2DMUA

Solution structure of the homeobox domain of homeobox protein goosecoid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GSSGSSGRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the homeobox domain of Homeobox protein goosecoid
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Homeobox protein goosecoid
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dmuA01
3S15J 4ABZA 2XGCA 1OFCX 2MW8A 3ZQIA 1TWAJ 5JLXA 3JRDA 3TW6A 1W0UA 1RKTA 1JJ6C 1B72B 2HOTA 1IV6A 1IGNA 1R9TJ 2K40A 1T56A 2JJ7A 4IHXA 2X9DA 2Y2ZA 1MSEC 3TP3A 3MVPA 3HKZN 4D5CA 4FE4A 4DYQA 1HOMA 4DYCA 5FLMJ 4NDLA 3OSGA 1RESA 1OCPA 1FIPA 1ETYA 2M2EA 5F0CA 2HQ5A 3JRCA 3FIWA 2DMPA 2IBDA 2EZHA 3NAUA 5EGOA 1GDTA 1S7EA 1X2NA 4S0HB 4G12A 3FK6A 3GTKJ 1WH7A 2EQRA 1A6IA 3MKLA 1H88C 4Y7NJ 3H3VK 4LOCA 2NVTJ 4XICA 3QPLA 3HOUJ 5E3LA 1ETVA 3HEFA 1ENHA 1ORKA 3IH4A 3HB9A 1U78A 1IJWC 4BY1J 4IHYA 2ME0A 4J19A 2XB0X 5EZGA 4W97A 1VI0A 4I6ZA 2H8RA 3K2AA 3C2BA 1E3OC 1IG7A 2N8GA 3OOUA 3GTMJ 1JGGA 1U8BA 1TC3C 2GLOA 3G1LA 4MO7A 1F36A 4A3JJ 3S2DJ 1NTCA 2O9LA 2X6OA 2XPWA 1MBGA 3CCYA 1WPKA 1HDPA 4A3CJ 3JRHA 1JUSA 1BA5A 3ZQCA 2R5YB 1LFUP 3LSPA 3HOZJ 4QSHA 2XGDA 3WHCA 3BQYA 2XRLA 4UUSB 4A3BJ 2R0QC 2DA1A 4V2FA 2CJJA 1X58A 5M5WJ 2R7ZJ 1UHSA 2DMQA 2NOGA 2EBIA 1QRYA 3SFIA 3HGGA 2M34A 2L7FP 5EG0A 3F0CA 1MNMC 5DS9A 1B8IA 2DTZA 3S1RJ 1SFOJ 3M4OJ 4A3DJ 2L7ZA 2LY9A 2DMNA 1VF9A 4M3BA 4FTHA 5K7ZA 1PUFB 3K7AJ 4B4CA 5C44J 1POGA 1WCMJ 1ITYA 3HOVJ 2G0EA 5J1RA 2JA7J 2XGEA 4A3FJ 3ZOBA 1LFBA 2FX0A 3GBGA 3RKQA 5J3LA 2JA8J 5M3FJ 1PUFA 4A3GJ 3HOXJ 2FD5A 5C4XJ 2IAIA 1JKQC 1I50J 2MSYA 3BR1A 3W6VA 1O4XA 1B72A 2VPRA 4A3EJ 1MH3A 2R5ZB 5K7FA 4EEFG 5IOYA 5FLVA 1X2MA 2ECBA 2ID6A 2M0CA 3NARA 2MG4A 4AYBN 2E2IJ 1WH5A 5IP7J 1LE8A 1MBHA 2YS9A 3BTCA 4D7NA 2Y30A 1IC8A 2M9HA 5HODA 2OF7A 3TEDA 4DYRA 4XK4A 1ETQA 1GV5A 5K7HA 2E19A 4FISA 3LOCA 3DEWA 3Q0UA 1ETOA 3S14J 3CQZJ 3FK7A 2LD5A 1BJZA 3I4MJ 4M3GA 1Q1VA 1TWGJ 3SDGA 5M5XJ 3H0GJ 3JRBA 3RZOJ 4QTRA 4A3IJ 3HOYJ 1JUPA 1ZR4A 2P81A 3L1PA 3GTJJ 1AHDP 4BXXJ 2TCTA 3HGYA 3CDLA 3HBLA 1VNDA 3JRAA 1QPIA 3BTJA 1JT6A 1P7JA 2OPTA 4AC0A 3O8HA 2HOSA 2VKEA 2LFBA 1GUUA 2ECCA 3BQZA 5BNGA 3LSGA 4X1EA 1IRZA 3B6CA 5EGOB 1JKRC 3BG5A 4QIWN 4M3EA 5E3MA 1MSFC 3A01A 2K9SA 5EZHA 2WV1A 1RETA 4MFDA 5IP6A 5IYCJ 5JLWA 2WB1N 4V2GA 1VFCA 2IEKA 4AUXA 5FKLA 2HI3A 4BKXA 4C3IJ 1WI3A 4HNVA 4JX4A 2ME6A 2XPUA 1XS9A 1XG1A 4BBSJ 2M8GX 3TW7A 1Z0XA 3S17J 2ELKA 2CQXA 2X48A 3D1NI 2FQ4A 2W48A 5IOZA 3I4NJ 2K9QA 2NS7A 2GM4A 5EDNA 3LNQA 1DU6A 3GTGJ 1FIAA 4CYCA 1MBKA 4M3FA 1JJ8C 3ZQFA 2CUFA 3G1MA 4IHWA 1B8IB 2LKXA 3HDDA 5C3EJ 2AO9A 3TP0A 3IV5A 1T33A 2CRGA 2R5YA 1NK2P 1AU7A 1ZR2A 3S2HJ 1ZGWA 3BG9A 3G1OA 1UMQA 3JRGA 1K61A 1TWHJ 2R92J 2Y9YA 2JN6A 3O8GA 4A3LJ 2HYJA 3S1NJ 3ZQHA 2E1OA 2L7MP 4XRSA 4A3MJ 2DJNA 3Q0WA 5F04A 2E2JJ 2ZB9A 3JREA 2EZIA 2R5ZA 1EF4A 2TRTA 3BR2A 2EZLA 3GTOJ 4JP0A 2NVYJ 3IH2A 3IH3A 1YRNA 1RPWA 4C3JJ 1OJLA 2Y31A 1LE8B 2DA5A 2RAEA 2HOAA 2L9RA 1JUMA 1APLC 4M3DA 1BL0A 1XC5A 1H8AC 2LR8A 5FJ8J 3M3YJ 2B63J 4BBRJ 2CU7A 9ANTA 2D5VA 2LLKA 1FEXA 2DMUA 4XRMA 3HOWJ 1BW6A 1TWCJ 2DN0A 1IDYA 2XPVA 3BR3A 1F43A 1MBEA 5M3MJ 2HXIA 3BTIA 4UUTA 5M5YJ 5FKKA 5E3OA 1HLVA 3QQAA 2NVQJ 1D5YA 3UKGA 2CUEA 3LSRA 1IUFA 2I10A 2H1KA 1GVDA 4RBOA 2EH3A 3FKIJ 4MFEA 5FKOA 1I3QJ 5IYDJ 1NK3P 4MIMA 3JRFA 1BW5A 2VKVA 3A02A 3BR5A 5F0HA 2VI6A 5F27A 3CMYA 3S16J 2GBYA 2KDZA 4FE7A 3WHBA 4DZPA 2HXOA 5GPCA 2NVXJ 2LP0A 4JYKA 2QCOA 3QPSA 1AKHA 1HCRA 3JRIA 3GTPJ 3VPRA 1QVUA 1Z77A 2DA3A 5EYRA 2NS8A 1FJLA 2FJ1A 3GTQJ 2O7OA 5J1YA 3SJMA 4B1RA 4C3HJ 1AKHB 3OIOA 1MBJA 1UG2A 2LK2A 2XSDC 5J1UA 2COBA 4IEJA 3ZQLA 4W1UA 2JWTA 2Y9ZA 1CQTA 4IHVA 4BY7J 5F1JA 4CYCB 1DU0A 1JT0A 3E7LA 3DCFA 3BR6A 4DW6A 2R93J 2WAQN 1JTXA 2K9NA 2XB5A 3RQIA 4DZJA 3RZDJ 2PMZN 3BT9A 2YUSA 4MLOA 1Y1VJ 3HM5A 1RR7A 4A69C 1FTZA 1MH4A 3BR0A 1ETKA 2DA2A 4M6VA 4A93J 3S1QJ 1ZQ3P 1TWFJ 4B3AA 1IDZA 2DA7A 4L5EA 1JTYA 4FCYA 2QF7A 4Y52J 1SANA 3A01B 1I6HJ 2L0KA 1HDDC 1OCTC 5C4JJ 2JA6J 4X6AJ 3BG3A 4JX5A 3S1MJ 2VUMJ 2O8KA 5FKNA 4D7MA 1ZTRA 3LSJA 5EEAA 5IYBJ 4D5FA 3JR9A 1GV2A 3PO3J 3Q3SA 1G2HA 1U9NA 5IP9J 3A03A 3BTLA 5E3NA 1ZKGA 4C2MJ 1FTTA 4XIDA 1P7IA 2JK3A 1WGXA 5FKMA 3PO2J 5GPAA 1RKWA 1JKPC 1QVTA 1MBFA 4XRSG 1H89C 3B6AA 1ETXA 3FISA 4I76A 5GP9A 1W0TA 2E2HJ 2KT0A 2LVSA 2EZKA 5F08A 4RDUA 4UUSA 2AHQA 5EF6A 2DA4A 1HF0A 1YRNB 4GFBA 3MN2A 2DMTA 5F0FA 3ZQGA 1K83J 5IPAA 1U9OA 4A3KJ 2YU9J 1ETWA 5EG0B 1A5JA 4JX6A 2ID3A 3GTLJ 5DTDA 2CQQA 2DA6A 1GT0C 1JKOC 2JA5J 2LTPA 3PM1A 2HDDA 2Y0SN 2MGQA 1Y1WJ 3OSFA 3Q0VA 2JMWA 1ZK8A
chains in the Genus database with same CATH superfamily
3BCAA 4ABZA 3M9AA 2GWRA 4BJTA 3ML6A 3GEZA 3H9QA 4XLEA 3TDZC 1YJNI 2G9WA 2MW8A 5L3DA 4XLCA 4WCGA 2X1CA 4HLYA 1O57A 5JLXA 1UB9A 5ILUA 3JRDA 1SFUA 1E2XA 1HQCA 4Y17A 1B72B 1I1GA 4RLFA 1DGRM 1BR4A 1O3TA 1H9GA 4N4NB 3LA3A 4OOIA 4HOBA 3KEYA 3FBNB 2Z1DA 2CV0A 1XGNA 1R58A 1TTYA 4PK4A 3J80K 2O3FA 3M8FA 3MVPA 2Q8KA 4BU2A 4ON0A 5GAGJ 4LFUA 1S7AA 2V9KA 2QQ9A 1I27A 1NG7A 2Z16A 4NDLA 2HVRA 1R5ID 4EJOA 3OSGA 3LSKA 1T8IA 4BDYA 5JHUA 4XONA 4RMNA 5ICEA 2R7UA 2DMPA 4G7ZF 2VJ4A 3M8EA 2NNYA 1T95A 4XBFA 1BI3A 1X2NA 4G6QA 2ZJ2A 4ASNA 4KYWA 3ASNH 1Z91A 2P5LC 1WH7A 2WTEA 3GTKJ 1W4MA 5JR3A 3G2BA 4XKBA 5KK1A 1H88C 2X51A 4Y7NJ 2NVTJ 4XICA 1JHFA 3GW2A 3QPLA 2P7VB 4XMYA 2O6GE 4HNTA 1DDNA 1ORKA 2KL4A 3MEXA 3CJRB 1U78A 4AWXB 2V9PA 1IJWC 3JSPA 3F8MA 3J80Z 4I0AA 2KIUA 2VB6A 1VI0A 4P5OA 4LK1F 1W5SA 2HQNA 2VBWA 1RZ4A 1S29A 3TOBA 1ZRFA 4BQAA 3TO6A 3GTMJ 2V79A 1S8NA 2GLOA 1N78A 1IF1A 4KICA 1LKXA 3CLOA 2H94A 2O9LA 3SZTA 2XPWA 4GCVA 3CCYA 3SDBA 3UNGC 3IAM2 3KP7A 1BIAA 1JUSA 4N4OB 1VTNC 3C7JA 3RDIA 4UVAA 1LFUP 3TGNA 2KRFA 2WY8Q 3WGIA 4UB8C 4R79A 1TW2A 2KPMA 3WHCA 2EA2A 3CZ6A 2A6EF 3R4KA 4OIQF 3HIFA 1D5VA 1BJAA 2ISZA 1D8KA 5M5WJ 3HC7A 1UHSA 2DMQA 1QRYA 2DT6A 2NOGA 4Y4RA 2L7FP 2P5KA 2LF8A 3PUFA 1I39A 4P9UA 1MNMC 4U87A 1S7OA 3R60A 3U1DA 3S1RJ 1R71A 1SFOJ 3H9JA 3M4OJ 1J7KA 3DXJF 4M3BA 5K7ZA 4B4CA 5C44J 3PNTA 3CDHA 2G0EA 1WKMA 3AG1H 3FX3A 4RAGA 1MMSA 3OYBA 3DU6A 4XQFA 3GBGA 4U88A 2VC1A 3HRUA 3OYAA 5J3LA 1D3YA 3M8JA 2JA8J 2LF7A 3DTKA 4G7HF 2IAIA 3CJTB 4BS9A 3VB2A 4L0YB 4A3EJ 4HF0A 3H9GA 3OIPA 2FRHA 5K7FA 4HX4A 1K6YA 2H27A 2MLGA 2HVSA 3A0HC 5FLVA 2EILH 2ID6A 3HUGB 1VQ8I 5FRNA 3HHHA 4R1HA 1W7PA 2QBYA 5KNLA 4EGZA 2KRHA 3BP8A 4L5JA 1W1WE 1I6XA 1MBHA 3WTUC 3BTCA 2VODA 1G59A 2Y30A 4OMZA 2D1HA 3O3KA 3S3OA 1HA8A 4YRVA 3RKWA 1ETQA 4RLQA 1D8JA 1RRJA 3ZQQA 1R5GA 2E19A 2XRNA 3KYCB 4HEA2 3DEWA 3Q0UA 5H6RA 1J9IA 5H20A 3CQZJ 2LD5A 2X1EA 3PUBA 2OCEA 3HKZA 4YFNF 3K1NA 4HBLA 3SDGA 2PX9A 3D5RC 4QTRA 2BOLA 4M6YA 2BEOA 2FMLA 4P96A 4BQQA 2M4GA 5D4SA 3GYHX 1QPIA 3GUDA 1VNDA 3F23A 2ZBKA 1KYWA 3DKXA 3PNYA 4EVIA 4EM2A 4IOCF 1XB4A 2HZDA 2ECCA 5BNGA 3OR1C 3LSGA 2W7NA 3B6CA 2DQLA 5KHDA 3OIQA 1MDMA 3HPHA 4NC7A 4U0WA 4QIWN 3N97A 4O6JA 4XORA 2HPMA 1MSFC 3A01A 3IL2A 4J00A 1QPMA 5EZHA 2HTJA 1RETA 1SD4A 2GA1A 4MFDA 5JLWA 5JI6A 2VT3A 2D2WA 1IW7F 3H5NA 1MGTA 1EV7A 4AUXA 5FKLA 4BKXA 4C3IJ 2LBFA 4HNVA 1X3UA 4JX4A 3E6DA 2XPUA 2FF4A 5J8CA 1TP4A 3NRVA 4IRIA 4ESJA 2CUZA 3GVAA 3FF5A 3TL4X 4Z6YA 3I59A 3EYIA 4OMYA 2NS7A 4XSXF 4UHTA 1KGSA 1W7PD 3GTGJ 3LFUA 3L2WA 4UUVA 4CYCA 3N4MA 5GAHJ 1PDNC 3K69A 4IHWA 4KIBA 1S9HA 5GTHC 2L5QA 2M3AA 1HW5A 3TP0A 3CD6I 4RS8A 5LEJA 4C2TA 2XROA 3K70C 4BDZA 3FXUA 3BG9A 5AIPA 3HSRA 2A61A 4PGGA 4ANJA 3H5AA 3T8RA 4PUSA 3DBHB 2IS4A 3OL4A 4EV0A 4F93B 4G8XA 1OR7A 5DCFA 1YI2I 3J7AY 4A3LJ 2BHYA 2R7OA 1X3ZB 2E1OA 3OYKA 2L7MP 2PQ8A 1LDKB 4RA2A 1ZARA 3D5LA 1CF7A 1ERDA 2R7VA 4YIRX 3JREA 2WBMA 4J01A 4EM1A 1R49A 3GMEA 1EF4A 2DPDA 3BR2A 2OQRA 2CSOA 2E5ZA 1Y0NA 2KRCA 1YG2A 2Q1ZB 4TV7A 5J4VA 1YOVB 3K4NA 4FX4A 4CGZA 4CCLA 5CKTA 1X1PA 1LE8B 2DA5A 2O8XA 2RAEA 5HDKA 4Y15A 2WAQA 1JUMA 1ZGJA 2KIQA 2PEXA 4PFOA 5FLXK 1MD0A 2QKLB 1H8AC 3F3XA 2LR8A 5FJ8J 3GXOA 1SFXA 2FE3A 3S8PA 5HNHA 4ENNA 9ANTA 1JHHA 1AA7A 4P1WA 3NEUA 2O5RA 1FX7A 1NG6A 1OCRH 3MZYA 3TBIA 4G6TB 3ZR8X 5B1BH 1R22A 2DO7A 4DOZA 1G3WA 1GXPA 1HBXG 3S3NA 3GZ5A 3M7GA 3BJAA 2DN0A 2FBKA 2XPVA 1MBEA 2IJLA 3BTIA 4UUTA 3CCMI 5FKKA 2V1DA 4YFKF 4CYDA 1D5YA 4BHCA 4KISA 2CUEA 4NBQA 2BBYA 2I10A 3DPUA 1GVDA 3FXOA 3Q9VA 1U6GA 2UXXA 2AQFA 3M1EA 4RBOA 4PJ0C 5FKOA 5IYDJ 1XD7A 1NK3P 1WWXA 4MIMA 1GHCA 1FOYA 1MDMB 2VKVA 2ESNA 1IN8A 4PDKA 1JI8A 4LIVA 3S16J 2M7AA 1FOKA 2GBYA 3WTZA 4BXFA 1BM9A 1IN4A 4FE7A 2W24A 3CCVI 1Z3XA 3WHBA 3E1SA 3DTEA 3HTSB 2LSOA 2MLKA 2OV7A 1V4RA 3DEUA 1HKTA 3FDYA 1HCRA 3JRIA 2M5WA 2Z99A 3VPRA 2LKPA 1A31A 3F21A 1QVUA 1FMVA 5EYRA 2BV6A 2EFOA 5KCMA 3V42A 3K4KA 3OV8A 1SD6A 1AKHB 3OIOA 3R0JA 2VLAA 3EPZA 1XSDA 1WJBA 2DI3A 2XSDC 2COBA 3DTIA 4W1UA 2JWTA 2RVCA 4BHBA 4Y13A 2ZXJA 4MNUA 5F1JA 1K78B 3EUHC 4CYCB 5CVUA 1G3TA 1ZYRF 2UUZA 4NQWA 5K5RA 3OYEA 5TRDA 4RAFA 1X19A 4DIQA 4ITVA 2GAUA 1U0JA 3A0BC 2YX4A 1K4TA 5D8KB 2VT2A 2X1DA 2BW3B 4KDPA 3CJQB 4DQ2A 4A0ZA 4GYIA 3OYCA 1VQNI 1EKEA 3MWMA 3HM5A 3TDUC 3FHNA 1Z67A 2FNAA 4B3XA 3P5JA 2PJPA 1ZG3A 1ZQ3P 2LKSA 3I55I 3WG9A 1W5CC 1R1VA 3F8NA 4M6XA 3VYUB 1W36C 4UNOA 2QF7A 1R4NB 2L4MA 5FLXZ 2R7DA 2FUG2 2KJBA 4U0YA 3SEZA 1HDDC 2B0LA 4U0VA 5HS9A 4X6AJ 4JX5A 3S1MJ 3JTHA 1HXDA 1HW2A 3CO7C 1ZTRA 3LSIA 5A2QK 5IYBJ 2ZJQF 1G2HA 2IPQX 2CMPA 3FMRA 3VDXA 2F5VA 3BTLA 4FT8A 3DKYA 4HAMA 1FTTA 4KMFA 2PJRA 2QQ8A 5E17F 1DPUA 3RCOA 4EQQA 1VQ6I 3PFYA 2DBBA 3E0JB 5CQEA 3B6AA 2DOEA 1ETXA 5GP9A 5H2FC 1KZHA 1B9MA 2VQHA 3RKXA 2FOKA 1HF0A 3L00A 3AL0C 4M72A 2K85A 1MJAA 2KZVA 4BACA 1IN7A 2W85A 1T98A 4BGDA 4ZC3A 1GT0C 1VZ0A 2LTPA 3K10A 1D1BA 4QLCU 2Q0OA 4C30A 1LNWA 4LGWA 2NNNA 4HV6A 2Y48A 1S5LC 2L7KA 1YX3A 3WU1B 2EV5A 1TWAJ 4E7LA 2A69F 5LGNA 1QBJA 2BY0A 2RC4A 1QA6A 3CC2I 1G3SA 1RKTA 1JJ6C 2YPRA 2H09A 4OINF 2K40A 3VYSB 2KIMA 2HU9A 1GLNA 3WU0A 4XL9A 2JJ7A 4HW0A 2CW7A 1R23A 2Y2ZA 1TNTA 3TP3A 1YJ9I 1MSEC 2EFNA 4LJZF 1YFHA 2A5YB 4HPQA 2JTVA 4D5CA 4FE4A 2LH9A 3GLLA 4DYQA 4F92B 1HOMA 5FLMJ 3L2RA 1FOXA 4BHPA 3CMMA 4C9YA 4G9YA 1FIPA 1CGPA 2E36A 4PJLA 4CICA 1PJRA 5D5VB 3K4CA 3GWZA 3FIWA 4BQOA 1OR7C 2IBDA 1XMAA 1BIBA 2LREA 3NAUA 4I02A 3O2PE 2BVLA 4U7BA 1GDTA 1S7EA 2R7SA 2MABA 3I9V2 2XASA 4G12A 3E5XA 2W57A 2XF7A 3WTTC 4G6DA 2EQRA 4Q47A 3K4MA 3K6GA 4UV9A 3HOUJ 5E3LA 4XLPF 1QO0D 2GXAA 1ETVA 3IH4A 4GDFA 3GF2A 4I2OA 2L9SA 2MC4A 2X6WA 4IJAA 5L3CA 2HYFA 1RUNA 1R1TA 4BY1J 1YS6A 2ME0A 3E5UA 3WTWC 2LYCA 4IHYA 3CUQA 1R7JA 3IP4B 2J5OA 4W97A 3PIPF 4I6ZA 2KLOA 2IW5A 1QGPA 4IXAA 3HOSA 1BR1A 3V8KA 3U2RA 2QA4I 2BY2A 1RI7A 2DYSH 2VBXA 3FZVA 1U8BA 3G1LA 4MO7A 1ZLKA 2NVUB 3QRFF 3DV8A 4V19K 3S2DJ 3ZMSA 2X6OA 1MBGA 4S04A 1WPKA 1ZLJA 2H8WA 2ZC2A 4M73A 3HZJA 3C2GA 3OOPA 3V7RA 4QWQA 4FASD 3SHFA 3OYGA 1DP7P 2GA2A 5D4RA 4RB0A 3OYLA 1PP8F 5HS7A 2IA2A 2FQ3A 2GXGA 2KHMA 1U5TA 2BE5F 2VOOA 1YO5C 4V2FA 1VQMI 3SZPA 3KIOA 4BAYA 1BOBA 3V7SA 1I5ZA 2EBIA 3SFIA 3VODA 3HGGA 1CF7B 2BW3A 4HDVA 1DUXC 5TJJA 4A2UA 5IT9K 4F3QA 4MQ9F 3K7AJ 5FD5A 1POGA 3HOVJ 2CG4A 2NXNB 2JA7J 2XGEA 3I56I 4IOAF 2MFZA 1ZGAA 1LJ9A 3S2WA 2FX0A 3V8LA 1JXSA 3RKQA 2DXIA 5M3FJ 1PUFA 4A3GJ 2XAQA 4WXDA 5C4XJ 1L0OC 1I50J 2MSYA 3BR1A 4CHUA 2W00A 1XGOA 2VPRA 2L9NA 4ZYHA 4YFXF 2IT0A 5HLHA 1K79A 3ABMH 3EUKL 3K4JA 1X2MA 2QSHX 1GXQA 1SC7A 1ZRCA 2M0CA 2MG4A 2E2IJ 3T1BA 1LEBA 4M9XA 3TKYA 3QODA 4MHGA 3E97A 2STTA 1WJAA 2V1XA 1IC8A 4DBRA 2XUBA 1V5GA 3IRRA 2A68F 2OF7A 4PJMA 3TEDA 1T6SA 3VEPA 1SEUA 4FISA 2DOAA 3PSIA 3RIRA 4HV5A 2HFHA 3S14J 3FXLA 3FK7A 3QPHA 2Z2SB 2NRAC 1Q1VA 4LK0F 2ICWG 5M5XJ 4RB3C 3H0GJ 3JRBA 4A3IJ 3MD2A 5ERIA 4FHTA 3HOYJ 1XCVA 1R6RA 2P81A 2WWYA 4Q48A 1J5YA 3SQNA 3F72A 4NC8A 4AC0A 1YLFA 4IO9F 1ZN2A 1YTYA 4NB5A 1OCCH 3O8HA 2LFBA 1QHGA 5KAIC 2E35A 3BQZA 3QOPA 3DFGA 4X1EA 1MJ9A 3RPQA 2BY3A 2OC6A 5EGOB 2ZFUA 2XAFA 1ZH5A 2EIMH 2X0LA 3VYRB 3BZCA 1U5TC 2IGOA 1VQ5I 3G73A 4I98B 5IP6A 2WB1N 1V3FA 2E1MB 4PCQA 4CZCA 2IEKA 2X6XA 3F8FA 1D0XA 3PSFA 2E7XA 1XS9A 4BBSJ 2X6YA 3ONQA 1MNEA 2ELKA 1TW3A 3E6BA 2MD5A 1BR2A 5IOZA 5BS6A 3I4NJ 1WFXA 3RTRA 1QZYA 1FC3A 1D1AA 3LNQA 1DU6A 4H0EA 5D5UB 2W25A 4KT6A 1G4DA 2ISYA 3LSTA 3G1MA 1B8IB 3SFZA 2LKXA 5C3EJ 2AO9A 3QP6A 2ADUA 5B5EC 2CRGA 4E7IA 2EB7A 1WJFA 2VQCA 5FO5A 4UY8I 3S2HJ 3KZIC 1ZGWA 2JUGA 3JRGA 1K61A 4OIPF 1TWHJ 2R92J 2GIZA 3SEQA 3HOTA 2BXYA 2X4HA 2HYJA 4KN7X 1DPRA 2DJIA 1H9TA 1NHAA 3ZQHA 2Z5UA 1SMTA 2M7BA 4A3MJ 1UCRA 2HS5A 5F04A 2J5PA 2IGKA 3FWEA 1BI0A 3KP3A 4HSRA 2EZIA 4N9HA 1KYZA 1T08B 5LEKA 1UHMA 4PFPA 3K70D 2R5ZA 1K7AA 1KU2A 2WY7Q 4WX9A 1MW7A 4CZZA 4JP0A 3OYIA 2XAGA 3IH2A 4MQVA 3RSNA 2ZO4A 5E8IA 1J59A 1YRNA 2RREA 1FZPB 2KKOA 5HLTA 2CS3A 2DW4A 2RGVA 5GADJ 2HOAA 2EJRA 2YR2A 5LLQA 1BL0A 1J09A 4HQMA 2IS1A 2HKOA 2ZNZA 1TZLA 4FETA 3JCUC 4PSWA 5DD4A 4BBRJ 2K4JA 2FSWA 2Q2EA 3FMSA 1FYLA 4JQFA 4BE2A 2D5VA 2LLKA 3OYDA 2DMUA 3BZKA 1FEXA 1N25A 1BW6A 3OYHA 2XF5A 4IHSA 2UZKA 4IHTA 4GO1A 1HKSA 3DF8A 2F4MB 2YSRA 1XCBA 2UV1A 3CUQC 3H35A 2OTLI 2HXIA 1TT0A 5HDGA 2OCCH 2XDVA 4E4HA 5CQGA 3I71A 2HYGD 5L3BA 4I7HA 3HHGA 1VQ7I 3UKGA 3EUHA 3FHZA 4IVNA 3FKIJ 3E6MA 1OPCA 1IO2A 4MFEA 5K5QA 2HWVA 3FM3A 3JRFA 2OZUA 5DDGA 2IP2A 5F0HA 1P92A 3DEEA 5LFAA 3IAS2 4LG0B 2CV1A 3CCUI 3RPUA 4HX8A 1D1CA 2RQPA 2NVXJ 3K1PA 3REOA 2VKHA 4JYKA 2QCOA 2QBYB 3AL0B 2P5VA 1LVKA 2DU9A 5CYVA 4LG0A 1Z77A 2DA3A 2A05A 4ZDPA 1FJLA 5ILVA 3QWLA 2O7OA 4G94A 4I0BA 2O61A 2JZYA 3KYDB 4F7ZA 5HDNA 1UG2A 5J1UA 4IHVA 3ZQLA 1LPQA 3G3ZA 3IHUA 4BY7J 4RGXA 4PZJA 1TQMA 5JHFA 2GQQA 1MKMA 2BVMA 2X85A 4AVZA 2B9SA 5LHIA 2VJJA 2V1NA 3I4PA 4O5VA 4ESFA 4UVCA 2G7UA 5J40A 2WAQN 3JW4A 3B73A 2ZKZA 3VYTB 2WB1A 1J75A 2XB5A 2CUJA 4LB6B 3RQIA 2EFPA 4DZJA 3QYBA 1LFPA 3RZDJ 1TNSA 1Y1VJ 3DWLE 1XSVA 2PBIA 1MH4A 1XTAA 2EA4A 1ETKA 4KNYA 1WI9A 1UJ8A 2XIGA 4A93J 3ECHA 1FSHA 2M8EA 2R7RA 4BXUA 2DA7A 3BDDA 2EV0A 4L5EA 4HDUA 4FCYA 1O3RA 1XPXA 5D5XB 1R4MB 3A01B 1QU3A 3CCQI 3I64A 1K4SA 3ABUA 2XKPA 3ECOA 4LIUA 2XAUA 1Z6TA 5FKNA 2O8KA 2W84A 1WZ2A 3LSJA 3SXYA 1TLHB 2GOXB 2V1UA 2R7WA 3PO3J 1U9NA 3ULQB 5IP9J 3A03A 1SMYF 5E3NA 3OYJA 1ZKGA 1FT9A 3GO5A 4XIDA 2JK3A 3L2VA 1XDSA 4RAYA 5F1RA 3PO2J 4XRSG 3P7NA 4I76A 3FISA 1RR8C 2KT0A 2LVSA 4AD9A 2EZKA 2LNBA 5F08A 4UUSA 3H36A 5HNFA 4ZDOA 1FP1D 1YRNB 4GFBA 5JVTA 4LG3A 5F0FA 1K83J 2K5CA 3MCZA 1OCZH 1WJ5A 2OBPA 3HTUA 5LGUA 1YIOA 1DGWY 4A3KJ 5LGTA 3MQ0A 2MA3A 3JTGA 4P9FA 1ETWA 5EG0B 4JX6A 4OIRF 2WAFA 5E8GA 2GIVA 1JKOC 5B66C 1T39A 2NAZA 3WODF 4PGHA 2Q2EB 3QP5A 4ESBA 1B4AA 1P6RA 2MGQA 1Y1WJ 2PLYA 2VJIA 2JMWA 1ZK8A 1LEAA 1PYVA 1O3SA 1W7PB 1I3AA 1WJDA 3CCLI 1J2XA 1OFCX 1DP3A 3ABKH 1FSEA 3QU3A 3CCEI 3E5QA 4AU7A 4XKVA 2HOTA 3HG9A 1MMGA 5F64A 3ERMA 1IV6A 1IGNA 1R9TJ 3CCJI 1F9NA 5IT3A 3N05A 1HW1A 5DEQA 3ZGKA 1FLIA 4KJZA 2A6TA 1T56A 2F5EA 2A3SA 2X9DA 4LD5A 1A6QA 4N9IA 5D5WB 2K4BA 4N0BA 3BZ6A 4DYCA 2FBIA 2ETHA 3CTAA 1F1ZA 4YG2F 1ETYA 2M2EA 5F0CA 2HQ5A 4CO8A 4ETSA 3S3MA 1Z05A 3I59B 2EZHA 2K7LA 4F55A 3CF5F 1YW8A 4RB2C 2ZJRF 4BJ5C 4S0HB 4CXFA 2IVMA 3T0YA 3WE3A 1WRJA 3FK6A 3K1MA 4XKWA 3FXKA 1A6IA 4CSWA 2VQGA 1JGSA 1S3JA 4LOCA 4BE0A 3ERED 2XAJA 2VBYA 3ZMVA 5E1ZB 3HEFA 2ZMEC 2DTRA 4B8XA 2K3FA 2DCEA 3LL7A 4XOPA 2DT7B 2FEZA 3TOAA 3F22A 1Z6RA 4J19A 2MYSA 3BCBA 4XR6A 2CQKA 5EZGA 3K2AA 1ODDA 3TO7A 2KJCA 1IG7A 2L4AA 2L54A 3KLNA 2VKDA 2P6TA 4PJJA 3W6JB 4CUGA 5L3GA 3T8TA 3KFWX 2CFOA 4ZZDA 4Z2YA 1TC3C 5TISC 3QOEA 3EUAA 3ZN1A 2QGUA 4ENMA 4A3JJ 1NTCA 5LHGA 4YIIA 1B59A 1OYWA 4A5NA 5D8LB 1HDPA 3GFIA 2IRFG 4A3CJ 2GZWA 3JRHA 1X1AA 4Q4ZF 3ZPLA 1ULYA 1PUEE 4HA8A 3LSPA 2NYXA 1B6AA 4QSHA 2XGDA 4B43A 1RUOA 5DUKA 3IRQA 4UUSB 4A3BJ 3KZYA 3P9CA 3JSOA 3EQLF 2DA1A 3PQJA 2FA5A 5CVJA 2F5FA 2CJJA 4UXNA 4XNFA 5FROA 2R7ZJ 4IQJA 3GFJA 2M34A 3DKWA 5EG0A 4HQEA 1K6OA 5DS9A 1B8IA 3KX2A 2LY9A 3W6KB 1R36A 2DMNA 3BG7A 4IZZA 1V54H 4BNCA 5DD8A 1PUFB 1SVOA 1WCMJ 3CUOA 3GFLA 4AIDA 4A3FJ 3ZOBA 1LFBA 2LDUA 3S93A 2ZXWH 1XGMA 3HOXJ 5J8FA 1WJEA 4XSZF 1JKQC 3BC8A 2UWMA 2CFXA 4CCOA 1O4XA 1N77A 1B72A 2VOPA 2R5ZB 4KUMA 4L9NA 4NNJA 4RGSA 4EEFG 4PJNA 1P2FA 2DQRA 3F6OA 1LDDA 3ZQ7A 5IOYA 1IAWA 1BI2A 4HRIA 3MKYB 2ECBA 1X1BA 1V5EA 2H6BA 3I58A 1F4KA 1YYVA 1GVJA 2QENA 3M07A 4EATA 1IXSB 2FU4A 3JAMK 1LE8A 2YS9A 4BUPA 2CQNA 2LRDA 4D7NA 3CP8A 5HS8A 1YX5A 2ZMEA 3FMQA 5BMZA 3ESWB 2M9HA 5HODA 4ZTFA 5GAEJ 2V26A 4DYRA 2FOWA 4XK4A 4A12A 3COAC 1IV8A 4BH9A 3LOCA 2PFBA 3LWFA 4GXOA 1IUYA 3KYLA 1BJZA 4LB5A 5E1WA 3I4MJ 4M3GA 1ZREA 2ESHA 3FXMA 4RB1A 4XLHA 1X4OA 3OL3A 3UR3C 3IKVA 5CJ9A 1JUPA 3DBRB 1ZR4A 1LDJA 3L1PA 1AHDP 5ILSA 4IX7A 3CCRI 1D0YA 1ON2A 3PNVA 3TO9A 2TCTA 3HBLA 3CDLA 3KLOA 4WK8F 4QPQA 1QQIA 4LMYA 1Y0UA 4XLFA 3BTJA 1P7JA 2OPTA 4MTDA 4OAZA 5IY5H 2XKOA 4BEHA 2HOSA 2VKEA 3WE2A 1A36A 2E1NA 1E0EA 4E6KG 2LOOA 4QPOA 1DQUA 3QYFA 1Z1DA 3F9KA 4HF2A 3PQKA 3G4SI 2CW8A 2F48A 2O0YA 4AM3A 2VPLA 3CLQA 2L2OA 3I3LA 2K9MA 2K9SA 3AG2H 1E17A 2WV1A 1YE9A 5IYCJ 3ZP5A 5EJCA 4K2EA 4V2GA 1VFCA 1MMNA 3CUQB 4DNCA 2ME6A 2YX7A 2M8GX 3NWTA 1Z0XA 3VSKA 3S17J 2R7XA 1FYKA 4CCNA 4ZYAA 3D1NI 2W1OA 1VQLI 2FQ4A 2W48A 3GZNB 3BPXA 1MNDA 2E71A 2K9QA 2AQEA 1SFEA 1HKQA 1SD5A 3L9FA 3BY6A 1KONA 2I8DA 4NC6A 4RAZA 2R5YA 5E18F 1ZR2A 3ZMTA 4OAYA 4AVPA 3G1OA 4S05A 1UMQA 1UHWA 2FNPA 2VASA 5BPDA 3D5SC 5F6FA 2Y9YA 1ZG1A 2JN6A 1MMAA 1JE8A 1USSA 5IT9Z 4XRSA 3Q0WA 5HLGA 3AKZA 3HJEA 2HGCA 4HYEA 4B44A 2CO5A 4A6EA 4F91B 2JPCA 2EZLA 3AAFA 2D45A 2A6HF 2XC7A 4HLXA 4L9TA 1J0RA 2NVYJ 4EJWA 3DP7A 3CC4I 2F4IA 3IH3A 4KMUX 1FYMA 3KP4A 1RPWA 4C3JJ 1ON1A 1MJBA 2LC2A 3ISPA 3GLXA 3LQQA 2V6EA 4XN3A 5HOOA 5CVIA 4ENJA 4M3DA 2HQRA 3HRMA 3TQNA 2A5WA 2ELHA 3HL2A 2MD0A 4ENKA 5L3FA 3BG6A 3M3YJ 2B63J 1OYIA 3KZZA 2CU7A 2HOEA 2KDOA 1SVLA 1UZCA 1ZRDA 3KETA 3HOWJ 3KE2A 1TWCJ 1A35A 3I53A 5BPIA 5JVGF 4LLGF 2QEXI 4XRFA 1FBQA 2K27A 3W2VA 2HPIA 5ED4A 3J7AO 3CO6C 2ZSIB 2UXNA 5ICGA 3T5XA 5E3OA 3SYTA 1HLVA 3RYRA 2F2EA 3K4BA 1HC8A 1IUFA 2OQGA 2DFEA 3U1KA 1IRFA 2EH3A 1TT5B 1QZEA 1O3QA 1Z21A 1I3QJ 3PJRA 3K0LA 2M0MA 2EWNA 1BW5A 3DPLC 4AIKA 1X4PA 3A02A 3QYEA 1VQ4I 2R7QA 2VI6A 4YEJA 3CMYA 2H1LA 2I5UA 4JK1X 4M9SA 4UV8A 1NH3A 3LFKA 1YITI 2JPBA 4D1QA 5GPCA 4P55A 3OYNA 3CCSI 2F4OB 2QLZA 1G3YA 3GTPJ 4IPAA 3W3CA 2P0WA 3ABTA 3F6VA 4BQNA 1MZBA 2R7TA 2EK5A 2HTSA 4ZTJA 3A4CA 4DJAA 3GTQJ 1XSXA 2CW0F 2E1MC 2QSFX 3SJMA 4C3HJ 1G6NA 1U3EM 2XHKA 3W2WA 1CQTA 2Y9ZA 1A04A 4XKCA 2JRTA 4F52A 4WF2A 3BWGA 1DU0A 1JT0A 3E7LA 2P4WA 5H6QA 3BR6A 1RNLA 2JSPA 3LA2A 1EH7A 3FBIB 5GTIC 2E7WA 2K9NA 3KEOA 3MAJA 2A07F 4ZJZA 3CP2A 1USTA 4GRIA 1Z7LA 2PMZN 4AIJA 4EM0B 4X0GA 1EJ9A 2VJ5A 2XGXA 3VFZA 3C1DA 2V7FA 2H6CA 4A69C 2DA2A 2Y75A 3KP2A 1Y6IA 2MC3A 3V4GA 1EA3A 1TWFJ 1P4AA 1IDZA 4FX0A 4PSXA 2OTJI 3D0SA 1SANA 4A5MA 2F5DA 3OYFA 3LAPA 1ONVA 4YELA 2QQAA 2L0KA 2K86A 1ZHFA 1OCTC 5C4JJ 3FXQA 4A0XA 2JA6J 3BG3A 3MZ8A 5DYMA 1TQIA 4WXHA 2IA1A 3CC7I 2L01A 4Q5SF 1Y8RB 5EEAA 2ZSHB 4OU0A 2JT1A 1HSJA 4GYGA 1RIOH 2B7EA 3HUGA 1P7IA 3WTYC 1WGXA 4FQGA 2CGPA 4Y3OA 1RKWA 4JOMA 1JKPC 5B3SH 1QVTA 3IC7A 2Y0MA 1FOWA 1W0TA 1ZAOA 4CCJA 1YJWI 2M87A 2KP6A 2XF6A 4CH7A 3P9IA 2MBFA 3OYMA 5LD2C 2IXSA 3MN2A 2DMTA 2DYRH 1Y56A 1U9OA 3L2CA 1Z9CA 4RM3A 2FMYA 3MZHA 1A5JA 2ELJA 5FFXA 3X2QH 5DTDA 3ZCOA 5DM6F 2DA6A 4KA4A 2VIXA 2JA5J 3PM1A 4XM3A 2HDDA 2Y0SN 4XLAA 3PIOF 2ZFWA 3OSFA 3Q0VA 1LQ1A 5DM7F 2KMUA 4R8HA 3S15J 4WXCA 2R3SA 4EJUA 1U8RA 2XGCA 2JSCA 5DCMA 1FBUA 1PVEA 3ZQIA 4BEHB 3ROUA 4HX7A 2ZMEB 4M9ZA 4ZYEA 1Z7UA 4C2UA 3O6BB 3TW6A 5E79C 3HPGA 1W0UA 2PMHA 3HYIA 1P9QC 2BXZA 2YU3A 3KCCA 4L0ZB 1Q1HA 2JUCA 2Y0SA 4IHXA 1KQ9A 1XX5A 2WA0A 2COMA 3HKZN 3LA7A 1XDUA 2JVGA 1H0MA 3U9GA 3G6EI 3MMYB 4LLNA 1K78A 2F6CA 4NQWB 1RESA 3V8JA 1BC8C 1OCPA 4KIFA 3V7CA 3ZMUA 1HSTA 3JRCA 1LUJB 2Z33A 2L9VA 3H1CA 3OS2A 5EGOA 3J81K 1X1CA 3RPUD 4AYBA 4HZFA 5HLIA 3ZN0A 4L9VA 1OCOH 3MKLA 2MH9A 2OZ6A 3H3VK 4B09A 6PAXA 3OMYA 4MEXF 2LY2A 2P8TA 3HRSA 4IRGA 4U7DA 3IUOA 2FBHA 3HB9A 1ENHA 4E7JA 3GFMA 2CQ7A 1Y8QB 2QYOA 2VXZA 3KEQA 2VC0A 4HF1A 2LG4A 2PN6A 1XN7A 5LHHA 4RM2A 2LBFB 3JAMZ 2XB0X 2DK5A 2QVOA 2H8RA 2VBZA 5J4YA 4DGWB 4ZH4F 3C2BA 4IQ4A 1E3OC 3HSFA 2N8GA 3Q5FA 2HZTA 2W82A 2XAHA 3OOUA 4E7ZA 1YS7A 1JGGA 2E5NA 5EEHA 4ZYDA 3MKWB 1F36A 2XV4S 2ZXIA 3AFHA 1W5TA 1B9NA 2LMDA 5B1AH 3P9KA 3DBLB 5JFRA 3R61A 3VSLA 4HG2A 2PMZA 3KP6A 2RV8A 5CLSA 5TGTA 1BA5A 3DQVC 3ZQCA 2R5YB 3HRTA 2K02A 1R5HA 3TMOA 1FP2A 1OKRA 2EFWA 3HOZJ 3OS0A 1BC7C 3BQYA 1TL8A 4UVBA 2XRLA 3LAJA 2R0QC 2IGNA 4H4KC 3L2QA 2PI0A 4IRHA 5AIQA 3WTSC 1BI1A 1X58A 3M1CA 1M1EB 5KAFC 2KZGA 5FRMA 2BZTA 4I01A 1LVAA 4E7HA 3F0CA 4G7OF 1BOAA 1QHHD 2DTZA 2OD5A 2ZXHA 4EMSA 2L7ZA 4A3DJ 3DPTA 2EINH 1VF9A 2WADA 4FTHA 1OQYA 2Y69H 3S32A 2DLLA 1U2WA 2HR3A 1ITYA 1OYYA 3NWSA 2D1VA 1SAUA 5FD6A 5J1RA 3OS1A 5L3EA 3J7ZI 3WGHA 3Q9SA 2XSJC 2P7CB 2VXDA 1SVMA 5E1XA 3L7WA 3MKZA 3WGGA 3IKTA 5LRRA 2FD5A 3DU5A 1T0FA 4BE1A 5A2QZ 2LY1A 1IN5A 2ACJA 3W6VA 1G8XA 4XN0A 2GXBA 4A0YA 2P6SA 2QZ8A 1SFKA 1MH3A 2DOFA 1MIJA 2PG4A 5BQTA 3RI4A 2DFFA 5K5OA 3IWFA 4LITA 2GOMA 3K2ZA 3NARA 5DV5A 4AYBN 4OWRB 4II3A 5FGMA 1WH5A 1I1SA 5J6XA 2VE8A 5IP7J 3QU6A 4HNUA 3OWTA 2CV2A 5BOXA 1R1UA 1IRGA 1BBYA 1GV5A 2CYYA 1OLTA 2HNHA 3BROA 5K7HA 5D6EA 1ETOA 1E3HA 4MEYF 4WWCA 1VQ9I 2M4KA 1TWGJ 2M30A 3QPTA 2DK8A 1UFMA 1Z3YA 2QKMB 3PFIA 3RZOJ 2STWA 3H92A 4CDGA 1FY7A 3R6SA 2ZNYA 5LRSA 3OY9A 3GTJJ 3EDPA 3CF2A 4BXXJ 2QQBA 3HGYA 3JRAA 2L02A 4RGRA 2JVHA 2HEOA 1VQPI 3GCMA 1JT6A 2NOJB 3VOEA 2KFDA 2DPUA 3LSMA 1ZG5A 2DODA 3L09A 2R7FA 2OA4A 3C18A 1GUUA 2QM3A 3HXLA 4BJ6C 4XOTA 4I09A 2AXTC 1IRZA 3WTXC 4O3MA 1JKRC 3BG5A 2VONA 3PL8A 2M1BA 3HSEA 4M3EA 2BY1A 5E3MA 2R4GA 4II2A 1T0FC 5CPRB 3WTVC 3GX4X 3NQOA 2IA0A 2DFHA 1F5TA 4OIOF 1EH6A 5FFZA 1FPQA 4CCKA 3K9TA 1YW7A 1IN6A 1XMXA 2HI3A 2OU2A 2ZCWA 1WI3A 2RNJA 1WJCA 1EH8A 4EJVA 1R00A 3DLLF 1XG1A 3TW7A 2NS0A 3WU2C 2CQXA 3RQ4A 2X48A 2PJRB 3CMEI 2KQRA 4KT5C 1X3WB 2BGCA 5EDNA 2GM4A 1V55H 4ZZLA 1FIAA 1O7LA 3CDIA 1MBKA 3H3ZA 4M3FA 3ZQFA 1JJ8C 2CUFA 1SAXA 3AG4H 1D0ZA 3HDDA 1XGSA 2IS2A 3GZ6A 1ZELA 1QZZA 1XMKA 3H3UA 3IV5A 1T33A 1NK2P 5D6FA 1AU7A 1LB2A 1N75A 1UELB 4I99C 2HQAA 3F8CA 2C6YA 4B47A 1UG0A 3RJPA 4MTEA 3ELKA 2VQLA 3RYPA 2KIFA 4Y33A 3O8GA 2AS5F 2RKHA 3KP5A 2OJED 3LSHA 5E20A 3S1NJ 2EFQA 4M71A 4KN4X 4CCMA 2DJNA 2WV0A 1AWCA 2E2JJ 2V9VA 2ZB9A 3ZMZA 1QNTA 3LMMA 2F5CA 2K3PA 3MFKA 4EJTA 3A1YA 3BJ6A 1C0WA 2RNGA 3I5UA 5J47A 2TRTA 2PMUA 2CWEA 5DCMB 3EETA 1ACIA 2XVCA 3GTOJ 1YQAA 3F8BA 4E7SA 4JBAA 4EGYA 1WSUA 1Y39A 4L9JA 1OJLA 2Y31A 4IL6C 2OAZA 2RQQA 2L9RA 1T2KA 1APLC 1O7FA 1XC5A 4B48A 2DDBA 1P4XA 1L3LA 2TDXA 3ZMDA 2QWWA 4AIHA 1FMWA 1YIJI 4D0PA 4XRMA 3IWZA 2QSGX 5AONA 3FKJA 1VQKI 3ABLH 4L5IA 2BYVE 3E6CC 2JRMA 3EYYA 1IDYA 2DFIA 3BR3A 1F43A 3C3WA 5M3MJ 5M5YJ 1S72I 3QQAA 4E70A 4M74A 2NVQJ 4ZDLA 2G7HA 3LSRA 2H1KA 2L3DA 3G71I 2E34A 2KISA 2VN2A 4GGGA 3J7YJ 1E3PA 3FXJA 2MH2A 5ICFA 4HSTA 1KQ8A 1TQPA 2HDWA 4NUBA 3BR5A 3RKYA 5F27A 2Z9OA 3K4LA 3BOQA 2KDZA 3BPVA 3C2HA 2WAEA 2VE9A 4XLNF 2RDPA 4MGRA 4DZPA 3A2KA 2HXOA 3KPHA 2LP0A 3QPSA 1MMDA 1AKHA 4ZYGA 3CJNA 3ZXSA 3FM5A 4KFCA 2W4SA 2HVQA 1W36D 2NS8A 5HVQC 4L18B 2FJ1A 2K9LA 1OISA 3ZRGA 3ASOH 5J1YA 4B1RA 5ICCA 4YIFA 2DT5A 3FXRA 1MBJA 5K1YA 2LK2A 3CMAI 3I54A 4IEJA 2JQ7A 2E60A 1B1BA 1RC9A 3L2UA 3B02A 4E7KA 3DCFA 2R93J 4DW6A 1IZ1A 2CH0A 1KU9A 1JTXA 1STZA 2O03A 1KA8A 5CVRA 1KQ0A 3AG3H 3R0AA 2BHZA 1KU3A 1YW9A 4LLLA 2WC2A 3BT9A 2YUSA 4RGUA 2V6CA 4MLOA 2RN7A 2EIJH 5DUIA 1P4WA 1RR7A 3SZGA 1FTZA 4NHJA 3BR0A 1VQOI 4M6VA 1UAAA 3S1QJ 4B3AA 5FB2A 2EIKH 3QAHA 1JTYA 4Y52J 5LBQA 1IXRC 1I6HJ 1SD7A 1FBSA 3I0TA 3WG7H 2AXLA 4IF4A 1FWZA 2DAOA 4BL0B 4DBQA 1T38A 3BLYA 2ZJPF 3VWBA 4KIGA 2VUMJ 4A6DA 2IGMA 4D7MA 2Z3YA 4D5FA 3JR9A 1GV2A 3Q3SA 1PP7U 5KVRA 2VL8A 1OMIA 2DDAA 5EEGA 4C2MJ 4IKFA 2EPFA 3DLAA 5FKMA 3CESA 3W2AA 4D9JA 3U21A 3H0DA 5GPAA 1IXCA 1MBFA 1S6LA 1AOYA 1WHUA 1H89C 2HDCA 1WQ2A 2HKXA 1FNNA 2E2HJ 3J81Z 1TBXA 4RDUA 2AHQA 5EF6A 5CVVA 2IS6A 1KU7A 1U5TB 2DA4A 4BYYA 2EV6A 3OR2C 3ZQGA 1REPC 3LQRA 4KITB 5IPAA 1X1DA 2FXAA 2YU9J 2OUMA 4CA0A 2E1CA 2JA2A 2ID3A 3GTLJ 1IRXA 3BJOA 2CQQA 3E3VA 1BN5A 2M45A 2V4JC 1V5FA 2QUFA 1YHQI 1WVRA 3H5RA 4UB6C
chains in the Genus database with same CATH topology
3S15J 4ABZA 2XGCA 1OFCX 2MW8A 3ZQIA 1TWAJ 5JLXA 3JRDA 3TW6A 1W0UA 1RKTA 1JJ6C 1B72B 2HOTA 1IV6A 1IGNA 1R9TJ 2K40A 1T56A 2JJ7A 4IHXA 2X9DA 2Y2ZA 1MSEC 3TP3A 3MVPA 3HKZN 4D5CA 4FE4A 4DYQA 1HOMA 4DYCA 5FLMJ 4NDLA 3OSGA 1RESA 1OCPA 1FIPA 1ETYA 2M2EA 5F0CA 2HQ5A 3JRCA 3FIWA 2DMPA 2IBDA 2EZHA 3NAUA 5EGOA 1GDTA 1S7EA 1X2NA 4S0HB 4G12A 3FK6A 3GTKJ 1WH7A 2EQRA 1A6IA 3MKLA 1H88C 4Y7NJ 3H3VK 4LOCA 2NVTJ 4XICA 3QPLA 3HOUJ 5E3LA 1ETVA 3HEFA 1ENHA 1ORKA 3IH4A 3HB9A 1U78A 1IJWC 4BY1J 4IHYA 2ME0A 4J19A 2XB0X 5EZGA 4W97A 1VI0A 4I6ZA 2H8RA 3K2AA 3C2BA 1E3OC 1IG7A 2N8GA 3OOUA 3GTMJ 1JGGA 1U8BA 1TC3C 2GLOA 3G1LA 4MO7A 1F36A 4A3JJ 3S2DJ 1NTCA 2O9LA 2X6OA 2XPWA 1MBGA 3CCYA 1WPKA 1HDPA 4A3CJ 3JRHA 1JUSA 1BA5A 3ZQCA 2R5YB 1LFUP 3LSPA 3HOZJ 4QSHA 2XGDA 3WHCA 3BQYA 2XRLA 4UUSB 4A3BJ 2R0QC 2DA1A 4V2FA 2CJJA 1X58A 5M5WJ 2R7ZJ 1UHSA 2DMQA 2NOGA 2EBIA 1QRYA 3SFIA 3HGGA 2M34A 2L7FP 5EG0A 3F0CA 1MNMC 5DS9A 1B8IA 2DTZA 3S1RJ 1SFOJ 3M4OJ 4A3DJ 2L7ZA 2LY9A 2DMNA 1VF9A 4M3BA 4FTHA 5K7ZA 1PUFB 3K7AJ 4B4CA 5C44J 1POGA 1WCMJ 1ITYA 3HOVJ 2G0EA 5J1RA 2JA7J 2XGEA 4A3FJ 3ZOBA 1LFBA 2FX0A 3GBGA 3RKQA 5J3LA 2JA8J 5M3FJ 1PUFA 4A3GJ 3HOXJ 2FD5A 5C4XJ 2IAIA 1JKQC 1I50J 2MSYA 3BR1A 3W6VA 1O4XA 1B72A 2VPRA 4A3EJ 1MH3A 2R5ZB 5K7FA 4EEFG 5IOYA 5FLVA 1X2MA 2ECBA 2ID6A 2M0CA 3NARA 2MG4A 4AYBN 2E2IJ 1WH5A 5IP7J 1LE8A 1MBHA 2YS9A 3BTCA 4D7NA 2Y30A 1IC8A 2M9HA 5HODA 2OF7A 3TEDA 4DYRA 4XK4A 1ETQA 1GV5A 5K7HA 2E19A 4FISA 3LOCA 3DEWA 3Q0UA 1ETOA 3S14J 3CQZJ 3FK7A 2LD5A 1BJZA 3I4MJ 4M3GA 1Q1VA 1TWGJ 3SDGA 5M5XJ 3H0GJ 3JRBA 3RZOJ 4QTRA 4A3IJ 3HOYJ 1JUPA 1ZR4A 2P81A 3L1PA 3GTJJ 1AHDP 4BXXJ 2TCTA 3HGYA 3CDLA 3HBLA 1VNDA 3JRAA 1QPIA 3BTJA 1JT6A 1P7JA 2OPTA 4AC0A 3O8HA 2HOSA 2VKEA 2LFBA 1GUUA 2ECCA 3BQZA 5BNGA 3LSGA 4X1EA 1IRZA 3B6CA 5EGOB 1JKRC 3BG5A 4QIWN 4M3EA 5E3MA 1MSFC 3A01A 2K9SA 5EZHA 2WV1A 1RETA 4MFDA 5IP6A 5IYCJ 5JLWA 2WB1N 4V2GA 1VFCA 2IEKA 4AUXA 5FKLA 2HI3A 4BKXA 4C3IJ 1WI3A 4HNVA 4JX4A 2ME6A 2XPUA 1XS9A 1XG1A 4BBSJ 2M8GX 3TW7A 1Z0XA 3S17J 2ELKA 2CQXA 2X48A 3D1NI 2FQ4A 2W48A 5IOZA 3I4NJ 2K9QA 2NS7A 2GM4A 5EDNA 3LNQA 1DU6A 3GTGJ 1FIAA 4CYCA 1MBKA 4M3FA 1JJ8C 3ZQFA 2CUFA 3G1MA 4IHWA 1B8IB 2LKXA 3HDDA 5C3EJ 2AO9A 3TP0A 3IV5A 1T33A 2CRGA 2R5YA 1NK2P 1AU7A 1ZR2A 3S2HJ 1ZGWA 3BG9A 3G1OA 1UMQA 3JRGA 1K61A 1TWHJ 2R92J 2Y9YA 2JN6A 3O8GA 4A3LJ 2HYJA 3S1NJ 3ZQHA 2E1OA 2L7MP 4XRSA 4A3MJ 2DJNA 3Q0WA 5F04A 2E2JJ 2ZB9A 3JREA 2EZIA 2R5ZA 1EF4A 2TRTA 3BR2A 2EZLA 3GTOJ 4JP0A 2NVYJ 3IH2A 3IH3A 1YRNA 1RPWA 4C3JJ 1OJLA 2Y31A 1LE8B 2DA5A 2RAEA 2HOAA 2L9RA 1JUMA 1APLC 4M3DA 1BL0A 1XC5A 1H8AC 2LR8A 5FJ8J 3M3YJ 2B63J 4BBRJ 2CU7A 9ANTA 2D5VA 2LLKA 1FEXA 2DMUA 4XRMA 3HOWJ 1BW6A 1TWCJ 2DN0A 1IDYA 2XPVA 3BR3A 1F43A 1MBEA 5M3MJ 2HXIA 3BTIA 4UUTA 5M5YJ 5FKKA 5E3OA 1HLVA 3QQAA 2NVQJ 1D5YA 3UKGA 2CUEA 3LSRA 1IUFA 2I10A 2H1KA 1GVDA 4RBOA 2EH3A 3FKIJ 4MFEA 5FKOA 1I3QJ 5IYDJ 1NK3P 4MIMA 3JRFA 1BW5A 2VKVA 3A02A 3BR5A 5F0HA 2VI6A 5F27A 3CMYA 3S16J 2GBYA 2KDZA 4FE7A 3WHBA 4DZPA 2HXOA 5GPCA 2NVXJ 2LP0A 4JYKA 2QCOA 3QPSA 1AKHA 1HCRA 3JRIA 3GTPJ 3VPRA 1QVUA 1Z77A 2DA3A 5EYRA 2NS8A 1FJLA 2FJ1A 3GTQJ 2O7OA 5J1YA 3SJMA 4B1RA 4C3HJ 1AKHB 3OIOA 1MBJA 1UG2A 2LK2A 2XSDC 5J1UA 2COBA 4IEJA 3ZQLA 4W1UA 2JWTA 2Y9ZA 1CQTA 4IHVA 4BY7J 5F1JA 4CYCB 1DU0A 1JT0A 3E7LA 3DCFA 3BR6A 4DW6A 2R93J 2WAQN 1JTXA 2K9NA 2XB5A 3RQIA 4DZJA 3RZDJ 2PMZN 3BT9A 2YUSA 4MLOA 1Y1VJ 3HM5A 1RR7A 4A69C 1FTZA 1MH4A 3BR0A 1ETKA 2DA2A 4M6VA 4A93J 3S1QJ 1ZQ3P 1TWFJ 4B3AA 1IDZA 2DA7A 4L5EA 1JTYA 4FCYA 2QF7A 4Y52J 1SANA 3A01B 1I6HJ 2L0KA 1HDDC 1OCTC 5C4JJ 2JA6J 4X6AJ 3BG3A 4JX5A 3S1MJ 2VUMJ 2O8KA 5FKNA 4D7MA 1ZTRA 3LSJA 5EEAA 5IYBJ 4D5FA 3JR9A 1GV2A 3PO3J 3Q3SA 1G2HA 1U9NA 5IP9J 3A03A 3BTLA 5E3NA 1ZKGA 4C2MJ 1FTTA 4XIDA 1P7IA 2JK3A 1WGXA 5FKMA 3PO2J 5GPAA 1RKWA 1JKPC 1QVTA 1MBFA 4XRSG 1H89C 3B6AA 1ETXA 3FISA 4I76A 5GP9A 1W0TA 2E2HJ 2KT0A 2LVSA 2EZKA 5F08A 4RDUA 4UUSA 2AHQA 5EF6A 2DA4A 1HF0A 1YRNB 4GFBA 3MN2A 2DMTA 5F0FA 3ZQGA 1K83J 5IPAA 1U9OA 4A3KJ 2YU9J 1ETWA 5EG0B 1A5JA 4JX6A 2ID3A 3GTLJ 5DTDA 2CQQA 2DA6A 1GT0C 1JKOC 2JA5J 2LTPA 3PM1A 2HDDA 2Y0SN 2MGQA 1Y1WJ 3OSFA 3Q0VA 2JMWA 1ZK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S15 J;  4ABZ A;  2XGC A;  1OFC X;  2MW8 A;  3ZQI A;  1TWA J;  5JLX A;  3JRD A;  3TW6 A;  1W0U A;  1RKT A;  1JJ6 C;  1B72 B;  2HOT A;  1IV6 A;  1IGN A;  1R9T J;  2K40 A;  1T56 A;  2JJ7 A;  4IHX A;  2X9D A;  2Y2Z A;  1MSE C;  3TP3 A;  3MVP A;  3HKZ N;  4D5C A;  4FE4 A;  4DYQ A;  1HOM A;  4DYC A;  5FLM J;  4NDL A;  3OSG A;  1RES A;  1OCP A;  1FIP A;  1ETY A;  2M2E A;  5F0C A;  2HQ5 A;  3JRC A;  3FIW A;  2DMP A;  2IBD A;  2EZH A;  3NAU A;  5EGO A;  1GDT A;  1S7E A;  1X2N A;  4S0H B;  4G12 A;  3FK6 A;  3GTK J;  1WH7 A;  2EQR A;  1A6I A;  3MKL A;  1H88 C;  4Y7N J;  3H3V K;  4LOC A;  2NVT J;  4XIC A;  3QPL A;  3HOU J;  5E3L A;  1ETV A;  3HEF A;  1ENH A;  1ORK A;  3IH4 A;  3HB9 A;  1U78 A;  1IJW C;  4BY1 J;  4IHY A;  2ME0 A;  4J19 A;  2XB0 X;  5EZG A;  4W97 A;  1VI0 A;  4I6Z A;  2H8R A;  3K2A A;  3C2B A;  1E3O C;  1IG7 A;  2N8G A;  3OOU A;  3GTM J;  1JGG A;  1U8B A;  1TC3 C;  2GLO A;  3G1L A;  4MO7 A;  1F36 A;  4A3J J;  3S2D J;  1NTC A;  2O9L A;  2X6O A;  2XPW A;  1MBG A;  3CCY A;  1WPK A;  1HDP A;  4A3C J;  3JRH A;  1JUS A;  1BA5 A;  3ZQC A;  2R5Y B;  1LFU P;  3LSP A;  3HOZ J;  4QSH A;  2XGD A;  3WHC A;  3BQY A;  2XRL A;  4UUS B;  4A3B J;  2R0Q C;  2DA1 A;  4V2F A;  2CJJ A;  1X58 A;  5M5W J;  2R7Z J;  1UHS A;  2DMQ A;  2NOG A;  2EBI A;  1QRY A;  3SFI A;  3HGG A;  2M34 A;  2L7F P;  5EG0 A;  3F0C A;  1MNM C;  5DS9 A;  1B8I A;  2DTZ A;  3S1R J;  1SFO J;  3M4O J;  4A3D J;  2L7Z A;  2LY9 A;  2DMN A;  1VF9 A;  4M3B A;  4FTH A;  5K7Z A;  1PUF B;  3K7A J;  4B4C A;  5C44 J;  1POG A;  1WCM J;  1ITY A;  3HOV J;  2G0E A;  5J1R A;  2JA7 J;  2XGE A;  4A3F J;  3ZOB A;  1LFB A;  2FX0 A;  3GBG A;  3RKQ A;  5J3L A;  2JA8 J;  5M3F J;  1PUF A;  4A3G J;  3HOX J;  2FD5 A;  5C4X J;  2IAI A;  1JKQ C;  1I50 J;  2MSY A;  3BR1 A;  3W6V A;  1O4X A;  1B72 A;  2VPR A;  4A3E J;  1MH3 A;  2R5Z B;  5K7F A;  4EEF G;  5IOY A;  5FLV A;  1X2M A;  2ECB A;  2ID6 A;  2M0C A;  3NAR A;  2MG4 A;  4AYB N;  2E2I J;  1WH5 A;  5IP7 J;  1LE8 A;  1MBH A;  2YS9 A;  3BTC A;  4D7N A;  2Y30 A;  1IC8 A;  2M9H A;  5HOD A;  2OF7 A;  3TED A;  4DYR A;  4XK4 A;  1ETQ A;  1GV5 A;  5K7H A;  2E19 A;  4FIS A;  3LOC A;  3DEW A;  3Q0U A;  1ETO A;  3S14 J;  3CQZ J;  3FK7 A;  2LD5 A;  1BJZ A;  3I4M J;  4M3G A;  1Q1V A;  1TWG J;  3SDG A;  5M5X J;  3H0G J;  3JRB A;  3RZO J;  4QTR A;  4A3I J;  3HOY J;  1JUP A;  1ZR4 A;  2P81 A;  3L1P A;  3GTJ J;  1AHD P;  4BXX J;  2TCT A;  3HGY A;  3CDL A;  3HBL A;  1VND A;  3JRA A;  1QPI A;  3BTJ A;  1JT6 A;  1P7J A;  2OPT A;  4AC0 A;  3O8H A;  2HOS A;  2VKE A;  2LFB A;  1GUU A;  2ECC A;  3BQZ A;  5BNG A;  3LSG A;  4X1E A;  1IRZ A;  3B6C A;  5EGO B;  1JKR C;  3BG5 A;  4QIW N;  4M3E A;  5E3M A;  1MSF C;  3A01 A;  2K9S A;  5EZH A;  2WV1 A;  1RET A;  4MFD A;  5IP6 A;  5IYC J;  5JLW A;  2WB1 N;  4V2G A;  1VFC A;  2IEK A;  4AUX A;  5FKL A;  2HI3 A;  4BKX A;  4C3I J;  1WI3 A;  4HNV A;  4JX4 A;  2ME6 A;  2XPU A;  1XS9 A;  1XG1 A;  4BBS J;  2M8G X;  3TW7 A;  1Z0X A;  3S17 J;  2ELK A;  2CQX A;  2X48 A;  3D1N I;  2FQ4 A;  2W48 A;  5IOZ A;  3I4N J;  2K9Q A;  2NS7 A;  2GM4 A;  5EDN A;  3LNQ A;  1DU6 A;  3GTG J;  1FIA A;  4CYC A;  1MBK A;  4M3F A;  1JJ8 C;  3ZQF A;  2CUF A;  3G1M A;  4IHW A;  1B8I B;  2LKX A;  3HDD A;  5C3E J;  2AO9 A;  3TP0 A;  3IV5 A;  1T33 A;  2CRG A;  2R5Y A;  1NK2 P;  1AU7 A;  1ZR2 A;  3S2H J;  1ZGW A;  3BG9 A;  3G1O A;  1UMQ A;  3JRG A;  1K61 A;  1TWH J;  2R92 J;  2Y9Y A;  2JN6 A;  3O8G A;  4A3L J;  2HYJ A;  3S1N J;  3ZQH A;  2E1O A;  2L7M P;  4XRS A;  4A3M J;  2DJN A;  3Q0W A;  5F04 A;  2E2J J;  2ZB9 A;  3JRE A;  2EZI A;  2R5Z A;  1EF4 A;  2TRT A;  3BR2 A;  2EZL A;  3GTO J;  4JP0 A;  2NVY J;  3IH2 A;  3IH3 A;  1YRN A;  1RPW A;  4C3J J;  1OJL A;  2Y31 A;  1LE8 B;  2DA5 A;  2RAE A;  2HOA A;  2L9R A;  1JUM A;  1APL C;  4M3D A;  1BL0 A;  1XC5 A;  1H8A C;  2LR8 A;  5FJ8 J;  3M3Y J;  2B63 J;  4BBR J;  2CU7 A;  9ANT A;  2D5V A;  2LLK A;  1FEX A;  2DMU A;  4XRM A;  3HOW J;  1BW6 A;  1TWC J;  2DN0 A;  1IDY A;  2XPV A;  3BR3 A;  1F43 A;  1MBE A;  5M3M J;  2HXI A;  3BTI A;  4UUT A;  5M5Y J;  5FKK A;  5E3O A;  1HLV A;  3QQA A;  2NVQ J;  1D5Y A;  3UKG A;  2CUE A;  3LSR A;  1IUF A;  2I10 A;  2H1K A;  1GVD A;  4RBO A;  2EH3 A;  3FKI J;  4MFE A;  5FKO A;  1I3Q J;  5IYD J;  1NK3 P;  4MIM A;  3JRF A;  1BW5 A;  2VKV A;  3A02 A;  3BR5 A;  5F0H A;  2VI6 A;  5F27 A;  3CMY A;  3S16 J;  2GBY A;  2KDZ A;  4FE7 A;  3WHB A;  4DZP A;  2HXO A;  5GPC A;  2NVX J;  2LP0 A;  4JYK A;  2QCO A;  3QPS A;  1AKH A;  1HCR A;  3JRI A;  3GTP J;  3VPR A;  1QVU A;  1Z77 A;  2DA3 A;  5EYR A;  2NS8 A;  1FJL A;  2FJ1 A;  3GTQ J;  2O7O A;  5J1Y A;  3SJM A;  4B1R A;  4C3H J;  1AKH B;  3OIO A;  1MBJ A;  1UG2 A;  2LK2 A;  2XSD C;  5J1U A;  2COB A;  4IEJ A;  3ZQL A;  4W1U A;  2JWT A;  2Y9Z A;  1CQT A;  4IHV A;  4BY7 J;  5F1J A;  4CYC B;  1DU0 A;  1JT0 A;  3E7L A;  3DCF A;  3BR6 A;  4DW6 A;  2R93 J;  2WAQ N;  1JTX A;  2K9N A;  2XB5 A;  3RQI A;  4DZJ A;  3RZD J;  2PMZ N;  3BT9 A;  2YUS A;  4MLO A;  1Y1V J;  3HM5 A;  1RR7 A;  4A69 C;  1FTZ A;  1MH4 A;  3BR0 A;  1ETK A;  2DA2 A;  4M6V A;  4A93 J;  3S1Q J;  1ZQ3 P;  1TWF J;  4B3A A;  1IDZ A;  2DA7 A;  4L5E A;  1JTY A;  4FCY A;  2QF7 A;  4Y52 J;  1SAN A;  3A01 B;  1I6H J;  2L0K A;  1HDD C;  1OCT C;  5C4J J;  2JA6 J;  4X6A J;  3BG3 A;  4JX5 A;  3S1M J;  2VUM J;  2O8K A;  5FKN A;  4D7M A;  1ZTR A;  3LSJ A;  5EEA A;  5IYB J;  4D5F A;  3JR9 A;  1GV2 A;  3PO3 J;  3Q3S A;  1G2H A;  1U9N A;  5IP9 J;  3A03 A;  3BTL A;  5E3N A;  1ZKG A;  4C2M J;  1FTT A;  4XID A;  1P7I A;  2JK3 A;  1WGX A;  5FKM A;  3PO2 J;  5GPA A;  1RKW A;  1JKP C;  1QVT A;  1MBF A;  4XRS G;  1H89 C;  3B6A A;  1ETX A;  3FIS A;  4I76 A;  5GP9 A;  1W0T A;  2E2H J;  2KT0 A;  2LVS A;  2EZK A;  5F08 A;  4RDU A;  4UUS A;  2AHQ A;  5EF6 A;  2DA4 A;  1HF0 A;  1YRN B;  4GFB A;  3MN2 A;  2DMT A;  5F0F A;  3ZQG A;  1K83 J;  5IPA A;  1U9O A;  4A3K J;  2YU9 J;  1ETW A;  5EG0 B;  1A5J A;  4JX6 A;  2ID3 A;  3GTL J;  5DTD A;  2CQQ A;  2DA6 A;  1GT0 C;  1JKO C;  2JA5 J;  2LTP A;  3PM1 A;  2HDD A;  2Y0S N;  2MGQ A;  1Y1W J;  3OSF A;  3Q0V A;  2JMW A;  1ZK8 A; 
#chains in the Genus database with same CATH topology
 3BCA A;  4ABZ A;  3M9A A;  2GWR A;  4BJT A;  3ML6 A;  3GEZ A;  3H9Q A;  4XLE A;  3TDZ C;  1YJN I;  2G9W A;  2MW8 A;  5L3D A;  4XLC A;  4WCG A;  2X1C A;  4HLY A;  1O57 A;  5JLX A;  1UB9 A;  5ILU A;  3JRD A;  1SFU A;  1E2X A;  1HQC A;  4Y17 A;  1B72 B;  1I1G A;  4RLF A;  1DGR M;  1BR4 A;  1O3T A;  1H9G A;  4N4N B;  3LA3 A;  4OOI A;  4HOB A;  3KEY A;  3FBN B;  2Z1D A;  2CV0 A;  1XGN A;  1R58 A;  1TTY A;  4PK4 A;  3J80 K;  2O3F A;  3M8F A;  3MVP A;  2Q8K A;  4BU2 A;  4ON0 A;  5GAG J;  4LFU A;  1S7A A;  2V9K A;  2QQ9 A;  1I27 A;  1NG7 A;  2Z16 A;  4NDL A;  2HVR A;  1R5I D;  4EJO A;  3OSG A;  3LSK A;  1T8I A;  4BDY A;  5JHU A;  4XON A;  4RMN A;  5ICE A;  2R7U A;  2DMP A;  4G7Z F;  2VJ4 A;  3M8E A;  2NNY A;  1T95 A;  4XBF A;  1BI3 A;  1X2N A;  4G6Q A;  2ZJ2 A;  4ASN A;  4KYW A;  3ASN H;  1Z91 A;  2P5L C;  1WH7 A;  2WTE A;  3GTK J;  1W4M A;  5JR3 A;  3G2B A;  4XKB A;  5KK1 A;  1H88 C;  2X51 A;  4Y7N J;  2NVT J;  4XIC A;  1JHF A;  3GW2 A;  3QPL A;  2P7V B;  4XMY A;  2O6G E;  4HNT A;  1DDN A;  1ORK A;  2KL4 A;  3MEX A;  3CJR B;  1U78 A;  4AWX B;  2V9P A;  1IJW C;  3JSP A;  3F8M A;  3J80 Z;  4I0A A;  2KIU A;  2VB6 A;  1VI0 A;  4P5O A;  4LK1 F;  1W5S A;  2HQN A;  2VBW A;  1RZ4 A;  1S29 A;  3TOB A;  1ZRF A;  4BQA A;  3TO6 A;  3GTM J;  2V79 A;  1S8N A;  2GLO A;  1N78 A;  1IF1 A;  4KIC A;  1LKX A;  3CLO A;  2H94 A;  2O9L A;  3SZT A;  2XPW A;  4GCV A;  3CCY A;  3SDB A;  3UNG C;  3IAM 2;  3KP7 A;  1BIA A;  1JUS A;  4N4O B;  1VTN C;  3C7J A;  3RDI A;  4UVA A;  1LFU P;  3TGN A;  2KRF A;  2WY8 Q;  3WGI A;  4UB8 C;  4R79 A;  1TW2 A;  2KPM A;  3WHC A;  2EA2 A;  3CZ6 A;  2A6E F;  3R4K A;  4OIQ F;  3HIF A;  1D5V A;  1BJA A;  2ISZ A;  1D8K A;  5M5W J;  3HC7 A;  1UHS A;  2DMQ A;  1QRY A;  2DT6 A;  2NOG A;  4Y4R A;  2L7F P;  2P5K A;  2LF8 A;  3PUF A;  1I39 A;  4P9U A;  1MNM C;  4U87 A;  1S7O A;  3R60 A;  3U1D A;  3S1R J;  1R71 A;  1SFO J;  3H9J A;  3M4O J;  1J7K A;  3DXJ F;  4M3B A;  5K7Z A;  4B4C A;  5C44 J;  3PNT A;  3CDH A;  2G0E A;  1WKM A;  3AG1 H;  3FX3 A;  4RAG A;  1MMS A;  3OYB A;  3DU6 A;  4XQF A;  3GBG A;  4U88 A;  2VC1 A;  3HRU A;  3OYA A;  5J3L A;  1D3Y A;  3M8J A;  2JA8 J;  2LF7 A;  3DTK A;  4G7H F;  2IAI A;  3CJT B;  4BS9 A;  3VB2 A;  4L0Y B;  4A3E J;  4HF0 A;  3H9G A;  3OIP A;  2FRH A;  5K7F A;  4HX4 A;  1K6Y A;  2H27 A;  2MLG A;  2HVS A;  3A0H C;  5FLV A;  2EIL H;  2ID6 A;  3HUG B;  1VQ8 I;  5FRN A;  3HHH A;  4R1H A;  1W7P A;  2QBY A;  5KNL A;  4EGZ A;  2KRH A;  3BP8 A;  4L5J A;  1W1W E;  1I6X A;  1MBH A;  3WTU C;  3BTC A;  2VOD A;  1G59 A;  2Y30 A;  4OMZ A;  2D1H A;  3O3K A;  3S3O A;  1HA8 A;  4YRV A;  3RKW A;  1ETQ A;  4RLQ A;  1D8J A;  1RRJ A;  3ZQQ A;  1R5G A;  2E19 A;  2XRN A;  3KYC B;  4HEA 2;  3DEW A;  3Q0U A;  5H6R A;  1J9I A;  5H20 A;  3CQZ J;  2LD5 A;  2X1E A;  3PUB A;  2OCE A;  3HKZ A;  4YFN F;  3K1N A;  4HBL A;  3SDG A;  2PX9 A;  3D5R C;  4QTR A;  2BOL A;  4M6Y A;  2BEO A;  2FML A;  4P96 A;  4BQQ A;  2M4G A;  5D4S A;  3GYH X;  1QPI A;  3GUD A;  1VND A;  3F23 A;  2ZBK A;  1KYW A;  3DKX A;  3PNY A;  4EVI A;  4EM2 A;  4IOC F;  1XB4 A;  2HZD A;  2ECC A;  5BNG A;  3OR1 C;  3LSG A;  2W7N A;  3B6C A;  2DQL A;  5KHD A;  3OIQ A;  1MDM A;  3HPH A;  4NC7 A;  4U0W A;  4QIW N;  3N97 A;  4O6J A;  4XOR A;  2HPM A;  1MSF C;  3A01 A;  3IL2 A;  4J00 A;  1QPM A;  5EZH A;  2HTJ A;  1RET A;  1SD4 A;  2GA1 A;  4MFD A;  5JLW A;  5JI6 A;  2VT3 A;  2D2W A;  1IW7 F;  3H5N A;  1MGT A;  1EV7 A;  4AUX A;  5FKL A;  4BKX A;  4C3I J;  2LBF A;  4HNV A;  1X3U A;  4JX4 A;  3E6D A;  2XPU A;  2FF4 A;  5J8C A;  1TP4 A;  3NRV A;  4IRI A;  4ESJ A;  2CUZ A;  3GVA A;  3FF5 A;  3TL4 X;  4Z6Y A;  3I59 A;  3EYI A;  4OMY A;  2NS7 A;  4XSX F;  4UHT A;  1KGS A;  1W7P D;  3GTG J;  3LFU A;  3L2W A;  4UUV A;  4CYC A;  3N4M A;  5GAH J;  1PDN C;  3K69 A;  4IHW A;  4KIB A;  1S9H A;  5GTH C;  2L5Q A;  2M3A A;  1HW5 A;  3TP0 A;  3CD6 I;  4RS8 A;  5LEJ A;  4C2T A;  2XRO A;  3K70 C;  4BDZ A;  3FXU A;  3BG9 A;  5AIP A;  3HSR A;  2A61 A;  4PGG A;  4ANJ A;  3H5A A;  3T8R A;  4PUS A;  3DBH B;  2IS4 A;  3OL4 A;  4EV0 A;  4F93 B;  4G8X A;  1OR7 A;  5DCF A;  1YI2 I;  3J7A Y;  4A3L J;  2BHY A;  2R7O A;  1X3Z B;  2E1O A;  3OYK A;  2L7M P;  2PQ8 A;  1LDK B;  4RA2 A;  1ZAR A;  3D5L A;  1CF7 A;  1ERD A;  2R7V A;  4YIR X;  3JRE A;  2WBM A;  4J01 A;  4EM1 A;  1R49 A;  3GME A;  1EF4 A;  2DPD A;  3BR2 A;  2OQR A;  2CSO A;  2E5Z A;  1Y0N A;  2KRC A;  1YG2 A;  2Q1Z B;  4TV7 A;  5J4V A;  1YOV B;  3K4N A;  4FX4 A;  4CGZ A;  4CCL A;  5CKT A;  1X1P A;  1LE8 B;  2DA5 A;  2O8X A;  2RAE A;  5HDK A;  4Y15 A;  2WAQ A;  1JUM A;  1ZGJ A;  2KIQ A;  2PEX A;  4PFO A;  5FLX K;  1MD0 A;  2QKL B;  1H8A C;  3F3X A;  2LR8 A;  5FJ8 J;  3GXO A;  1SFX A;  2FE3 A;  3S8P A;  5HNH A;  4ENN A;  9ANT A;  1JHH A;  1AA7 A;  4P1W A;  3NEU A;  2O5R A;  1FX7 A;  1NG6 A;  1OCR H;  3MZY A;  3TBI A;  4G6T B;  3ZR8 X;  5B1B H;  1R22 A;  2DO7 A;  4DOZ A;  1G3W A;  1GXP A;  1HBX G;  3S3N A;  3GZ5 A;  3M7G A;  3BJA A;  2DN0 A;  2FBK A;  2XPV A;  1MBE A;  2IJL A;  3BTI A;  4UUT A;  3CCM I;  5FKK A;  2V1D A;  4YFK F;  4CYD A;  1D5Y A;  4BHC A;  4KIS A;  2CUE A;  4NBQ A;  2BBY A;  2I10 A;  3DPU A;  1GVD A;  3FXO A;  3Q9V A;  1U6G A;  2UXX A;  2AQF A;  3M1E A;  4RBO A;  4PJ0 C;  5FKO A;  5IYD J;  1XD7 A;  1NK3 P;  1WWX A;  4MIM A;  1GHC A;  1FOY A;  1MDM B;  2VKV A;  2ESN A;  1IN8 A;  4PDK A;  1JI8 A;  4LIV A;  3S16 J;  2M7A A;  1FOK A;  2GBY A;  3WTZ A;  4BXF A;  1BM9 A;  1IN4 A;  4FE7 A;  2W24 A;  3CCV I;  1Z3X A;  3WHB A;  3E1S A;  3DTE A;  3HTS B;  2LSO A;  2MLK A;  2OV7 A;  1V4R A;  3DEU A;  1HKT A;  3FDY A;  1HCR A;  3JRI A;  2M5W A;  2Z99 A;  3VPR A;  2LKP A;  1A31 A;  3F21 A;  1QVU A;  1FMV A;  5EYR A;  2BV6 A;  2EFO A;  5KCM A;  3V42 A;  3K4K A;  3OV8 A;  1SD6 A;  1AKH B;  3OIO A;  3R0J A;  2VLA A;  3EPZ A;  1XSD A;  1WJB A;  2DI3 A;  2XSD C;  2COB A;  3DTI A;  4W1U A;  2JWT A;  2RVC A;  4BHB A;  4Y13 A;  2ZXJ A;  4MNU A;  5F1J A;  1K78 B;  3EUH C;  4CYC B;  5CVU A;  1G3T A;  1ZYR F;  2UUZ A;  4NQW A;  5K5R A;  3OYE A;  5TRD A;  4RAF A;  1X19 A;  4DIQ A;  4ITV A;  2GAU A;  1U0J A;  3A0B C;  2YX4 A;  1K4T A;  5D8K B;  2VT2 A;  2X1D A;  2BW3 B;  4KDP A;  3CJQ B;  4DQ2 A;  4A0Z A;  4GYI A;  3OYC A;  1VQN I;  1EKE A;  3MWM A;  3HM5 A;  3TDU C;  3FHN A;  1Z67 A;  2FNA A;  4B3X A;  3P5J A;  2PJP A;  1ZG3 A;  1ZQ3 P;  2LKS A;  3I55 I;  3WG9 A;  1W5C C;  1R1V A;  3F8N A;  4M6X A;  3VYU B;  1W36 C;  4UNO A;  2QF7 A;  1R4N B;  2L4M A;  5FLX Z;  2R7D A;  2FUG 2;  2KJB A;  4U0Y A;  3SEZ A;  1HDD C;  2B0L A;  4U0V A;  5HS9 A;  4X6A J;  4JX5 A;  3S1M J;  3JTH A;  1HXD A;  1HW2 A;  3CO7 C;  1ZTR A;  3LSI A;  5A2Q K;  5IYB J;  2ZJQ F;  1G2H A;  2IPQ X;  2CMP A;  3FMR A;  3VDX A;  2F5V A;  3BTL A;  4FT8 A;  3DKY A;  4HAM A;  1FTT A;  4KMF A;  2PJR A;  2QQ8 A;  5E17 F;  1DPU A;  3RCO A;  4EQQ A;  1VQ6 I;  3PFY A;  2DBB A;  3E0J B;  5CQE A;  3B6A A;  2DOE A;  1ETX A;  5GP9 A;  5H2F C;  1KZH A;  1B9M A;  2VQH A;  3RKX A;  2FOK A;  1HF0 A;  3L00 A;  3AL0 C;  4M72 A;  2K85 A;  1MJA A;  2KZV A;  4BAC A;  1IN7 A;  2W85 A;  1T98 A;  4BGD A;  4ZC3 A;  1GT0 C;  1VZ0 A;  2LTP A;  3K10 A;  1D1B A;  4QLC U;  2Q0O A;  4C30 A;  1LNW A;  4LGW A;  2NNN A;  4HV6 A;  2Y48 A;  1S5L C;  2L7K A;  1YX3 A;  3WU1 B;  2EV5 A;  1TWA J;  4E7L A;  2A69 F;  5LGN A;  1QBJ A;  2BY0 A;  2RC4 A;  1QA6 A;  3CC2 I;  1G3S A;  1RKT A;  1JJ6 C;  2YPR A;  2H09 A;  4OIN F;  2K40 A;  3VYS B;  2KIM A;  2HU9 A;  1GLN A;  3WU0 A;  4XL9 A;  2JJ7 A;  4HW0 A;  2CW7 A;  1R23 A;  2Y2Z A;  1TNT A;  3TP3 A;  1YJ9 I;  1MSE C;  2EFN A;  4LJZ F;  1YFH A;  2A5Y B;  4HPQ A;  2JTV A;  4D5C A;  4FE4 A;  2LH9 A;  3GLL A;  4DYQ A;  4F92 B;  1HOM A;  5FLM J;  3L2R A;  1FOX A;  4BHP A;  3CMM A;  4C9Y A;  4G9Y A;  1FIP A;  1CGP A;  2E36 A;  4PJL A;  4CIC A;  1PJR A;  5D5V B;  3K4C A;  3GWZ A;  3FIW A;  4BQO A;  1OR7 C;  2IBD A;  1XMA A;  1BIB A;  2LRE A;  3NAU A;  4I02 A;  3O2P E;  2BVL A;  4U7B A;  1GDT A;  1S7E A;  2R7S A;  2MAB A;  3I9V 2;  2XAS A;  4G12 A;  3E5X A;  2W57 A;  2XF7 A;  3WTT C;  4G6D A;  2EQR A;  4Q47 A;  3K4M A;  3K6G A;  4UV9 A;  3HOU J;  5E3L A;  4XLP F;  1QO0 D;  2GXA A;  1ETV A;  3IH4 A;  4GDF A;  3GF2 A;  4I2O A;  2L9S A;  2MC4 A;  2X6W A;  4IJA A;  5L3C A;  2HYF A;  1RUN A;  1R1T A;  4BY1 J;  1YS6 A;  2ME0 A;  3E5U A;  3WTW C;  2LYC A;  4IHY A;  3CUQ A;  1R7J A;  3IP4 B;  2J5O A;  4W97 A;  3PIP F;  4I6Z A;  2KLO A;  2IW5 A;  1QGP A;  4IXA A;  3HOS A;  1BR1 A;  3V8K A;  3U2R A;  2QA4 I;  2BY2 A;  1RI7 A;  2DYS H;  2VBX A;  3FZV A;  1U8B A;  3G1L A;  4MO7 A;  1ZLK A;  2NVU B;  3QRF F;  3DV8 A;  4V19 K;  3S2D J;  3ZMS A;  2X6O A;  1MBG A;  4S04 A;  1WPK A;  1ZLJ A;  2H8W A;  2ZC2 A;  4M73 A;  3HZJ A;  3C2G A;  3OOP A;  3V7R A;  4QWQ A;  4FAS D;  3SHF A;  3OYG A;  1DP7 P;  2GA2 A;  5D4R A;  4RB0 A;  3OYL A;  1PP8 F;  5HS7 A;  2IA2 A;  2FQ3 A;  2GXG A;  2KHM A;  1U5T A;  2BE5 F;  2VOO A;  1YO5 C;  4V2F A;  1VQM I;  3SZP A;  3KIO A;  4BAY A;  1BOB A;  3V7S A;  1I5Z A;  2EBI A;  3SFI A;  3VOD A;  3HGG A;  1CF7 B;  2BW3 A;  4HDV A;  1DUX C;  5TJJ A;  4A2U A;  5IT9 K;  4F3Q A;  4MQ9 F;  3K7A J;  5FD5 A;  1POG A;  3HOV J;  2CG4 A;  2NXN B;  2JA7 J;  2XGE A;  3I56 I;  4IOA F;  2MFZ A;  1ZGA A;  1LJ9 A;  3S2W A;  2FX0 A;  3V8L A;  1JXS A;  3RKQ A;  2DXI A;  5M3F J;  1PUF A;  4A3G J;  2XAQ A;  4WXD A;  5C4X J;  1L0O C;  1I50 J;  2MSY A;  3BR1 A;  4CHU A;  2W00 A;  1XGO A;  2VPR A;  2L9N A;  4ZYH A;  4YFX F;  2IT0 A;  5HLH A;  1K79 A;  3ABM H;  3EUK L;  3K4J A;  1X2M A;  2QSH X;  1GXQ A;  1SC7 A;  1ZRC A;  2M0C A;  2MG4 A;  2E2I J;  3T1B A;  1LEB A;  4M9X A;  3TKY A;  3QOD A;  4MHG A;  3E97 A;  2STT A;  1WJA A;  2V1X A;  1IC8 A;  4DBR A;  2XUB A;  1V5G A;  3IRR A;  2A68 F;  2OF7 A;  4PJM A;  3TED A;  1T6S A;  3VEP A;  1SEU A;  4FIS A;  2DOA A;  3PSI A;  3RIR A;  4HV5 A;  2HFH A;  3S14 J;  3FXL A;  3FK7 A;  3QPH A;  2Z2S B;  2NRA C;  1Q1V A;  4LK0 F;  2ICW G;  5M5X J;  4RB3 C;  3H0G J;  3JRB A;  4A3I J;  3MD2 A;  5ERI A;  4FHT A;  3HOY J;  1XCV A;  1R6R A;  2P81 A;  2WWY A;  4Q48 A;  1J5Y A;  3SQN A;  3F72 A;  4NC8 A;  4AC0 A;  1YLF A;  4IO9 F;  1ZN2 A;  1YTY A;  4NB5 A;  1OCC H;  3O8H A;  2LFB A;  1QHG A;  5KAI C;  2E35 A;  3BQZ A;  3QOP A;  3DFG A;  4X1E A;  1MJ9 A;  3RPQ A;  2BY3 A;  2OC6 A;  5EGO B;  2ZFU A;  2XAF A;  1ZH5 A;  2EIM H;  2X0L A;  3VYR B;  3BZC A;  1U5T C;  2IGO A;  1VQ5 I;  3G73 A;  4I98 B;  5IP6 A;  2WB1 N;  1V3F A;  2E1M B;  4PCQ A;  4CZC A;  2IEK A;  2X6X A;  3F8F A;  1D0X A;  3PSF A;  2E7X A;  1XS9 A;  4BBS J;  2X6Y A;  3ONQ A;  1MNE A;  2ELK A;  1TW3 A;  3E6B A;  2MD5 A;  1BR2 A;  5IOZ A;  5BS6 A;  3I4N J;  1WFX A;  3RTR A;  1QZY A;  1FC3 A;  1D1A A;  3LNQ A;  1DU6 A;  4H0E A;  5D5U B;  2W25 A;  4KT6 A;  1G4D A;  2ISY A;  3LST A;  3G1M A;  1B8I B;  3SFZ A;  2LKX A;  5C3E J;  2AO9 A;  3QP6 A;  2ADU A;  5B5E C;  2CRG A;  4E7I A;  2EB7 A;  1WJF A;  2VQC A;  5FO5 A;  4UY8 I;  3S2H J;  3KZI C;  1ZGW A;  2JUG A;  3JRG A;  1K61 A;  4OIP F;  1TWH J;  2R92 J;  2GIZ A;  3SEQ A;  3HOT A;  2BXY A;  2X4H A;  2HYJ A;  4KN7 X;  1DPR A;  2DJI A;  1H9T A;  1NHA A;  3ZQH A;  2Z5U A;  1SMT A;  2M7B A;  4A3M J;  1UCR A;  2HS5 A;  5F04 A;  2J5P A;  2IGK A;  3FWE A;  1BI0 A;  3KP3 A;  4HSR A;  2EZI A;  4N9H A;  1KYZ A;  1T08 B;  5LEK A;  1UHM A;  4PFP A;  3K70 D;  2R5Z A;  1K7A A;  1KU2 A;  2WY7 Q;  4WX9 A;  1MW7 A;  4CZZ A;  4JP0 A;  3OYI A;  2XAG A;  3IH2 A;  4MQV A;  3RSN A;  2ZO4 A;  5E8I A;  1J59 A;  1YRN A;  2RRE A;  1FZP B;  2KKO A;  5HLT A;  2CS3 A;  2DW4 A;  2RGV A;  5GAD J;  2HOA A;  2EJR A;  2YR2 A;  5LLQ A;  1BL0 A;  1J09 A;  4HQM A;  2IS1 A;  2HKO A;  2ZNZ A;  1TZL A;  4FET A;  3JCU C;  4PSW A;  5DD4 A;  4BBR J;  2K4J A;  2FSW A;  2Q2E A;  3FMS A;  1FYL A;  4JQF A;  4BE2 A;  2D5V A;  2LLK A;  3OYD A;  2DMU A;  3BZK A;  1FEX A;  1N25 A;  1BW6 A;  3OYH A;  2XF5 A;  4IHS A;  2UZK A;  4IHT A;  4GO1 A;  1HKS A;  3DF8 A;  2F4M B;  2YSR A;  1XCB A;  2UV1 A;  3CUQ C;  3H35 A;  2OTL I;  2HXI A;  1TT0 A;  5HDG A;  2OCC H;  2XDV A;  4E4H A;  5CQG A;  3I71 A;  2HYG D;  5L3B A;  4I7H A;  3HHG A;  1VQ7 I;  3UKG A;  3EUH A;  3FHZ A;  4IVN A;  3FKI J;  3E6M A;  1OPC A;  1IO2 A;  4MFE A;  5K5Q A;  2HWV A;  3FM3 A;  3JRF A;  2OZU A;  5DDG A;  2IP2 A;  5F0H A;  1P92 A;  3DEE A;  5LFA A;  3IAS 2;  4LG0 B;  2CV1 A;  3CCU I;  3RPU A;  4HX8 A;  1D1C A;  2RQP A;  2NVX J;  3K1P A;  3REO A;  2VKH A;  4JYK A;  2QCO A;  2QBY B;  3AL0 B;  2P5V A;  1LVK A;  2DU9 A;  5CYV A;  4LG0 A;  1Z77 A;  2DA3 A;  2A05 A;  4ZDP A;  1FJL A;  5ILV A;  3QWL A;  2O7O A;  4G94 A;  4I0B A;  2O61 A;  2JZY A;  3KYD B;  4F7Z A;  5HDN A;  1UG2 A;  5J1U A;  4IHV A;  3ZQL A;  1LPQ A;  3G3Z A;  3IHU A;  4BY7 J;  4RGX A;  4PZJ A;  1TQM A;  5JHF A;  2GQQ A;  1MKM A;  2BVM A;  2X85 A;  4AVZ A;  2B9S A;  5LHI A;  2VJJ A;  2V1N A;  3I4P A;  4O5V A;  4ESF A;  4UVC A;  2G7U A;  5J40 A;  2WAQ N;  3JW4 A;  3B73 A;  2ZKZ A;  3VYT B;  2WB1 A;  1J75 A;  2XB5 A;  2CUJ A;  4LB6 B;  3RQI A;  2EFP A;  4DZJ A;  3QYB A;  1LFP A;  3RZD J;  1TNS A;  1Y1V J;  3DWL E;  1XSV A;  2PBI A;  1MH4 A;  1XTA A;  2EA4 A;  1ETK A;  4KNY A;  1WI9 A;  1UJ8 A;  2XIG A;  4A93 J;  3ECH A;  1FSH A;  2M8E A;  2R7R A;  4BXU A;  2DA7 A;  3BDD A;  2EV0 A;  4L5E A;  4HDU A;  4FCY A;  1O3R A;  1XPX A;  5D5X B;  1R4M B;  3A01 B;  1QU3 A;  3CCQ I;  3I64 A;  1K4S A;  3ABU A;  2XKP A;  3ECO A;  4LIU A;  2XAU A;  1Z6T A;  5FKN A;  2O8K A;  2W84 A;  1WZ2 A;  3LSJ A;  3SXY A;  1TLH B;  2GOX B;  2V1U A;  2R7W A;  3PO3 J;  1U9N A;  3ULQ B;  5IP9 J;  3A03 A;  1SMY F;  5E3N A;  3OYJ A;  1ZKG A;  1FT9 A;  3GO5 A;  4XID A;  2JK3 A;  3L2V A;  1XDS A;  4RAY A;  5F1R A;  3PO2 J;  4XRS G;  3P7N A;  4I76 A;  3FIS A;  1RR8 C;  2KT0 A;  2LVS A;  4AD9 A;  2EZK A;  2LNB A;  5F08 A;  4UUS A;  3H36 A;  5HNF A;  4ZDO A;  1FP1 D;  1YRN B;  4GFB A;  5JVT A;  4LG3 A;  5F0F A;  1K83 J;  2K5C A;  3MCZ A;  1OCZ H;  1WJ5 A;  2OBP A;  3HTU A;  5LGU A;  1YIO A;  1DGW Y;  4A3K J;  5LGT A;  3MQ0 A;  2MA3 A;  3JTG A;  4P9F A;  1ETW A;  5EG0 B;  4JX6 A;  4OIR F;  2WAF A;  5E8G A;  2GIV A;  1JKO C;  5B66 C;  1T39 A;  2NAZ A;  3WOD F;  4PGH A;  2Q2E B;  3QP5 A;  4ESB A;  1B4A A;  1P6R A;  2MGQ A;  1Y1W J;  2PLY A;  2VJI A;  2JMW A;  1ZK8 A;  1LEA A;  1PYV A;  1O3S A;  1W7P B;  1I3A A;  1WJD A;  3CCL I;  1J2X A;  1OFC X;  1DP3 A;  3ABK H;  1FSE A;  3QU3 A;  3CCE I;  3E5Q A;  4AU7 A;  4XKV A;  2HOT A;  3HG9 A;  1MMG A;  5F64 A;  3ERM A;  1IV6 A;  1IGN A;  1R9T J;  3CCJ I;  1F9N A;  5IT3 A;  3N05 A;  1HW1 A;  5DEQ A;  3ZGK A;  1FLI A;  4KJZ A;  2A6T A;  1T56 A;  2F5E A;  2A3S A;  2X9D A;  4LD5 A;  1A6Q A;  4N9I A;  5D5W B;  2K4B A;  4N0B A;  3BZ6 A;  4DYC A;  2FBI A;  2ETH A;  3CTA A;  1F1Z A;  4YG2 F;  1ETY A;  2M2E A;  5F0C A;  2HQ5 A;  4CO8 A;  4ETS A;  3S3M A;  1Z05 A;  3I59 B;  2EZH A;  2K7L A;  4F55 A;  3CF5 F;  1YW8 A;  4RB2 C;  2ZJR F;  4BJ5 C;  4S0H B;  4CXF A;  2IVM A;  3T0Y A;  3WE3 A;  1WRJ A;  3FK6 A;  3K1M A;  4XKW A;  3FXK A;  1A6I A;  4CSW A;  2VQG A;  1JGS A;  1S3J A;  4LOC A;  4BE0 A;  3ERE D;  2XAJ A;  2VBY A;  3ZMV A;  5E1Z B;  3HEF A;  2ZME C;  2DTR A;  4B8X A;  2K3F A;  2DCE A;  3LL7 A;  4XOP A;  2DT7 B;  2FEZ A;  3TOA A;  3F22 A;  1Z6R A;  4J19 A;  2MYS A;  3BCB A;  4XR6 A;  2CQK A;  5EZG A;  3K2A A;  1ODD A;  3TO7 A;  2KJC A;  1IG7 A;  2L4A A;  2L54 A;  3KLN A;  2VKD A;  2P6T A;  4PJJ A;  3W6J B;  4CUG A;  5L3G A;  3T8T A;  3KFW X;  2CFO A;  4ZZD A;  4Z2Y A;  1TC3 C;  5TIS C;  3QOE A;  3EUA A;  3ZN1 A;  2QGU A;  4ENM A;  4A3J J;  1NTC A;  5LHG A;  4YII A;  1B59 A;  1OYW A;  4A5N A;  5D8L B;  1HDP A;  3GFI A;  2IRF G;  4A3C J;  2GZW A;  3JRH A;  1X1A A;  4Q4Z F;  3ZPL A;  1ULY A;  1PUE E;  4HA8 A;  3LSP A;  2NYX A;  1B6A A;  4QSH A;  2XGD A;  4B43 A;  1RUO A;  5DUK A;  3IRQ A;  4UUS B;  4A3B J;  3KZY A;  3P9C A;  3JSO A;  3EQL F;  2DA1 A;  3PQJ A;  2FA5 A;  5CVJ A;  2F5F A;  2CJJ A;  4UXN A;  4XNF A;  5FRO A;  2R7Z J;  4IQJ A;  3GFJ A;  2M34 A;  3DKW A;  5EG0 A;  4HQE A;  1K6O A;  5DS9 A;  1B8I A;  3KX2 A;  2LY9 A;  3W6K B;  1R36 A;  2DMN A;  3BG7 A;  4IZZ A;  1V54 H;  4BNC A;  5DD8 A;  1PUF B;  1SVO A;  1WCM J;  3CUO A;  3GFL A;  4AID A;  4A3F J;  3ZOB A;  1LFB A;  2LDU A;  3S93 A;  2ZXW H;  1XGM A;  3HOX J;  5J8F A;  1WJE A;  4XSZ F;  1JKQ C;  3BC8 A;  2UWM A;  2CFX A;  4CCO A;  1O4X A;  1N77 A;  1B72 A;  2VOP A;  2R5Z B;  4KUM A;  4L9N A;  4NNJ A;  4RGS A;  4EEF G;  4PJN A;  1P2F A;  2DQR A;  3F6O A;  1LDD A;  3ZQ7 A;  5IOY A;  1IAW A;  1BI2 A;  4HRI A;  3MKY B;  2ECB A;  1X1B A;  1V5E A;  2H6B A;  3I58 A;  1F4K A;  1YYV A;  1GVJ A;  2QEN A;  3M07 A;  4EAT A;  1IXS B;  2FU4 A;  3JAM K;  1LE8 A;  2YS9 A;  4BUP A;  2CQN A;  2LRD A;  4D7N A;  3CP8 A;  5HS8 A;  1YX5 A;  2ZME A;  3FMQ A;  5BMZ A;  3ESW B;  2M9H A;  5HOD A;  4ZTF A;  5GAE J;  2V26 A;  4DYR A;  2FOW A;  4XK4 A;  4A12 A;  3COA C;  1IV8 A;  4BH9 A;  3LOC A;  2PFB A;  3LWF A;  4GXO A;  1IUY A;  3KYL A;  1BJZ A;  4LB5 A;  5E1W A;  3I4M J;  4M3G A;  1ZRE A;  2ESH A;  3FXM A;  4RB1 A;  4XLH A;  1X4O A;  3OL3 A;  3UR3 C;  3IKV A;  5CJ9 A;  1JUP A;  3DBR B;  1ZR4 A;  1LDJ A;  3L1P A;  1AHD P;  5ILS A;  4IX7 A;  3CCR I;  1D0Y A;  1ON2 A;  3PNV A;  3TO9 A;  2TCT A;  3HBL A;  3CDL A;  3KLO A;  4WK8 F;  4QPQ A;  1QQI A;  4LMY A;  1Y0U A;  4XLF A;  3BTJ A;  1P7J A;  2OPT A;  4MTD A;  4OAZ A;  5IY5 H;  2XKO A;  4BEH A;  2HOS A;  2VKE A;  3WE2 A;  1A36 A;  2E1N A;  1E0E A;  4E6K G;  2LOO A;  4QPO A;  1DQU A;  3QYF A;  1Z1D A;  3F9K A;  4HF2 A;  3PQK A;  3G4S I;  2CW8 A;  2F48 A;  2O0Y A;  4AM3 A;  2VPL A;  3CLQ A;  2L2O A;  3I3L A;  2K9M A;  2K9S A;  3AG2 H;  1E17 A;  2WV1 A;  1YE9 A;  5IYC J;  3ZP5 A;  5EJC A;  4K2E A;  4V2G A;  1VFC A;  1MMN A;  3CUQ B;  4DNC A;  2ME6 A;  2YX7 A;  2M8G X;  3NWT A;  1Z0X A;  3VSK A;  3S17 J;  2R7X A;  1FYK A;  4CCN A;  4ZYA A;  3D1N I;  2W1O A;  1VQL I;  2FQ4 A;  2W48 A;  3GZN B;  3BPX A;  1MND A;  2E71 A;  2K9Q A;  2AQE A;  1SFE A;  1HKQ A;  1SD5 A;  3L9F A;  3BY6 A;  1KON A;  2I8D A;  4NC6 A;  4RAZ A;  2R5Y A;  5E18 F;  1ZR2 A;  3ZMT A;  4OAY A;  4AVP A;  3G1O A;  4S05 A;  1UMQ A;  1UHW A;  2FNP A;  2VAS A;  5BPD A;  3D5S C;  5F6F A;  2Y9Y A;  1ZG1 A;  2JN6 A;  1MMA A;  1JE8 A;  1USS A;  5IT9 Z;  4XRS A;  3Q0W A;  5HLG A;  3AKZ A;  3HJE A;  2HGC A;  4HYE A;  4B44 A;  2CO5 A;  4A6E A;  4F91 B;  2JPC A;  2EZL A;  3AAF A;  2D45 A;  2A6H F;  2XC7 A;  4HLX A;  4L9T A;  1J0R A;  2NVY J;  4EJW A;  3DP7 A;  3CC4 I;  2F4I A;  3IH3 A;  4KMU X;  1FYM A;  3KP4 A;  1RPW A;  4C3J J;  1ON1 A;  1MJB A;  2LC2 A;  3ISP A;  3GLX A;  3LQQ A;  2V6E A;  4XN3 A;  5HOO A;  5CVI A;  4ENJ A;  4M3D A;  2HQR A;  3HRM A;  3TQN A;  2A5W A;  2ELH A;  3HL2 A;  2MD0 A;  4ENK A;  5L3F A;  3BG6 A;  3M3Y J;  2B63 J;  1OYI A;  3KZZ A;  2CU7 A;  2HOE A;  2KDO A;  1SVL A;  1UZC A;  1ZRD A;  3KET A;  3HOW J;  3KE2 A;  1TWC J;  1A35 A;  3I53 A;  5BPI A;  5JVG F;  4LLG F;  2QEX I;  4XRF A;  1FBQ A;  2K27 A;  3W2V A;  2HPI A;  5ED4 A;  3J7A O;  3CO6 C;  2ZSI B;  2UXN A;  5ICG A;  3T5X A;  5E3O A;  3SYT A;  1HLV A;  3RYR A;  2F2E A;  3K4B A;  1HC8 A;  1IUF A;  2OQG A;  2DFE A;  3U1K A;  1IRF A;  2EH3 A;  1TT5 B;  1QZE A;  1O3Q A;  1Z21 A;  1I3Q J;  3PJR A;  3K0L A;  2M0M A;  2EWN A;  1BW5 A;  3DPL C;  4AIK A;  1X4P A;  3A02 A;  3QYE A;  1VQ4 I;  2R7Q A;  2VI6 A;  4YEJ A;  3CMY A;  2H1L A;  2I5U A;  4JK1 X;  4M9S A;  4UV8 A;  1NH3 A;  3LFK A;  1YIT I;  2JPB A;  4D1Q A;  5GPC A;  4P55 A;  3OYN A;  3CCS I;  2F4O B;  2QLZ A;  1G3Y A;  3GTP J;  4IPA A;  3W3C A;  2P0W A;  3ABT A;  3F6V A;  4BQN A;  1MZB A;  2R7T A;  2EK5 A;  2HTS A;  4ZTJ A;  3A4C A;  4DJA A;  3GTQ J;  1XSX A;  2CW0 F;  2E1M C;  2QSF X;  3SJM A;  4C3H J;  1G6N A;  1U3E M;  2XHK A;  3W2W A;  1CQT A;  2Y9Z A;  1A04 A;  4XKC A;  2JRT A;  4F52 A;  4WF2 A;  3BWG A;  1DU0 A;  1JT0 A;  3E7L A;  2P4W A;  5H6Q A;  3BR6 A;  1RNL A;  2JSP A;  3LA2 A;  1EH7 A;  3FBI B;  5GTI C;  2E7W A;  2K9N A;  3KEO A;  3MAJ A;  2A07 F;  4ZJZ A;  3CP2 A;  1UST A;  4GRI A;  1Z7L A;  2PMZ N;  4AIJ A;  4EM0 B;  4X0G A;  1EJ9 A;  2VJ5 A;  2XGX A;  3VFZ A;  3C1D A;  2V7F A;  2H6C A;  4A69 C;  2DA2 A;  2Y75 A;  3KP2 A;  1Y6I A;  2MC3 A;  3V4G A;  1EA3 A;  1TWF J;  1P4A A;  1IDZ A;  4FX0 A;  4PSX A;  2OTJ I;  3D0S A;  1SAN A;  4A5M A;  2F5D A;  3OYF A;  3LAP A;  1ONV A;  4YEL A;  2QQA A;  2L0K A;  2K86 A;  1ZHF A;  1OCT C;  5C4J J;  3FXQ A;  4A0X A;  2JA6 J;  3BG3 A;  3MZ8 A;  5DYM A;  1TQI A;  4WXH A;  2IA1 A;  3CC7 I;  2L01 A;  4Q5S F;  1Y8R B;  5EEA A;  2ZSH B;  4OU0 A;  2JT1 A;  1HSJ A;  4GYG A;  1RIO H;  2B7E A;  3HUG A;  1P7I A;  3WTY C;  1WGX A;  4FQG A;  2CGP A;  4Y3O A;  1RKW A;  4JOM A;  1JKP C;  5B3S H;  1QVT A;  3IC7 A;  2Y0M A;  1FOW A;  1W0T A;  1ZAO A;  4CCJ A;  1YJW I;  2M87 A;  2KP6 A;  2XF6 A;  4CH7 A;  3P9I A;  2MBF A;  3OYM A;  5LD2 C;  2IXS A;  3MN2 A;  2DMT A;  2DYR H;  1Y56 A;  1U9O A;  3L2C A;  1Z9C A;  4RM3 A;  2FMY A;  3MZH A;  1A5J A;  2ELJ A;  5FFX A;  3X2Q H;  5DTD A;  3ZCO A;  5DM6 F;  2DA6 A;  4KA4 A;  2VIX A;  2JA5 J;  3PM1 A;  4XM3 A;  2HDD A;  2Y0S N;  4XLA A;  3PIO F;  2ZFW A;  3OSF A;  3Q0V A;  1LQ1 A;  5DM7 F;  2KMU A;  4R8H A;  3S15 J;  4WXC A;  2R3S A;  4EJU A;  1U8R A;  2XGC A;  2JSC A;  5DCM A;  1FBU A;  1PVE A;  3ZQI A;  4BEH B;  3ROU A;  4HX7 A;  2ZME B;  4M9Z A;  4ZYE A;  1Z7U A;  4C2U A;  3O6B B;  3TW6 A;  5E79 C;  3HPG A;  1W0U A;  2PMH A;  3HYI A;  1P9Q C;  2BXZ A;  2YU3 A;  3KCC A;  4L0Z B;  1Q1H A;  2JUC A;  2Y0S A;  4IHX A;  1KQ9 A;  1XX5 A;  2WA0 A;  2COM A;  3HKZ N;  3LA7 A;  1XDU A;  2JVG A;  1H0M A;  3U9G A;  3G6E I;  3MMY B;  4LLN A;  1K78 A;  2F6C A;  4NQW B;  1RES A;  3V8J A;  1BC8 C;  1OCP A;  4KIF A;  3V7C A;  3ZMU A;  1HST A;  3JRC A;  1LUJ B;  2Z33 A;  2L9V A;  3H1C A;  3OS2 A;  5EGO A;  3J81 K;  1X1C A;  3RPU D;  4AYB A;  4HZF A;  5HLI A;  3ZN0 A;  4L9V A;  1OCO H;  3MKL A;  2MH9 A;  2OZ6 A;  3H3V K;  4B09 A;  6PAX A;  3OMY A;  4MEX F;  2LY2 A;  2P8T A;  3HRS A;  4IRG A;  4U7D A;  3IUO A;  2FBH A;  3HB9 A;  1ENH A;  4E7J A;  3GFM A;  2CQ7 A;  1Y8Q B;  2QYO A;  2VXZ A;  3KEQ A;  2VC0 A;  4HF1 A;  2LG4 A;  2PN6 A;  1XN7 A;  5LHH A;  4RM2 A;  2LBF B;  3JAM Z;  2XB0 X;  2DK5 A;  2QVO A;  2H8R A;  2VBZ A;  5J4Y A;  4DGW B;  4ZH4 F;  3C2B A;  4IQ4 A;  1E3O C;  3HSF A;  2N8G A;  3Q5F A;  2HZT A;  2W82 A;  2XAH A;  3OOU A;  4E7Z A;  1YS7 A;  1JGG A;  2E5N A;  5EEH A;  4ZYD A;  3MKW B;  1F36 A;  2XV4 S;  2ZXI A;  3AFH A;  1W5T A;  1B9N A;  2LMD A;  5B1A H;  3P9K A;  3DBL B;  5JFR A;  3R61 A;  3VSL A;  4HG2 A;  2PMZ A;  3KP6 A;  2RV8 A;  5CLS A;  5TGT A;  1BA5 A;  3DQV C;  3ZQC A;  2R5Y B;  3HRT A;  2K02 A;  1R5H A;  3TMO A;  1FP2 A;  1OKR A;  2EFW A;  3HOZ J;  3OS0 A;  1BC7 C;  3BQY A;  1TL8 A;  4UVB A;  2XRL A;  3LAJ A;  2R0Q C;  2IGN A;  4H4K C;  3L2Q A;  2PI0 A;  4IRH A;  5AIQ A;  3WTS C;  1BI1 A;  1X58 A;  3M1C A;  1M1E B;  5KAF C;  2KZG A;  5FRM A;  2BZT A;  4I01 A;  1LVA A;  4E7H A;  3F0C A;  4G7O F;  1BOA A;  1QHH D;  2DTZ A;  2OD5 A;  2ZXH A;  4EMS A;  2L7Z A;  4A3D J;  3DPT A;  2EIN H;  1VF9 A;  2WAD A;  4FTH A;  1OQY A;  2Y69 H;  3S32 A;  2DLL A;  1U2W A;  2HR3 A;  1ITY A;  1OYY A;  3NWS A;  2D1V A;  1SAU A;  5FD6 A;  5J1R A;  3OS1 A;  5L3E A;  3J7Z I;  3WGH A;  3Q9S A;  2XSJ C;  2P7C B;  2VXD A;  1SVM A;  5E1X A;  3L7W A;  3MKZ A;  3WGG A;  3IKT A;  5LRR A;  2FD5 A;  3DU5 A;  1T0F A;  4BE1 A;  5A2Q Z;  2LY1 A;  1IN5 A;  2ACJ A;  3W6V A;  1G8X A;  4XN0 A;  2GXB A;  4A0Y A;  2P6S A;  2QZ8 A;  1SFK A;  1MH3 A;  2DOF A;  1MIJ A;  2PG4 A;  5BQT A;  3RI4 A;  2DFF A;  5K5O A;  3IWF A;  4LIT A;  2GOM A;  3K2Z A;  3NAR A;  5DV5 A;  4AYB N;  4OWR B;  4II3 A;  5FGM A;  1WH5 A;  1I1S A;  5J6X A;  2VE8 A;  5IP7 J;  3QU6 A;  4HNU A;  3OWT A;  2CV2 A;  5BOX A;  1R1U A;  1IRG A;  1BBY A;  1GV5 A;  2CYY A;  1OLT A;  2HNH A;  3BRO A;  5K7H A;  5D6E A;  1ETO A;  1E3H A;  4MEY F;  4WWC A;  1VQ9 I;  2M4K A;  1TWG J;  2M30 A;  3QPT A;  2DK8 A;  1UFM A;  1Z3Y A;  2QKM B;  3PFI A;  3RZO J;  2STW A;  3H92 A;  4CDG A;  1FY7 A;  3R6S A;  2ZNY A;  5LRS A;  3OY9 A;  3GTJ J;  3EDP A;  3CF2 A;  4BXX J;  2QQB A;  3HGY A;  3JRA A;  2L02 A;  4RGR A;  2JVH A;  2HEO A;  1VQP I;  3GCM A;  1JT6 A;  2NOJ B;  3VOE A;  2KFD A;  2DPU A;  3LSM A;  1ZG5 A;  2DOD A;  3L09 A;  2R7F A;  2OA4 A;  3C18 A;  1GUU A;  2QM3 A;  3HXL A;  4BJ6 C;  4XOT A;  4I09 A;  2AXT C;  1IRZ A;  3WTX C;  4O3M A;  1JKR C;  3BG5 A;  2VON A;  3PL8 A;  2M1B A;  3HSE A;  4M3E A;  2BY1 A;  5E3M A;  2R4G A;  4II2 A;  1T0F C;  5CPR B;  3WTV C;  3GX4 X;  3NQO A;  2IA0 A;  2DFH A;  1F5T A;  4OIO F;  1EH6 A;  5FFZ A;  1FPQ A;  4CCK A;  3K9T A;  1YW7 A;  1IN6 A;  1XMX A;  2HI3 A;  2OU2 A;  2ZCW A;  1WI3 A;  2RNJ A;  1WJC A;  1EH8 A;  4EJV A;  1R00 A;  3DLL F;  1XG1 A;  3TW7 A;  2NS0 A;  3WU2 C;  2CQX A;  3RQ4 A;  2X48 A;  2PJR B;  3CME I;  2KQR A;  4KT5 C;  1X3W B;  2BGC A;  5EDN A;  2GM4 A;  1V55 H;  4ZZL A;  1FIA A;  1O7L A;  3CDI A;  1MBK A;  3H3Z A;  4M3F A;  3ZQF A;  1JJ8 C;  2CUF A;  1SAX A;  3AG4 H;  1D0Z A;  3HDD A;  1XGS A;  2IS2 A;  3GZ6 A;  1ZEL A;  1QZZ A;  1XMK A;  3H3U A;  3IV5 A;  1T33 A;  1NK2 P;  5D6F A;  1AU7 A;  1LB2 A;  1N75 A;  1UEL B;  4I99 C;  2HQA A;  3F8C A;  2C6Y A;  4B47 A;  1UG0 A;  3RJP A;  4MTE A;  3ELK A;  2VQL A;  3RYP A;  2KIF A;  4Y33 A;  3O8G A;  2AS5 F;  2RKH A;  3KP5 A;  2OJE D;  3LSH A;  5E20 A;  3S1N J;  2EFQ A;  4M71 A;  4KN4 X;  4CCM A;  2DJN A;  2WV0 A;  1AWC A;  2E2J J;  2V9V A;  2ZB9 A;  3ZMZ A;  1QNT A;  3LMM A;  2F5C A;  2K3P A;  3MFK A;  4EJT A;  3A1Y A;  3BJ6 A;  1C0W A;  2RNG A;  3I5U A;  5J47 A;  2TRT A;  2PMU A;  2CWE A;  5DCM B;  3EET A;  1ACI A;  2XVC A;  3GTO J;  1YQA A;  3F8B A;  4E7S A;  4JBA A;  4EGY A;  1WSU A;  1Y39 A;  4L9J A;  1OJL A;  2Y31 A;  4IL6 C;  2OAZ A;  2RQQ A;  2L9R A;  1T2K A;  1APL C;  1O7F A;  1XC5 A;  4B48 A;  2DDB A;  1P4X A;  1L3L A;  2TDX A;  3ZMD A;  2QWW A;  4AIH A;  1FMW A;  1YIJ I;  4D0P A;  4XRM A;  3IWZ A;  2QSG X;  5AON A;  3FKJ A;  1VQK I;  3ABL H;  4L5I A;  2BYV E;  3E6C C;  2JRM A;  3EYY A;  1IDY A;  2DFI A;  3BR3 A;  1F43 A;  3C3W A;  5M3M J;  5M5Y J;  1S72 I;  3QQA A;  4E70 A;  4M74 A;  2NVQ J;  4ZDL A;  2G7H A;  3LSR A;  2H1K A;  2L3D A;  3G71 I;  2E34 A;  2KIS A;  2VN2 A;  4GGG A;  3J7Y J;  1E3P A;  3FXJ A;  2MH2 A;  5ICF A;  4HST A;  1KQ8 A;  1TQP A;  2HDW A;  4NUB A;  3BR5 A;  3RKY A;  5F27 A;  2Z9O A;  3K4L A;  3BOQ A;  2KDZ A;  3BPV A;  3C2H A;  2WAE A;  2VE9 A;  4XLN F;  2RDP A;  4MGR A;  4DZP A;  3A2K A;  2HXO A;  3KPH A;  2LP0 A;  3QPS A;  1MMD A;  1AKH A;  4ZYG A;  3CJN A;  3ZXS A;  3FM5 A;  4KFC A;  2W4S A;  2HVQ A;  1W36 D;  2NS8 A;  5HVQ C;  4L18 B;  2FJ1 A;  2K9L A;  1OIS A;  3ZRG A;  3ASO H;  5J1Y A;  4B1R A;  5ICC A;  4YIF A;  2DT5 A;  3FXR A;  1MBJ A;  5K1Y A;  2LK2 A;  3CMA I;  3I54 A;  4IEJ A;  2JQ7 A;  2E60 A;  1B1B A;  1RC9 A;  3L2U A;  3B02 A;  4E7K A;  3DCF A;  2R93 J;  4DW6 A;  1IZ1 A;  2CH0 A;  1KU9 A;  1JTX A;  1STZ A;  2O03 A;  1KA8 A;  5CVR A;  1KQ0 A;  3AG3 H;  3R0A A;  2BHZ A;  1KU3 A;  1YW9 A;  4LLL A;  2WC2 A;  3BT9 A;  2YUS A;  4RGU A;  2V6C A;  4MLO A;  2RN7 A;  2EIJ H;  5DUI A;  1P4W A;  1RR7 A;  3SZG A;  1FTZ A;  4NHJ A;  3BR0 A;  1VQO I;  4M6V A;  1UAA A;  3S1Q J;  4B3A A;  5FB2 A;  2EIK H;  3QAH A;  1JTY A;  4Y52 J;  5LBQ A;  1IXR C;  1I6H J;  1SD7 A;  1FBS A;  3I0T A;  3WG7 H;  2AXL A;  4IF4 A;  1FWZ A;  2DAO A;  4BL0 B;  4DBQ A;  1T38 A;  3BLY A;  2ZJP F;  3VWB A;  4KIG A;  2VUM J;  4A6D A;  2IGM A;  4D7M A;  2Z3Y A;  4D5F A;  3JR9 A;  1GV2 A;  3Q3S A;  1PP7 U;  5KVR A;  2VL8 A;  1OMI A;  2DDA A;  5EEG A;  4C2M J;  4IKF A;  2EPF A;  3DLA A;  5FKM A;  3CES A;  3W2A A;  4D9J A;  3U21 A;  3H0D A;  5GPA A;  1IXC A;  1MBF A;  1S6L A;  1AOY A;  1WHU A;  1H89 C;  2HDC A;  1WQ2 A;  2HKX A;  1FNN A;  2E2H J;  3J81 Z;  1TBX A;  4RDU A;  2AHQ A;  5EF6 A;  5CVV A;  2IS6 A;  1KU7 A;  1U5T B;  2DA4 A;  4BYY A;  2EV6 A;  3OR2 C;  3ZQG A;  1REP C;  3LQR A;  4KIT B;  5IPA A;  1X1D A;  2FXA A;  2YU9 J;  2OUM A;  4CA0 A;  2E1C A;  2JA2 A;  2ID3 A;  3GTL J;  1IRX A;  3BJO A;  2CQQ A;  3E3V A;  1BN5 A;  2M45 A;  2V4J C;  1V5F A;  2QUF A;  1YHQ I;  1WVR A;  3H5R A;  4UB6 C; 
#chains in the Genus database with same CATH homology
 3S15 J;  4ABZ A;  2XGC A;  1OFC X;  2MW8 A;  3ZQI A;  1TWA J;  5JLX A;  3JRD A;  3TW6 A;  1W0U A;  1RKT A;  1JJ6 C;  1B72 B;  2HOT A;  1IV6 A;  1IGN A;  1R9T J;  2K40 A;  1T56 A;  2JJ7 A;  4IHX A;  2X9D A;  2Y2Z A;  1MSE C;  3TP3 A;  3MVP A;  3HKZ N;  4D5C A;  4FE4 A;  4DYQ A;  1HOM A;  4DYC A;  5FLM J;  4NDL A;  3OSG A;  1RES A;  1OCP A;  1FIP A;  1ETY A;  2M2E A;  5F0C A;  2HQ5 A;  3JRC A;  3FIW A;  2DMP A;  2IBD A;  2EZH A;  3NAU A;  5EGO A;  1GDT A;  1S7E A;  1X2N A;  4S0H B;  4G12 A;  3FK6 A;  3GTK J;  1WH7 A;  2EQR A;  1A6I A;  3MKL A;  1H88 C;  4Y7N J;  3H3V K;  4LOC A;  2NVT J;  4XIC A;  3QPL A;  3HOU J;  5E3L A;  1ETV A;  3HEF A;  1ENH A;  1ORK A;  3IH4 A;  3HB9 A;  1U78 A;  1IJW C;  4BY1 J;  4IHY A;  2ME0 A;  4J19 A;  2XB0 X;  5EZG A;  4W97 A;  1VI0 A;  4I6Z A;  2H8R A;  3K2A A;  3C2B A;  1E3O C;  1IG7 A;  2N8G A;  3OOU A;  3GTM J;  1JGG A;  1U8B A;  1TC3 C;  2GLO A;  3G1L A;  4MO7 A;  1F36 A;  4A3J J;  3S2D J;  1NTC A;  2O9L A;  2X6O A;  2XPW A;  1MBG A;  3CCY A;  1WPK A;  1HDP A;  4A3C J;  3JRH A;  1JUS A;  1BA5 A;  3ZQC A;  2R5Y B;  1LFU P;  3LSP A;  3HOZ J;  4QSH A;  2XGD A;  3WHC A;  3BQY A;  2XRL A;  4UUS B;  4A3B J;  2R0Q C;  2DA1 A;  4V2F A;  2CJJ A;  1X58 A;  5M5W J;  2R7Z J;  1UHS A;  2DMQ A;  2NOG A;  2EBI A;  1QRY A;  3SFI A;  3HGG A;  2M34 A;  2L7F P;  5EG0 A;  3F0C A;  1MNM C;  5DS9 A;  1B8I A;  2DTZ A;  3S1R J;  1SFO J;  3M4O J;  4A3D J;  2L7Z A;  2LY9 A;  2DMN A;  1VF9 A;  4M3B A;  4FTH A;  5K7Z A;  1PUF B;  3K7A J;  4B4C A;  5C44 J;  1POG A;  1WCM J;  1ITY A;  3HOV J;  2G0E A;  5J1R A;  2JA7 J;  2XGE A;  4A3F J;  3ZOB A;  1LFB A;  2FX0 A;  3GBG A;  3RKQ A;  5J3L A;  2JA8 J;  5M3F J;  1PUF A;  4A3G J;  3HOX J;  2FD5 A;  5C4X J;  2IAI A;  1JKQ C;  1I50 J;  2MSY A;  3BR1 A;  3W6V A;  1O4X A;  1B72 A;  2VPR A;  4A3E J;  1MH3 A;  2R5Z B;  5K7F A;  4EEF G;  5IOY A;  5FLV A;  1X2M A;  2ECB A;  2ID6 A;  2M0C A;  3NAR A;  2MG4 A;  4AYB N;  2E2I J;  1WH5 A;  5IP7 J;  1LE8 A;  1MBH A;  2YS9 A;  3BTC A;  4D7N A;  2Y30 A;  1IC8 A;  2M9H A;  5HOD A;  2OF7 A;  3TED A;  4DYR A;  4XK4 A;  1ETQ A;  1GV5 A;  5K7H A;  2E19 A;  4FIS A;  3LOC A;  3DEW A;  3Q0U A;  1ETO A;  3S14 J;  3CQZ J;  3FK7 A;  2LD5 A;  1BJZ A;  3I4M J;  4M3G A;  1Q1V A;  1TWG J;  3SDG A;  5M5X J;  3H0G J;  3JRB A;  3RZO J;  4QTR A;  4A3I J;  3HOY J;  1JUP A;  1ZR4 A;  2P81 A;  3L1P A;  3GTJ J;  1AHD P;  4BXX J;  2TCT A;  3HGY A;  3CDL A;  3HBL A;  1VND A;  3JRA A;  1QPI A;  3BTJ A;  1JT6 A;  1P7J A;  2OPT A;  4AC0 A;  3O8H A;  2HOS A;  2VKE A;  2LFB A;  1GUU A;  2ECC A;  3BQZ A;  5BNG A;  3LSG A;  4X1E A;  1IRZ A;  3B6C A;  5EGO B;  1JKR C;  3BG5 A;  4QIW N;  4M3E A;  5E3M A;  1MSF C;  3A01 A;  2K9S A;  5EZH A;  2WV1 A;  1RET A;  4MFD A;  5IP6 A;  5IYC J;  5JLW A;  2WB1 N;  4V2G A;  1VFC A;  2IEK A;  4AUX A;  5FKL A;  2HI3 A;  4BKX A;  4C3I J;  1WI3 A;  4HNV A;  4JX4 A;  2ME6 A;  2XPU A;  1XS9 A;  1XG1 A;  4BBS J;  2M8G X;  3TW7 A;  1Z0X A;  3S17 J;  2ELK A;  2CQX A;  2X48 A;  3D1N I;  2FQ4 A;  2W48 A;  5IOZ A;  3I4N J;  2K9Q A;  2NS7 A;  2GM4 A;  5EDN A;  3LNQ A;  1DU6 A;  3GTG J;  1FIA A;  4CYC A;  1MBK A;  4M3F A;  1JJ8 C;  3ZQF A;  2CUF A;  3G1M A;  4IHW A;  1B8I B;  2LKX A;  3HDD A;  5C3E J;  2AO9 A;  3TP0 A;  3IV5 A;  1T33 A;  2CRG A;  2R5Y A;  1NK2 P;  1AU7 A;  1ZR2 A;  3S2H J;  1ZGW A;  3BG9 A;  3G1O A;  1UMQ A;  3JRG A;  1K61 A;  1TWH J;  2R92 J;  2Y9Y A;  2JN6 A;  3O8G A;  4A3L J;  2HYJ A;  3S1N J;  3ZQH A;  2E1O A;  2L7M P;  4XRS A;  4A3M J;  2DJN A;  3Q0W A;  5F04 A;  2E2J J;  2ZB9 A;  3JRE A;  2EZI A;  2R5Z A;  1EF4 A;  2TRT A;  3BR2 A;  2EZL A;  3GTO J;  4JP0 A;  2NVY J;  3IH2 A;  3IH3 A;  1YRN A;  1RPW A;  4C3J J;  1OJL A;  2Y31 A;  1LE8 B;  2DA5 A;  2RAE A;  2HOA A;  2L9R A;  1JUM A;  1APL C;  4M3D A;  1BL0 A;  1XC5 A;  1H8A C;  2LR8 A;  5FJ8 J;  3M3Y J;  2B63 J;  4BBR J;  2CU7 A;  9ANT A;  2D5V A;  2LLK A;  1FEX A;  2DMU A;  4XRM A;  3HOW J;  1BW6 A;  1TWC J;  2DN0 A;  1IDY A;  2XPV A;  3BR3 A;  1F43 A;  1MBE A;  5M3M J;  2HXI A;  3BTI A;  4UUT A;  5M5Y J;  5FKK A;  5E3O A;  1HLV A;  3QQA A;  2NVQ J;  1D5Y A;  3UKG A;  2CUE A;  3LSR A;  1IUF A;  2I10 A;  2H1K A;  1GVD A;  4RBO A;  2EH3 A;  3FKI J;  4MFE A;  5FKO A;  1I3Q J;  5IYD J;  1NK3 P;  4MIM A;  3JRF A;  1BW5 A;  2VKV A;  3A02 A;  3BR5 A;  5F0H A;  2VI6 A;  5F27 A;  3CMY A;  3S16 J;  2GBY A;  2KDZ A;  4FE7 A;  3WHB A;  4DZP A;  2HXO A;  5GPC A;  2NVX J;  2LP0 A;  4JYK A;  2QCO A;  3QPS A;  1AKH A;  1HCR A;  3JRI A;  3GTP J;  3VPR A;  1QVU A;  1Z77 A;  2DA3 A;  5EYR A;  2NS8 A;  1FJL A;  2FJ1 A;  3GTQ J;  2O7O A;  5J1Y A;  3SJM A;  4B1R A;  4C3H J;  1AKH B;  3OIO A;  1MBJ A;  1UG2 A;  2LK2 A;  2XSD C;  5J1U A;  2COB A;  4IEJ A;  3ZQL A;  4W1U A;  2JWT A;  2Y9Z A;  1CQT A;  4IHV A;  4BY7 J;  5F1J A;  4CYC B;  1DU0 A;  1JT0 A;  3E7L A;  3DCF A;  3BR6 A;  4DW6 A;  2R93 J;  2WAQ N;  1JTX A;  2K9N A;  2XB5 A;  3RQI A;  4DZJ A;  3RZD J;  2PMZ N;  3BT9 A;  2YUS A;  4MLO A;  1Y1V J;  3HM5 A;  1RR7 A;  4A69 C;  1FTZ A;  1MH4 A;  3BR0 A;  1ETK A;  2DA2 A;  4M6V A;  4A93 J;  3S1Q J;  1ZQ3 P;  1TWF J;  4B3A A;  1IDZ A;  2DA7 A;  4L5E A;  1JTY A;  4FCY A;  2QF7 A;  4Y52 J;  1SAN A;  3A01 B;  1I6H J;  2L0K A;  1HDD C;  1OCT C;  5C4J J;  2JA6 J;  4X6A J;  3BG3 A;  4JX5 A;  3S1M J;  2VUM J;  2O8K A;  5FKN A;  4D7M A;  1ZTR A;  3LSJ A;  5EEA A;  5IYB J;  4D5F A;  3JR9 A;  1GV2 A;  3PO3 J;  3Q3S A;  1G2H A;  1U9N A;  5IP9 J;  3A03 A;  3BTL A;  5E3N A;  1ZKG A;  4C2M J;  1FTT A;  4XID A;  1P7I A;  2JK3 A;  1WGX A;  5FKM A;  3PO2 J;  5GPA A;  1RKW A;  1JKP C;  1QVT A;  1MBF A;  4XRS G;  1H89 C;  3B6A A;  1ETX A;  3FIS A;  4I76 A;  5GP9 A;  1W0T A;  2E2H J;  2KT0 A;  2LVS A;  2EZK A;  5F08 A;  4RDU A;  4UUS A;  2AHQ A;  5EF6 A;  2DA4 A;  1HF0 A;  1YRN B;  4GFB A;  3MN2 A;  2DMT A;  5F0F A;  3ZQG A;  1K83 J;  5IPA A;  1U9O A;  4A3K J;  2YU9 J;  1ETW A;  5EG0 B;  1A5J A;  4JX6 A;  2ID3 A;  3GTL J;  5DTD A;  2CQQ A;  2DA6 A;  1GT0 C;  1JKO C;  2JA5 J;  2LTP A;  3PM1 A;  2HDD A;  2Y0S N;  2MGQ A;  1Y1W J;  3OSF A;  3Q0V A;  2JMW A;  1ZK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...