2DNUA

Solution structure of rsgi ruh-061, a sh3 domain from human
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
GSSGSSGEEKYVTVQPYTSQSKDEIGFEKGVTVEVIRKNLEGWWYIRYLGKEGWAPASYLKKAKDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-061, a SH3 domain from human
rcsb
source organism Homo sapiens
molecule tags Structural genomics, structural protein
molecule keywords SH3 multiple domains 1
total genus 7
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dnuA00
1UJYA 3M0QA 2RNAA 1UE9A 2EGAA 2KNBB 2GTOA 3C0CA 4J9IA 1M3BA 3FJ5A 2W10A 1K4US 5IH2A 1Y0MA 2A08A 1NEBA 3UA7A 5EC7A 1AZGB 5FWBA 2J6KA 3GBQA 2KRNA 2EVRA 1KIKA 1UFFA 1G2BA 2KXCA 2EPDA 2BTTA 1ABOA 1SRLA 1X6GA 2B86A 2KRSA 4J9CA 2BZYA 2JMCA 3M0RA 4RTTA 2O9VA 4RTZA 4X1VA 2LP5A 2YT6A 2D8HA 4RTWA 1VYUA 2CT3A 2EYXA 2K2MA 1MV0B 3VS3A 3NGPA 1I07A 2J7IA 1UUEA 2M51A 1X27A 1X69A 1VYVA 1NYGA 1PRMC 1ZUUA 2DRMA 1WFWA 4OMOA 3ZL7C 2A37A 2BZXA 2LNHB 1IO6A 1BU1A 4F14A 2AKLA 4Z89A 2F2VA 5IXBA 2ROLA 1WYXA 3VRZA 4OMLA 3I9QA 3UATA 2KT8A 2KBTA 4LE9A 2W0ZA 2JMAA 1M8MA 3EGUA 1MUZA 4ESRA 1AD5A 2O31A 2O2OA 1LCKA 2H8HA 3CQTA 1WXUA 1JXMA 2RN8A 2J6FA 2KYMA 2LJ0A 2KROA 2DL7A 3TVTA 2EYZA 3VS1A 1YCSB 4JPBW 3H0HA 2GNCA 1FYNA 2L0AA 2JW4A 1WA7A 1BB9A 2VKNA 5FWCA 1BK2A 1S1NA 1OEBA 2EQIA 1YWOA 2OAWA 1MV3A 1YN8A 1J3TA 2L3SA 1U5SA 2CH4A 2LQWA 3PVLA 4E6RA 3EHRA 4LUDA 2DA9A 2C0OA 2AK5A 1T3LA 3VRYA 1TUCA 2GQIA 5IHNA 1I0CA 2QDLA 4Z88A 5L23A 2RQTA 2DYBA 2K7AA 3VS5A 4OMNA 1Y57A 1PWTA 4ORZA 1AOJA 2YUPA 4OMMA 2K9GA 3M0UA 2EYYA 1SRMA 4J9HA 1RLPC 2K6DA 3I35A 2K79A 3R6NA 2D8JA 3RNJA 2JM9A 2G6FX 2AZVA 1W6XA 3VS0A 1GBRA 2DNUA 2JTEA 2EW3A 4JZ4A 2YSQA 1AZEA 2C0IA 1X43A 2DBMA 2RPNA 3NMZC 2DBKA 3UA6A 2YUNA 1JQQA 3H0FA 3UF4A 1M30A 1UGVA 2ABLA 1HD3A 5IHKA 4D8DA 2DF6A 2CDTA 4CC4B 1YWPA 2HCKA 1JO8A 1NG2A 2PZ1A 1NM7A 1UDLA 3U23A 3REBB 2P4RA 3VS6A 4OMQA 2A28A 1EFNA 4JJBA 4CC2A 1HJDA 2J6OA 1H92A 2RQUA 1ZX6A 3H41A 3VS2A 2EYWA 2LJ1A 1JXOA 1NEGA 4JZ3A 2RQVA 2SEMA 2FRYA 2KXDA 2OJ2A 1GCQC 1T3SA 4RUGA 2AZSA 4EIKA 1X2KA 2JT4A 1AWXA 5ECAA 4RTUA 4DEXA 2V1QA 2RF0A 1K1ZA 1ZLMA 1CKBA 4F17A 1ZUKA 2LJ3A 2EGCA 1V1CA 1JU5C 1RUWA 2DX1A 4AFZC 2DILA 4DEYA 3TSZA 2AKKA 2D0NA 3JV3A 2DL4A 1UHFA 2OI3A 1B3QA 4J9EA 3REAB 1X6BA 1KFZA 1FMKA 2LMJA 2J06A 1QKXA 1OPKA 2ED0A 4RTYA 1G83A 3SHWA 2GGRA 3H0IA 4FSSA 4LN2A 1PKTA 2ENMA 1T0JA 2PTKA 1U3OA 2I0NA 1RI9A 5GJWB 1T0HA 3EG1A 2EGEA 2ED1A 4IIOA 1CKAA 4Z8AA 3PE0A 2CUBA 1ZSGA 1W70A 1GFDA 1WIEA 3EG0A 2L3PA 3ULRB 2JS0A 1SSHA 2M0YA 1YP5A 2D1XA 1I1JA 2DJQA 4R0KA 2DLPA 2L2PA 2CREA 4J9BA 2FO0A 1UTIA 2ECZA 2PNIA 2EKHA 2DE0X 1BBZA 4HCKA 1QKWA 2BZ8A 4GBQA 5IHIA 1NLOC 1H3HA 1K76A 3LH5A 4F16A 2HBWA 2F2XA 2DL5A 4HXJA 2A36A 3EG3A 2JS2A 1WX6A 3A98A 2HSPA 2DM1A 1AWOA 1SPKA 2X3XD 5IXFA 1GL5A 4A63B 1E6GA 1AVZC 4CC7A 3I5SA 2DMOA 2EBPA 1QLYA 1AEYA 2RQRA 1AWWA 1KSWA 1UECA 2KE9A 5I11A 1X2QA 1PNJA 2HDAA 1UHCA 3O5ZA 1VA7A 2NWMA 1CSKA 2YDLA 2V1RA 4GLMA 2FRWA 2GTJA 5FW9A 3NHNA 2FPDA 4Y92A 4J9GA 1UJ0A 2FG0A 3NPFA 4CC3A 2YUQA 3IQLA 1Z9QA 3M0TA 1PRLC 1E6HA 2HEQA 1K0SA 1VYTA 2O9SA 2MCNA 1M3CA 2CT4A 1TG0A 2X3WD 1GFCA 4J9FA 1KJWA 4K11A 1ZBJA 2ESWA 1U06A 1XOVA 4WCIA 2SRCA 2DVJA 5I22A 4LNPA 1WDXA 2O88A 2FEIA 4AFUC 3QWXX 1W1FA 2KGTA 2VWFA 1QWFA 1PHTA 1GCQA 2LZ6B 2KEAA 1WI7A 1WXTA 2VVKA 2IIMA 3VS7A 3TSWA 2K3BA 2GBQA 3KFVA 1PKSA 1OOTA 2NUZA 1SHGA 1YNZA 1SEMA 4HVUA 2RMOA 2CSQA 1M27C 1NLPC 1HSQA 2KYBA 2ROTA 1N5ZA 2CUDA 2YUOA 1E7OA 2LQNA 2CSIA 5GJVB 3M0SA 3SEMA 2RQWA 4HVWA 1OPLA 4ZNXA 2JXBA 2J05A 2DL8A 4KRTA 1M3AA 4RTXA 1K9AA 1OV3A 3I5RA 2JM8A 2L3QA 1QWEA 3QWYA 1JEGA 2LCSA 4AFQC 3EHQA 1ZUYA 2DRKA 1RLQC 4RTVA 3PVQA 1ABQA 3RBBB 4AG2C 4JJCA 2KR3A 2CH4W 2FPEA 3EG2A 1A0NB 1ARKA 1Z9ZA 3THKA 2F2WA 4QT7A 1AWJA 3VS4A 1K0XA 4LUEA 4AG1C 2C0TA 2KRMA 4AFSC 4J9DA 2KT1A 4D8KA 3M0PA 1WLPB 1UG1A 1TUDA 1SHFA 2E5KA 1GBQA 1H8KA 2LX7A 1GCPA 1WXBA 1B07A 1NYFA 5HCKA 2MIOA 4IIMA 2DL3A 4OMPA 4M4ZA 1GRIA 4JJDA 2MOXA 2FPFA 4HVVA 2XMFA 1QCFA
chains in the Genus database with same CATH superfamily
4XTVA 5LJ5e 3M0QA 4M77E 3M4YA 4KH0B 1QP3A 2VGNA 1K4US 4HT9A 5IH2A 3JCMc 4A4FA 5EC7A 1IGQA 5FWBA 4PJOB 1M90R 2RJEA 3CC2Q 2EVRA 5CVIA 2JUFA 2KDSA 3CCRT 2EPDA 3G4SA 4R56A 2QQ9A 1D1BA 2JMCA 1LNXA 4Y91A 3M0RA 2LP5A 2YT6A 2CT3A 2EYXA 2DK3A 2ZPBB 1I07A 2M51A 3CPFA 2K57A 3CBOA 2QA4T 1D3BA 4YTLA 2RO0A 2I2LA 3HRSA 2DRMA 3CCVA 2A37A 1M9SA 1WHJA 1C0MA 2BZXA 3JCMe 4PJOE 3HKSA 2X4XA 2E41A 5FLXE 3I9QA 1TS9A 2QYZA 2LDMA 3QKJA 3OSSC 2R5MA 4KUIA 3UATA 4LE9A 3VKIA 3EGUA 3WVEB 4C8QA 4ESRA 5DLQE 2O31A 1RAEB 2E12A 3G6ET 1Q7YC 1VQ4Q 2KYMA 3LH0A 4C92A 4OGCA 1KD1R 3CCVT 3OMCA 3SWNB 3NTIA 2EYZA 3EFRA 3P8DA 1YCSB 4A4EA 3CCJA 2JW4A 2DXCA 3X24B 1BB9A 5GANh 2VKNA 2XIDA 3DKMA 5FWCA 4C92F 4P5NA 2EQIA 4DBHA 2E10A 4J6XA 2GCXA 4PLIA 3JCMh 2F5KA 4EMKA 2L3SA 2EQMA 2KSSA 2LQWA 3PVLA 3EHRA 2IVWA 4M7DB 4JRIA 1Y07A 1QQJA 2M02A 2GQIA 1Q81C 2QAZA 2XD0A 4E7SA 2K3XA 1W2BS 4OMNA 1VQKT 1QVGP 4JDSA 1AOJA 3N5BB 4WTOB 4OMMA 3T9NA 3M0UA 1IRXA 3QYHB 1SRMA 4J9HA 1RLPC 2MWOA 1VQOQ 1K9MR 4QQ6A 4LXCA 1O75A 3M5AA 5L8RE 5C6SA 4PFOA 5LJ5h 2JM9A 2G6FX 3CCET 2PUOB 4AT1B 3RIRA 2CS7A 1WJSA 2P0QA 4JZ4A 3GNFB 3A8GB 2C0IA 4B9WA 2RPNA 3NMZC 3PNWC 3UA6A 1PD0A 2O4XB 3CBPA 1QVGA 5CK9A 4D8DA 3QJYA 2RI3A 3G71T 1UDLA 3OW2S 4E47A 5EG2A 1H3ZA 4JLIA 1MHNA 4N0AC 3EGDA 4C92E 2LJ1A 1BI0A 4OF1A 3L42A 4PL6A 2KXDA 1YJWA 2AZSA 1NE8A 3OYBA 5FU7C 3CD6Q 3HSBA 5ECAA 4II1A 3KUFA 4RTUA 3OYMA 3SD4A 2V1QA 1ZHIA 1K1ZA 1ZLMA 5CQYA 4F17A 4MZTA 3KBGA 1V1CA 4AFZC 4DEYA 3JV3A 1VIEA 1B3QA 4PJMA 3S3NA 2RM4A 1KFZA 4RTYA 1G83A 2VUBA 3CPWS 3H0IA 1PKTA 2ENMA 1T0JA 1U3OA 1TOVA 4HCCA 2RA2A 1R0CB 1WHMA 2MF2A 2R58A 4M77D 4AMCA 1W70A 5GANj 5AYFA 1KD1U 3OS2A 3EG0A 4FCYA 3OYFA 3ULRB 4OB0B 3OS1A 1TWBA 2JS0A 1H641 2WACA 1SKUB 1D1AA 3P8BB 4C5EA 3M54A 1TH7A 1YP5A 3M53A 2DJQA 4LDYA 1R0BG 4MMLA 3CPWA 3CMEQ 5GMKe 1UGSB 1B7TA 2FO0A 4HA8A 4C0GA 2VB6A 1H3HA 3LH5A 2HBWA 2IG0A 3RMQA 3CC2A 2QTXA 2F2XA 2D6FA 1PSFA 1KC8R 2H3JA 4LDXA 2LT1A 3QBYA 5KYYB 3DLLA 3J80E 4BB7A 2HSPA 2DM1A 1AWOA 2X3XD 2WSFE 1RI0A 3JCMV 4JLGA 1OULA 1VQ5Q 2RB6A 3I5SA 4CRIA 1YHQQ 1K73C 2DMOA 3PTAA 2RQRA 3BFMA 1KSWA 2HQEA 4IKFA 2KE9A 1PNJA 1OX9A 2K5IA 3O5ZA 1VA7A 3HRUA 2DXBA 4GLMA 3DLMA 3G6EA 3M55A 4BE2A 3M57A 1QP2A 3JRZA 3A5ZB 3OS5A 2MWPA 2K2VA 5C0MA 4XU0A 8ATCB 1FMWA 1PRLC 5CKFA 3CCVQ 1YITQ 2QA4A 2VC8A 4PKCC 3CCJT 1YJNQ 1VQ8T 2MCNA 2O9SA 2CT4A 1KJWA 1G5VA 3L2UA 1M2VB 4M78D 2DVJA 4RKUE 5LL6S 1RAGB 2DERA 4A4HA 4NL3A 2ZPGB 3JB9J 1PHTA 1C1AA 3ZEHA 4ELZC 4C92C 5GAOn 3TQ7P 4JS4A 2VVKA 2QQRA 4F7UE 3VS7A 3TSWA 3GIBA 1AHJB 2EFIA 1K9MU 2GBQA 3KFVA 5GANe 1PKSA 1OOTA 2XICA 5LJ3d 2NUZA 1SHGA 2QA4Q 4HCBA 1SEMA 3CCMQ 5GAN5 4V2SA 1KK7A 1TXQA 4F04B 1M27C 3MEWA 2ROTA 2YWWA 4WF2A 1E7OA 5GJVB 3M0SA 4FYVB 1IZ6A 1OPLA 1M1FA 2YRCA 3CCUQ 4FM4B 1K9AA 1WHGA 4QQDA 2JM8A 5CCAA 3QWYA 4LDUA 4ZTFA 1ZUYA 1MGQA 3G7ZA 2OTLA 3C95A 4FW1A 2VASA 4RTVA 3S3MA 3PVQA 2FL7A 2DPPB 4F7UA 1ABQA 4AG2C 2XI9A 4JJCA 3FDRA 3EG2A 2HSEB 4PJOC 4LUEA 3SWNA 3CCLT 2C0TA 2L5QA 4AFSC 4KH1B 4DOVA 4D8KA 1UGRB 3H8ZA 4BACA 1I4K1 2LQKA 1WLPB 1WJQA 4L59A 6AT1B 1TTHB 2E5KA 2YLCA 3OBWA 1GCPA 5GANd 3CMET 5HCKA 2MIOA 3M58A 2FZCB 1PM3A 1GRIA 2XKOC 4JJDA 2MOXA 3PT9A 4QVCA 4E7IA 5J26A 1QCFA 4QVZA 4OP0A 3CMAT 5GAOm 4KUDK 2RNAA 2KNBB 2RD1A 2LCCA 3C0CA 4J9IA 1Y0MA 4J6WA 1NEBA 3LLRA 1M90C 2M0OA 1KIKA 3GLXA 1UFFA 2BE9B 4ZTJA 2BTTA 1Q81R 1KQSS 4LDWA 2GF7A 1BKBA 4RTZA 4X1VA 2D8HA 4RTWA 5GAN6 4BDZA 3HRTA 2XU8A 1UUEA 2ZPIB 4JJNK 2RJDA 1I81A 1WFWA 2DTIA 5IXBA 5KYXA 2WSEE 4OMLA 1WZOA 2DO3A 2HNIA 1NJIC 2W0ZA 4M78C 3MO8A 3LGFA 3TEEA 1WQWA 2O01E 5LJ3h 3JAME 1RAAB 4LDVA 1VQ7T 3OYGA 3CBMA 2C06A 2LCLA 1MMAA 4IUQA 1Q82C 2RHZA 3QIIA 3CXCP 2PUKB 3OYEA 2MI6A 3H0HA 3PMIA 2GNCA 1MNDA 4XK8E 3SFMA 3RERA 4IUPA 5D6WA 5I2SA 4PNOA 2OAWA 3OS0A 1MV3A 4FYWB 2PVOB 1YI2Q 5KYYA 1YJWQ 2LC4A 2DVEA 4E6RA 4IUVA 2DA9A 3I56T 3VRYA 1YBYA 4ZGEB 4M78G 4Z88A 1D0XA 3CCQA 2DYBA 1EZZB 4M77G 4FL6A 2K7AA 3VS5A 1YFNA 4DA4A 1Y57A 4ORZA 2K5FA 1XQHA 4FSXA 2QQAA 4PK4A 2X35A 1PG5B 1NJIR 3R6NA 2D8JA 1ZSZA 3RNJA 3QZ5B 3JSCA 2AZVA 3QJ6A 4BI3A 1GBRA 2DNUA 4C8QG 4N4HA 3HHTB 2HKQB 1OU8A 4C5HA 2XHCA 1D1CA 1X43A 2E3IA 1YI2A 1VQ9Q 1BI1A 3V7CA 1JQQA 4OB2B 3UF4A 1M30A 1HD3A 2PQWA 2DF6A 4CC4B 2HCKA 5CO7A 1JO8A 1OQKA 1NM7A 1YCYA 4X9CA 3G4SQ 3U23A 2F69A 3CCJQ 4OMQA 1G3TA 1LJOA 2ATCB 1VQPT 2D9TA 1HJDA 1IHWA 1H92A 2RQUA 2M16A 1ZX6A 3CXCS 3VS2A 3I55Q 5HY6A 5GAMj 4RCBA 2M1HA 3HFOA 2OJ2A 1GCQC 4RUGA 2CP7A 4EIKA 2LX9A 3JCMQ 3C4SA 2RH2A 5GAN2 4DEXA 1VQ8Q 3JB9H 1YITT 2CP0A 2QQSA 3ASKA 2LJ3A 3OYJA 2DEQA 1KQ1A 1RUWA 2X4YA 3TSZA 2AKKA 3MKDA 1S72Q 3REAB 1X6BA 2LMJA 2J06A 5KYUB 1OPKA 2ED0A 5GAMf 3ER0A 1Q95G 1YJ9Q 2GGRA 1UB4A 4LN2A 1VQOA 3META 4M78B 2FZGB 3UPUA 5GJWB 1K8AU 2RHXA 3EG1A 2DTOA 4HT8A 1PD1A 3E2UA 1ZSGA 4MDWA 1WJRA 3UWNA 1SSHA 2XDBA 1N6AA 1VUBA 1VQMA 4NOYA 3EFOA 3JCMP 3L2WA 4BE0A 2CREA 4KGZB 4HCKA 1KC8U 2BZ8A 4GBQA 5I21A 4PJOA 3FB9A 1OI1A 2A0FB 1K76A 4VUBA 5GMKh 3MCAB 2RJFA 4GY5A 4HXJA 2A36A 4X34A 3GF5A 1PCXA 1V29B 1DJ7B 2JS2A 5D6XA 4M7AB 1W2BP 3A98A 1X75C 4PJJA 4A63B 1AVZC 2E5QA 1OYXA 4FU6A 1EIFA 1VQMT 3QXEB 1N27A 2R57A 5GMKj 2A3LA 3L2VA 1UECA 1N8RU 5I11A 4EMKC 1X2QA 3MHXA 3TCJA 1UHCA 2QEXQ 2VXEA 2FRWA 3BDLA 2GTJA 5FW9A 4Y92A 3M4GA 3LYIA 4JRKA 5IN1A 1UJ0A 3NPFA 4J8OA 1RAHB 3M0TA 2NUPB 3RKWA 3QHSA 1VQKA 2HEQA 1K0SA 4J9FA 1P92A 1ZBJA 2ESWA 2P4TA 1XOVA 5LJ3g 3E19A 5I22A 3H9NA 2O88A 2FEIA 5KCOA 3FEOA 2IPOB 1M2OA 2L3RA 3JCMX 3GP8A 1GCQA 2JN0A 2WSCE 3MEVA 5J39A 1VQPQ 2Y4YA 2AHJB 2AT1B 3CC7Q 2JVVA 4HVUA 2RMOA 1RABB 1NLPC 1R77A 4X9DA 2YUOA 5FU7B 2LQNA 1KHIA 1JJ2S 2G3RA 2E70A 5GAMg 2ZAEA 4KRTA 1OV3A 2L3QA 1VQ5A 1YI2T 3EHQA 1ZSZC 5IT9E 2DXTA 2DRKA 1RLQC 4ANJA 3I56A 2QG9B 3RUXA 2V8IA 4D6WA 2KR3A 1VQKQ 2K3YA 4HKEA 1A0NB 2DJZA 1ARKA 2F2WA 1AWJA 1K0XA 4J6YA 1M8VA 2PU9B 1FX7A 2KT1A 3CC2T 1ZA2B 3A1PA 1UG1A 2YLBA 3CMEA 1SHFA 3MPUB 1WXBA 3A8MB 2Z0WA 3C12A 3GPLA 4IIMA 5KE2A 2XMFA 4B6MA 4C8QD 3EG9B 2M9UA 1VQLA 3FJPA 4M7AD 2DIQA 5LJ5j 1UE9A 2EGAA 1QMCA 2RHUA 3EGXB 1G8XA 2NLUA 5GAMd 2HQXA 2FVUA 1AZGB 4B9XA 1BCOA 1PC0A 4OMFB 3CC4Q 2KRNA 3V8LA 2DD5A 3G1JA 4F7UG 1SRLA 1BCMA 2KRSA 1VIFA 2BZYA 2O9VA 4BY6B 1VYUA 4FW2A 4N4IA 1MV0B 3NGPA 3QO3A 4F7UF 1X69A 1QVFA 1NYGA 1PRMC 1ZUUA 2CP2A 3JCMb 2KK4A 1TSFA 2EIFA 2LNHB 3I55A 1BU1A 4F14A 2AKLA 4Z89A 1ACMB 2F2VA 3RMSA 4PLLA 4M75E 1WYXA 5KCHA 3VRZA 2KT8A 4XTUA 4M77B 4E2FB 1VQNQ 2JMAA 4A53A 4RMOA 1M8MA 1LCKA 3QDFA 3CQTA 4EDUA 1WXUA 5GAOr 2J6FA 4M7DF 1TU0B 2LJ0A 4N0AA 3CCSA 1VQ6T 1KHCA 2KROA 1QVFS 2COYA 3A8HB 2Y4XA 1S72A 3TVTA 2NUTA 4E7ZA 4JPBW 1FYNA 3GNGA 4J5YA 2K5LA 3V8KA 4C8QF 3OYIA 3PFSA 1S1NA 1OEBA 2E6NA 2V8JA 1KG1A 2QDYB 1YWOA 4EPCA 3C94A 1J3TA 2EKOA 3LWIA 2X51A 1U5SA 2CH4A 4E7KA 4LUDA 4CI0C 2C0OA 3OW2P 1T3LA 3CCRA 3CCQQ 1TUCA 5IHNA 2QDLA 4XU1A 5L23A 3CCLQ 1Q86U 4DOWA 2RQTA 3MP1A 4ZGDB 1ZSZB 3L2ZA 3L2RA 1PWTA 2LQ8A 2K9GA 3WVDB 4M7AF 4PFZA 5LJ5f 2K6DA 2KMTA 2P0PA 3E9FA 1IB8A 3OQ5A 3VUBA 1B34B 3VS0A 1D09B 3E9GA 1O9SA 2EW3A 2JTEA 3R6OA 3CC4T 2DBKA 2GQVA 3O8VA 3UDCA 2FHDA 1Q86R 2YUNA 3A8OB 2ABLA 1QW1A 2CDTA 3X28B 2OTLT 1NG2A 1M4ZA 2DZ9A 4M7DG 3CPWP 5DLOA 3REBB 2MPXC 5J3BA 2A28A 2FYKA 1EFNA 3PGGA 4JJBA 3CCST 4OB1B 5HKCA 3CXCA 3S3OA 5M9OA 2QGFB 3H41A 2EYWA 2NYSA 4J7IA 1ZA1B 2DIGA 1JXOA 5LJ3j 1NEGA 2RQVA 5GAN8 2SEMA 4C92G 2E1HA 1JJ2A 1T3SA 1X2KA 2JT4A 3RKXA 2P84A 2HKNA 3PIPA 3PIOA 2RF0A 3EH2A 4NS5A 1VQ5T 1CKBA 4M75G 1ZUKA 4XU2A 4IUUA 1JU5C 2DX1A 4RG8A 3LW5E 4J7FA 2D0NA 2ZPEB 3NFCA 4PJOF 1I5LA 2DL4A 1R8OB 2CKKA 5FU6B 1UHFA 1W2BA 2OI3A 2BE7D 1Y7XA 1V76A 3I56Q 3CCSQ 1JJ2P 2EJ9A 2E4HA 2LVMA 3SHWA 4M7AC 2VGMA 1G3WA 1N8RR 1RI9A 1X6OA 3QUIA 3VYHB 3DB3A 1QVPA 1VQNA 2EGEA 2MYSA 2BUDA 2HL3A 5D6YA 4EMHA 3CCUT 1MMDA 1WHHA 1RAIB 4IIOA 5FRNA 3HFNA 1VQLT 5CQXA 1LVKA 3PE0A 2KI7A 1WIEA 4XTXA 5GAN7 4M77F 1XJWB 2X9HA 1IHVA 2QQBA 4KULA 5CAIA 1N9RA 3QYGB 2RK2A 2CZ1B 2D1XA 3FIFA 1I1JA 2DEUA 2OTLQ 2DLPA 2L2PA 3FC3A 4C0DB 1VQ4A 4J9BA 2PNIA 2HL5C 2EKHA 2MMPA 1BBZA 3ME9A 3A8LB 1NLOC 4C8QC 4F16A 1OZ3A 3F70A 2DL5A 5KYXB 2ZPHB 4PJOD 2ZGWA 1IGUA 4M75A 2EWNA 2B8AA 1M1GA 5LJ5g 4C0ZA 4CC7A 1Y96A 1BYMA 2L8DA 1NBEB 5GAN3 3CC7A 3P8HA 1QLYA 3QSUA 1AWWA 3M59A 4DBFA 1UGQB 1WHKA 2NUPA 2A7YA 4C0FA 2CP6A 2X4WA 1VQPA 4M7AA 2NWMA 2V1RA 2GFUA 7AT1B 3NHNA 2FPDA 3X26B 4GLKA 1D0ZA 4C0DC 4CC3A 1VOMA 2YUQA 3EG9A 3IQLA 2YHTA 1Z9QA 4M78E 3X25B 2Y90A 1YIJA 3LX7A 2CZ6B 2X3WD 1XNIA 1YHQT 4BD3A 4FYYB 4K11A 5CKBA 1U06A 4WCIA 5AT1B 3EFSA 1OZ2A 2HQHA 2RI5A 2DYIA 1YJNA 4AFUC 3QWXX 5GAMe 3QPHA 2BIVA 3OSVA 4XTYA 2KGTA 2VWFA 1JRIA 1QWFA 4IUTA 5LJ5d 5CR2A 3CMAA 4FYXB 1WI7A 4KGVB 1WXTA 1SG5A 1RACB 4FT2A 2EQUA 2XG8D 2E3HA 2IIMA 4XU3A 5GMKm 2K3BA 1MNEA 2KY9A 2DFUA 3EFOB 1VQOT 1YHQA 1YJ9T 4M77C 2YRVA 5DM7R 1Q86C 2KYBA 4RCCA 1N5ZA 5KYNA 1U8RA 2CUDA 4MZMA 2CP5A 1AT1B 5FRMA 2RQWA 4HCZA 2E6ZA 4ZNXA 2QEXT 3V7RA 5KYWB 1FWZA 2JXBA 1UEBA 1Q82R 2J05A 3MEUA 5CKEA 1M3AA 4RTXA 5GAOp 1OX8A 3RDVA 1JEGA 3TU4K 4AFQC 3BY7A 2ZCFB 5I2MA 3RR6A 3CC7T 5GMKi 2FPEA 3OW2A 1YITA 2QK0A 4M75B 3THKA 4QT7A 5A0DA 1VQ7A 3FRNA 3JB9D 4NL2A 2KRMA 2NUTB 2JJ9A 3EGDB 1VQ8A 2QGGA 1IREB 2XDPA 2EYQA 4BI8B 1NYFA 2VV5A 4IURA 1K9MC 2DL3A 4M4ZA 4N4GA 4M78A 2P0KA 2VYTA 4A54A 3CD6T 1GXIE 1K73R 3QDRB 1UJYA 1Q82U 1YJNT 2GTOA 1M3BA 3FJ5A 2W10A 2A08A 1I8FA 3OYDA 3UA7A 2J6KA 3GBQA 1M1KR 4PJNA 1G2BA 5FU6C 2KXCA 4R55A 1Q81U 1ABOA 1X6GA 4M7DD 2B86A 1M90U 3JCMW 4J9CA 1QVGS 3G4ST 1NZ9A 4RTTA 3G71Q 1MMGA 3OMGA 2K2MA 3OB9A 3VS3A 2LTOA 2J7IA 1VQMQ 1X27A 3JB9G 1VYVA 3QZ9B 4C92D 1ZQ1A 4BE1A 4OMOA 3ZL7C 1IO6A 3VU3C 1HYOA 2ROLA 2BKDN 3JB9F 3NTKA 2EJFA 1M5Q1 3VYGA 2KBTA 1M1KC 1YJWT 2RJCA 4BDYA 5LJ3f 3DB4A 2MK5A 5GAN4 2QI2A 1MUZA 1FMVA 2QTVA 2OAUA 1AD5A 3J7AF 4JRQA 1QCNA 2O2OA 1NJIU 2H8HA 4KGXB 1JXMA 1UGPB 2PVGB 2RN8A 3CCLA 3QG1A 5GANg 2LNVA 3MP8A 3E1SA 4QQGA 4DBQA 2DL7A 3CCRQ 4Q5WA 4M7DE 4MZPA 4QKUA 1LPLA 3VS1A 3V8JA 2LT4A 2L0AA 4TVRA 1BI3A 1WA7A 2JNGA 3M56A 4ZN3A 2V8KA 1XTDA 1K8AR 3INZA 4C92B 3OYLA 1BK2A 1MMNA 3G6EQ 3JCMg 4M7DA 1RAFB 1SF9A 4LD9K 3OBYA 2GFAA 3BW1A 1YN8A 3BDUA 4FT4A 5DY9A 5KYUA 1VQ9T 4MMKA 1BIBA 2AK5A 4LD6A 2L89A 3RKYA 1I0CA 4E7JA 4EMKB 3URGA 3OY9A 1K73U 2JOYA 2OTJA 3OA6A 4BUGA 2CP3A 2DXUA 2YUPA 5CIUA 2FB7A 1EX4A 2AIRB 2EYYA 2CZ7B 2HZYA 3I35A 1C6VX 1YIJT 4L5GA 2K79A 3WXMB 4ZN1A 3S6WA 1VQ9A 5GAOl 1W6XA 4C5IA 2D0QB 2YSQA 4EMGA 3CCEA 1AZEA 2OX7A 2EQKA 1X01A 1D0YA 2DBMA 1KD1C 3HP9A 1JB0E 5D7UA 4M75D 3H0FA 1KQ2A 1UGVA 4PJOG 3MEAA 5IHKA 4DBRA 4XTZA 1YWPA 1NPRA 2PZ1A 2DKGA 4M78F 3J81E 1PSEA 2P4RA 3VS6A 3SDZA 2ZPFB 2JTMA 4E7LA 4CC2A 2O4XA 1YJ9A 2J6OA 2YXYA 1B34A 3OYCA 1QCOA 4OVAA 1N9SA 1Y71A 4DQ2A 5GAOq 2HBPA 1SSFA 1TUGB 4JZ3A 2KAFA 5A0GA 3CCEQ 2FRYA 1ZBXA 1I5OB 4ATOA 4OB3B 3EAEA 1AWXA 2EQJA 4O5VA 3JCMf 2F5TX 2HAXA 3BE3A 4C8QE 2EGCA 3H6ZA 1RL2A 2DILA 1WPYA 1S72T 3D7SB 3V7SA 2OTJQ 2MAMA 2ZZDA 3OYNA 4J9EA 4Z02A 5HK0A 1FMKA 1HK9A 1QKXA 2E65A 2CGHA 2DETA 4XAXB 4FSSA 2FZKB 1N8RC 2PTKA 2I0NA 4M77A 3CCUA 1T0HA 4JRPA 5FROA 2JTFA 2ED1A 4BI4A 2YRDA 1CKAA 3UT1A 4Z8AA 4ZGJB 4M7DC 9ATCB 3I55T 2CUBA 1WNLA 1VQLQ 1GFDA 3OYYA 2DZCA 2L3PA 1LOJA 1KQSA 3FLGA 2H3EB 1Y96B 1WHLA 2M0YA 1VQ4T 2DAQA 3OYKA 2CZ0B 4R0KA 5KE3A 5HK3A 5KYWA 4QW2A 1UTIA 2ECZA 4A4KA 2DE0X 1QKWA 4QVDA 5IAYA 4E7HA 5IHIA 1WGSA 5GMKl 3KXTA 3EG3A 1KC8C 3ZFJA 3AHUA 1WX6A 2RK1A 3EH1A 4XQ3A 3Q1JA 1U1SA 4A4GA 1SPKA 5IXFA 1GL5A 1E6GA 3GOXA 1M2VA 4C8QB 2XK0A 2EBPA 4M7AE 1AEYA 1OU9A 2KVQG 4M75F 4F7UB 3MJXA 2HDAA 1K8AC 1CSKA 2YDLA 4KBMB 1QVFP 1G3SA 3G71A 1G3YA 2RHYA 4J9GA 4MDXA 4M75C 2FG0A 4L6V5 5CKHA 2E64A 3RESA 3EGXA 1RADB 1E6HA 2KQWA 3PMTA 4JUVA 1W4SA 2VXFA 4J83A 1VYTA 2LRQA 1M3CA 3CCMT 1TG0A 1GFCA 4PFPA 3CEYA 3LGLA 3VUZA 2SRCA 4LNPA 4O6JA 1WDXA 1F1BB 5A0LA 4FIBA 2XDDA 5GANf 1W1FA 8AT1B 2JZ2A 3L1AA 1U1TA 3X20B 3CC4A 2LZ6B 2KEAA 3OYAA 4XTWA 1BIAA 2DD4A 3LWHA 2R5AA 2QASA 3NTHA 3VJPA 3JCMJ 2F1LA 1VQ6Q 2COWA 4BY6C 4M7AG 2RI2A 1VQ7Q 1YIJQ 3SWNC 1YNZA 3JCMd 2CYZB 2RHIA 2CSQA 5GAMh 2HMAA 1VQNT 1HSQA 3MP6A 2QEXA 2CSIA 2PVDB 3SEMA 5LJ3e 4HVWA 3M9QA 3OYHA 2K4YA 4JS5A 2X4JA 2QXFA 3ZBDA 4ME7A 4KT0E 4UC4A 3VV0A 4RG2A 2DL8A 1M1KU 3I5RA 1QWEA 2LCSA 1KQSP 1JBMA 4PJLA 1FXXA 3AT1B 3RBBB 2CH4W 3SB2A 2COZA 1Z9ZA 3VS4A 2EAYA 4C5GA 2OTJT 4Y28E 4AG1C 3L2QA 1VQ6A 3HL8A 4J9DA 3M0PA 2V26A 3HTRA 3CCQT 2HD0A 1TUDA 3HPWA 4ELYC 5A2QE 5CKDA 1BI2A 3JB9I 1GBQA 1IXDA 1Q7YR 1H8KA 2LX7A 1WQ7A 1B07A 3CMAQ 2EJGA 4OMPA 3CD6A 1HXDA 3CCMA 4HVVA 2FPFA 1NPPA 3TREA 1D3BB 4OGEA 1Q7YU 5KH6A 2DTHA
chains in the Genus database with same CATH topology
1UJYA 3M0QA 2RNAA 1UE9A 2EGAA 2KNBB 2GTOA 3C0CA 4J9IA 1M3BA 3FJ5A 2W10A 1K4US 5IH2A 1Y0MA 2A08A 1NEBA 3UA7A 5EC7A 1AZGB 5FWBA 2J6KA 3GBQA 2KRNA 2EVRA 1KIKA 1UFFA 1G2BA 2KXCA 2EPDA 2BTTA 1ABOA 1SRLA 1X6GA 2B86A 2KRSA 4J9CA 2BZYA 2JMCA 3M0RA 4RTTA 2O9VA 4RTZA 4X1VA 2LP5A 2YT6A 2D8HA 4RTWA 1VYUA 2CT3A 2EYXA 2K2MA 1MV0B 3VS3A 3NGPA 1I07A 2J7IA 1UUEA 2M51A 1X27A 1X69A 1VYVA 1NYGA 1PRMC 1ZUUA 2DRMA 1WFWA 4OMOA 3ZL7C 2A37A 2BZXA 2LNHB 1IO6A 1BU1A 4F14A 2AKLA 4Z89A 2F2VA 5IXBA 2ROLA 1WYXA 3VRZA 4OMLA 3I9QA 3UATA 2KT8A 2KBTA 4LE9A 2W0ZA 2JMAA 1M8MA 3EGUA 1MUZA 4ESRA 1AD5A 2O31A 2O2OA 1LCKA 2H8HA 3CQTA 1WXUA 1JXMA 2RN8A 2J6FA 2KYMA 2LJ0A 2KROA 2DL7A 3TVTA 2EYZA 3VS1A 1YCSB 4JPBW 3H0HA 2GNCA 1FYNA 2L0AA 2JW4A 1WA7A 1BB9A 2VKNA 5FWCA 1BK2A 1S1NA 1OEBA 2EQIA 1YWOA 2OAWA 1MV3A 1YN8A 1J3TA 2L3SA 1U5SA 2CH4A 2LQWA 3PVLA 4E6RA 3EHRA 4LUDA 2DA9A 2C0OA 2AK5A 1T3LA 3VRYA 1TUCA 2GQIA 5IHNA 1I0CA 2QDLA 4Z88A 5L23A 2RQTA 2DYBA 2K7AA 3VS5A 4OMNA 1Y57A 1PWTA 4ORZA 1AOJA 2YUPA 4OMMA 2K9GA 3M0UA 2EYYA 1SRMA 4J9HA 1RLPC 2K6DA 3I35A 2K79A 3R6NA 2D8JA 3RNJA 2JM9A 2G6FX 2AZVA 1W6XA 3VS0A 1GBRA 2DNUA 2JTEA 2EW3A 4JZ4A 2YSQA 1AZEA 2C0IA 1X43A 2DBMA 2RPNA 3NMZC 2DBKA 3UA6A 2YUNA 1JQQA 3H0FA 3UF4A 1M30A 1UGVA 2ABLA 1HD3A 5IHKA 4D8DA 2DF6A 2CDTA 4CC4B 1YWPA 2HCKA 1JO8A 1NG2A 2PZ1A 1NM7A 1UDLA 3U23A 3REBB 2P4RA 3VS6A 4OMQA 2A28A 1EFNA 4JJBA 4CC2A 1HJDA 2J6OA 1H92A 2RQUA 1ZX6A 3H41A 3VS2A 2EYWA 2LJ1A 1JXOA 1NEGA 4JZ3A 2RQVA 2SEMA 2FRYA 2KXDA 2OJ2A 1GCQC 1T3SA 4RUGA 2AZSA 4EIKA 1X2KA 2JT4A 1AWXA 5ECAA 4RTUA 4DEXA 2V1QA 2RF0A 1K1ZA 1ZLMA 1CKBA 4F17A 1ZUKA 2LJ3A 2EGCA 1V1CA 1JU5C 1RUWA 2DX1A 4AFZC 2DILA 4DEYA 3TSZA 2AKKA 2D0NA 3JV3A 2DL4A 1UHFA 2OI3A 1B3QA 4J9EA 3REAB 1X6BA 1KFZA 1FMKA 2LMJA 2J06A 1QKXA 1OPKA 2ED0A 4RTYA 1G83A 3SHWA 2GGRA 3H0IA 4FSSA 4LN2A 1PKTA 2ENMA 1T0JA 2PTKA 1U3OA 2I0NA 1RI9A 5GJWB 1T0HA 3EG1A 2EGEA 2ED1A 4IIOA 1CKAA 4Z8AA 3PE0A 2CUBA 1ZSGA 1W70A 1GFDA 1WIEA 3EG0A 2L3PA 3ULRB 2JS0A 1SSHA 2M0YA 1YP5A 2D1XA 1I1JA 2DJQA 4R0KA 2DLPA 2L2PA 2CREA 4J9BA 2FO0A 1UTIA 2ECZA 2PNIA 2EKHA 2DE0X 1BBZA 4HCKA 1QKWA 2BZ8A 4GBQA 5IHIA 1NLOC 1H3HA 1K76A 3LH5A 4F16A 2HBWA 2F2XA 2DL5A 4HXJA 2A36A 3EG3A 2JS2A 1WX6A 3A98A 2HSPA 2DM1A 1AWOA 1SPKA 2X3XD 5IXFA 1GL5A 4A63B 1E6GA 1AVZC 4CC7A 3I5SA 2DMOA 2EBPA 1QLYA 1AEYA 2RQRA 1AWWA 1KSWA 1UECA 2KE9A 5I11A 1X2QA 1PNJA 2HDAA 1UHCA 3O5ZA 1VA7A 2NWMA 1CSKA 2YDLA 2V1RA 4GLMA 2FRWA 2GTJA 5FW9A 3NHNA 2FPDA 4Y92A 4J9GA 1UJ0A 2FG0A 3NPFA 4CC3A 2YUQA 3IQLA 1Z9QA 3M0TA 1PRLC 1E6HA 2HEQA 1K0SA 1VYTA 2O9SA 2MCNA 1M3CA 2CT4A 1TG0A 2X3WD 1GFCA 4J9FA 1KJWA 4K11A 1ZBJA 2ESWA 1U06A 1XOVA 4WCIA 2SRCA 2DVJA 5I22A 4LNPA 1WDXA 2O88A 2FEIA 4AFUC 3QWXX 1W1FA 2KGTA 2VWFA 1QWFA 1PHTA 1GCQA 2LZ6B 2KEAA 1WI7A 1WXTA 2VVKA 2IIMA 3VS7A 3TSWA 2K3BA 2GBQA 3KFVA 1PKSA 1OOTA 2NUZA 1SHGA 1YNZA 1SEMA 4HVUA 2RMOA 2CSQA 1M27C 1NLPC 1HSQA 2KYBA 2ROTA 1N5ZA 2CUDA 2YUOA 1E7OA 2LQNA 2CSIA 5GJVB 3M0SA 3SEMA 2RQWA 4HVWA 1OPLA 4ZNXA 2JXBA 2J05A 2DL8A 4KRTA 1M3AA 4RTXA 1K9AA 1OV3A 3I5RA 2JM8A 2L3QA 1QWEA 3QWYA 1JEGA 2LCSA 4AFQC 3EHQA 1ZUYA 2DRKA 1RLQC 4RTVA 3PVQA 1ABQA 3RBBB 4AG2C 4JJCA 2KR3A 2CH4W 2FPEA 3EG2A 1A0NB 1ARKA 1Z9ZA 3THKA 2F2WA 4QT7A 1AWJA 3VS4A 1K0XA 4LUEA 4AG1C 2C0TA 2KRMA 4AFSC 4J9DA 2KT1A 4D8KA 3M0PA 1WLPB 1UG1A 1TUDA 1SHFA 2E5KA 1GBQA 1H8KA 2LX7A 1GCPA 1WXBA 1B07A 1NYFA 5HCKA 2MIOA 4IIMA 2DL3A 4OMPA 4M4ZA 1GRIA 4JJDA 2MOXA 2FPFA 4HVVA 2XMFA 1QCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJY A;  3M0Q A;  2RNA A;  1UE9 A;  2EGA A;  2KNB B;  2GTO A;  3C0C A;  4J9I A;  1M3B A;  3FJ5 A;  2W10 A;  1K4U S;  5IH2 A;  1Y0M A;  2A08 A;  1NEB A;  3UA7 A;  5EC7 A;  1AZG B;  5FWB A;  2J6K A;  3GBQ A;  2KRN A;  2EVR A;  1KIK A;  1UFF A;  1G2B A;  2KXC A;  2EPD A;  2BTT A;  1ABO A;  1SRL A;  1X6G A;  2B86 A;  2KRS A;  4J9C A;  2BZY A;  2JMC A;  3M0R A;  4RTT A;  2O9V A;  4RTZ A;  4X1V A;  2LP5 A;  2YT6 A;  2D8H A;  4RTW A;  1VYU A;  2CT3 A;  2EYX A;  2K2M A;  1MV0 B;  3VS3 A;  3NGP A;  1I07 A;  2J7I A;  1UUE A;  2M51 A;  1X27 A;  1X69 A;  1VYV A;  1NYG A;  1PRM C;  1ZUU A;  2DRM A;  1WFW A;  4OMO A;  3ZL7 C;  2A37 A;  2BZX A;  2LNH B;  1IO6 A;  1BU1 A;  4F14 A;  2AKL A;  4Z89 A;  2F2V A;  5IXB A;  2ROL A;  1WYX A;  3VRZ A;  4OML A;  3I9Q A;  3UAT A;  2KT8 A;  2KBT A;  4LE9 A;  2W0Z A;  2JMA A;  1M8M A;  3EGU A;  1MUZ A;  4ESR A;  1AD5 A;  2O31 A;  2O2O A;  1LCK A;  2H8H A;  3CQT A;  1WXU A;  1JXM A;  2RN8 A;  2J6F A;  2KYM A;  2LJ0 A;  2KRO A;  2DL7 A;  3TVT A;  2EYZ A;  3VS1 A;  1YCS B;  4JPB W;  3H0H A;  2GNC A;  1FYN A;  2L0A A;  2JW4 A;  1WA7 A;  1BB9 A;  2VKN A;  5FWC A;  1BK2 A;  1S1N A;  1OEB A;  2EQI A;  1YWO A;  2OAW A;  1MV3 A;  1YN8 A;  1J3T A;  2L3S A;  1U5S A;  2CH4 A;  2LQW A;  3PVL A;  4E6R A;  3EHR A;  4LUD A;  2DA9 A;  2C0O A;  2AK5 A;  1T3L A;  3VRY A;  1TUC A;  2GQI A;  5IHN A;  1I0C A;  2QDL A;  4Z88 A;  5L23 A;  2RQT A;  2DYB A;  2K7A A;  3VS5 A;  4OMN A;  1Y57 A;  1PWT A;  4ORZ A;  1AOJ A;  2YUP A;  4OMM A;  2K9G A;  3M0U A;  2EYY A;  1SRM A;  4J9H A;  1RLP C;  2K6D A;  3I35 A;  2K79 A;  3R6N A;  2D8J A;  3RNJ A;  2JM9 A;  2G6F X;  2AZV A;  1W6X A;  3VS0 A;  1GBR A;  2DNU A;  2JTE A;  2EW3 A;  4JZ4 A;  2YSQ A;  1AZE A;  2C0I A;  1X43 A;  2DBM A;  2RPN A;  3NMZ C;  2DBK A;  3UA6 A;  2YUN A;  1JQQ A;  3H0F A;  3UF4 A;  1M30 A;  1UGV A;  2ABL A;  1HD3 A;  5IHK A;  4D8D A;  2DF6 A;  2CDT A;  4CC4 B;  1YWP A;  2HCK A;  1JO8 A;  1NG2 A;  2PZ1 A;  1NM7 A;  1UDL A;  3U23 A;  3REB B;  2P4R A;  3VS6 A;  4OMQ A;  2A28 A;  1EFN A;  4JJB A;  4CC2 A;  1HJD A;  2J6O A;  1H92 A;  2RQU A;  1ZX6 A;  3H41 A;  3VS2 A;  2EYW A;  2LJ1 A;  1JXO A;  1NEG A;  4JZ3 A;  2RQV A;  2SEM A;  2FRY A;  2KXD A;  2OJ2 A;  1GCQ C;  1T3S A;  4RUG A;  2AZS A;  4EIK A;  1X2K A;  2JT4 A;  1AWX A;  5ECA A;  4RTU A;  4DEX A;  2V1Q A;  2RF0 A;  1K1Z A;  1ZLM A;  1CKB A;  4F17 A;  1ZUK A;  2LJ3 A;  2EGC A;  1V1C A;  1JU5 C;  1RUW A;  2DX1 A;  4AFZ C;  2DIL A;  4DEY A;  3TSZ A;  2AKK A;  2D0N A;  3JV3 A;  2DL4 A;  1UHF A;  2OI3 A;  1B3Q A;  4J9E A;  3REA B;  1X6B A;  1KFZ A;  1FMK A;  2LMJ A;  2J06 A;  1QKX A;  1OPK A;  2ED0 A;  4RTY A;  1G83 A;  3SHW A;  2GGR A;  3H0I A;  4FSS A;  4LN2 A;  1PKT A;  2ENM A;  1T0J A;  2PTK A;  1U3O A;  2I0N A;  1RI9 A;  5GJW B;  1T0H A;  3EG1 A;  2EGE A;  2ED1 A;  4IIO A;  1CKA A;  4Z8A A;  3PE0 A;  2CUB A;  1ZSG A;  1W70 A;  1GFD A;  1WIE A;  3EG0 A;  2L3P A;  3ULR B;  2JS0 A;  1SSH A;  2M0Y A;  1YP5 A;  2D1X A;  1I1J A;  2DJQ A;  4R0K A;  2DLP A;  2L2P A;  2CRE A;  4J9B A;  2FO0 A;  1UTI A;  2ECZ A;  2PNI A;  2EKH A;  2DE0 X;  1BBZ A;  4HCK A;  1QKW A;  2BZ8 A;  4GBQ A;  5IHI A;  1NLO C;  1H3H A;  1K76 A;  3LH5 A;  4F16 A;  2HBW A;  2F2X A;  2DL5 A;  4HXJ A;  2A36 A;  3EG3 A;  2JS2 A;  1WX6 A;  3A98 A;  2HSP A;  2DM1 A;  1AWO A;  1SPK A;  2X3X D;  5IXF A;  1GL5 A;  4A63 B;  1E6G A;  1AVZ C;  4CC7 A;  3I5S A;  2DMO A;  2EBP A;  1QLY A;  1AEY A;  2RQR A;  1AWW A;  1KSW A;  1UEC A;  2KE9 A;  5I11 A;  1X2Q A;  1PNJ A;  2HDA A;  1UHC A;  3O5Z A;  1VA7 A;  2NWM A;  1CSK A;  2YDL A;  2V1R A;  4GLM A;  2FRW A;  2GTJ A;  5FW9 A;  3NHN A;  2FPD A;  4Y92 A;  4J9G A;  1UJ0 A;  2FG0 A;  3NPF A;  4CC3 A;  2YUQ A;  3IQL A;  1Z9Q A;  3M0T A;  1PRL C;  1E6H A;  2HEQ A;  1K0S A;  1VYT A;  2O9S A;  2MCN A;  1M3C A;  2CT4 A;  1TG0 A;  2X3W D;  1GFC A;  4J9F A;  1KJW A;  4K11 A;  1ZBJ A;  2ESW A;  1U06 A;  1XOV A;  4WCI A;  2SRC A;  2DVJ A;  5I22 A;  4LNP A;  1WDX A;  2O88 A;  2FEI A;  4AFU C;  3QWX X;  1W1F A;  2KGT A;  2VWF A;  1QWF A;  1PHT A;  1GCQ A;  2LZ6 B;  2KEA A;  1WI7 A;  1WXT A;  2VVK A;  2IIM A;  3VS7 A;  3TSW A;  2K3B A;  2GBQ A;  3KFV A;  1PKS A;  1OOT A;  2NUZ A;  1SHG A;  1YNZ A;  1SEM A;  4HVU A;  2RMO A;  2CSQ A;  1M27 C;  1NLP C;  1HSQ A;  2KYB A;  2ROT A;  1N5Z A;  2CUD A;  2YUO A;  1E7O A;  2LQN A;  2CSI A;  5GJV B;  3M0S A;  3SEM A;  2RQW A;  4HVW A;  1OPL A;  4ZNX A;  2JXB A;  2J05 A;  2DL8 A;  4KRT A;  1M3A A;  4RTX A;  1K9A A;  1OV3 A;  3I5R A;  2JM8 A;  2L3Q A;  1QWE A;  3QWY A;  1JEG A;  2LCS A;  4AFQ C;  3EHQ A;  1ZUY A;  2DRK A;  1RLQ C;  4RTV A;  3PVQ A;  1ABQ A;  3RBB B;  4AG2 C;  4JJC A;  2KR3 A;  2CH4 W;  2FPE A;  3EG2 A;  1A0N B;  1ARK A;  1Z9Z A;  3THK A;  2F2W A;  4QT7 A;  1AWJ A;  3VS4 A;  1K0X A;  4LUE A;  4AG1 C;  2C0T A;  2KRM A;  4AFS C;  4J9D A;  2KT1 A;  4D8K A;  3M0P A;  1WLP B;  1UG1 A;  1TUD A;  1SHF A;  2E5K A;  1GBQ A;  1H8K A;  2LX7 A;  1GCP A;  1WXB A;  1B07 A;  1NYF A;  5HCK A;  2MIO A;  4IIM A;  2DL3 A;  4OMP A;  4M4Z A;  1GRI A;  4JJD A;  2MOX A;  2FPF A;  4HVV A;  2XMF A;  1QCF A; 
#chains in the Genus database with same CATH topology
 4XTV A;  5LJ5 e;  3M0Q A;  4M77 E;  3M4Y A;  4KH0 B;  1QP3 A;  2VGN A;  1K4U S;  4HT9 A;  5IH2 A;  3JCM c;  4A4F A;  5EC7 A;  1IGQ A;  5FWB A;  4PJO B;  1M90 R;  2RJE A;  3CC2 Q;  2EVR A;  5CVI A;  2JUF A;  2KDS A;  3CCR T;  2EPD A;  3G4S A;  4R56 A;  2QQ9 A;  1D1B A;  2JMC A;  1LNX A;  4Y91 A;  3M0R A;  2LP5 A;  2YT6 A;  2CT3 A;  2EYX A;  2DK3 A;  2ZPB B;  1I07 A;  2M51 A;  3CPF A;  2K57 A;  3CBO A;  2QA4 T;  1D3B A;  4YTL A;  2RO0 A;  2I2L A;  3HRS A;  2DRM A;  3CCV A;  2A37 A;  1M9S A;  1WHJ A;  1C0M A;  2BZX A;  3JCM e;  4PJO E;  3HKS A;  2X4X A;  2E41 A;  5FLX E;  3I9Q A;  1TS9 A;  2QYZ A;  2LDM A;  3QKJ A;  3OSS C;  2R5M A;  4KUI A;  3UAT A;  4LE9 A;  3VKI A;  3EGU A;  3WVE B;  4C8Q A;  4ESR A;  5DLQ E;  2O31 A;  1RAE B;  2E12 A;  3G6E T;  1Q7Y C;  1VQ4 Q;  2KYM A;  3LH0 A;  4C92 A;  4OGC A;  1KD1 R;  3CCV T;  3OMC A;  3SWN B;  3NTI A;  2EYZ A;  3EFR A;  3P8D A;  1YCS B;  4A4E A;  3CCJ A;  2JW4 A;  2DXC A;  3X24 B;  1BB9 A;  5GAN h;  2VKN A;  2XID A;  3DKM A;  5FWC A;  4C92 F;  4P5N A;  2EQI A;  4DBH A;  2E10 A;  4J6X A;  2GCX A;  4PLI A;  3JCM h;  2F5K A;  4EMK A;  2L3S A;  2EQM A;  2KSS A;  2LQW A;  3PVL A;  3EHR A;  2IVW A;  4M7D B;  4JRI A;  1Y07 A;  1QQJ A;  2M02 A;  2GQI A;  1Q81 C;  2QAZ A;  2XD0 A;  4E7S A;  2K3X A;  1W2B S;  4OMN A;  1VQK T;  1QVG P;  4JDS A;  1AOJ A;  3N5B B;  4WTO B;  4OMM A;  3T9N A;  3M0U A;  1IRX A;  3QYH B;  1SRM A;  4J9H A;  1RLP C;  2MWO A;  1VQO Q;  1K9M R;  4QQ6 A;  4LXC A;  1O75 A;  3M5A A;  5L8R E;  5C6S A;  4PFO A;  5LJ5 h;  2JM9 A;  2G6F X;  3CCE T;  2PUO B;  4AT1 B;  3RIR A;  2CS7 A;  1WJS A;  2P0Q A;  4JZ4 A;  3GNF B;  3A8G B;  2C0I A;  4B9W A;  2RPN A;  3NMZ C;  3PNW C;  3UA6 A;  1PD0 A;  2O4X B;  3CBP A;  1QVG A;  5CK9 A;  4D8D A;  3QJY A;  2RI3 A;  3G71 T;  1UDL A;  3OW2 S;  4E47 A;  5EG2 A;  1H3Z A;  4JLI A;  1MHN A;  4N0A C;  3EGD A;  4C92 E;  2LJ1 A;  1BI0 A;  4OF1 A;  3L42 A;  4PL6 A;  2KXD A;  1YJW A;  2AZS A;  1NE8 A;  3OYB A;  5FU7 C;  3CD6 Q;  3HSB A;  5ECA A;  4II1 A;  3KUF A;  4RTU A;  3OYM A;  3SD4 A;  2V1Q A;  1ZHI A;  1K1Z A;  1ZLM A;  5CQY A;  4F17 A;  4MZT A;  3KBG A;  1V1C A;  4AFZ C;  4DEY A;  3JV3 A;  1VIE A;  1B3Q A;  4PJM A;  3S3N A;  2RM4 A;  1KFZ A;  4RTY A;  1G83 A;  2VUB A;  3CPW S;  3H0I A;  1PKT A;  2ENM A;  1T0J A;  1U3O A;  1TOV A;  4HCC A;  2RA2 A;  1R0C B;  1WHM A;  2MF2 A;  2R58 A;  4M77 D;  4AMC A;  1W70 A;  5GAN j;  5AYF A;  1KD1 U;  3OS2 A;  3EG0 A;  4FCY A;  3OYF A;  3ULR B;  4OB0 B;  3OS1 A;  1TWB A;  2JS0 A;  1H64 1;  2WAC A;  1SKU B;  1D1A A;  3P8B B;  4C5E A;  3M54 A;  1TH7 A;  1YP5 A;  3M53 A;  2DJQ A;  4LDY A;  1R0B G;  4MML A;  3CPW A;  3CME Q;  5GMK e;  1UGS B;  1B7T A;  2FO0 A;  4HA8 A;  4C0G A;  2VB6 A;  1H3H A;  3LH5 A;  2HBW A;  2IG0 A;  3RMQ A;  3CC2 A;  2QTX A;  2F2X A;  2D6F A;  1PSF A;  1KC8 R;  2H3J A;  4LDX A;  2LT1 A;  3QBY A;  5KYY B;  3DLL A;  3J80 E;  4BB7 A;  2HSP A;  2DM1 A;  1AWO A;  2X3X D;  2WSF E;  1RI0 A;  3JCM V;  4JLG A;  1OUL A;  1VQ5 Q;  2RB6 A;  3I5S A;  4CRI A;  1YHQ Q;  1K73 C;  2DMO A;  3PTA A;  2RQR A;  3BFM A;  1KSW A;  2HQE A;  4IKF A;  2KE9 A;  1PNJ A;  1OX9 A;  2K5I A;  3O5Z A;  1VA7 A;  3HRU A;  2DXB A;  4GLM A;  3DLM A;  3G6E A;  3M55 A;  4BE2 A;  3M57 A;  1QP2 A;  3JRZ A;  3A5Z B;  3OS5 A;  2MWP A;  2K2V A;  5C0M A;  4XU0 A;  8ATC B;  1FMW A;  1PRL C;  5CKF A;  3CCV Q;  1YIT Q;  2QA4 A;  2VC8 A;  4PKC C;  3CCJ T;  1YJN Q;  1VQ8 T;  2MCN A;  2O9S A;  2CT4 A;  1KJW A;  1G5V A;  3L2U A;  1M2V B;  4M78 D;  2DVJ A;  4RKU E;  5LL6 S;  1RAG B;  2DER A;  4A4H A;  4NL3 A;  2ZPG B;  3JB9 J;  1PHT A;  1C1A A;  3ZEH A;  4ELZ C;  4C92 C;  5GAO n;  3TQ7 P;  4JS4 A;  2VVK A;  2QQR A;  4F7U E;  3VS7 A;  3TSW A;  3GIB A;  1AHJ B;  2EFI A;  1K9M U;  2GBQ A;  3KFV A;  5GAN e;  1PKS A;  1OOT A;  2XIC A;  5LJ3 d;  2NUZ A;  1SHG A;  2QA4 Q;  4HCB A;  1SEM A;  3CCM Q;  5GAN 5;  4V2S A;  1KK7 A;  1TXQ A;  4F04 B;  1M27 C;  3MEW A;  2ROT A;  2YWW A;  4WF2 A;  1E7O A;  5GJV B;  3M0S A;  4FYV B;  1IZ6 A;  1OPL A;  1M1F A;  2YRC A;  3CCU Q;  4FM4 B;  1K9A A;  1WHG A;  4QQD A;  2JM8 A;  5CCA A;  3QWY A;  4LDU A;  4ZTF A;  1ZUY A;  1MGQ A;  3G7Z A;  2OTL A;  3C95 A;  4FW1 A;  2VAS A;  4RTV A;  3S3M A;  3PVQ A;  2FL7 A;  2DPP B;  4F7U A;  1ABQ A;  4AG2 C;  2XI9 A;  4JJC A;  3FDR A;  3EG2 A;  2HSE B;  4PJO C;  4LUE A;  3SWN A;  3CCL T;  2C0T A;  2L5Q A;  4AFS C;  4KH1 B;  4DOV A;  4D8K A;  1UGR B;  3H8Z A;  4BAC A;  1I4K 1;  2LQK A;  1WLP B;  1WJQ A;  4L59 A;  6AT1 B;  1TTH B;  2E5K A;  2YLC A;  3OBW A;  1GCP A;  5GAN d;  3CME T;  5HCK A;  2MIO A;  3M58 A;  2FZC B;  1PM3 A;  1GRI A;  2XKO C;  4JJD A;  2MOX A;  3PT9 A;  4QVC A;  4E7I A;  5J26 A;  1QCF A;  4QVZ A;  4OP0 A;  3CMA T;  5GAO m;  4KUD K;  2RNA A;  2KNB B;  2RD1 A;  2LCC A;  3C0C A;  4J9I A;  1Y0M A;  4J6W A;  1NEB A;  3LLR A;  1M90 C;  2M0O A;  1KIK A;  3GLX A;  1UFF A;  2BE9 B;  4ZTJ A;  2BTT A;  1Q81 R;  1KQS S;  4LDW A;  2GF7 A;  1BKB A;  4RTZ A;  4X1V A;  2D8H A;  4RTW A;  5GAN 6;  4BDZ A;  3HRT A;  2XU8 A;  1UUE A;  2ZPI B;  4JJN K;  2RJD A;  1I81 A;  1WFW A;  2DTI A;  5IXB A;  5KYX A;  2WSE E;  4OML A;  1WZO A;  2DO3 A;  2HNI A;  1NJI C;  2W0Z A;  4M78 C;  3MO8 A;  3LGF A;  3TEE A;  1WQW A;  2O01 E;  5LJ3 h;  3JAM E;  1RAA B;  4LDV A;  1VQ7 T;  3OYG A;  3CBM A;  2C06 A;  2LCL A;  1MMA A;  4IUQ A;  1Q82 C;  2RHZ A;  3QII A;  3CXC P;  2PUK B;  3OYE A;  2MI6 A;  3H0H A;  3PMI A;  2GNC A;  1MND A;  4XK8 E;  3SFM A;  3RER A;  4IUP A;  5D6W A;  5I2S A;  4PNO A;  2OAW A;  3OS0 A;  1MV3 A;  4FYW B;  2PVO B;  1YI2 Q;  5KYY A;  1YJW Q;  2LC4 A;  2DVE A;  4E6R A;  4IUV A;  2DA9 A;  3I56 T;  3VRY A;  1YBY A;  4ZGE B;  4M78 G;  4Z88 A;  1D0X A;  3CCQ A;  2DYB A;  1EZZ B;  4M77 G;  4FL6 A;  2K7A A;  3VS5 A;  1YFN A;  4DA4 A;  1Y57 A;  4ORZ A;  2K5F A;  1XQH A;  4FSX A;  2QQA A;  4PK4 A;  2X35 A;  1PG5 B;  1NJI R;  3R6N A;  2D8J A;  1ZSZ A;  3RNJ A;  3QZ5 B;  3JSC A;  2AZV A;  3QJ6 A;  4BI3 A;  1GBR A;  2DNU A;  4C8Q G;  4N4H A;  3HHT B;  2HKQ B;  1OU8 A;  4C5H A;  2XHC A;  1D1C A;  1X43 A;  2E3I A;  1YI2 A;  1VQ9 Q;  1BI1 A;  3V7C A;  1JQQ A;  4OB2 B;  3UF4 A;  1M30 A;  1HD3 A;  2PQW A;  2DF6 A;  4CC4 B;  2HCK A;  5CO7 A;  1JO8 A;  1OQK A;  1NM7 A;  1YCY A;  4X9C A;  3G4S Q;  3U23 A;  2F69 A;  3CCJ Q;  4OMQ A;  1G3T A;  1LJO A;  2ATC B;  1VQP T;  2D9T A;  1HJD A;  1IHW A;  1H92 A;  2RQU A;  2M16 A;  1ZX6 A;  3CXC S;  3VS2 A;  3I55 Q;  5HY6 A;  5GAM j;  4RCB A;  2M1H A;  3HFO A;  2OJ2 A;  1GCQ C;  4RUG A;  2CP7 A;  4EIK A;  2LX9 A;  3JCM Q;  3C4S A;  2RH2 A;  5GAN 2;  4DEX A;  1VQ8 Q;  3JB9 H;  1YIT T;  2CP0 A;  2QQS A;  3ASK A;  2LJ3 A;  3OYJ A;  2DEQ A;  1KQ1 A;  1RUW A;  2X4Y A;  3TSZ A;  2AKK A;  3MKD A;  1S72 Q;  3REA B;  1X6B A;  2LMJ A;  2J06 A;  5KYU B;  1OPK A;  2ED0 A;  5GAM f;  3ER0 A;  1Q95 G;  1YJ9 Q;  2GGR A;  1UB4 A;  4LN2 A;  1VQO A;  3MET A;  4M78 B;  2FZG B;  3UPU A;  5GJW B;  1K8A U;  2RHX A;  3EG1 A;  2DTO A;  4HT8 A;  1PD1 A;  3E2U A;  1ZSG A;  4MDW A;  1WJR A;  3UWN A;  1SSH A;  2XDB A;  1N6A A;  1VUB A;  1VQM A;  4NOY A;  3EFO A;  3JCM P;  3L2W A;  4BE0 A;  2CRE A;  4KGZ B;  4HCK A;  1KC8 U;  2BZ8 A;  4GBQ A;  5I21 A;  4PJO A;  3FB9 A;  1OI1 A;  2A0F B;  1K76 A;  4VUB A;  5GMK h;  3MCA B;  2RJF A;  4GY5 A;  4HXJ A;  2A36 A;  4X34 A;  3GF5 A;  1PCX A;  1V29 B;  1DJ7 B;  2JS2 A;  5D6X A;  4M7A B;  1W2B P;  3A98 A;  1X75 C;  4PJJ A;  4A63 B;  1AVZ C;  2E5Q A;  1OYX A;  4FU6 A;  1EIF A;  1VQM T;  3QXE B;  1N27 A;  2R57 A;  5GMK j;  2A3L A;  3L2V A;  1UEC A;  1N8R U;  5I11 A;  4EMK C;  1X2Q A;  3MHX A;  3TCJ A;  1UHC A;  2QEX Q;  2VXE A;  2FRW A;  3BDL A;  2GTJ A;  5FW9 A;  4Y92 A;  3M4G A;  3LYI A;  4JRK A;  5IN1 A;  1UJ0 A;  3NPF A;  4J8O A;  1RAH B;  3M0T A;  2NUP B;  3RKW A;  3QHS A;  1VQK A;  2HEQ A;  1K0S A;  4J9F A;  1P92 A;  1ZBJ A;  2ESW A;  2P4T A;  1XOV A;  5LJ3 g;  3E19 A;  5I22 A;  3H9N A;  2O88 A;  2FEI A;  5KCO A;  3FEO A;  2IPO B;  1M2O A;  2L3R A;  3JCM X;  3GP8 A;  1GCQ A;  2JN0 A;  2WSC E;  3MEV A;  5J39 A;  1VQP Q;  2Y4Y A;  2AHJ B;  2AT1 B;  3CC7 Q;  2JVV A;  4HVU A;  2RMO A;  1RAB B;  1NLP C;  1R77 A;  4X9D A;  2YUO A;  5FU7 B;  2LQN A;  1KHI A;  1JJ2 S;  2G3R A;  2E70 A;  5GAM g;  2ZAE A;  4KRT A;  1OV3 A;  2L3Q A;  1VQ5 A;  1YI2 T;  3EHQ A;  1ZSZ C;  5IT9 E;  2DXT A;  2DRK A;  1RLQ C;  4ANJ A;  3I56 A;  2QG9 B;  3RUX A;  2V8I A;  4D6W A;  2KR3 A;  1VQK Q;  2K3Y A;  4HKE A;  1A0N B;  2DJZ A;  1ARK A;  2F2W A;  1AWJ A;  1K0X A;  4J6Y A;  1M8V A;  2PU9 B;  1FX7 A;  2KT1 A;  3CC2 T;  1ZA2 B;  3A1P A;  1UG1 A;  2YLB A;  3CME A;  1SHF A;  3MPU B;  1WXB A;  3A8M B;  2Z0W A;  3C12 A;  3GPL A;  4IIM A;  5KE2 A;  2XMF A;  4B6M A;  4C8Q D;  3EG9 B;  2M9U A;  1VQL A;  3FJP A;  4M7A D;  2DIQ A;  5LJ5 j;  1UE9 A;  2EGA A;  1QMC A;  2RHU A;  3EGX B;  1G8X A;  2NLU A;  5GAM d;  2HQX A;  2FVU A;  1AZG B;  4B9X A;  1BCO A;  1PC0 A;  4OMF B;  3CC4 Q;  2KRN A;  3V8L A;  2DD5 A;  3G1J A;  4F7U G;  1SRL A;  1BCM A;  2KRS A;  1VIF A;  2BZY A;  2O9V A;  4BY6 B;  1VYU A;  4FW2 A;  4N4I A;  1MV0 B;  3NGP A;  3QO3 A;  4F7U F;  1X69 A;  1QVF A;  1NYG A;  1PRM C;  1ZUU A;  2CP2 A;  3JCM b;  2KK4 A;  1TSF A;  2EIF A;  2LNH B;  3I55 A;  1BU1 A;  4F14 A;  2AKL A;  4Z89 A;  1ACM B;  2F2V A;  3RMS A;  4PLL A;  4M75 E;  1WYX A;  5KCH A;  3VRZ A;  2KT8 A;  4XTU A;  4M77 B;  4E2F B;  1VQN Q;  2JMA A;  4A53 A;  4RMO A;  1M8M A;  1LCK A;  3QDF A;  3CQT A;  4EDU A;  1WXU A;  5GAO r;  2J6F A;  4M7D F;  1TU0 B;  2LJ0 A;  4N0A A;  3CCS A;  1VQ6 T;  1KHC A;  2KRO A;  1QVF S;  2COY A;  3A8H B;  2Y4X A;  1S72 A;  3TVT A;  2NUT A;  4E7Z A;  4JPB W;  1FYN A;  3GNG A;  4J5Y A;  2K5L A;  3V8K A;  4C8Q F;  3OYI A;  3PFS A;  1S1N A;  1OEB A;  2E6N A;  2V8J A;  1KG1 A;  2QDY B;  1YWO A;  4EPC A;  3C94 A;  1J3T A;  2EKO A;  3LWI A;  2X51 A;  1U5S A;  2CH4 A;  4E7K A;  4LUD A;  4CI0 C;  2C0O A;  3OW2 P;  1T3L A;  3CCR A;  3CCQ Q;  1TUC A;  5IHN A;  2QDL A;  4XU1 A;  5L23 A;  3CCL Q;  1Q86 U;  4DOW A;  2RQT A;  3MP1 A;  4ZGD B;  1ZSZ B;  3L2Z A;  3L2R A;  1PWT A;  2LQ8 A;  2K9G A;  3WVD B;  4M7A F;  4PFZ A;  5LJ5 f;  2K6D A;  2KMT A;  2P0P A;  3E9F A;  1IB8 A;  3OQ5 A;  3VUB A;  1B34 B;  3VS0 A;  1D09 B;  3E9G A;  1O9S A;  2EW3 A;  2JTE A;  3R6O A;  3CC4 T;  2DBK A;  2GQV A;  3O8V A;  3UDC A;  2FHD A;  1Q86 R;  2YUN A;  3A8O B;  2ABL A;  1QW1 A;  2CDT A;  3X28 B;  2OTL T;  1NG2 A;  1M4Z A;  2DZ9 A;  4M7D G;  3CPW P;  5DLO A;  3REB B;  2MPX C;  5J3B A;  2A28 A;  2FYK A;  1EFN A;  3PGG A;  4JJB A;  3CCS T;  4OB1 B;  5HKC A;  3CXC A;  3S3O A;  5M9O A;  2QGF B;  3H41 A;  2EYW A;  2NYS A;  4J7I A;  1ZA1 B;  2DIG A;  1JXO A;  5LJ3 j;  1NEG A;  2RQV A;  5GAN 8;  2SEM A;  4C92 G;  2E1H A;  1JJ2 A;  1T3S A;  1X2K A;  2JT4 A;  3RKX A;  2P84 A;  2HKN A;  3PIP A;  3PIO A;  2RF0 A;  3EH2 A;  4NS5 A;  1VQ5 T;  1CKB A;  4M75 G;  1ZUK A;  4XU2 A;  4IUU A;  1JU5 C;  2DX1 A;  4RG8 A;  3LW5 E;  4J7F A;  2D0N A;  2ZPE B;  3NFC A;  4PJO F;  1I5L A;  2DL4 A;  1R8O B;  2CKK A;  5FU6 B;  1UHF A;  1W2B A;  2OI3 A;  2BE7 D;  1Y7X A;  1V76 A;  3I56 Q;  3CCS Q;  1JJ2 P;  2EJ9 A;  2E4H A;  2LVM A;  3SHW A;  4M7A C;  2VGM A;  1G3W A;  1N8R R;  1RI9 A;  1X6O A;  3QUI A;  3VYH B;  3DB3 A;  1QVP A;  1VQN A;  2EGE A;  2MYS A;  2BUD A;  2HL3 A;  5D6Y A;  4EMH A;  3CCU T;  1MMD A;  1WHH A;  1RAI B;  4IIO A;  5FRN A;  3HFN A;  1VQL T;  5CQX A;  1LVK A;  3PE0 A;  2KI7 A;  1WIE A;  4XTX A;  5GAN 7;  4M77 F;  1XJW B;  2X9H A;  1IHV A;  2QQB A;  4KUL A;  5CAI A;  1N9R A;  3QYG B;  2RK2 A;  2CZ1 B;  2D1X A;  3FIF A;  1I1J A;  2DEU A;  2OTL Q;  2DLP A;  2L2P A;  3FC3 A;  4C0D B;  1VQ4 A;  4J9B A;  2PNI A;  2HL5 C;  2EKH A;  2MMP A;  1BBZ A;  3ME9 A;  3A8L B;  1NLO C;  4C8Q C;  4F16 A;  1OZ3 A;  3F70 A;  2DL5 A;  5KYX B;  2ZPH B;  4PJO D;  2ZGW A;  1IGU A;  4M75 A;  2EWN A;  2B8A A;  1M1G A;  5LJ5 g;  4C0Z A;  4CC7 A;  1Y96 A;  1BYM A;  2L8D A;  1NBE B;  5GAN 3;  3CC7 A;  3P8H A;  1QLY A;  3QSU A;  1AWW A;  3M59 A;  4DBF A;  1UGQ B;  1WHK A;  2NUP A;  2A7Y A;  4C0F A;  2CP6 A;  2X4W A;  1VQP A;  4M7A A;  2NWM A;  2V1R A;  2GFU A;  7AT1 B;  3NHN A;  2FPD A;  3X26 B;  4GLK A;  1D0Z A;  4C0D C;  4CC3 A;  1VOM A;  2YUQ A;  3EG9 A;  3IQL A;  2YHT A;  1Z9Q A;  4M78 E;  3X25 B;  2Y90 A;  1YIJ A;  3LX7 A;  2CZ6 B;  2X3W D;  1XNI A;  1YHQ T;  4BD3 A;  4FYY B;  4K11 A;  5CKB A;  1U06 A;  4WCI A;  5AT1 B;  3EFS A;  1OZ2 A;  2HQH A;  2RI5 A;  2DYI A;  1YJN A;  4AFU C;  3QWX X;  5GAM e;  3QPH A;  2BIV A;  3OSV A;  4XTY A;  2KGT A;  2VWF A;  1JRI A;  1QWF A;  4IUT A;  5LJ5 d;  5CR2 A;  3CMA A;  4FYX B;  1WI7 A;  4KGV B;  1WXT A;  1SG5 A;  1RAC B;  4FT2 A;  2EQU A;  2XG8 D;  2E3H A;  2IIM A;  4XU3 A;  5GMK m;  2K3B A;  1MNE A;  2KY9 A;  2DFU A;  3EFO B;  1VQO T;  1YHQ A;  1YJ9 T;  4M77 C;  2YRV A;  5DM7 R;  1Q86 C;  2KYB A;  4RCC A;  1N5Z A;  5KYN A;  1U8R A;  2CUD A;  4MZM A;  2CP5 A;  1AT1 B;  5FRM A;  2RQW A;  4HCZ A;  2E6Z A;  4ZNX A;  2QEX T;  3V7R A;  5KYW B;  1FWZ A;  2JXB A;  1UEB A;  1Q82 R;  2J05 A;  3MEU A;  5CKE A;  1M3A A;  4RTX A;  5GAO p;  1OX8 A;  3RDV A;  1JEG A;  3TU4 K;  4AFQ C;  3BY7 A;  2ZCF B;  5I2M A;  3RR6 A;  3CC7 T;  5GMK i;  2FPE A;  3OW2 A;  1YIT A;  2QK0 A;  4M75 B;  3THK A;  4QT7 A;  5A0D A;  1VQ7 A;  3FRN A;  3JB9 D;  4NL2 A;  2KRM A;  2NUT B;  2JJ9 A;  3EGD B;  1VQ8 A;  2QGG A;  1IRE B;  2XDP A;  2EYQ A;  4BI8 B;  1NYF A;  2VV5 A;  4IUR A;  1K9M C;  2DL3 A;  4M4Z A;  4N4G A;  4M78 A;  2P0K A;  2VYT A;  4A54 A;  3CD6 T;  1GXI E;  1K73 R;  3QDR B;  1UJY A;  1Q82 U;  1YJN T;  2GTO A;  1M3B A;  3FJ5 A;  2W10 A;  2A08 A;  1I8F A;  3OYD A;  3UA7 A;  2J6K A;  3GBQ A;  1M1K R;  4PJN A;  1G2B A;  5FU6 C;  2KXC A;  4R55 A;  1Q81 U;  1ABO A;  1X6G A;  4M7D D;  2B86 A;  1M90 U;  3JCM W;  4J9C A;  1QVG S;  3G4S T;  1NZ9 A;  4RTT A;  3G71 Q;  1MMG A;  3OMG A;  2K2M A;  3OB9 A;  3VS3 A;  2LTO A;  2J7I A;  1VQM Q;  1X27 A;  3JB9 G;  1VYV A;  3QZ9 B;  4C92 D;  1ZQ1 A;  4BE1 A;  4OMO A;  3ZL7 C;  1IO6 A;  3VU3 C;  1HYO A;  2ROL A;  2BKD N;  3JB9 F;  3NTK A;  2EJF A;  1M5Q 1;  3VYG A;  2KBT A;  1M1K C;  1YJW T;  2RJC A;  4BDY A;  5LJ3 f;  3DB4 A;  2MK5 A;  5GAN 4;  2QI2 A;  1MUZ A;  1FMV A;  2QTV A;  2OAU A;  1AD5 A;  3J7A F;  4JRQ A;  1QCN A;  2O2O A;  1NJI U;  2H8H A;  4KGX B;  1JXM A;  1UGP B;  2PVG B;  2RN8 A;  3CCL A;  3QG1 A;  5GAN g;  2LNV A;  3MP8 A;  3E1S A;  4QQG A;  4DBQ A;  2DL7 A;  3CCR Q;  4Q5W A;  4M7D E;  4MZP A;  4QKU A;  1LPL A;  3VS1 A;  3V8J A;  2LT4 A;  2L0A A;  4TVR A;  1BI3 A;  1WA7 A;  2JNG A;  3M56 A;  4ZN3 A;  2V8K A;  1XTD A;  1K8A R;  3INZ A;  4C92 B;  3OYL A;  1BK2 A;  1MMN A;  3G6E Q;  3JCM g;  4M7D A;  1RAF B;  1SF9 A;  4LD9 K;  3OBY A;  2GFA A;  3BW1 A;  1YN8 A;  3BDU A;  4FT4 A;  5DY9 A;  5KYU A;  1VQ9 T;  4MMK A;  1BIB A;  2AK5 A;  4LD6 A;  2L89 A;  3RKY A;  1I0C A;  4E7J A;  4EMK B;  3URG A;  3OY9 A;  1K73 U;  2JOY A;  2OTJ A;  3OA6 A;  4BUG A;  2CP3 A;  2DXU A;  2YUP A;  5CIU A;  2FB7 A;  1EX4 A;  2AIR B;  2EYY A;  2CZ7 B;  2HZY A;  3I35 A;  1C6V X;  1YIJ T;  4L5G A;  2K79 A;  3WXM B;  4ZN1 A;  3S6W A;  1VQ9 A;  5GAO l;  1W6X A;  4C5I A;  2D0Q B;  2YSQ A;  4EMG A;  3CCE A;  1AZE A;  2OX7 A;  2EQK A;  1X01 A;  1D0Y A;  2DBM A;  1KD1 C;  3HP9 A;  1JB0 E;  5D7U A;  4M75 D;  3H0F A;  1KQ2 A;  1UGV A;  4PJO G;  3MEA A;  5IHK A;  4DBR A;  4XTZ A;  1YWP A;  1NPR A;  2PZ1 A;  2DKG A;  4M78 F;  3J81 E;  1PSE A;  2P4R A;  3VS6 A;  3SDZ A;  2ZPF B;  2JTM A;  4E7L A;  4CC2 A;  2O4X A;  1YJ9 A;  2J6O A;  2YXY A;  1B34 A;  3OYC A;  1QCO A;  4OVA A;  1N9S A;  1Y71 A;  4DQ2 A;  5GAO q;  2HBP A;  1SSF A;  1TUG B;  4JZ3 A;  2KAF A;  5A0G A;  3CCE Q;  2FRY A;  1ZBX A;  1I5O B;  4ATO A;  4OB3 B;  3EAE A;  1AWX A;  2EQJ A;  4O5V A;  3JCM f;  2F5T X;  2HAX A;  3BE3 A;  4C8Q E;  2EGC A;  3H6Z A;  1RL2 A;  2DIL A;  1WPY A;  1S72 T;  3D7S B;  3V7S A;  2OTJ Q;  2MAM A;  2ZZD A;  3OYN A;  4J9E A;  4Z02 A;  5HK0 A;  1FMK A;  1HK9 A;  1QKX A;  2E65 A;  2CGH A;  2DET A;  4XAX B;  4FSS A;  2FZK B;  1N8R C;  2PTK A;  2I0N A;  4M77 A;  3CCU A;  1T0H A;  4JRP A;  5FRO A;  2JTF A;  2ED1 A;  4BI4 A;  2YRD A;  1CKA A;  3UT1 A;  4Z8A A;  4ZGJ B;  4M7D C;  9ATC B;  3I55 T;  2CUB A;  1WNL A;  1VQL Q;  1GFD A;  3OYY A;  2DZC A;  2L3P A;  1LOJ A;  1KQS A;  3FLG A;  2H3E B;  1Y96 B;  1WHL A;  2M0Y A;  1VQ4 T;  2DAQ A;  3OYK A;  2CZ0 B;  4R0K A;  5KE3 A;  5HK3 A;  5KYW A;  4QW2 A;  1UTI A;  2ECZ A;  4A4K A;  2DE0 X;  1QKW A;  4QVD A;  5IAY A;  4E7H A;  5IHI A;  1WGS A;  5GMK l;  3KXT A;  3EG3 A;  1KC8 C;  3ZFJ A;  3AHU A;  1WX6 A;  2RK1 A;  3EH1 A;  4XQ3 A;  3Q1J A;  1U1S A;  4A4G A;  1SPK A;  5IXF A;  1GL5 A;  1E6G A;  3GOX A;  1M2V A;  4C8Q B;  2XK0 A;  2EBP A;  4M7A E;  1AEY A;  1OU9 A;  2KVQ G;  4M75 F;  4F7U B;  3MJX A;  2HDA A;  1K8A C;  1CSK A;  2YDL A;  4KBM B;  1QVF P;  1G3S A;  3G71 A;  1G3Y A;  2RHY A;  4J9G A;  4MDX A;  4M75 C;  2FG0 A;  4L6V 5;  5CKH A;  2E64 A;  3RES A;  3EGX A;  1RAD B;  1E6H A;  2KQW A;  3PMT A;  4JUV A;  1W4S A;  2VXF A;  4J83 A;  1VYT A;  2LRQ A;  1M3C A;  3CCM T;  1TG0 A;  1GFC A;  4PFP A;  3CEY A;  3LGL A;  3VUZ A;  2SRC A;  4LNP A;  4O6J A;  1WDX A;  1F1B B;  5A0L A;  4FIB A;  2XDD A;  5GAN f;  1W1F A;  8AT1 B;  2JZ2 A;  3L1A A;  1U1T A;  3X20 B;  3CC4 A;  2LZ6 B;  2KEA A;  3OYA A;  4XTW A;  1BIA A;  2DD4 A;  3LWH A;  2R5A A;  2QAS A;  3NTH A;  3VJP A;  3JCM J;  2F1L A;  1VQ6 Q;  2COW A;  4BY6 C;  4M7A G;  2RI2 A;  1VQ7 Q;  1YIJ Q;  3SWN C;  1YNZ A;  3JCM d;  2CYZ B;  2RHI A;  2CSQ A;  5GAM h;  2HMA A;  1VQN T;  1HSQ A;  3MP6 A;  2QEX A;  2CSI A;  2PVD B;  3SEM A;  5LJ3 e;  4HVW A;  3M9Q A;  3OYH A;  2K4Y A;  4JS5 A;  2X4J A;  2QXF A;  3ZBD A;  4ME7 A;  4KT0 E;  4UC4 A;  3VV0 A;  4RG2 A;  2DL8 A;  1M1K U;  3I5R A;  1QWE A;  2LCS A;  1KQS P;  1JBM A;  4PJL A;  1FXX A;  3AT1 B;  3RBB B;  2CH4 W;  3SB2 A;  2COZ A;  1Z9Z A;  3VS4 A;  2EAY A;  4C5G A;  2OTJ T;  4Y28 E;  4AG1 C;  3L2Q A;  1VQ6 A;  3HL8 A;  4J9D A;  3M0P A;  2V26 A;  3HTR A;  3CCQ T;  2HD0 A;  1TUD A;  3HPW A;  4ELY C;  5A2Q E;  5CKD A;  1BI2 A;  3JB9 I;  1GBQ A;  1IXD A;  1Q7Y R;  1H8K A;  2LX7 A;  1WQ7 A;  1B07 A;  3CMA Q;  2EJG A;  4OMP A;  3CD6 A;  1HXD A;  3CCM A;  4HVV A;  2FPF A;  1NPP A;  3TRE A;  1D3B B;  4OGE A;  1Q7Y U;  5KH6 A;  2DTH A; 
#chains in the Genus database with same CATH homology
 1UJY A;  3M0Q A;  2RNA A;  1UE9 A;  2EGA A;  2KNB B;  2GTO A;  3C0C A;  4J9I A;  1M3B A;  3FJ5 A;  2W10 A;  1K4U S;  5IH2 A;  1Y0M A;  2A08 A;  1NEB A;  3UA7 A;  5EC7 A;  1AZG B;  5FWB A;  2J6K A;  3GBQ A;  2KRN A;  2EVR A;  1KIK A;  1UFF A;  1G2B A;  2KXC A;  2EPD A;  2BTT A;  1ABO A;  1SRL A;  1X6G A;  2B86 A;  2KRS A;  4J9C A;  2BZY A;  2JMC A;  3M0R A;  4RTT A;  2O9V A;  4RTZ A;  4X1V A;  2LP5 A;  2YT6 A;  2D8H A;  4RTW A;  1VYU A;  2CT3 A;  2EYX A;  2K2M A;  1MV0 B;  3VS3 A;  3NGP A;  1I07 A;  2J7I A;  1UUE A;  2M51 A;  1X27 A;  1X69 A;  1VYV A;  1NYG A;  1PRM C;  1ZUU A;  2DRM A;  1WFW A;  4OMO A;  3ZL7 C;  2A37 A;  2BZX A;  2LNH B;  1IO6 A;  1BU1 A;  4F14 A;  2AKL A;  4Z89 A;  2F2V A;  5IXB A;  2ROL A;  1WYX A;  3VRZ A;  4OML A;  3I9Q A;  3UAT A;  2KT8 A;  2KBT A;  4LE9 A;  2W0Z A;  2JMA A;  1M8M A;  3EGU A;  1MUZ A;  4ESR A;  1AD5 A;  2O31 A;  2O2O A;  1LCK A;  2H8H A;  3CQT A;  1WXU A;  1JXM A;  2RN8 A;  2J6F A;  2KYM A;  2LJ0 A;  2KRO A;  2DL7 A;  3TVT A;  2EYZ A;  3VS1 A;  1YCS B;  4JPB W;  3H0H A;  2GNC A;  1FYN A;  2L0A A;  2JW4 A;  1WA7 A;  1BB9 A;  2VKN A;  5FWC A;  1BK2 A;  1S1N A;  1OEB A;  2EQI A;  1YWO A;  2OAW A;  1MV3 A;  1YN8 A;  1J3T A;  2L3S A;  1U5S A;  2CH4 A;  2LQW A;  3PVL A;  4E6R A;  3EHR A;  4LUD A;  2DA9 A;  2C0O A;  2AK5 A;  1T3L A;  3VRY A;  1TUC A;  2GQI A;  5IHN A;  1I0C A;  2QDL A;  4Z88 A;  5L23 A;  2RQT A;  2DYB A;  2K7A A;  3VS5 A;  4OMN A;  1Y57 A;  1PWT A;  4ORZ A;  1AOJ A;  2YUP A;  4OMM A;  2K9G A;  3M0U A;  2EYY A;  1SRM A;  4J9H A;  1RLP C;  2K6D A;  3I35 A;  2K79 A;  3R6N A;  2D8J A;  3RNJ A;  2JM9 A;  2G6F X;  2AZV A;  1W6X A;  3VS0 A;  1GBR A;  2DNU A;  2JTE A;  2EW3 A;  4JZ4 A;  2YSQ A;  1AZE A;  2C0I A;  1X43 A;  2DBM A;  2RPN A;  3NMZ C;  2DBK A;  3UA6 A;  2YUN A;  1JQQ A;  3H0F A;  3UF4 A;  1M30 A;  1UGV A;  2ABL A;  1HD3 A;  5IHK A;  4D8D A;  2DF6 A;  2CDT A;  4CC4 B;  1YWP A;  2HCK A;  1JO8 A;  1NG2 A;  2PZ1 A;  1NM7 A;  1UDL A;  3U23 A;  3REB B;  2P4R A;  3VS6 A;  4OMQ A;  2A28 A;  1EFN A;  4JJB A;  4CC2 A;  1HJD A;  2J6O A;  1H92 A;  2RQU A;  1ZX6 A;  3H41 A;  3VS2 A;  2EYW A;  2LJ1 A;  1JXO A;  1NEG A;  4JZ3 A;  2RQV A;  2SEM A;  2FRY A;  2KXD A;  2OJ2 A;  1GCQ C;  1T3S A;  4RUG A;  2AZS A;  4EIK A;  1X2K A;  2JT4 A;  1AWX A;  5ECA A;  4RTU A;  4DEX A;  2V1Q A;  2RF0 A;  1K1Z A;  1ZLM A;  1CKB A;  4F17 A;  1ZUK A;  2LJ3 A;  2EGC A;  1V1C A;  1JU5 C;  1RUW A;  2DX1 A;  4AFZ C;  2DIL A;  4DEY A;  3TSZ A;  2AKK A;  2D0N A;  3JV3 A;  2DL4 A;  1UHF A;  2OI3 A;  1B3Q A;  4J9E A;  3REA B;  1X6B A;  1KFZ A;  1FMK A;  2LMJ A;  2J06 A;  1QKX A;  1OPK A;  2ED0 A;  4RTY A;  1G83 A;  3SHW A;  2GGR A;  3H0I A;  4FSS A;  4LN2 A;  1PKT A;  2ENM A;  1T0J A;  2PTK A;  1U3O A;  2I0N A;  1RI9 A;  5GJW B;  1T0H A;  3EG1 A;  2EGE A;  2ED1 A;  4IIO A;  1CKA A;  4Z8A A;  3PE0 A;  2CUB A;  1ZSG A;  1W70 A;  1GFD A;  1WIE A;  3EG0 A;  2L3P A;  3ULR B;  2JS0 A;  1SSH A;  2M0Y A;  1YP5 A;  2D1X A;  1I1J A;  2DJQ A;  4R0K A;  2DLP A;  2L2P A;  2CRE A;  4J9B A;  2FO0 A;  1UTI A;  2ECZ A;  2PNI A;  2EKH A;  2DE0 X;  1BBZ A;  4HCK A;  1QKW A;  2BZ8 A;  4GBQ A;  5IHI A;  1NLO C;  1H3H A;  1K76 A;  3LH5 A;  4F16 A;  2HBW A;  2F2X A;  2DL5 A;  4HXJ A;  2A36 A;  3EG3 A;  2JS2 A;  1WX6 A;  3A98 A;  2HSP A;  2DM1 A;  1AWO A;  1SPK A;  2X3X D;  5IXF A;  1GL5 A;  4A63 B;  1E6G A;  1AVZ C;  4CC7 A;  3I5S A;  2DMO A;  2EBP A;  1QLY A;  1AEY A;  2RQR A;  1AWW A;  1KSW A;  1UEC A;  2KE9 A;  5I11 A;  1X2Q A;  1PNJ A;  2HDA A;  1UHC A;  3O5Z A;  1VA7 A;  2NWM A;  1CSK A;  2YDL A;  2V1R A;  4GLM A;  2FRW A;  2GTJ A;  5FW9 A;  3NHN A;  2FPD A;  4Y92 A;  4J9G A;  1UJ0 A;  2FG0 A;  3NPF A;  4CC3 A;  2YUQ A;  3IQL A;  1Z9Q A;  3M0T A;  1PRL C;  1E6H A;  2HEQ A;  1K0S A;  1VYT A;  2O9S A;  2MCN A;  1M3C A;  2CT4 A;  1TG0 A;  2X3W D;  1GFC A;  4J9F A;  1KJW A;  4K11 A;  1ZBJ A;  2ESW A;  1U06 A;  1XOV A;  4WCI A;  2SRC A;  2DVJ A;  5I22 A;  4LNP A;  1WDX A;  2O88 A;  2FEI A;  4AFU C;  3QWX X;  1W1F A;  2KGT A;  2VWF A;  1QWF A;  1PHT A;  1GCQ A;  2LZ6 B;  2KEA A;  1WI7 A;  1WXT A;  2VVK A;  2IIM A;  3VS7 A;  3TSW A;  2K3B A;  2GBQ A;  3KFV A;  1PKS A;  1OOT A;  2NUZ A;  1SHG A;  1YNZ A;  1SEM A;  4HVU A;  2RMO A;  2CSQ A;  1M27 C;  1NLP C;  1HSQ A;  2KYB A;  2ROT A;  1N5Z A;  2CUD A;  2YUO A;  1E7O A;  2LQN A;  2CSI A;  5GJV B;  3M0S A;  3SEM A;  2RQW A;  4HVW A;  1OPL A;  4ZNX A;  2JXB A;  2J05 A;  2DL8 A;  4KRT A;  1M3A A;  4RTX A;  1K9A A;  1OV3 A;  3I5R A;  2JM8 A;  2L3Q A;  1QWE A;  3QWY A;  1JEG A;  2LCS A;  4AFQ C;  3EHQ A;  1ZUY A;  2DRK A;  1RLQ C;  4RTV A;  3PVQ A;  1ABQ A;  3RBB B;  4AG2 C;  4JJC A;  2KR3 A;  2CH4 W;  2FPE A;  3EG2 A;  1A0N B;  1ARK A;  1Z9Z A;  3THK A;  2F2W A;  4QT7 A;  1AWJ A;  3VS4 A;  1K0X A;  4LUE A;  4AG1 C;  2C0T A;  2KRM A;  4AFS C;  4J9D A;  2KT1 A;  4D8K A;  3M0P A;  1WLP B;  1UG1 A;  1TUD A;  1SHF A;  2E5K A;  1GBQ A;  1H8K A;  2LX7 A;  1GCP A;  1WXB A;  1B07 A;  1NYF A;  5HCK A;  2MIO A;  4IIM A;  2DL3 A;  4OMP A;  4M4Z A;  1GRI A;  4JJD A;  2MOX A;  2FPF A;  4HVV A;  2XMF A;  1QCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...