2DNUA

Solution structure of rsgi ruh-061, a sh3 domain from human
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
b'GSSGSSGEEKYVTVQPYTSQSKDEIGFEKGVTVEVIRKNLEGWWYIRYLGKEGWAPASYLKKAKDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 multiple domains 1
molecule tags Structural genomics, structural protein
source organism Homo sapiens
publication title Solution structure of RSGI RUH-061, a SH3 domain from human
rcsb
total genus 7
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dnuA00
4HVVA 2L0AA 4J9CA 4J9IA 3REAB 3VS5A 4DEXA 1VYUA 1ZUYA 2C0OA 5HCKA 3VS6A 2EYWA 2V1RA 4KRTA 1OEBA 4J9EA 4ZNXA 2ED0A 1Z9ZA 3TSZA 1T3SA 2EGCA 2PNIA 1G83A 1LCKA 1BB9A 2IIMA 1X2KA 4RTWA 4ESRA 3SHWA 2X3WD 4HVWA 1AZGB 4DEYA 4OMOA 1UJYA 2OAWA 1Y0MA 2ECZA 2FG0A 5FWCA 4AFSC 5I22A 2BZ8A 5ECAA 2D8JA 1T0JA 1AWXA 1QKWA 4OMLA 2DBMA 3C0CA 2V1QA 3EGUA 4RTUA 1X27A 3I35A 3ULRB 1K4US 2RQVA 3H0HA 1K1ZA 1HJDA 1YP5A 3NMZC 1WX6A 2CH4A 2CH4W 4JPBW 4J9HA 1M3BA 1UFFA 1WI7A 2C0IA 5FW9A 1V1CA 4QT7A 3IQLA 4LUEA 2LNHB 3UATA 3RNJA 2CUDA 2KT1A 1JO8A 1ZUKA 2L3QA 1AWWA 2DVJA 4GBQA 2YUQA 2CSQA 3PVLA 2DE0X 1GRIA 2K9GA 2KT8A 1YN8A 2YUPA 4Z8AA 3THKA 3VS0A 2KEAA 2DRKA 3JV3A 1K0XA 2DL8A 1H8KA 1AOJA 2EYZA 1SRLA 3I5RA 3EG1A 1E6HA 1J3TA 1SHGA 3VS1A 2LMJA 4OMQA 1VYVA 3I9QA 3M0SA 3O5ZA 1UHCA 1SEMA 2AZSA 3PE0A 2H8HA 1ZX6A 1GL5A 2DNUA 2G6FX 2BTTA 2DL3A 2DJQA 2K7AA 4AG1C 2JW4A 2LCSA 1UE9A 2DM1A 3UF4A 2LP5A 4LE9A 2O9SA 2HDAA 1PKSA 1GFCA 1QWEA 1GCQC 1GFDA 2NUZA 5IHNA 2O2OA 1H92A 4D8DA 1ABOA 1BU1A 2SEMA 4LN2A 2KYBA 1AZEA 2BZXA 2EBPA 1RI9A 2LJ0A 2HSPA 1NLPC 1PHTA 1K9AA 4JJCA 4M4ZA 1JU5C 1SRMA 3KFVA 4CC2A 1EFNA 2DL4A 1ZUUA 2EVRA 4X1VA 3VRYA 1H3HA 1OV3A 1ARKA 1X6BA 3GBQA 2YUNA 3EG2A 2LJ3A 2KXDA 2EPDA 2PTKA 2KE9A 1SSHA 1VYTA 2KROA 2GQIA 1M3AA 1MV0B 4A63B 1JXOA 1I0CA 1NYFA 2YUOA 5FWBA 1UUEA 1Z9QA 2RQRA 2K2MA 2K3BA 1X43A 1CSKA 4CC7A 4ORZA 1WFWA 1BK2A 3REBB 2O88A 2D8HA 4LNPA 5IHIA 4F14A 4R0KA 2MCNA 2AZVA 1UDLA 2AKLA 1NM7A 2A08A 4AFUC 3NGPA 2L3PA 3EHQA 4RTZA 2C0TA 4E6RA 1ZBJA 4OMMA 2AK5A 2NWMA 1FMKA 1UGVA 2B86A 1K0SA 3QWYA 5IH2A 1SHFA 4IIMA 4AG2C 3I5SA 2K79A 2YT6A 1U06A 3EG3A 1OPLA 1WIEA 1QKXA 1ZSGA 1RLPC 2YDLA 3M0UA 1KIKA 2JMAA 3M0PA 1UG1A 2ED1A 1AEYA 2P4RA 2RQWA 3VS3A 4Y92A 1GBQA 1NLOC 1WLPB 1JEGA 2GTOA 4J9DA 2M51A 1HSQA 1QCFA 4JJBA 4OMNA 4JZ3A 1B3QA 1PKTA 2J7IA 2F2WA 2JS2A 2EYYA 3M0RA 2RPNA 1M27C 1MUZA 2DX1A 2GNCA 4JJDA 1ZLMA 2CREA 4Z89A 4J9BA 2LJ1A 2RF0A 2FPFA 2FEIA 1NEGA 2L2PA 1QLYA 1W6XA 1WXTA 3H41A 3NPFA 4AFQC 1AWJA 1E7OA 1GCPA 4RTVA 3M0TA 2MIOA 2DL5A 2GGRA 1TUCA 1N5ZA 4IIOA 4AFZC 2I0NA 2FO0A 3M0QA 3EHRA 1AWOA 1U3OA 4J9GA 5GJWB 2QDLA 2CUBA 2LX7A 2RQUA 1M8MA 1WYXA 4GLMA 2KYMA 1AD5A 1IO6A 5IXFA 1OOTA 2DLPA 3NHNA 4RTYA 1Y57A 2DILA 2PZ1A 5EC7A 2LQWA 1W70A 1KFZA 2JM9A 2CSIA 1NG2A 1YNZA 2E5KA 1FYNA 2KRNA 2SRCA 2VWFA 1KJWA 1WXBA 3UA7A 2DRMA 4RTXA 1SPKA 3SEMA 4F16A 1PNJA 1X6GA 2J06A 2KRMA 1UTIA 2J6FA 2J05A 2VVKA 2F2XA 1WA7A 4Z88A 1WXUA 2X3XD 2DMOA 2GBQA 1A0NB 2BZYA 2KR3A 2A36A 5IHKA 3TSWA 1MV3A 2JMCA 4K11A 2EW3A 4OMPA 4RTTA 1JQQA 2HEQA 1X69A 2O9VA 1PRMC 1RUWA 2EGEA 2EQIA 3EG0A 1WDXA 1ABQA 4FSSA 1PRLC 1G2BA 3UA6A 1NEBA 1B07A 2D0NA 1QWFA 1I1JA 1I07A 2M0YA 2XMFA 2LZ6B 4J9FA 2DL7A 5IXBA 3LH5A 4D8KA 2JXBA 2CT4A 2FRYA 3RBBB 2CDTA 2FPDA 1XOVA 3QWXX 3PVQA 3FJ5A 1K76A 4JZ4A 2W0ZA 1VA7A 3VS2A 2DBKA 2DYBA 2FPEA 1X2QA 2KXCA 1E6GA 2A37A 2RQTA 1U5SA 3CQTA 2HCKA 4HXJA 1KSWA 3R6NA 1S1NA 4RUGA 1GCQA 2JTEA 1UHFA 4LUDA 1NYGA 3ZL7C 3VS4A 2K6DA 2KNBB 3H0IA 5GJVB 3VRZA 2KBTA 2ROLA 3TVTA 2ESWA 4WCIA 1OPKA 3VS7A 2VKNA 2J6KA 1TG0A 5I11A 2RNAA 1T3LA 2ENMA 2LQNA 2ROTA 4EIKA 1UECA 1CKBA 1CKAA 2EYXA 1UJ0A 2HBWA 1M3CA 2OJ2A 2L3SA 1BBZA 2F2VA 1RLQC 2MOXA 2GTJA 1M30A 1GBRA 2J6OA 2DF6A 1TUDA 2A28A 4CC3A 4F17A 1T0HA 4HVUA 2JS0A 2EKHA 4CC4B 2CT3A 2AKKA 2O31A 2RN8A 1YWOA 2W10A 2FRWA 2EGAA 2JT4A 2KGTA 1AVZC 2DA9A 2D1XA 1PWTA 2YSQA 2ABLA 2RMOA 4HCKA 1HD3A 3H0FA 2KRSA 2JM8A 1JXMA 5L23A 2OI3A 1W1FA 3U23A 1YWPA 1YCSB 3A98A
chains in the Genus database with same CATH superfamily
2M02A 3URGA 1K73U 4J9CA 4DEXA 2XU8A 3VS5A 2YWWA 2DEUA 3BFMA 3DKMA 1Y7XA 3PIOA 1ZUYA 1YJWT 5LJ3e 4DOVA 2EYWA 2V1RA 1OEBA 2HQEA 3QPHA 2ED0A 2COWA 5CO7A 4IURA 1BIAA 3ME9A 2PNIA 3CC4T 3I56T 4PLIA 4OB1B 1OX9A 1XTDA 1X2KA 1Y96B 4OMOA 1UJYA 2CP6A 2VV5A 2OAWA 4PL6A 4M78G 4ZGDB 3OW2P 4FW2A 4FYVB 2P4TA 4R55A 2BZ8A 5I2MA 1VQKT 1RAHB 1QKWA 2DYIA 4OMLA 1ZHIA 2DBMA 2RJCA 4E47A 3ULRB 1K4US 1O9SA 3M53A 1UEBA 1HJDA 2K5FA 2VYTA 4OGEA 4J7FA 3L2UA 2DO3A 4LD6A 2CH4A 4JDSA 1UFFA 2MPXC 2VC8A 2EIFA 1D3BA 4RG8A 4LUEA 2QEXT 3RNJA 2CUDA 2WACA 1AWWA 1VQLQ 2LC4A 1R0CB 3VUBA 5GAN7 2K9GA 1VQKQ 2DZCA 4M77B 4EMKC 2RI5A 3HRSA 1H8KA 3MP8A 3EG1A 1E6HA 2Y4XA 3VS1A 4OMQA 3VJPA 5DLQE 3HSBA 1VQ5A 5GAMe 3RKYA 2AZSA 2H8HA 1WHKA 3MEVA 4PKCC 1GL5A 2R5MA 2BTTA 2K7AA 5AT1B 4KH0B 3M57A 2DTHA 4AG1C 2JW4A 1ZSZA 2DM1A 5DM7R 2LP5A 4LE9A 5DY9A 1PKSA 3GIBA 4A4EA 2O4XB 1H92A 3LH0A 3QIIA 1VQOT 5GAMh 3M59A 3G4SQ 2LNVA 5D6WA 1M2VB 2ATCB 4JJNK 3CMAT 2YLBA 4M4ZA 1JU5C 3OMGA 3CMAA 3LX7A 3V8KA 1KHIA 3LLRA 4M78E 3GBQA 2X4WA 3CEYA 2KE9A 5GAN3 1VQ8T 4C92D 5GAN2 2KROA 3SB2A 1MV0B 5FU7B 1NYFA 1I0CA 2YUOA 2NUPB 2PVOB 1Z9QA 5GMKm 5GAOp 4HKEA 4QVDA 1X43A 1VQNA 2K5LA 3LGLA 2DIQA 1WFWA 1RAAB 2O88A 2ZPHB 2FZCB 3OSSC 2JTMA 3EG9A 3CCSA 2MCNA 2E1HA 1NJIR 1OI1A 3CBOA 2AKLA 3JCMP 4D6WA 3OYJA 3NGPA 3OMCA 2RJFA 3EHQA 2P0KA 3CCMQ 4C0DB 3PGGA 1X01A 4F7UA 5I21A 1SHFA 1JJ2S 1U8RA 3I5SA 3HKSA 2YT6A 5GMKl 1WIEA 4OGCA 1TUGB 1TOVA 1ZSGA 1QQJA 2X4XA 2QAZA 2CZ7B 1AEYA 2P4RA 2RQWA 1MNEA 4M7AF 4Y92A 4PJOA 2A3LA 1G8XA 1M2OA 4EMKB 3GPLA 1BIBA 5DLOA 1HXDA 3TCJA 4OB3B 4C92B 3QO3A 1B3QA 4LDVA 2EYYA 4QQ6A 3RESA 2RPNA 4C0GA 3JB9D 4JJDA 4DBFA 2PU9B 4LDUA 1S72A 4J9BA 2CS7A 2RI2A 5D7UA 1O75A 4PNOA 5C6SA 1W6XA 1WXTA 4BI3A 4PFZA 4C92C 2QDYB 1LOJA 2EWNA 1XQHA 1AWJA 4E7LA 4L5GA 3QZ9B 4F04B 2MIOA 2E6ZA 4MMKA 5FRNA 4AFZC 2I0NA 3M0QA 1ZSZB 1U3OA 1YBYA 1YHQQ 3CXCA 4KUIA 3OYEA 4UC4A 5LJ5f 5FU6B 2EQKA 2GQVA 2CSIA 2QGFB 2E5QA 2E5KA 1WXBA 1BI2A 2RJEA 2DRMA 1EZZB 1SPKA 4MZPA 3QYGB 1PNJA 4Z02A 4ZGEB 5EG2A 2J05A 1PSFA 2RD1A 2VVKA 1WXUA 3CCRA 2OTJQ 4K11A 3QKJA 4OMPA 2HEQA 1D1AA 2O9VA 4PJMA 1PRMC 1RUWA 4C5GA 1KC8U 1ABQA 4J5YA 2FYKA 3SDZA 3I55T 2IVWA 3CC2Q 3BW1A 2M0YA 5CKDA 2XMFA 1VQNQ 2DL7A 4D8KA 3TEEA 4DOWA 4C92F 2CT4A 1X75C 2CP3A 1QVGS 3CD6T 2D0QB 3GF5A 3FJ5A 3E9GA 3LWIA 4JZ4A 3G6EA 2W0ZA 1YJ9A 1KK7A 3VS2A 2FVUA 2XDBA 2AIRB 3EFRA 3LWHA 2RQTA 1WJQA 4EMKA 2QA4Q 4HXJA 2O01E 1W4SA 4BACA 4HT8A 1VQ6A 1BKBA 4C8QE 1GCQA 1NYGA 3ZL7C 1UGQB 3EFOB 3SFMA 3OYGA 3CCJT 2KNBB 5FROA 5GJVB 2YLCA 2LT1A 3VS7A 2J6KA 1YJNQ 2KI7A 2RNAA 2LQNA 2ENMA 4EIKA 4L59A 1CKBA 4V2SA 4N4IA 4PJOG 5J3BA 2DERA 2CP2A 1NE8A 4Y91A 2DF6A 4CC3A 1N9RA 4A4HA 1T0HA 4FT4A 4E7ZA 1PCXA 1N6AA 3KXTA 3E19A 1M1KC 2RN8A 1YWOA 1U1TA 2FRWA 5GAOm 2MWOA 1N8RC 3RIRA 4E7JA 4CI0C 3G7ZA 3EGXB 4C5EA 1HD3A 3H0FA 2R58A 1VQ4A 3JCMJ 1K9MR 1IB8A 1JXMA 5HK3A 3N5BB 5L23A 2OI3A 4XTVA 3QJ6A 3M9QA 3ER0A 5LJ5g 4HVVA 2L0AA 1K73R 1UGRB 3REAB 2VASA 1YJWA 4O6JA 4ELYC 3M4GA 3HL8A 3OYLA 2C0OA 3VYHB 4M78D 1KQSP 4FYWB 5HK0A 2QXFA 4J9EA 3C12A 5CAIA 4ZNXA 1VQMA 5GAN5 5GAN6 2EGCA 4XTXA 5HKCA 2R5AA 2KQWA 3X24B 2WSCE 4EMGA 1FMWA 1BB9A 2P0PA 2IIMA 4ESRA 4HVWA 1AZGB 4C8QG 1IXDA 1Y0MA 2M1HA 3CMAQ 4X9DA 2FG0A 2CYZB 4AFSC 5GAN4 4ANJA 5I22A 3CPWS 4J83A 4C8QC 2OTJT 1UB4A 3FC3A 2G3RA 1D3BB 1M1GA 2V1QA 4RTUA 5CR2A 3RKWA 3H0HA 2JN0A 1PSEA 1YHQT 3S3MA 1R77A 1VQ5T 4GLKA 1YP5A 3NMZC 1WX6A 2CH4W 2VB6A 5FW9A 1V1CA 4JS4A 2EAYA 2L8DA 4J8OA 3IQLA 2ZAEA 1KHCA 2KVQG 2QASA 1VQ5Q 2KT1A 2PUOB 2CZ6B 2PVGB 1M1FA 4JLGA 1WQWA 2CP7A 2YUQA 1W2BP 2DE0X 2K57A 4KGVB 1GRIA 4J6YA 1M90C 4Z8AA 5LJ3f 5GAOq 3VS0A 2KEAA 1D1CA 1Y71A 3JV3A 1K0XA 4RCBA 2QA4A 2DL8A 4II1A 1NJIU 3EGDA 3GLXA 4QQGA 4YTLA 3GNGA 4CRIA 3S3NA 2LDMA 2ZPBB 2RHXA 3O5ZA 2COYA 3OYMA 3Q1JA 1UHCA 4N4HA 3L42A 3CCUQ 3PIPA 2DXTA 5GAN8 3QZ5B 3M5AA 2CP0A 2YHTA 5CKFA 4HCCA 4OMFB 5LJ3g 2PVDB 4FM4B 1UE9A 3G71T 4A54A 5GANd 1GFCA 2X9HA 2X4YA 1GCQC 1G3TA 4RCCA 2O2OA 4B9WA 4M78A 1ABOA 2QGGA 4N4GA 2VXEA 1AZEA 2BZXA 2LJ0A 1WNLA 1NLPC 1PHTA 1K9AA 2DKGA 2HSPA 1IREB 4OVAA 2GCXA 1QMCA 2DL4A 1ZUUA 3OS0A 1H3HA 1OV3A 1ARKA 2HKNA 2QQAA 3QYHB 2KMTA 3VUZA 2CGHA 1VQMT 1IHWA 1RABB 2GQIA 3MPUB 4L6V5 1KC8C 4M75C 1IRXA 1JXOA 4KH1B 5GAMf 5FWBA 1UUEA 4M75B 3PNWC 1BK2A 2E65A 3RKXA 2OTLA 5IHIA 4AMCA 1QVFP 1VIEA 2A08A 4M7DG 2L3PA 4E7KA 1K73C 4E6RA 3JCMg 1SKUB 3HHTB 2NWMA 5KYNA 2B86A 4M75A 3OYIA 5IH2A 4IIMA 4IUVA 2L3RA 4C8QF 5A0GA 2K79A 3CCRQ 1OPLA 1RI0A 2X35A 4KGZB 2XK0A 2FL7A 4KUDK 3JB9G 2JMAA 3M0PA 2DTOA 2ED1A 3VU3C 3HFNA 3VS3A 3JCMV 1GBQA 2V8IA 3P8HA 3FJPA 3VYGA 1VQ7Q 1I5LA 4J9DA 4JJBA 1D0XA 4BI8B 4BD3A 2RO0A 3SD4A 2Z0WA 2J7IA 2JS2A 4PJOE 1K8AU 3L2ZA 3OQ5A 3JCMd 1MUZA 2DX1A 2GNCA 3TREA 4Z89A 4C5HA 2LJ1A 2RF0A 2LCLA 2EYQA 4X34A 4M7AG 1YI2Q 1FMVA 5D6YA 4ELZC 2RH2A 4RTVA 2GGRA 2JTFA 1N5ZA 3CPWP 4IUTA 2DXCA 4ME7A 4M7DB 4MZTA 2FO0A 3FEOA 3EHRA 4NL2A 4BI4A 5GJWB 2QDLA 4JLIA 2RQUA 1QCNA 3EH2A 2KYMA 3G6ET 2JZ2A 2OTJA 2LQWA 1KFZA 1NG2A 3SWNA 2JJ9A 1YNZA 1FYNA 2KRNA 3EG9B 2XI9A 2VWFA 1WJRA 3MEUA 2LQ8A 3UA7A 4M7DE 5KYYB 4RTXA 1KD1R 4F16A 1X6GA 1Q95G 2J06A 2MF2A 3QG1A 1NZ9A 4F7UB 4FYXB 4J7IA 2A7YA 2J6FA 3CC7A 2F2XA 4Z88A 2X3XD 2DMOA 3CBPA 2CP5A 1A0NB 2A36A 4M77A 5IHKA 1MV3A 3CCLT 1GXIE 2EJFA 4HCZA 2LT4A 4OB0B 4R56A 3C95A 4M75D 1ZQ1A 2EQIA 3EG0A 3JB9I 3NTIA 1NBEB 5CQXA 3RMSA 1OQKA 3P8BB 2VXFA 3CMET 2MWPA 3LH5A 2LTOA 3JRZA 2JXBA 3RBBB 3OY9A 2NYSA 2DVEA 1RAIB 5A0DA 2QTXA 3E1SA 8ATCB 4PFPA 4F7UF 3BDLA 1MMNA 3A8HB 2CZ1B 4E7IA 5GMKj 4WTOB 4C0DC 2FPEA 3RMQA 3MCAB 2KXCA 1HK9A 4OB2B 1PM3A 4PJNA 1U5SA 4MZMA 2OAUA 2RI3A 5GMKh 2MYSA 2VUBA 3A1PA 2K6DA 3H0IA 3VRZA 2ROLA 4M7DF 2DEQA 4FYYB 2PQWA 1QVGP 3E2UA 1Q81R 3HP9A 3CBMA 1T3LA 1PD0A 4M77E 1CKAA 4FCYA 2WSEE 2O4XA 4DQ2A 1UJ0A 1M3CA 2OJ2A 3CCEA 1BBZA 3P8DA 1HYOA 1RLQC 3PTAA 1RL2A 1JBMA 2WSFE 1K9MC 3EGXA 2JS0A 2KY9A 3JCMQ 2CT3A 2KSSA 4LXCA 2D6FA 2M16A 4XU1A 2ABLA 1W2BA 2RMOA 1YI2A 3JB9F 5J39A 3JCMf 3CCLQ 1IGQA 5LJ5d 4PJOB 4M7AA 2DD5A 1R8OB 1VOMA 1W1FA 4C8QB 3JAME 1W2BS 2M9UA 2OTLT 4J9IA 1MMGA 2NUTB 3X28B 4XU3A 2X51A 1M5Q1 3MJXA 3VS6A 4M77G 4KRTA 1KQ1A 3GNFB 1T3SA 2DK3A 8AT1B 4MDXA 5CVIA 2E64A 1G83A 1YITA 1LJOA 2RHUA 4RTWA 1TWBA 2F5KA 2X3WD 3BY7A 2K3YA 2QG9B 2E3HA 2ECZA 1N9SA 4QW2A 4QVCA 1M9SA 2LRQA 4KULA 1AWXA 1I8FA 2QQBA 4FT2A 3TU4K 3C0CA 3A8GB 3EGUA 3C94A 5GAMd 2RQVA 1VQLA 2YRCA 3MKDA 1K1ZA 3HPWA 1TU0B 3D7SB 1M3BA 1WI7A 4JRPA 2JOYA 3CXCS 2AT1B 3MHXA 3LW5E 3UATA 1MGQA 2OTLQ 2QTVA 2L3QA 3QBYA 2DVJA 4GBQA 1UGPB 2CSQA 3JB9H 2DPPB 4PJLA 3JCMW 3HRTA 1F1BB 2DRKA 1PG5B 1TTHB 3OYYA 5L8RE 4PJOD 1AOJA 1S72Q 2EYZA 1SRLA 1G3YA 4BDYA 1J3TA 4P5NA 1B7TA 1QP3A 3PFSA 1VYVA 2EQJA 5CIUA 1M8VA 5CKHA 5HY6A 3S6WA 1SEMA 4HA8A 3CD6Q 3PE0A 1YITT 2DNUA 2FB7A 3EFSA 2AHJB 2DJQA 4GY5A 3CCMT 2DTIA 1LPLA 4A4FA 3V7SA 1AHJB 1WHLA 3JCMh 2O9SA 2HDAA 1QWEA 2E70A 2NUZA 5IHNA 1G5VA 2ZPEB 2BIVA 4D8DA 3KUFA 4LN2A 1U1SA 3FRNA 1M1KU 3R6OA 3J7AF 1VQOA 2C06A 4JJCA 5C0MA 3A8MB 4NL3A 2IPOB 4F7UE 1EFNA 1KD1C 3GP8A 1VQOQ 2EVRA 3JCMe 3OYCA 2GFUA 3DB3A 1MNDA 2YUNA 2LJ3A 2KXDA 3H9NA 4DBHA 2PTKA 2RHIA 2E4HA 3OYBA 1YIJA 1Q82C 2XIDA 3QJYA 3G1JA 1SSHA 1VYTA 5CKEA 2LVMA 2L89A 3FLGA 4A63B 3CCMA 3LYIA 1Q82R 2RQRA 5GMKe 2K2MA 2K3BA 5FU7C 1EIFA 2ZGWA 1CSKA 4CC7A 4ORZA 1M90U 2CKKA 3A8OB 4LNPA 3M55A 4DBRA 4F14A 4EMHA 2L5QA 1UDLA 1JRIA 1NM7A 1VQ7A 5KYXB 3UPUA 2C0TA 2LQKA 4OMMA 2BE7D 3J80E 1C0MA 1RAEB 1UGVA 4KT0E 1K0SA 5GMKi 2X4JA 1VQ9A 1QKXA 4E7HA 2B8AA 1UG1A 2YRDA 2JUFA 1WHMA 3T9NA 1WLPB 1KQSA 2XHCA 9ATCB 2GTOA 4LDYA 1B34A 2DZ9A 2HMAA 1HSQA 5J26A 1G3SA 1QCFA 2NUPA 4OMNA 5FU6C 2CZ0B 2F2WA 4IUUA 3M0RA 2KK4A 3I56Q 1FWZA 5M9OA 5GANh 3CXCP 3V7RA 2XG8D 1I5OB 3CCUA 3M54A 1OULA 2FEIA 3CC4A 1NEGA 2L2PA 5KYWA 3OYAA 3CC2A 3H41A 2DFUA 3NPFA 1Q7YC 4AFQC 2JNGA 1OU9A 5LJ3h 1H3ZA 3PMTA 3CC4Q 3M0TA 4NS5A 2DL5A 6AT1B 3G6EQ 4IIOA 5GANe 5LL6S 3FIFA 1AWOA 1G3WA 4C92E 4XK8E 4J9GA 2LX7A 4ZN3A 1M8MA 5KYYA 1AD5A 1IO6A 3V7CA 5IXFA 1OOTA 3NHNA 1Y57A 2DILA 2PZ1A 1RAGB 5EC7A 4BDZA 2R57A 1W70A 1WZOA 2HD0A 1XNIA 2GF7A 1ZA1B 1SSFA 2SRCA 5KCHA 4C92A 1NJIC 1KJWA 3WVDB 1VQ9T 4FIBA 1QCOA 4M75G 1VQPT 2KRMA 1UTIA 4XQ3A 1RADB 4M7DC 2QK0A 4C92G 1YJWQ 2GBQA 3CCJQ 2BZYA 2JMCA 2EW3A 2HQXA 4BUGA 3L2RA 2DXUA 4M78F 1YIJQ 3CCQA 3UA6A 1G2BA 3X20B 4M7DD 2DIGA 4XAXB 3CCSQ 1QWFA 1YI2T 3OS2A 2FZKB 1YJ9Q 1YIJT 2RK1A 1AT1B 2LZ6B 1VUBA 2EJ9A 3OS1A 1D1BA 4FU6A 1KG1A 1TXQA 4MDWA 2CDTA 5AYFA 3S3OA 3JSCA 1ACMB 3PVQA 1YJNT 1R0BG 1VA7A 2H3JA 3CCRT 2DBKA 5GAMg 1QVGA 3HFOA 2DYBA 1QVPA 2HNIA 1I81A 1X2QA 3MP6A 3CCET 5D6XA 3QDRB 2MI6A 1YHQA 3H8ZA 3CQTA 4FSXA 4JS5A 1KSWA 3R6NA 1S1NA 1V76A 1NPPA 5KE2A 5GAMj 4RUGA 3OSVA 1VQMQ 4A53A 4B6MA 3DB4A 2I2LA 2PUKB 3E9FA 4LUDA 3MO8A 3VS4A 1LNXA 1Q86C 3SWNB 5CCAA 3CCQQ 2KBTA 3TVTA 2H3EB 4WCIA 1YFNA 2ZPIB 3DLMA 4IUQA 2VKNA 3DLLA 1Q81U 2M0OA 5I11A 3G71A 3G4SA 1UECA 1ZSZC 2EYXA 1Q86U 4DA4A 1EX4A 3UT1A 1VQLT 2HBWA 2EQMA 3X26B 5LJ5j 1QP2A 7AT1B 2YRVA 1BCOA 2L3SA 2F2VA 3OBWA 2E6NA 2MOXA 1OU8A 4F17A 4BE0A 2E12A 3RDVA 1S72T 3OYDA 3EAEA 2HAXA 1DJ7B 2D9TA 2EGAA 2VGMA 3MEAA 3QXEB 1OZ3A 2DA9A 1AVZC 3META 2D1XA 3CCVT 2V8KA 1VIFA 2HL3A 2ZZDA 4IUPA 4HCKA 3OBYA 4M77D 3L2WA 3G4ST 3ZBDA 4PJJA 2JM8A 1I4K1 1WGSA 2RB6A 4M7AC 1YWPA 3KBGA 3A98A 2MK5A 5A0LA 2GFAA 2HL5C 1VYUA 1BYMA 3CCLA 2RHYA 1K8AR 5HCKA 1N8RR 1ZBXA 4JRQA 1Z9ZA 3TSZA 3X25B 5IT9E 1VQ6T 1LCKA 4M78C 3SHWA 1VQPQ 1BI0A 4N0AA 1WQ7A 4KBMB 5A2QE 4DEYA 3WXMB 1M2VA 4C0FA 3ZFJA 3CPFA 5KH6A 2QA4T 5FWCA 5GANj 4LDXA 2E3IA 5GAOl 5ECAA 3OYHA 3BDUA 3JCMb 2D8JA 1MMAA 1T0JA 2F69A 5KE3A 3OS5A 1C1AA 3L2QA 2K4YA 1X27A 3I35A 4JUVA 3HRUA 3CCQT 2HQHA 2COZA 2KDSA 1WPYA 3ZEHA 4C8QD 2HZYA 4JPBW 2VGNA 3I55Q 4J9HA 2C0IA 1FX7A 2MAMA 5KYWB 2DXBA 5GAOn 1KD1U 4QT7A 2A0FB 2LNHB 1VQNT 4M78B 1JO8A 4OF1A 1Q7YU 3CD6A 5FLXE 2EFIA 1ZUKA 3PVLA 1VQ4T 3MP1A 2KT8A 1P92A 1YN8A 2YUPA 3THKA 4AT1B 2KAFA 3O8VA 2ZCFB 3I5RA 2EJGA 3FB9A 1KC8R 1SHGA 3CCVA 2LMJA 3I9QA 3M0SA 3OYNA 1XJWB 4KGXB 3RUXA 4LDWA 2HBPA 2E10A 1ZX6A 4M7AE 2G6FX 4M7AD 4M77F 2DL3A 3A8LB 4XTWA 2ZPFB 4E2FB 4BE2A 2RK2A 2LCSA 3OYFA 2EKOA 3CMEQ 1JJ2A 3UF4A 4BY6C 4M77C 2QQ9A 1NPRA 1GFDA 3QHSA 2P0QA 4BY6B 3LGFA 1MMDA 1IGUA 2SEMA 1BU1A 4XTUA 5FRMA 1RAFB 2KYBA 4Y28E 2EBPA 1RI9A 4HT9A 1BCMA 2XKOC 1SRMA 3KFVA 4CC2A 1OYXA 4X1VA 3VRYA 4E7SA 4DBQA 3VV0A 3SWNC 4ZTFA 1X6BA 4PFOA 3EG2A 2EPDA 3EGDB 3M56A 4XU0A 3QSUA 4C0ZA 1TS9A 1M3AA 2RHZA 1Q82U 2IG0A 1JJ2P 2QEXA 4FW1A 3REBB 3OW2S 1M90R 4PK4A 3TQ7P 2D8HA 4RKUE 4RMOA 1TSFA 4JRKA 4R0KA 4IKFA 1Y07A 2AZVA 4M75E 2V8JA 3AHUA 4AFUC 3V8LA 4RTZA 4Q5WA 1YCYA 3V8JA 2FHDA 2Y4YA 1ZBJA 1UGSB 2AK5A 1FMKA 3ASKA 2HKQB 3F70A 3QWYA 4N0AC 2F1LA 4AG2C 3A5ZB 5CKBA 3CCJA 4M7DA 1ZA2B 2ZPGB 1U06A 3EG3A 3M4YA 2JVVA 1RACB 1RLPC 2YDLA 3M0UA 3CC7Q 3RERA 1KIKA 1YITQ 1K9MU 1Q81C 1SG5A 1Y96A 5LJ5e 3J81E 4NOYA 5GANg 1NLOC 1JEGA 2FZGB 2K2VA 3CC7T 2M51A 4FL6A 3I55A 3AT1B 1WHJA 3QDFA 4JZ3A 4BB7A 1PKTA 4B9XA 1VQ6Q 2NLUA 1M27C 1M4ZA 1WJSA 1ZLMA 2CREA 3UDCA 5LJ5h 4ZTJA 2HSEB 2FPFA 1OZ2A 2F5TX 3JB9J 1PC0A 1QLYA 2E41A 4WF2A 3GOXA 4J6XA 1E7OA 1GCPA 3RR6A 3CCEQ 4M7AB 1TUCA 3QUIA 1Q86R 1VQ8A 4QKUA 2RM4A 5KYUB 3NTKA 3C4SA 1KQ2A 1FXXA 2CUBA 4JRIA 1WYXA 4GLMA 1WHHA 1YJNA 2DLPA 4RTYA 4HCBA 3CCVQ 2JM9A 3BE3A 3CMEA 5IAYA 4ATOA 2XICA 1D0ZA 4F7UG 2OX7A 3SEMA 2DAQA 5KYXA 3FDRA 3WVEB 3OYKA 1IZ6A 1KQSS 5KCOA 5GAOr 4QQDA 1D0YA 1BI1A 1H641 1WA7A 2QQRA 2DJZA 2KR3A 3TSWA 2LX9A 2YXYA 4RTTA 3VKIA 1JQQA 4XTZA 1X69A 3NFCA 2XDPA 1VQ4Q 2EGEA 2P84A 4EDUA 1PD1A 4X9CA 3HTRA 1OX8A 1WDXA 4FSSA 4C5IA 1VQ9Q 1PRLC 4RG2A 1C6VX 1NEBA 1QVFA 1B07A 2D0NA 1I1JA 1I07A 4XTYA 2BKDN 4TVRA 1N27A 2QEXQ 4J9FA 4VUBA 5IXBA 2LCCA 5LJ3j 1IHVA 3OA6A 3CC2T 2FRYA 1BI3A 2MMPA 2Y90A 3NTHA 2FPDA 1XOVA 2QQSA 1QVFS 3QWXX 3CCUT 1K76A 2RA2A 1V29B 3PMIA 4ZN1A 2K3XA 5I2SA 1WHGA 2BUDA 3OB9A 1M1KR 1E6GA 2V26A 3G71Q 2A37A 5CQYA 3JCMX 4O5VA 3OW2A 2HCKA 3I56A 4A4KA 5CK9A 2RJDA 2JTEA 1N8RU 1VQKA 1UHFA 2K5IA 3MEWA 5LJ3d 3L2VA 1Q7YR 2ESWA 2QYZA 4C8QA 1OPKA 4PJOC 1TG0A 1K8AC 4M75F 2NUTA 4PLLA 3L1AA 2ROTA 3EFOA 1LVKA 4A4GA 3CCST 4PJOF 1SF9A 1YJ9T 2XDDA 5GANf 1VQ7T 5KYUA 2GTJA 1M30A 1GBRA 2J6OA 4MMLA 4BE1A 1TUDA 2A28A 2DD4A 4EPCA 4HVUA 1X6OA 3CPWA 3INZA 2EKHA 4CC4B 1TH7A 3M58A 2BE9B 3JCMc 1QW1A 2DETA 2AKKA 2O31A 1MHNA 2W10A 4J6WA 1VQ8Q 3H6ZA 5IN1A 2JT4A 4ZGJB 2KGTA 1JB0E 1PWTA 2YSQA 1VQPA 2QI2A 3EH1A 4OP0A 3UWNA 3PT9A 2KRSA 2EQUA 4XU2A 2XD0A 1B34B 1D09B 3U23A 1YCSB 4QVZA 4LD9K
chains in the Genus database with same CATH topology
4HVVA 2L0AA 4J9CA 4J9IA 3REAB 3VS5A 4DEXA 1VYUA 1ZUYA 2C0OA 5HCKA 3VS6A 2EYWA 2V1RA 4KRTA 1OEBA 4J9EA 4ZNXA 2ED0A 1Z9ZA 3TSZA 1T3SA 2EGCA 2PNIA 1G83A 1LCKA 1BB9A 2IIMA 1X2KA 4RTWA 4ESRA 3SHWA 2X3WD 4HVWA 1AZGB 4DEYA 4OMOA 1UJYA 2OAWA 1Y0MA 2ECZA 2FG0A 5FWCA 4AFSC 5I22A 2BZ8A 5ECAA 2D8JA 1T0JA 1AWXA 1QKWA 4OMLA 2DBMA 3C0CA 2V1QA 3EGUA 4RTUA 1X27A 3I35A 3ULRB 1K4US 2RQVA 3H0HA 1K1ZA 1HJDA 1YP5A 3NMZC 1WX6A 2CH4A 2CH4W 4JPBW 4J9HA 1M3BA 1UFFA 1WI7A 2C0IA 5FW9A 1V1CA 4QT7A 3IQLA 4LUEA 2LNHB 3UATA 3RNJA 2CUDA 2KT1A 1JO8A 1ZUKA 2L3QA 1AWWA 2DVJA 4GBQA 2YUQA 2CSQA 3PVLA 2DE0X 1GRIA 2K9GA 2KT8A 1YN8A 2YUPA 4Z8AA 3THKA 3VS0A 2KEAA 2DRKA 3JV3A 1K0XA 2DL8A 1H8KA 1AOJA 2EYZA 1SRLA 3I5RA 3EG1A 1E6HA 1J3TA 1SHGA 3VS1A 2LMJA 4OMQA 1VYVA 3I9QA 3M0SA 3O5ZA 1UHCA 1SEMA 2AZSA 3PE0A 2H8HA 1ZX6A 1GL5A 2DNUA 2G6FX 2BTTA 2DL3A 2DJQA 2K7AA 4AG1C 2JW4A 2LCSA 1UE9A 2DM1A 3UF4A 2LP5A 4LE9A 2O9SA 2HDAA 1PKSA 1GFCA 1QWEA 1GCQC 1GFDA 2NUZA 5IHNA 2O2OA 1H92A 4D8DA 1ABOA 1BU1A 2SEMA 4LN2A 2KYBA 1AZEA 2BZXA 2EBPA 1RI9A 2LJ0A 2HSPA 1NLPC 1PHTA 1K9AA 4JJCA 4M4ZA 1JU5C 1SRMA 3KFVA 4CC2A 1EFNA 2DL4A 1ZUUA 2EVRA 4X1VA 3VRYA 1H3HA 1OV3A 1ARKA 1X6BA 3GBQA 2YUNA 3EG2A 2LJ3A 2KXDA 2EPDA 2PTKA 2KE9A 1SSHA 1VYTA 2KROA 2GQIA 1M3AA 1MV0B 4A63B 1JXOA 1I0CA 1NYFA 2YUOA 5FWBA 1UUEA 1Z9QA 2RQRA 2K2MA 2K3BA 1X43A 1CSKA 4CC7A 4ORZA 1WFWA 1BK2A 3REBB 2O88A 2D8HA 4LNPA 5IHIA 4F14A 4R0KA 2MCNA 2AZVA 1UDLA 2AKLA 1NM7A 2A08A 4AFUC 3NGPA 2L3PA 3EHQA 4RTZA 2C0TA 4E6RA 1ZBJA 4OMMA 2AK5A 2NWMA 1FMKA 1UGVA 2B86A 1K0SA 3QWYA 5IH2A 1SHFA 4IIMA 4AG2C 3I5SA 2K79A 2YT6A 1U06A 3EG3A 1OPLA 1WIEA 1QKXA 1ZSGA 1RLPC 2YDLA 3M0UA 1KIKA 2JMAA 3M0PA 1UG1A 2ED1A 1AEYA 2P4RA 2RQWA 3VS3A 4Y92A 1GBQA 1NLOC 1WLPB 1JEGA 2GTOA 4J9DA 2M51A 1HSQA 1QCFA 4JJBA 4OMNA 4JZ3A 1B3QA 1PKTA 2J7IA 2F2WA 2JS2A 2EYYA 3M0RA 2RPNA 1M27C 1MUZA 2DX1A 2GNCA 4JJDA 1ZLMA 2CREA 4Z89A 4J9BA 2LJ1A 2RF0A 2FPFA 2FEIA 1NEGA 2L2PA 1QLYA 1W6XA 1WXTA 3H41A 3NPFA 4AFQC 1AWJA 1E7OA 1GCPA 4RTVA 3M0TA 2MIOA 2DL5A 2GGRA 1TUCA 1N5ZA 4IIOA 4AFZC 2I0NA 2FO0A 3M0QA 3EHRA 1AWOA 1U3OA 4J9GA 5GJWB 2QDLA 2CUBA 2LX7A 2RQUA 1M8MA 1WYXA 4GLMA 2KYMA 1AD5A 1IO6A 5IXFA 1OOTA 2DLPA 3NHNA 4RTYA 1Y57A 2DILA 2PZ1A 5EC7A 2LQWA 1W70A 1KFZA 2JM9A 2CSIA 1NG2A 1YNZA 2E5KA 1FYNA 2KRNA 2SRCA 2VWFA 1KJWA 1WXBA 3UA7A 2DRMA 4RTXA 1SPKA 3SEMA 4F16A 1PNJA 1X6GA 2J06A 2KRMA 1UTIA 2J6FA 2J05A 2VVKA 2F2XA 1WA7A 4Z88A 1WXUA 2X3XD 2DMOA 2GBQA 1A0NB 2BZYA 2KR3A 2A36A 5IHKA 3TSWA 1MV3A 2JMCA 4K11A 2EW3A 4OMPA 4RTTA 1JQQA 2HEQA 1X69A 2O9VA 1PRMC 1RUWA 2EGEA 2EQIA 3EG0A 1WDXA 1ABQA 4FSSA 1PRLC 1G2BA 3UA6A 1NEBA 1B07A 2D0NA 1QWFA 1I1JA 1I07A 2M0YA 2XMFA 2LZ6B 4J9FA 2DL7A 5IXBA 3LH5A 4D8KA 2JXBA 2CT4A 2FRYA 3RBBB 2CDTA 2FPDA 1XOVA 3QWXX 3PVQA 3FJ5A 1K76A 4JZ4A 2W0ZA 1VA7A 3VS2A 2DBKA 2DYBA 2FPEA 1X2QA 2KXCA 1E6GA 2A37A 2RQTA 1U5SA 3CQTA 2HCKA 4HXJA 1KSWA 3R6NA 1S1NA 4RUGA 1GCQA 2JTEA 1UHFA 4LUDA 1NYGA 3ZL7C 3VS4A 2K6DA 2KNBB 3H0IA 5GJVB 3VRZA 2KBTA 2ROLA 3TVTA 2ESWA 4WCIA 1OPKA 3VS7A 2VKNA 2J6KA 1TG0A 5I11A 2RNAA 1T3LA 2ENMA 2LQNA 2ROTA 4EIKA 1UECA 1CKBA 1CKAA 2EYXA 1UJ0A 2HBWA 1M3CA 2OJ2A 2L3SA 1BBZA 2F2VA 1RLQC 2MOXA 2GTJA 1M30A 1GBRA 2J6OA 2DF6A 1TUDA 2A28A 4CC3A 4F17A 1T0HA 4HVUA 2JS0A 2EKHA 4CC4B 2CT3A 2AKKA 2O31A 2RN8A 1YWOA 2W10A 2FRWA 2EGAA 2JT4A 2KGTA 1AVZC 2DA9A 2D1XA 1PWTA 2YSQA 2ABLA 2RMOA 4HCKA 1HD3A 3H0FA 2KRSA 2JM8A 1JXMA 5L23A 2OI3A 1W1FA 3U23A 1YWPA 1YCSB 3A98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVV A;  2L0A A;  4J9C A;  4J9I A;  3REA B;  3VS5 A;  4DEX A;  1VYU A;  1ZUY A;  2C0O A;  5HCK A;  3VS6 A;  2EYW A;  2V1R A;  4KRT A;  1OEB A;  4J9E A;  4ZNX A;  2ED0 A;  1Z9Z A;  3TSZ A;  1T3S A;  2EGC A;  2PNI A;  1G83 A;  1LCK A;  1BB9 A;  2IIM A;  1X2K A;  4RTW A;  4ESR A;  3SHW A;  2X3W D;  4HVW A;  1AZG B;  4DEY A;  4OMO A;  1UJY A;  2OAW A;  1Y0M A;  2ECZ A;  2FG0 A;  5FWC A;  4AFS C;  5I22 A;  2BZ8 A;  5ECA A;  2D8J A;  1T0J A;  1AWX A;  1QKW A;  4OML A;  2DBM A;  3C0C A;  2V1Q A;  3EGU A;  4RTU A;  1X27 A;  3I35 A;  3ULR B;  1K4U S;  2RQV A;  3H0H A;  1K1Z A;  1HJD A;  1YP5 A;  3NMZ C;  1WX6 A;  2CH4 A;  2CH4 W;  4JPB W;  4J9H A;  1M3B A;  1UFF A;  1WI7 A;  2C0I A;  5FW9 A;  1V1C A;  4QT7 A;  3IQL A;  4LUE A;  2LNH B;  3UAT A;  3RNJ A;  2CUD A;  2KT1 A;  1JO8 A;  1ZUK A;  2L3Q A;  1AWW A;  2DVJ A;  4GBQ A;  2YUQ A;  2CSQ A;  3PVL A;  2DE0 X;  1GRI A;  2K9G A;  2KT8 A;  1YN8 A;  2YUP A;  4Z8A A;  3THK A;  3VS0 A;  2KEA A;  2DRK A;  3JV3 A;  1K0X A;  2DL8 A;  1H8K A;  1AOJ A;  2EYZ A;  1SRL A;  3I5R A;  3EG1 A;  1E6H A;  1J3T A;  1SHG A;  3VS1 A;  2LMJ A;  4OMQ A;  1VYV A;  3I9Q A;  3M0S A;  3O5Z A;  1UHC A;  1SEM A;  2AZS A;  3PE0 A;  2H8H A;  1ZX6 A;  1GL5 A;  2DNU A;  2G6F X;  2BTT A;  2DL3 A;  2DJQ A;  2K7A A;  4AG1 C;  2JW4 A;  2LCS A;  1UE9 A;  2DM1 A;  3UF4 A;  2LP5 A;  4LE9 A;  2O9S A;  2HDA A;  1PKS A;  1GFC A;  1QWE A;  1GCQ C;  1GFD A;  2NUZ A;  5IHN A;  2O2O A;  1H92 A;  4D8D A;  1ABO A;  1BU1 A;  2SEM A;  4LN2 A;  2KYB A;  1AZE A;  2BZX A;  2EBP A;  1RI9 A;  2LJ0 A;  2HSP A;  1NLP C;  1PHT A;  1K9A A;  4JJC A;  4M4Z A;  1JU5 C;  1SRM A;  3KFV A;  4CC2 A;  1EFN A;  2DL4 A;  1ZUU A;  2EVR A;  4X1V A;  3VRY A;  1H3H A;  1OV3 A;  1ARK A;  1X6B A;  3GBQ A;  2YUN A;  3EG2 A;  2LJ3 A;  2KXD A;  2EPD A;  2PTK A;  2KE9 A;  1SSH A;  1VYT A;  2KRO A;  2GQI A;  1M3A A;  1MV0 B;  4A63 B;  1JXO A;  1I0C A;  1NYF A;  2YUO A;  5FWB A;  1UUE A;  1Z9Q A;  2RQR A;  2K2M A;  2K3B A;  1X43 A;  1CSK A;  4CC7 A;  4ORZ A;  1WFW A;  1BK2 A;  3REB B;  2O88 A;  2D8H A;  4LNP A;  5IHI A;  4F14 A;  4R0K A;  2MCN A;  2AZV A;  1UDL A;  2AKL A;  1NM7 A;  2A08 A;  4AFU C;  3NGP A;  2L3P A;  3EHQ A;  4RTZ A;  2C0T A;  4E6R A;  1ZBJ A;  4OMM A;  2AK5 A;  2NWM A;  1FMK A;  1UGV A;  2B86 A;  1K0S A;  3QWY A;  5IH2 A;  1SHF A;  4IIM A;  4AG2 C;  3I5S A;  2K79 A;  2YT6 A;  1U06 A;  3EG3 A;  1OPL A;  1WIE A;  1QKX A;  1ZSG A;  1RLP C;  2YDL A;  3M0U A;  1KIK A;  2JMA A;  3M0P A;  1UG1 A;  2ED1 A;  1AEY A;  2P4R A;  2RQW A;  3VS3 A;  4Y92 A;  1GBQ A;  1NLO C;  1WLP B;  1JEG A;  2GTO A;  4J9D A;  2M51 A;  1HSQ A;  1QCF A;  4JJB A;  4OMN A;  4JZ3 A;  1B3Q A;  1PKT A;  2J7I A;  2F2W A;  2JS2 A;  2EYY A;  3M0R A;  2RPN A;  1M27 C;  1MUZ A;  2DX1 A;  2GNC A;  4JJD A;  1ZLM A;  2CRE A;  4Z89 A;  4J9B A;  2LJ1 A;  2RF0 A;  2FPF A;  2FEI A;  1NEG A;  2L2P A;  1QLY A;  1W6X A;  1WXT A;  3H41 A;  3NPF A;  4AFQ C;  1AWJ A;  1E7O A;  1GCP A;  4RTV A;  3M0T A;  2MIO A;  2DL5 A;  2GGR A;  1TUC A;  1N5Z A;  4IIO A;  4AFZ C;  2I0N A;  2FO0 A;  3M0Q A;  3EHR A;  1AWO A;  1U3O A;  4J9G A;  5GJW B;  2QDL A;  2CUB A;  2LX7 A;  2RQU A;  1M8M A;  1WYX A;  4GLM A;  2KYM A;  1AD5 A;  1IO6 A;  5IXF A;  1OOT A;  2DLP A;  3NHN A;  4RTY A;  1Y57 A;  2DIL A;  2PZ1 A;  5EC7 A;  2LQW A;  1W70 A;  1KFZ A;  2JM9 A;  2CSI A;  1NG2 A;  1YNZ A;  2E5K A;  1FYN A;  2KRN A;  2SRC A;  2VWF A;  1KJW A;  1WXB A;  3UA7 A;  2DRM A;  4RTX A;  1SPK A;  3SEM A;  4F16 A;  1PNJ A;  1X6G A;  2J06 A;  2KRM A;  1UTI A;  2J6F A;  2J05 A;  2VVK A;  2F2X A;  1WA7 A;  4Z88 A;  1WXU A;  2X3X D;  2DMO A;  2GBQ A;  1A0N B;  2BZY A;  2KR3 A;  2A36 A;  5IHK A;  3TSW A;  1MV3 A;  2JMC A;  4K11 A;  2EW3 A;  4OMP A;  4RTT A;  1JQQ A;  2HEQ A;  1X69 A;  2O9V A;  1PRM C;  1RUW A;  2EGE A;  2EQI A;  3EG0 A;  1WDX A;  1ABQ A;  4FSS A;  1PRL C;  1G2B A;  3UA6 A;  1NEB A;  1B07 A;  2D0N A;  1QWF A;  1I1J A;  1I07 A;  2M0Y A;  2XMF A;  2LZ6 B;  4J9F A;  2DL7 A;  5IXB A;  3LH5 A;  4D8K A;  2JXB A;  2CT4 A;  2FRY A;  3RBB B;  2CDT A;  2FPD A;  1XOV A;  3QWX X;  3PVQ A;  3FJ5 A;  1K76 A;  4JZ4 A;  2W0Z A;  1VA7 A;  3VS2 A;  2DBK A;  2DYB A;  2FPE A;  1X2Q A;  2KXC A;  1E6G A;  2A37 A;  2RQT A;  1U5S A;  3CQT A;  2HCK A;  4HXJ A;  1KSW A;  3R6N A;  1S1N A;  4RUG A;  1GCQ A;  2JTE A;  1UHF A;  4LUD A;  1NYG A;  3ZL7 C;  3VS4 A;  2K6D A;  2KNB B;  3H0I A;  5GJV B;  3VRZ A;  2KBT A;  2ROL A;  3TVT A;  2ESW A;  4WCI A;  1OPK A;  3VS7 A;  2VKN A;  2J6K A;  1TG0 A;  5I11 A;  2RNA A;  1T3L A;  2ENM A;  2LQN A;  2ROT A;  4EIK A;  1UEC A;  1CKB A;  1CKA A;  2EYX A;  1UJ0 A;  2HBW A;  1M3C A;  2OJ2 A;  2L3S A;  1BBZ A;  2F2V A;  1RLQ C;  2MOX A;  2GTJ A;  1M30 A;  1GBR A;  2J6O A;  2DF6 A;  1TUD A;  2A28 A;  4CC3 A;  4F17 A;  1T0H A;  4HVU A;  2JS0 A;  2EKH A;  4CC4 B;  2CT3 A;  2AKK A;  2O31 A;  2RN8 A;  1YWO A;  2W10 A;  2FRW A;  2EGA A;  2JT4 A;  2KGT A;  1AVZ C;  2DA9 A;  2D1X A;  1PWT A;  2YSQ A;  2ABL A;  2RMO A;  4HCK A;  1HD3 A;  3H0F A;  2KRS A;  2JM8 A;  1JXM A;  5L23 A;  2OI3 A;  1W1F A;  3U23 A;  1YWP A;  1YCS B;  3A98 A; 
#chains in the Genus database with same CATH topology
 2M02 A;  3URG A;  1K73 U;  4J9C A;  4DEX A;  2XU8 A;  3VS5 A;  2YWW A;  2DEU A;  3BFM A;  3DKM A;  1Y7X A;  3PIO A;  1ZUY A;  1YJW T;  5LJ3 e;  4DOV A;  2EYW A;  2V1R A;  1OEB A;  2HQE A;  3QPH A;  2ED0 A;  2COW A;  5CO7 A;  4IUR A;  1BIA A;  3ME9 A;  2PNI A;  3CC4 T;  3I56 T;  4PLI A;  4OB1 B;  1OX9 A;  1XTD A;  1X2K A;  1Y96 B;  4OMO A;  1UJY A;  2CP6 A;  2VV5 A;  2OAW A;  4PL6 A;  4M78 G;  4ZGD B;  3OW2 P;  4FW2 A;  4FYV B;  2P4T A;  4R55 A;  2BZ8 A;  5I2M A;  1VQK T;  1RAH B;  1QKW A;  2DYI A;  4OML A;  1ZHI A;  2DBM A;  2RJC A;  4E47 A;  3ULR B;  1K4U S;  1O9S A;  3M53 A;  1UEB A;  1HJD A;  2K5F A;  2VYT A;  4OGE A;  4J7F A;  3L2U A;  2DO3 A;  4LD6 A;  2CH4 A;  4JDS A;  1UFF A;  2MPX C;  2VC8 A;  2EIF A;  1D3B A;  4RG8 A;  4LUE A;  2QEX T;  3RNJ A;  2CUD A;  2WAC A;  1AWW A;  1VQL Q;  2LC4 A;  1R0C B;  3VUB A;  5GAN 7;  2K9G A;  1VQK Q;  2DZC A;  4M77 B;  4EMK C;  2RI5 A;  3HRS A;  1H8K A;  3MP8 A;  3EG1 A;  1E6H A;  2Y4X A;  3VS1 A;  4OMQ A;  3VJP A;  5DLQ E;  3HSB A;  1VQ5 A;  5GAM e;  3RKY A;  2AZS A;  2H8H A;  1WHK A;  3MEV A;  4PKC C;  1GL5 A;  2R5M A;  2BTT A;  2K7A A;  5AT1 B;  4KH0 B;  3M57 A;  2DTH A;  4AG1 C;  2JW4 A;  1ZSZ A;  2DM1 A;  5DM7 R;  2LP5 A;  4LE9 A;  5DY9 A;  1PKS A;  3GIB A;  4A4E A;  2O4X B;  1H92 A;  3LH0 A;  3QII A;  1VQO T;  5GAM h;  3M59 A;  3G4S Q;  2LNV A;  5D6W A;  1M2V B;  2ATC B;  4JJN K;  3CMA T;  2YLB A;  4M4Z A;  1JU5 C;  3OMG A;  3CMA A;  3LX7 A;  3V8K A;  1KHI A;  3LLR A;  4M78 E;  3GBQ A;  2X4W A;  3CEY A;  2KE9 A;  5GAN 3;  1VQ8 T;  4C92 D;  5GAN 2;  2KRO A;  3SB2 A;  1MV0 B;  5FU7 B;  1NYF A;  1I0C A;  2YUO A;  2NUP B;  2PVO B;  1Z9Q A;  5GMK m;  5GAO p;  4HKE A;  4QVD A;  1X43 A;  1VQN A;  2K5L A;  3LGL A;  2DIQ A;  1WFW A;  1RAA B;  2O88 A;  2ZPH B;  2FZC B;  3OSS C;  2JTM A;  3EG9 A;  3CCS A;  2MCN A;  2E1H A;  1NJI R;  1OI1 A;  3CBO A;  2AKL A;  3JCM P;  4D6W A;  3OYJ A;  3NGP A;  3OMC A;  2RJF A;  3EHQ A;  2P0K A;  3CCM Q;  4C0D B;  3PGG A;  1X01 A;  4F7U A;  5I21 A;  1SHF A;  1JJ2 S;  1U8R A;  3I5S A;  3HKS A;  2YT6 A;  5GMK l;  1WIE A;  4OGC A;  1TUG B;  1TOV A;  1ZSG A;  1QQJ A;  2X4X A;  2QAZ A;  2CZ7 B;  1AEY A;  2P4R A;  2RQW A;  1MNE A;  4M7A F;  4Y92 A;  4PJO A;  2A3L A;  1G8X A;  1M2O A;  4EMK B;  3GPL A;  1BIB A;  5DLO A;  1HXD A;  3TCJ A;  4OB3 B;  4C92 B;  3QO3 A;  1B3Q A;  4LDV A;  2EYY A;  4QQ6 A;  3RES A;  2RPN A;  4C0G A;  3JB9 D;  4JJD A;  4DBF A;  2PU9 B;  4LDU A;  1S72 A;  4J9B A;  2CS7 A;  2RI2 A;  5D7U A;  1O75 A;  4PNO A;  5C6S A;  1W6X A;  1WXT A;  4BI3 A;  4PFZ A;  4C92 C;  2QDY B;  1LOJ A;  2EWN A;  1XQH A;  1AWJ A;  4E7L A;  4L5G A;  3QZ9 B;  4F04 B;  2MIO A;  2E6Z A;  4MMK A;  5FRN A;  4AFZ C;  2I0N A;  3M0Q A;  1ZSZ B;  1U3O A;  1YBY A;  1YHQ Q;  3CXC A;  4KUI A;  3OYE A;  4UC4 A;  5LJ5 f;  5FU6 B;  2EQK A;  2GQV A;  2CSI A;  2QGF B;  2E5Q A;  2E5K A;  1WXB A;  1BI2 A;  2RJE A;  2DRM A;  1EZZ B;  1SPK A;  4MZP A;  3QYG B;  1PNJ A;  4Z02 A;  4ZGE B;  5EG2 A;  2J05 A;  1PSF A;  2RD1 A;  2VVK A;  1WXU A;  3CCR A;  2OTJ Q;  4K11 A;  3QKJ A;  4OMP A;  2HEQ A;  1D1A A;  2O9V A;  4PJM A;  1PRM C;  1RUW A;  4C5G A;  1KC8 U;  1ABQ A;  4J5Y A;  2FYK A;  3SDZ A;  3I55 T;  2IVW A;  3CC2 Q;  3BW1 A;  2M0Y A;  5CKD A;  2XMF A;  1VQN Q;  2DL7 A;  4D8K A;  3TEE A;  4DOW A;  4C92 F;  2CT4 A;  1X75 C;  2CP3 A;  1QVG S;  3CD6 T;  2D0Q B;  3GF5 A;  3FJ5 A;  3E9G A;  3LWI A;  4JZ4 A;  3G6E A;  2W0Z A;  1YJ9 A;  1KK7 A;  3VS2 A;  2FVU A;  2XDB A;  2AIR B;  3EFR A;  3LWH A;  2RQT A;  1WJQ A;  4EMK A;  2QA4 Q;  4HXJ A;  2O01 E;  1W4S A;  4BAC A;  4HT8 A;  1VQ6 A;  1BKB A;  4C8Q E;  1GCQ A;  1NYG A;  3ZL7 C;  1UGQ B;  3EFO B;  3SFM A;  3OYG A;  3CCJ T;  2KNB B;  5FRO A;  5GJV B;  2YLC A;  2LT1 A;  3VS7 A;  2J6K A;  1YJN Q;  2KI7 A;  2RNA A;  2LQN A;  2ENM A;  4EIK A;  4L59 A;  1CKB A;  4V2S A;  4N4I A;  4PJO G;  5J3B A;  2DER A;  2CP2 A;  1NE8 A;  4Y91 A;  2DF6 A;  4CC3 A;  1N9R A;  4A4H A;  1T0H A;  4FT4 A;  4E7Z A;  1PCX A;  1N6A A;  3KXT A;  3E19 A;  1M1K C;  2RN8 A;  1YWO A;  1U1T A;  2FRW A;  5GAO m;  2MWO A;  1N8R C;  3RIR A;  4E7J A;  4CI0 C;  3G7Z A;  3EGX B;  4C5E A;  1HD3 A;  3H0F A;  2R58 A;  1VQ4 A;  3JCM J;  1K9M R;  1IB8 A;  1JXM A;  5HK3 A;  3N5B B;  5L23 A;  2OI3 A;  4XTV A;  3QJ6 A;  3M9Q A;  3ER0 A;  5LJ5 g;  4HVV A;  2L0A A;  1K73 R;  1UGR B;  3REA B;  2VAS A;  1YJW A;  4O6J A;  4ELY C;  3M4G A;  3HL8 A;  3OYL A;  2C0O A;  3VYH B;  4M78 D;  1KQS P;  4FYW B;  5HK0 A;  2QXF A;  4J9E A;  3C12 A;  5CAI A;  4ZNX A;  1VQM A;  5GAN 5;  5GAN 6;  2EGC A;  4XTX A;  5HKC A;  2R5A A;  2KQW A;  3X24 B;  2WSC E;  4EMG A;  1FMW A;  1BB9 A;  2P0P A;  2IIM A;  4ESR A;  4HVW A;  1AZG B;  4C8Q G;  1IXD A;  1Y0M A;  2M1H A;  3CMA Q;  4X9D A;  2FG0 A;  2CYZ B;  4AFS C;  5GAN 4;  4ANJ A;  5I22 A;  3CPW S;  4J83 A;  4C8Q C;  2OTJ T;  1UB4 A;  3FC3 A;  2G3R A;  1D3B B;  1M1G A;  2V1Q A;  4RTU A;  5CR2 A;  3RKW A;  3H0H A;  2JN0 A;  1PSE A;  1YHQ T;  3S3M A;  1R77 A;  1VQ5 T;  4GLK A;  1YP5 A;  3NMZ C;  1WX6 A;  2CH4 W;  2VB6 A;  5FW9 A;  1V1C A;  4JS4 A;  2EAY A;  2L8D A;  4J8O A;  3IQL A;  2ZAE A;  1KHC A;  2KVQ G;  2QAS A;  1VQ5 Q;  2KT1 A;  2PUO B;  2CZ6 B;  2PVG B;  1M1F A;  4JLG A;  1WQW A;  2CP7 A;  2YUQ A;  1W2B P;  2DE0 X;  2K57 A;  4KGV B;  1GRI A;  4J6Y A;  1M90 C;  4Z8A A;  5LJ3 f;  5GAO q;  3VS0 A;  2KEA A;  1D1C A;  1Y71 A;  3JV3 A;  1K0X A;  4RCB A;  2QA4 A;  2DL8 A;  4II1 A;  1NJI U;  3EGD A;  3GLX A;  4QQG A;  4YTL A;  3GNG A;  4CRI A;  3S3N A;  2LDM A;  2ZPB B;  2RHX A;  3O5Z A;  2COY A;  3OYM A;  3Q1J A;  1UHC A;  4N4H A;  3L42 A;  3CCU Q;  3PIP A;  2DXT A;  5GAN 8;  3QZ5 B;  3M5A A;  2CP0 A;  2YHT A;  5CKF A;  4HCC A;  4OMF B;  5LJ3 g;  2PVD B;  4FM4 B;  1UE9 A;  3G71 T;  4A54 A;  5GAN d;  1GFC A;  2X9H A;  2X4Y A;  1GCQ C;  1G3T A;  4RCC A;  2O2O A;  4B9W A;  4M78 A;  1ABO A;  2QGG A;  4N4G A;  2VXE A;  1AZE A;  2BZX A;  2LJ0 A;  1WNL A;  1NLP C;  1PHT A;  1K9A A;  2DKG A;  2HSP A;  1IRE B;  4OVA A;  2GCX A;  1QMC A;  2DL4 A;  1ZUU A;  3OS0 A;  1H3H A;  1OV3 A;  1ARK A;  2HKN A;  2QQA A;  3QYH B;  2KMT A;  3VUZ A;  2CGH A;  1VQM T;  1IHW A;  1RAB B;  2GQI A;  3MPU B;  4L6V 5;  1KC8 C;  4M75 C;  1IRX A;  1JXO A;  4KH1 B;  5GAM f;  5FWB A;  1UUE A;  4M75 B;  3PNW C;  1BK2 A;  2E65 A;  3RKX A;  2OTL A;  5IHI A;  4AMC A;  1QVF P;  1VIE A;  2A08 A;  4M7D G;  2L3P A;  4E7K A;  1K73 C;  4E6R A;  3JCM g;  1SKU B;  3HHT B;  2NWM A;  5KYN A;  2B86 A;  4M75 A;  3OYI A;  5IH2 A;  4IIM A;  4IUV A;  2L3R A;  4C8Q F;  5A0G A;  2K79 A;  3CCR Q;  1OPL A;  1RI0 A;  2X35 A;  4KGZ B;  2XK0 A;  2FL7 A;  4KUD K;  3JB9 G;  2JMA A;  3M0P A;  2DTO A;  2ED1 A;  3VU3 C;  3HFN A;  3VS3 A;  3JCM V;  1GBQ A;  2V8I A;  3P8H A;  3FJP A;  3VYG A;  1VQ7 Q;  1I5L A;  4J9D A;  4JJB A;  1D0X A;  4BI8 B;  4BD3 A;  2RO0 A;  3SD4 A;  2Z0W A;  2J7I A;  2JS2 A;  4PJO E;  1K8A U;  3L2Z A;  3OQ5 A;  3JCM d;  1MUZ A;  2DX1 A;  2GNC A;  3TRE A;  4Z89 A;  4C5H A;  2LJ1 A;  2RF0 A;  2LCL A;  2EYQ A;  4X34 A;  4M7A G;  1YI2 Q;  1FMV A;  5D6Y A;  4ELZ C;  2RH2 A;  4RTV A;  2GGR A;  2JTF A;  1N5Z A;  3CPW P;  4IUT A;  2DXC A;  4ME7 A;  4M7D B;  4MZT A;  2FO0 A;  3FEO A;  3EHR A;  4NL2 A;  4BI4 A;  5GJW B;  2QDL A;  4JLI A;  2RQU A;  1QCN A;  3EH2 A;  2KYM A;  3G6E T;  2JZ2 A;  2OTJ A;  2LQW A;  1KFZ A;  1NG2 A;  3SWN A;  2JJ9 A;  1YNZ A;  1FYN A;  2KRN A;  3EG9 B;  2XI9 A;  2VWF A;  1WJR A;  3MEU A;  2LQ8 A;  3UA7 A;  4M7D E;  5KYY B;  4RTX A;  1KD1 R;  4F16 A;  1X6G A;  1Q95 G;  2J06 A;  2MF2 A;  3QG1 A;  1NZ9 A;  4F7U B;  4FYX B;  4J7I A;  2A7Y A;  2J6F A;  3CC7 A;  2F2X A;  4Z88 A;  2X3X D;  2DMO A;  3CBP A;  2CP5 A;  1A0N B;  2A36 A;  4M77 A;  5IHK A;  1MV3 A;  3CCL T;  1GXI E;  2EJF A;  4HCZ A;  2LT4 A;  4OB0 B;  4R56 A;  3C95 A;  4M75 D;  1ZQ1 A;  2EQI A;  3EG0 A;  3JB9 I;  3NTI A;  1NBE B;  5CQX A;  3RMS A;  1OQK A;  3P8B B;  2VXF A;  3CME T;  2MWP A;  3LH5 A;  2LTO A;  3JRZ A;  2JXB A;  3RBB B;  3OY9 A;  2NYS A;  2DVE A;  1RAI B;  5A0D A;  2QTX A;  3E1S A;  8ATC B;  4PFP A;  4F7U F;  3BDL A;  1MMN A;  3A8H B;  2CZ1 B;  4E7I A;  5GMK j;  4WTO B;  4C0D C;  2FPE A;  3RMQ A;  3MCA B;  2KXC A;  1HK9 A;  4OB2 B;  1PM3 A;  4PJN A;  1U5S A;  4MZM A;  2OAU A;  2RI3 A;  5GMK h;  2MYS A;  2VUB A;  3A1P A;  2K6D A;  3H0I A;  3VRZ A;  2ROL A;  4M7D F;  2DEQ A;  4FYY B;  2PQW A;  1QVG P;  3E2U A;  1Q81 R;  3HP9 A;  3CBM A;  1T3L A;  1PD0 A;  4M77 E;  1CKA A;  4FCY A;  2WSE E;  2O4X A;  4DQ2 A;  1UJ0 A;  1M3C A;  2OJ2 A;  3CCE A;  1BBZ A;  3P8D A;  1HYO A;  1RLQ C;  3PTA A;  1RL2 A;  1JBM A;  2WSF E;  1K9M C;  3EGX A;  2JS0 A;  2KY9 A;  3JCM Q;  2CT3 A;  2KSS A;  4LXC A;  2D6F A;  2M16 A;  4XU1 A;  2ABL A;  1W2B A;  2RMO A;  1YI2 A;  3JB9 F;  5J39 A;  3JCM f;  3CCL Q;  1IGQ A;  5LJ5 d;  4PJO B;  4M7A A;  2DD5 A;  1R8O B;  1VOM A;  1W1F A;  4C8Q B;  3JAM E;  1W2B S;  2M9U A;  2OTL T;  4J9I A;  1MMG A;  2NUT B;  3X28 B;  4XU3 A;  2X51 A;  1M5Q 1;  3MJX A;  3VS6 A;  4M77 G;  4KRT A;  1KQ1 A;  3GNF B;  1T3S A;  2DK3 A;  8AT1 B;  4MDX A;  5CVI A;  2E64 A;  1G83 A;  1YIT A;  1LJO A;  2RHU A;  4RTW A;  1TWB A;  2F5K A;  2X3W D;  3BY7 A;  2K3Y A;  2QG9 B;  2E3H A;  2ECZ A;  1N9S A;  4QW2 A;  4QVC A;  1M9S A;  2LRQ A;  4KUL A;  1AWX A;  1I8F A;  2QQB A;  4FT2 A;  3TU4 K;  3C0C A;  3A8G B;  3EGU A;  3C94 A;  5GAM d;  2RQV A;  1VQL A;  2YRC A;  3MKD A;  1K1Z A;  3HPW A;  1TU0 B;  3D7S B;  1M3B A;  1WI7 A;  4JRP A;  2JOY A;  3CXC S;  2AT1 B;  3MHX A;  3LW5 E;  3UAT A;  1MGQ A;  2OTL Q;  2QTV A;  2L3Q A;  3QBY A;  2DVJ A;  4GBQ A;  1UGP B;  2CSQ A;  3JB9 H;  2DPP B;  4PJL A;  3JCM W;  3HRT A;  1F1B B;  2DRK A;  1PG5 B;  1TTH B;  3OYY A;  5L8R E;  4PJO D;  1AOJ A;  1S72 Q;  2EYZ A;  1SRL A;  1G3Y A;  4BDY A;  1J3T A;  4P5N A;  1B7T A;  1QP3 A;  3PFS A;  1VYV A;  2EQJ A;  5CIU A;  1M8V A;  5CKH A;  5HY6 A;  3S6W A;  1SEM A;  4HA8 A;  3CD6 Q;  3PE0 A;  1YIT T;  2DNU A;  2FB7 A;  3EFS A;  2AHJ B;  2DJQ A;  4GY5 A;  3CCM T;  2DTI A;  1LPL A;  4A4F A;  3V7S A;  1AHJ B;  1WHL A;  3JCM h;  2O9S A;  2HDA A;  1QWE A;  2E70 A;  2NUZ A;  5IHN A;  1G5V A;  2ZPE B;  2BIV A;  4D8D A;  3KUF A;  4LN2 A;  1U1S A;  3FRN A;  1M1K U;  3R6O A;  3J7A F;  1VQO A;  2C06 A;  4JJC A;  5C0M A;  3A8M B;  4NL3 A;  2IPO B;  4F7U E;  1EFN A;  1KD1 C;  3GP8 A;  1VQO Q;  2EVR A;  3JCM e;  3OYC A;  2GFU A;  3DB3 A;  1MND A;  2YUN A;  2LJ3 A;  2KXD A;  3H9N A;  4DBH A;  2PTK A;  2RHI A;  2E4H A;  3OYB A;  1YIJ A;  1Q82 C;  2XID A;  3QJY A;  3G1J A;  1SSH A;  1VYT A;  5CKE A;  2LVM A;  2L89 A;  3FLG A;  4A63 B;  3CCM A;  3LYI A;  1Q82 R;  2RQR A;  5GMK e;  2K2M A;  2K3B A;  5FU7 C;  1EIF A;  2ZGW A;  1CSK A;  4CC7 A;  4ORZ A;  1M90 U;  2CKK A;  3A8O B;  4LNP A;  3M55 A;  4DBR A;  4F14 A;  4EMH A;  2L5Q A;  1UDL A;  1JRI A;  1NM7 A;  1VQ7 A;  5KYX B;  3UPU A;  2C0T A;  2LQK A;  4OMM A;  2BE7 D;  3J80 E;  1C0M A;  1RAE B;  1UGV A;  4KT0 E;  1K0S A;  5GMK i;  2X4J A;  1VQ9 A;  1QKX A;  4E7H A;  2B8A A;  1UG1 A;  2YRD A;  2JUF A;  1WHM A;  3T9N A;  1WLP B;  1KQS A;  2XHC A;  9ATC B;  2GTO A;  4LDY A;  1B34 A;  2DZ9 A;  2HMA A;  1HSQ A;  5J26 A;  1G3S A;  1QCF A;  2NUP A;  4OMN A;  5FU6 C;  2CZ0 B;  2F2W A;  4IUU A;  3M0R A;  2KK4 A;  3I56 Q;  1FWZ A;  5M9O A;  5GAN h;  3CXC P;  3V7R A;  2XG8 D;  1I5O B;  3CCU A;  3M54 A;  1OUL A;  2FEI A;  3CC4 A;  1NEG A;  2L2P A;  5KYW A;  3OYA A;  3CC2 A;  3H41 A;  2DFU A;  3NPF A;  1Q7Y C;  4AFQ C;  2JNG A;  1OU9 A;  5LJ3 h;  1H3Z A;  3PMT A;  3CC4 Q;  3M0T A;  4NS5 A;  2DL5 A;  6AT1 B;  3G6E Q;  4IIO A;  5GAN e;  5LL6 S;  3FIF A;  1AWO A;  1G3W A;  4C92 E;  4XK8 E;  4J9G A;  2LX7 A;  4ZN3 A;  1M8M A;  5KYY A;  1AD5 A;  1IO6 A;  3V7C A;  5IXF A;  1OOT A;  3NHN A;  1Y57 A;  2DIL A;  2PZ1 A;  1RAG B;  5EC7 A;  4BDZ A;  2R57 A;  1W70 A;  1WZO A;  2HD0 A;  1XNI A;  2GF7 A;  1ZA1 B;  1SSF A;  2SRC A;  5KCH A;  4C92 A;  1NJI C;  1KJW A;  3WVD B;  1VQ9 T;  4FIB A;  1QCO A;  4M75 G;  1VQP T;  2KRM A;  1UTI A;  4XQ3 A;  1RAD B;  4M7D C;  2QK0 A;  4C92 G;  1YJW Q;  2GBQ A;  3CCJ Q;  2BZY A;  2JMC A;  2EW3 A;  2HQX A;  4BUG A;  3L2R A;  2DXU A;  4M78 F;  1YIJ Q;  3CCQ A;  3UA6 A;  1G2B A;  3X20 B;  4M7D D;  2DIG A;  4XAX B;  3CCS Q;  1QWF A;  1YI2 T;  3OS2 A;  2FZK B;  1YJ9 Q;  1YIJ T;  2RK1 A;  1AT1 B;  2LZ6 B;  1VUB A;  2EJ9 A;  3OS1 A;  1D1B A;  4FU6 A;  1KG1 A;  1TXQ A;  4MDW A;  2CDT A;  5AYF A;  3S3O A;  3JSC A;  1ACM B;  3PVQ A;  1YJN T;  1R0B G;  1VA7 A;  2H3J A;  3CCR T;  2DBK A;  5GAM g;  1QVG A;  3HFO A;  2DYB A;  1QVP A;  2HNI A;  1I81 A;  1X2Q A;  3MP6 A;  3CCE T;  5D6X A;  3QDR B;  2MI6 A;  1YHQ A;  3H8Z A;  3CQT A;  4FSX A;  4JS5 A;  1KSW A;  3R6N A;  1S1N A;  1V76 A;  1NPP A;  5KE2 A;  5GAM j;  4RUG A;  3OSV A;  1VQM Q;  4A53 A;  4B6M A;  3DB4 A;  2I2L A;  2PUK B;  3E9F A;  4LUD A;  3MO8 A;  3VS4 A;  1LNX A;  1Q86 C;  3SWN B;  5CCA A;  3CCQ Q;  2KBT A;  3TVT A;  2H3E B;  4WCI A;  1YFN A;  2ZPI B;  3DLM A;  4IUQ A;  2VKN A;  3DLL A;  1Q81 U;  2M0O A;  5I11 A;  3G71 A;  3G4S A;  1UEC A;  1ZSZ C;  2EYX A;  1Q86 U;  4DA4 A;  1EX4 A;  3UT1 A;  1VQL T;  2HBW A;  2EQM A;  3X26 B;  5LJ5 j;  1QP2 A;  7AT1 B;  2YRV A;  1BCO A;  2L3S A;  2F2V A;  3OBW A;  2E6N A;  2MOX A;  1OU8 A;  4F17 A;  4BE0 A;  2E12 A;  3RDV A;  1S72 T;  3OYD A;  3EAE A;  2HAX A;  1DJ7 B;  2D9T A;  2EGA A;  2VGM A;  3MEA A;  3QXE B;  1OZ3 A;  2DA9 A;  1AVZ C;  3MET A;  2D1X A;  3CCV T;  2V8K A;  1VIF A;  2HL3 A;  2ZZD A;  4IUP A;  4HCK A;  3OBY A;  4M77 D;  3L2W A;  3G4S T;  3ZBD A;  4PJJ A;  2JM8 A;  1I4K 1;  1WGS A;  2RB6 A;  4M7A C;  1YWP A;  3KBG A;  3A98 A;  2MK5 A;  5A0L A;  2GFA A;  2HL5 C;  1VYU A;  1BYM A;  3CCL A;  2RHY A;  1K8A R;  5HCK A;  1N8R R;  1ZBX A;  4JRQ A;  1Z9Z A;  3TSZ A;  3X25 B;  5IT9 E;  1VQ6 T;  1LCK A;  4M78 C;  3SHW A;  1VQP Q;  1BI0 A;  4N0A A;  1WQ7 A;  4KBM B;  5A2Q E;  4DEY A;  3WXM B;  1M2V A;  4C0F A;  3ZFJ A;  3CPF A;  5KH6 A;  2QA4 T;  5FWC A;  5GAN j;  4LDX A;  2E3I A;  5GAO l;  5ECA A;  3OYH A;  3BDU A;  3JCM b;  2D8J A;  1MMA A;  1T0J A;  2F69 A;  5KE3 A;  3OS5 A;  1C1A A;  3L2Q A;  2K4Y A;  1X27 A;  3I35 A;  4JUV A;  3HRU A;  3CCQ T;  2HQH A;  2COZ A;  2KDS A;  1WPY A;  3ZEH A;  4C8Q D;  2HZY A;  4JPB W;  2VGN A;  3I55 Q;  4J9H A;  2C0I A;  1FX7 A;  2MAM A;  5KYW B;  2DXB A;  5GAO n;  1KD1 U;  4QT7 A;  2A0F B;  2LNH B;  1VQN T;  4M78 B;  1JO8 A;  4OF1 A;  1Q7Y U;  3CD6 A;  5FLX E;  2EFI A;  1ZUK A;  3PVL A;  1VQ4 T;  3MP1 A;  2KT8 A;  1P92 A;  1YN8 A;  2YUP A;  3THK A;  4AT1 B;  2KAF A;  3O8V A;  2ZCF B;  3I5R A;  2EJG A;  3FB9 A;  1KC8 R;  1SHG A;  3CCV A;  2LMJ A;  3I9Q A;  3M0S A;  3OYN A;  1XJW B;  4KGX B;  3RUX A;  4LDW A;  2HBP A;  2E10 A;  1ZX6 A;  4M7A E;  2G6F X;  4M7A D;  4M77 F;  2DL3 A;  3A8L B;  4XTW A;  2ZPF B;  4E2F B;  4BE2 A;  2RK2 A;  2LCS A;  3OYF A;  2EKO A;  3CME Q;  1JJ2 A;  3UF4 A;  4BY6 C;  4M77 C;  2QQ9 A;  1NPR A;  1GFD A;  3QHS A;  2P0Q A;  4BY6 B;  3LGF A;  1MMD A;  1IGU A;  2SEM A;  1BU1 A;  4XTU A;  5FRM A;  1RAF B;  2KYB A;  4Y28 E;  2EBP A;  1RI9 A;  4HT9 A;  1BCM A;  2XKO C;  1SRM A;  3KFV A;  4CC2 A;  1OYX A;  4X1V A;  3VRY A;  4E7S A;  4DBQ A;  3VV0 A;  3SWN C;  4ZTF A;  1X6B A;  4PFO A;  3EG2 A;  2EPD A;  3EGD B;  3M56 A;  4XU0 A;  3QSU A;  4C0Z A;  1TS9 A;  1M3A A;  2RHZ A;  1Q82 U;  2IG0 A;  1JJ2 P;  2QEX A;  4FW1 A;  3REB B;  3OW2 S;  1M90 R;  4PK4 A;  3TQ7 P;  2D8H A;  4RKU E;  4RMO A;  1TSF A;  4JRK A;  4R0K A;  4IKF A;  1Y07 A;  2AZV A;  4M75 E;  2V8J A;  3AHU A;  4AFU C;  3V8L A;  4RTZ A;  4Q5W A;  1YCY A;  3V8J A;  2FHD A;  2Y4Y A;  1ZBJ A;  1UGS B;  2AK5 A;  1FMK A;  3ASK A;  2HKQ B;  3F70 A;  3QWY A;  4N0A C;  2F1L A;  4AG2 C;  3A5Z B;  5CKB A;  3CCJ A;  4M7D A;  1ZA2 B;  2ZPG B;  1U06 A;  3EG3 A;  3M4Y A;  2JVV A;  1RAC B;  1RLP C;  2YDL A;  3M0U A;  3CC7 Q;  3RER A;  1KIK A;  1YIT Q;  1K9M U;  1Q81 C;  1SG5 A;  1Y96 A;  5LJ5 e;  3J81 E;  4NOY A;  5GAN g;  1NLO C;  1JEG A;  2FZG B;  2K2V A;  3CC7 T;  2M51 A;  4FL6 A;  3I55 A;  3AT1 B;  1WHJ A;  3QDF A;  4JZ3 A;  4BB7 A;  1PKT A;  4B9X A;  1VQ6 Q;  2NLU A;  1M27 C;  1M4Z A;  1WJS A;  1ZLM A;  2CRE A;  3UDC A;  5LJ5 h;  4ZTJ A;  2HSE B;  2FPF A;  1OZ2 A;  2F5T X;  3JB9 J;  1PC0 A;  1QLY A;  2E41 A;  4WF2 A;  3GOX A;  4J6X A;  1E7O A;  1GCP A;  3RR6 A;  3CCE Q;  4M7A B;  1TUC A;  3QUI A;  1Q86 R;  1VQ8 A;  4QKU A;  2RM4 A;  5KYU B;  3NTK A;  3C4S A;  1KQ2 A;  1FXX A;  2CUB A;  4JRI A;  1WYX A;  4GLM A;  1WHH A;  1YJN A;  2DLP A;  4RTY A;  4HCB A;  3CCV Q;  2JM9 A;  3BE3 A;  3CME A;  5IAY A;  4ATO A;  2XIC A;  1D0Z A;  4F7U G;  2OX7 A;  3SEM A;  2DAQ A;  5KYX A;  3FDR A;  3WVE B;  3OYK A;  1IZ6 A;  1KQS S;  5KCO A;  5GAO r;  4QQD A;  1D0Y A;  1BI1 A;  1H64 1;  1WA7 A;  2QQR A;  2DJZ A;  2KR3 A;  3TSW A;  2LX9 A;  2YXY A;  4RTT A;  3VKI A;  1JQQ A;  4XTZ A;  1X69 A;  3NFC A;  2XDP A;  1VQ4 Q;  2EGE A;  2P84 A;  4EDU A;  1PD1 A;  4X9C A;  3HTR A;  1OX8 A;  1WDX A;  4FSS A;  4C5I A;  1VQ9 Q;  1PRL C;  4RG2 A;  1C6V X;  1NEB A;  1QVF A;  1B07 A;  2D0N A;  1I1J A;  1I07 A;  4XTY A;  2BKD N;  4TVR A;  1N27 A;  2QEX Q;  4J9F A;  4VUB A;  5IXB A;  2LCC A;  5LJ3 j;  1IHV A;  3OA6 A;  3CC2 T;  2FRY A;  1BI3 A;  2MMP A;  2Y90 A;  3NTH A;  2FPD A;  1XOV A;  2QQS A;  1QVF S;  3QWX X;  3CCU T;  1K76 A;  2RA2 A;  1V29 B;  3PMI A;  4ZN1 A;  2K3X A;  5I2S A;  1WHG A;  2BUD A;  3OB9 A;  1M1K R;  1E6G A;  2V26 A;  3G71 Q;  2A37 A;  5CQY A;  3JCM X;  4O5V A;  3OW2 A;  2HCK A;  3I56 A;  4A4K A;  5CK9 A;  2RJD A;  2JTE A;  1N8R U;  1VQK A;  1UHF A;  2K5I A;  3MEW A;  5LJ3 d;  3L2V A;  1Q7Y R;  2ESW A;  2QYZ A;  4C8Q A;  1OPK A;  4PJO C;  1TG0 A;  1K8A C;  4M75 F;  2NUT A;  4PLL A;  3L1A A;  2ROT A;  3EFO A;  1LVK A;  4A4G A;  3CCS T;  4PJO F;  1SF9 A;  1YJ9 T;  2XDD A;  5GAN f;  1VQ7 T;  5KYU A;  2GTJ A;  1M30 A;  1GBR A;  2J6O A;  4MML A;  4BE1 A;  1TUD A;  2A28 A;  2DD4 A;  4EPC A;  4HVU A;  1X6O A;  3CPW A;  3INZ A;  2EKH A;  4CC4 B;  1TH7 A;  3M58 A;  2BE9 B;  3JCM c;  1QW1 A;  2DET A;  2AKK A;  2O31 A;  1MHN A;  2W10 A;  4J6W A;  1VQ8 Q;  3H6Z A;  5IN1 A;  2JT4 A;  4ZGJ B;  2KGT A;  1JB0 E;  1PWT A;  2YSQ A;  1VQP A;  2QI2 A;  3EH1 A;  4OP0 A;  3UWN A;  3PT9 A;  2KRS A;  2EQU A;  4XU2 A;  2XD0 A;  1B34 B;  1D09 B;  3U23 A;  1YCS B;  4QVZ A;  4LD9 K; 
#chains in the Genus database with same CATH homology
 4HVV A;  2L0A A;  4J9C A;  4J9I A;  3REA B;  3VS5 A;  4DEX A;  1VYU A;  1ZUY A;  2C0O A;  5HCK A;  3VS6 A;  2EYW A;  2V1R A;  4KRT A;  1OEB A;  4J9E A;  4ZNX A;  2ED0 A;  1Z9Z A;  3TSZ A;  1T3S A;  2EGC A;  2PNI A;  1G83 A;  1LCK A;  1BB9 A;  2IIM A;  1X2K A;  4RTW A;  4ESR A;  3SHW A;  2X3W D;  4HVW A;  1AZG B;  4DEY A;  4OMO A;  1UJY A;  2OAW A;  1Y0M A;  2ECZ A;  2FG0 A;  5FWC A;  4AFS C;  5I22 A;  2BZ8 A;  5ECA A;  2D8J A;  1T0J A;  1AWX A;  1QKW A;  4OML A;  2DBM A;  3C0C A;  2V1Q A;  3EGU A;  4RTU A;  1X27 A;  3I35 A;  3ULR B;  1K4U S;  2RQV A;  3H0H A;  1K1Z A;  1HJD A;  1YP5 A;  3NMZ C;  1WX6 A;  2CH4 A;  2CH4 W;  4JPB W;  4J9H A;  1M3B A;  1UFF A;  1WI7 A;  2C0I A;  5FW9 A;  1V1C A;  4QT7 A;  3IQL A;  4LUE A;  2LNH B;  3UAT A;  3RNJ A;  2CUD A;  2KT1 A;  1JO8 A;  1ZUK A;  2L3Q A;  1AWW A;  2DVJ A;  4GBQ A;  2YUQ A;  2CSQ A;  3PVL A;  2DE0 X;  1GRI A;  2K9G A;  2KT8 A;  1YN8 A;  2YUP A;  4Z8A A;  3THK A;  3VS0 A;  2KEA A;  2DRK A;  3JV3 A;  1K0X A;  2DL8 A;  1H8K A;  1AOJ A;  2EYZ A;  1SRL A;  3I5R A;  3EG1 A;  1E6H A;  1J3T A;  1SHG A;  3VS1 A;  2LMJ A;  4OMQ A;  1VYV A;  3I9Q A;  3M0S A;  3O5Z A;  1UHC A;  1SEM A;  2AZS A;  3PE0 A;  2H8H A;  1ZX6 A;  1GL5 A;  2DNU A;  2G6F X;  2BTT A;  2DL3 A;  2DJQ A;  2K7A A;  4AG1 C;  2JW4 A;  2LCS A;  1UE9 A;  2DM1 A;  3UF4 A;  2LP5 A;  4LE9 A;  2O9S A;  2HDA A;  1PKS A;  1GFC A;  1QWE A;  1GCQ C;  1GFD A;  2NUZ A;  5IHN A;  2O2O A;  1H92 A;  4D8D A;  1ABO A;  1BU1 A;  2SEM A;  4LN2 A;  2KYB A;  1AZE A;  2BZX A;  2EBP A;  1RI9 A;  2LJ0 A;  2HSP A;  1NLP C;  1PHT A;  1K9A A;  4JJC A;  4M4Z A;  1JU5 C;  1SRM A;  3KFV A;  4CC2 A;  1EFN A;  2DL4 A;  1ZUU A;  2EVR A;  4X1V A;  3VRY A;  1H3H A;  1OV3 A;  1ARK A;  1X6B A;  3GBQ A;  2YUN A;  3EG2 A;  2LJ3 A;  2KXD A;  2EPD A;  2PTK A;  2KE9 A;  1SSH A;  1VYT A;  2KRO A;  2GQI A;  1M3A A;  1MV0 B;  4A63 B;  1JXO A;  1I0C A;  1NYF A;  2YUO A;  5FWB A;  1UUE A;  1Z9Q A;  2RQR A;  2K2M A;  2K3B A;  1X43 A;  1CSK A;  4CC7 A;  4ORZ A;  1WFW A;  1BK2 A;  3REB B;  2O88 A;  2D8H A;  4LNP A;  5IHI A;  4F14 A;  4R0K A;  2MCN A;  2AZV A;  1UDL A;  2AKL A;  1NM7 A;  2A08 A;  4AFU C;  3NGP A;  2L3P A;  3EHQ A;  4RTZ A;  2C0T A;  4E6R A;  1ZBJ A;  4OMM A;  2AK5 A;  2NWM A;  1FMK A;  1UGV A;  2B86 A;  1K0S A;  3QWY A;  5IH2 A;  1SHF A;  4IIM A;  4AG2 C;  3I5S A;  2K79 A;  2YT6 A;  1U06 A;  3EG3 A;  1OPL A;  1WIE A;  1QKX A;  1ZSG A;  1RLP C;  2YDL A;  3M0U A;  1KIK A;  2JMA A;  3M0P A;  1UG1 A;  2ED1 A;  1AEY A;  2P4R A;  2RQW A;  3VS3 A;  4Y92 A;  1GBQ A;  1NLO C;  1WLP B;  1JEG A;  2GTO A;  4J9D A;  2M51 A;  1HSQ A;  1QCF A;  4JJB A;  4OMN A;  4JZ3 A;  1B3Q A;  1PKT A;  2J7I A;  2F2W A;  2JS2 A;  2EYY A;  3M0R A;  2RPN A;  1M27 C;  1MUZ A;  2DX1 A;  2GNC A;  4JJD A;  1ZLM A;  2CRE A;  4Z89 A;  4J9B A;  2LJ1 A;  2RF0 A;  2FPF A;  2FEI A;  1NEG A;  2L2P A;  1QLY A;  1W6X A;  1WXT A;  3H41 A;  3NPF A;  4AFQ C;  1AWJ A;  1E7O A;  1GCP A;  4RTV A;  3M0T A;  2MIO A;  2DL5 A;  2GGR A;  1TUC A;  1N5Z A;  4IIO A;  4AFZ C;  2I0N A;  2FO0 A;  3M0Q A;  3EHR A;  1AWO A;  1U3O A;  4J9G A;  5GJW B;  2QDL A;  2CUB A;  2LX7 A;  2RQU A;  1M8M A;  1WYX A;  4GLM A;  2KYM A;  1AD5 A;  1IO6 A;  5IXF A;  1OOT A;  2DLP A;  3NHN A;  4RTY A;  1Y57 A;  2DIL A;  2PZ1 A;  5EC7 A;  2LQW A;  1W70 A;  1KFZ A;  2JM9 A;  2CSI A;  1NG2 A;  1YNZ A;  2E5K A;  1FYN A;  2KRN A;  2SRC A;  2VWF A;  1KJW A;  1WXB A;  3UA7 A;  2DRM A;  4RTX A;  1SPK A;  3SEM A;  4F16 A;  1PNJ A;  1X6G A;  2J06 A;  2KRM A;  1UTI A;  2J6F A;  2J05 A;  2VVK A;  2F2X A;  1WA7 A;  4Z88 A;  1WXU A;  2X3X D;  2DMO A;  2GBQ A;  1A0N B;  2BZY A;  2KR3 A;  2A36 A;  5IHK A;  3TSW A;  1MV3 A;  2JMC A;  4K11 A;  2EW3 A;  4OMP A;  4RTT A;  1JQQ A;  2HEQ A;  1X69 A;  2O9V A;  1PRM C;  1RUW A;  2EGE A;  2EQI A;  3EG0 A;  1WDX A;  1ABQ A;  4FSS A;  1PRL C;  1G2B A;  3UA6 A;  1NEB A;  1B07 A;  2D0N A;  1QWF A;  1I1J A;  1I07 A;  2M0Y A;  2XMF A;  2LZ6 B;  4J9F A;  2DL7 A;  5IXB A;  3LH5 A;  4D8K A;  2JXB A;  2CT4 A;  2FRY A;  3RBB B;  2CDT A;  2FPD A;  1XOV A;  3QWX X;  3PVQ A;  3FJ5 A;  1K76 A;  4JZ4 A;  2W0Z A;  1VA7 A;  3VS2 A;  2DBK A;  2DYB A;  2FPE A;  1X2Q A;  2KXC A;  1E6G A;  2A37 A;  2RQT A;  1U5S A;  3CQT A;  2HCK A;  4HXJ A;  1KSW A;  3R6N A;  1S1N A;  4RUG A;  1GCQ A;  2JTE A;  1UHF A;  4LUD A;  1NYG A;  3ZL7 C;  3VS4 A;  2K6D A;  2KNB B;  3H0I A;  5GJV B;  3VRZ A;  2KBT A;  2ROL A;  3TVT A;  2ESW A;  4WCI A;  1OPK A;  3VS7 A;  2VKN A;  2J6K A;  1TG0 A;  5I11 A;  2RNA A;  1T3L A;  2ENM A;  2LQN A;  2ROT A;  4EIK A;  1UEC A;  1CKB A;  1CKA A;  2EYX A;  1UJ0 A;  2HBW A;  1M3C A;  2OJ2 A;  2L3S A;  1BBZ A;  2F2V A;  1RLQ C;  2MOX A;  2GTJ A;  1M30 A;  1GBR A;  2J6O A;  2DF6 A;  1TUD A;  2A28 A;  4CC3 A;  4F17 A;  1T0H A;  4HVU A;  2JS0 A;  2EKH A;  4CC4 B;  2CT3 A;  2AKK A;  2O31 A;  2RN8 A;  1YWO A;  2W10 A;  2FRW A;  2EGA A;  2JT4 A;  2KGT A;  1AVZ C;  2DA9 A;  2D1X A;  1PWT A;  2YSQ A;  2ABL A;  2RMO A;  4HCK A;  1HD3 A;  3H0F A;  2KRS A;  2JM8 A;  1JXM A;  5L23 A;  2OI3 A;  1W1F A;  3U23 A;  1YWP A;  1YCS B;  3A98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...