2DNGA

Solution structure of rna binding domain in eukaryotic translation initiation factor 4h
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
103
structure length
103
Chain Sequence
GSSGSSGKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 4H
publication title Solution structure of RNA binding domain in Eukaryotic translation initiation factor 4H
rcsb
source organism Mus musculus
molecule tags Translation
total genus 11
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dngA00
3S7RA 2L08A 1AUDA 1U2FA 2J0SD 1NJIT 1OIAA 1WF2A 2DIUA 1M5VC 5H1SV 1HL6A 1OPIA 3VF0B 3CCMS 4ED5A 2MQLA 2RS2A 1U1KA 1PGZA 3VAFA 1K73T 3UD3P 1FT8A 3N9UC 2QEXS 5DM6Q 2MZJA 4IOCQ 3IWNC 1DBDA 3I55S 2CPHA 5IQQA 2AD9A 3VAHA 1DRZA 3D2WA 2CPIA 1M5OC 3Q2TC 2I2YA 2DNOA 1M90T 3ZZYA 5JVGQ 2XNRA 5GADU 1U1NA 2KU7A 2RT3A 1DHMA 2LXUA 2F3JA 2J76E 2X1BA 4W92B 2SXLA 2DH7A 3RW6A 2VOOA 3EGZA 2NLWA 2UP1A 1X4AA 3LQVA 1W2BR 2M52A 1YJ9S 4LIRA 2M88A 3CMES 1ZZNA 2XS7A 1JJ4A 4UQTA 2CPEA 2D3OR 2DNHA 5DM7Q 3MOJB 1QVGR 3CC2S 1URNA 1WWHA 3VAMA 1X5PA 4ZKAA 2DH9A 2F9JA 5LJ5Y 3CCES 1FJ7A 2WBRA 2RU3A 1RKJA 3TO8A 2HGNA 2KXHA 2MY7A 4F26A 1U1LA 2VODA 2DGVA 3H2UB 1S72S 1M5KC 2DO0A 2PE8A 2FC9A 4IOAQ 1KC8T 1WHWA 3PIOQ 1VBZA 2GO9A 1SJ3P 3G8TA 2LA6A 1WELA 1R8HA 2MKKA 1Q81T 4M5DB 1L3KA 2KG0A 1HD1A 2OIHA 1WG4A 1YWXA 2KYXA 3NNHA 3CCUS 5LXRA 1PO6A 2LEBA 2M2BA 2RS8A 3CC7S 2E44A 2CQCA 2E5HA 5DDRC 1VQMS 2KXNB 1S79A 1QM9A 2BZ2A 2RNEA 3UCZP 2DK2A 1FJCA 2AYGA 2D9PA 1R8PA 3G96A 2CPZA 3RW7A 1U1MA 2DHGA 1OWXA 4WF9Q 2KXFA 1YI2S 2NZ4A 2Q79A 3THPA 3NS5A 2J8AA 2PEHA 2RQCA 2M8DB 4C4WA 2VONA 1H2VZ 2CPFA 3G9CA 2OSRA 3EGNA 3SMZA 1IQTA 1P27B 2MQMA 1JMTA 1WF1A 3SXLA 2VOPA 3BO4A 2OJ3A 1D9AA 1KOOA 4ERDA 4TU9A 4TU8A 2MKSA 1YITS 3P49B 3BS9A 1UFWA 1VC5A 1UW4A 1F9FA 2DITA 4U67Q 2KVIA 2MYFA 2F9DA 3B4MA 3G8SA 2OTJS 2FPHX 4FXVA 5ITHA 2KM8B 2JX2A 2CQDA 3UCUP 1HA1A 2KG1A 2N7CA 4W90B 3G71S 3CD6S 2AYMA 2E5IA 4TU7A 3R1LA 3JB9k 5LSOA 1DZ5A 2ADCA 2DGTA 2LA4A 3UWTA 2MY8A 1U1QA 1B7FA 1WEZA 2CQ4A 3S8SA 5JVHQ 2KFYA 1VC0A 1NO8A 2B0GA 2LQ5A 4WFAQ 2AYBA 2D9OA 5GVQA 2DISA 2XNQA 2JWNA 2KI2A 2DGWA 5GAEU 1YTYA 3DXBA 3MUVP 1YIJS 1Q86T 1VQKS 2DGQA 1U6BA 4CH1A 4YB1P 3US5A 1VQLS 1A9NB 2EK1A 4LJMA 2DHXA 1VQPS 1VC6A 2HZCA 5CA5A 2DGSA 2L9WA 5DDPC 1O0PA 5GAGU 2MSSA 2YTCA 1BY9A 2FC8A 1FHTA 2MHNA 3VAGA 2YWKA 4FXWA 1ZH5A 3P5TL 1N8RT 3U1LA 3R27A 4CH0S 2CQ2A 2M4MA 1VBYA 1H2TZ 1N52B 2OSQA 2DNRA 2BOPA 1WEYA 2DNKA 2CPJA 3NNCA 5DDQC 1UP1A 3BO3A 2M7SA 3MI7X 3V4MA 1K8AT 3IRWP 3VAIA 2FHOB 3B4DA 2N82B 4WKRA 1U1OA 2CPDA 2DNLA 2LECA 2HYIB 4Y00A 1WHVA 2RRAA 3H2VE 4WFNQ 1U6FA 2YH0A 5GAHU 4Z2XA 2QA4S 2CQIA 1U1RA 4IUFA 1X5TA 4LMZA 1X0FA 4P6QA 2KH9A 3I56S 2KM8C 1Q7YT 1M1KT 2V94A 3CC4S 5D78A 2CQGA 2DNNA 3UE2A 1SJ4P 2MKJA 2MGZA 2DGXA 4QU6A 2MJNA 2RQ4A 3FEYB 1HD0A 2MZQA 1WHXA 2HGLA 1FJEB 2KT5A 2DNGA 3J7YU 1SXLA 1VQ7S 2CQ0A 3LPYA 2M8HA 2MZ1A 1SJFA 1P1TA 2MPUA 5IFMA 2MKCA 3P6YC 2ZJRQ 1X5SA 4Y0FA 1K9MT 3CCRS 3CCLS 2YKAA 1VQOS 4BS2A 5CYJA 2ZJPQ 1WI6A 2KN4A 1OO0B 4F02A 2XSFA 2CPYA 2N3LA 3BO2A 3R1HA 2RVJA 3CCJS 2DB1A 2CPXA 3CTRA 2MJUA 3CPWR 2G1DA 2MXYA 2MKHA 3K0JA 2YH1A 1VQ9S 5DETA 3NNAA 3PIPQ 3NMRA 3BEGB 3CUNA 3ZZZA 5CXTA 1X4DA 1A7GE 2ZJQQ 2MGZB 4PRFA 2MZSA 2U2FA 5MLCV 2G4BA 2DHAA 1KD1T 2LCWA 4OZ0A 2KRBA 1WG1A 2X1GA 1WHYA 2CQ1A 3TYTA 5IM0B 4IO9Q 1FO1A 5LSLA 2GHPA 3DLLQ 1FXLA 3CCQS 2M9KA 1WI8A 2E5JA 1VQ8S 3SDEA 2DNQA 4C7QA 1JJHA 2JVOA 2JVRA 1FNXH 3S6EA 2A3JA 2DNMA 4J5OA 3UCGA 2RRBA 2KRRA 2M0GB 3CCSS 1VQ5S 4CQ1A 2E5GA 1X5OA 2MMYA 3OW2R 2LKZA 1WG5A 2EVZA 2G0CA 1CVJA 1RK8A 2EK6A 3FEXB 2MQQA 2QFJA 1H2UX 3VAJA 2DNZA 4QQBA 3CF5Q 1VBXA 1ZZFA 2HGMA 3MD3A 2RUGA 1SJRA 2DNYA 2LYVA 2K3KA 2X1FA 3CCVS 5D77A 2DGOA 3MUTP 1X4HA 2DH8A 2N3OA 2L41A 1WEXA 3MD1A 5DDOC 3HHNB 4QPTA 2X1AA 3SDEB 3G6ES 3Q2SC 2DO4A 2XB2D 1G2EA 1D8ZA 3THTA 3MURP 2MQPA 3EX7B 1SJQA 2MZTA 5LJ3Y 2MQOA 2CQ3A 3S01A 3MXHP 4UY8T 2MQNA 1UAWA 2J0QD 4YOEA 4WFBQ 2DGUA 1VQNS 2XS2A 3CULA 2CQPA 4WIIA 2OTLS 1X4BA 1YJNS 3VAKA 1KOHA 2MKIA 3U1MA 2MZRA 1N88A 2LXIA 2JRSA 5FJ4A 5GMKa 3NS6A 2HVZA 1YJWS 1JJ2R 1QVFR 2ADBA 3TP2A 3CXCR 4RU2A 5LXYA 5HO4A 1Q82T 2DHSA 1X4GA 2ERRA 3G4SS 1VQ6S 2CJKA 3HI9A 4C0OC 1VQ4S 2MB0B 2LMIA 4EGLA 5HL7Q 2XS5A 3VALA 5IM0A 3MUMP 2CQBA 2O3DA 2K8GA 4F25A 3UD4P 4V19X 1WF0A 1N54B 4QU7A 4A8XA 1XN9A 2FY1A 4PKDB 1H6KX 1X4CA 2DIVA 2MSTA 3P3DA 1WTBA 3L3CA 2LEAA 3ULHA 5EN1A 2I38A 1KQSR 1X4FA 5BJRA 4CIOA 1YHQS 1NU4A 1U1PA 4YUDA 4TLQA 2CQHA 1X4EA 2AYEA 2M70A 2DNPA 3MDFA 1M5PC 3CMAS 3J7ZT 2U1AA 4OZ1A 2KHCA 4WCEQ 4PR6A
chains in the Genus database with same CATH superfamily
3S7RA 4KE5A 1FRMA 3D9BA 3VV2B 3T1AA 3KHRA 4PXEA 4ED7A 3AJDA 4DX8H 3IWNC 3E01B 5CHCB 5DLFA 3VAHA 2BQUA 1K0TA 2Q66A 5ETPA 2B3TB 2KU7A 2CJ9A 2X1BA 5F9NA 1NHUA 1KWMA 3KLEB 2OPSA 4DHVA 4LFBJ 2P6SA 3GYNA 1MNEA 4DV0J 1HNXF 1IR0A 1SC3B 4HKQA 3FSYA 1WWHA 2ZOMA 3DGVA 2HBRB 1JLBA 5KG1A 5A8RA 2QO3A 3GCXP 3DGPA 2Z2MA 2O66A 1T11A 2R8HA 3SSQA 2NUUG 1G3OA 3AQOA 2OPSB 3PIOQ 2DXEA 3D5MA 3MEKA 2OELA 2UUAF 3W8PA 4CO4A 2ALYB 2KYXA 3M2UA 3NRBA 3DRXA 3NOCA 1JLBB 5IC4B 5E3PA 3W1YC 4KGKA 1MN9A 2DHGA 2J8AA 4J37A 4C98A 2VONA 3H98A 4QCLA 3GFZA 1H0HB 4GVLA 3ENAA 3FGVA 2PA3A 1ULRA 4S0MA 2BA9A 1OYDA 2F63A 1YITS 2WSCC 2DR8A 4QWEA 3M2UB 2F9DA 1CULA 1N48A 1NDCA 4NYOA 1QD1A 3GB0A 2N7CA 2E5IA 4NLTA 4DV6F 2YWWA 4DL5A 1NO8A 4USVA 2EW9A 4WFAQ 5ETOA 3MZIA 5L1IA 2EC2A 3TJAA 5ETMA 3H0PA 3O8WA 2CDQA 1CULB 3H40A 5SUHA 5KFEA 3HXMA 2BUNA 3OL7A 5HN0A 4HH0A 2NQPA 3I9V9 1WNEA 1KR4A 4KPCA 1ROFA 1S59A 4F7VA 2XYPB 5HQLA 4UOFA 4ED3A 1UP1A 2M7SA 5KFNA 2AGPA 1WHVA 4JI6F 5CAAA 4EO6A 2ZVSA 1U1RA 1RHRB 3RR7A 2GZOA 1TL1A 2KH9A 5J2QA 1Q7YT 2NR0A 2QX0A 4C6AA 4UT4A 2MKJA 2Y8YA 4ZCLA 4Y28C 5LOQA 2HGLA 1VISA 2WB4A 2YQ1A 1Q7LB 2A10A 4DSLA 4LF1A 1TL7A 3IS9B 1X5SA 2EXUA 1EHWA 4F02A 1J5EJ 2CPXA 1TL1B 1NDLA 5J2QB 2R2RA 3B78A 1YGYA 2RQMA 5B0GA 5CCLA 5CXTA 1XTZA 2D41A 5E2QA 2ZJQQ 1C0TA 4OI1A 2B8QA 3DFEA 2HEKA 1B7YB 1B0TA 4Y65A 3MTKA 1QAJA 3HHEA 4KHPJ 3OV7A 1NK8A 3CO0P 4ETZA 3T9NA 3RJMB 4DQIA 1LQ9A 4ZA1A 2NXJA 1UJ4A 3MR2A 3RU0A 2DBBA 2G2YA 2YY3A 1XEZA 1C0TB 2YNGB 3ETOA 3IFEA 2MLZA 3Q22A 2X1AA 4C2MA 4MIBA 1D8ZA 2EG2A 2PDAA 2CIMA 3VZHA 1GTHA 2W2NP 1RAEB 2BE9B 4CO5A 2UV8G 3MMJA 1REGX 3M8WA 2HAFA 2FY8A 3FBFA 3CCTA 2H5JB 2AV5A 1KRPA 1EB0A 2HKEA 4NLOA 4U9RA 2P9CA 3HVRA 2HHVA 2KJWA 4KGVB 5LXYA 3BGFA 1N34J 2HS3A 3LANA 2OI2A 4FS2A 2FUG9 4OI2A 1K47A 1F5AA 5KFYA 1N54B 1TL4A 1R8AA 4NXMJ 1RHJB 1QUVA 1HARA 1UPMB 3KJQB 3HFZB 1KVIA 2MSTA 3L3CA 2FVPA 5C7PA 1NDKA 1J27A 3EDQB 4ECTA 1YKWA 2FVCA 5F8HA 3T6JA 1AXQA 3FFIB 3TX0A 1U1KA 3VAFA 1IBKF 2QSWA 2QMWA 1FT8A 1I94J 2IC3A 1HQUA 4DU7A 4MKVA 2FHJA 3T5HA 3W2VB 4EYIB 1M5OC 3W3SA 5J1EA 1BQNA 1NZ8A 3M6WA 3LQVA 1CBKA 2M52A 4DSFA 2VBXA 1SVDA 4PWDA 1PIEA 3KUGA 1HBMA 3ZTPA 2D3OR 4DR3F 4J91A 1URNA 3MPWA 2IC3B 3N6LA 4RUAA 2EFVA 1D09B 3KUHA 4DEZA 3N6NA 5MAOA 4X4UA 3SQGA 1BQNB 2NPFA 1SV5B 1WHWA 2GGPA 4RBVA 1ZS6A 1RWNB 4K50A 1R0CB 4ANDA 1Q81T 4PWDB 4FF4A 1HBMB 2D1CA 4A8KA 2DR9A 5LXRA 2QG9B 1UWAA 2QYGA 5L1KA 2DK2A 4PWUA 3JS9A 1CJVB 3K57A 1RDRA 4NLSA 3AY0A 5A2QU 1H2VZ 1VK8A 1CEZA 3TUIC 1WF1A 3SXLA 3IGVA 4AUKA 1Z2ZA 2V50A 4K0KF 2XY7A 1UETA 3UDCA 5EX3A 3QQCD 4U67Q 1VDHA 4X4TA 2UXDF 3R6GB 4TNOA 1QSYA 1CS4A 3ISNC 4GC6A 4A8OA 2QLXA 2FVQA 3R1LA 3EZ5A 1LKZA 1YZ7A 2WCXA 2WHOA 2PMZD 3KLHB 3KLFA 3QIDA 5GAEU 2KKHA 2VHGA 2J7WA 3PYGA 4JB8B 5IC6B 2W9CA 4BWJA 2HW3A 1RT1A 1VC6A 2UZAA 4R0JA 5GAGU 2HLTA 1WACA 2XSJA 3CDWA 3B6BA 3T1HJ 5AXLA 2C3PA 3IBFB 2NS1B 4Q44A 2ASDA 5KFDA 3KLFB 2JC1A 1W7WA 3RZAA 3GG1A 3CB4A 3WDOA 3HPOA 3UVJA 2W9CB 2HFVA 3V6KA 1RT2A 1RT1B 3D6HB 2CZVC 1IBMJ 3G86A 2KM8C 2V94A 2KYZA 2XSJB 2V8PA 3OVBA 1A6LA 5JXSA 1NRKA 1VFJA 4DR2J 2EFPA 2KFZA 4PYAA 3X3UA 1Y10A 2L48A 3CE8A 1H73A 1RUSA 3UVJB 3CCLS 4DV3J 1RT2B 5KT2A 4KBIA 1S76D 3CTRA 2G1DA 4ZLLA 3PFOA 2YPZA 2G2ZA 3P4UB 2JFKA 3H5XA 3FCWA 4O3RA 4KR0B 1VQ8S 4XIUA 2K1RA 3GZ7A 4ZPDA 1J5OA 4O0IA 2KRRA 5KFVA 3PY8A 4NLGA 3CCSS 3KG0A 2PFFB 2LKZA 2WOMA 4Q7AA 4DSIA 3SCKE 1LK7A 3FEXB 2MQQA 3HZGA 2JL9A 4LUBA 1UWBA 4LVNP 2UUBF 1VBXA 4E2FB 3J7A1 3MMAA 2DRBA 4HEA9 3SV4A 1ZM2A 4C0HA 4LFCF 1N36J 4WU2A 2DCUB 3WX4A 1J5OB 2G13A 3DLKB 3EX7B 3UDVA 2ZM6F 2RH3A 4RPFA 1BQMA 2I6WA 3AOBA 2LU2A 1UWBB 5L1JA 1N88A 1FVQA 4L3NA 4GO7X 3W63A 1CQNA 1TL3A 3WZ0A 3ZZ0A 2CQBA 2Z2LA 3TI0A 1Z2LA 2ZH3A 3X1LB 2ZBRA 1UVLA 1XJWB 2YKMB 4FVCA 3ULHA 1F1BB 4WXWA 2BE2A 1S0NA 3W7BA 3R3TA 3IR7B 2GAGC 5CYQA 3ENVA 1TL3B 2I5JA 1IBLJ 3N5BA 6AT1B 3TEHB 3MAQA 2LLZA 2JOQA 4RW8A 2CPHA 4Z7CA 3HVTA 3PW7A 2K06A 4N77A 4B3RJ 1LWXA 1DRZA 2KZMA 1FVSA 2HZAA 4OYOA 5JVGQ 2HQ3A 1OPZA 5A6WA 1XK8A 3TUPA 3LOUA 5CYQB 3J7AN 2I5JB 4LIRA 3VVTA 4IKAA 2QLJB 1FI4A 1JJ4A 2OPPB 1B64A 3OD2A 1RAHB 5KTQA 4DR6J 3GIIA 3HVTB 3DLEB 2CZ9A 3DRYA 4UF4A 1HNWJ 1O6XA 1YDLA 1NEEA 1F2GA 1FKAF 4F8RA 1HYSA 4IOAQ 3K2YA 4CO1A 1VBZA 4MFBA 2GO9A 2BACA 4Q43A 3HJVA 2WVFA 8RUCA 2BJ8A 1IQZA 4P72A 4ECQA 3IO1A 3K7RA 3KHHA 3SBMA 2ZUAA 1SIWB 4NCBA 2IDLA 4XPEA 3KLIA 2ZEJA 2CNKB 3G82A 2FHMA 2BXJA 1XMQF 2EFOA 2F8EX 4MFBB 1H74A 2VOPA 3M9NB 2R2UA 4OV1A 4B3MJ 3P49B 1QSSA 4LF6F 2OKQA 1KVJA 3KLIB 5KFZA 4R0EA 2X3GA 2VBYA 3TA2A 3G82B 2J0WA 4QW9A 1S1WA 5HK4A 3S8SA 3EDRB 4ID8A 2VDHA 4I64A 2FD2A 2C3YA 4ILRA 1VRQC 4RUCA 2JWNA 4DU8A 2FQQB 3W62A 4YHHJ 2ZH6A 4OHYA 5EUHA 4WXOA 2E9ZA 2QV6A 5KFPA 2DHXA 2R3VA 2IM0A 2B56A 4JI0F 2V8VA 1FDDA 1LNQA 4DPUA 4IH5A 2BM0A 3GFHA 3A12A 1FERA 2IYGA 3VAGA 2PFDA 4FBUA 4RW9A 2M5YA 4K4VA 2OSQA 1LWEA 2DNKA 2JH3A 2W2OP 1KBRA 3IRWP 2HG4A 1UA0A 3DRRA 1O51A 4DPOA 3RB3A 4DDFA 4MKAA 4N7TA 4P6QA 4ZN1A 1GT8A 3ONQA 4JI8F 4O3SA 2R2SA 4K4XA 1HHTP 4E0DA 2UU9J 3UE2A 3JSRA 2HRYA 2FGOA 1FRLA 3FBEA 4RW9B 1U0SA 1Y0HA 3IM9A 3A3OB 1SI9A 3KHLA 1YJTA 3NCRA 3BDEA 4I69A 3BZQA 4BS2A 2ZJPQ 2RVJA 5FIIA 4MMOA 3CPWR 4WP3A 3LALA 3KTQA 3OUYA 3KG1A 3W9JA 4ZVTB 4O3OA 2G4BA 2DHAA 1S12A 1YVFA 2QZ8A 4MK8A 4LF4F 3OFGA 4ZS6A 1MROA 2ZDPA 1FNOA 1VLOA 1TK8A 2HMIB 1IN0A 3S6EA 2DNMA 4DQRA 3FZ2A 1Y11A 2OMOA 5B7WA 3OVAA 3SI8A 4MAKA 3OUYB 5DGAA 5C42A 2ZNZA 2RB7A 2BE7D 3NCQA 5H9EJ 2QRRA 1R6VA 1VQYA 3A4TA 3VAJA 2HGMA 4NLDA 1FK9A 3EZUA 4I67A 1OQ6A 9RUBA 1MROB 2J9EA 4P52A 3MD1A 2HHHJ 3CJQA 1FDAA 3G6ES 2A6MA 4P2XA 4WJBA 4ECXA 1V9OA 3PW5A 1RGVA 1HR0F 3MM8A 1BWVA 2CNLB 5C42B 2W4PA 4F0HA 3PJ9A 1TR0A 1NH7A 1YJNS 4B3TF 2J9DA 2AEMA 3U1MA 2LDYA 2V6AA 2DHSA 2UXCF 2CG8A 5EWFA 5U47A 3B54A 1VQ6S 2CJKA 3M2VA 4B08A 1KHVA 1ZA1B 5M2RA 4DV4J 5A6PA 3MM8B 4ID5A 5E3QA 1C0UA 1TFWA 1KQSR 5C2GA 1WSVA 4RW6A 2IDEA 4V19J 3HT3A 1JLQA 3DXSX 3CMAS 2XQCA 3PJWA 1YBTA 4GVBA 3RAXA 6FDRA 1NDPA 1NJIT 1WF2A 1UVMA 2K7KA 3M2VB 1KNZA 2VL1A 4CRJA 3ZXWA 4ZLNA 2V34A 4I6AA 4P73A 1YLXA 2UVVA 2RE1A 1C0UB 1YRXA 1RAAB 3FCHA 4LF5J 5LT5A 3AA8A 3BB5A 1BGXT 2F1FA 1T05A 4MK9A 4HLBA 4DFKA 4HT5A 2JZ5A 2FLLA 1YJ9S 1RYSA 2OD6A 4JYAF 3BQ2A 2DNHA 2Z0GA 2DH9A 5HMWA 4PG5A 3CCWA 2WBRA 2EFQA 2UXBF 1FE4A 2HS0A 2KXHA 3H2UB 4HH1A 1KC8T 2K2PA 3GE9A 3VGUA 1T05B 3DHWC 4DCPB 4C3KA 2CVEA 5C25B 1YZ6A 5D4PA 2I8EA 5KFAA 1YJRA 4MKYA 1F9EB 3OHAA 1XQIA 1U0HB 2DT9A 2RQCA 4C4WA 2R7OA 4OX6A 5L9NA 4DL2A 1FCAA 1YJUA 2RKIA 3DLBA 3DOLA 4YR2A 2MKSA 2XI3A 4A4JA 4K8RA 4DMZA 2MYFA 2JEIA 3I5AA 2FJBB 1KQKA 4ER8A 2AYMA 3TOQA 3WIUA 3CJRA 4C8OA 1RT4A 4IQMA 1HQ2A 1RTJA 2LEPA 1RI7A 4B3SF 1IUJA 4JI2F 4C8YA 2RKIB 1RQ0A 3I0SA 1YIJS 3OL6A 2CZ4A 1NJZA 3ZNJ1 3I96A 1GNKA 4JV5F 5LMNF 2EK1A 5B0EA 2VASA 2J9CA 4ILLA 1ZBTA 1M5SA 1KQGB 5KT5A 2R9LA 2DGSA 2W4CA 2RAQA 3SEOA 3OL8A 3K5OA 4NLRA 4LRCA 3GQCA 5IT9U 3Q8YA 4Y2KA 5D4OA 2KHCA 1RT4B 1JNZB 1UJ6A 2XCAA 1RTJB 3AXMA 3H90A 2GMHA 3D0HE 3SYZA 2FHOB 3B4DA 2DNLA 3BGUA 2V0NA 2XMUA 2FYXA 2IJFA 4LF8F 2DEIA 2AP6A 4LMZA 1X0FA 1SCJB 2PC6A 5DG7A 5D78A 2VKRA 4RNNA 2RQ4A 3EM1A 3DRPA 3EGVA 3LPYA 4DPWA 4ZN3A 2M8HA 4OJGA 2FZKB 2JEJA 1K9MT 4HYKA 2AEJA 1RWPB 3I31A 2YH1A 5D4LA 3HD2A 4LF2A 2WBMA 1T95A 4DSEA 4PRFA 1WC4A 5E0OA 1WOOA 3ZFVA 3DRPB 1RAFB 2OH2A 4FXDA 1WG1A 2A2DA 2OGUA 1JKHA 2W24A 2MLXA 1WI8A 4PXBA 1HNVA 4M5JA 4CO3A 1EZZB 3QWUA 3OVSA 2MMYA 2HS4A 3MPDA 3TAQA 3MR7A 1S4FA 3CD0A 1EJ7L 4RWWA 3TARA 2G9OA 2XULA 3QJPA 4X65J 5LJ3Y 3TA0A 2MQOA 2D69A 4KIAA 4NCGA 1MWZA 1QE1A 2IA0A 3UNGC 4YOEA 4WFBQ 2DGUA 4B9LA 5DZ7A 1NH8A 3RBXA 5IT0A 1RXOB 2OTLS 5BR8F 2W2PP 1RZMA 1MWQA 4ICLA 1VMBA 4XTTA 2J9DE 2YWFA 5J2MA 2O3DA 2XMVA 4BC7A 3QPIA 2ASJA 5AJ3F 1S0VA 2Y1LB 4CLSA 1X4CA 4RX6A 1CJTA 4NCGB 4TKTA 2IIHA 2CNNB 2WRMA 3GWCA 1SBRA 3E8OA 1YQHA 2Z57B 1IKXB 1YHQS 4KY3A 1U1PA 2J6UA 4YUDA 3BGRA 5DQHA 3P5BP 2L08A 4ICLB 1M5VC 5J2MB 1OPIA 2YBVA 4O44A 4CCHA 5H9EK 4LR8A 1PGZA 1BHNA 3BDPA 2YPYA 4OYIA 5A8WA 4WWSA 2VJUA 1R89A 4AD6A 2F4VF 3FNNA 1FDNA 2E29A 1CJTB 1MN7A 2AD9A 4ZVOB 2I2YA 3ZZYA 2XNRA 2QSFA 1SH3A 4TYAA 3BGRB 4W92B 5I3UA 1BE4A 4XDDA 3MM5A 1MU2A 2HSEB 4OQJA 5LL6d 1RWOB 2M88A 1FDBA 3HVAA 4J90A 5A8WB 2B9XA 4GKJF 1NHVA 2LVWA 5F8JA 1F3FA 2DCLA 1BWEA 1FJ7A 4ZHRA 1N5YB 3NKYA 1WC3A 3PFEA 3DKDA 2DO0A 5FLXU 2PE8A 5I3UB 1NMEB 2J8SA 1TKXA 4N56A 4OHVA 1GMWA 3MM5B 4RBTA 2LA6A 4NLUA 1R8HA 1HIYA 3BPDA 1M0SA 2OEJA 1HWLA 3NNHA 4TY8A 2M2BA 4JI1J 2KXNB 2G1HA 2AYGA 5H9FJ 3RGIA 4QIWD 2XBPA 3NS5A 4PUOA 4RUBA 3H42A 4JI7F 3G9CA 4JV1A 4CP5A 1IQTA 4KAIA 1E6YA 2XMAA 5D3GA 2P9EA 5F8LA 4F4WA 2R7TA 2F65A 3M4XA 3ZZUA 3GILA 3CD7A 2BJDA 2IVMA 1VC5A 1LV5A 1VS3A 2C2MB 3GFYA 4TY8B 2KVIA 3RB0A 1FEEA 4O23A 3UCUP 4MT1A 4OJHA 1AB8A 2DYAA 4PUOB 1XC9A 2DGTA 1NK5A 2B6AB 4K4UA 4J9QA 2HFNA 5F8MA 2DISA 5D3GB 4CM0A 5IZHA 4F67A 3QLHB 3GYGA 4EFAC 5CA5A 2FTRA 2RIJA 2YTCA 1BY9A 4YY3F 3QRQA 1FHTA 2MHNA 1REVA 4OX7A 4LSNA 1RP5A 3M8QA 2DNRA 2ZVIA 1WEYA 1CJUA 3MMCB 3V4MA 4ES3A 1SPBP 3NGSA 2WSFC 1U6FA 2O67A 5RUBA 1RTDB 1L3SA 1N5TA 2QA4S 2CQIA 4M5IA 2YKPA 1U02A 1NM2A 4HHJA 3D7SB 5GMEA 3M8ZA 1REVB 3CJSA 5CCMA 2DGXA 5HAOA 2V67A 4P7VA 3VQSA 1GMUA 3A8JA 4CM2A 1JLFB 1WHXA 3ZC4A 3M8QB 2ZZTA 4NASA 2AZ1A 2CQ0A 1CJUB 4LFBF 1IKVA 2EKYA 4JI3J 2R8GA 4DV0F 1FF2A 1SUQB 1G4CA 1MWYA 1NKEA 2VF3A 3MF5A 3MM9A 2FDNA 1XERA 4URSA 2PD1A 2QJ3A 1GFWB 4KB7A 5CD4H 2JNJA 5IM0B 4IO9Q 2E5JA 4FKXA 1RJJA 3V4IB 5F3TA 2R7VA 4CLFA 4OYZA 2JVRA 3W66A 4DPXA 5F0WA 3KUEA 4A47A 3MM9B 1VQ5S 4NOHA 4BWMA 4HDGA 4URQU 1S1XA 2Y1JA 1VK3A 4ZJLA 4IG3A 3TZWA 5J2PA 4URGA 3BH7B 3OTEA 5IQ6A 1GX6A 2N3OA 3OL9A 1WEXA 2E1CA 1UVIA 4DF4A 2EWHA 1HFEL 3HJFA 1T9UA 3UN3A 4I6YA 1UVKA 1Q79A 2QTWA 1S1XB 3IA0A 1VQNS 3THVA 4Q2MA 5EGYA 5CQGA 4IG3B 2YKOA 4C11B 1TUGB 4Q0BA 4LRDA 1QVFR 2ADBA 5IT4A 4O3NA 1Q82T 3HI9A 2LMIA 3S1TA 2QA4G 4KPYA 3HHLC 1VRTA 4ALZA 2VFUA 4EWTA 2BR0A 4AT1B 4K4SA 2VQEF 2G2OA 2QGFB 5KT6A 4NA3A 3Q8QB 2VJVA 3H7HB 4Q0BB 3LGMA 3K5LA 1KONA 4ZVUB 3NAIA 5CYMA 3GMGA 4ZVRB 2YNIA 4IDKA 3BYPA 3UD3P 1HPZA 1ZTWA 1IWGA 3TQ1A 3Q89A 3IR5B 5AXNA 3IR6B 2WTFA 3MMBA 1NB7A 1S9GA 3U7JA 3GIRA 3EGZA 2NLWA 2GO8A 3M7VA 1WKKA 1NAQA 5CYMB 1LWFA 5HMXA 2VICA 2RRNA 4QWDA 2Z58B 2F9JA 2DR5A 3FRZA 3E3XA 4K4ZA 2DPJA 1BC6A 4KYZA 4K5SA 1FJGJ 3MMBB 1UEUA 3ITHA 1M5KC 1S9GB 3UDEA 4DV6J 2CRLA 2N4DA 4E8UA 2GJFA 2GVZB 4OL8A 3MEGA 3M1VA 1HD1A 1YWXA 4ETXA 4KHPF 1RT3B 2DD8S 2AX0A 1U49A 3V2UC 4CZCA 3PW0A 4USWA 2P8IA 4DI6A 4Y34A 1JK9B 4DV2J 2AZ3A 4H4MA 3KG4A 3GPAA 3ITHB 4Y2IA 5KFMA 2XMTA 1R8BA 2OSRA 3RRKA 3FEZA 3PR5B 4AQYJ 3M1VB 1OQ3A 4P2SA 3JXOA 1DTQA 3CJTA 1IM4A 1DQAA 2MDAA 1S48A 2CQDA 4OHXA 1Q95G 2XI2A 2ZE2A 4LIWA 3OQ2A 3F56A 3FUYA 3UWTA 2V63A 3EJMA 4IH7A 1EETA 3NGKA 4J9RA 1WTFA 2JEGA 1OY6A 2WONA 2RUSA 1H38A 2KI2A 1N34F 1RA7A 3DXBA 1Q86T 1QUPA 4WBFA 3QZ7A 1DTQB 3US5A 4LT6A 4DUTA 2UUCJ 3O6QA 4OZ3A 4NXMF 1PAUB 2V4RA 5A76A 4HI2A 2ZE2B 1EQMA 1VHFA 4U95A 3R7SB 1HBUB 1ZH5A 1NK6A 4TQRA 3KK2A 2M4MA 4M63A 2WONB 4F04B 3VAIA 5H9FK 3DOMA 2CPDA 3DYAA 1N5VA 5HMZA 5K9FA 1SQGA 2YH0A 4BHQA 1RWMB 1I94F 3I56S 4OZJA 2CQGA 4DN9A 5I4MA 1FNMA 1D1UA 3UDLA 3KK2B 3FEYB 3TVKA 2CJYB 5DQIA 3C46A 1TFYA 2N4CA 2W4DA 3DOMB 4F4ZA 3DYAB 3U1NA 1DJ0A 1NUEA 1Q5YA 3D68A 2YKAA 3DCAA 2XSFA 1U26A 2WAQD 3H4BA 4WFZA 2CWXA 3CDEA 3NNAA 2XCPA 4ZP7A 2RQKA 1A7GE 1LW2B 2MZSA 1BUXA 2E1PA 4ZJQA 1KD1T 3W9HA 4C8NA 2X1GA 2C2RA 1GXLA 3K58A 2ZD1A 1WHYA 2HVEA 4XDCA 4XO0A 1FO1A 5LSLA 1AW0A 1JJHA 1FNXH 2GQCA 4YR3A 4J5OA 1RADB 4C48A 1IJEB 4RR5A 5ETLA 4CQ1A 5D6GA 4FVMA 1AFJA 5F9LA 3LAMA 3TNVA 3TZXA 2XWYA 2QFJA 5KFFA 3K8VA 4F4AA 4M5HA 1DLOA 2C42A 2H54B 1DURA 5BXIA 3ZO7A 2B4PA 3GP9A 1G2EA 2MQPA 5B0CA 5KG0A 2HQDA 4UY8T 3PYDA 4M8LA 4ED1A 4L76A 1X4BA 3BH6B 3E51A 5EWGA 5GMKa 2ZH4A 3IXQA 4RU2A 2XO7A 1LW0A 4WKYA 4AFFA 2XS5A 4L75A 1NK9A 1EIYB 5L1LA 3A8IA 1JX4A 4ITSA 3FDSA 4DR1J 1RTIA 3DLHA 3PHEA 3D3BJ 3P3DA 2VKZG 4C8LA 2HBYB 4ZPCA 3V81B 5DG9A 3T1HF 4ZDNA 2KZZA 3EMTA 4WYWA 3W5YA 5AE1A 2DPIA 1JXLA 3ILLA 1HL6A 1XBWA 4ED5A 2BVZA 1K73T 3PCOB 4IOCQ 2J0XA 1RTIB 4K59A 3AT1B 2HQGA 1VRUA 5EWEA 2COLA 2ILYA 4JBCA 5K5MA 2VG5B 4FBTA 4DR2F 4G3IA 4FNHA 4I2QA 4M5DA 2YWHA 1S6PB 1N33J 4AL6A 5DM7Q 3CC2S 3D67A 1WC5A 4H4OA 4U8YA 4DV3F 5EHHA 3VAMA 3JSYA 1FWPA 4PQUA 1DFDA 3CCES 3TZZA 1VRUB 1RA6A 2GX8A 4OX9J 1HQEB 5L38A 1JWWA 2ZBPA 4KJIA 5L9XA 1PBUA 2IBOA 1UEKA 2QL7B 1H7WA 4M5DB 3C19A 2KVQE 4C9DA 4H4OB 3AJ1A 3GSIA 4PQUB 1V3ZA 2OUGA 3UR3C 2RNEA 3EXCX 2E1AA 4KRWA 3RW7A 2KXFA 2POKA 3T5LA 2PEHA 4WFXA 1GMWD 4B9TA 2HFZA 3EGNA 2VG6A 1P27B 3DI6A 5KAKA 4HACA 1N36F 1C1BA 4Q8FA 1EP4A 1F60B 3BS9A 2GV1A 1FXDA 1UFWA 2C1EB 5ITHA 1NPRA 3PKMA 4W90B 1WDDA 4N41A 3RAMA 3D6MB 1RTZA 4B9UA 1WJ9A 2WB1D 4DX6A 2O5DA 2ZH9A 3HHLB 1C1BB 4DQPA 4YB7A 1EP4B 2DGQA 4PG6A 2ZHAA 3K89A 3O5TB 3ADAC 5KFOA 2ZBIA 3AD8C 4X84A 1LXNA 1YRUA 3ZZRA 3J80U 1S6OA 2YX4A 5HLFA 3P5TL 4K4TA 2CQ2A 3M8PB 2HBZB 5DDQC 4X4RA 2ZH2A 3BO3A 1N6QB 5A0YA 3JQMA 4F3MA 1IBLF 1X8DA 1VGYA 2QC3A 2BOAA 1Z4UA 1PJ6A 1MSWD 5KFHA 1SJ4P 2ZWPA 2MZQA 2XM3A 3KJNB 1OY9A 2RD5C 3OXGA 5DGBA 4PG4A 2VA2A 2ATCB 2CA9A 3KJVA 3LP1A 2GMJA 4G6VB 2P2CB 5DJBA 3VWSA 3BO2A 2YQ3A 4E98A 3R5BA 3T1YJ 2KL8A 4DR6F 3ZTOA 5HANA 3CUNA 3ZZZA 2ZM6J 3BV8A 4Y3CA 1HNWF 1HNZJ 1WD6A 3F73A 4OJ3A 3PTWA 2PI5A 3KHGA 4EI2A 3AFGA 1AUSL 1Q78A 1ZETA 4C7QA 4EZ6A 2XYHB 5J1PA 4NYZA 3DOKB 3GSDA 2NSCA 2B9EA 5LSRA 4ZK7M 2QA2A 2IFXA 2EVZA 3WC0A 5LM7E 3GG0A 2V2ZA 2RUGA 2Q1LA 5KFKA 1SL2A 5IV4A 1YJVA 4P74A 3TUJC 3HT0A 1BMQB 2A2CA 4B3MF 1GMVA 2WK4A 1TTHB 2QLBB 2CYYA 3AQPA 3V6JA 2YNHA 1U09A 2HQCA 3MFIA 4DOZA 2CJQA 4I1TA 2KTQA 4OX8A 2MKIA 2D3UA 3IWXA 1S1UA 2BRKA 4ELUA 1ZM4A 4YHHF 4Q45A 3UD4P 2Z56B 2HQFA 3TJ8A 5A8RB 1TL5A 2HLUA 1L3VA 2YNHB 3DGPB 4NCAA 1R27B 3V6DA 2EG1A 2VUGA 2HWIA 3SV3A 1ZM9A 4IR1A 4QW8A 1MW7A 2U1AA 2FLOA 2PMHA 3PO5A 4A8FA 4HL9A 1I51B 2IHR1 4RL1A 3LO3A 4ECRA 3CCMS 2RS2A 3F44A 1NNDA 1WC0A 4I2PA 2AHOB 4X4VA 3JQKA 3V6DB 3R5AA 3IN5A 5K8PA 2UU9F 1T3OA 5E3CA 3D1OA 2GMLA 3NGTA 1RWWB 3QBCA 1W2IA 4UQTA 3CJ2A 2CXEA 2K7JA 5BYRA 1QVGR 4I2PB 4NRUA 4LVOP 4F4KA 3PYEA 3KDNA 5FD1A 4NA1A 5LJ5Y 3OJUA 3FBCA 1Q5VA 3IMQJ 2HGNA 4F26A 3BF4A 4L72B 4G1IA 1DY3A 4NA2A 4USMA 2OMLA 2FB0A 4DG1A 2GIQA 1RAGB 1GK8A 3HVWA 1VJWA 3QAEA 2HWTA 1GAOA 2AEFA 3N4WA 3CCUS 4ED8A 1JXEA 4ZCIA 5DDRC 1VQSA 2BZ2A 3PV8A 5EX0A 4DR7J 5GADI 1GXTA 4WTYA 4IR9A 4DX5A 1P9YA 3THPA 2W2QP 4YR0A 4LR9A 4DG1B 3CMQA 1F3VA 1KOOA 1Y3JA 4ERDA 3IGNA 4TU8A 3GONA 2HHHF 1SH0A 3BKFA 5IV3A 1U2RA 1U8SA 2WVEA 4YFUA 1HA1A 2KG1A 2VQFJ 1QTMA 3PVXA 5A8KA 4N5SA 4X4OA 3SFGA 3KNGA 1X9WA 1IKWA 3IAM9 4X66J 1TL7B 4LRFA 4X62F 2R7XA 1U6BA 5D8HB 4O3PA 1RAJA 4CDIA 2IPOB 4WZQA 2LQBA 1U24A 4DV4F 1N0UA 1O0PA 3MR6A 4F50A 3KMQA 2J7KA 2LFVA 1TELA 3I82A 5A8KB 2YWGA 2N7YA 3BN7A 2ACYA 1DQ8A 3UFCX 4P10A 2Y1RI 1SKSA 4LF4J 4DR5J 2N82B 2ZZMA 3NGDA 4DUZJ 2BABA 5AE2A 2GJIA 3IRXA 3OR2A 4OYMA 1I5OB 2DNNA 1UZDA 5C2CA 3T5JA 4ZP6A 3UPFA 4J9MA 4C3LA 3JTOA 3M32A 2MZ1A 1D9DA 3GIJA 2BDPA 3H2LA 4Y0FA 3CCRS 1AZSA 2XYGB 3SZ2A 3R2CJ 3UI3A 3CCJS 3OR2B 5KFJA 2IY5B 1LEOA 1XMBA 5DO2A 3I9ZA 1RHKB 3TYTA 4FYDA 4OHWA 4EBEA 5HI7A 2M9KA 2UXCJ 2NUHA 4J9NA 4DS5A 4KH0B 1PKUA 1AZSB 1S9FA 2LP4A 2J5AA 2XY6A 3AB4B 4GC7A 3AJ2A 1F0XA 2DNYA 4CLWA 1Q4RA 3CD5A 3Q23A 4F0MA 4UW2A 3HHNB 3VTIA 5AE3A 3RB4A 1HQUB 2AJ2A 3PEJA 3NL0A 2OEKA 4ECSA 2QT7A 4JP8A 5J1EB 2JLEA 2XS2A 3CULA 2CQPA 3ENWA 2MZRA 3ZZPA 3C15A 1V5VA 1YJWS 3PHTA 2RHSB 1F5CA 2BJ1A 4ES2A 5KG2A 4PXCA 3G4SS 1UPPA 2EI5A 1WC6A 3VALA 2IMOA 3PW4A 3QRPA 1T9VA 3L4BC 4DX7A 1SC1B 4JYAJ 4NLYA 3N01A 2YX1A 4A8XA 4CNYA 4PKDB 3SQGB 3KXDA 1PSDA 3C6UA 4Y2CA 4WE1A 4WP9A 2LEAA 1ZTTA 2C2ZB 2HWHA 4CLKA 1Q8BA 3LH2S 1RCOB 2AW0A 1X4EA 2GGPB 1T3NA 2VC0A 3C15B 3MM7A 4OZ1A 1AUDA 2DIUA 2JJ4D 1HKAA 2WVDA 4NI2A 3C6UB 4EUVA 3Q2TC 1U1NA 1RKIA 4YN3B 3W61A 1KTVA 1Q0NA 2ABYA 4OZNA 3BKUA 1TZ0A 5ETSA 3MM7B 3IC1A 1D8YA 2R42A 4NMLA 3I5CA 3M9OB 2GCFA 3KLGA 4I6WA 3PKYA 4IG0A 1ZA2B 2PSZA 1ZZNA 2F7VA 3R8YA 3MOJB 1L3TA 1CS4B 3V5RA 3W8GA 4NI2B 2FJDB 2V69A 2OFHX 2EKNA 2MY7A 2FHKA 2PMWA 4WTOB 4C97A 4KTQA 1X9MA 3ZNUA 4ELVA 4K2XA 3R5DA 3L09A 2KG0A 2CWKA 3H4DA 4ILMA 1XMOF 1FFSB 2F40A 5HP1A 2FJAB 3OJSA 4RKUC 2PI4A 5KFIA 2FGCA 3SCJE 1SKUB 4X65F 3BO4A 1IWAA 2HPUA 3MWBA 4RNMA 1CC7A 2I9SA 2KFNA 5THWA 2DITA 1K1QA 2KT3A 4ECUA 2H51B 2HRTA 1JB0C 4DUYJ 2FZGB 3HSGA 2Z4PA 2WVCA 4DV5J 1U1QA 3A3NB 4G1PA 1WSRA 4FYYB 1FRJA 3IBWA 2R7WA 3HHLD 2NZCA 2AYBA 2C2OB 4OI4A 5GVQA 4CLPA 4EMDA 3KK3A 4X4QA 5HBMA 1VQKS 4QWBA 2E9RX 5HQMA 2VPYB 5F3ZA 1T7PA 4FF3A 2KJVA 3NGRA 3I6PA 3CDUA 3VGVA 5KG7A 3AA9A 4FXWA 3VR1A 3H25A 1WKJA 3R27A 1H2TZ 1FXRA 2K1RB 4ZOSA 3KK3B 3R9LA 4QYRA 1K8AT 4YB6A 4WKRA 5HBMB 3BSNA 2ROEA 2HYIB 2MTLA 4WFNQ 1Y5NB 2WOMB 4ENOA 3HHKA 4ZJOA 1N32J 3WX8A 2HVIA 2AGOA 3CVKA 3T9ZA 3ILJA 3I4HX 2G0IA 3MMAB 2VFRA 5B0DA 3K5PA 5KFCA 3D3CJ 5EDWA 3QGHA 3T19A 1RAOA 3J7YU 3JSMA 1VQ7S 1WOSA 4J9VA 3H5SA 4LFAJ 2ATLA 3GV5B 5CYJA 1KLNA 2V2KA 2N3LA 3CWJA 3HO1A 3RYLA 3MEDA 4U7UD 1BQMB 8ATCB 2NPIA 2OAUA 1C2PA 3PIPQ 4ZITA 1Q8IA 4ATNA 2E7VA 4EBDA 2VPZB 1EQ0A 4YP3A 2RHQB 2D3O1 2LCWA 3JSMB 2IRYA 5BR8J 2W7OA 3H59A 3D4JA 4X4PA 4DWIA 5KFTA 3CCQS 2V5HG 2R8JA 3SDEA 1TP7A 2CUYA 2EFGA 3MEDB 4JI1F 3DRSA 3K59A 1F6TA 2BE2B 4QWCA 1S6UA 2LQ8A 1NJXA 4WU3A 2K3KA 5D77A 3MR3A 2DGOA 9ATCB 3MUTP 3TX8A 4KHMA 2A6OA 4EBCA 2QN6B 3SDEB 4RW8B 3MAAA 3DRSB 4IFVA 2P9GA 3RAQA 3DLJA 4W4MA 1S0MA 3I32A 4BLGA 4HTIA 1V3RA 3CSKA 3UR0A 2AJFE 3OSPA 1MMNA 3Q0AA 2MB0B 2DRAA 5B0FA 3LGHA 4QIFA 1JLCA 1NBEB 2AMCB 4CYUA 4DF8A 1UMJA 5IT9Y 3MAAB 4A8QA 3OXFA 4IFVB 4EEYA 1XNQJ 4F2RA 2DIVA 5KFUA 1WTBA 3HK2A 2X51A 4CIOA 1HYSB 2PA8D 3R2DJ 1X9SA 2WW8A 3N28A 4CLYA 2D7SA 1TVRA 3G8QA 5H1SV 3ZZTA 2QA1A 1XNRJ 2MQLA 3FKBA 3OSNA 3JYTA 1JLCB 2EFNA 1NPKA 1NK0A 1KFSA 1JXVA 4KGXB 4AL5A 4ED2A 4X64F 5GADU 1HBNA 4YEAA 1IKYA 2J76E 3RW6A 5D0GA 2UP1A 1C4AA 1U6ZA 1TVRB 1CJKA 4JI3F 3RTVA 2XS7A 2HNZA 2CPEA 2ZKTA 2HFUA 3GJRB 1RT7A 4K2JA 1S1WB 3J81U 1TUVA 2RU3A 4P71A 3ELHA 1U48A 2XMWA 3ZTSA 1BQXA 1HBNB 3CDBA 2ZC4A 3D66A 1BXNA 3MR5A 5HVGA 1IJFB 4LF9J 4OYPA 1CJKB 1QAIA 2FLPA 2PIIA 4WYLA 7FDRA 1VR6A 4NXNJ 2XZWA 1RT7B 2RDIA 1FE0A 2L3MA 2ZHBA 1R8PA 3G96A 5I3PA 2CPZA 3RBEA 1NLKL 1QAXA 4NLQA 5K8OA 1PJ7A 2M8DB 3VVUA 1LWEB 3EPGA 1FEHA 4H4KA 4KH1B 2IM2A 2CPFA 3GJQB 1Q8KA 4OIXA 5HMYA 4HT7A 1KDNA 4ZIWA 1CLFA 3DRRB 3ICLA 2ZOFA 1S99A 3U27A 4BBYA 4FF1A 1OSCA 3QJLA 1QY7A 4K7QA 4TU7A 1DZ5A 2MY8A 4P2MA 2ZNYA 4QJVA 4UY85 2D9OA 1S9EA 2MLYA 3BBCA 3JAMU 2P5VA 1PBAA 1YTYA 2VC1A 2I1RA 3ETMA 4DBQA 4MIWA 2V2VA 1Y7PA 2JDJA 4NL5A 3PX6A 4F2SA 2AU0A 2YWEA 1FD2A 2NYIA 4NRTA 1B70B 1AYEA 4CH0S 1RE1B 2H48B 1OJ4A 3OTDA 2XEXA 1N5SA 2JLGA 1S9EB 4LSZB 4USTA 2LDIA 3LUYA 3MI7X 4HR2A 2HHTA 1QJHA 4YDDB 4Y00A 2VPXB 3U02A 1M1KT 3SCIE 1OY8A 1FK9B 4O0NA 2X7IA 2MGZA 5HATA 3CO9A 1NSQA 2VZ9A 2QIFA 1FRIA 3D6FB 5K8NA 3N6MA 3FMBA 3PG9A 3W9IA 4O4GA 3AB2B 3FQLA 1ELOA 3R1HA 3FVYA 2CG4A 2MJUA 3QWPA 2MXYA 4DV7F 4MKBA 5FLXY 1FRHA 3BEGB 2AT1B 4FYXB 3O2IA 2MGZB 1NSKL 1FJGF 4WPAA 3IBCB 1FXLA 4PEOA 1R6YA 2V8DA 1Q16B 5JUMA 3WQPA 3UQSA 3CJ3A 2W8LA 4O4GB 4QYZK 3RR8A 4ID5B 3CJ5A 2BKNA 4HVZA 4RW6B 2G0CA 1Q1KA 2VQEJ 4GRSA 1JLQB 3K8WA 2IVFB 5F8NA 4EYHB 2L9NA 4DV2F 2HBQB 4GVBB 1HNIA 4NYPA 3RBDA 4ZVSB 1X4HA 4RNOA 5DDOC 3MEEA 2FHJD 2NXUA 4AQYF 2ASLA 3DDNA 3IS9A 3A1YG 3MXHP 4GKKJ 4J9UE 2UVRA 4N8NA 2VFSA 4WK3A 2W1BA 1HNIB 1P9QC 2JRSA 3QIPA 5FJ4A 1PYSB 2HVZA 3SQOP 4QIEA 3CXCR 1TK0A 3L7UA 4M5GA 3HCXA 3MEEB 2VH7A 4PABA 1KVKA 2DR7A 3RG6A 4F25A 4LR7A 3NG8A 1LFPA 1TMJA 4LF7J 2UUCF 4DFMA 3MPUB 4BDPA 1Y5LB 2Y3YA 1QDUB 3QIPB 4OI6A 3TANA 4DLGA 2YNGA 3EICA 1YRTA 2VPWB 2HK2A 1QSLA 3PX0A 3MCMA 3QSIA 5F41A 1DQ9A 3CJ8A 4ZCKA 2DNOA 2JHEA 1LOUA 1B3TA 4LQ3A 5F8GA 2UVUA 3I87A 2SXLA 2DH7A 4BC9A 1SKWA 3DOLB 2XLIA 1OS5A 3TWZA 4ZMMA 4YDXA 1VCTA 4RW4A 5J2NA 3OFHA 3BPSP 2Y1IA 1TK5A 3LF0A 4QWAA 3TO8A 3O1LA 2LXFA 5KG5A 2WW4A 1JJCB 4ZP9A 1FX4A 2AJQA 1S5ZA 3BKTA 3I0SB 4USJC 4ED6A 2RDJA 1WELA 3TUZC 2VBZA 1I3OB 3KYLA 2BV3A 2E9TA 4JI4J 3NAHA 3FFIA 2LEBA 3CC7S 1S79A 4RW4B 5J2NB 3UCZP 4JUZA 3ZTRA 2V8HA 1XIQA 2MEWA 4MK7A 3W2VA 1PAEX 5E41A 2AKWB 5IWAJ 4DV1J 4AXJA 1PYTA 4DPTA 1CC8A 2OJ3A 1IXKA 4C8ZA 4QR0A 4TU9A 3H5YA 1R7IA 3MOZA 2OTJS 2FPHX 3D0IE 3QRRA 2O1PA 5D0HA 1T94A 2HFOA 4DFJA 3VCDA 4U6PA 4ZLPA 5HQ8A 2KO1A 4CO2A 3PX4A 1QTNB 1GQEA 1SV5A 2GS8A 1W25A 3SSRA 2DXFA 4B17A 2AJ4A 2R7QA 3C16A 5E3AA 5HVHA 4DR1F 1YG0A 1QAYA 3M6VA 2L9WA 2MSSA 2FC8A 1ICEB 2YWKA 1CJVA 1N8RT 4QOTA 3U1LA 2IM3A 1JKHB 1HMVA 2V2QA 1HNVB 5M2UA 1UFKA 2XO6A 1MMDA 4PWWA 1HWKA 1S1VA 4XPCA 2DVIA 3HX9A 3AHPA 3TR5A 3C16B 4ED0A 3D28A 2CJAA 1RWXB 5KG3A 5LMUJ 4QU6A 5ETTA 4DFPA 1HD0A 1HMVB 1UA1A 1SQFA 1PCAA 1RT5A 2B5JA 2MKCA 1S1VB 4A48A 4DL6A 3P6YC 3KLHA 1FRKA 1VQOS 1V5IB 1N33F 1OO0B 1VIOA 4WZMA 1QE1B 2DB1A 3QMQA 2AJ1A 1WUUA 2QMUB 3CJ4A 2AWZA 4DZDA 1FX2A 2R4FA 4OX9F 3OTOJ 1JLAA 2PT0A 2EPIA 1RT5B 1C1CA 2B5JB 3K5NA 3RRGA 2DNQA 5KFRA 1RLDA 1S7HA 3UCGA 2XMJA 1JQGA 2HHUA 2W25A 3W5ZA 1T9XA 3TJ9A 1JLAB 3R7NB 1ZAXA 3QYYA 4O44B 2DEJA 1C1CB 1SQEA 5E5NA 4N8OA 2XMKA 4DSJA 2NCKL 1GX5A 2UVWA 3PRDA 5B0AA 3MURP 4MYTA 1SJQA 3IP0A 1CPZA 1YBUA 1KP6A 2CQ3A 1SB6A 3BSOA 4X4SA 4OLPA 3BREA 3KKFA 4OZLA 2ZH5A 4USHA 2OEMA 3M8SA 1JJ2R 3OHBA 1OSDA 1MU2B 3Q8PB 4EK2A 2ZWOA 5HL7Q 5HJYA 1WF0A 4IRCA 4G1QA 2QMXA 3HULA 4ZHRB 2FY1A 4JI5J 5IOLA 3EYZA 3AODA 3DM2A 3ILOA 4TY9A 2E5LJ 2I38A 5L39A 1TKXB 3EUNA 3MDFA 2M70A 2DNPA 3C14A 1HI8A 4RJVA 4PR6A 3HFKA 2XHWA 4PYDA 3I5BA 2NXCA 3K5MA 4G1QB 4DL7A 2MZJA 4CLUA 1VJQA 3RB6A 3DLKA 2CJBA 1S49A 3DM2B 3D2WA 3BGOP 3MECA 1ZOTA 2B9WA 1DHMA 1MLAA 2F3JA 4IO1A 3C14B 3AOAA 1E6YB 4IRDA 3GV7B 2LQJA 4P75A 2IJNA 5DRKA 1RT6A 2GJ2A 3G6XA 3DC2A 1U2CA 2OFGX 4ZVFA 3E2EA 1X5PA 3MCOA 3T1YF 4C3MA 2BX6A 5T14A 3MECB 1EKRA 2YKMA 3C2PA 3R6LB 1HNZF 2BYCA 1SJ1A 3FRYA 1M1GA 2YQ0A 2QE5A 2IBKA 1RT6B 4OV6A 2OHDA 2OIHA 3B8HA 4EU0A 4DXLA 2E44A 2C3OA 3L9ZA 2EEYA 3HKWA 2WVBA 3JTPA 1FJCA 3QATA 2XMMA 2W9BA 4M5KA 4QPXA 3OLBA 3IG1A 4LREA 2ZBQA 4LSNB 1H98A 3PXGa 3FSXA 3EE3A 3HLUA 3LWLA 4DCOB 2BJ3A 4R25A 1IBCB 1GH8A 2R2TA 1F9FA 2OPPA 2GVDA 3NCPA 2E7WA 3EXYA 3KJFB 2W9BB 3G71S 3CD6S 4ZCMA 5F8IA 1Y4ZB 1Y9OA 3DLEA 3IG1B 1U8WA 2HVDA 3OXLA 1T8EA 4UOGA 4WK1A 1TKTA 1IKVB 1X31C 1VI7A 4ZPBA 2FIUA 4TYBA 3TAPA 1VIXA 1JNRB 3LP0A 5G4DA 5ETRA 2Z2YB 2HIQA 2ACMA 1A9NB 2PEBA 2VBWA 5CABA 4KKOA 4CWBA 4O4RA 4DSKA 3AAWB 2GVDB 5DDPC 4IYQA 2KHDA 3HD1A 4DR4J 1SC6A 5DG8A 3LWMA 4KFBA 3QSYB 3PACA 1TKTB 3PR4A 1VBYA 1RYRA 5B09A 4Q5VA 3NNCA 3QAUA 4LSLA 3QGIA 1SIZA 3LP0B 1FFWB 1RLCL 1NJYA 3BR8A 2RRAA 3H2VE 4KKOB 4Z2XA 4HHHA 1TKZA 5HVFA 3AOCA 1PC4A 4DL0C 5M2PA 3BSAA 5J2PB 2C2DA 1SL1A 1U7LA 4KFBB 3POTA 1SC4B 1FJEB 2DY9A 4DL4A 2C2EA 3VZIA 4M95A 1E6VA 3CCZA 4LSLB 1SJFA 1HNXJ 1NZAA 3R97A 1O8BA 1I1GA 2MKYA 1H7XA 2IJRA 2YKQA 2ZBCA 2CPYA 1TKZB 2MKHA 3K0JA 1VQ9S 3PM9A 4J9OA 3BGLA 4YQWA 4NEYA 3GCWP 1KLMA 3IAS9 2W01A 3POTB 4PG8A 3GV8B 2V68A 3LTOA 2CJXB 1E6VB 2UUAJ 2Z8QA 3DLLQ 3BSCA 5ETVA 1VRTB 3Q8SB 3HP6A 4TXSA 4J9PA 4RU9A 3HM9A 4OFZA 3W2WA 3OW2R 2AIRB 1VLYA 3DLGA 3P96A 4DR7F 2EK6A 1P1LA 1KLMB 2CKWA 5AXMA 1H2UX 2HURA 2IM1A 4A8SA 1IR2A 5K20B 2AF6A 4JOUA 4PAAA 2YNIB 4IDKB 3OTCA 3D6TB 1R0BG 1HPZB 1NSAA 2QL9B 4QPTA 2GIFA 4OYWA 1VYAA 3BN4A 1J5EF 4USKA 2LU1A 5D15A 4TLRA 3S01A 2Q6BA 3W2WB 1NK4A 3DLGB 5E33A 2GA7A 3KK1A 2VQFF 3QFWA 2BRLA 3MAHA 1KOHA 3GLJA 2HK3A 5HO4A 1LWFB 1X4GA 3CNQP 2GFFA 4OLOA 4X66F 2ERRA 2QLFB 1NJWA 2OO4A 2L9DA 4V19X 5KFQA 4DJBA 2H1YA 1T9TA 2HMIA 4QU7A 1LWCA 5KT7A 4AXIA 3J80Y 2C2NA 4NMXA 4OYAA 1KFDA 5CZVA 4NLWA 3KK1B 2AX1A 5BJRA 4NWBA 1TAQA 1ZPVA 4C8KA 3EPIA 5KFWA 3J7ZT 3MEGB 2W7AA 2D74B 1QLNA 3VF0B 4DR5F 2BMBA 4JI6J 4KQZA 1JIHA 3N9UC 1RHQB 1EARA 4I0WA 1LWCB 3BQ0A 4DUZF 3M8RA 3HFVA 4R8UA 4H4MB 4ZVGA 2XY5A 1D3WA 3T41A 4BCAA 1U45A 1JLGA 2ZKUA 2GQQA 3KNAA 1FKPA 2PGCA 1S1TA 5C5JA 3C8YA 1H72C 3NP5A 4D3GA 3W5XA 4NZ0A 2HIYA 3GIKA 2BQRA 5HSPA 4R8UB 1RKJA 1EETB 4RZRA 3TQEA 2GQ2A 1JLGB 3TVZA 2DY1A 2DGVA 3CIMA 1ACMB 2C3MA 1RHUB 3DU6A 5DQGA 1FKPB 3G8TA 3IM8A 2HHPA 1KTQA 3D54A 4ZVQB 1S1TB 1L3KA 4X62J 1NSPA 1WKLA 1URRA 1PO6A 2RS8A 2QL5B 4ZLJA 5JMNA 1BLUA 1SKRA 3M2RA 4U96A 3H20A 1F5BA 3W64A 4LBHA 3Q24A 1TQLA 2MQMA 1R0AA 4CLLA 3DHXA 3HMJG 4KSEB 3ET6A 4AE5A 4W98A 2CVIA 2RMLA 2KM8B 2V8GA 1DTTA 4EO8A 3M2RB 3OBIA 2CNOB 3HZEA 1Q8LA 2B8PA 2CQ4A 1X0PA 2X3DA 1SL0A 1PG5B 4I7FA 1O5JA 2B0GA 1UTAA 3QO9A 2W7PA 1R0AB 4MTPA 2XNQA 3HDSA 4EZ9A 2EBEA 5SZTA 3ET6B 3MUVP 2B4OA 1R8CA 1B0VA 4CH1A 3D1QA 4YB1P 3C6TA 1VQPS 2HZCA 1DTTB 4ELTA 2XZTB 5C25A 4L73A 3MCSA 5HROA 4M1KA 3NMAA 2ZD1B 1U0HA 4I7FB 5KG6A 3QO9B 2B7CB 1HHQA 4ES1A 2HZVA 4C8MA 1U1OA 1IBKJ 1FWLA 2HAIA 3C66A 2A0FB 3C6TB 4X2BA 1T9YA 4QIVA 4DCJB 4RW7A 3LW5C 3CC4S 4UQGA 4ZVEA 5B0BA 1GEHA 5HROB 3HSJA 4YB5A 1DLOB 1HW9A 4P2FA 3G6VA 4USUA 3P45B 1AT1B 3F41A 5IFMA 3CEDA 3NY0A 3VQTA 4DR3J 3CJKA 3T3FA 4IFYA 1SH2A 3QT7A 3C3LA 4HTJA 4QBUA 4RW7B 3NMRA 2ZC3A 4RBUA 2GNKA 3JSBA 2RF2A 5KFLA 1LW0B 3UN5A 4DN0A 2F4FA 1R43A 2YX7A 7FD1A 2B7BB 4U8VA 3CJKB 4IFYB 5KFBA 2B4VA 1XR6A 1HI0P 1IBMF 1DAXA 4YMEA 4RWXA 1X5OA 4NX9A 1WG5A 1CVJA 1RBAA 2W2MP 3UO0A 1HWIA 3MPYA 4OJ1A 1D9FA 2RF2B 3MD3A 4ZPAA 5KG4A 2X1FA 3A8EA 3LP2A 5CH7B 2DH8A 3BBFA 4K0KJ 1G6BA 2ASYA 5DS7A 2B9YA 3Q2SC 3Q8VA 1S6QA 2V9KA 3PW2A 1RSCA 4TQSA 1RWKB 2MZTA 2UXDJ 3FMWA 2H4YB 3PRBA 2VFVA 2MQNA 3IWLA 4DUYF 4AYBD 4OZ5A 4DV5F 4MYUA 3NS6A 5G0RA 3QGPA 3LP2B 4I2QB 2O01C 3M30A 2BW2A 5T7LA 1NKBA 1S6QB 1UZHA 4JV2A 3OLAA 3W65A 2ALZA 5EN1A 1AA1B 3D1HA 1U4BA 1X4FA 4F4XA 1ZAWA 2B43A 1XR5A 2AYEA 3CW2C 2FJXA 5G0RB 3M30B 5IXUA 2J0SD 1B99A 4FPIA 5T7LB 1APSA 5DM6Q 3OFEA 3AD9C 1DBDA 3G87A 1N32F 1UW9A 1XMOJ 4Z37A 1PYOB 2G0JA 3OR1A 2VG6B 3DI6B 4HACB 5T41A 2HFSA 1G7CB 2GC8A 1W2BR 4FKYA 1PJ5A 3NGUA 2UV8A 2OD4A 1WC1A 4F4YA 5ETNA 1GXUA 4LFAF 3PO4A 2HHSA 4ZKAA 4DL3A 5AXKA 3GJTB 4PPZA 3AXKA 5JJBA 2OLWA 2D3ZA 3G2XA 2IRXA 2R7SA 3OR1B 4QR1A 1IKXA 3CT9A 1SJ3P 4DZ6A 3PYFA 1JLEA 2MKKA 4Q8EA 3GIMA 4GO5X 4OI0A 1TKDA 3SSSA 1K44A 1N56A 3NLCA 1FA0A 2E5HA 3JTNA 2HRUA 4B3RF 1KN6A 1WOPA 2AJ0A 2J7UA 5HLFB 1OWXA 1TMMA 1YI2S 1B0PA 2NZ4A 1FTRA 1OYEA 4IRKA 2UUBJ 2HVHA 2NYHA 3EVMA 2XG8A 5A0YB 5GMDA 4LFCJ 4LRAA 1JMTA 3ILIA 1YSJA 2KT2A 1JLEB 3R5JB 3OFFA 2F5GA 3FQKA 2OP5A 4UOHA 5E3RA 2Y0BB 4ZIVA 2XZDB 3W60A 4CO0A 2BW7A 1T03A 1TUWA 2WZ1A 3KLVA 4L74A 5LSOA 4ECYA 4NZ7A 1N5YA 3WBZA 2CAJA 1V6HA 1WEZA 1EAYC 3TA1A 1VC0A 3KJVB 3LP1B 3RRHA 3R7BB 2VIHA 1ZM3A 2GW8A 1RBLA 3Q8RB 2RSQA 3H8YA 5A2QY 2BJEA 5KFXA 2H3EB 1T03B 2JFDA 2W8KA 1XNQF 3J7YI 1X60A 1U25A 2FJVA 1EX8A 2XGQA 2DTJA 5KOWA 2HHWA 3J81j 5F0UA 3NXZA 2BOPA 2E1MC 3CDAA 4DS4A 1U47A 2BKOA 5E7OB 1XNRF 5KT3A 4CI0B 5D0RA 3R5GA 3TVYA 4IH6A 5ETQA 1X5TA 4WIQA 1KQFB 2V4JA 2BEFA 3V6HA 3I0RA 5DZ6A 4NLXA 2MJNA 3UD5A 2XGPA 4M5NA 4FYWB 4K5RA 3MTJA 3MCNA 4KO0A 2DNGA 2B6AA 1SXLA 3FSIA 1KSPA 1P1TA 3A3PB 1S57A 1YX2A 2JSXA 3ENQA 1L5UA 2ZITA 1WI6A 1IM6A 1KHWA 3BJYA 1HI1A 3QLHA 5DETA 2V4JB 4OI3A 1HWUA 4JV0A 2W9AA 4PZVA 3I0RB 3PJXA 4CNZA 1ZAVA 2XLKA 1S1UB 4KO0B 2P6TA 2KRBA 1A0OB 2AGQA 7AT1B 3L95X 2DXDA 2GHPA 4FN5A 4RNHA 2JLFA 3GR1A 4LF9F 8AT1B 2BJ9A 3MMCA 5GAHI 2H9ZA 2A3JA 3M6XA 2RRBA 3O3LA 4NXNF 3FCVA 2M0GB 1L3UA 2E5GA 4M94A 1RTDA 2JEFA 1Y3KA 2EC0A 1RBOB 1MMLA 1XMQJ 2HQIA 1UKUA 2DHHA 5L8RC 1ZZFA 2C2KB 1JLFA 1TV6A 1YBAA 2QFIA 2H5IB 4TVAB 4IQXA 1FTCA 4LF6J 2XB2D 2DO4A 1D0EA 2V4QA 3L7OA 3NS7B 1SUQA 1S10A 4ZVPB 4DLEA 5K8MA 1UAWA 2B51A 3OPKA 3VAKA 4X64J 1V3SA 3T6BA 4U7UK 4J9SA 1NK7A 2VFTA 4FF2A 1TV6B 4OMFG 4M5MA 2Y9HA 2FVSA 4EGLA 4DQSA 5IM0A 4B9NA 4X4NA 4ANEA 5I42A 2F8HA 2C3UA 4ZP8A 3V4IA 1RHMB 1P8GA 4JI0J 3EGWB 1XN9A 3UN2A 1H6KX 4A8MP 4B9MA 3SFUA 2VV5A 3DNCA 4QR2A 3A8KA 4GMKA 1ITPA 1VOMA 3G6YA 2Y8WA 3GTYX 4OYXA 5CZXA 2HNDA 4A8WA 2J6TA 1OIAA 5KFSA 4LQ9A 4H54A 4K4YA 5I42B 1XR7A 1T02A 4Z7YA 2XHCA 1DARA 3I55S 5IQQA 4JI8J 3SCLE 2DJWA 2CPIA 3PRVA 1M90T 2IA6A 1NPPA 5AT1B 1RABB 3TAMA 1UL3A 3BR9A 2K3IA 2Q3PA 1XWLA 4C11A 4UUWA 2GHVC 1VBKA 2HNDB 3GJSB 4Y6IA 4ED4A 3MFHA 4FS1A 3CMES 3GYXB 3ISND 4MJKA 1PC5A 1WORA 2Z30B 4RUHA 2C22A 5I3QA 4CT9A 5DLGA 4K4WA 1U1LA 2VU5A 3PEHA 3TAMB 1IKWB 1I6JA 1HHSA 1HBOA 1CG2A 3Q8UA 4KC5A 4CTAA 4M5LA 1RWVB 6FD1A 1C4CA 3QT8A 1VQMS 4FYVB 1QM9A 4F0KA 3M9MB 3NOGA 4MH8A 2PO4A 1KS2A 1U1MA 4WF9Q 2Q79A 4NZ6A 4LF5F 3N5FA 1HBOB 4OZ2A 1D9AA 4UZCA 4CTAB 4FZVA 4PXDA 4XAKA 3ISZA 2CDRB 3JQJA 2HNYA 2BKPA 1N5QA 3IRXB 4MIAA 2YKNA 4ANCA 2E1RA 3G8SA 4FXVA 1M1HA 1HR0J 4GKKF 1AROP 4B02A 1S7IA 3AD7C 3QGGA 2ADCA 1RWUA 4B3TJ 2LA4A 1B7FA 3GR0A 5JVHQ 3M32B 3GU0A 3FZBA 3QT6A 3R5CA 4PPDA 5C24A 2GVZA 2HNYB 4UOCA 4J7CA 4V1Ak 2YKNB 5HJXA 4LF7F 1RAIB 2R8IA 1RT3A 4DV7J 1H3DA 1RU1A 2GIRA 2EBGA 1N52B 1W26A 2QLWA 3O44A 4FP9A 2CPJA 2XLJA 3M05A 2QYCA 5C24B 2LECA 1N0VC 4Q2LA 3VGTA 2WSEC 1N4LA 4HDHA 2MHEA 2H4WB 4H4KC 1BD6A 4FDFA 1T9WA 3BQ1A 3J81Y 2ROGA 2NREA 1F2HA 4KGMA 4A8YA 1FFGB 4KV8A 3NEKA 2UXBJ 1X4DA 3MM6A 4NE9C 2Y0SD 3CGIA 2U2FA 2F8MA 2Q6CA 1B4SA 4PCQA 4YS2A 1HBUA 2ZH8A 2CQ1A 4F36A 5ADZA 2ZH7A 2FLNA 2YNFA 4WFYA 3BBBA 4QZVB 4C0BA 2ZZNA 2JVOA 4JI4F 3WHIA 4WE1B 1KEKA 4KV8B 1HW8A 1RK8A 1YK9A 1S77D 2E7XA 3MM6B 2IYIA 4U7CA 1ZYQA 1RACB 1Z1ZA 5IWAF 2IVYA 1ZPWX 3BYRA 4DV1F 3QT5A 2YNFB 1S97A 4B9SA 2H5EA 2OPRA 3I4PA 1T0TV 3THTA 3ZZOA 2RDDA 5BYSA 1TU0B 3AH6A 3LA0A 4CT8A 4F3QA 5CD4A 2DRDA 3FJ2A 3JAMY 4ZPWR 2LXIA 3TRGA 1LW2A 3RBZA 4UUXA 3K17A 4FPRA 3KLGB 2DKOB 4B3SJ 4UZBA 4JI2J 4IG0B 4C0OC 1VQ4S 3DU5A 4DQQA 2IRUA 2OPRB 1IR1A 1FWKA 5LMNJ 4JV5J 5L46A 3DDKA 1RTHA 3EVOA 4TLQA 2CQHA 1M5PC 3KDOA 4NLVA 1S0OA 2ROPA 2CADA 2NSBA 2R7UA 4KGZB 4N47A 1U2FA 3D0GE 1NKCA 5KT4A 2QEXS 4LF8J 4B9VA 2ZOGA 2FVRA 2V9WA 5HP1B 2MQ8A 5BYQA 1WDTA 1RTHB 5KFGA 3KOAA 3M8YA 3KWMA 1NCLA 2RT3A 2LXUA 5LMUF 2ZDOA 3LPEA 4P7TA 1F9HA 2VOOA 4J9KA 3EZOA 4B3OA 1X4AA 3LGNA 4PG7A 3EWGA 1FD8A 3BM7A 3T5KA 3WC2A 1FESA 4KHRA 1M5HA 2UUWA 3MPVA 4ZPTR 2B4UA 2M3DA 1RB0A 2C28A 1UJ5A 2KB2A 4NEZA 4QYZJ 2BM1A 3WIVA 2VODA 4CLZA 2XC9A 1S72S 3OT9A 1R31A 2FC9A 3OTOF 1YJ7A 3L7PA 3FBBA 3KFWX 3V81A 3SIPB 4B3OB 1Y5IB 4I4BA 4R5PA 1PILA 1HWJA 2XWXA 3N0VA 1GTEA 1KKHA 1WG4A 2KDOA 4LBPA 2CQCA 2IAJA 2ZH1A 5FDLA 4CH7A 1UEVA 2D9PA 3P8BB 4LBIA 1UVNA 3M6UA 4P9SA 2BANA 3HKZD 1UCNA 2VG5A 3SMZA 4ZPVR 4R5PB 4TN2A 3DMJA 2GAHC 3MHYA 3QFHA 4NLPA 4A46A 2FZCB 2AQ4A 1CQMA 1UW4A 1J2VA 3VHQA 3B4MA 1NXIA 1S6PA 2IAJB 5FDLB 2JX2A 2RILA 3FC9A 4ECVA 3JB9k 1P6TA 2VA3A 3KMSA 2BANB 4D3HA 2CFXA 2JC0A 3QJJA 4O3QA 2KFYA 4UTGA 2J6SA 2LQ5A 2BBEA 2RU9A 4OYBA 1HQEA 4LRBA 1NHKL 4ZVHA 3DMJB 1G1XA 2DGWA 1NB2A 2VD3A 1VQLS 5AJ3J 2LQ9A 2XTJP 1EKSA 2E66A 4LJMA 4PQAA 3PNIA 4L6V3 4I56A 4JI5F 5D4NA 2RJZA 2HHQA 3B82A 3OTBA 2VB6A 3CJ0A 4G65A 4Y2MA 2E5LF 4IOBA 4FNIA 2I0XA 1RCXB 4L3KA 2APOA 1R3NA 2F4VJ 2NXNA 3NWGA 3J7Z5 2Q43A 5GAHU 2R7RA 4IUFA 1OMSA 4AL7A 5ETKA 5J1NA 2HHXA 1X7VA 2ILZA 3NBPA 3ZTQA 1Q53A 2KT5A 5GAEI 1K0VA 5D0EA 2MPUA 3QZ8A 4KT0C 3PZPA 2ZJRQ 3HHLA 4ECWA 4CLTA 4GKJJ 2KN4A 3A13A 3HHDA 5GAGI 1UVJA 3NWRA 3DN9A 1LFWA 3EVWA 4DPYA 4WP8A 3LAKA 5MLCV 3QNWB 3NBPB 4NPOA 2DR6A 3MGJA 4OZ0A 4RNFA 4F3OA 3GFXA 3M8PA 1IVZA 1MG7A 4CYUB 1N6QA 3F0NA 2VG7A 5K14A 2OPQA 3TEGA 3Q83A 1HLWA 2FJEB 4N76A 1S4EA 2FJWA 3Q86A 4JI7J 2DNZA 4QQBA 3TW0A 3CF5Q 3H5UA 1SJRA 2LYVA 4USIA 3CCVS 1RU2A 4QIGA 3UW1A 3JYTB 2L41A 1FRXA 1K1SA 3CIZA 4I68A 4ECZA 2VG7B 5K14B 2OPQB 2NXEA 1FKOA 2A18A 2YVSA 4J9LA 2R8KA 2A1BA 3UNYA 3HSZA 4Y2AA 2J0QD 1CSJA 1IKYB 2YXLA 2ZHOA 5IS2A 2UUTA 4WIIA 3PDNA 5B08A 3VGSA 4RO0A 1RISA 1UFLA 2ZUGA 1LXJA 1AFIA 3N79A 3RUBL 1VHIA 3TP2A 2ZFHA 4HI1A 5KOXA 3HF5A 2HNZB 2VDIA 3MUMP 2BQ3A 3DDIA 1LK5A 2K8GA 2H65B 1TAUA 1FKOB 2BJ7A 3E01A 2IMWP 4RLEA 4YY3J 4HHUA 3DOKA 3HSDA 4OHZA 2Z2ZA 4DR4F 4XK8C 3FK4A 1NU4A 3TZYA 2PN6A 1Y00A 3KLEA 4WCEQ 2GHWA
chains in the Genus database with same CATH topology
3S7RA 2L08A 1AUDA 4ICLB 4KE5A 3MEGB 2W7AA 2D74B 1QLNA 1FRMA 2DIUA 2JJ4D 1M5VC 5J2MB 3VF0B 1OPIA 4O44A 4CCHA 4DR5F 1PGZA 3T1AA 3KHRA 4PXEA 4KQZA 4ED7A 3BDPA 4DX8H 1JIHA 3N9UC 5A8WA 1R89A 4I0WA 3IWNC 3E01B 5CHCB 3FNNA 1LWCB 1FDNA 3BQ0A 5DLFA 2F4VF 4DUZF 2E29A 3M8RA 3C6UB 4R8UA 3VAHA 2AD9A 4EUVA 4H4MB 4ZVGA 3Q2TC 2XY5A 1D3WA 2BQUA 2I2YA 1K0TA 4BCAA 3ZZYA 2XNRA 1U45A 1JLGA 2QSFA 2ZKUA 1RKIA 1U1NA 2Q66A 1KTVA 2GQQA 2B3TB 1SH3A 2ABYA 2KU7A 4OZNA 3KNAA 2CJ9A 2X1BA 1TZ0A 4TYAA 3BGRB 1NHUA 5F9NA 5I3UA 4W92B 3MM7B 3KLEB 3IC1A 2OPSA 1D8YA 4XDDA 4DHVA 4NMLA 3I5CA 2P6SA 3GYNA 1FKPA 3MM5A 1MNEA 3M9OB 2PGCA 2GCFA 3KLGA 1MU2A 4I6WA 3PKYA 1HNXF 4OQJA 5LL6d 1S1TA 5C5JA 2M88A 4IG0A 1FDBA 3C8YA 3HVAA 1IR0A 2PSZA 1ZZNA 4HKQA 2F7VA 5A8WB 3MOJB 1L3TA 3NP5A 4D3GA 3FSYA 1WWHA 2B9XA 2ZOMA 1NHVA 4GKJF 2LVWA 4NZ0A 5F8JA 3V5RA 1JLBA 2DCLA 2FJDB 3GIKA 5KG1A 2BQRA 4R8UB 1BWEA 1FJ7A 4ZHRA 5A8RA 1N5YB 1RKJA 2QO3A 2OFHX 3NKYA 1EETB 4RZRA 2GQ2A 2MY7A 3DGPA 1JLGB 3TVZA 3PFEA 2DGVA 2Z2MA 2O66A 3CIMA 2DO0A 2C3MA 2PE8A 5I3UB 2R8HA 3SSQA 2NUUG 1G3OA 1TKXA 2FHKA 3AQOA 4N56A 3DU6A 2OPSB 3PIOQ 5DQGA 4C97A 4OHVA 4KTQA 1X9MA 1FKPB 3MM5B 4RBTA 3G8TA 3D5MA 3MEKA 2HHPA 2LA6A 4NLUA 2UUAF 4ELVA 1R8HA 1KTQA 3D54A 1S1TB 4K2XA 1L3KA 4CO4A 1M0SA 1HWLA 3L09A 3R5DA 2KG0A 2KYXA 3M2UA 3NNHA 1URRA 3NRBA 4TY8A 3DRXA 1PO6A 2M2BA 2RS8A 2KXNB 1JLBB 3H4DA 1BLUA 4ILMA 5E3PA 2AYGA 5H9FJ 1XMOF 2F40A 1SKRA 3M2RA 4KGKA 5HP1A 2FJAB 2DHGA 3OJSA 4RKUC 4QIWD 2XBPA 3NS5A 2J8AA 4J37A 4PUOA 4C98A 3H20A 2PI4A 2VONA 3H98A 1F5BA 4JI7F 5KFIA 4QCLA 3GFZA 3Q24A 1H0HB 3G9CA 1TQLA 2FGCA 4JV1A 1IQTA 2MQMA 3FGVA 4KAIA 3SCJE 1R0AA 1E6YA 3DHXA 3HMJG 4X65F 2PA3A 3BO4A 5D3GA 2P9EA 5F8LA 2HPUA 1ULRA 4F4WA 4KSEB 2R7TA 3MWBA 4AE5A 4RNMA 2BA9A 3M4XA 3ZZUA 1YITS 3GILA 2WSCC 3CD7A 1CC7A 2I9SA 2CVIA 2BJDA 2DR8A 4QWEA 2IVMA 3M2UB 1VC5A 1VS3A 1LV5A 2KFNA 5THWA 2DITA 3GFYA 4TY8B 2KVIA 2F9DA 1K1QA 2KT3A 2RMLA 4ECUA 3RB0A 1N48A 1FEEA 2KM8B 4O23A 3UCUP 4NYOA 2V8GA 3GB0A 1DTTA 4EO8A 1JB0C 2N7CA 4OJHA 3M2RB 3OBIA 2E5IA 3HZEA 4NLTA 2Z4PA 1Q8LA 4PUOB 1XC9A 2DGTA 4G1PA 1U1QA 1NK5A 4DV6F 2CQ4A 2B6AB 1FRJA 1X0PA 4K4UA 3IBWA 1SL0A 4DL5A 2R7WA 4I7FA 4J9QA 1O5JA 1NO8A 2HFNA 3HHLD 2B0GA 5F8MA 2EW9A 4WFAQ 3MZIA 3QO9A 2AYBA 4OI4A 5L1IA 5GVQA 2W7PA 1R0AB 4MTPA 2DISA 2XNQA 3KK3A 3HDSA 4X4QA 4EZ9A 5D3GB 2EBEA 5SZTA 5IZHA 5HBMA 3MUVP 1VQKS 2B4OA 1R8CA 1B0VA 4QWBA 4CH1A 3D1QA 2E9RX 4YB1P 4F67A 2VPYB 5F3ZA 3C6TA 1T7PA 4FF3A 2KJVA 3QLHB 3O8WA 2CDQA 1VQPS 4EFAC 2HZCA 3I6PA 5CA5A 5SUHA 5KFEA 2FTRA 3H40A 3HXMA 2RIJA 1DTTB 4ELTA 2YTCA 1BY9A 2BUNA 3CDUA 5C25A 4YY3F 1FHTA 3OL7A 2MHNA 5HN0A 3MCSA 5KG7A 1REVA 3AA9A 4HH0A 5HROA 2NQPA 4FXWA 4OX7A 3I9V9 4M1KA 3VR1A 3NMAA 2ZD1B 1WNEA 3H25A 1KR4A 3R27A 1ROFA 4I7FB 5KG6A 4LSNA 1RP5A 1H2TZ 3M8QA 2DNRA 3QO9B 1FXRA 1WEYA 2B7CB 2K1RB 4ZOSA 4ED3A 4ES1A 3KK3B 1UP1A 4QYRA 2M7SA 3MMCB 1K8AT 3V4MA 4C8MA 4YB6A 5KFNA 4ES3A 4WKRA 5HBMB 1U1OA 3BSNA 2HAIA 2ROEA 2WSFC 2AGPA 2HYIB 1WHVA 3C66A 3C6TB 4JI6F 4WFNQ 4X2BA 1U6FA 2O67A 1RTDB 1Y5NB 4EO6A 2WOMB 1L3SA 3HHKA 1N5TA 2ZVSA 2QA4S 2CQIA 1U1RA 3RR7A 1TL1A 2YKPA 4QIVA 2KH9A 5J2QA 4HHJA 1Q7YT 2HVIA 4RW7A 2NR0A 3LW5C 2AGOA 3CVKA 3CC4S 4UQGA 3T9ZA 4ZVEA 1REVB 3I4HX 5B0BA 5CCMA 2MKJA 3MMAB 5HROB 2DGXA 4YB5A 2VFRA 4ZCLA 1DLOB 4P7VA 3VQSA 5B0DA 3K5PA 5KFCA 4Y28C 1JLFB 5EDWA 1WHXA 3QGHA 3ZC4A 2HGLA 3T19A 3J7YU 3JSMA 3M8QB 1HW9A 3G6VA 1VQ7S 2CQ0A 2WB4A 1Q7LB 2A10A 4DSLA 4LFBF 1IKVA 2EKYA 3F41A 2R8GA 4DV0F 1FF2A 5IFMA 3IS9B 3H5SA 1SUQB 3CEDA 2ATLA 1X5SA 1MWYA 3VQTA 3GV5B 3CJKA 3T3FA 1NKEA 4IFYA 3MF5A 1SH2A 5CYJA 3C3LA 4F02A 1KLNA 2V2KA 2N3LA 3MM9A 3CWJA 2FDNA 3RYLA 3MEDA 3HO1A 2CPXA 1TL1B 1BQMB 4HTJA 2NPIA 1XERA 2OAUA 4QBUA 5J2QB 2R2RA 1C2PA 3B78A 4RW7B 3PIPQ 1YGYA 2RQMA 5B0GA 3NMRA 1Q8IA 2ZC3A 5CCLA 4RBUA 4ATNA 5CXTA 1XTZA 2D41A 2GNKA 5E2QA 2ZJQQ 4URSA 3JSBA 4EBDA 2VPZB 2RF2A 2PD1A 5KFLA 4YP3A 1C0TA 1LW0B 2LCWA 4OI1A 3JSMB 2IRYA 2W7OA 3DFEA 3H59A 4KB7A 5CD4H 5IM0B 4X4PA 4DWIA 4IO9Q 4DN0A 1B0TA 4Y65A 5KFTA 3CCQS 2V5HG 2E5JA 3V4IB 1R43A 1RJJA 5F3TA 2R8JA 3MTKA 2YX7A 3SDEA 1QAJA 3HHEA 2R7VA 7FD1A 2B7BB 2JVRA 3CJKB 1TP7A 4IFYB 3OV7A 1NK8A 5KFBA 2B4VA 1XR6A 5F0WA 1HI0P 2EFGA 4A47A 4ETZA 1IBMF 1DAXA 3T9NA 4DQIA 3MM9B 1LQ9A 3MEDB 4ZA1A 4YMEA 4JI1F 1VQ5S 1UJ4A 3DRSA 4RWXA 3K59A 4NOHA 1X5OA 4BWMA 3MR2A 4NX9A 1WG5A 2BE2B 3RU0A 4HDGA 1CVJA 2DBBA 4QWCA 1S6UA 4URQU 1S1XA 1HWIA 2Y1JA 2YY3A 3MPYA 4OJ1A 1XEZA 1NJXA 1D9FA 2RF2B 4WU3A 1VK3A 4IG3A 1C0TB 5J2PA 3MD3A 4URGA 4ZPAA 2YNGB 2K3KA 3OTEA 5KG4A 2X1FA 3A8EA 5D77A 3ETOA 3MR3A 2DGOA 3IFEA 3LP2A 5IQ6A 3TX8A 3MUTP 5CH7B 2DH8A 1GX6A 2N3OA 3OL9A 4KHMA 1WEXA 3Q22A 2E1CA 4EBCA 1G6BA 1UVIA 2ASYA 2X1AA 3SDEB 4DF4A 5DS7A