXA 2X1CA 1HDPA 4BHPA 4WF2A 5J40A 3S2HJ 2LR8A 5CVVA 5E1XA 4P96A 2HU9A 2IXSA 4BAYA 3GLLA 3K1MA 2E34A 1T56A 4Q48A 3CMAI 5IT3A 1X1AA 4CO8A 4X0GA 3HXLA 1MMSA 4M3EA 1XDUA 4KN7X 3F8FA 1HSTA 1BL0A 4E7IA 1LPQA 1HA8A 2QVOA 3V7CA 1VZ0A 4XONA 1UMQA 1VF9A 2Y0SA 3RYPA 3GZ6A 1YRNB 2R7UA 3BCAA 2GXGA 2KIQA 1B72A 4XLCA 5FLXZ 3T8RA 2Y30A 4E6KG 1B72B 1B1BA 3QPHA 5E8GA 2BXZA 2DT7B 2IP2A 2VXDA 3T5XA 2TRTA 4NC6A 4RGRA 1USSA 1R5GA 3RPUD 2VLAA 3S16J 1JJ6C 1MGTA 3CUQC 4HRIA 2NYXA 5IYBJ 4XOTA 2G7HA 4IJAA 4CCMA 2HNHA 2X1EA 1W5TA 3HTSB 5B3SH 2VBYA 2F5EA 4EJUA 1W5CC 4B3AA 1D8KA 3BG3A 1O7FA 3PNTA 1IUFA 2R5YA 5J47A 3FXLA 3PUFA 1FX7A 2OA4A 2QQ9A 1Z9CA 3FHNA 4LLGF 3CDHA 2GAUA 5DDGA 1I27A 2HWVA 3K10A 3BR0A 2EA4A 3F0CA 4N9IA 4NQWA 4PFOA 1S7EA 4UB8C 2CW8A 5D5WB 4F55A 1A6QA 5LEKA 1BR1A 2J5OA 2M4KA 3C18A 5C4JJ 4XSZF 3PNYA 4NBQA 1DUXC 5HLTA 4LG0B 2XPVA 1P4AA 3GTJJ 2ZC2A 4WCGA 2WY7Q 2RN7A 5K5RA 3C7JA 2KKOA 3ERMA 4M71A 1TQMA 5C4XJ 4CCJA 4ESFA 4IZZA 3HJEA 3DU5A 2WV1A 3PUBA 2OPTA 4JX5A 4FHTA 2FEZA 3KEYA 4AIKA 2M0CA 3VODA 4FISA 3DLAA 3JRHA 2B9SA 5CKTA 2STTA 2BY2A 2XIGA 1SD7A 2E7WA 3M1EA 4BE1A 4RB3C 4LK1F 3ZMVA 2HDDA 1T0FA 3OR1C 5FJ8J 1AKHB 2GQQA 3K70C 3W2WA 1UCRA 1U8RA 1SVLA 3K0LA 3RKXA 1MDMA 2DO7A 4KJZA 4ENKA 1PUFA 1UHSA 3NWSA 4F52A 3OYAA 4ZDPA 3DPTA 2DODA 4R8HA 3ZQ7A 2M45A 5H6QA 4DGWB 3D5LA 2BVLA 3BJOA 4UVBA 5M5WJ 4L9NA 3ZMDA 2DI3A 3L2CA 2OV7A 1VI0A 3I4MJ 1Y6IA 3OYEA 2DT5A 4XQFA 1IXRC 3P7NA 1V5GA 2DDBA 3Q0VA 1HKSA 5EZHA 1TP4A 2VOOA 2L01A 2IT0A 2VIXA 3MKLA 3ML6A 1RETA 2UXNA 1LJ9A 2V26A 2P8TA 2P5LC 3LAJA 4MHGA 1IN8A 5DEQA 4HF1A 1I3AA 5E1ZB 2GIVA 3CLOA 2PI0A 1D1AA 1BIAA 4B8XA 4BUPA 1ZQ3P 5F0CA 3FHZA 2FBKA 4G6QA 1B6AA 3EUKL 1VQ4I 4MIMA 5BOXA 4H4KC 2V1NA 3LL7A 4UVAA 2CUEA 4PK4A 2QYOA 1W7PB 3P9CA 3R0JA
chains in the Genus database with same CATH topology
3HOVJ 3ZQCA 3S14J 3HGGA 2ECBA 1ETWA 1HLVA 1GVDA 3MN2A 1BA5A 5K7HA 1K83J 4XRSG 4A3KJ 1ETXA 2ELKA 1WGXA 1JKOC 4CYCA 1GDTA 5IP9J 2DJNA 5IOYA 1Q1VA 2KT0A 1DU0A 3PO2J 1X58A 4UUSB 5M3MJ 2E1OA 4HNVA 2Y2ZA 3BR3A 1GV5A 1TWFJ 3O8HA 1MH4A 1MH3A 3FK7A 1JKPC 3GTQJ 1TWCJ 1WCMJ 5EYRA 3JREA 3C2BA 3RZOJ 1MBGA 3PM1A 1XC5A 3BTCA 2K40A 3K7AJ 1WH5A 2WB1N 1FIPA 2MSYA 2B63J 2CQQA 5J1UA 4D7MA 5EG0A 4XIDA 3FKIJ 2NVXJ 2ME6A 2LFBA 5GPAA 2XB5A 3LOCA 4QSHA 2EZKA 3QPLA 4FE7A 3NARA 3S2DJ 3QQAA 2IBDA 2E2JJ 2K9QA 2M34A 2G0EA 4CYCB 5F0FA 1PUFB 3HEFA 3RZDJ 1LE8A 1RKWA 2X9DA 5E3NA 2JWTA 4JP0A 2MW8A 3JRFA 2CUFA 4Y7NJ 1I6HJ 5IP6A 4M3BA 2DTZA 3TP3A 5EEAA 4I6ZA 3GBGA 4C2MJ 4IHXA 1JT6A 2YS9A 4JX4A 1SFOJ 1IV6A 2L0KA 3ZQIA 1MBHA 4A3CJ 1QVUA 1TC3C 2O7OA 3GTPJ 2JA7J 4MFEA 2M8GX 2XGEA 3S1QJ 1QPIA 3PO3J 3M3YJ 1IC8A 2DA5A 2COBA 3H0GJ 2R7ZJ 1VNDA 9ANTA 2Y9YA 2TCTA 4B1RA 4AUXA 4MLOA 1H89C 4DZPA 1VFCA 2DA2A 4W1UA 2PMZN 4BBRJ 4Y52J 2AO9A 2M2EA 1H88C 1U9OA 1OJLA 4BKXA 2N8GA 1ORKA 2EZHA 4G12A 1A5JA 2X6OA 1F36A 2JA8J 1U9NA 1T33A 3CDLA 3TW6A 1EF4A 3HM5A 2AHQA 4ABZA 3JRGA 4FTHA 1DU6A 2R0QC 5M3FJ 5FKMA 3TW7A 1GUUA 2NS8A 4FCYA 5E3LA 3FISA 2FQ4A 2NS7A 1G2HA 4XK4A 2LVSA 3CMYA 1AHDP 3GTLJ 3FK6A 3A01A 4D5CA 1X2NA 1AU7A 1R9TJ 2Y0SN 2LTPA 3HOYJ 3IH2A 1ETQA 1LFUP 2XRLA 4UUTA 2DMQA 2HI3A 1XG1A 3Q0UA 4QIWN 5C3EJ 4RDUA 2XPWA 5M5XJ 1LE8B 2X48A 2LLKA 2HXIA 5FKOA 3M4OJ 2CU7A 5IP7J 1MBJA 4JYKA 4UUSA 4A3IJ 5EGOA 2ME0A 1IJWC 5K7ZA 3ZQLA 4AC0A 3A03A 5E3MA 2HOAA 3NAUA 2VI6A 1GV2A 1I3QJ 4M6VA 3G1OA 3IH4A 2H8RA 2HOSA 1HDDC 1FTZA 1K61A 2Y31A 3BR6A 4XRSA 2E19A 3JRDA 2FD5A 4X1EA 4A3EJ 1ETYA 3TP0A 1FIAA 3HB9A 1ZGWA 5J1YA 3Q3SA 3CQZJ 3SDGA 2JA5J 1E3OC 3JRIA 2LD5A 1JUPA 2EZIA 2WAQN 1A6IA 1RPWA 5EDNA 3G1LA 3OSFA 5FLVA 3RQIA 5IOZA 2HYJA 2HOTA 2GLOA 4BXXJ 1FEXA 1NK3P 1ZR2A 1JUMA 2ZB9A 3BTIA 3G1MA 4W97A 1AKHA 4D5FA 1JJ8C 2L7FP 1ENHA 3GTGJ 4S0HB 4V2FA 2JN6A 4DYRA 2XGDA 5HODA 4AYBN 2W48A 3BT9A 1CQTA 4NDLA 3L1PA 2XGCA 2IEKA 5FKKA 3HOXJ 3DCFA 3B6CA 3JRBA 3GTMJ 3SFIA 4L5EA 2XPUA 1ZK8A 1H8AC 3LSPA 1Z77A 2DMTA 2KDZA 1NTCA 2R5YB 2O8KA 1Y1VJ 1QVTA 2DMUA 4DZJA 3BR2A 1IG7A 3ZOBA 1ZKGA 2DMPA 4A3LJ 3HOWJ 5E3OA 3BR1A 2EQRA 1ZTRA 4BBSJ 2E2HJ 4IEJA 1MBEA 4LOCA 5DTDA 1IDZA 2ID3A 1X2MA 3IH3A 5IYDJ 1JGGA 3I4NJ 1FTTA 2P81A 2H1KA 3OOUA 1JTXA 4A3BJ 1RR7A 1BJZA 1I50J 2L7ZA 3VPRA 5FLMJ 4C3HJ 2JK3A 3FIWA 1Z0XA 3OSGA 5JLXA 1GT0C 3LSGA 1BW6A 5DS9A 2QF7A 1W0UA 5F08A 5GPCA 4M3GA 1JTYA 5FKLA 4A93J 1ETKA 4JX6A 5J3LA 2JJ7A 5IPAA 3A02A 5J1RA 4GFBA 2XSDC 3E7LA 5EGOB 5F04A 4X6AJ 1LFBA 3WHBA 5EG0B 3QPSA 2HXOA 4FE4A 1MBKA 1RKTA 1U78A 2DA4A 3HKZN 3ZQHA 1HDPA 1POGA 3S2HJ 5EF6A 2LR8A 2DA6A 2DA7A 2VKVA 2QCOA 1T56A 1NK2P 1RESA 3LSJA 2L7MP 3BTLA 4M3EA 5F27A 3D1NI 1BL0A 1JKRC 3S1NJ 2ECCA 3O8GA 3TEDA 1B8IA 1UMQA 1VF9A 2K9SA 5BNGA 1OCTC 2I10A 1B8IB 1YRNB 3HBLA 2VKEA 1B72A 1YRNA 1MBFA 4XICA 2Y30A 3H3VK 4C3JJ 1B72B 1ETOA 2VPRA 2ID6A 2TRTA 4I76A 3CCYA 2JMWA 1U8BA 1ITYA 2YU9J 3ZQFA 1F43A 2DA3A 3BR5A 1JKQC 3S16J 1JJ6C 1WPKA 4EEFG 2LP0A 2EZLA 2M9HA 5IYBJ 3S1RJ 2JA6J 4IHYA 3WHCA 1XS9A 2XB0X 2EBIA 4C3IJ 1BW5A 3JRAA 3GTKJ 4B3AA 3BG3A 3S17J 4QTRA 1P7IA 5C44J 2IAIA 1IUFA 2R5YA 2FJ1A 1O4XA 5IYCJ 3OIOA 4DYCA 2CJJA 1WI3A 3BR0A 3F0CA 2DA1A 1S7EA 3JRCA 4B4CA 5JLWA 1ETVA 2CQXA 2GBYA 2L9RA 5EZGA 3B6AA 1TWGJ 4V2GA 4J19A 1SANA 5C4JJ 2MGQA 2EH3A 3HOZJ 2NOGA 3RKQA 3BQYA 2NVTJ 2XPVA 3GTJJ 1QRYA 4A3FJ 2LK2A 2OF7A 2YUSA 4MO7A 2E2IJ 1TWHJ 5K7FA 3BQZA 3IV5A 5C4XJ 3DEWA 3HOUJ 1HCRA 1HOMA 2WV1A 2OPTA 4JX5A 3HGYA 2RAEA 4BY7J 2VUMJ 5GP9A 2M0CA 4XRMA 2D5VA 1HF0A 1IGNA 4FISA 2DN0A 3JRHA 3A01B 1JUSA 1MSEC 1TWAJ 4DW6A 4DYQA 2CRGA 4BY1J 1FJLA 1MNMC 2HDDA 1AKHB 5FJ8J 2R5ZB 2NVYJ 2LKXA 3S15J 4A3JJ 4A3MJ 1OCPA 2FX0A 4M3FA 3LSRA 2HQ5A 3HDDA 1W0TA 1PUFA 1UHSA 3MVPA 3UKGA 4A3GJ 2MG4A 3Q0WA 2R92J 1APLC 2GM4A 5M5WJ 2NVQJ 2R5ZA 3I4MJ 1VI0A 5F0HA 4MFDA 1ZR4A 2LY9A 2DMNA 3JR9A 3SJMA 3Q0VA 3BG5A 1D5YA 4M3DA 1Y1WJ 1WH7A 5EZHA 1UG2A 3GTOJ 4IHWA 3MKLA 4A3DJ 1RETA 4IHVA 1MSFC 3K2AA 2K9NA 3BG9A 3ZQGA 1IRZA 5FKNA 1IDYA 2Y9ZA 2R93J 1OFCX 1JT0A 4RBOA 1ZQ3P 5F0CA 3S1MJ 3LNQA 4D7NA 2O9LA 4MIMA 3W6VA 4A69C 2CUEA 1P7JA 5F1JA 5M5YJ 3BTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV J;  3ZQC A;  3S14 J;  3HGG A;  2ECB A;  1ETW A;  1HLV A;  1GVD A;  3MN2 A;  1BA5 A;  5K7H A;  1K83 J;  4XRS G;  4A3K J;  1ETX A;  2ELK A;  1WGX A;  1JKO C;  4CYC A;  1GDT A;  5IP9 J;  2DJN A;  5IOY A;  1Q1V A;  2KT0 A;  1DU0 A;  3PO2 J;  1X58 A;  4UUS B;  5M3M J;  2E1O A;  4HNV A;  2Y2Z A;  3BR3 A;  1GV5 A;  1TWF J;  3O8H A;  1MH4 A;  1MH3 A;  3FK7 A;  1JKP C;  3GTQ J;  1TWC J;  1WCM J;  5EYR A;  3JRE A;  3C2B A;  3RZO J;  1MBG A;  3PM1 A;  1XC5 A;  3BTC A;  2K40 A;  3K7A J;  1WH5 A;  2WB1 N;  1FIP A;  2MSY A;  2B63 J;  2CQQ A;  5J1U A;  4D7M A;  5EG0 A;  4XID A;  3FKI J;  2NVX J;  2ME6 A;  2LFB A;  5GPA A;  2XB5 A;  3LOC A;  4QSH A;  2EZK A;  3QPL A;  4FE7 A;  3NAR A;  3S2D J;  3QQA A;  2IBD A;  2E2J J;  2K9Q A;  2M34 A;  2G0E A;  4CYC B;  5F0F A;  1PUF B;  3HEF A;  3RZD J;  1LE8 A;  1RKW A;  2X9D A;  5E3N A;  2JWT A;  4JP0 A;  2MW8 A;  3JRF A;  2CUF A;  4Y7N J;  1I6H J;  5IP6 A;  4M3B A;  2DTZ A;  3TP3 A;  5EEA A;  4I6Z A;  3GBG A;  4C2M J;  4IHX A;  1JT6 A;  2YS9 A;  4JX4 A;  1SFO J;  1IV6 A;  2L0K A;  3ZQI A;  1MBH A;  4A3C J;  1QVU A;  1TC3 C;  2O7O A;  3GTP J;  2JA7 J;  4MFE A;  2M8G X;  2XGE A;  3S1Q J;  1QPI A;  3PO3 J;  3M3Y J;  1IC8 A;  2DA5 A;  2COB A;  3H0G J;  2R7Z J;  1VND A;  9ANT A;  2Y9Y A;  2TCT A;  4B1R A;  4AUX A;  4MLO A;  1H89 C;  4DZP A;  1VFC A;  2DA2 A;  4W1U A;  2PMZ N;  4BBR J;  4Y52 J;  2AO9 A;  2M2E A;  1H88 C;  1U9O A;  1OJL A;  4BKX A;  2N8G A;  1ORK A;  2EZH A;  4G12 A;  1A5J A;  2X6O A;  1F36 A;  2JA8 J;  1U9N A;  1T33 A;  3CDL A;  3TW6 A;  1EF4 A;  3HM5 A;  2AHQ A;  4ABZ A;  3JRG A;  4FTH A;  1DU6 A;  2R0Q C;  5M3F J;  5FKM A;  3TW7 A;  1GUU A;  2NS8 A;  4FCY A;  5E3L A;  3FIS A;  2FQ4 A;  2NS7 A;  1G2H A;  4XK4 A;  2LVS A;  3CMY A;  1AHD P;  3GTL J;  3FK6 A;  3A01 A;  4D5C A;  1X2N A;  1AU7 A;  1R9T J;  2Y0S N;  2LTP A;  3HOY J;  3IH2 A;  1ETQ A;  1LFU P;  2XRL A;  4UUT A;  2DMQ A;  2HI3 A;  1XG1 A;  3Q0U A;  4QIW N;  5C3E J;  4RDU A;  2XPW A;  5M5X J;  1LE8 B;  2X48 A;  2LLK A;  2HXI A;  5FKO A;  3M4O J;  2CU7 A;  5IP7 J;  1MBJ A;  4JYK A;  4UUS A;  4A3I J;  5EGO A;  2ME0 A;  1IJW C;  5K7Z A;  3ZQL A;  4AC0 A;  3A03 A;  5E3M A;  2HOA A;  3NAU A;  2VI6 A;  1GV2 A;  1I3Q J;  4M6V A;  3G1O A;  3IH4 A;  2H8R A;  2HOS A;  1HDD C;  1FTZ A;  1K61 A;  2Y31 A;  3BR6 A;  4XRS A;  2E19 A;  3JRD A;  2FD5 A;  4X1E A;  4A3E J;  1ETY A;  3TP0 A;  1FIA A;  3HB9 A;  1ZGW A;  5J1Y A;  3Q3S A;  3CQZ J;  3SDG A;  2JA5 J;  1E3O C;  3JRI A;  2LD5 A;  1JUP A;  2EZI A;  2WAQ N;  1A6I A;  1RPW A;  5EDN A;  3G1L A;  3OSF A;  5FLV A;  3RQI A;  5IOZ A;  2HYJ A;  2HOT A;  2GLO A;  4BXX J;  1FEX A;  1NK3 P;  1ZR2 A;  1JUM A;  2ZB9 A;  3BTI A;  3G1M A;  4W97 A;  1AKH A;  4D5F A;  1JJ8 C;  2L7F P;  1ENH A;  3GTG J;  4S0H B;  4V2F A;  2JN6 A;  4DYR A;  2XGD A;  5HOD A;  4AYB N;  2W48 A;  3BT9 A;  1CQT A;  4NDL A;  3L1P A;  2XGC A;  2IEK A;  5FKK A;  3HOX J;  3DCF A;  3B6C A;  3JRB A;  3GTM J;  3SFI A;  4L5E A;  2XPU A;  1ZK8 A;  1H8A C;  3LSP A;  1Z77 A;  2DMT A;  2KDZ A;  1NTC A;  2R5Y B;  2O8K A;  1Y1V J;  1QVT A;  2DMU A;  4DZJ A;  3BR2 A;  1IG7 A;  3ZOB A;  1ZKG A;  2DMP A;  4A3L J;  3HOW J;  5E3O A;  3BR1 A;  2EQR A;  1ZTR A;  4BBS J;  2E2H J;  4IEJ A;  1MBE A;  4LOC A;  5DTD A;  1IDZ A;  2ID3 A;  1X2M A;  3IH3 A;  5IYD J;  1JGG A;  3I4N J;  1FTT A;  2P81 A;  2H1K A;  3OOU A;  1JTX A;  4A3B J;  1RR7 A;  1BJZ A;  1I50 J;  2L7Z A;  3VPR A;  5FLM J;  4C3H J;  2JK3 A;  3FIW A;  1Z0X A;  3OSG A;  5JLX A;  1GT0 C;  3LSG A;  1BW6 A;  5DS9 A;  2QF7 A;  1W0U A;  5F08 A;  5GPC A;  4M3G A;  1JTY A;  5FKL A;  4A93 J;  1ETK A;  4JX6 A;  5J3L A;  2JJ7 A;  5IPA A;  3A02 A;  5J1R A;  4GFB A;  2XSD C;  3E7L A;  5EGO B;  5F04 A;  4X6A J;  1LFB A;  3WHB A;  5EG0 B;  3QPS A;  2HXO A;  4FE4 A;  1MBK A;  1RKT A;  1U78 A;  2DA4 A;  3HKZ N;  3ZQH A;  1HDP A;  1POG A;  3S2H J;  5EF6 A;  2LR8 A;  2DA6 A;  2DA7 A;  2VKV A;  2QCO A;  1T56 A;  1NK2 P;  1RES A;  3LSJ A;  2L7M P;  3BTL A;  4M3E A;  5F27 A;  3D1N I;  1BL0 A;  1JKR C;  3S1N J;  2ECC A;  3O8G A;  3TED A;  1B8I A;  1UMQ A;  1VF9 A;  2K9S A;  5BNG A;  1OCT C;  2I10 A;  1B8I B;  1YRN B;  3HBL A;  2VKE A;  1B72 A;  1YRN A;  1MBF A;  4XIC A;  2Y30 A;  3H3V K;  4C3J J;  1B72 B;  1ETO A;  2VPR A;  2ID6 A;  2TRT A;  4I76 A;  3CCY A;  2JMW A;  1U8B A;  1ITY A;  2YU9 J;  3ZQF A;  1F43 A;  2DA3 A;  3BR5 A;  1JKQ C;  3S16 J;  1JJ6 C;  1WPK A;  4EEF G;  2LP0 A;  2EZL A;  2M9H A;  5IYB J;  3S1R J;  2JA6 J;  4IHY A;  3WHC A;  1XS9 A;  2XB0 X;  2EBI A;  4C3I J;  1BW5 A;  3JRA A;  3GTK J;  4B3A A;  3BG3 A;  3S17 J;  4QTR A;  1P7I A;  5C44 J;  2IAI A;  1IUF A;  2R5Y A;  2FJ1 A;  1O4X A;  5IYC J;  3OIO A;  4DYC A;  2CJJ A;  1WI3 A;  3BR0 A;  3F0C A;  2DA1 A;  1S7E A;  3JRC A;  4B4C A;  5JLW A;  1ETV A;  2CQX A;  2GBY A;  2L9R A;  5EZG A;  3B6A A;  1TWG J;  4V2G A;  4J19 A;  1SAN A;  5C4J J;  2MGQ A;  2EH3 A;  3HOZ J;  2NOG A;  3RKQ A;  3BQY A;  2NVT J;  2XPV A;  3GTJ J;  1QRY A;  4A3F J;  2LK2 A;  2OF7 A;  2YUS A;  4MO7 A;  2E2I J;  1TWH J;  5K7F A;  3BQZ A;  3IV5 A;  5C4X J;  3DEW A;  3HOU J;  1HCR A;  1HOM A;  2WV1 A;  2OPT A;  4JX5 A;  3HGY A;  2RAE A;  4BY7 J;  2VUM J;  5GP9 A;  2M0C A;  4XRM A;  2D5V A;  1HF0 A;  1IGN A;  4FIS A;  2DN0 A;  3JRH A;  3A01 B;  1JUS A;  1MSE C;  1TWA J;  4DW6 A;  4DYQ A;  2CRG A;  4BY1 J;  1FJL A;  1MNM C;  2HDD A;  1AKH B;  5FJ8 J;  2R5Z B;  2NVY J;  2LKX A;  3S15 J;  4A3J J;  4A3M J;  1OCP A;  2FX0 A;  4M3F A;  3LSR A;  2HQ5 A;  3HDD A;  1W0T A;  1PUF A;  1UHS A;  3MVP A;  3UKG A;  4A3G J;  2MG4 A;  3Q0W A;  2R92 J;  1APL C;  2GM4 A;  5M5W J;  2NVQ J;  2R5Z A;  3I4M J;  1VI0 A;  5F0H A;  4MFD A;  1ZR4 A;  2LY9 A;  2DMN A;  3JR9 A;  3SJM A;  3Q0V A;  3BG5 A;  1D5Y A;  4M3D A;  1Y1W J;  1WH7 A;  5EZH A;  1UG2 A;  3GTO J;  4IHW A;  3MKL A;  4A3D J;  1RET A;  4IHV A;  1MSF C;  3K2A A;  2K9N A;  3BG9 A;  3ZQG A;  1IRZ A;  5FKN A;  1IDY A;  2Y9Z A;  2R93 J;  1OFC X;  1JT0 A;  4RBO A;  1ZQ3 P;  5F0C A;  3S1M J;  3LNQ A;  4D7N A;  2O9L A;  4MIM A;  3W6V A;  4A69 C;  2CUE A;  1P7J A;  5F1J A;  5M5Y J;  3BTJ A; 
#chains in the Genus database with same CATH topology
 3HOV J;  3ERE D;  3S14 J;  3HGG A;  1ZLJ A;  2VKD A;  4L9T A;  1HXD A;  1SD6 A;  3CMM A;  4KT6 A;  2CG4 A;  1BA5 A;  5LHG A;  2ELK A;  1WGX A;  2HDW A;  2NRA C;  5FFX A;  3DKY A;  4CYC A;  3AAF A;  3D5S C;  1GDT A;  3PIO F;  4P9U A;  4Y15 A;  3V8J A;  2CW0 F;  5D6F A;  2E1O A;  2P5K A;  1GV5 A;  4JQF A;  2KLO A;  2KIM A;  1KGS A;  2K85 A;  1P4W A;  4A2U A;  4AID A;  1WJB A;  3FK7 A;  1JKP C;  3CCQ I;  4ESJ A;  1TWC J;  2O0Y A;  5EYR A;  3BP8 A;  5E17 F;  2XGX A;  3A0H C;  3C2B A;  1MBG A;  1E3P A;  1PP7 U;  2RNJ A;  2ISY A;  3KEQ A;  2M5W A;  3K7A J;  4IQJ A;  4ON0 A;  1S7A A;  1FIP A;  3LAP A;  3CUQ B;  3KP4 A;  4RA2 A;  4D7M A;  3X2Q H;  3FKI J;  2O8X A;  4XKC A;  5CPR B;  3OS0 A;  1SVO A;  3DWL E;  1CF7 B;  2HQR A;  3LOC A;  4GDF A;  3NAR A;  1ZG1 A;  3DBR B;  5KCM A;  3CDI A;  5JHF A;  1YE9 A;  2IBD A;  1ZLK A;  3IWZ A;  4YFN F;  3GZ5 A;  2QKM B;  1HC8 A;  1U5T C;  1HSJ A;  1KYW A;  1PUF B;  3HEF A;  3RZD J;  3HPH A;  5F6F A;  4U7B A;  1LE8 A;  4C2U A;  2GZW A;  2JWT A;  2W4S A;  1IN7 A;  1BN5 A;  2IA0 A;  5ICE A;  1K6O A;  3OIP A;  1OLT A;  2HQN A;  1ERD A;  2ADU A;  2DTZ A;  4NC7 A;  4BQO A;  2XDV A;  4IHX A;  1WJA A;  3L2U A;  5A2Q K;  2JA2 A;  4RB1 A;  5LGU A;  1X1C A;  3EYY A;  4JOM A;  1IV6 A;  2L0K A;  3ZQI A;  2O6G E;  1QVU A;  3JTH A;  1TC3 C;  3DEE A;  4M72 A;  3WTY C;  3HOS A;  2CV2 A;  3S1Q J;  1QPI A;  3M3Y J;  5BQT A;  3COA C;  2R7Z J;  1VND A;  3H9J A;  2BY3 A;  3FXJ A;  2UZK A;  3LA2 A;  2TCT A;  4B1R A;  1H89 C;  1UFM A;  3TO6 A;  3B73 A;  1WI9 A;  2DA2 A;  1OR7 C;  4LGW A;  1LDJ A;  2AO9 A;  2R3S A;  3VFZ A;  3RSN A;  2QSH X;  2VOD A;  1E2X A;  3MZH A;  2VXZ A;  2XAJ A;  1F36 A;  1O7L A;  1SFX A;  1U9N A;  3JSP A;  1T33 A;  1FNN A;  4RAY A;  3PQK A;  2ZJQ F;  2FNP A;  3HM5 A;  3MZY A;  2AHQ A;  1Z1D A;  2R0Q C;  4BXF A;  1BR2 A;  2QEN A;  5FKM A;  2M3A A;  4II2 A;  1XCV A;  3TW7 A;  1Z21 A;  2NS8 A;  2V6C A;  2XUB A;  2M7A A;  3QYB A;  2ZO4 A;  3DU6 A;  4LLL A;  2W00 A;  1MND A;  2PMH A;  3ABM H;  1YJW I;  4L0Z B;  2LVS A;  4EQQ A;  4LIT A;  1MMG A;  1S7O A;  4FQG A;  1X2N A;  3TDZ C;  3CO7 C;  3AG3 H;  3IH2 A;  3U1K A;  3ULQ B;  2XRL A;  4UUT A;  5GTH C;  1XG1 A;  5H2F C;  4RGS A;  4RDU A;  4IXA A;  4Z2Y A;  3I59 A;  2XPW A;  5M5X J;  1YS7 A;  2OC6 A;  2LDU A;  3REO A;  2LKS A;  3VEP A;  2DFE A;  2HXI A;  5FKO A;  2H6B A;  2HR3 A;  3OYI A;  1MMD A;  5IP7 J;  3E6D A;  4HQM A;  2L9V A;  3BDD A;  4LFU A;  4J00 A;  3ZQL A;  5E3M A;  2HOA A;  3NAU A;  1TNS A;  3QYE A;  1X3W B;  2V79 A;  3FM5 A;  4M6V A;  1KU3 A;  3F8B A;  2OTL I;  3DTK A;  3BJA A;  3M7G A;  1ULY A;  4XRS A;  5KAF C;  2ZNY A;  3S32 A;  1FIA A;  1W7P A;  1YO5 C;  3L00 A;  3SDG A;  2OQG A;  3P5J A;  4OU0 A;  5EJC A;  4NUB A;  2W24 A;  3ZXS A;  3TL4 X;  2OTJ I;  4YIR X;  3OSF A;  2YR2 A;  2DK5 A;  2KL4 A;  1B59 A;  4HF0 A;  2RVC A;  5IOZ A;  1QHG A;  4OIP F;  2M4G A;  1HQC A;  5LBQ A;  5HLG A;  2EFO A;  1SEU A;  1X19 A;  5ED4 A;  1FEX A;  1WJE A;  4HDU A;  2ZME C;  1OR7 A;  2QA4 I;  1JUM A;  1ZRD A;  4WXC A;  3DTE A;  2ZB9 A;  3DF8 A;  3G73 A;  2LRE A;  1X1B A;  1JJ8 C;  3FBN B;  1JI8 A;  3GTG J;  1ENH A;  3R60 A;  2L3D A;  5B66 C;  2FQ3 A;  4V2F A;  2DCE A;  2JN6 A;  1R7J A;  1PP8 F;  1FMW A;  2L9S A;  2JVG A;  1V54 H;  2A68 F;  2H1L A;  2W48 A;  5FGM A;  4NDL A;  1YG2 A;  4M9Z A;  3IRQ A;  1L3L A;  3TKY A;  5EEG A;  2FOK A;  4AYB A;  3NEU A;  5IT9 Z;  3TGN A;  3G2B A;  3SXY A;  2KDZ A;  2V1D A;  4ZTF A;  4OIO F;  2AS5 F;  5J8F A;  1QVT A;  2W25 A;  3BZC A;  3H36 A;  4R79 A;  2AQF A;  3VYR B;  3ZMZ A;  1ONV A;  2BXY A;  3IC7 A;  4RM3 A;  2DMP A;  1XGO A;  2JVH A;  4A3L J;  5J4V A;  3WGI A;  5E3O A;  4XRF A;  1XPX A;  2L4M A;  3HPG A;  4IEJ A;  1MBE A;  4PJM A;  1R1T A;  3IH3 A;  2V9P A;  2WC2 A;  2P81 A;  1WJ5 A;  2IGO A;  3AG1 H;  1RR7 A;  4XLN F;  1I50 J;  4ANJ A;  5HDG A;  4KMF A;  3CC2 I;  3F21 A;  3JTG A;  4L9V A;  4MTE A;  5JLX A;  1BW6 A;  4MQ9 F;  4EGY A;  2QF7 A;  1R1U A;  1G59 A;  3VB2 A;  1JHF A;  1W0U A;  3H5N A;  4IOA F;  2LBF A;  2GOX B;  4HV5 A;  5ICG A;  5KVR A;  5JFR A;  2E35 A;  2HYF A;  4I0B A;  5DD4 A;  5IPA A;  2DU9 A;  3I9V 2;  3E7L A;  2FE3 A;  3K4J A;  4X6A J;  4ZYA A;  2A05 A;  3KP7 A;  3WHB A;  5EG0 B;  3SZT A;  2HXO A;  2Z33 A;  3CJR B;  2R7S A;  5L3E A;  3N4M A;  3ZQH A;  3L9F A;  2K27 A;  4KMU X;  3MCZ A;  3HZJ A;  4UHT A;  4MTD A;  1RRJ A;  3QRF F;  2QSG X;  5FRO A;  5EF6 A;  3CC7 I;  4I09 A;  1B4A A;  1FP2 A;  4LD5 A;  3BRO A;  3CJN A;  2QCO A;  4A12 A;  3GW2 A;  4ZDL A;  4XBF A;  4CA0 A;  1NK2 P;  1R00 A;  1RES A;  1Y8Q B;  2LG4 A;  3FMR A;  3BTL A;  2OCC H;  4KT5 C;  4M9S A;  5JI6 A;  2FML A;  4ZTJ A;  3S1N J;  1TNT A;  2PX9 A;  2G7U A;  3ABT A;  2K9S A;  5FFZ A;  5E18 F;  3FXU A;  2I10 A;  3BCB A;  5AON A;  4LJZ F;  1R49 A;  1MBF A;  3EUH A;  2ZFW A;  1XB4 A;  4C3J J;  1R4N B;  3CCL I;  5KK1 A;  3DBL B;  2DOA A;  1MJB A;  1FSE A;  1LDD A;  3FWE A;  4OAZ A;  4R1H A;  3F6V A;  4NHJ A;  5ICC A;  5DV5 A;  4BYY A;  2H94 A;  1F43 A;  3KCC A;  2DA3 A;  1XSX A;  2DXI A;  3F22 A;  1WPK A;  4EEF G;  2M9H A;  4GYI A;  3S1R J;  4EJT A;  4IHY A;  1EV7 A;  1OCZ H;  3WHC A;  2QEX I;  4OIR F;  1XS9 A;  3K6G A;  2XB0 X;  2D1H A;  4PUS A;  4DNC A;  1SMT A;  2MC4 A;  1BW5 A;  3CME I;  1NH3 A;  2L4A A;  2NS0 A;  2X1D A;  2XRN A;  3GYH X;  1U3E M;  3QWL A;  3S17 J;  2WA0 A;  3V42 A;  2CH0 A;  3L2Q A;  2DJI A;  4QTR A;  2IA2 A;  3AKZ A;  1W7P D;  1P7I A;  5C44 J;  1FBS A;  4XKB A;  4EM1 A;  5D5X B;  5TGT A;  3BG6 A;  1O4X A;  4A6D A;  1DGW Y;  2JSC A;  4PZJ A;  4IKF A;  2CJJ A;  1WRJ A;  3SHF A;  3W6K B;  3MKZ A;  3K4M A;  3TOB A;  3RTR A;  3GO5 A;  2FUG 2;  4UNO A;  3JRC A;  1IRF A;  1IRX A;  2CQX A;  2MD0 A;  4IVN A;  4PJN A;  2GOM A;  3B6A A;  1TWG J;  2VJ5 A;  3MEX A;  4HNU A;  1SC7 A;  3O2P E;  1IXC A;  3C1D A;  2IA1 A;  1QRY A;  2WAD A;  4LB5 A;  3LQQ A;  2A3S A;  2OF7 A;  2YUS A;  2E2I J;  2P4W A;  2IS1 A;  5JHU A;  3O3K A;  3IV5 A;  4E7L A;  1OPC A;  1OIS A;  1YTY A;  2WTE A;  1A31 A;  1HOM A;  4Y17 A;  3HGY A;  2OBP A;  4OAY A;  2BVM A;  6PAX A;  5GP9 A;  4XRM A;  4DBQ A;  1YHQ I;  1IGN A;  3SYT A;  4M6X A;  4RB2 C;  2BY1 A;  2L02 A;  2QM3 A;  2R7O A;  4I99 C;  4DOZ A;  1B9N A;  2FF4 A;  3HHG A;  4KN4 X;  1IZ1 A;  1TWA J;  3IKV A;  3A01 B;  5L3C A;  4A5N A;  2CRG A;  2EB7 A;  2QLZ A;  5LD2 C;  4BY1 J;  1Y8R B;  3E5Q A;  5B1A H;  3U2R A;  2R5Z B;  2LKX A;  3S15 J;  3MMY B;  3R0A A;  3S2W A;  1OCP A;  2VBX A;  3PL8 A;  4CHU A;  1SFE A;  2HQ5 A;  4BXU A;  2W7N A;  2AXT C;  3T8T A;  2EFN A;  1G3Y A;  1YW7 A;  1FOY A;  1X1P A;  1Z67 A;  2XSJ C;  2K5C A;  3UKG A;  4PSX A;  4A3G J;  2R7X A;  1FWZ A;  1WFX A;  3VSK A;  2CFX A;  2GM4 A;  5D5V B;  1U5T A;  2R5Z A;  3K4N A;  4DJA A;  4WXD A;  5F0H A;  4ENM A;  2FMY A;  2H8W A;  4N4N B;  2KPM A;  2DMN A;  2Z3Y A;  3JR9 A;  3K4C A;  4HAM A;  3R6S A;  3PFI A;  1Y1W J;  1UG2 A;  3PQJ A;  2GA1 A;  3DEU A;  4ZYD A;  3BPV A;  2OUM A;  3UNG C;  5KNL A;  4ESB A;  1LFP A;  4A3D J;  4IHV A;  1MSF C;  2CYY A;  5GAG J;  4B47 A;  2CS3 A;  2M30 A;  2HEO A;  4OIN F;  5FRM A;  1IRZ A;  5L3G A;  2R93 J;  1YOV B;  1JT0 A;  3EQL F;  1JHH A;  2FU4 A;  2HDC A;  4YFX F;  3LNQ A;  2VON A;  4HPQ A;  3RYR A;  3JCU C;  4YII A;  4IPA A;  5LGN A;  1P7J A;  5HS7 A;  2XRO A;  4CUG A;  3OYM A;  5CVJ A;  2KHM A;  4RAZ A;  2ECB A;  4NQW B;  3RJP A;  1HLV A;  1GVD A;  2C6Y A;  4BEH A;  2WAF A;  4GGG A;  1OMI A;  2JTV A;  1C0W A;  1UJ8 A;  1OYI A;  4XRS G;  2L9N A;  4HF2 A;  3HSR A;  3LFK A;  1JKO C;  1Q1H A;  3A0B C;  4B3X A;  3JAM K;  3E0J B;  3DPL C;  3K4L A;  3E1S A;  2HPM A;  2HZT A;  1K79 A;  3G71 I;  3PO2 J;  4UUS B;  1RUN A;  2Y2Z A;  3BR3 A;  1TWF J;  2BEO A;  2EK5 A;  3MKY B;  4CYD A;  5DD8 A;  2HQA A;  2X51 A;  3FMS A;  2VBW A;  2BE5 F;  1XDS A;  4RLF A;  3JRE A;  3WOD F;  3MZ8 A;  4O6J A;  3RZO J;  1NG7 A;  1U0J A;  2F6C A;  4HW0 A;  4AD9 A;  5GAD J;  4IO9 F;  2E1M B;  3QU3 A;  1L0O C;  1DDN A;  3KPH A;  2NVX J;  1MW7 A;  5JVG F;  2BGC A;  4HG2 A;  2ESN A;  1E0E A;  2HKO A;  4G9Y A;  4JBA A;  3CJT B;  1CGP A;  1YJN I;  2OCE A;  1J2X A;  1VQL I;  4IRH A;  2GXA A;  2M34 A;  2XAS A;  2G0E A;  2UV1 A;  2ZME A;  4P9F A;  5E3N A;  3JW4 A;  3V4G A;  1CF7 A;  3PSF A;  1HBX G;  4D0P A;  4Y7N J;  3IRR A;  5IP6 A;  4KYW A;  5EEA A;  2ZME B;  1JT6 A;  4I02 A;  2LKP A;  2YS9 A;  4JX4 A;  2XAQ A;  4KIC A;  1SFO J;  1ZN2 A;  1REP C;  3H9Q A;  4A3C J;  2JUG A;  4M6Y A;  4FT8 A;  3ZMU A;  1IC8 A;  5ILV A;  3H0G J;  2JRT A;  2MH2 A;  2RQP A;  2IS2 A;  2P7V B;  3WTZ A;  1MJ9 A;  2L54 A;  4OMZ A;  1WSU A;  1QA6 A;  3FXK A;  4G7O F;  2PMZ N;  4ZYH A;  4BQA A;  2RNG A;  2MAB A;  2M2E A;  1U9O A;  4GCV A;  1MJA A;  1OJL A;  4XLE A;  4BKX A;  1VQ5 I;  1YX3 A;  2EZH A;  1A5J A;  4G6T B;  2W57 A;  2VBZ A;  5M5Y J;  2JA8 J;  3VYT B;  4HST A;  3CDL A;  1FYL A;  4F3Q A;  4CGZ A;  1J59 A;  3HC7 A;  3EYI A;  2F5F A;  5EEH A;  5DCF A;  4ABZ A;  5FB2 A;  4FTH A;  4ASN A;  4HX8 A;  4KNY A;  5M3F J;  1AWC A;  2XVC A;  2ESH A;  1WVR A;  1UHW A;  1Z91 A;  2IVM A;  3I71 A;  4Q5S F;  2K9M A;  4IOC F;  2NS7 A;  1N75 A;  3V7S A;  4FX4 A;  1DQU A;  3P9K A;  2NVU B;  3CMY A;  1AHD P;  1K4T A;  3OWT A;  3GTL J;  2E1C A;  2VQC A;  1ZGA A;  2KZV A;  4D5C A;  1R9T J;  2EIJ H;  1T2K A;  1Z3Y A;  2VE8 A;  2DFI A;  4M9X A;  3W3C A;  2DMQ A;  4BEH B;  2HI3 A;  1GHC A;  1DP3 A;  2MH9 A;  3K69 A;  4BGD A;  2IJL A;  3OS2 A;  3KZI C;  2F5V A;  2X48 A;  5B1B H;  4ITV A;  4I0A A;  4U0V A;  1BR4 A;  2E36 A;  1XGN A;  4O3M A;  1FOW A;  3HL2 A;  1QO0 D;  2OZ6 A;  3HHH A;  2CU7 A;  2XKP A;  2DT6 A;  1MBJ A;  1XGS A;  2YPR A;  4L9J A;  4UUS A;  2M1B A;  1IJW C;  2ACJ A;  4U88 A;  3A03 A;  2DK8 A;  1BBY A;  1SD5 A;  4RGX A;  2K3F A;  1GV2 A;  1KU9 A;  1WKM A;  1SAX A;  1KYZ A;  2K02 A;  3G1O A;  1WJD A;  2H8R A;  4V19 K;  2A6H F;  4UXN A;  1HDD C;  1FTZ A;  1K61 A;  4UV9 A;  2EWN A;  3J7A Y;  1N77 A;  2DBB A;  3VOE A;  4BJT A;  1ZGW A;  3CP8 A;  2M0M A;  3TBI A;  3DKX A;  3ZQQ A;  2JA5 J;  1JUP A;  3WTS C;  1A6I A;  1BI1 A;  5K5Q A;  2EFW A;  2E5Z A;  1U5T B;  3GLX A;  3W2A A;  3HOT A;  2PMZ A;  3RQI A;  3AG4 H;  3KLO A;  1UAA A;  3MAJ A;  4E7K A;  1ZH5 A;  4MEX F;  1O57 A;  2GLO A;  4XKW A;  1Z05 A;  4HDV A;  1T39 A;  3OYC A;  4BXX J;  5J4Y A;  2F5D A;  1NK3 P;  1D1B A;  1ZR2 A;  4PGG A;  3ISP A;  3DQV C;  2NNN A;  3IAS 2;  2X0L A;  3BTI A;  3G1M A;  3M8F A;  4FET A;  1IV8 A;  3CES A;  4BHC A;  2NOJ B;  3HTU A;  2L7F P;  2WWY A;  1BC8 C;  4S0H B;  3HUG A;  4Q47 A;  3IHU A;  5HNH A;  3OYK A;  4HEA 2;  5HOD A;  1STZ A;  1BIB A;  4E7Z A;  3LA7 A;  2LY1 A;  2OAZ A;  3JRB A;  4LB6 B;  1T0F C;  4BNC A;  3GTM J;  5D4R A;  2ZBK A;  1FOK A;  1H8A C;  1ZK8 A;  2L2O A;  3GFI A;  2DMT A;  2VOP A;  4B44 A;  2Z99 A;  3TO9 A;  5DYM A;  3ZMS A;  2O8K A;  1Y1V J;  3VYU B;  1OYW A;  2DMU A;  1S5L C;  3S3N A;  2QZ8 A;  3CTA A;  4PCQ A;  2LBF B;  1U6G A;  2HGC A;  3M07 A;  2BW3 A;  3JAM Z;  2L7K A;  3BR1 A;  1FC3 A;  2EQR A;  5H6R A;  3RCO A;  2E2H J;  2STW A;  4LOC A;  5IYD J;  4RGU A;  1JGG A;  3I4N J;  4ZYE A;  3FXO A;  1ODD A;  3OOU A;  1TBX A;  2B0L A;  4F91 B;  5L3F A;  4C3H J;  5D5U B;  3ASN H;  4EJO A;  3F6O A;  3RKY A;  1P2F A;  1PJR A;  1J7K A;  5DS9 A;  5KAI C;  3WTV C;  4AM3 A;  3F9K A;  3WGG A;  1QPM A;  2E1N A;  2V6E A;  2OD5 A;  1E17 A;  2HOE A;  1R71 A;  3CCE I;  1JTY A;  2Q2E A;  4A93 J;  4XLP F;  4O5V A;  4IHT A;  1SFK A;  4S05 A;  3HIF A;  4PJJ A;  4TV7 A;  1FSH A;  1LNW A;  2D2W A;  1QHH D;  3SQN A;  4CXF A;  2IW5 A;  5J1R A;  3EET A;  1V5E A;  3EUH C;  4BE2 A;  4HBL A;  1VQM I;  5ILU A;  3FKJ A;  4FE4 A;  1U78 A;  3FM3 A;  2CWE A;  3OR2 C;  1XD7 A;  5LHI A;  3S8P A;  3KZY A;  1W5S A;  1POG A;  1S3J A;  2KIU A;  2O3F A;  3V8L A;  2KRC A;  4GYG A;  5LRR A;  2E1M C;  2CUZ A;  1UB9 A;  1KQ0 A;  4BL0 B;  3U1D A;  5DCM B;  3D1N I;  1Y56 A;  1WZ2 A;  2JRM A;  3O8G A;  3G6E I;  3DPU A;  1W36 C;  5E1W A;  2CV0 A;  4XIC A;  1R6R A;  3HSE A;  3H3V K;  2JPC A;  2A6T A;  3M1C A;  2LF7 A;  2VPR A;  2MC3 A;  3RKW A;  2A69 F;  2CW7 A;  1HW1 A;  4FX0 A;  3A4C A;  3CO6 C;  1F9N A;  4I76 A;  1FBQ A;  2JPB A;  3FZV A;  2FOW A;  1JKQ C;  3CLQ A;  2LP0 A;  3K1N A;  2JA6 J;  2XHK A;  4EGZ A;  1Z6T A;  3KX2 A;  5J8C A;  1W1W E;  1QNT A;  1SVM A;  1YS6 A;  3IWF A;  4KDP A;  2ZCW A;  4C3I J;  5FD5 A;  2R7Q A;  3LSI A;  3CF2 A;  3GXO A;  4CIC A;  2NAZ A;  1TQI A;  2DQL A;  5ILS A;  3CZ6 A;  3HRU A;  3WU2 C;  2K4B A;  3SZG A;  1OYY A;  2PBI A;  2G9W A;  5TJJ A;  4UB6 C;  3OIO A;  4DYC A;  2EIM H;  1WI3 A;  4S04 A;  1Z3X A;  1YIJ I;  4KFC A;  2DA1 A;  4BQQ A;  3CJQ B;  2X85 A;  2CO5 A;  3I0T A;  5HNF A;  1D1C A;  3AL0 B;  3J81 Z;  4J19 A;  4ZC3 A;  2DFF A;  2YX7 A;  1SAN A;  2DOE A;  3WTU C;  3HOZ J;  3RKQ A;  4PGH A;  2DFH A;  4D9J A;  4A3F J;  1WJC A;  1VQK I;  2P7C B;  1ZEL A;  3GZN B;  3OS1 A;  2VC1 A;  4QLC U;  5K7F A;  2GXB A;  1QZZ A;  3BQZ A;  5CQE A;  3QPT A;  1QBJ A;  2LYC A;  3HOU J;  3KYD B;  1V3F A;  2MBF A;  2I8D A;  4HV6 A;  4I01 A;  2YX4 A;  2D5V A;  4ZDO A;  2DN0 A;  2QSF X;  3DTI A;  1JUS A;  4DW6 A;  4DYQ A;  2UUZ A;  5TRD A;  3I3L A;  2R7R A;  1J9I A;  3M8J A;  3K2Z A;  1MNM C;  3S93 A;  2NVY J;  4A3J J;  1OCC H;  3C3W A;  2FX0 A;  4WWC A;  4N0B A;  2RGV A;  3EDP A;  3LSR A;  1W0T A;  1H9G A;  1Z7U A;  2JUC A;  3H92 A;  3GF2 A;  3MVP A;  2WBM A;  1EH6 A;  1EH8 A;  2RRE A;  2MG4 A;  3Q0W A;  2A6E F;  2PEX A;  2R92 J;  4PSW A;  1APL C;  2NVQ J;  2O03 A;  3ZPL A;  4QPO A;  2FBI A;  4MFD A;  2Z2S B;  2PQ8 A;  2LY9 A;  4HYE A;  4BJ6 C;  3SJM A;  1D5Y A;  1F1Z A;  1Y0U A;  4M3D A;  1WH7 A;  2EV0 A;  1G6N A;  5F1R A;  4HLX A;  3GTO J;  4F93 B;  3OYL A;  1W36 D;  4IHW A;  1BI0 A;  2Q0O A;  4CCL A;  2BYV E;  4F7Z A;  3LSH A;  3CC4 I;  1VQ8 I;  4YEJ A;  4E70 A;  1S9H A;  3K2A A;  1XMA A;  3ZQG A;  2EIN H;  1D8J A;  1G4D A;  1IDY A;  4L5J A;  2Y9Z A;  4I2O A;  2VJI A;  2XAG A;  4RBO A;  4XLF A;  1NG6 A;  3S1M J;  4CZC A;  5K1Y A;  2KJB A;  4YG2 F;  4D7N A;  3FXM A;  2O9L A;  3L7W A;  3H1C A;  2Z16 A;  2OQR A;  4A69 C;  3DLL F;  4BQN A;  3FXQ A;  5F1J A;  1T38 A;  3BTJ A;  5IT9 K;  3QYF A;  2X6Y A;  1EA3 A;  1ETW A;  3FBI B;  2FBH A;  3F72 A;  5JR3 A;  3MN2 A;  5JVT A;  4DQ2 A;  5K7H A;  1K83 J;  3SEQ A;  4EJV A;  3CCM I;  1ETX A;  1XMK A;  4LIU A;  4MQV A;  2BOL A;  4MGR A;  3EUA A;  3V8K A;  1WHU A;  5IP9 J;  3RPU A;  4XSX F;  3KLN A;  1IUY A;  2XAH A;  1JE8 A;  3VWB A;  5LLQ A;  2VB6 A;  3OY9 A;  4HNV A;  5E20 A;  2VJJ A;  3O8H A;  1MH4 A;  4OWR B;  1MH3 A;  1FPQ A;  1BI3 A;  3DV8 A;  1G3T A;  1P92 A;  1WCM J;  3H0D A;  2BBY A;  3H9G A;  3IUO A;  3KZZ A;  4RAG A;  3J7Y J;  2VQG A;  2EIK H;  5DM7 F;  3KP6 A;  3PM1 A;  3U21 A;  1IO2 A;  1XC5 A;  3BTC A;  4XLH A;  1WH5 A;  2WB1 N;  1IN4 A;  4CCN A;  3J81 K;  4EJW A;  2B63 J;  2CGP A;  4BHB A;  2CQQ A;  3M8E A;  5J1U A;  2MFZ A;  2ICW G;  1Y0N A;  2HS5 A;  2ZSI B;  2XKO A;  2XB5 A;  3QOD A;  1S8N A;  2WV0 A;  4QSH A;  2EZK A;  1RIO H;  2Y69 H;  2K9Q A;  3K4K A;  3T1B A;  5D8L B;  4BS9 A;  4CYC B;  3GWZ A;  5F0F A;  1VQ7 I;  1XTA A;  4ENN A;  1RKW A;  1ZG5 A;  1I1S A;  2X9D A;  1YJ9 I;  3LFU A;  1DPR A;  3TQN A;  2XAU A;  4JP0 A;  2MW8 A;  3OYH A;  4BJ5 C;  4B43 A;  1BOA A;  2R7D A;  3WTW C;  3AL0 C;  3WU0 A;  3OOP A;  4I6Z A;  2X6X A;  4C2M J;  3KFW X;  1OCR H;  1TZL A;  4IQ4 A;  2LMD A;  4EM0 B;  1HW2 A;  1RR8 C;  1UST A;  4KIS A;  1MBH A;  1ON2 A;  1P6R A;  3P9I A;  5BPI A;  2O7O A;  1FMV A;  2X6W A;  2JA7 J;  2LH9 A;  4MFE A;  2XGE A;  3PO3 J;  2CUJ A;  2Y9Y A;  2V9V A;  4BDY A;  1LQ1 A;  1BJA A;  2R7F A;  1BC7 C;  1RC9 A;  2QGU A;  2IGK A;  4W1U A;  3Q5F A;  2KFD A;  3LA3 A;  3I56 I;  4E7J A;  2ZXW H;  1TW3 A;  2DPU A;  1ORK A;  1TT5 B;  4EMS A;  2DPD A;  2F48 A;  1XX5 A;  2KP6 A;  1MNE A;  2AXL A;  1X1D A;  3F8N A;  4LMY A;  1EF4 A;  1PVE A;  4BAC A;  3ZP5 A;  3JRG A;  1ZRC A;  3H35 A;  4XN0 A;  1A35 A;  2VT3 A;  4HQE A;  1YLF A;  4ZZD A;  5E3L A;  4Z6Y A;  3GEZ A;  3S3O A;  1QGP A;  3FIS A;  2FQ4 A;  2RC4 A;  3EPZ A;  3F3X A;  4XK4 A;  5TIS C;  3ZN1 A;  3FK6 A;  4N4O B;  1XCB A;  2QQB A;  1AU7 A;  1GLN A;  1NHA A;  2LTP A;  2P6T A;  2Y0S N;  3HOY J;  2DDA A;  1ETQ A;  1LFU P;  4Q4Z F;  1F4K A;  5FD6 A;  3O6B B;  2F2E A;  1P9Q C;  3Q0U A;  3PJR A;  3ZN0 A;  1LE8 B;  2QBY A;  1TQP A;  1ACI A;  2MD5 A;  1T08 B;  2LLK A;  1XSV A;  4Y33 A;  3R61 A;  5CVI A;  2H09 A;  1JXS A;  2GWR A;  4JYK A;  2K9L A;  4A3I J;  2COM A;  2JQ7 A;  3A2K A;  3R4K A;  4A0Z A;  5EGO A;  2ME0 A;  1VQN I;  5K7Z A;  2RV8 A;  3BJ6 A;  2R7V A;  1VTN C;  1FYM A;  2ZXJ A;  1IRG A;  3ZRG A;  2MLK A;  2KQR A;  2VQL A;  2QBY B;  1R22 A;  3E5U A;  3RDI A;  1GXQ A;  4G7Z F;  3I58 A;  2HOS A;  2TDX A;  4YEL A;  2A61 A;  2X4H A;  4UVC A;  3J7A O;  2O61 A;  3U9G A;  2E19 A;  1D3Y A;  3JRD A;  2FD5 A;  2DOF A;  3MQ0 A;  4II3 A;  3TP0 A;  3HB9 A;  3SDB A;  5J1Y A;  2PJR B;  3ASO H;  1AA7 A;  2HPI A;  1E3O C;  4N9H A;  3F8C A;  3ZGK A;  5EDN A;  4J01 A;  2VL8 A;  1TTY A;  5FLV A;  4E7S A;  3BLY A;  2VE9 A;  1KQ9 A;  4D1Q A;  3RPQ A;  2HYJ A;  2ZNZ A;  2V4J C;  3WG7 H;  2D45 A;  3E6B A;  1ON1 A;  3OYN A;  3BZK A;  2HZD A;  2H27 A;  3L2V A;  1N25 A;  4W97 A;  4A0X A;  1FYK A;  1AKH A;  4XMY A;  4D5F A;  3AG2 H;  5D8K B;  5HDN A;  2DQR A;  3OYD A;  3FXR A;  2ELJ A;  3IP4 B;  2MLG A;  1FOX A;  2XGD A;  3CUO A;  4AYB N;  4XR6 A;  2QUF A;  3BT9 A;  4HNT A;  1CQT A;  1R1V A;  2IEK A;  3ZMT A;  1YW9 A;  4HX4 A;  3DCF A;  3B6C A;  3K4B A;  4CH7 A;  3SFI A;  2BHY A;  1V55 H;  4OOI A;  3LSP A;  1Z77 A;  3BY6 A;  1S29 A;  1NTC A;  5HLH A;  5HLI A;  1VQ6 I;  1ZRF A;  3LSK A;  4DZJ A;  2VKH A;  1ZG3 A;  3BR2 A;  3K1P A;  3J7Z I;  1WWX A;  2F4M B;  1ZKG A;  3HRM A;  4XLA A;  5CJ9 A;  4HA8 A;  3HOW J;  1WJF A;  1ZTR A;  4RAF A;  1BI2 A;  2BY0 A;  4XOP A;  1X2M A;  1FTT A;  2IGM A;  2QKL B;  1JTX A;  4A3B J;  3F8M A;  4M73 A;  1IXS B;  1G3W A;  2L7Z A;  5FLM J;  3WE2 A;  3KP2 A;  2JK3 A;  3FIW A;  3A1Y A;  1Z0X A;  3OSG A;  1GT0 C;  4A6E A;  2WY8 Q;  4AIH A;  2HVR A;  1KQ8 A;  2HTJ A;  3OMY A;  1XSD A;  3C2H A;  3PIP F;  5F08 A;  1VQO I;  1O3R A;  1X3U A;  5FKL A;  2P5V A;  3K9T A;  3W6J B;  4ZZL A;  2OU2 A;  1MDM B;  4JX6 A;  4IX7 A;  2JJ7 A;  4BU2 A;  2B7E A;  2EA2 A;  3A02 A;  5DUI A;  4GFB A;  2XSD C;  4Y4R A;  1ZGJ A;  2E7X A;  2XV4 S;  5F04 A;  2LF8 A;  2ELH A;  1RKT A;  5FO5 A;  1QQI A;  2DA4 A;  2LSO A;  2KJC A;  3I64 A;  2DYS H;  1OCO H;  2DW4 A;  3OL3 A;  4I98 B;  2P6S A;  2DA6 A;  2RDP A;  2DA7 A;  3DBH B;  3ABU A;  1T8I A;  3WTT C;  2VKV A;  3MWM A;  1RNL A;  4WK8 F;  1YYV A;  4CCK A;  3PFY A;  3J80 Z;  1LKX A;  3FX3 A;  2W82 A;  3LSJ A;  1J09 A;  4KIF A;  2L7M P;  1K4S A;  5F27 A;  4L5I A;  1JKR C;  1J0R A;  2ECC A;  3TED A;  1B8I A;  4QWQ A;  3OV8 A;  2E71 A;  5BNG A;  1OCT C;  1B8I B;  2CFO A;  5CVR A;  3HBL A;  2VKE A;  1YRN A;  4RB0 A;  5E8I A;  5A2Q Z;  1Z7L A;  4CZZ A;  1ETO A;  1FBU A;  1MD0 A;  3ELK A;  2ID6 A;  3NWT A;  5LRS A;  1R5H A;  2RKH A;  1LEB A;  3KP5 A;  5DCM A;  3MFK A;  1A04 A;  2LRD A;  4AIJ A;  3CCY A;  5ICF A;  2JMW A;  1U8B A;  5LGT A;  1ITY A;  2YU9 J;  2O5R A;  3ZQF A;  3BR5 A;  4U7D A;  3Q9V A;  2EZL A;  1UZC A;  2L5Q A;  4XNF A;  2NNY A;  2FNA A;  5GTI C;  2QQ8 A;  3RI4 A;  2FXA A;  2EBI A;  3QU6 A;  1J5Y A;  3JRA A;  3GTK J;  1QZE A;  2VC0 A;  2KIF A;  4LG3 A;  2KRF A;  2IAI A;  4LLN A;  2FJ1 A;  1O3S A;  5IYC J;  3OYJ A;  1IN6 A;  2GA2 A;  2NXN B;  4YRV A;  1LVK A;  3IAM 2;  1V4R A;  4AWX B;  4E7H A;  1GVJ A;  2EIL H;  4H0E A;  2BZT A;  1X4O A;  4HSR A;  4NC8 A;  4B4C A;  5JLW A;  2HFH A;  1ETV A;  3H3Z A;  2GBY A;  2ETH A;  2L9R A;  5EZG A;  4AVP A;  2A07 F;  2BW3 B;  4LIV A;  1MZB A;  3CUQ A;  2F5C A;  4IF4 A;  4V2G A;  1YIT I;  3LWF A;  2MGQ A;  2IS6 A;  4ZYG A;  2EH3 A;  2M87 A;  2NOG A;  3E6M A;  3BQY A;  5HS9 A;  3OYG A;  2NVT J;  4XOR A;  2ZFU A;  2LK2 A;  4E4H A;  3GX4 X;  1KA8 A;  2E5N A;  4MO7 A;  3KIO A;  1R58 A;  2EPF A;  1TWH J;  2CV1 A;  1YI2 I;  1IW7 F;  2DAO A;  3DEW A;  3K70 D;  1N78 A;  3I5U A;  3GFM A;  1K7A A;  3J80 K;  1HCR A;  3FF5 A;  4XM3 A;  4BY7 J;  2DTR A;  2RAE A;  2R7W A;  1SD4 A;  2VUM J;  3GFJ A;  2CQ7 A;  2XAF A;  3BWG A;  3H5A A;  1K78 A;  1HF0 A;  2ZJ2 A;  3BOQ A;  2IS4 A;  2KDO A;  5LEJ A;  2CSO A;  3UR3 C;  2XC7 A;  5KHD A;  1MSE C;  3H5R A;  2P0W A;  4KA4 A;  1FJL A;  2W85 A;  3ONQ A;  4A3M J;  2VPL A;  1IF1 A;  4ZH4 F;  3WGH A;  2V9K A;  3F23 A;  4M3F A;  2XF7 A;  3D0S A;  2GIZ A;  3HDD A;  1MMN A;  2XF5 A;  2FSW A;  4RLQ A;  3HKZ A;  1F5T A;  1FZP B;  4WX9 A;  5ERI A;  1P4X A;  3HRS A;  2V1U A;  3HRT A;  4HLY A;  2Y48 A;  1R36 A;  1ZR4 A;  1TL8 A;  3I55 I;  1MKM A;  2WB1 A;  1B9M A;  4ETS A;  4WXH A;  3HUG B;  5LFA A;  1H0M A;  1LEA A;  2M8E A;  3L2W A;  1PDN C;  3BG5 A;  4G6D A;  1QZY A;  4EM2 A;  2Z9O A;  5CLS A;  3WE3 A;  4A5M A;  1R23 A;  2K9N A;  3BG9 A;  4ENJ A;  2Z5U A;  3G4S I;  2KZG A;  1KON A;  5FKN A;  2CQN A;  3VYS B;  3NRV A;  4K2E A;  1FLI A;  1ZRE A;  5HS8 A;  1OFC X;  3Q9S A;  2D1V A;  2HVQ A;  1S72 I;  2W1O A;  4L18 B;  3OYF A;  1EKE A;  2FA5 A;  4XKV A;  1X4P A;  3W2V A;  1MMA A;  2PLY A;  2V7F A;  4UV8 A;  1TW2 A;  1BM9 A;  2Q2E B;  2XF6 A;  3SEZ A;  3W6V A;  3WG9 A;  1J75 A;  4UUV A;  1ZAR A;  4P1W A;  2E60 A;  3QOE A;  3NQO A;  3ZQC A;  4EAT A;  1WQ2 A;  2PG4 A;  4U87 A;  1XMX A;  2M7B A;  5F64 A;  4NB5 A;  2BV6 A;  2IPQ X;  2W84 A;  3TMO A;  1KU2 A;  5K5O A;  2ZJR F;  4A3K J;  2H6C A;  2VAS A;  5HVQ C;  3HSF A;  2EJR A;  4DBR A;  3LSM A;  4NNJ A;  4GXO A;  2DJN A;  5IOY A;  1Q1V A;  2KT0 A;  2F4I A;  5D6E A;  3ZCO A;  1DU0 A;  4OMY A;  1DPU A;  5HDK A;  4IRG A;  5LHH A;  2PN6 A;  1X58 A;  1Z6R A;  5M3M J;  2LY2 A;  1ZAO A;  1I1G A;  3GVA A;  1AOY A;  4KIT B;  2EFQ A;  3GTQ J;  1SAU A;  1W4M A;  3DFG A;  4XN3 A;  3E6C C;  3LQR A;  3AFH A;  3B02 A;  1KU7 A;  3E5X A;  1IAW A;  2EV6 A;  3PSI A;  3IL2 A;  1M1E B;  2K40 A;  3I59 B;  1K78 B;  1R5I D;  4A0Y A;  2MSY A;  2OJE D;  1XGM A;  4HX7 A;  5EG0 A;  4XID A;  1GXP A;  5GAH J;  2ME6 A;  2F4O B;  2LFB A;  5GPA A;  5L3B A;  3QPL A;  4FE7 A;  1RUO A;  3S2D J;  3M9A A;  3CCV I;  3QQA A;  1HKT A;  2E2J J;  3KE2 A;  4RS8 A;  3ECH A;  5IY5 H;  4BH9 A;  3E97 A;  1BOB A;  3TOA A;  1HW5 A;  3JSO A;  3JRF A;  2CUF A;  3QP6 A;  1EJ9 A;  2R4G A;  2Q8K A;  1I6H J;  2JSP A;  1YIO A;  1ZYR F;  4Y3O A;  5L3D A;  1I39 A;  1K6Y A;  1V5F A;  4M3B A;  4B09 A;  3TP3 A;  3KYL A;  3GBG A;  1SMY F;  3WTX C;  2KIS A;  3BG7 A;  3WU1 B;  3LMM A;  4G8X A;  3N97 A;  1D0Z A;  3I4P A;  3ABL H;  2Y75 A;  5BS6 A;  4KUM A;  2K4J A;  3KET A;  3GTP J;  2Q1Z B;  5BMZ A;  5DM6 F;  2M8G X;  1O3T A;  3T0Y A;  4IRI A;  2DA5 A;  2COB A;  2IGN A;  9ANT A;  2A5Y B;  2YSR A;  1UG0 A;  2WAQ A;  1D0Y A;  3PNV A;  4C30 A;  4MLO A;  4AUX A;  4DZP A;  2UWM A;  4MNU A;  1VFC A;  3V7R A;  5BPD A;  3CCS I;  3OIQ A;  3L09 A;  4BBR J;  1DGR M;  3TO7 A;  4Y52 J;  4PDK A;  1H88 C;  2A5W A;  4ZJZ A;  2N8G A;  4G12 A;  2X6O A;  1SFU A;  1RZ4 A;  4Y13 A;  1T6S A;  2IRF G;  2JT1 A;  3GCM A;  4RMN A;  3TW6 A;  1JGS A;  2VJ4 A;  1I5Z A;  1U2W A;  2DYR H;  5AIQ A;  4L0Y B;  2K86 A;  1DU6 A;  1ZHF A;  1XN7 A;  4HOB A;  2WAE A;  1MIJ A;  3KP3 A;  2ZXI A;  4FCY A;  1GUU A;  3FDY A;  1O3Q A;  4B48 A;  3GFL A;  4P55 A;  1G2H A;  4FAS D;  3D5R C;  5CVU A;  4C2T A;  2MA3 A;  1Y39 A;  4IHS A;  4XL9 A;  3ESW B;  1OQY A;  3A01 A;  1R4M B;  2R7T A;  4GO1 A;  1QU3 A;  4EVI A;  1E3H A;  4QIW N;  3E3V A;  5C3E J;  4KIG A;  1LB2 A;  4PJ0 C;  3CF5 F;  1YQA A;  3G3Z A;  2PMU A;  3DXJ F;  3M4O J;  2ZXH A;  4G94 A;  2CQK A;  1FY7 A;  2J5P A;  4BDZ A;  1D0X A;  1PUE E;  3HG9 A;  5DUK A;  5FLX K;  4AC0 A;  1T95 A;  3RIR A;  1YW8 A;  2Y0M A;  4BE0 A;  4QPQ A;  4OIQ F;  2VI6 A;  2VQH A;  1FT9 A;  1I3Q J;  3HYI A;  1UHM A;  2DLL A;  5E79 C;  4M74 A;  4CSW A;  3IH4 A;  1DP7 P;  2ZKZ A;  4YFK F;  3L2R A;  2BHZ A;  3I53 A;  1G3S A;  5H20 A;  2Y31 A;  2KRH A;  3BR6 A;  1T98 A;  4HZF A;  4X1E A;  4A3E J;  1ETY A;  3KEO A;  4G7H F;  3RQ4 A;  4UY8 I;  3BPX A;  3Q3S A;  3CQZ J;  5GAE J;  2HVS A;  3TDU C;  3JRI A;  2LD5 A;  2WAQ N;  2EZI A;  1H9T A;  1RPW A;  2QQA A;  4P5O A;  3G1L A;  4C9Y A;  2ZSH B;  3BC8 A;  3H3U A;  3KYC B;  4DIQ A;  1X3Z B;  4CCO A;  5FRN A;  5D4S A;  1TT0 A;  2KMU A;  2PFB A;  2CMP A;  2HOT A;  1YFH A;  3ROU A;  4AVZ A;  3SFZ A;  4GRI A;  3MKW B;  1RI7 A;  1TLH B;  2OZU A;  3CCU I;  2RQQ A;  2YU3 A;  4KIB A;  3QAH A;  4JK1 X;  4I7H A;  3ZR8 X;  2ZJP F;  3OL4 A;  3QP5 A;  4MEY F;  4LK0 F;  3LST A;  4DYR A;  2AQE A;  1LVA A;  1D5V A;  1PYV A;  3L1P A;  2XGC A;  4CDG A;  3S3M A;  5FKK A;  3HOX J;  1LDK B;  1FP1 D;  3N05 A;  1LUJ B;  3QOP A;  2LOO A;  3C2G A;  4L5E A;  1YX5 A;  2XPU A;  3OYB A;  5B5E C;  3CCJ I;  3I54 A;  2VN2 A;  2R5Y B;  4PJL A;  5HOO A;  1A36 A;  2V1X A;  3DP7 A;  2VT2 A;  1HKQ A;  3VSL A;  3MD2 A;  4U0Y A;  1IG7 A;  1EH7 A;  3ZOB A;  1VQP I;  1UEL B;  5CYV A;  4EV0 A;  2HKX A;  2EFP A;  3CCR I;  3IKT A;  4BBS J;  5DTD A;  2ISZ A;  3GME A;  2ID3 A;  4AU7 A;  4U0W A;  5J6X A;  1IDZ A;  3DKW A;  4LG0 A;  1S6L A;  2H1K A;  3CD6 I;  1BJZ A;  4F92 B;  3VPR A;  2PJR A;  3FMQ A;  1IN5 A;  4YIF A;  3LSG A;  1OKR A;  4IL6 C;  3SZP A;  2FRH A;  1VQ9 I;  2LNB A;  5GPC A;  1KZH A;  4M3G A;  2K7L A;  3CP2 A;  2PJP A;  1ETK A;  2QWW A;  5CQG A;  5J3L A;  2EV5 A;  5AIP A;  2LC2 A;  3GUD A;  1G8X A;  2HTS A;  2HYG D;  2K3P A;  3ECO A;  5EGO B;  1LFB A;  2Z1D A;  3QPS A;  1I6X A;  2UXX A;  4RM2 A;  1MBK A;  2I5U A;  2MYS A;  2JZY A;  4PFP A;  3HKZ N;  3ABK H;  3BZ6 A;  3VDX A;  2X1C A;  1HDP A;  4BHP A;  4WF2 A;  5J40 A;  3S2H J;  2LR8 A;  5CVV A;  5E1X A;  4P96 A;  2HU9 A;  2IXS A;  4BAY A;  3GLL A;  3K1M A;  2E34 A;  1T56 A;  4Q48 A;  3CMA I;  5IT3 A;  1X1A A;  4CO8 A;  4X0G A;  3HXL A;  1MMS A;  4M3E A;  1XDU A;  4KN7 X;  3F8F A;  1HST A;  1BL0 A;  4E7I A;  1LPQ A;  1HA8 A;  2QVO A;  3V7C A;  1VZ0 A;  4XON A;  1UMQ A;  1VF9 A;  2Y0S A;  3RYP A;  3GZ6 A;  1YRN B;  2R7U A;  3BCA A;  2GXG A;  2KIQ A;  1B72 A;  4XLC A;  5FLX Z;  3T8R A;  2Y30 A;  4E6K G;  1B72 B;  1B1B A;  3QPH A;  5E8G A;  2BXZ A;  2DT7 B;  2IP2 A;  2VXD A;  3T5X A;  2TRT A;  4NC6 A;  4RGR A;  1USS A;  1R5G A;  3RPU D;  2VLA A;  3S16 J;  1JJ6 C;  1MGT A;  3CUQ C;  4HRI A;  2NYX A;  5IYB J;  4XOT A;  2G7H A;  4IJA A;  4CCM A;  2HNH A;  2X1E A;  1W5T A;  3HTS B;  5B3S H;  2VBY A;  2F5E A;  4EJU A;  1W5C C;  4B3A A;  1D8K A;  3BG3 A;  1O7F A;  3PNT A;  1IUF A;  2R5Y A;  5J47 A;  3FXL A;  3PUF A;  1FX7 A;  2OA4 A;  2QQ9 A;  1Z9C A;  3FHN A;  4LLG F;  3CDH A;  2GAU A;  5DDG A;  1I27 A;  2HWV A;  3K10 A;  3BR0 A;  2EA4 A;  3F0C A;  4N9I A;  4NQW A;  4PFO A;  1S7E A;  4UB8 C;  2CW8 A;  5D5W B;  4F55 A;  1A6Q A;  5LEK A;  1BR1 A;  2J5O A;  2M4K A;  3C18 A;  5C4J J;  4XSZ F;  3PNY A;  4NBQ A;  1DUX C;  5HLT A;  4LG0 B;  2XPV A;  1P4A A;  3GTJ J;  2ZC2 A;  4WCG A;  2WY7 Q;  2RN7 A;  5K5R A;  3C7J A;  2KKO A;  3ERM A;  4M71 A;  1TQM A;  5C4X J;  4CCJ A;  4ESF A;  4IZZ A;  3HJE A;  3DU5 A;  2WV1 A;  3PUB A;  2OPT A;  4JX5 A;  4FHT A;  2FEZ A;  3KEY A;  4AIK A;  2M0C A;  3VOD A;  4FIS A;  3DLA A;  3JRH A;  2B9S A;  5CKT A;  2STT A;  2BY2 A;  2XIG A;  1SD7 A;  2E7W A;  3M1E A;  4BE1 A;  4RB3 C;  4LK1 F;  3ZMV A;  2HDD A;  1T0F A;  3OR1 C;  5FJ8 J;  1AKH B;  2GQQ A;  3K70 C;  3W2W A;  1UCR A;  1U8R A;  1SVL A;  3K0L A;  3RKX A;  1MDM A;  2DO7 A;  4KJZ A;  4ENK A;  1PUF A;  1UHS A;  3NWS A;  4F52 A;  3OYA A;  4ZDP A;  3DPT A;  2DOD A;  4R8H A;  3ZQ7 A;  2M45 A;  5H6Q A;  4DGW B;  3D5L A;  2BVL A;  3BJO A;  4UVB A;  5M5W J;  4L9N A;  3ZMD A;  2DI3 A;  3L2C A;  2OV7 A;  1VI0 A;  3I4M J;  1Y6I A;  3OYE A;  2DT5 A;  4XQF A;  1IXR C;  3P7N A;  1V5G A;  2DDB A;  3Q0V A;  1HKS A;  5EZH A;  1TP4 A;  2VOO A;  2L01 A;  2IT0 A;  2VIX A;  3MKL A;  3ML6 A;  1RET A;  2UXN A;  1LJ9 A;  2V26 A;  2P8T A;  2P5L C;  3LAJ A;  4MHG A;  1IN8 A;  5DEQ A;  4HF1 A;  1I3A A;  5E1Z B;  2GIV A;  3CLO A;  2PI0 A;  1D1A A;  1BIA A;  4B8X A;  4BUP A;  1ZQ3 P;  5F0C A;  3FHZ A;  2FBK A;  4G6Q A;  1B6A A;  3EUK L;  1VQ4 I;  4MIM A;  5BOX A;  4H4K C;  2V1N A;  3LL7 A;  4UVA A;  2CUE A;  4PK4 A;  2QYO A;  1W7P B;  3P9C A;  3R0J A; 
#chains in the Genus database with same CATH homology
 3HOV J;  3ZQC A;  3S14 J;  3HGG A;  2ECB A;  1ETW A;  1HLV A;  1GVD A;  3MN2 A;  1BA5 A;  5K7H A;  1K83 J;  4XRS G;  4A3K J;  1ETX A;  2ELK A;  1WGX A;  1JKO C;  4CYC A;  1GDT A;  5IP9 J;  2DJN A;  5IOY A;  1Q1V A;  2KT0 A;  1DU0 A;  3PO2 J;  1X58 A;  4UUS B;  5M3M J;  2E1O A;  4HNV A;  2Y2Z A;  3BR3 A;  1GV5 A;  1TWF J;  3O8H A;  1MH4 A;  1MH3 A;  3FK7 A;  1JKP C;  3GTQ J;  1TWC J;  1WCM J;  5EYR A;  3JRE A;  3C2B A;  3RZO J;  1MBG A;  3PM1 A;  1XC5 A;  3BTC A;  2K40 A;  3K7A J;  1WH5 A;  2WB1 N;  1FIP A;  2MSY A;  2B63 J;  2CQQ A;  5J1U A;  4D7M A;  5EG0 A;  4XID A;  3FKI J;  2NVX J;  2ME6 A;  2LFB A;  5GPA A;  2XB5 A;  3LOC A;  4QSH A;  2EZK A;  3QPL A;  4FE7 A;  3NAR A;  3S2D J;  3QQA A;  2IBD A;  2E2J J;  2K9Q A;  2M34 A;  2G0E A;  4CYC B;  5F0F A;  1PUF B;  3HEF A;  3RZD J;  1LE8 A;  1RKW A;  2X9D A;  5E3N A;  2JWT A;  4JP0 A;  2MW8 A;  3JRF A;  2CUF A;  4Y7N J;  1I6H J;  5IP6 A;  4M3B A;  2DTZ A;  3TP3 A;  5EEA A;  4I6Z A;  3GBG A;  4C2M J;  4IHX A;  1JT6 A;  2YS9 A;  4JX4 A;  1SFO J;  1IV6 A;  2L0K A;  3ZQI A;  1MBH A;  4A3C J;  1QVU A;  1TC3 C;  2O7O A;  3GTP J;  2JA7 J;  4MFE A;  2M8G X;  2XGE A;  3S1Q J;  1QPI A;  3PO3 J;  3M3Y J;  1IC8 A;  2DA5 A;  2COB A;  3H0G J;  2R7Z J;  1VND A;  9ANT A;  2Y9Y A;  2TCT A;  4B1R A;  4AUX A;  4MLO A;  1H89 C;  4DZP A;  1VFC A;  2DA2 A;  4W1U A;  2PMZ N;  4BBR J;  4Y52 J;  2AO9 A;  2M2E A;  1H88 C;  1U9O A;  1OJL A;  4BKX A;  2N8G A;  1ORK A;  2EZH A;  4G12 A;  1A5J A;  2X6O A;  1F36 A;  2JA8 J;  1U9N A;  1T33 A;  3CDL A;  3TW6 A;  1EF4 A;  3HM5 A;  2AHQ A;  4ABZ A;  3JRG A;  4FTH A;  1DU6 A;  2R0Q C;  5M3F J;  5FKM A;  3TW7 A;  1GUU A;  2NS8 A;  4FCY A;  5E3L A;  3FIS A;  2FQ4 A;  2NS7 A;  1G2H A;  4XK4 A;  2LVS A;  3CMY A;  1AHD P;  3GTL J;  3FK6 A;  3A01 A;  4D5C A;  1X2N A;  1AU7 A;  1R9T J;  2Y0S N;  2LTP A;  3HOY J;  3IH2 A;  1ETQ A;  1LFU P;  2XRL A;  4UUT A;  2DMQ A;  2HI3 A;  1XG1 A;  3Q0U A;  4QIW N;  5C3E J;  4RDU A;  2XPW A;  5M5X J;  1LE8 B;  2X48 A;  2LLK A;  2HXI A;  5FKO A;  3M4O J;  2CU7 A;  5IP7 J;  1MBJ A;  4JYK A;  4UUS A;  4A3I J;  5EGO A;  2ME0 A;  1IJW C;  5K7Z A;  3ZQL A;  4AC0 A;  3A03 A;  5E3M A;  2HOA A;  3NAU A;  2VI6 A;  1GV2 A;  1I3Q J;  4M6V A;  3G1O A;  3IH4 A;  2H8R A;  2HOS A;  1HDD C;  1FTZ A;  1K61 A;  2Y31 A;  3BR6 A;  4XRS A;  2E19 A;  3JRD A;  2FD5 A;  4X1E A;  4A3E J;  1ETY A;  3TP0 A;  1FIA A;  3HB9 A;  1ZGW A;  5J1Y A;  3Q3S A;  3CQZ J;  3SDG A;  2JA5 J;  1E3O C;  3JRI A;  2LD5 A;  1JUP A;  2EZI A;  2WAQ N;  1A6I A;  1RPW A;  5EDN A;  3G1L A;  3OSF A;  5FLV A;  3RQI A;  5IOZ A;  2HYJ A;  2HOT A;  2GLO A;  4BXX J;  1FEX A;  1NK3 P;  1ZR2 A;  1JUM A;  2ZB9 A;  3BTI A;  3G1M A;  4W97 A;  1AKH A;  4D5F A;  1JJ8 C;  2L7F P;  1ENH A;  3GTG J;  4S0H B;  4V2F A;  2JN6 A;  4DYR A;  2XGD A;  5HOD A;  4AYB N;  2W48 A;  3BT9 A;  1CQT A;  4NDL A;  3L1P A;  2XGC A;  2IEK A;  5FKK A;  3HOX J;  3DCF A;  3B6C A;  3JRB A;  3GTM J;  3SFI A;  4L5E A;  2XPU A;  1ZK8 A;  1H8A C;  3LSP A;  1Z77 A;  2DMT A;  2KDZ A;  1NTC A;  2R5Y B;  2O8K A;  1Y1V J;  1QVT A;  2DMU A;  4DZJ A;  3BR2 A;  1IG7 A;  3ZOB A;  1ZKG A;  2DMP A;  4A3L J;  3HOW J;  5E3O A;  3BR1 A;  2EQR A;  1ZTR A;  4BBS J;  2E2H J;  4IEJ A;  1MBE A;  4LOC A;  5DTD A;  1IDZ A;  2ID3 A;  1X2M A;  3IH3 A;  5IYD J;  1JGG A;  3I4N J;  1FTT A;  2P81 A;  2H1K A;  3OOU A;  1JTX A;  4A3B J;  1RR7 A;  1BJZ A;  1I50 J;  2L7Z A;  3VPR A;  5FLM J;  4C3H J;  2JK3 A;  3FIW A;  1Z0X A;  3OSG A;  5JLX A;  1GT0 C;  3LSG A;  1BW6 A;  5DS9 A;  2QF7 A;  1W0U A;  5F08 A;  5GPC A;  4M3G A;  1JTY A;  5FKL A;  4A93 J;  1ETK A;  4JX6 A;  5J3L A;  2JJ7 A;  5IPA A;  3A02 A;  5J1R A;  4GFB A;  2XSD C;  3E7L A;  5EGO B;  5F04 A;  4X6A J;  1LFB A;  3WHB A;  5EG0 B;  3QPS A;  2HXO A;  4FE4 A;  1MBK A;  1RKT A;  1U78 A;  2DA4 A;  3HKZ N;  3ZQH A;  1HDP A;  1POG A;  3S2H J;  5EF6 A;  2LR8 A;  2DA6 A;  2DA7 A;  2VKV A;  2QCO A;  1T56 A;  1NK2 P;  1RES A;  3LSJ A;  2L7M P;  3BTL A;  4M3E A;  5F27 A;  3D1N I;  1BL0 A;  1JKR C;  3S1N J;  2ECC A;  3O8G A;  3TED A;  1B8I A;  1UMQ A;  1VF9 A;  2K9S A;  5BNG A;  1OCT C;  2I10 A;  1B8I B;  1YRN B;  3HBL A;  2VKE A;  1B72 A;  1YRN A;  1MBF A;  4XIC A;  2Y30 A;  3H3V K;  4C3J J;  1B72 B;  1ETO A;  2VPR A;  2ID6 A;  2TRT A;  4I76 A;  3CCY A;  2JMW A;  1U8B A;  1ITY A;  2YU9 J;  3ZQF A;  1F43 A;  2DA3 A;  3BR5 A;  1JKQ C;  3S16 J;  1JJ6 C;  1WPK A;  4EEF G;  2LP0 A;  2EZL A;  2M9H A;  5IYB J;  3S1R J;  2JA6 J;  4IHY A;  3WHC A;  1XS9 A;  2XB0 X;  2EBI A;  4C3I J;  1BW5 A;  3JRA A;  3GTK J;  4B3A A;  3BG3 A;  3S17 J;  4QTR A;  1P7I A;  5C44 J;  2IAI A;  1IUF A;  2R5Y A;  2FJ1 A;  1O4X A;  5IYC J;  3OIO A;  4DYC A;  2CJJ A;  1WI3 A;  3BR0 A;  3F0C A;  2DA1 A;  1S7E A;  3JRC A;  4B4C A;  5JLW A;  1ETV A;  2CQX A;  2GBY A;  2L9R A;  5EZG A;  3B6A A;  1TWG J;  4V2G A;  4J19 A;  1SAN A;  5C4J J;  2MGQ A;  2EH3 A;  3HOZ J;  2NOG A;  3RKQ A;  3BQY A;  2NVT J;  2XPV A;  3GTJ J;  1QRY A;  4A3F J;  2LK2 A;  2OF7 A;  2YUS A;  4MO7 A;  2E2I J;  1TWH J;  5K7F A;  3BQZ A;  3IV5 A;  5C4X J;  3DEW A;  3HOU J;  1HCR A;  1HOM A;  2WV1 A;  2OPT A;  4JX5 A;  3HGY A;  2RAE A;  4BY7 J;  2VUM J;  5GP9 A;  2M0C A;  4XRM A;  2D5V A;  1HF0 A;  1IGN A;  4FIS A;  2DN0 A;  3JRH A;  3A01 B;  1JUS A;  1MSE C;  1TWA J;  4DW6 A;  4DYQ A;  2CRG A;  4BY1 J;  1FJL A;  1MNM C;  2HDD A;  1AKH B;  5FJ8 J;  2R5Z B;  2NVY J;  2LKX A;  3S15 J;  4A3J J;  4A3M J;  1OCP A;  2FX0 A;  4M3F A;  3LSR A;  2HQ5 A;  3HDD A;  1W0T A;  1PUF A;  1UHS A;  3MVP A;  3UKG A;  4A3G J;  2MG4 A;  3Q0W A;  2R92 J;  1APL C;  2GM4 A;  5M5W J;  2NVQ J;  2R5Z A;  3I4M J;  1VI0 A;  5F0H A;  4MFD A;  1ZR4 A;  2LY9 A;  2DMN A;  3JR9 A;  3SJM A;  3Q0V A;  3BG5 A;  1D5Y A;  4M3D A;  1Y1W J;  1WH7 A;  5EZH A;  1UG2 A;  3GTO J;  4IHW A;  3MKL A;  4A3D J;  1RET A;  4IHV A;  1MSF C;  3K2A A;  2K9N A;  3BG9 A;  3ZQG A;  1IRZ A;  5FKN A;  1IDY A;  2Y9Z A;  2R93 J;  1OFC X;  1JT0 A;  4RBO A;  1ZQ3 P;  5F0C A;  3S1M J;  3LNQ A;  4D7N A;  2O9L A;  4MIM A;  3W6V A;  4A69 C;  2CUE A;  1P7J A;  5F1J A;  5M5Y J;  3BTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...