2DMUA

Solution structure of the homeobox domain of homeobox protein goosecoid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GSSGSSGRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein goosecoid
publication title Solution structure of the homeobox domain of Homeobox protein goosecoid
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dmuA01
1MBKA 1HDPA 2ECBA 4M6VA 3RQIA 3K7AJ 4M3DA 4C3IJ 1U8BA 2IBDA 3JRDA 1PUFA 2M34A 3C2BA 1BW5A 1H89C 2I10A 3I4NJ 4IHYA 2Y31A 4MIMA 2O9LA 3BG5A 1TWGJ 1U9OA 2DMNA 3O8HA 1Y1VJ 1MBEA 1ENHA 4DYRA 5E3LA 3BQZA 2JA8J 1IGNA 5J1YA 1UMQA 2N8GA 1X58A 2XGDA 1OFCX 2DA2A 1A5JA 2CUEA 1O4XA 3ZQHA 4DYQA 2LY9A 5EZHA 1IRZA 1MBGA 2QCOA 3BR1A 1S7EA 4FISA 3WHCA 1P7IA 1ZK8A 5C3EJ 2DMQA 1GV2A 2XPVA 1I3QJ 2OPTA 3QPSA 2HXOA 3ZQCA 4DYCA 1JKOC 2E2IJ 9ANTA 2MW8A 1EF4A 5M5WJ 4A3FJ 1DU6A 5FKMA 5IOYA 1W0UA 3H0GJ 1U78A 4AYBN 5C44J 1K61A 1ORKA 1JUMA 2JN6A 2MSYA 2FD5A 5K7ZA 4CYCA 4A3MJ 4L5EA 1ZR2A 4FTHA 1HLVA 2O8KA 1ETKA 2DA5A 3LSPA 1AKHB 3S2HJ 4BKXA 2KT0A 1T33A 2X48A 2ECCA 3PO3J 2JK3A 3GTKJ 4A3GJ 4BY1J 1VF9A 3GTPJ 4IHXA 1RESA 2WAQN 5IP7J 4B1RA 1FEXA 4DZJA 1E3OC 3ZOBA 2HDDA 1A6IA 3BR6A 2MGQA 1Y1WJ 1WH5A 3MN2A 2CU7A 1GVDA 4QSHA 1ETOA 1AU7A 2GBYA 3BR0A 2DA7A 2E2HJ 3M3YJ 2IAIA 1ETWA 2PMZN 4M3GA 4V2FA 5FLMJ 1GT0C 3JRIA 3JRGA 1JTYA 2R5YA 3BR2A 5FKOA 2AO9A 1B72A 4IEJA 2R0QC 3CMYA 1K83J 1ITYA 1G2HA 4XRMA 2VUMJ 3LNQA 1Q1VA 1WPKA 2FJ1A 2L7MP 1D5YA 1MSEC 3ZQIA 1ZR4A 3LSGA 2KDZA 4JX6A 1T56A 1QVUA 2XB5A 1MH3A 1APLC 1OCPA 3A02A 2LTPA 4B3AA 2E2JJ 2HOSA 5J3LA 5F0HA 5DS9A 2EZKA 2H8RA 4W97A 5EG0B 1XC5A 5M5XJ 2MG4A 4M3FA 1BW6A 5EZGA 3LSRA 2XRLA 2B63J 5F27A 4AC0A 4A3CJ 3HDDA 4DZPA 2M0CA 1JT0A 1I50J 3SDGA 1R9TJ 1HDDC 5J1RA 2K9NA 5EGOB 1ETXA 2TRTA 5FKKA 2TCTA 1MBHA 3LOCA 1MBFA 2DMTA 1SANA 1HOMA 1B8IB 4GFBA 3A01B 2LP0A 3Q0WA 2GM4A 3LSJA 4BBSJ 3HOYJ 1ETYA 3BTCA 5K7FA 2LR8A 5EF6A 3NARA 1H8AC 1F43A 2XPWA 2EBIA 3S1QJ 4MFEA 2NS7A 2L7ZA 4FCYA 3PO2J 1JKRC 2CQQA 3MKLA 3F0CA 3HKZN 4ABZA 2Y2ZA 1HF0A 2NVXJ 5F1JA 1WI3A 3SJMA 2R5ZB 2NOGA 2ID6A 4NDLA 2M8GX 4D7NA 2DA1A 1JTXA 4V2GA 1LE8A 1FIAA 1OJLA 3A03A 4I76A 1XS9A 2OF7A 4C2MJ 2DMPA 2NVQJ 3HBLA 2Y30A 3O8GA 4S0HB 1TWFJ 1FTTA 4A3JJ 2XGEA 2HI3A 2HOAA 3TW6A 2HOTA 2LFBA 4C3HJ 5IOZA 3S15J 2CUFA 2W48A 1X2MA 2R92J 1IJWC 2VKEA 2JA5J 1LFBA 5EDNA 1BA5A 2X6OA 1JUPA 3RKQA 2EZLA 3IH2A 4Y52J 3TEDA 4CYCB 2ZB9A 2M9HA 1RKWA 5HODA 1P7JA 1LFUP 2NVYJ 3FIWA 4HNVA 1IUFA 3CQZJ 3CCYA 1IV6A 1RPWA 1TWHJ 2K9QA 3HOWJ 2L0KA 1ZKGA 3Q0VA 2D5VA 3W6VA 1MBJA 2YU9J 1AHDP 1Z77A 2CRGA 4A93J 4DW6A 2P81A 5F0FA 5C4XJ 4C3JJ 2ME6A 1MNMC 1NTCA 1ETQA 5J1UA 1JJ8C 1WGXA 3JREA 1JKPC 4LOCA 2R93J 2E1OA 1RKTA 3HOZJ 4A3EJ 2R5YB 2X9DA 5DTDA 4M3BA 1B72B 3B6CA 2K40A 1GUUA 5F04A 5E3NA 2O7OA 3BR3A 1JJ6C 4JP0A 3G1MA 3BTIA 4D7MA 3BG9A 3FK7A 5C4JJ 1UHSA 4XRSG 3HB9A 3GTLJ 3QQAA 2HQ5A 3G1LA 5E3MA 3IV5A 4IHVA 3S17J 4UUSA 4W1UA 3JRHA 4J19A 2WB1N 3HM5A 1YRNA 5EG0A 2XSDC 1JKQC 3K2AA 3OSGA 1CQTA 3RZOJ 3S14J 5K7HA 5IPAA 5EYRA 5GPCA 3SFIA 3JRCA 2VI6A 3IH3A 3RZDJ 4M3EA 3GBGA 4FE7A 1HCRA 3IH4A 3GTGJ 2CQXA 2IEKA 3Q0UA 2ID3A 5FKNA 4RDUA 4XIDA 1NK2P 1TWAJ 3HOXJ 2VKVA 3S2DJ 1QVTA 2JMWA 3G1OA 2EZHA 4JX4A 4XRSA 1I6HJ 1PUFB 1ZQ3P 2H1KA 2DMUA 5F08A 1POGA 2GLOA 3GTJJ 1OCTC 1JGGA 2L7FP 3TP3A 5GP9A 3OSFA 3Q3SA 2LD5A 4BY7J 2ME0A 3CDLA 2R5ZA 3M4OJ 5M3MJ 2VPRA 1GV5A 3FKIJ 4G12A 4RBOA 4Y7NJ 4BXXJ 3ZQGA 3TW7A 3S1NJ 5IYBJ 2K9SA 3WHBA 1TWCJ 3S16J 5M5YJ 1H88C 1QRYA 3MVPA 2DTZA 2Y9ZA 3H3VK 1XG1A 3PM1A 3E7LA 3OIOA 1FIPA 3DCFA 1GDTA 5GPAA 2WV1A 1ETVA 1LE8B 3JRBA 2AHQA 2DA4A 4I6ZA 2JA6J 2Y9YA 2LKXA 2R7ZJ 4MLOA 4A69C 3OOUA 4D5FA 3DEWA 4MO7A 1AKHA 2COBA 2Y0SN 5FLVA 5F0CA 3HOVJ 3BTLA 1VNDA 3HOUJ 2DA6A 2XPUA 3VPRA 3BTJA 2LK2A 5BNGA 2JJ7A 2NS8A 1W0TA 2CJJA 2XB0X 2YUSA 3D1NI 1Z0XA 2DJNA 2QF7A 3HEFA 3QPLA 2LVSA 2HXIA 3FISA 4AUXA 2ELKA 3L1PA 2HYJA 4BBRJ 3UKGA 3ZQLA 2DA3A 4X1EA 5IYDJ 4QTRA 4D5CA 3S1RJ 2LLKA 3FK6A 1IDYA 5JLXA 1U9NA 4X6AJ 2RAEA 2EQRA 3JRFA 1IC8A 1WH7A 3HGYA 1FJLA 4A3DJ 2FX0A 3BR5A 1VI0A 2JA7J 3JR9A 4XICA 1X2NA 4A3KJ 3HGGA 1NK3P 4A3LJ 1RR7A 1ZTRA 3JRAA 2EH3A 2YS9A 3BQYA 4QIWN 3S1MJ 4FE4A 1ZGWA 2DN0A 4MFDA 5JLWA 1JUSA 5FJ8J 3GTOJ 2NVTJ 3GTQJ 4XK4A 4B4CA 2EZIA 3BG3A 3B6AA 2M2EA 1BL0A 1DU0A 4A3IJ 2FQ4A 2L9RA 2XGCA 5EEAA 4IHWA 4A3BJ 1SFOJ 1UG2A 5IYCJ 1F36A 3TP0A 1VFCA 3I4MJ 4UUTA 5IP9J 2G0EA 3ZQFA 4UUSB 1MH4A 5IP6A 5EGOA 3GTMJ 1YRNB 1FTZA 1JT6A 5FKLA 3NAUA 4JX5A 1WCMJ 4EEFG 1TC3C 3BT9A 1RETA 4JYKA 1B8IA 1BJZA 1QPIA 1MSFC 3A01A 5M3FJ 1IDZA 2JWTA 5E3OA 2E19A 1IG7A
chains in the Genus database with same CATH superfamily
1HDPA 3R61A 4M6VA 3M8JA 4RS8A 3S8PA 4C3IJ 4B09A 1DPRA 1ULYA 3JRDA 3H0DA 1VQ7I 2K7LA 2M34A 2EV6A 1YYVA 4KISA 3OYHA 1H89C 2I10A 3ZMDA 3PUBA 4F3QA 2FBHA 2KDOA 1IN7A 3H92A 3ASOH 1ENHA 1G8XA 1IRFA 4PFPA 4XLPF 3E97A 1X58A 2XGDA 2DA2A 3DTIA 2Q1ZB 3GX4X 2X1DA 4LG0A 3LA7A 4XR6A 4G94A 1O4XA 3O3KA 5EZHA 3QOPA 3RSNA 2QCOA 1J2XA 1S7EA 3F8FA 5LHHA 3DFGA 3W2AA 4E4HA 2ZNZA 1T0FC 5HNFA 1ZK8A 2VT3A 2DMQA 4IOAF 1MZBA 1GV2A 2XPVA 1TZLA 2QUFA 3BWGA 3QPSA 4DYCA 1J7KA 2DK8A 4KMUX 1KZHA 5FKMA 1QZEA 4AYBN 1YW7A 3IL2A 2JSPA 3IC7A 2A07F 2DOEA 5LD2C 4E7KA 4CCJA 4CYCA 2MSYA 2JSCA 3RDIA 3KYLA 3RI4A 1ZR2A 3PQKA 3S3NA 1VQ8I 4HOBA 2O8KA 1Y0NA 1D5VA 2DPUA 1AKHB 4R1HA 2O0YA 4HX8A 5J8CA 1NG6A 2ECCA 2V79A 3WU0A 4IX7A 2EV0A 3LSKA 1VF9A 2DPDA 4IHXA 1RESA 2OC6A 4WK8F 1B1BA 1Z7UA 3EYYA 2HDDA 1YJ9I 1MJAA 2O03A 1WH5A 1BM9A 4IL6C 3DBRB 1K4SA 4O5VA 2PLYA 4LGWA 2A6HF 3E1SA 3CC7I 1E3HA 2DA7A 2BOLA 1ETWA 2WWYA 1G3YA 2PN6A 1P2FA 1XTAA 4DQ2A 1V4RA 3KZIC 3RCOA 3BR2A 3KEOA 5FKOA 1B72A 2ACJA 3CMYA 2H94A 3GZ5A 3A2KA 1ITYA 2XRNA 4XSXF 2DBBA 3MZ8A 2ZJRF 2G9WA 4N0BA 2FJ1A 2L7MP 3ZMZA 4YFNF 1XD7A 1FBUA 4AIKA 1BIAA 4PGHA 2XB5A 2Z16A 5KNLA 4N9IA 4RM3A 1APLC 2HDWA 3BROA 3ZMUA 4JOMA 1BI1A 3WGHA 3L2UA 2M5WA 2E2JJ 3CCQI 5LEKA 3K4NA 5DS9A 1RUOA 1SMYF 3B73A 5CLSA 2M3AA 5F27A 4IQJA 2Z5UA 1R5ID 4I7HA 1JT0A 5GAHJ 3D5RC 4EMSA 1R4MB 3LFUA 4BQNA 1HDDC 2JRTA 4F7ZA 2DTRA 3GYHX 5HDNA 1XN7A 2HKOA 1Z3XA 2HZTA 3CCUI 2VOPA 3Q0WA 4MQ9F 4BBSJ 1ETYA 2CWEA 4RM2A 4BU2A 2LR8A 3QU6A 4ZZLA 1PUEE 2XPWA 3MZYA 3S1QJ 1BI2A 1U2WA 3GLLA 2XROA 3MD2A 3COAC 3VFZA 4FCYA 3OR1C 3VEPA 4Q47A 3IRQA 3SFZA 4LITA 3VSLA 1SVOA 1MD0A 3HYIA 3K10A 1GHCA 1KU2A 5F1JA 1FP2A 2BXZA 1MNDA 3VOEA 2IVMA 4D7NA 1CF7B 1FIAA 1ZGAA 5KAIC 4S04A 1KONA 4OIPF 1WJFA 1F5TA 4DBRA 2OF7A 1SFEA 2P0WA 2NVQJ 3HBLA 3O8GA 3HSRA 2FMYA 1HW5A 1OCRH 2XV4S 2DO7A 1EV7A 2VBXA 2HOTA 2VLAA 4U7BA 3J7ZI 3V8KA 4C3HJ 1Z67A 3T0YA 3BZ6A 4CUGA 2CUFA 1X4PA 3PL8A 4KN4X 3HRTA 2R92J 2XC7A 2VBYA 3OYBA 2TDXA 5FGMA 3HTUA 1Y39A 3OY9A 1K6OA 4M6YA 1XMXA 4KA4A 4HF0A 3RKQA 2ZXJA 3IH2A 2L9SA 3AKZA 3TEDA 4Q48A 2DW4A 5KAFC 4OU0A 1RKWA 4HZFA 1Z9CA 1P7JA 4BXUA 4LLNA 3V7SA 2L3DA 2KRFA 2JQ7A 2R7DA 2ZCWA 4WCGA 4K2EA 3TO9A 5ICEA 5CPRB 1TWHJ 3C3WA 2PG4A 2HVQA 3C2HA 1MW7A 2DFIA 3CLOA 2HQAA 2L4AA 1B59A 3RIRA 3W6VA 1Y6IA 2VJ5A 2ETHA 4XM3A 5HS7A 3AG3H 4DW6A 5C4XJ 3C18A 4PSXA 4NB5A 4JBAA 3FXQA 5F6FA 1OMIA 4CZCA 2DOAA 3KP4A 2ESHA 2OTJI 1ETQA 5J1UA 4NHJA 3U1KA 1JJ8C 5A2QZ 1G3WA 3WODF 2HPMA 1RKTA 4P1WA 4ZJZA 3HOZJ 1WJAA 2X9DA 2XAQA 2K40A 2O8XA 2E5ZA 1B72B 2HDCA 3BR3A 1JJ6C 3HIFA 3G1MA 3WE2A 3MCZA 1OLTA 5AIPA 3K2ZA 5L3FA 1FYMA 2HQRA 2RDPA 2H09A 4HNUA 2EILH 3RKWA 4GGGA 4UUSA 4II2A 3HM5A 3ZGKA 2KZVA 4GDFA 1KQ0A 2XSDC 1MDMB 1DQUA 2R7OA 2LG4A 2XKPA 1FY7A 4CCLA 3CJNA 5K7HA 1V3FA 3SFIA 4AVZA 5HS8A 3QRFF 2LMDA 5J4YA 1IF1A 1BIBA 2VI6A 2VN2A 5H2FC 5ED4A 2M4KA 3F72A 4MEYF 4M3EA 3GBGA 2BV6A 5ERIA 3QPTA 1VQNI 4I98B 4IXAA 3GTGJ 4KUMA 2VKDA 2JPBA 5CQEA 1G3TA 2CQXA 2IEKA 4AU7A 4U0YA 3AAFA 3Q0UA 2K27A 4U0WA 2HVSA 2ID3A 1XGNA 5HNHA 4XKCA 2LBFA 1J75A 2ZNYA 3AG4H 3S2DJ 2F4IA 2O61A 4XRSA 4HV5A 1FC3A 3HOTA 1W7PD 1PDNC 1U6GA 2A5WA 2M8EA 2O5RA 1MNEA 2VXZA 1HQCA 2MYSA 4P55A 2LKSA 3Q9VA 3VYTB 2FF4A 1JHFA 2JUCA 3TDUC 1VQOI 2OA4A 3EPZA 3TP3A 4PDKA 3Q3SA 1U5TB 4S05A 3ULQB 2LD5A 2VQGA 2ISYA 3CDLA 3M4OJ 5M3MJ 2VPRA 4PZJA 5KCMA 1LB2A 4Y7NJ 1FYKA 4OINF 2A61A 3WHBA 1H88C 1T6SA 2DXIA 2DTZA 1XMAA 2Y9ZA 3H3VK 4UHTA 1AOYA 1YQAA 1XG1A 2MA3A 3OYLA 3E7LA 1MJ9A 1LQ1A 4HBLA 2WV1A 1K7AA 2DA4A 1W4MA 1U0JA 4QWQA 5JVGF 3DBHB 2L54A 4IKFA 4MLOA 3K6GA 1L0OC 1IXSB 3DEWA 4ZYEA 5K5RA 2Y0SN 2BY2A 3LSHA 2Q8KA 2ICWG 3LA2A 4CGZA 2BY1A 1UG0A 2CFOA 3H5NA 5FRNA 1E2XA 5HLTA 2XAGA 1XB4A 3VPRA 2QA4I 2LK2A 3QYEA 2LYCA 2D2WA 5BNGA 3SYTA 2QBYB 1W0TA 3P9IA 2CJJA 2CUJA 3K4LA 3R0AA 3QP5A 2GA1A 2YUSA 1BI3A 2F48A 3CDHA 2LVSA 1XGMA 3F22A 1ZRCA 2ELJA 2DDBA 3DF8A 1Z21A 3F8NA 2FNPA 2IGNA 2K4JA 2V7FA 4X1EA 4QTRA 4D5CA 2DFEA 4EATA 2LLKA 4ZYHA 2WTEA 3QPHA 2PQ8A 5BS6A 1IRGA 4IRHA 4UUVA 1FJLA 4A3DJ 2FX0A 2LY2A 3JR9A 4YIRX 1BOBA 2IGOA 1LNWA 3OYAA 2X1EA 4A3KJ 5D5UB 2E1MC 3WTTC 2V1NA 5DCMA 1ZYRF 3H36A 1KU9A 1ZTRA 2NS0A 3JRAA 1YX3A 1W5CC 3L00A 3BQYA 4EQQA 3S1MJ 5GAEJ 5JI6A 1STZA 5JR3A 2JTVA 1J09A 3CP8A 2HNHA 1TNSA 3DU6A 2NVTJ 3GTQJ 1R58A 4PGGA 2OBPA 3DQVC 1BL0A 1OR7A 3QU3A 3P9CA 5DUIA 5FRMA 3FXRA 4A3IJ 3LSMA 3DEUA 4HYEA 1OKRA 2MBFA 5A2QK 4A3BJ 2J5OA 2MLKA 4R79A 1UFMA 1UZCA 4H4KC 4QPOA 1F36A 2X1CA 3JW4A 4PJJA 3I4MJ 2ZXHA 5IP9J 4E7LA 4PUSA 1FNNA 5EGOA 1R7JA 2ZBKA 3ZRGA 2CGPA 5CYVA 1YRNB 1IV8A 1JT6A 3OYKA 3TMOA 1FTZA 5E20A 1WVRA 3DXJF 4NQWA 2AQFA 4XKVA 3FZVA 5F64A 3BT9A 4LD5A 2LC2A 1B8IA 1TC3C 4RGXA 3A01A 4QPQA 2I5UA 3BJ6A 1X3WB 4F93B 2ZSIB 3LL7A 3JCUC 3K7AJ 4AYBA 5DDGA 2IBDA 3MEXA 2XAHA 1K79A 2IS6A 2W82A 3DKWA 2L9VA 1R00A 2RC4A 3C2BA 3IWZA 3I4NJ 5AIQA 4IHYA 4O3MA 3I71A 2JA8J 3BQZA 4BEHA 3VYUB 4EGZA 2VB6A 3ECHA 3H9JA 5J1YA 4BH9A 2JT1A 2WBMA 2CUEA 1ZELA 5LHIA 4UV9A 3AL0C 3I64A 4OIOF 4CDGA 3WTSC 2BHZA 2P7CB 5GADJ 3A1YA 2QVOA 3CO7C 5D5XB 5C3EJ 2R7UA 5HDKA 2K02A 3PIOF 2CV0A 3OYDA 2CQKA 1I3QJ 1QNTA 1B9MA 3VSKA 2FNAA 4XKWA 3WTWC 4LJZF 1AA7A 2QEXI 1HA8A 9ANTA 2MW8A 4L9JA 5M5WJ 1KYWA 5H6QA 5IT9Z 5IOYA 1QBJA 3H0GJ 4Q5SF 5H6RA 4GYGA 2VONA 2R7WA 2V9VA 1K78A 5HS9A 2KIQA 4KJZA 1R22A 2L2OA 1WJDA 3WU1B 4FTHA 4ENKA 2UV1A 5BOXA 1ETKA 1Y8RB 2IPQX 2DA5A 4BJTA 4OIRF 4EV0A 1I5ZA 2PJPA 4L18B 4DOZA 2QBYA 4L0YB 1T33A 2X48A 4BGDA 3U9GA 3GTKJ 3GTPJ 3C7JA 4WXHA 1TQPA 4B1RA 2V6CA 3ABLH 1FEXA 1Y1WJ 4J01A 2CU7A 2WB1A 4QSHA 2VBZA 1ETOA 3K0LA 5DEQA 2ADUA 3I54A 2Q0OA 1AU7A 2NYXA 3NWTA 3M3YJ 4V2FA 2GQQA 2OCCH 4ZDLA 3HPGA 3JRGA 2R5YA 3OL3A 2R0QC 2EPFA 2MFZA 1VQ6I 2K3PA 4XRMA 3J7YJ 3ONQA 4IRIA 2RKHA 4B8XA 2ZMEC 4HAMA 2KIMA 4G6QA 4XORA 4I0BA 3TOBA 1D5YA 1MSEC 3ZQIA 3PSIA 4G9YA 5D5WB 4HF2A 5BQTA 2JPCA 5JVTA 1VQKI 1SAUA 4B3AA 4MNUA 2HOSA 5JFRA 5F0HA 5FLXZ 3ELKA 5EG0B 1OYIA 5M5XJ 1R6RA 3LSRA 4AIHA 2RGVA 2GZWA 1H9TA 2BGCA 4ZDPA 3V8LA 4A3CJ 2VJ4A 2K4BA 1W1WE 5HLHA 3QAHA 3KE2A 4E7SA 1RUNA 4RLQA 4XLNF 4I0AA 1W36D 1OPCA 2B7EA 4G6DA 4FX4A 1MBFA 1BC7C 1RRJA 3C2GA 1ODDA 2LP0A 3VB2A 3E5UA 1N77A 1N25A 3FDYA 1BJAA 4KIFA 3BTCA 4ZDOA 1S3JA 4KIBA 3CCJI 1F43A 2EBIA 1SFUA 4EM0B 1QGPA 3G73A 3PO2J 2IA0A 2CQQA 3MKLA 5F1RA 3F0CA 2XF6A 4G7ZF 5CVJA 2EIJH 5L3BA 1TW2A 2HPIA 1HF0A 2NVXJ 4DIQA 5JHFA 3V8JA 1KQ9A 2R5ZB 2NOGA 3GXOA 1T95A 2B0LA 1S5LC 1XSVA 4NDLA 4HSRA 2K5CA 1VTNC 5E18F 4V2GA 2HTJA 3DP7A 1LE8A 1ONVA 3L2CA 2P6SA 1HXDA 2HYFA 1YIJI 2PMUA 2DMPA 4IHTA 4BHBA 2CH0A 3L2WA 4S0HB 5D6EA 4Y15A 3TO6A 4RB2C 2JUGA 3DBLB 2LFBA 4BDYA 4YEJA 3OL4A 3HHGA 3JSOA 2NOJB 3ZXSA 4GCVA 3SEQA 3V4GA 2RNJA 2E35A 4G8XA 1D0XA 1BA5A 5DV5A 5ICFA 4EJUA 4E7IA 4BAYA 4AM3A 4LB5A 4Y52J 2K86A 2H6BA 2R7TA 2AQEA 2OUMA 2Z99A 4MTEA 3ABKH 1UHMA 3DU5A 5HODA 2UUZA 5IT9K 4MTDA 3G6EI 5LGNA 3VWBA 1GXQA 2RN7A 4LK0F 5DYMA 4J00A 2BVLA 3LSIA 1D8JA 3RQ4A 4BQOA 4CA0A 2O6GE 3IAM2 1ZKGA 3NRVA 4A2UA 1C0WA 1LUJB 3QODA 4CCOA 1ZG1A 3RTRA 1MBJA 4IF4A 2YU9J 2CRGA 2NVUB 2H27A 3J7AO 4A93J 1XMKA 3KP3A 1IN6A 5F0FA 4C3JJ 2V1DA 4YIFA 2VE8A 2ME6A 1MNMC 1BI0A 3KP2A 3GFJA 1VQ5I 2AS5F 2LY1A 3I56I 3WU2C 1FSEA 3O6BB 4HF1A 1QZZA 3RKXA 1BBYA 1WFXA 1R36A 3MKZA 4A3EJ 5DTDA 2HTSA 3CDIA 3J80Z 4V19K 2CW8A 3ESWB 3SQNA 4RAGA 3MAJA 1TQMA 3A4CA 1FBSA 4DNCA 1DGWY 5BPIA 4O6JA 4CCNA 4D7MA 2DODA 4CZZA 1KYZA 2HS5A 3QQAA 2YX7A 5ICCA 5ILSA 3OIPA 3G1LA 4IHVA 3ZN0A 1YFHA 3S17J 1Z6TA 4J19A 2WB1N 3W6KB 1G6NA 5EG0A 5BPDA 3ZQ7A 3BC8A 2HQNA 3FXUA 3OSGA 4DGWB 1CQTA 1ZGJA 3S14J 5EYRA 1QPMA 2JRMA 5D8LB 2DQLA 3CF2A 4RGSA 1SEUA 2EJRA 1TBXA 2FMLA 4N9HA 4RAFA 4A12A 4M9ZA 2K3FA 4ENNA 2QQ8A 3KZZA 2KIUA 2A69F 4E7HA 3LQQA 5FKNA 1ZLKA 2Y48A 2IT0A 1MMNA 2OZUA 2GIVA 5FD5A 4CH7A 2M45A 4JX4A 4QLCU 3P5JA 2Y0SA 2IS4A 3CUQB 3E6CC 1PUFB 1JI8A 3DTEA 2DK5A 5HDGA 3LFKA 3M7GA 5IY5H 4CICA 2DMUA 3W2WA 1SD7A 4XLFA 5F08A 2GLOA 1FYLA 3IRRA 4Y4RA 2LOOA 3GTJJ 4C30A 2L7FP 3H9GA 3FM5A 3QOEA 1Z6RA 3FXLA 2XKOA 4BY7J 2GIZA 4Q4ZF 2ZJQF 2R5ZA 1IN8A 2KFDA 4G12A 4RBOA 3Q9SA 2XAFA 4GYIA 2Z9OA 5EEGA 2XUBA 3PQJA 4RLFA 3ML6A 3ZQGA 4FASD 1G59A 2XSJC 4I01A 1XGSA 2F4MB 3LAJA 2Z33A 2WAQA 2K9SA 2BZTA 1FWZA 4ZZDA 3CCLI 1FIPA 3DCFA 4PJNA 2MH9A 1HW2A 2KISA 5CVRA 2QGUA 1ETVA 2QKLB 2R7RA 3DV8A 4I6ZA 2EV5A 4II3A 4LLGF 4Y33A 5CVIA 5CVVA 4MHGA 1X1AA 1B4AA 1D1BA 3CO6C 3OIQA 1W36C 1FT9A 3PUFA 1AKHA 5LFAA 2STTA 2W7NA 1LPQA 3HOVJ 2QLZA 2FQ3A 2B9SA 3FF5A 1GXPA 3HOUJ 5B1AH 3G71I 1TLHB 2XPUA 3BTJA 2X85A 4UB6C 5J4VA 5HLGA 2YX4A 1D3YA 1MKMA 3OMYA 2O3FA 1RNLA 1R5HA 3CJQB 3PFYA 3HG9A 3HEFA 3QPLA 2V9PA 3WGGA 2HXIA 5ILUA 3HJEA 2P5LC 2OV7A 2UXNA 2HYJA 4BXFA 3K4CA 3G3ZA 4M9SA 3ZQLA 3IKVA 3KX2A 3T1BA 1P6RA 1YHQI 3SDBA 3S1RJ 4BHCA 2DLLA 1IDYA 2WA0A 4BQAA 3L9FA 4EJOA 3JRFA 2EQRA 2OCEA 3HC7A 4PJMA 3I55I 1ZRDA 3C1DA 4HLXA 2Z1DA 2ZJ2A 2ZKZA 3HGYA 5GAGJ 1VQPI 4UXNA 2F2EA 3FXKA 3LQRA 2RV8A 3I59B 3LA3A 5K1YA 2CQNA 1RR7A 2IS1A 1UELB 1O3TA 3DWLE 2XIGA 2VQCA 2YS9A 4QIWN 2QSHX 4FE4A 1ZGWA 2DN0A 3KIOA 1JUSA 3CP2A 4XOPA 3ZN1A 5L3EA 5FJ8J 4ENJA 3GTOJ 3O2PE 4CSWA 2OAZA 2E60A 4XK4A 1MMGA 4XOTA 2QKMB 3K4MA 2EZIA 1WWXA 2FBIA 3BG3A 5FFXA 3TL4X 1KQ8A 5EEAA 1X1CA 1PVEA 4XMYA 1F9NA 2Z3YA 4BJ6C 3IAS2 3J80K 3TP0A 2Y69H 4UUTA 1FX7A 3HKZA 2CQ7A 1S9HA 3EUAA 1XCVA 2VASA 2NNNA 2WV0A 3NAUA 2FEZA 2XVCA 1J9IA 4B43A 2L9NA 3L2QA 3OR2C 4EEFG 1RI7A 1U3EM 1VZ0A 1RETA 4JYKA 1X1BA 3WTZA 2HEOA 1I3AA 1IDZA 2JWTA 3GFMA 5E3OA 1FLIA 2E19A 2P7VB 1ZARA 1MBKA 2DT7B 2ECBA 2KHMA 3RQIA 4YELA 1NH3A 2V1UA 4M3DA 3ZMVA 1TT0A 2OZ6A 3HRSA 3CUQA 1PUFA 1HKQA 1MMAA 3WE3A 5CJ9A 1KA8A 1NG7A 4MIMA 2O9LA 2W1OA 1TWGJ 3MFKA 1EH7A 1U9OA 3KEQA 1BOAA 1ZRFA 4DYRA 5E3LA 1I39A 3KYDB 2GWRA 2J5PA 1IGNA 3I3LA 2YPRA 3EETA 1UMQA 1SD5A 2QENA 1CF7A 2W84A 2YU3A 2FA5A 1A5JA 2BY0A 3OYGA 3ZQHA 4DYQA 3G4SI 2ZSHB 4KFCA 2P5VA 1EKEA 2KQRA 3UNGC 2ESNA 1IRZA 2IJLA 1CGPA 1XSXA 3FWEA 5FROA 1JGSA 1QZYA 1YITI 1M1EB 3WHCA 4L5JA 1LEAA 2R7VA 3S3MA 4L9TA 1A31A 3F6OA 2VJJA 1LDKB 3BPXA 3ZQCA 2OPTA 1V5GA 2EIMH 3H9QA 4OMZA 1JKOC 2ZXWH 3SHFA 2PJRB 2VJIA 5TISC 1EF4A 1JXSA 2P4WA 3OYIA 1U78A 4N4NB 1K61A 1ORKA 2BYVE 4BDZA 4KMFA 4RB1A 5E1WA 4BACA 4IVNA 3ZQQA 2JN6A 1FOYA 1YS7A 2FD5A 5K7ZA 1HLVA 3T8RA 3BG7A 3GO5A 3TOAA 3DLAA 4XONA 1X3UA 3BJAA 1J59A 2H8WA 4ANJA 3S2HJ 1TL8A 3RJPA 3CC4I 1T39A 1ZREA 2KT0A 4Y3OA 5FB2A 3PO3J 1VQ4I 2JK3A 4BY1J 1W7PB 2M0MA 2WAQN 4PK4A 2Z2SB 2DFFA 2YSRA 3HUGB 3ZPLA 3V42A 1YIOA 1LFPA 1WI9A 3R0JA 4TV7A 4DZJA 1O3RA 3BG6A 3ZOBA 2W4SA 4UVBA 1X4OA 4AIDA 5EJCA 4ENMA 2MGQA 1QHHD 2W85A 3WG7H 4A0ZA 3GF2A 3W6JB 3KPHA 3U21A 2GBYA 5EEHA 3BR0A 4RB0A 3GEZA 2A6TA 4M9XA 1GT0C 1EA3A 1I6XA 1Z3YA 2OU2A 3CF5F 2QQAA 1OCCH 2R7SA 1JTYA 2OQGA 2AO9A 3CD6I 4IEJA 2EFOA 1K83J 3SZGA 2IP2A 1WZ2A 3MKWB 1G2HA 5J6XA 3E3VA 2X6WA 3M1EA 1X1DA 1Q1VA 2JVHA 1P4XA 3FXOA 3SEZA 1WPKA 3RYRA 1R1VA 3EUHA 2BE5F 1ZR4A 1MMDA 5D6FA 3LSGA 4FT8A 2KDZA 3FXJA 2EFNA 3M1CA 4L9NA 1MH3A 3W2VA 1MDMA 3R4KA 3A02A 4M71A 4HDUA 2LTPA 2PMHA 1OR7C 5K5QA 5JHUA 4B3XA 2ZFWA 4IHSA 1WKMA 3PNYA 5AONA 5J3LA 1LEBA 3CJRB 1UHWA 1WJBA 2EZKA 2L7KA 2KLOA 2W24A 4W97A 5E8GA 2H8RA 2IS2A 4M74A 2MG4A 1K6YA 2K9MA 4M3FA 3HOSA 2VPLA 2Q2EB 2QSFX 2EK5A 1U8RA 3RPQA 3K4BA 1FSHA 2MABA 1I50J 2F5DA 5J47A 3OYMA 5TGTA 1R9TJ 4ZTFA 5B5EC 5J1RA 3AG1H 2VL8A 4BUPA 1S72I 4AWXB 1MGTA 2CUZA 2XF7A 4A0XA 1MBHA 2Y0MA 3K69A 2JZYA 4RMNA 4KICA 4Y17A 3EUKL 1YE9A 3W3CA 2EFQA 3LSJA 4FHTA 3HOYJ 3F8MA 3GZNB 3NARA 2LDUA 4EGYA 4HRIA 4UY8I 1U5TA 2AXTC 5LEJA 2NS7A 2X6XA 1SD6A 3KP6A 2F5EA 1U5TC 3HKZN 2F5FA 3F21A 2Y2ZA 4XBFA 2DT5A 1QU3A 4MGRA 1WI3A 3SJMA 1WJ5A 4HPQA 2WAFA 2ID6A 2L4MA 1VQLI 3ZP5A 2M8GX 2QZ8A 4L0ZB 2DA1A 3P7NA 4LG0B 2M87A 5LGTA 1OJLA 3A03A 1V5FA 4WXCA 1XS9A 3ISPA 1LDDA 1IZ1A 2A6EF 2EIKH 4HLYA 4BE2A 2Y30A 3E6DA 2KMUA 2FXAA 2MD5A 1FTTA 2ZFUA 2HOAA 3TW6A 1H9GA 4NC7A 5IOZA 2PFBA 1FMVA 3S15J 2W48A 2VIXA 1X2MA 2MLGA 3CLQA 3L09A 2WY7Q 4ZYAA 2LSOA 2HU9A 1F4KA 1I1GA 5EDNA 2A68F 2E36A 2X6OA 3U1DA 3I58A 4CYCB 4IOCF 3I9V2 4EVIA 3HUGA 1LFUP 4M73A 3FIWA 5J40A 4KT6A 4KN7X 3CQZJ 3V7CA 1IV6A 1RPWA 2K9QA 1T38A 1ON1A 3LWFA 3F8BA 1Q1HA 3HOWJ 2L0KA 1PYVA 1XCBA 2IA1A 3EYIA 3Q0VA 2D5VA 1AWCA 3WGIA 4LIUA 4YIIA 2VXDA 4EM1A 2DI3A 1X3ZB 3REOA 2WY8Q 4XN0A 4AVPA 4OAZA 3M9AA 2MC4A 4UNOA 1NTCA 2KRHA 3G2BA 2W00A 4BNCA 2D1HA 2NNYA 3M8EA 4NUBA 2MD0A 4NC8A 4D9JA 1W5TA 4LOCA 3JREA 2R93J 2E1OA 1X1PA 3ROUA 2ISZA 4HSTA 1B9NA 2FE3A 4L9VA 3FBIB 3GZ6A 1NHAA 3B6CA 2QM3A 1WRJA 1SVMA 1GUUA 4ESFA 1Y8QB 5E3NA 3CCSI 4H0EA 3ABUA 2EINH 1LKXA 2E1NA 3BTIA 4BE1A 3HRMA 3DPTA 2QWWA 5C4JJ 1UHSA 4XQFA 3SXYA 3GTLJ 2L5QA 2HFHA 2RREA 2COMA 2HQ5A 3OV8A 2V1XA 3BPVA 4XL9A 5E3MA 4ETSA 3HPHA 3IV5A 3S32A 4BL0B 2CMPA 4HV6A 5L3CA 1YRNA 4KYWA 4NC6A 3RZOJ 1ZH5A 4I99C 5IPAA 3BJOA 1A04A 2HGCA 3J7AY 4XLAA 3J81Z 3JRCA 3IH3A 5FD6A 3RZDJ 5H20A 1D8KA 1KU7A 5ICGA 3IH4A 2M7AA 2KRCA 3EQLF 3KP5A 2RQPA 1T08B 1YW8A 1HW1A 3CMAI 3DPLC 1S6LA 1TQIA 3PIPF 2VKHA 5L3DA 3SZTA 4XIDA 1NK2P 5E1XA 2RQQA 1TWAJ 4E7ZA 3WTUC 4C2UA 3HOXJ 2VKVA 2PEXA 4HW0A 2FRHA 3OYEA 1MIJA 2EZHA 4FQGA 1PP8F 3VYSB 1ZQ3P 3GUDA 1R71A 3HZJA 2VOOA 1SMTA 1H0MA 1POGA 1QHGA 2E71A 4JQFA 4XLHA 4BYYA 4CCMA 3QYBA 1OCTC 2BY3A 1JGGA 1OCOH 3DPUA 2KIFA 5KVRA 5B3SH 2ME0A 3A0HC 3S3OA 2EA2A 4DJAA 3NQOA 3FKIJ 4C2TA 1E3PA 4BXXJ 4F52A 3S1NJ 2DT6A 5IYBJ 3HL2A 4PJ0C 5HOOA 5DUKA 4EJVA 3S16J 2IA2A 1QRYA 1T0FA 3RKYA 3PM1A 3OIOA 2EB7A 2OD5A 1GDTA 1F1ZA 2LH9A 1FOWA 2AHQA 1O7LA 2JA6J 1T8IA 2ZJPF 5D5VB 3SZPA 2Y9YA 2R7ZJ 4A69C 2PMZA 3OOUA 1A36A 1HSJA 4RA2A 4D5FA 3FHNA 4MO7A 2COBA 2PBIA 3DKXA 4F55A 5GTHC 5FLVA 2BHYA 4LMYA 4U88A 2FOKA 3IP4B 1L3LA 1J5YA 2DFHA 3GW2A 1XGOA 4A0YA 4WWCA 4GRIA 3GLXA 2NS8A 2V26A 2CG4A 2XB0X 3BY6A 4UVCA 5D4SA 3D1NI 1Z0XA 2DJNA 1XSDA 2K9LA 4AUXA 2DYSH 3IUOA 4HA8A 4U7DA 3L1PA 3MZHA 4NNJA 4PSWA 4FETA 1IO2A 2NAZA 3CUOA 3M8FA 2LRDA 3HSFA 4HNTA 1XX5A 4B47A 4WX9A 3FMQA 5IYDJ 4E70A 3FBNB 1BC8C 4XNFA 3HTSB 2CW0F 4I2OA 3N4MA 2BW3B 3FK6A 1FOKA 1HKSA 5JLXA 2R4GA 2F6CA 4X6AJ 1V55H 2LNBA 3OYNA 4ESBA 1IC8A 3VODA 4MQVA 2XF5A 4PFOA 1BR2A 3TGNA 1SC7A 1VI0A 1DP7P 5J8FA 1MMSA 1EJ9A 2XASA 4AIJA 2I8DA 1DP3A 3HGGA 1E0EA 5E79C 3CCMI 4A3LJ 1UJ8A 4P9UA 1IUYA 3GWZA 1WHUA 3DEEA 1XPXA 2BBYA 2E7WA 4MFDA 5JLWA 5KK1A 5D4RA 2VQHA 3HHHA 4B4CA 3VYRB 1FZPB 1JHHA 2L9RA 1Z05A 2GXBA 4HDVA 1DDNA 4LK1F 1YOVB 4A6EA 1ON2A 3RYPA 1SFOJ 3OWTA 4XRFA 3HXLA 3OYFA 1SVLA 4YG2F 2VT2A 3GFIA 1O3QA 5IYCJ 2MC3A 1VFCA 3U2RA 2DU9A 1PP7U 3X2QH 1IN4A 5GTIC 3OS0A 4UUSB 4L5IA 5IP6A 3GTMJ 5TJJA 5LRRA 5KHDA 2GOMA 4JX5A 1WCMJ 2KP6A 4Z6YA 2KJCA 3CCEI 2DYRH 2P6TA 5FLXK 1ZN2A 1N75A 1BJZA 1QPIA 5LHGA 3IHUA 2H6CA 3AG2H 4G7OF 2PI0A 3CJTB 4XKBA 1IG7A 2NRAC 4YFKF 4E7JA 2C6YA 5E17F 3FHZA 5ILVA 1U8BA 1S29A 4UV8A 4RAZA 3J81K 2LBFB 1BW5A 2DAOA 3PFIA 5B1BH 2Y31A 4DBQA 3JAMZ 1R1TA 3BG5A 3QP6A 3S2WA 2DOFA 2DMNA 3O8HA 1Y1VJ 1MBEA 2K85A 3A0BC 1BR4A 1V5EA 3DKYA 5HLIA 2HOEA 2KKOA 2N8GA 2KL4A 2FOWA 3M07A 1OFCX 3ABMH 3ABTA 1P9QC 2LY9A 4P96A 3H3ZA 5HVQC 1MBGA 3BR1A 1G3SA 1MJBA 4ASNA 4FISA 3FXMA 1WSUA 2F4OB 3BCAA 1P7IA 2CSOA 3MWMA 4PJLA 4RB3C 2D1VA 3TQNA 1RC9A 2E2IJ 2HXOA 1O7FA 3E0JB 4A3FJ 1DU6A 3OYJA 1W0UA 1T98A 4HX7A 5C44J 3MKYB 1SFKA 1R49A 3CCVI 1GLNA 1TW3A 1JUMA 3F23A 4A3MJ 4L5EA 1IN5A 3ERMA 3ZR8X 4B44A 1EH8A 4RGUA 3JSPA 3ZMTA 3LSPA 4BHPA 2HVRA 4BKXA 3WTXC 4OWRB 1J0RA 3H5AA 3P9KA 3EDPA 4A3GJ 2JVGA 5IP7J 1G4DA 1KGSA 2R7QA 3GMEA 1E3OC 4IZZA 1A6IA 3BR6A 2VQLA 3L7WA 3IWFA 2EWNA 2M7BA 3MN2A 4G6TB 2BW3A 3K1MA 1GVDA 4CO8A 4UB8C 2E2HJ 4ZYGA 2IAIA 2PMZN 4M3GA 3ASNH 5FLMJ 2CYYA 4WF2A 1OQYA 3JRIA 1UAAA 3TO7A 4LIVA 1QQIA 2PX9A 4M6XA 4RAYA 3CC2I 2E1MB 2EFPA 2XAJA 4XN3A 3RPUD 1RZ4A 3F9KA 2VUMJ 2IXSA 3VDXA 2UXXA 3LNQA 2V4JC 4IJAA 1UB9A 4BE0A 2HYGD 3PNTA 4EJTA 3B02A 1TTYA 1YLFA 5DCMB 2AXLA 3BOQA 2XDVA 4BQQA 4JX6A 3ERED 1T56A 1QVUA 3F8CA 3LAPA 2E34A 4KIGA 1OCPA 4KNYA 2KJBA 2LF7A 1O3SA 1D1CA 2NXNB 4F92B 4E6KG 2RVCA 2XAUA 2VC0A 1XC5A 4CXFA 1Z1DA 5EZGA 1BW6A 4LB6B 2XRLA 2B63J 3CMMA 1ZLJA 3IKTA 1Y56A 2CW7A 4AC0A 4XSZF 4D1QA 1ZAOA 3HDDA 3FKJA 4DZPA 1SAXA 2M0CA 3NWSA 1ZHFA 3D0SA 3N97A 3SDGA 4M72A 2K9NA 3BP8A 1ETXA 2TRTA 5FKKA 5EGOB 4HQEA 5DD8A 2TCTA 5IT3A 1P4WA 4NQWB 3LOCA 1X19A 3L2RA 2DMTA 1SANA 2IRFG 1HOMA 2OQRA 3HRUA 1B8IB 3MMYB 4GFBA 3A01B 1IW7F 1WJCA 2GM4A 2GAUA 3CUQC 3KEYA 5K7FA 1FMWA 1TP4A 5EF6A 2Y75A 2QYOA 3K4KA 1H8AC 2QQBA 1SFXA 4MFEA 3K70D 3PNVA 2L7ZA 4ZTJA 1JKRC 1SD4A 2HKXA 4NBQA 4ABZA 2RNGA 1REPC 5D8KB 4BEHB 5DD4A 1T2KA 4OAYA 3AL0B 2GXAA 4P9FA 2X0LA 5B66C 3JAMK 1JTXA 5DCFA 1W5SA 3F3XA 4FX0A 1XDSA 3CESA 5FO5A 2LREA 4I76A 4GO1A 4GXOA 4C2MJ 5DM7F 2F5VA 2FSWA 3GVAA 1D0ZA 4IO9F 2GXGA 4LLLA 3BLYA 4ZC3A 1TWFJ 2VODA 2GA2A 4A3JJ 4HEA2 2EA4A 2XGEA 2HI3A 1DGRM 3WTYC 4A5MA 3K1NA 1USSA 3KP7A 4P5OA 1IJWC 1QO0D 3R60A 2VKEA 2JA5J 1YX5A 1DUXC 1LFBA 2R7FA 1XDUA 2VBWA 3KFWX 3S93A 2P8TA 1JUPA 1YW9A 1K78B 2EZLA 2W25A 4HG2A 3UR3C 2ZB9A 3F6VA 2M9HA 2LKPA 4HQMA 2NVYJ 2XHKA 2A3SA 1IUFA 4HNVA 4XLCA 3CCYA 2UZKA 3MQ0A 5LBQA 4AD9A 2XGXA 2VC1A 2IGMA 1S7AA 3OOPA 1RR8C 4I09A 3D5SC 3DTKA 1BR1A 5TRDA 2X6YA 1YTYA 2L02A 1AHDP 1Z77A 3DLLF 3HSEA 2P81A 1HSTA 3I59A 2WC2A 3K4JA 2QQ9A 2R3SA 5L3GA 1I27A 1K4TA 3KZYA 4IRGA 3H35A 2FU4A 1WGXA 3CTAA 1OYYA 4ZH4F 1JKPC 2ZMEB 2R5YB 2HR3A 3T8TA 1GVJA 4LFUA 4M3BA 5F04A 2O7OA 2CO5A 3BZKA 3QWLA 4HX4A 1WJEA 4JP0A 3EUHC 1HBXG 1Z7LA 2L01A 1S7OA 2WAEA 3BG9A 3FK7A 1IXRC 4XRSG 3HB9A 2E1CA 2ZO4A 1I1SA 3K1PA 1D0YA 1YI2I 4W1UA 3JRHA 3E6BA 4ON0A 4U87A 3BZCA 1JKQC 3K2AA 1IRXA 2DCEA 2ELHA 2LF8A 2M4GA 2ZXIA 2BXYA 5FFZA 1HC8A 3LMMA 2HZDA 4Z2YA 5GPCA 2KZGA 6PAXA 1RIOH 1YS6A 1LVKA 2JA2A 2ZC2A 1QA6A 3D5LA 4CYDA 1ZG3A 1KU3A 4FE7A 4F91B 1HCRA 3JTHA 1ACIA 3GCMA 2A5YB 3TBIA 2UWMA 5BMZA 1LVAA 1LJ9A 4RDUA 3QYFA 4MEXF 3RPUA 4YFXF 2D45A 4BJ5C 1EH6A 1QVTA 2JMWA 3G1OA 3NEUA 3H1CA 3LSTA 1I6HJ 2EFWA 1A35A 3ECOA 4U0VA 4R8HA 2H1KA 3KLOA 3JTGA 1A6QA 3E5QA 4EM2A 5E8IA 1FOXA 4N4OB 2CFXA 5K5OA 1FBQA 2P5KA 5GP9A 3OSFA 4ESJA 1LDJA 2FBKA 3I5UA 3I4PA 4Y13A 3ZMSA 2CV2A 2HWVA 1GV5A 3ZCOA 4IQ4A 3TW7A 2H1LA 2G7UA 3TDZC 3V7RA 1TWCJ 5M5YJ 2PJRA 3MVPA 4BS9A 3AFHA 2STWA 3FM3A 4RGRA 1D1AA 3H5RA 2E5NA 4ITVA 1TT5B 5LLQA 5GPAA 1LE8B 3JRBA 5DM6F 5CQGA 2M1BA 2LKXA 3CCRI 1YJWI 2DQRA 2FUG2 2V6EA 1R23A 3CMEI 2CS3A 2WADA 2KPMA 5F0CA 2VE9A 3BTLA 1VNDA 3E5XA 1ERDA 3K9TA 2DA6A 1W7PA 3KLNA 1UCRA 3FMRA 2JJ7A 3OS1A 5LGUA 3K70C 2IW5A 2IGKA 1FPQA 2QF7A 4X0GA 3PSFA 4PCQA 3BCBA 1YG2A 3FISA 4G7HF 1DPUA 1ZG5A 1HKTA 2ELKA 1YJNI 4BBRJ 3UKGA 2DA3A 2DJIA 4CCKA 4YRVA 1R4NB 2M30A 4WXDA 3I0TA 1U9NA 2CV1A 4EJWA 2QSGX 2RAEA 3N05A 3I53A 3T5XA 1WH7A 4A6DA 4B48A 3FMSA 1JE8A 2MH2A 3BR5A 2JA7J 3OS2A 4XICA 1B6AA 1X2NA 1IAWA 4IPAA 4KT5C 4KDPA 3WG9A 4OMYA 3WTVC 1NK3P 3FX3A 5LRSA 2R7XA 2YR2A 3BDDA 3CZ6A 2DDAA 1OYWA 2ZMEA 1WQ2A 5E1ZB 2EH3A 3KETA 4OIQF 1Y0UA 1USTA 3OYCA 4CHUA 1OCZH 1R1UA 2BVMA 1PJRA 2A05A 2F5CA 4JK1X 2OTLI 3TKYA 1O57A 2BEOA 4A5NA 1V54H 1N78A 3KYCB 3R6SA 3B6AA 2M2EA 1R5GA 3L2VA 1DU0A 2E7XA 2FQ4A 1P4AA 4ZYDA 4C9YA 2XGCA 2Q2EA 1VQ9I 4IHWA 1YO5C 5CKTA 2X4HA 1P92A 1UG2A 4XLEA 2G7HA 2GOXB 3KCCA 3Q5FA 2G0EA 3ZQFA 1BN5A 4D0PA 1MH4A 2V9KA 1E17A 1FP1D 1IXCA 4OOIA 3GFLA 5FKLA 1Z91A 4KITB 1S8NA 4UVAA 4LG3A 1TNTA 4I02A 2W57A 1OISA 3E6MA 1MSFC 2OJED 5M3FJ 2X51A 5CVUA 3H3UA 1VQMI 3PJRA
chains in the Genus database with same CATH topology
1MBKA 1HDPA 2ECBA 4M6VA 3RQIA 3K7AJ 4M3DA 4C3IJ 1U8BA 2IBDA 3JRDA 1PUFA 2M34A 3C2BA 1BW5A 1H89C 2I10A 3I4NJ 4IHYA 2Y31A 4MIMA 2O9LA 3BG5A 1TWGJ 1U9OA 2DMNA 3O8HA 1Y1VJ 1MBEA 1ENHA 4DYRA 5E3LA 3BQZA 2JA8J 1IGNA 5J1YA 1UMQA 2N8GA 1X58A 2XGDA 1OFCX 2DA2A 1A5JA 2CUEA 1O4XA 3ZQHA 4DYQA 2LY9A 5EZHA 1IRZA 1MBGA 2QCOA 3BR1A 1S7EA 4FISA 3WHCA 1P7IA 1ZK8A 5C3EJ 2DMQA 1GV2A 2XPVA 1I3QJ 2OPTA 3QPSA 2HXOA 3ZQCA 4DYCA 1JKOC 2E2IJ 9ANTA 2MW8A 1EF4A 5M5WJ 4A3FJ 1DU6A 5FKMA 5IOYA 1W0UA 3H0GJ 1U78A 4AYBN 5C44J 1K61A 1ORKA 1JUMA 2JN6A 2MSYA 2FD5A 5K7ZA 4CYCA 4A3MJ 4L5EA 1ZR2A 4FTHA 1HLVA 2O8KA 1ETKA 2DA5A 3LSPA 1AKHB 3S2HJ 4BKXA 2KT0A 1T33A 2X48A 2ECCA 3PO3J 2JK3A 3GTKJ 4A3GJ 4BY1J 1VF9A 3GTPJ 4IHXA 1RESA 2WAQN 5IP7J 4B1RA 1FEXA 4DZJA 1E3OC 3ZOBA 2HDDA 1A6IA 3BR6A 2MGQA 1Y1WJ 1WH5A 3MN2A 2CU7A 1GVDA 4QSHA 1ETOA 1AU7A 2GBYA 3BR0A 2DA7A 2E2HJ 3M3YJ 2IAIA 1ETWA 2PMZN 4M3GA 4V2FA 5FLMJ 1GT0C 3JRIA 3JRGA 1JTYA 2R5YA 3BR2A 5FKOA 2AO9A 1B72A 4IEJA 2R0QC 3CMYA 1K83J 1ITYA 1G2HA 4XRMA 2VUMJ 3LNQA 1Q1VA 1WPKA 2FJ1A 2L7MP 1D5YA 1MSEC 3ZQIA 1ZR4A 3LSGA 2KDZA 4JX6A 1T56A 1QVUA 2XB5A 1MH3A 1APLC 1OCPA 3A02A 2LTPA 4B3AA 2E2JJ 2HOSA 5J3LA 5F0HA 5DS9A 2EZKA 2H8RA 4W97A 5EG0B 1XC5A 5M5XJ 2MG4A 4M3FA 1BW6A 5EZGA 3LSRA 2XRLA 2B63J 5F27A 4AC0A 4A3CJ 3HDDA 4DZPA 2M0CA 1JT0A 1I50J 3SDGA 1R9TJ 1HDDC 5J1RA 2K9NA 5EGOB 1ETXA 2TRTA 5FKKA 2TCTA 1MBHA 3LOCA 1MBFA 2DMTA 1SANA 1HOMA 1B8IB 4GFBA 3A01B 2LP0A 3Q0WA 2GM4A 3LSJA 4BBSJ 3HOYJ 1ETYA 3BTCA 5K7FA 2LR8A 5EF6A 3NARA 1H8AC 1F43A 2XPWA 2EBIA 3S1QJ 4MFEA 2NS7A 2L7ZA 4FCYA 3PO2J 1JKRC 2CQQA 3MKLA 3F0CA 3HKZN 4ABZA 2Y2ZA 1HF0A 2NVXJ 5F1JA 1WI3A 3SJMA 2R5ZB 2NOGA 2ID6A 4NDLA 2M8GX 4D7NA 2DA1A 1JTXA 4V2GA 1LE8A 1FIAA 1OJLA 3A03A 4I76A 1XS9A 2OF7A 4C2MJ 2DMPA 2NVQJ 3HBLA 2Y30A 3O8GA 4S0HB 1TWFJ 1FTTA 4A3JJ 2XGEA 2HI3A 2HOAA 3TW6A 2HOTA 2LFBA 4C3HJ 5IOZA 3S15J 2CUFA 2W48A 1X2MA 2R92J 1IJWC 2VKEA 2JA5J 1LFBA 5EDNA 1BA5A 2X6OA 1JUPA 3RKQA 2EZLA 3IH2A 4Y52J 3TEDA 4CYCB 2ZB9A 2M9HA 1RKWA 5HODA 1P7JA 1LFUP 2NVYJ 3FIWA 4HNVA 1IUFA 3CQZJ 3CCYA 1IV6A 1RPWA 1TWHJ 2K9QA 3HOWJ 2L0KA 1ZKGA 3Q0VA 2D5VA 3W6VA 1MBJA 2YU9J 1AHDP 1Z77A 2CRGA 4A93J 4DW6A 2P81A 5F0FA 5C4XJ 4C3JJ 2ME6A 1MNMC 1NTCA 1ETQA 5J1UA 1JJ8C 1WGXA 3JREA 1JKPC 4LOCA 2R93J 2E1OA 1RKTA 3HOZJ 4A3EJ 2R5YB 2X9DA 5DTDA 4M3BA 1B72B 3B6CA 2K40A 1GUUA 5F04A 5E3NA 2O7OA 3BR3A 1JJ6C 4JP0A 3G1MA 3BTIA 4D7MA 3BG9A 3FK7A 5C4JJ 1UHSA 4XRSG 3HB9A 3GTLJ 3QQAA 2HQ5A 3G1LA 5E3MA 3IV5A 4IHVA 3S17J 4UUSA 4W1UA 3JRHA 4J19A 2WB1N 3HM5A 1YRNA 5EG0A 2XSDC 1JKQC 3K2AA 3OSGA 1CQTA 3RZOJ 3S14J 5K7HA 5IPAA 5EYRA 5GPCA 3SFIA 3JRCA 2VI6A 3IH3A 3RZDJ 4M3EA 3GBGA 4FE7A 1HCRA 3IH4A 3GTGJ 2CQXA 2IEKA 3Q0UA 2ID3A 5FKNA 4RDUA 4XIDA 1NK2P 1TWAJ 3HOXJ 2VKVA 3S2DJ 1QVTA 2JMWA 3G1OA 2EZHA 4JX4A 4XRSA 1I6HJ 1PUFB 1ZQ3P 2H1KA 2DMUA 5F08A 1POGA 2GLOA 3GTJJ 1OCTC 1JGGA 2L7FP 3TP3A 5GP9A 3OSFA 3Q3SA 2LD5A 4BY7J 2ME0A 3CDLA 2R5ZA 3M4OJ 5M3MJ 2VPRA 1GV5A 3FKIJ 4G12A 4RBOA 4Y7NJ 4BXXJ 3ZQGA 3TW7A 3S1NJ 5IYBJ 2K9SA 3WHBA 1TWCJ 3S16J 5M5YJ 1H88C 1QRYA 3MVPA 2DTZA 2Y9ZA 3H3VK 1XG1A 3PM1A 3E7LA 3OIOA 1FIPA 3DCFA 1GDTA 5GPAA 2WV1A 1ETVA 1LE8B 3JRBA 2AHQA 2DA4A 4I6ZA 2JA6J 2Y9YA 2LKXA 2R7ZJ 4MLOA 4A69C 3OOUA 4D5FA 3DEWA 4MO7A 1AKHA 2COBA 2Y0SN 5FLVA 5F0CA 3HOVJ 3BTLA 1VNDA 3HOUJ 2DA6A 2XPUA 3VPRA 3BTJA 2LK2A 5BNGA 2JJ7A 2NS8A 1W0TA 2CJJA 2XB0X 2YUSA 3D1NI 1Z0XA 2DJNA 2QF7A 3HEFA 3QPLA 2LVSA 2HXIA 3FISA 4AUXA 2ELKA 3L1PA 2HYJA 4BBRJ 3UKGA 3ZQLA 2DA3A 4X1EA 5IYDJ 4QTRA 4D5CA 3S1RJ 2LLKA 3FK6A 1IDYA 5JLXA 1U9NA 4X6AJ 2RAEA 2EQRA 3JRFA 1IC8A 1WH7A 3HGYA 1FJLA 4A3DJ 2FX0A 3BR5A 1VI0A 2JA7J 3JR9A 4XICA 1X2NA 4A3KJ 3HGGA 1NK3P 4A3LJ 1RR7A 1ZTRA 3JRAA 2EH3A 2YS9A 3BQYA 4QIWN 3S1MJ 4FE4A 1ZGWA 2DN0A 4MFDA 5JLWA 1JUSA 5FJ8J 3GTOJ 2NVTJ 3GTQJ 4XK4A 4B4CA 2EZIA 3BG3A 3B6AA 2M2EA 1BL0A 1DU0A 4A3IJ 2FQ4A 2L9RA 2XGCA 5EEAA 4IHWA 4A3BJ 1SFOJ 1UG2A 5IYCJ 1F36A 3TP0A 1VFCA 3I4MJ 4UUTA 5IP9J 2G0EA 3ZQFA 4UUSB 1MH4A 5IP6A 5EGOA 3GTMJ 1YRNB 1FTZA 1JT6A 5FKLA 3NAUA 4JX5A 1WCMJ 4EEFG 1TC3C 3BT9A 1RETA 4JYKA 1B8IA 1BJZA 1QPIA 1MSFC 3A01A 5M3FJ 1IDZA 2JWTA 5E3OA 2E19A 1IG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBK A;  1HDP A;  2ECB A;  4M6V A;  3RQI A;  3K7A J;  4M3D A;  4C3I J;  1U8B A;  2IBD A;  3JRD A;  1PUF A;  2M34 A;  3C2B A;  1BW5 A;  1H89 C;  2I10 A;  3I4N J;  4IHY A;  2Y31 A;  4MIM A;  2O9L A;  3BG5 A;  1TWG J;  1U9O A;  2DMN A;  3O8H A;  1Y1V J;  1MBE A;  1ENH A;  4DYR A;  5E3L A;  3BQZ A;  2JA8 J;  1IGN A;  5J1Y A;  1UMQ A;  2N8G A;  1X58 A;  2XGD A;  1OFC X;  2DA2 A;  1A5J A;  2CUE A;  1O4X A;  3ZQH A;  4DYQ A;  2LY9 A;  5EZH A;  1IRZ A;  1MBG A;  2QCO A;  3BR1 A;  1S7E A;  4FIS A;  3WHC A;  1P7I A;  1ZK8 A;  5C3E J;  2DMQ A;  1GV2 A;  2XPV A;  1I3Q J;  2OPT A;  3QPS A;  2HXO A;  3ZQC A;  4DYC A;  1JKO C;  2E2I J;  9ANT A;  2MW8 A;  1EF4 A;  5M5W J;  4A3F J;  1DU6 A;  5FKM A;  5IOY A;  1W0U A;  3H0G J;  1U78 A;  4AYB N;  5C44 J;  1K61 A;  1ORK A;  1JUM A;  2JN6 A;  2MSY A;  2FD5 A;  5K7Z A;  4CYC A;  4A3M J;  4L5E A;  1ZR2 A;  4FTH A;  1HLV A;  2O8K A;  1ETK A;  2DA5 A;  3LSP A;  1AKH B;  3S2H J;  4BKX A;  2KT0 A;  1T33 A;  2X48 A;  2ECC A;  3PO3 J;  2JK3 A;  3GTK J;  4A3G J;  4BY1 J;  1VF9 A;  3GTP J;  4IHX A;  1RES A;  2WAQ N;  5IP7 J;  4B1R A;  1FEX A;  4DZJ A;  1E3O C;  3ZOB A;  2HDD A;  1A6I A;  3BR6 A;  2MGQ A;  1Y1W J;  1WH5 A;  3MN2 A;  2CU7 A;  1GVD A;  4QSH A;  1ETO A;  1AU7 A;  2GBY A;  3BR0 A;  2DA7 A;  2E2H J;  3M3Y J;  2IAI A;  1ETW A;  2PMZ N;  4M3G A;  4V2F A;  5FLM J;  1GT0 C;  3JRI A;  3JRG A;  1JTY A;  2R5Y A;  3BR2 A;  5FKO A;  2AO9 A;  1B72 A;  4IEJ A;  2R0Q C;  3CMY A;  1K83 J;  1ITY A;  1G2H A;  4XRM A;  2VUM J;  3LNQ A;  1Q1V A;  1WPK A;  2FJ1 A;  2L7M P;  1D5Y A;  1MSE C;  3ZQI A;  1ZR4 A;  3LSG A;  2KDZ A;  4JX6 A;  1T56 A;  1QVU A;  2XB5 A;  1MH3 A;  1APL C;  1OCP A;  3A02 A;  2LTP A;  4B3A A;  2E2J J;  2HOS A;  5J3L A;  5F0H A;  5DS9 A;  2EZK A;  2H8R A;  4W97 A;  5EG0 B;  1XC5 A;  5M5X J;  2MG4 A;  4M3F A;  1BW6 A;  5EZG A;  3LSR A;  2XRL A;  2B63 J;  5F27 A;  4AC0 A;  4A3C J;  3HDD A;  4DZP A;  2M0C A;  1JT0 A;  1I50 J;  3SDG A;  1R9T J;  1HDD C;  5J1R A;  2K9N A;  5EGO B;  1ETX A;  2TRT A;  5FKK A;  2TCT A;  1MBH A;  3LOC A;  1MBF A;  2DMT A;  1SAN A;  1HOM A;  1B8I B;  4GFB A;  3A01 B;  2LP0 A;  3Q0W A;  2GM4 A;  3LSJ A;  4BBS J;  3HOY J;  1ETY A;  3BTC A;  5K7F A;  2LR8 A;  5EF6 A;  3NAR A;  1H8A C;  1F43 A;  2XPW A;  2EBI A;  3S1Q J;  4MFE A;  2NS7 A;  2L7Z A;  4FCY A;  3PO2 J;  1JKR C;  2CQQ A;  3MKL A;  3F0C A;  3HKZ N;  4ABZ A;  2Y2Z A;  1HF0 A;  2NVX J;  5F1J A;  1WI3 A;  3SJM A;  2R5Z B;  2NOG A;  2ID6 A;  4NDL A;  2M8G X;  4D7N A;  2DA1 A;  1JTX A;  4V2G A;  1LE8 A;  1FIA A;  1OJL A;  3A03 A;  4I76 A;  1XS9 A;  2OF7 A;  4C2M J;  2DMP A;  2NVQ J;  3HBL A;  2Y30 A;  3O8G A;  4S0H B;  1TWF J;  1FTT A;  4A3J J;  2XGE A;  2HI3 A;  2HOA A;  3TW6 A;  2HOT A;  2LFB A;  4C3H J;  5IOZ A;  3S15 J;  2CUF A;  2W48 A;  1X2M A;  2R92 J;  1IJW C;  2VKE A;  2JA5 J;  1LFB A;  5EDN A;  1BA5 A;  2X6O A;  1JUP A;  3RKQ A;  2EZL A;  3IH2 A;  4Y52 J;  3TED A;  4CYC B;  2ZB9 A;  2M9H A;  1RKW A;  5HOD A;  1P7J A;  1LFU P;  2NVY J;  3FIW A;  4HNV A;  1IUF A;  3CQZ J;  3CCY A;  1IV6 A;  1RPW A;  1TWH J;  2K9Q A;  3HOW J;  2L0K A;  1ZKG A;  3Q0V A;  2D5V A;  3W6V A;  1MBJ A;  2YU9 J;  1AHD P;  1Z77 A;  2CRG A;  4A93 J;  4DW6 A;  2P81 A;  5F0F A;  5C4X J;  4C3J J;  2ME6 A;  1MNM C;  1NTC A;  1ETQ A;  5J1U A;  1JJ8 C;  1WGX A;  3JRE A;  1JKP C;  4LOC A;  2R93 J;  2E1O A;  1RKT A;  3HOZ J;  4A3E J;  2R5Y B;  2X9D A;  5DTD A;  4M3B A;  1B72 B;  3B6C A;  2K40 A;  1GUU A;  5F04 A;  5E3N A;  2O7O A;  3BR3 A;  1JJ6 C;  4JP0 A;  3G1M A;  3BTI A;  4D7M A;  3BG9 A;  3FK7 A;  5C4J J;  1UHS A;  4XRS G;  3HB9 A;  3GTL J;  3QQA A;  2HQ5 A;  3G1L A;  5E3M A;  3IV5 A;  4IHV A;  3S17 J;  4UUS A;  4W1U A;  3JRH A;  4J19 A;  2WB1 N;  3HM5 A;  1YRN A;  5EG0 A;  2XSD C;  1JKQ C;  3K2A A;  3OSG A;  1CQT A;  3RZO J;  3S14 J;  5K7H A;  5IPA A;  5EYR A;  5GPC A;  3SFI A;  3JRC A;  2VI6 A;  3IH3 A;  3RZD J;  4M3E A;  3GBG A;  4FE7 A;  1HCR A;  3IH4 A;  3GTG J;  2CQX A;  2IEK A;  3Q0U A;  2ID3 A;  5FKN A;  4RDU A;  4XID A;  1NK2 P;  1TWA J;  3HOX J;  2VKV A;  3S2D J;  1QVT A;  2JMW A;  3G1O A;  2EZH A;  4JX4 A;  4XRS A;  1I6H J;  1PUF B;  1ZQ3 P;  2H1K A;  2DMU A;  5F08 A;  1POG A;  2GLO A;  3GTJ J;  1OCT C;  1JGG A;  2L7F P;  3TP3 A;  5GP9 A;  3OSF A;  3Q3S A;  2LD5 A;  4BY7 J;  2ME0 A;  3CDL A;  2R5Z A;  3M4O J;  5M3M J;  2VPR A;  1GV5 A;  3FKI J;  4G12 A;  4RBO A;  4Y7N J;  4BXX J;  3ZQG A;  3TW7 A;  3S1N J;  5IYB J;  2K9S A;  3WHB A;  1TWC J;  3S16 J;  5M5Y J;  1H88 C;  1QRY A;  3MVP A;  2DTZ A;  2Y9Z A;  3H3V K;  1XG1 A;  3PM1 A;  3E7L A;  3OIO A;  1FIP A;  3DCF A;  1GDT A;  5GPA A;  2WV1 A;  1ETV A;  1LE8 B;  3JRB A;  2AHQ A;  2DA4 A;  4I6Z A;  2JA6 J;  2Y9Y A;  2LKX A;  2R7Z J;  4MLO A;  4A69 C;  3OOU A;  4D5F A;  3DEW A;  4MO7 A;  1AKH A;  2COB A;  2Y0S N;  5FLV A;  5F0C A;  3HOV J;  3BTL A;  1VND A;  3HOU J;  2DA6 A;  2XPU A;  3VPR A;  3BTJ A;  2LK2 A;  5BNG A;  2JJ7 A;  2NS8 A;  1W0T A;  2CJJ A;  2XB0 X;  2YUS A;  3D1N I;  1Z0X A;  2DJN A;  2QF7 A;  3HEF A;  3QPL A;  2LVS A;  2HXI A;  3FIS A;  4AUX A;  2ELK A;  3L1P A;  2HYJ A;  4BBR J;  3UKG A;  3ZQL A;  2DA3 A;  4X1E A;  5IYD J;  4QTR A;  4D5C A;  3S1R J;  2LLK A;  3FK6 A;  1IDY A;  5JLX A;  1U9N A;  4X6A J;  2RAE A;  2EQR A;  3JRF A;  1IC8 A;  1WH7 A;  3HGY A;  1FJL A;  4A3D J;  2FX0 A;  3BR5 A;  1VI0 A;  2JA7 J;  3JR9 A;  4XIC A;  1X2N A;  4A3K J;  3HGG A;  1NK3 P;  4A3L J;  1RR7 A;  1ZTR A;  3JRA A;  2EH3 A;  2YS9 A;  3BQY A;  4QIW N;  3S1M J;  4FE4 A;  1ZGW A;  2DN0 A;  4MFD A;  5JLW A;  1JUS A;  5FJ8 J;  3GTO J;  2NVT J;  3GTQ J;  4XK4 A;  4B4C A;  2EZI A;  3BG3 A;  3B6A A;  2M2E A;  1BL0 A;  1DU0 A;  4A3I J;  2FQ4 A;  2L9R A;  2XGC A;  5EEA A;  4IHW A;  4A3B J;  1SFO J;  1UG2 A;  5IYC J;  1F36 A;  3TP0 A;  1VFC A;  3I4M J;  4UUT A;  5IP9 J;  2G0E A;  3ZQF A;  4UUS B;  1MH4 A;  5IP6 A;  5EGO A;  3GTM J;  1YRN B;  1FTZ A;  1JT6 A;  5FKL A;  3NAU A;  4JX5 A;  1WCM J;  4EEF G;  1TC3 C;  3BT9 A;  1RET A;  4JYK A;  1B8I A;  1BJZ A;  1QPI A;  1MSF C;  3A01 A;  5M3F J;  1IDZ A;  2JWT A;  5E3O A;  2E19 A;  1IG7 A; 
#chains in the Genus database with same CATH topology
 1HDP A;  3R61 A;  4M6V A;  3M8J A;  4RS8 A;  3S8P A;  4C3I J;  4B09 A;  1DPR A;  1ULY A;  3JRD A;  3H0D A;  1VQ7 I;  2K7L A;  2M34 A;  2EV6 A;  1YYV A;  4KIS A;  3OYH A;  1H89 C;  2I10 A;  3ZMD A;  3PUB A;  4F3Q A;  2FBH A;  2KDO A;  1IN7 A;  3H92 A;  3ASO H;  1ENH A;  1G8X A;  1IRF A;  4PFP A;  4XLP F;  3E97 A;  1X58 A;  2XGD A;  2DA2 A;  3DTI A;  2Q1Z B;  3GX4 X;  2X1D A;  4LG0 A;  3LA7 A;  4XR6 A;  4G94 A;  1O4X A;  3O3K A;  5EZH A;  3QOP A;  3RSN A;  2QCO A;  1J2X A;  1S7E A;  3F8F A;  5LHH A;  3DFG A;  3W2A A;  4E4H A;  2ZNZ A;  1T0F C;  5HNF A;  1ZK8 A;  2VT3 A;  2DMQ A;  4IOA F;  1MZB A;  1GV2 A;  2XPV A;  1TZL A;  2QUF A;  3BWG A;  3QPS A;  4DYC A;  1J7K A;  2DK8 A;  4KMU X;  1KZH A;  5FKM A;  1QZE A;  4AYB N;  1YW7 A;  3IL2 A;  2JSP A;  3IC7 A;  2A07 F;  2DOE A;  5LD2 C;  4E7K A;  4CCJ A;  4CYC A;  2MSY A;  2JSC A;  3RDI A;  3KYL A;  3RI4 A;  1ZR2 A;  3PQK A;  3S3N A;  1VQ8 I;  4HOB A;  2O8K A;  1Y0N A;  1D5V A;  2DPU A;  1AKH B;  4R1H A;  2O0Y A;  4HX8 A;  5J8C A;  1NG6 A;  2ECC A;  2V79 A;  3WU0 A;  4IX7 A;  2EV0 A;  3LSK A;  1VF9 A;  2DPD A;  4IHX A;  1RES A;  2OC6 A;  4WK8 F;  1B1B A;  1Z7U A;  3EYY A;  2HDD A;  1YJ9 I;  1MJA A;  2O03 A;  1WH5 A;  1BM9 A;  4IL6 C;  3DBR B;  1K4S A;  4O5V A;  2PLY A;  4LGW A;  2A6H F;  3E1S A;  3CC7 I;  1E3H A;  2DA7 A;  2BOL A;  1ETW A;  2WWY A;  1G3Y A;  2PN6 A;  1P2F A;  1XTA A;  4DQ2 A;  1V4R A;  3KZI C;  3RCO A;  3BR2 A;  3KEO A;  5FKO A;  1B72 A;  2ACJ A;  3CMY A;  2H94 A;  3GZ5 A;  3A2K A;  1ITY A;  2XRN A;  4XSX F;  2DBB A;  3MZ8 A;  2ZJR F;  2G9W A;  4N0B A;  2FJ1 A;  2L7M P;  3ZMZ A;  4YFN F;  1XD7 A;  1FBU A;  4AIK A;  1BIA A;  4PGH A;  2XB5 A;  2Z16 A;  5KNL A;  4N9I A;  4RM3 A;  1APL C;  2HDW A;  3BRO A;  3ZMU A;  4JOM A;  1BI1 A;  3WGH A;  3L2U A;  2M5W A;  2E2J J;  3CCQ I;  5LEK A;  3K4N A;  5DS9 A;  1RUO A;  1SMY F;  3B73 A;  5CLS A;  2M3A A;  5F27 A;  4IQJ A;  2Z5U A;  1R5I D;  4I7H A;  1JT0 A;  5GAH J;  3D5R C;  4EMS A;  1R4M B;  3LFU A;  4BQN A;  1HDD C;  2JRT A;  4F7Z A;  2DTR A;  3GYH X;  5HDN A;  1XN7 A;  2HKO A;  1Z3X A;  2HZT A;  3CCU I;  2VOP A;  3Q0W A;  4MQ9 F;  4BBS J;  1ETY A;  2CWE A;  4RM2 A;  4BU2 A;  2LR8 A;  3QU6 A;  4ZZL A;  1PUE E;  2XPW A;  3MZY A;  3S1Q J;  1BI2 A;  1U2W A;  3GLL A;  2XRO A;  3MD2 A;  3COA C;  3VFZ A;  4FCY A;  3OR1 C;  3VEP A;  4Q47 A;  3IRQ A;  3SFZ A;  4LIT A;  3VSL A;  1SVO A;  1MD0 A;  3HYI A;  3K10 A;  1GHC A;  1KU2 A;  5F1J A;  1FP2 A;  2BXZ A;  1MND A;  3VOE A;  2IVM A;  4D7N A;  1CF7 B;  1FIA A;  1ZGA A;  5KAI C;  4S04 A;  1KON A;  4OIP F;  1WJF A;  1F5T A;  4DBR A;  2OF7 A;  1SFE A;  2P0W A;  2NVQ J;  3HBL A;  3O8G A;  3HSR A;  2FMY A;  1HW5 A;  1OCR H;  2XV4 S;  2DO7 A;  1EV7 A;  2VBX A;  2HOT A;  2VLA A;  4U7B A;  3J7Z I;  3V8K A;  4C3H J;  1Z67 A;  3T0Y A;  3BZ6 A;  4CUG A;  2CUF A;  1X4P A;  3PL8 A;  4KN4 X;  3HRT A;  2R92 J;  2XC7 A;  2VBY A;  3OYB A;  2TDX A;  5FGM A;  3HTU A;  1Y39 A;  3OY9 A;  1K6O A;  4M6Y A;  1XMX A;  4KA4 A;  4HF0 A;  3RKQ A;  2ZXJ A;  3IH2 A;  2L9S A;  3AKZ A;  3TED A;  4Q48 A;  2DW4 A;  5KAF C;  4OU0 A;  1RKW A;  4HZF A;  1Z9C A;  1P7J A;  4BXU A;  4LLN A;  3V7S A;  2L3D A;  2KRF A;  2JQ7 A;  2R7D A;  2ZCW A;  4WCG A;  4K2E A;  3TO9 A;  5ICE A;  5CPR B;  1TWH J;  3C3W A;  2PG4 A;  2HVQ A;  3C2H A;  1MW7 A;  2DFI A;  3CLO A;  2HQA A;  2L4A A;  1B59 A;  3RIR A;  3W6V A;  1Y6I A;  2VJ5 A;  2ETH A;  4XM3 A;  5HS7 A;  3AG3 H;  4DW6 A;  5C4X J;  3C18 A;  4PSX A;  4NB5 A;  4JBA A;  3FXQ A;  5F6F A;  1OMI A;  4CZC A;  2DOA A;  3KP4 A;  2ESH A;  2OTJ I;  1ETQ A;  5J1U A;  4NHJ A;  3U1K A;  1JJ8 C;  5A2Q Z;  1G3W A;  3WOD F;  2HPM A;  1RKT A;  4P1W A;  4ZJZ A;  3HOZ J;  1WJA A;  2X9D A;  2XAQ A;  2K40 A;  2O8X A;  2E5Z A;  1B72 B;  2HDC A;  3BR3 A;  1JJ6 C;  3HIF A;  3G1M A;  3WE2 A;  3MCZ A;  1OLT A;  5AIP A;  3K2Z A;  5L3F A;  1FYM A;  2HQR A;  2RDP A;  2H09 A;  4HNU A;  2EIL H;  3RKW A;  4GGG A;  4UUS A;  4II2 A;  3HM5 A;  3ZGK A;  2KZV A;  4GDF A;  1KQ0 A;  2XSD C;  1MDM B;  1DQU A;  2R7O A;  2LG4 A;  2XKP A;  1FY7 A;  4CCL A;  3CJN A;  5K7H A;  1V3F A;  3SFI A;  4AVZ A;  5HS8 A;  3QRF F;  2LMD A;  5J4Y A;  1IF1 A;  1BIB A;  2VI6 A;  2VN2 A;  5H2F C;  5ED4 A;  2M4K A;  3F72 A;  4MEY F;  4M3E A;  3GBG A;  2BV6 A;  5ERI A;  3QPT A;  1VQN I;  4I98 B;  4IXA A;  3GTG J;  4KUM A;  2VKD A;  2JPB A;  5CQE A;  1G3T A;  2CQX A;  2IEK A;  4AU7 A;  4U0Y A;  3AAF A;  3Q0U A;  2K27 A;  4U0W A;  2HVS A;  2ID3 A;  1XGN A;  5HNH A;  4XKC A;  2LBF A;  1J75 A;  2ZNY A;  3AG4 H;  3S2D J;  2F4I A;  2O61 A;  4XRS A;  4HV5 A;  1FC3 A;  3HOT A;  1W7P D;  1PDN C;  1U6G A;  2A5W A;  2M8E A;  2O5R A;  1MNE A;  2VXZ A;  1HQC A;  2MYS A;  4P55 A;  2LKS A;  3Q9V A;  3VYT B;  2FF4 A;  1JHF A;  2JUC A;  3TDU C;  1VQO I;  2OA4 A;  3EPZ A;  3TP3 A;  4PDK A;  3Q3S A;  1U5T B;  4S05 A;  3ULQ B;  2LD5 A;  2VQG A;  2ISY A;  3CDL A;  3M4O J;  5M3M J;  2VPR A;  4PZJ A;  5KCM A;  1LB2 A;  4Y7N J;  1FYK A;  4OIN F;  2A61 A;  3WHB A;  1H88 C;  1T6S A;  2DXI A;  2DTZ A;  1XMA A;  2Y9Z A;  3H3V K;  4UHT A;  1AOY A;  1YQA A;  1XG1 A;  2MA3 A;  3OYL A;  3E7L A;  1MJ9 A;  1LQ1 A;  4HBL A;  2WV1 A;  1K7A A;  2DA4 A;  1W4M A;  1U0J A;  4QWQ A;  5JVG F;  3DBH B;  2L54 A;  4IKF A;  4MLO A;  3K6G A;  1L0O C;  1IXS B;  3DEW A;  4ZYE A;  5K5R A;  2Y0S N;  2BY2 A;  3LSH A;  2Q8K A;  2ICW G;  3LA2 A;  4CGZ A;  2BY1 A;  1UG0 A;  2CFO A;  3H5N A;  5FRN A;  1E2X A;  5HLT A;  2XAG A;  1XB4 A;  3VPR A;  2QA4 I;  2LK2 A;  3QYE A;  2LYC A;  2D2W A;  5BNG A;  3SYT A;  2QBY B;  1W0T A;  3P9I A;  2CJJ A;  2CUJ A;  3K4L A;  3R0A A;  3QP5 A;  2GA1 A;  2YUS A;  1BI3 A;  2F48 A;  3CDH A;  2LVS A;  1XGM A;  3F22 A;  1ZRC A;  2ELJ A;  2DDB A;  3DF8 A;  1Z21 A;  3F8N A;  2FNP A;  2IGN A;  2K4J A;  2V7F A;  4X1E A;  4QTR A;  4D5C A;  2DFE A;  4EAT A;  2LLK A;  4ZYH A;  2WTE A;  3QPH A;  2PQ8 A;  5BS6 A;  1IRG A;  4IRH A;  4UUV A;  1FJL A;  4A3D J;  2FX0 A;  2LY2 A;  3JR9 A;  4YIR X;  1BOB A;  2IGO A;  1LNW A;  3OYA A;  2X1E A;  4A3K J;  5D5U B;  2E1M C;  3WTT C;  2V1N A;  5DCM A;  1ZYR F;  3H36 A;  1KU9 A;  1ZTR A;  2NS0 A;  3JRA A;  1YX3 A;  1W5C C;  3L00 A;  3BQY A;  4EQQ A;  3S1M J;  5GAE J;  5JI6 A;  1STZ A;  5JR3 A;  2JTV A;  1J09 A;  3CP8 A;  2HNH A;  1TNS A;  3DU6 A;  2NVT J;  3GTQ J;  1R58 A;  4PGG A;  2OBP A;  3DQV C;  1BL0 A;  1OR7 A;  3QU3 A;  3P9C A;  5DUI A;  5FRM A;  3FXR A;  4A3I J;  3LSM A;  3DEU A;  4HYE A;  1OKR A;  2MBF A;  5A2Q K;  4A3B J;  2J5O A;  2MLK A;  4R79 A;  1UFM A;  1UZC A;  4H4K C;  4QPO A;  1F36 A;  2X1C A;  3JW4 A;  4PJJ A;  3I4M J;  2ZXH A;  5IP9 J;  4E7L A;  4PUS A;  1FNN A;  5EGO A;  1R7J A;  2ZBK A;  3ZRG A;  2CGP A;  5CYV A;  1YRN B;  1IV8 A;  1JT6 A;  3OYK A;  3TMO A;  1FTZ A;  5E20 A;  1WVR A;  3DXJ F;  4NQW A;  2AQF A;  4XKV A;  3FZV A;  5F64 A;  3BT9 A;  4LD5 A;  2LC2 A;  1B8I A;  1TC3 C;  4RGX A;  3A01 A;  4QPQ A;  2I5U A;  3BJ6 A;  1X3W B;  4F93 B;  2ZSI B;  3LL7 A;  3JCU C;  3K7A J;  4AYB A;  5DDG A;  2IBD A;  3MEX A;  2XAH A;  1K79 A;  2IS6 A;  2W82 A;  3DKW A;  2L9V A;  1R00 A;  2RC4 A;  3C2B A;  3IWZ A;  3I4N J;  5AIQ A;  4IHY A;  4O3M A;  3I71 A;  2JA8 J;  3BQZ A;  4BEH A;  3VYU B;  4EGZ A;  2VB6 A;  3ECH A;  3H9J A;  5J1Y A;  4BH9 A;  2JT1 A;  2WBM A;  2CUE A;  1ZEL A;  5LHI A;  4UV9 A;  3AL0 C;  3I64 A;  4OIO F;  4CDG A;  3WTS C;  2BHZ A;  2P7C B;  5GAD J;  3A1Y A;  2QVO A;  3CO7 C;  5D5X B;  5C3E J;  2R7U A;  5HDK A;  2K02 A;  3PIO F;  2CV0 A;  3OYD A;  2CQK A;  1I3Q J;  1QNT A;  1B9M A;  3VSK A;  2FNA A;  4XKW A;  3WTW C;  4LJZ F;  1AA7 A;  2QEX I;  1HA8 A;  9ANT A;  2MW8 A;  4L9J A;  5M5W J;  1KYW A;  5H6Q A;  5IT9 Z;  5IOY A;  1QBJ A;  3H0G J;  4Q5S F;  5H6R A;  4GYG A;  2VON A;  2R7W A;  2V9V A;  1K78 A;  5HS9 A;  2KIQ A;  4KJZ A;  1R22 A;  2L2O A;  1WJD A;  3WU1 B;  4FTH A;  4ENK A;  2UV1 A;  5BOX A;  1ETK A;  1Y8R B;  2IPQ X;  2DA5 A;  4BJT A;  4OIR F;  4EV0 A;  1I5Z A;  2PJP A;  4L18 B;  4DOZ A;  2QBY A;  4L0Y B;  1T33 A;  2X48 A;  4BGD A;  3U9G A;  3GTK J;  3GTP J;  3C7J A;  4WXH A;  1TQP A;  4B1R A;  2V6C A;  3ABL H;  1FEX A;  1Y1W J;  4J01 A;  2CU7 A;  2WB1 A;  4QSH A;  2VBZ A;  1ETO A;  3K0L A;  5DEQ A;  2ADU A;  3I54 A;  2Q0O A;  1AU7 A;  2NYX A;  3NWT A;  3M3Y J;  4V2F A;  2GQQ A;  2OCC H;  4ZDL A;  3HPG A;  3JRG A;  2R5Y A;  3OL3 A;  2R0Q C;  2EPF A;  2MFZ A;  1VQ6 I;  2K3P A;  4XRM A;  3J7Y J;  3ONQ A;  4IRI A;  2RKH A;  4B8X A;  2ZME C;  4HAM A;  2KIM A;  4G6Q A;  4XOR A;  4I0B A;  3TOB A;  1D5Y A;  1MSE C;  3ZQI A;  3PSI A;  4G9Y A;  5D5W B;  4HF2 A;  5BQT A;  2JPC A;  5JVT A;  1VQK I;  1SAU A;  4B3A A;  4MNU A;  2HOS A;  5JFR A;  5F0H A;  5FLX Z;  3ELK A;  5EG0 B;  1OYI A;  5M5X J;  1R6R A;  3LSR A;  4AIH A;  2RGV A;  2GZW A;  1H9T A;  2BGC A;  4ZDP A;  3V8L A;  4A3C J;  2VJ4 A;  2K4B A;  1W1W E;  5HLH A;  3QAH A;  3KE2 A;  4E7S A;  1RUN A;  4RLQ A;  4XLN F;  4I0A A;  1W36 D;  1OPC A;  2B7E A;  4G6D A;  4FX4 A;  1MBF A;  1BC7 C;  1RRJ A;  3C2G A;  1ODD A;  2LP0 A;  3VB2 A;  3E5U A;  1N77 A;  1N25 A;  3FDY A;  1BJA A;  4KIF A;  3BTC A;  4ZDO A;  1S3J A;  4KIB A;  3CCJ I;  1F43 A;  2EBI A;  1SFU A;  4EM0 B;  1QGP A;  3G73 A;  3PO2 J;  2IA0 A;  2CQQ A;  3MKL A;  5F1R A;  3F0C A;  2XF6 A;  4G7Z F;  5CVJ A;  2EIJ H;  5L3B A;  1TW2 A;  2HPI A;  1HF0 A;  2NVX J;  4DIQ A;  5JHF A;  3V8J A;  1KQ9 A;  2R5Z B;  2NOG A;  3GXO A;  1T95 A;  2B0L A;  1S5L C;  1XSV A;  4NDL A;  4HSR A;  2K5C A;  1VTN C;  5E18 F;  4V2G A;  2HTJ A;  3DP7 A;  1LE8 A;  1ONV A;  3L2C A;  2P6S A;  1HXD A;  2HYF A;  1YIJ I;  2PMU A;  2DMP A;  4IHT A;  4BHB A;  2CH0 A;  3L2W A;  4S0H B;  5D6E A;  4Y15 A;  3TO6 A;  4RB2 C;  2JUG A;  3DBL B;  2LFB A;  4BDY A;  4YEJ A;  3OL4 A;  3HHG A;  3JSO A;  2NOJ B;  3ZXS A;  4GCV A;  3SEQ A;  3V4G A;  2RNJ A;  2E35 A;  4G8X A;  1D0X A;  1BA5 A;  5DV5 A;  5ICF A;  4EJU A;  4E7I A;  4BAY A;  4AM3 A;  4LB5 A;  4Y52 J;  2K86 A;  2H6B A;  2R7T A;  2AQE A;  2OUM A;  2Z99 A;  4MTE A;  3ABK H;  1UHM A;  3DU5 A;  5HOD A;  2UUZ A;  5IT9 K;  4MTD A;  3G6E I;  5LGN A;  3VWB A;  1GXQ A;  2RN7 A;  4LK0 F;  5DYM A;  4J00 A;  2BVL A;  3LSI A;  1D8J A;  3RQ4 A;  4BQO A;  4CA0 A;  2O6G E;  3IAM 2;  1ZKG A;  3NRV A;  4A2U A;  1C0W A;  1LUJ B;  3QOD A;  4CCO A;  1ZG1 A;  3RTR A;  1MBJ A;  4IF4 A;  2YU9 J;  2CRG A;  2NVU B;  2H27 A;  3J7A O;  4A93 J;  1XMK A;  3KP3 A;  1IN6 A;  5F0F A;  4C3J J;  2V1D A;  4YIF A;  2VE8 A;  2ME6 A;  1MNM C;  1BI0 A;  3KP2 A;  3GFJ A;  1VQ5 I;  2AS5 F;  2LY1 A;  3I56 I;  3WU2 C;  1FSE A;  3O6B B;  4HF1 A;  1QZZ A;  3RKX A;  1BBY A;  1WFX A;  1R36 A;  3MKZ A;  4A3E J;  5DTD A;  2HTS A;  3CDI A;  3J80 Z;  4V19 K;  2CW8 A;  3ESW B;  3SQN A;  4RAG A;  3MAJ A;  1TQM A;  3A4C A;  1FBS A;  4DNC A;  1DGW Y;  5BPI A;  4O6J A;  4CCN A;  4D7M A;  2DOD A;  4CZZ A;  1KYZ A;  2HS5 A;  3QQA A;  2YX7 A;  5ICC A;  5ILS A;  3OIP A;  3G1L A;  4IHV A;  3ZN0 A;  1YFH A;  3S17 J;  1Z6T A;  4J19 A;  2WB1 N;  3W6K B;  1G6N A;  5EG0 A;  5BPD A;  3ZQ7 A;  3BC8 A;  2HQN A;  3FXU A;  3OSG A;  4DGW B;  1CQT A;  1ZGJ A;  3S14 J;  5EYR A;  1QPM A;  2JRM A;  5D8L B;  2DQL A;  3CF2 A;  4RGS A;  1SEU A;  2EJR A;  1TBX A;  2FML A;  4N9H A;  4RAF A;  4A12 A;  4M9Z A;  2K3F A;  4ENN A;  2QQ8 A;  3KZZ A;  2KIU A;  2A69 F;  4E7H A;  3LQQ A;  5FKN A;  1ZLK A;  2Y48 A;  2IT0 A;  1MMN A;  2OZU A;  2GIV A;  5FD5 A;  4CH7 A;  2M45 A;  4JX4 A;  4QLC U;  3P5J A;  2Y0S A;  2IS4 A;  3CUQ B;  3E6C C;  1PUF B;  1JI8 A;  3DTE A;  2DK5 A;  5HDG A;  3LFK A;  3M7G A;  5IY5 H;  4CIC A;  2DMU A;  3W2W A;  1SD7 A;  4XLF A;  5F08 A;  2GLO A;  1FYL A;  3IRR A;  4Y4R A;  2LOO A;  3GTJ J;  4C30 A;  2L7F P;  3H9G A;  3FM5 A;  3QOE A;  1Z6R A;  3FXL A;  2XKO A;  4BY7 J;  2GIZ A;  4Q4Z F;  2ZJQ F;  2R5Z A;  1IN8 A;  2KFD A;  4G12 A;  4RBO A;  3Q9S A;  2XAF A;  4GYI A;  2Z9O A;  5EEG A;  2XUB A;  3PQJ A;  4RLF A;  3ML6 A;  3ZQG A;  4FAS D;  1G59 A;  2XSJ C;  4I01 A;  1XGS A;  2F4M B;  3LAJ A;  2Z33 A;  2WAQ A;  2K9S A;  2BZT A;  1FWZ A;  4ZZD A;  3CCL I;  1FIP A;  3DCF A;  4PJN A;  2MH9 A;  1HW2 A;  2KIS A;  5CVR A;  2QGU A;  1ETV A;  2QKL B;  2R7R A;  3DV8 A;  4I6Z A;  2EV5 A;  4II3 A;  4LLG F;  4Y33 A;  5CVI A;  5CVV A;  4MHG A;  1X1A A;  1B4A A;  1D1B A;  3CO6 C;  3OIQ A;  1W36 C;  1FT9 A;  3PUF A;  1AKH A;  5LFA A;  2STT A;  2W7N A;  1LPQ A;  3HOV J;  2QLZ A;  2FQ3 A;  2B9S A;  3FF5 A;  1GXP A;  3HOU J;  5B1A H;  3G71 I;  1TLH B;  2XPU A;  3BTJ A;  2X85 A;  4UB6 C;  5J4V A;  5HLG A;  2YX4 A;  1D3Y A;  1MKM A;  3OMY A;  2O3F A;  1RNL A;  1R5H A;  3CJQ B;  3PFY A;  3HG9 A;  3HEF A;  3QPL A;  2V9P A;  3WGG A;  2HXI A;  5ILU A;  3HJE A;  2P5L C;  2OV7 A;  2UXN A;  2HYJ A;  4BXF A;  3K4C A;  3G3Z A;  4M9S A;  3ZQL A;  3IKV A;  3KX2 A;  3T1B A;  1P6R A;  1YHQ I;  3SDB A;  3S1R J;  4BHC A;  2DLL A;  1IDY A;  2WA0 A;  4BQA A;  3L9F A;  4EJO A;  3JRF A;  2EQR A;  2OCE A;  3HC7 A;  4PJM A;  3I55 I;  1ZRD A;  3C1D A;  4HLX A;  2Z1D A;  2ZJ2 A;  2ZKZ A;  3HGY A;  5GAG J;  1VQP I;  4UXN A;  2F2E A;  3FXK A;  3LQR A;  2RV8 A;  3I59 B;  3LA3 A;  5K1Y A;  2CQN A;  1RR7 A;  2IS1 A;  1UEL B;  1O3T A;  3DWL E;  2XIG A;  2VQC A;  2YS9 A;  4QIW N;  2QSH X;  4FE4 A;  1ZGW A;  2DN0 A;  3KIO A;  1JUS A;  3CP2 A;  4XOP A;  3ZN1 A;  5L3E A;  5FJ8 J;  4ENJ A;  3GTO J;  3O2P E;  4CSW A;  2OAZ A;  2E60 A;  4XK4 A;  1MMG A;  4XOT A;  2QKM B;  3K4M A;  2EZI A;  1WWX A;  2FBI A;  3BG3 A;  5FFX A;  3TL4 X;  1KQ8 A;  5EEA A;  1X1C A;  1PVE A;  4XMY A;  1F9N A;  2Z3Y A;  4BJ6 C;  3IAS 2;  3J80 K;  3TP0 A;  2Y69 H;  4UUT A;  1FX7 A;  3HKZ A;  2CQ7 A;  1S9H A;  3EUA A;  1XCV A;  2VAS A;  2NNN A;  2WV0 A;  3NAU A;  2FEZ A;  2XVC A;  1J9I A;  4B43 A;  2L9N A;  3L2Q A;  3OR2 C;  4EEF G;  1RI7 A;  1U3E M;  1VZ0 A;  1RET A;  4JYK A;  1X1B A;  3WTZ A;  2HEO A;  1I3A A;  1IDZ A;  2JWT A;  3GFM A;  5E3O A;  1FLI A;  2E19 A;  2P7V B;  1ZAR A;  1MBK A;  2DT7 B;  2ECB A;  2KHM A;  3RQI A;  4YEL A;  1NH3 A;  2V1U A;  4M3D A;  3ZMV A;  1TT0 A;  2OZ6 A;  3HRS A;  3CUQ A;  1PUF A;  1HKQ A;  1MMA A;  3WE3 A;  5CJ9 A;  1KA8 A;  1NG7 A;  4MIM A;  2O9L A;  2W1O A;  1TWG J;  3MFK A;  1EH7 A;  1U9O A;  3KEQ A;  1BOA A;  1ZRF A;  4DYR A;  5E3L A;  1I39 A;  3KYD B;  2GWR A;  2J5P A;  1IGN A;  3I3L A;  2YPR A;  3EET A;  1UMQ A;  1SD5 A;  2QEN A;  1CF7 A;  2W84 A;  2YU3 A;  2FA5 A;  1A5J A;  2BY0 A;  3OYG A;  3ZQH A;  4DYQ A;  3G4S I;  2ZSH B;  4KFC A;  2P5V A;  1EKE A;  2KQR A;  3UNG C;  2ESN A;  1IRZ A;  2IJL A;  1CGP A;  1XSX A;  3FWE A;  5FRO A;  1JGS A;  1QZY A;  1YIT I;  1M1E B;  3WHC A;  4L5J A;  1LEA A;  2R7V A;  3S3M A;  4L9T A;  1A31 A;  3F6O A;  2VJJ A;  1LDK B;  3BPX A;  3ZQC A;  2OPT A;  1V5G A;  2EIM H;  3H9Q A;  4OMZ A;  1JKO C;  2ZXW H;  3SHF A;  2PJR B;  2VJI A;  5TIS C;  1EF4 A;  1JXS A;  2P4W A;  3OYI A;  1U78 A;  4N4N B;  1K61 A;  1ORK A;  2BYV E;  4BDZ A;  4KMF A;  4RB1 A;  5E1W A;  4BAC A;  4IVN A;  3ZQQ A;  2JN6 A;  1FOY A;  1YS7 A;  2FD5 A;  5K7Z A;  1HLV A;  3T8R A;  3BG7 A;  3GO5 A;  3TOA A;  3DLA A;  4XON A;  1X3U A;  3BJA A;  1J59 A;  2H8W A;  4ANJ A;  3S2H J;  1TL8 A;  3RJP A;  3CC4 I;  1T39 A;  1ZRE A;  2KT0 A;  4Y3O A;  5FB2 A;  3PO3 J;  1VQ4 I;  2JK3 A;  4BY1 J;  1W7P B;  2M0M A;  2WAQ N;  4PK4 A;  2Z2S B;  2DFF A;  2YSR A;  3HUG B;  3ZPL A;  3V42 A;  1YIO A;  1LFP A;  1WI9 A;  3R0J A;  4TV7 A;  4DZJ A;  1O3R A;  3BG6 A;  3ZOB A;  2W4S A;  4UVB A;  1X4O A;  4AID A;  5EJC A;  4ENM A;  2MGQ A;  1QHH D;  2W85 A;  3WG7 H;  4A0Z A;  3GF2 A;  3W6J B;  3KPH A;  3U21 A;  2GBY A;  5EEH A;  3BR0 A;  4RB0 A;  3GEZ A;  2A6T A;  4M9X A;  1GT0 C;  1EA3 A;  1I6X A;  1Z3Y A;  2OU2 A;  3CF5 F;  2QQA A;  1OCC H;  2R7S A;  1JTY A;  2OQG A;  2AO9 A;  3CD6 I;  4IEJ A;  2EFO A;  1K83 J;  3SZG A;  2IP2 A;  1WZ2 A;  3MKW B;  1G2H A;  5J6X A;  3E3V A;  2X6W A;  3M1E A;  1X1D A;  1Q1V A;  2JVH A;  1P4X A;  3FXO A;  3SEZ A;  1WPK A;  3RYR A;  1R1V A;  3EUH A;  2BE5 F;  1ZR4 A;  1MMD A;  5D6F A;  3LSG A;  4FT8 A;  2KDZ A;  3FXJ A;  2EFN A;  3M1C A;  4L9N A;  1MH3 A;  3W2V A;  1MDM A;  3R4K A;  3A02 A;  4M71 A;  4HDU A;  2LTP A;  2PMH A;  1OR7 C;  5K5Q A;  5JHU A;  4B3X A;  2ZFW A;  4IHS A;  1WKM A;  3PNY A;  5AON A;  5J3L A;  1LEB A;  3CJR B;  1UHW A;  1WJB A;  2EZK A;  2L7K A;  2KLO A;  2W24 A;  4W97 A;  5E8G A;  2H8R A;  2IS2 A;  4M74 A;  2MG4 A;  1K6Y A;  2K9M A;  4M3F A;  3HOS A;  2VPL A;  2Q2E B;  2QSF X;  2EK5 A;  1U8R A;  3RPQ A;  3K4B A;  1FSH A;  2MAB A;  1I50 J;  2F5D A;  5J47 A;  3OYM A;  5TGT A;  1R9T J;  4ZTF A;  5B5E C;  5J1R A;  3AG1 H;  2VL8 A;  4BUP A;  1S72 I;  4AWX B;  1MGT A;  2CUZ A;  2XF7 A;  4A0X A;  1MBH A;  2Y0M A;  3K69 A;  2JZY A;  4RMN A;  4KIC A;  4Y17 A;  3EUK L;  1YE9 A;  3W3C A;  2EFQ A;  3LSJ A;  4FHT A;  3HOY J;  3F8M A;  3GZN B;  3NAR A;  2LDU A;  4EGY A;  4HRI A;  4UY8 I;  1U5T A;  2AXT C;  5LEJ A;  2NS7 A;  2X6X A;  1SD6 A;  3KP6 A;  2F5E A;  1U5T C;  3HKZ N;  2F5F A;  3F21 A;  2Y2Z A;  4XBF A;  2DT5 A;  1QU3 A;  4MGR A;  1WI3 A;  3SJM A;  1WJ5 A;  4HPQ A;  2WAF A;  2ID6 A;  2L4M A;  1VQL I;  3ZP5 A;  2M8G X;  2QZ8 A;  4L0Z B;  2DA1 A;  3P7N A;  4LG0 B;  2M87 A;  5LGT A;  1OJL A;  3A03 A;  1V5F A;  4WXC A;  1XS9 A;  3ISP A;  1LDD A;  1IZ1 A;  2A6E F;  2EIK H;  4HLY A;  4BE2 A;  2Y30 A;  3E6D A;  2KMU A;  2FXA A;  2MD5 A;  1FTT A;  2ZFU A;  2HOA A;  3TW6 A;  1H9G A;  4NC7 A;  5IOZ A;  2PFB A;  1FMV A;  3S15 J;  2W48 A;  2VIX A;  1X2M A;  2MLG A;  3CLQ A;  3L09 A;  2WY7 Q;  4ZYA A;  2LSO A;  2HU9 A;  1F4K A;  1I1G A;  5EDN A;  2A68 F;  2E36 A;  2X6O A;  3U1D A;  3I58 A;  4CYC B;  4IOC F;  3I9V 2;  4EVI A;  3HUG A;  1LFU P;  4M73 A;  3FIW A;  5J40 A;  4KT6 A;  4KN7 X;  3CQZ J;  3V7C A;  1IV6 A;  1RPW A;  2K9Q A;  1T38 A;  1ON1 A;  3LWF A;  3F8B A;  1Q1H A;  3HOW J;  2L0K A;  1PYV A;  1XCB A;  2IA1 A;  3EYI A;  3Q0V A;  2D5V A;  1AWC A;  3WGI A;  4LIU A;  4YII A;  2VXD A;  4EM1 A;  2DI3 A;  1X3Z B;  3REO A;  2WY8 Q;  4XN0 A;  4AVP A;  4OAZ A;  3M9A A;  2MC4 A;  4UNO A;  1NTC A;  2KRH A;  3G2B A;  2W00 A;  4BNC A;  2D1H A;  2NNY A;  3M8E A;  4NUB A;  2MD0 A;  4NC8 A;  4D9J A;  1W5T A;  4LOC A;  3JRE A;  2R93 J;  2E1O A;  1X1P A;  3ROU A;  2ISZ A;  4HST A;  1B9N A;  2FE3 A;  4L9V A;  3FBI B;  3GZ6 A;  1NHA A;  3B6C A;  2QM3 A;  1WRJ A;  1SVM A;  1GUU A;  4ESF A;  1Y8Q B;  5E3N A;  3CCS I;  4H0E A;  3ABU A;  2EIN H;  1LKX A;  2E1N A;  3BTI A;  4BE1 A;  3HRM A;  3DPT A;  2QWW A;  5C4J J;  1UHS A;  4XQF A;  3SXY A;  3GTL J;  2L5Q A;  2HFH A;  2RRE A;  2COM A;  2HQ5 A;  3OV8 A;  2V1X A;  3BPV A;  4XL9 A;  5E3M A;  4ETS A;  3HPH A;  3IV5 A;  3S32 A;  4BL0 B;  2CMP A;  4HV6 A;  5L3C A;  1YRN A;  4KYW A;  4NC6 A;  3RZO J;  1ZH5 A;  4I99 C;  5IPA A;  3BJO A;  1A04 A;  2HGC A;  3J7A Y;  4XLA A;  3J81 Z;  3JRC A;  3IH3 A;  5FD6 A;  3RZD J;  5H20 A;  1D8K A;  1KU7 A;  5ICG A;  3IH4 A;  2M7A A;  2KRC A;  3EQL F;  3KP5 A;  2RQP A;  1T08 B;  1YW8 A;  1HW1 A;  3CMA I;  3DPL C;  1S6L A;  1TQI A;  3PIP F;  2VKH A;  5L3D A;  3SZT A;  4XID A;  1NK2 P;  5E1X A;  2RQQ A;  1TWA J;  4E7Z A;  3WTU C;  4C2U A;  3HOX J;  2VKV A;  2PEX A;  4HW0 A;  2FRH A;  3OYE A;  1MIJ A;  2EZH A;  4FQG A;  1PP8 F;  3VYS B;  1ZQ3 P;  3GUD A;  1R71 A;  3HZJ A;  2VOO A;  1SMT A;  1H0M A;  1POG A;  1QHG A;  2E71 A;  4JQF A;  4XLH A;  4BYY A;  4CCM A;  3QYB A;  1OCT C;  2BY3 A;  1JGG A;  1OCO H;  3DPU A;  2KIF A;  5KVR A;  5B3S H;  2ME0 A;  3A0H C;  3S3O A;  2EA2 A;  4DJA A;  3NQO A;  3FKI J;  4C2T A;  1E3P A;  4BXX J;  4F52 A;  3S1N J;  2DT6 A;  5IYB J;  3HL2 A;  4PJ0 C;  5HOO A;  5DUK A;  4EJV A;  3S16 J;  2IA2 A;  1QRY A;  1T0F A;  3RKY A;  3PM1 A;  3OIO A;  2EB7 A;  2OD5 A;  1GDT A;  1F1Z A;  2LH9 A;  1FOW A;  2AHQ A;  1O7L A;  2JA6 J;  1T8I A;  2ZJP F;  5D5V B;  3SZP A;  2Y9Y A;  2R7Z J;  4A69 C;  2PMZ A;  3OOU A;  1A36 A;  1HSJ A;  4RA2 A;  4D5F A;  3FHN A;  4MO7 A;  2COB A;  2PBI A;  3DKX A;  4F55 A;  5GTH C;  5FLV A;  2BHY A;  4LMY A;  4U88 A;  2FOK A;  3IP4 B;  1L3L A;  1J5Y A;  2DFH A;  3GW2 A;  1XGO A;  4A0Y A;  4WWC A;  4GRI A;  3GLX A;  2NS8 A;  2V26 A;  2CG4 A;  2XB0 X;  3BY6 A;  4UVC A;  5D4S A;  3D1N I;  1Z0X A;  2DJN A;  1XSD A;  2K9L A;  4AUX A;  2DYS H;  3IUO A;  4HA8 A;  4U7D A;  3L1P A;  3MZH A;  4NNJ A;  4PSW A;  4FET A;  1IO2 A;  2NAZ A;  3CUO A;  3M8F A;  2LRD A;  3HSF A;  4HNT A;  1XX5 A;  4B47 A;  4WX9 A;  3FMQ A;  5IYD J;  4E70 A;  3FBN B;  1BC8 C;  4XNF A;  3HTS B;  2CW0 F;  4I2O A;  3N4M A;  2BW3 B;  3FK6 A;  1FOK A;  1HKS A;  5JLX A;  2R4G A;  2F6C A;  4X6A J;  1V55 H;  2LNB A;  3OYN A;  4ESB A;  1IC8 A;  3VOD A;  4MQV A;  2XF5 A;  4PFO A;  1BR2 A;  3TGN A;  1SC7 A;  1VI0 A;  1DP7 P;  5J8F A;  1MMS A;  1EJ9 A;  2XAS A;  4AIJ A;  2I8D A;  1DP3 A;  3HGG A;  1E0E A;  5E79 C;  3CCM I;  4A3L J;  1UJ8 A;  4P9U A;  1IUY A;  3GWZ A;  1WHU A;  3DEE A;  1XPX A;  2BBY A;  2E7W A;  4MFD A;  5JLW A;  5KK1 A;  5D4R A;  2VQH A;  3HHH A;  4B4C A;  3VYR B;  1FZP B;  1JHH A;  2L9R A;  1Z05 A;  2GXB A;  4HDV A;  1DDN A;  4LK1 F;  1YOV B;  4A6E A;  1ON2 A;  3RYP A;  1SFO J;  3OWT A;  4XRF A;  3HXL A;  3OYF A;  1SVL A;  4YG2 F;  2VT2 A;  3GFI A;  1O3Q A;  5IYC J;  2MC3 A;  1VFC A;  3U2R A;  2DU9 A;  1PP7 U;  3X2Q H;  1IN4 A;  5GTI C;  3OS0 A;  4UUS B;  4L5I A;  5IP6 A;  3GTM J;  5TJJ A;  5LRR A;  5KHD A;  2GOM A;  4JX5 A;  1WCM J;  2KP6 A;  4Z6Y A;  2KJC A;  3CCE I;  2DYR H;  2P6T A;  5FLX K;  1ZN2 A;  1N75 A;  1BJZ A;  1QPI A;  5LHG A;  3IHU A;  2H6C A;  3AG2 H;  4G7O F;  2PI0 A;  3CJT B;  4XKB A;  1IG7 A;  2NRA C;  4YFK F;  4E7J A;  2C6Y A;  5E17 F;  3FHZ A;  5ILV A;  1U8B A;  1S29 A;  4UV8 A;  4RAZ A;  3J81 K;  2LBF B;  1BW5 A;  2DAO A;  3PFI A;  5B1B H;  2Y31 A;  4DBQ A;  3JAM Z;  1R1T A;  3BG5 A;  3QP6 A;  3S2W A;  2DOF A;  2DMN A;  3O8H A;  1Y1V J;  1MBE A;  2K85 A;  3A0B C;  1BR4 A;  1V5E A;  3DKY A;  5HLI A;  2HOE A;  2KKO A;  2N8G A;  2KL4 A;  2FOW A;  3M07 A;  1OFC X;  3ABM H;  3ABT A;  1P9Q C;  2LY9 A;  4P96 A;  3H3Z A;  5HVQ C;  1MBG A;  3BR1 A;  1G3S A;  1MJB A;  4ASN A;  4FIS A;  3FXM A;  1WSU A;  2F4O B;  3BCA A;  1P7I A;  2CSO A;  3MWM A;  4PJL A;  4RB3 C;  2D1V A;  3TQN A;  1RC9 A;  2E2I J;  2HXO A;  1O7F A;  3E0J B;  4A3F J;  1DU6 A;  3OYJ A;  1W0U A;  1T98 A;  4HX7 A;  5C44 J;  3MKY B;  1SFK A;  1R49 A;  3CCV I;  1GLN A;  1TW3 A;  1JUM A;  3F23 A;  4A3M J;  4L5E A;  1IN5 A;  3ERM A;  3ZR8 X;  4B44 A;  1EH8 A;  4RGU A;  3JSP A;  3ZMT A;  3LSP A;  4BHP A;  2HVR A;  4BKX A;  3WTX C;  4OWR B;  1J0R A;  3H5A A;  3P9K A;  3EDP A;  4A3G J;  2JVG A;  5IP7 J;  1G4D A;  1KGS A;  2R7Q A;  3GME A;  1E3O C;  4IZZ A;  1A6I A;  3BR6 A;  2VQL A;  3L7W A;  3IWF A;  2EWN A;  2M7B A;  3MN2 A;  4G6T B;  2BW3 A;  3K1M A;  1GVD A;  4CO8 A;  4UB8 C;  2E2H J;  4ZYG A;  2IAI A;  2PMZ N;  4M3G A;  3ASN H;  5FLM J;  2CYY A;  4WF2 A;  1OQY A;  3JRI A;  1UAA A;  3TO7 A;  4LIV A;  1QQI A;  2PX9 A;  4M6X A;  4RAY A;  3CC2 I;  2E1M B;  2EFP A;  2XAJ A;  4XN3 A;  3RPU D;  1RZ4 A;  3F9K A;  2VUM J;  2IXS A;  3VDX A;  2UXX A;  3LNQ A;  2V4J C;  4IJA A;  1UB9 A;  4BE0 A;  2HYG D;  3PNT A;  4EJT A;  3B02 A;  1TTY A;  1YLF A;  5DCM B;  2AXL A;  3BOQ A;  2XDV A;  4BQQ A;  4JX6 A;  3ERE D;  1T56 A;  1QVU A;  3F8C A;  3LAP A;  2E34 A;  4KIG A;  1OCP A;  4KNY A;  2KJB A;  2LF7 A;  1O3S A;  1D1C A;  2NXN B;  4F92 B;  4E6K G;  2RVC A;  2XAU A;  2VC0 A;  1XC5 A;  4CXF A;  1Z1D A;  5EZG A;  1BW6 A;  4LB6 B;  2XRL A;  2B63 J;  3CMM A;  1ZLJ A;  3IKT A;  1Y56 A;  2CW7 A;  4AC0 A;  4XSZ F;  4D1Q A;  1ZAO A;  3HDD A;  3FKJ A;  4DZP A;  1SAX A;  2M0C A;  3NWS A;  1ZHF A;  3D0S A;  3N97 A;  3SDG A;  4M72 A;  2K9N A;  3BP8 A;  1ETX A;  2TRT A;  5FKK A;  5EGO B;  4HQE A;  5DD8 A;  2TCT A;  5IT3 A;  1P4W A;  4NQW B;  3LOC A;  1X19 A;  3L2R A;  2DMT A;  1SAN A;  2IRF G;  1HOM A;  2OQR A;  3HRU A;  1B8I B;  3MMY B;  4GFB A;  3A01 B;  1IW7 F;  1WJC A;  2GM4 A;  2GAU A;  3CUQ C;  3KEY A;  5K7F A;  1FMW A;  1TP4 A;  5EF6 A;  2Y75 A;  2QYO A;  3K4K A;  1H8A C;  2QQB A;  1SFX A;  4MFE A;  3K70 D;  3PNV A;  2L7Z A;  4ZTJ A;  1JKR C;  1SD4 A;  2HKX A;  4NBQ A;  4ABZ A;  2RNG A;  1REP C;  5D8K B;  4BEH B;  5DD4 A;  1T2K A;  4OAY A;  3AL0 B;  2GXA A;  4P9F A;  2X0L A;  5B66 C;  3JAM K;  1JTX A;  5DCF A;  1W5S A;  3F3X A;  4FX0 A;  1XDS A;  3CES A;  5FO5 A;  2LRE A;  4I76 A;  4GO1 A;  4GXO A;  4C2M J;  5DM7 F;  2F5V A;  2FSW A;  3GVA A;  1D0Z A;  4IO9 F;  2GXG A;  4LLL A;  3BLY A;  4ZC3 A;  1TWF J;  2VOD A;  2GA2 A;  4A3J J;  4HEA 2;  2EA4 A;  2XGE A;  2HI3 A;  1DGR M;  3WTY C;  4A5M A;  3K1N A;  1USS A;  3KP7 A;  4P5O A;  1IJW C;  1QO0 D;  3R60 A;  2VKE A;  2JA5 J;  1YX5 A;  1DUX C;  1LFB A;  2R7F A;  1XDU A;  2VBW A;  3KFW X;  3S93 A;  2P8T A;  1JUP A;  1YW9 A;  1K78 B;  2EZL A;  2W25 A;  4HG2 A;  3UR3 C;  2ZB9 A;  3F6V A;  2M9H A;  2LKP A;  4HQM A;  2NVY J;  2XHK A;  2A3S A;  1IUF A;  4HNV A;  4XLC A;  3CCY A;  2UZK A;  3MQ0 A;  5LBQ A;  4AD9 A;  2XGX A;  2VC1 A;  2IGM A;  1S7A A;  3OOP A;  1RR8 C;  4I09 A;  3D5S C;  3DTK A;  1BR1 A;  5TRD A;  2X6Y A;  1YTY A;  2L02 A;  1AHD P;  1Z77 A;  3DLL F;  3HSE A;  2P81 A;  1HST A;  3I59 A;  2WC2 A;  3K4J A;  2QQ9 A;  2R3S A;  5L3G A;  1I27 A;  1K4T A;  3KZY A;  4IRG A;  3H35 A;  2FU4 A;  1WGX A;  3CTA A;  1OYY A;  4ZH4 F;  1JKP C;  2ZME B;  2R5Y B;  2HR3 A;  3T8T A;  1GVJ A;  4LFU A;  4M3B A;  5F04 A;  2O7O A;  2CO5 A;  3BZK A;  3QWL A;  4HX4 A;  1WJE A;  4JP0 A;  3EUH C;  1HBX G;  1Z7L A;  2L01 A;  1S7O A;  2WAE A;  3BG9 A;  3FK7 A;  1IXR C;  4XRS G;  3HB9 A;  2E1C A;  2ZO4 A;  1I1S A;  3K1P A;  1D0Y A;  1YI2 I;  4W1U A;  3JRH A;  3E6B A;  4ON0 A;  4U87 A;  3BZC A;  1JKQ C;  3K2A A;  1IRX A;  2DCE A;  2ELH A;  2LF8 A;  2M4G A;  2ZXI A;  2BXY A;  5FFZ A;  1HC8 A;  3LMM A;  2HZD A;  4Z2Y A;  5GPC A;  2KZG A;  6PAX A;  1RIO H;  1YS6 A;  1LVK A;  2JA2 A;  2ZC2 A;  1QA6 A;  3D5L A;  4CYD A;  1ZG3 A;  1KU3 A;  4FE7 A;  4F91 B;  1HCR A;  3JTH A;  1ACI A;  3GCM A;  2A5Y B;  3TBI A;  2UWM A;  5BMZ A;  1LVA A;  1LJ9 A;  4RDU A;  3QYF A;  4MEX F;  3RPU A;  4YFX F;  2D45 A;  4BJ5 C;  1EH6 A;  1QVT A;  2JMW A;  3G1O A;  3NEU A;  3H1C A;  3LST A;  1I6H J;  2EFW A;  1A35 A;  3ECO A;  4U0V A;  4R8H A;  2H1K A;  3KLO A;  3JTG A;  1A6Q A;  3E5Q A;  4EM2 A;  5E8I A;  1FOX A;  4N4O B;  2CFX A;  5K5O A;  1FBQ A;  2P5K A;  5GP9 A;  3OSF A;  4ESJ A;  1LDJ A;  2FBK A;  3I5U A;  3I4P A;  4Y13 A;  3ZMS A;  2CV2 A;  2HWV A;  1GV5 A;  3ZCO A;  4IQ4 A;  3TW7 A;  2H1L A;  2G7U A;  3TDZ C;  3V7R A;  1TWC J;  5M5Y J;  2PJR A;  3MVP A;  4BS9 A;  3AFH A;  2STW A;  3FM3 A;  4RGR A;  1D1A A;  3H5R A;  2E5N A;  4ITV A;  1TT5 B;  5LLQ A;  5GPA A;  1LE8 B;  3JRB A;  5DM6 F;  5CQG A;  2M1B A;  2LKX A;  3CCR I;  1YJW I;  2DQR A;  2FUG 2;  2V6E A;  1R23 A;  3CME I;  2CS3 A;  2WAD A;  2KPM A;  5F0C A;  2VE9 A;  3BTL A;  1VND A;  3E5X A;  1ERD A;  3K9T A;  2DA6 A;  1W7P A;  3KLN A;  1UCR A;  3FMR A;  2JJ7 A;  3OS1 A;  5LGU A;  3K70 C;  2IW5 A;  2IGK A;  1FPQ A;  2QF7 A;  4X0G A;  3PSF A;  4PCQ A;  3BCB A;  1YG2 A;  3FIS A;  4G7H F;  1DPU A;  1ZG5 A;  1HKT A;  2ELK A;  1YJN I;  4BBR J;  3UKG A;  2DA3 A;  2DJI A;  4CCK A;  4YRV A;  1R4N B;  2M30 A;  4WXD A;  3I0T A;  1U9N A;  2CV1 A;  4EJW A;  2QSG X;  2RAE A;  3N05 A;  3I53 A;  3T5X A;  1WH7 A;  4A6D A;  4B48 A;  3FMS A;  1JE8 A;  2MH2 A;  3BR5 A;  2JA7 J;  3OS2 A;  4XIC A;  1B6A A;  1X2N A;  1IAW A;  4IPA A;  4KT5 C;  4KDP A;  3WG9 A;  4OMY A;  3WTV C;  1NK3 P;  3FX3 A;  5LRS A;  2R7X A;  2YR2 A;  3BDD A;  3CZ6 A;  2DDA A;  1OYW A;  2ZME A;  1WQ2 A;  5E1Z B;  2EH3 A;  3KET A;  4OIQ F;  1Y0U A;  1UST A;  3OYC A;  4CHU A;  1OCZ H;  1R1U A;  2BVM A;  1PJR A;  2A05 A;  2F5C A;  4JK1 X;  2OTL I;  3TKY A;  1O57 A;  2BEO A;  4A5N A;  1V54 H;  1N78 A;  3KYC B;  3R6S A;  3B6A A;  2M2E A;  1R5G A;  3L2V A;  1DU0 A;  2E7X A;  2FQ4 A;  1P4A A;  4ZYD A;  4C9Y A;  2XGC A;  2Q2E A;  1VQ9 I;  4IHW A;  1YO5 C;  5CKT A;  2X4H A;  1P92 A;  1UG2 A;  4XLE A;  2G7H A;  2GOX B;  3KCC A;  3Q5F A;  2G0E A;  3ZQF A;  1BN5 A;  4D0P A;  1MH4 A;  2V9K A;  1E17 A;  1FP1 D;  1IXC A;  4OOI A;  3GFL A;  5FKL A;  1Z91 A;  4KIT B;  1S8N A;  4UVA A;  4LG3 A;  1TNT A;  4I02 A;  2W57 A;  1OIS A;  3E6M A;  1MSF C;  2OJE D;  5M3F J;  2X51 A;  5CVU A;  3H3U A;  1VQM I;  3PJR A; 
#chains in the Genus database with same CATH homology
 1MBK A;  1HDP A;  2ECB A;  4M6V A;  3RQI A;  3K7A J;  4M3D A;  4C3I J;  1U8B A;  2IBD A;  3JRD A;  1PUF A;  2M34 A;  3C2B A;  1BW5 A;  1H89 C;  2I10 A;  3I4N J;  4IHY A;  2Y31 A;  4MIM A;  2O9L A;  3BG5 A;  1TWG J;  1U9O A;  2DMN A;  3O8H A;  1Y1V J;  1MBE A;  1ENH A;  4DYR A;  5E3L A;  3BQZ A;  2JA8 J;  1IGN A;  5J1Y A;  1UMQ A;  2N8G A;  1X58 A;  2XGD A;  1OFC X;  2DA2 A;  1A5J A;  2CUE A;  1O4X A;  3ZQH A;  4DYQ A;  2LY9 A;  5EZH A;  1IRZ A;  1MBG A;  2QCO A;  3BR1 A;  1S7E A;  4FIS A;  3WHC A;  1P7I A;  1ZK8 A;  5C3E J;  2DMQ A;  1GV2 A;  2XPV A;  1I3Q J;  2OPT A;  3QPS A;  2HXO A;  3ZQC A;  4DYC A;  1JKO C;  2E2I J;  9ANT A;  2MW8 A;  1EF4 A;  5M5W J;  4A3F J;  1DU6 A;  5FKM A;  5IOY A;  1W0U A;  3H0G J;  1U78 A;  4AYB N;  5C44 J;  1K61 A;  1ORK A;  1JUM A;  2JN6 A;  2MSY A;  2FD5 A;  5K7Z A;  4CYC A;  4A3M J;  4L5E A;  1ZR2 A;  4FTH A;  1HLV A;  2O8K A;  1ETK A;  2DA5 A;  3LSP A;  1AKH B;  3S2H J;  4BKX A;  2KT0 A;  1T33 A;  2X48 A;  2ECC A;  3PO3 J;  2JK3 A;  3GTK J;  4A3G J;  4BY1 J;  1VF9 A;  3GTP J;  4IHX A;  1RES A;  2WAQ N;  5IP7 J;  4B1R A;  1FEX A;  4DZJ A;  1E3O C;  3ZOB A;  2HDD A;  1A6I A;  3BR6 A;  2MGQ A;  1Y1W J;  1WH5 A;  3MN2 A;  2CU7 A;  1GVD A;  4QSH A;  1ETO A;  1AU7 A;  2GBY A;  3BR0 A;  2DA7 A;  2E2H J;  3M3Y J;  2IAI A;  1ETW A;  2PMZ N;  4M3G A;  4V2F A;  5FLM J;  1GT0 C;  3JRI A;  3JRG A;  1JTY A;  2R5Y A;  3BR2 A;  5FKO A;  2AO9 A;  1B72 A;  4IEJ A;  2R0Q C;  3CMY A;  1K83 J;  1ITY A;  1G2H A;  4XRM A;  2VUM J;  3LNQ A;  1Q1V A;  1WPK A;  2FJ1 A;  2L7M P;  1D5Y A;  1MSE C;  3ZQI A;  1ZR4 A;  3LSG A;  2KDZ A;  4JX6 A;  1T56 A;  1QVU A;  2XB5 A;  1MH3 A;  1APL C;  1OCP A;  3A02 A;  2LTP A;  4B3A A;  2E2J J;  2HOS A;  5J3L A;  5F0H A;  5DS9 A;  2EZK A;  2H8R A;  4W97 A;  5EG0 B;  1XC5 A;  5M5X J;  2MG4 A;  4M3F A;  1BW6 A;  5EZG A;  3LSR A;  2XRL A;  2B63 J;  5F27 A;  4AC0 A;  4A3C J;  3HDD A;  4DZP A;  2M0C A;  1JT0 A;  1I50 J;  3SDG A;  1R9T J;  1HDD C;  5J1R A;  2K9N A;  5EGO B;  1ETX A;  2TRT A;  5FKK A;  2TCT A;  1MBH A;  3LOC A;  1MBF A;  2DMT A;  1SAN A;  1HOM A;  1B8I B;  4GFB A;  3A01 B;  2LP0 A;  3Q0W A;  2GM4 A;  3LSJ A;  4BBS J;  3HOY J;  1ETY A;  3BTC A;  5K7F A;  2LR8 A;  5EF6 A;  3NAR A;  1H8A C;  1F43 A;  2XPW A;  2EBI A;  3S1Q J;  4MFE A;  2NS7 A;  2L7Z A;  4FCY A;  3PO2 J;  1JKR C;  2CQQ A;  3MKL A;  3F0C A;  3HKZ N;  4ABZ A;  2Y2Z A;  1HF0 A;  2NVX J;  5F1J A;  1WI3 A;  3SJM A;  2R5Z B;  2NOG A;  2ID6 A;  4NDL A;  2M8G X;  4D7N A;  2DA1 A;  1JTX A;  4V2G A;  1LE8 A;  1FIA A;  1OJL A;  3A03 A;  4I76 A;  1XS9 A;  2OF7 A;  4C2M J;  2DMP A;  2NVQ J;  3HBL A;  2Y30 A;  3O8G A;  4S0H B;  1TWF J;  1FTT A;  4A3J J;  2XGE A;  2HI3 A;  2HOA A;  3TW6 A;  2HOT A;  2LFB A;  4C3H J;  5IOZ A;  3S15 J;  2CUF A;  2W48 A;  1X2M A;  2R92 J;  1IJW C;  2VKE A;  2JA5 J;  1LFB A;  5EDN A;  1BA5 A;  2X6O A;  1JUP A;  3RKQ A;  2EZL A;  3IH2 A;  4Y52 J;  3TED A;  4CYC B;  2ZB9 A;  2M9H A;  1RKW A;  5HOD A;  1P7J A;  1LFU P;  2NVY J;  3FIW A;  4HNV A;  1IUF A;  3CQZ J;  3CCY A;  1IV6 A;  1RPW A;  1TWH J;  2K9Q A;  3HOW J;  2L0K A;  1ZKG A;  3Q0V A;  2D5V A;  3W6V A;  1MBJ A;  2YU9 J;  1AHD P;  1Z77 A;  2CRG A;  4A93 J;  4DW6 A;  2P81 A;  5F0F A;  5C4X J;  4C3J J;  2ME6 A;  1MNM C;  1NTC A;  1ETQ A;  5J1U A;  1JJ8 C;  1WGX A;  3JRE A;  1JKP C;  4LOC A;  2R93 J;  2E1O A;  1RKT A;  3HOZ J;  4A3E J;  2R5Y B;  2X9D A;  5DTD A;  4M3B A;  1B72 B;  3B6C A;  2K40 A;  1GUU A;  5F04 A;  5E3N A;  2O7O A;  3BR3 A;  1JJ6 C;  4JP0 A;  3G1M A;  3BTI A;  4D7M A;  3BG9 A;  3FK7 A;  5C4J J;  1UHS A;  4XRS G;  3HB9 A;  3GTL J;  3QQA A;  2HQ5 A;  3G1L A;  5E3M A;  3IV5 A;  4IHV A;  3S17 J;  4UUS A;  4W1U A;  3JRH A;  4J19 A;  2WB1 N;  3HM5 A;  1YRN A;  5EG0 A;  2XSD C;  1JKQ C;  3K2A A;  3OSG A;  1CQT A;  3RZO J;  3S14 J;  5K7H A;  5IPA A;  5EYR A;  5GPC A;  3SFI A;  3JRC A;  2VI6 A;  3IH3 A;  3RZD J;  4M3E A;  3GBG A;  4FE7 A;  1HCR A;  3IH4 A;  3GTG J;  2CQX A;  2IEK A;  3Q0U A;  2ID3 A;  5FKN A;  4RDU A;  4XID A;  1NK2 P;  1TWA J;  3HOX J;  2VKV A;  3S2D J;  1QVT A;  2JMW A;  3G1O A;  2EZH A;  4JX4 A;  4XRS A;  1I6H J;  1PUF B;  1ZQ3 P;  2H1K A;  2DMU A;  5F08 A;  1POG A;  2GLO A;  3GTJ J;  1OCT C;  1JGG A;  2L7F P;  3TP3 A;  5GP9 A;  3OSF A;  3Q3S A;  2LD5 A;  4BY7 J;  2ME0 A;  3CDL A;  2R5Z A;  3M4O J;  5M3M J;  2VPR A;  1GV5 A;  3FKI J;  4G12 A;  4RBO A;  4Y7N J;  4BXX J;  3ZQG A;  3TW7 A;  3S1N J;  5IYB J;  2K9S A;  3WHB A;  1TWC J;  3S16 J;  5M5Y J;  1H88 C;  1QRY A;  3MVP A;  2DTZ A;  2Y9Z A;  3H3V K;  1XG1 A;  3PM1 A;  3E7L A;  3OIO A;  1FIP A;  3DCF A;  1GDT A;  5GPA A;  2WV1 A;  1ETV A;  1LE8 B;  3JRB A;  2AHQ A;  2DA4 A;  4I6Z A;  2JA6 J;  2Y9Y A;  2LKX A;  2R7Z J;  4MLO A;  4A69 C;  3OOU A;  4D5F A;  3DEW A;  4MO7 A;  1AKH A;  2COB A;  2Y0S N;  5FLV A;  5F0C A;  3HOV J;  3BTL A;  1VND A;  3HOU J;  2DA6 A;  2XPU A;  3VPR A;  3BTJ A;  2LK2 A;  5BNG A;  2JJ7 A;  2NS8 A;  1W0T A;  2CJJ A;  2XB0 X;  2YUS A;  3D1N I;  1Z0X A;  2DJN A;  2QF7 A;  3HEF A;  3QPL A;  2LVS A;  2HXI A;  3FIS A;  4AUX A;  2ELK A;  3L1P A;  2HYJ A;  4BBR J;  3UKG A;  3ZQL A;  2DA3 A;  4X1E A;  5IYD J;  4QTR A;  4D5C A;  3S1R J;  2LLK A;  3FK6 A;  1IDY A;  5JLX A;  1U9N A;  4X6A J;  2RAE A;  2EQR A;  3JRF A;  1IC8 A;  1WH7 A;  3HGY A;  1FJL A;  4A3D J;  2FX0 A;  3BR5 A;  1VI0 A;  2JA7 J;  3JR9 A;  4XIC A;  1X2N A;  4A3K J;  3HGG A;  1NK3 P;  4A3L J;  1RR7 A;  1ZTR A;  3JRA A;  2EH3 A;  2YS9 A;  3BQY A;  4QIW N;  3S1M J;  4FE4 A;  1ZGW A;  2DN0 A;  4MFD A;  5JLW A;  1JUS A;  5FJ8 J;  3GTO J;  2NVT J;  3GTQ J;  4XK4 A;  4B4C A;  2EZI A;  3BG3 A;  3B6A A;  2M2E A;  1BL0 A;  1DU0 A;  4A3I J;  2FQ4 A;  2L9R A;  2XGC A;  5EEA A;  4IHW A;  4A3B J;  1SFO J;  1UG2 A;  5IYC J;  1F36 A;  3TP0 A;  1VFC A;  3I4M J;  4UUT A;  5IP9 J;  2G0E A;  3ZQF A;  4UUS B;  1MH4 A;  5IP6 A;  5EGO A;  3GTM J;  1YRN B;  1FTZ A;  1JT6 A;  5FKL A;  3NAU A;  4JX5 A;  1WCM J;  4EEF G;  1TC3 C;  3BT9 A;  1RET A;  4JYK A;  1B8I A;  1BJZ A;  1QPI A;  1MSF C;  3A01 A;  5M3F J;  1IDZ A;  2JWT A;  5E3O A;  2E19 A;  1IG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...