2DNUA

Solution structure of rsgi ruh-061, a sh3 domain from human
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
GSSGSSGEEKYVTVQPYTSQSKDEIGFEKGVTVEVIRKNLEGWWYIRYLGKEGWAPASYLKKAKDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-061, a SH3 domain from human
rcsb
source organism Homo sapiens
molecule tags Structural genomics, structural protein
molecule keywords SH3 multiple domains 1
total genus 7
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dnuA00
2DBKA 2DMOA 3JV3A 1E6HA 2KNBB 1AWWA 2DLPA 2GQIA 2V1RA 2C0IA 1PKSA 1M3CA 2X3XD 1JO8A 3REAB 1E6GA 2DRKA 2A28A 2ECZA 2RQRA 4F17A 2JM9A 4RTXA 1UJ0A 4AFZC 2D8JA 2EGCA 3VRYA 2VWFA 2DVJA 2FPFA 4Z8AA 2CUBA 2EPDA 2DL8A 3LH5A 2KRMA 1YNZA 3VS3A 1ZX6A 2LJ3A 3VS1A 1WXTA 3O5ZA 1WYXA 2KROA 1HD3A 1OEBA 1UTIA 2KE9A 2V1QA 1PWTA 3EG1A 5FW9A 4OMOA 1WDXA 4K11A 1OPKA 1WIEA 4OMNA 3NMZC 2A08A 2FPDA 2RQWA 1J3TA 1GL5A 1U3OA 1WLPB 4LN2A 1G2BA 1A0NB 3QWXX 4J9GA 1X6BA 3KFVA 2K3BA 2DILA 2ED0A 4AG1C 1WXUA 1M27C 3H0IA 4D8KA 1QWFA 1TUCA 2W0ZA 2YSQA 1WFWA 1H92A 1UFFA 4RTZA 2RQUA 4JZ3A 4F14A 2DL3A 1JEGA 2EYYA 2LZ6B 4IIOA 2EQIA 1Z9ZA 3M0TA 2AKKA 2M51A 1JXMA 4RTUA 3A98A 2KXDA 2J6OA 1AWJA 1M3BA 2OI3A 1QKWA 1S1NA 2DX1A 4R0KA 1K9AA 2O2OA 2HSPA 1CKAA 4OMPA 3VS0A 1I0CA 2J6KA 3CQTA 4Y92A 2YUPA 1HSQA 3NGPA 4FSSA 1GFDA 1M3AA 2LCSA 2CSIA 1NG2A 4HCKA 1AOJA 2GBQA 3H0HA 1G83A 1PRLC 1NEBA 2HDAA 1QKXA 2K2MA 2DF6A 3NPFA 1OPLA 4JJCA 2MCNA 2F2XA 2SEMA 2JMAA 3M0PA 2C0TA 5HCKA 4X1VA 1X6GA 2B86A 3U23A 2FRWA 5EC7A 3RNJA 2YUOA 1E7OA 1PHTA 1TUDA 3I9QA 2D0NA 2J06A 2EGEA 1FYNA 2JXBA 2RNAA 4A63B 3VS6A 2OJ2A 2CREA 2CH4W 3ZL7C 2BTTA 1GBRA 1I07A 1VYTA 2LJ0A 2O31A 3EG3A 1AD5A 1UECA 4LUDA 2CSQA 5FWCA 2VKNA 2AZVA 2DL7A 1X69A 2L3SA 4JJDA 2O9SA 2DA9A 4HVUA 2J6FA 3M0SA 5IHNA 1BU1A 2FRYA 4J9HA 4J9CA 4DEXA 2K9GA 2RMOA 3VS7A 2FEIA 4F16A 3TVTA 4IIMA 3M0QA 5I22A 2AKLA 5GJVB 1B07A 2JMCA 4AFQC 1I1JA 1X2KA 4Z89A 1MV0B 3EHRA 2F2WA 4AFUC 1FMKA 4RTVA 1WA7A 1K0XA 2XMFA 5IH2A 1QWEA 1VA7A 1JU5C 2VVKA 3VS4A 1ARKA 2RPNA 1AEYA 2YUQA 2DNUA 4HXJA 4CC4B 3C0CA 2GNCA 4AG2C 2ROLA 1RUWA 2YDLA 2KT8A 1LCKA 1KFZA 1OOTA 1NM7A 1UHFA 2LMJA 3IQLA 1K4US 2E5KA 2J7IA 2SRCA 1KIKA 2PTKA 2L3PA 1UHCA 1RLPC 5IHKA 1NLOC 2H8HA 2O88A 2EVRA 4M4ZA 3VRZA 2KRNA 1Y0MA 1BK2A 2IIMA 2JS2A 1JQQA 4CC2A 4CC7A 2OAWA 1ABOA 1KJWA 3M0UA 2JS0A 2LP5A 1GCPA 2K6DA 4JZ4A 4GLMA 1MUZA 2KEAA 1AWOA 1CSKA 1X43A 5L23A 4HVVA 3EHQA 1AZGB 2ESWA 3PE0A 2NUZA 1W70A 4J9FA 4KRTA 1H3HA 1HJDA 3PVLA 4OMQA 1N5ZA 1YN8A 2CH4A 1U06A 1QCFA 1M8MA 2M0YA 3THKA 4LNPA 1NEGA 4HVWA 2KT1A 1T3LA 4QT7A 2JW4A 1ZLMA 1GCQA 2ED1A 2RQVA 1NYFA 3FJ5A 2FPEA 1PRMC 2BZYA 3NHNA 1YP5A 1AWXA 1ZUKA 3I5RA 4OMMA 1Y57A 2HBWA 1BBZA 1IO6A 5FWBA 2DL4A 3GBQA 1W1FA 3I5SA 1OV3A 2GTJA 2GGRA 1UUEA 4GBQA 1WI7A 2BZ8A 1UDLA 5ECAA 1GBQA 2JT4A 1K0SA 2P4RA 3UF4A 3TSZA 2DJQA 4RUGA 2G6FX 1JXOA 1KSWA 1WX6A 2I0NA 2YUNA 1MV3A 1B3QA 2GTOA 1GFCA 3EG2A 3I35A 2D8HA 2DM1A 4DEYA 4CC3A 1ZSGA 2CUDA 4Z88A 3REBB 1SRMA 2D1XA 2RN8A 2JTEA 2L3QA 2X3WD 2LX7A 4J9DA 2LNHB 3ULRB 1M30A 1UE9A 4ESRA 1QLYA 2EKHA 1YWPA 2DL5A 4LUEA 2MOXA 1W6XA 1SSHA 1PKTA 2FG0A 2KR3A 1EFNA 2F2VA 3M0RA 1SHFA 1GRIA 2DYBA 1CKBA 1T0HA 1SRLA 1H8KA 2O9VA 3TSWA 2CDTA 2LQNA 5IXBA 2EYZA 2CT4A 3UA7A 5IXFA 2ABLA 1XOVA 2RQTA 4OMLA 5GJWB 3VS2A 1T3SA 2CT3A 1AVZC 1K1ZA 1T0JA 3UATA 4J9BA 4ZNXA 3SHWA 4ORZA 1YCSB 1SPKA 2L2PA 1ABQA 1SEMA 3RBBB 3H0FA 2FO0A 1AZEA 3R6NA 2EW3A 2A37A 1RLQC 2C0OA 2DE0X 2BZXA 2EYWA 1ZUUA 1V1CA 1UGVA 3VS5A 2MIOA 4JPBW 2LQWA 4J9IA 2PNIA 4RTWA 3QWYA 4WCIA 1PNJA 4E6RA 4RTTA 5IHIA 2L0AA 4D8DA 2HEQA 2J05A 4J9EA 2KRSA 1WXBA 4LE9A 4AFSC 3SEMA 1YWOA 2PZ1A 2HCKA 2K7AA 2AK5A 1GCQC 1X2QA 1K76A 2KYMA 4JJBA 1U5SA 2EYXA 3PVQA 3EG0A 2KGTA 2A36A 2ENMA 1NLPC 2K79A 1UJYA 4RTYA 2JM8A 1NYGA 1SHGA 2EGAA 1TG0A 1VYUA 2NWMA 2QDLA 1Z9QA 2AZSA 3EGUA 1ZBJA 2DRMA 2EBPA 4EIKA 3UA6A 2W10A 3H41A 2RF0A 1RI9A 1ZUYA 2LJ1A 2ROTA 5I11A 2KXCA 2KBTA 2DBMA 1VYVA 2KYBA 1BB9A 2YT6A 1X27A 1UG1A
chains in the Genus database with same CATH superfamily
1E6HA 1V29B 2KNBB 1AWWA 1YJNA 3LW5E 1FMWA 3A8MB 4IUUA 1M3CA 2DRKA 2RQRA 4F17A 2JM9A 1PCXA 1QP3A 4KBMB 3N5BB 1OYXA 3G4SA 3QIIA 1W2BP 1IXDA 2DVJA 2FPFA 1VQMA 2KK4A 2OTLQ 2LNVA 5IT9E 1YI2A 3CC7T 4M75D 2KRMA 1TU0B 3VS3A 1WXTA 1OULA 1WYXA 4IUVA 4IUTA 1N9RA 4J7FA 1PWTA 2XD0A 3V7CA 5A2QE 1W2BS 1OPKA 3UT1A 3NMZC 1BIBA 4M77D 3OS2A 1ZSZB 1G2BA 5KE2A 1KD1R 5DLQE 3PMIA 2QTXA 2ZZDA 4M7DC 2K3BA 2DILA 4F7UA 2ED0A 4AG1C 3X28B 1M27C 1QWFA 5KYYA 1VQPQ 1ZA2B 3SD4A 2WACA 4BB7A 2JOYA 3EFOB 4KGZB 2KQWA 4RTZA 1TXQA 2OTJT 2LZ6B 2EQIA 2AKKA 3PIOA 3RKYA 1M3BA 3ER0A 2ZGWA 2CS7A 4R0KA 2R5AA 1UEBA 1NJIC 4XTVA 3RKWA 4BDYA 2DK3A 4C5EA 4OMPA 5GAMh 2FZCB 3S3MA 3PFSA 4TVRA 4Y92A 5D6YA 3DB3A 3CPWS 4JUVA 2CP0A 7AT1B 4KUIA 4M7DA 4QW2A 2LCSA 2RI2A 1D1CA 4BE1A 1AOJA 2GBQA 3H0HA 2E4HA 3RESA 1C1AA 3OYFA 1TTHB 3V8KA 4AMCA 1Q81C 1M8VA 2MCNA 4D6WA 3QYHB 2M9UA 4LD6A 1U1SA 3S6WA 1X6GA 1NPRA 2FZGB 1Y96B 2FRWA 2JUFA 3HRSA 1TUDA 3I9QA 3QJYA 3G71Q 1FX7A 2QA4T 2JN0A 1FYNA 3VS6A 2OJ2A 1BI3A 3ZL7C 3URGA 4RCBA 2O31A 3EG3A 4LUDA 2CSQA 1XTDA 2VKNA 2PUKB 2BIVA 2AZVA 4JJDA 2L3SA 1QW1A 4OB2B 1RACB 3CCUA 2K9GA 3TVTA 4IUPA 3V8LA 2ZPIB 2HBPA 2L8DA 1TH7A 1VQ7A 3EG9B 2JMCA 4AFQC 3OSSC 4C5GA 1X2KA 4Z89A 1KQSS 1FMKA 4Z02A 3A8GB 4DBHA 1WA7A 2Y90A 1K0XA 3JCMV 1VA7A 2VVKA 1AEYA 2RPNA 1VQOT 3G1JA 3JSCA 3C0CA 3R6OA 5KYYB 3PMTA 2EFIA 1LCKA 1KFZA 1NM7A 1K4US 2MYSA 3QXEB 5KYUA 4C0DC 1AHJB 2PTKA 3DKMA 1RLPC 4M77E 4L6V5 3JCMh 4EMKA 3Q1JA 4ZN1A 1SKUB 3OYMA 1H3ZA 2XICA 2O4XB 1Y0MA 2HZYA 4PJOF 5FU7B 2IIMA 2K2VA 2GCXA 4JRQA 4LDUA 2HL3A 2QQSA 4C0GA 2P0QA 3KXTA 3KBGA 3VYHB 3CCQA 2KEAA 3I56Q 1VQ5T 3EHQA 4M75F 2GQVA 3HRTA 2HAXA 3PE0A 2NUZA 3L2RA 4RG8A 2DTIA 2YRVA 3CEYA 1RAFB 4KRTA 5GMKm 1H3HA 1VQPA 3CCST 3EGXB 3JRZA 3OYEA 1M8MA 1QCFA 4JS5A 1QCOA 2M0YA 2QEXA 2DVEA 1W4SA 3SWNA 3QYGB 3OYJA 1ZLMA 3FJ5A 1AT1B 2JZ2A 3CCSQ 1R0CB 1PRMC 3HL8A 3NTIA 3J7AF 4B9WA 3I5RA 1IO6A 4B9XA 1KD1U 5FWBA 1Y07A 1UUEA 1UGPB 2LT4A 2JT4A 3OS5A 1K0SA 3VV0A 4M7DE 3RUXA 3UF4A 3JCMP 3MEVA 3TSZA 4C92G 5GANd 1D1AA 1WX6A 1PD0A 3CCMT 2HD0A 3GP8A 3HTRA 1MMNA 2CGHA 4EMHA 3CMAQ 3CPWP 1TSFA 3OYLA 2QXFA 2DM1A 2RI5A 3V7RA 3DLLA 3OA6A 2CP3A 5GAOr 3CCMQ 4PKCC 4J9DA 2F69A 1WHKA 5CO7A 4Y91A 4ESRA 1MGQA 5GAN6 3MP1A 2DL5A 5GMKi 3QO3A 4ZN3A 2MOXA 1W6XA 5GMKh 3C4SA 1SSHA 2P4TA 2F2VA 3ME9A 1WQ7A 2O9VA 3CD6A 5I2MA 3G71A 3P8BB 1Q81R 2CDTA 5IXBA 5GAMj 2EYZA 3QG1A 5IXFA 1K9MC 2RQTA 4IKFA 4J6YA 3HFNA 5LJ3j 1MHNA 1N6AA 3TU4K 4KH1B 5GJWB 1AVZC 1N8RC 3UATA 4GY5A 4PJLA 2XKOC 3PTAA 2RJDA 2L2PA 1YIJA 3RBBB 1HYOA 1MMDA 2Y4XA 2XHCA 3R6NA 2EW3A 1NPPA 1RLQC 2C0OA 4KH0B 3BFMA 1N8RR 3LGFA 1UGVA 3VS5A 5J39A 4KUDK 2MIOA 3RR6A 1UGQB 4J9IA 1D0XA 4BI4A 3QWYA 1WHMA 2KDSA 1NJIU 2DZCA 4BE2A 4RTTA 2EYQA 5IHIA 2MMPA 1M5Q1 1RADB 4J6XA 2DIGA 1U8RA 2DZ9A 1I4K1 2HCKA 4F7UG 2HQEA 2F5TX 2RA2A 3CCRT 3BW1A 1X2QA 4JJBA 4OF1A 1Y96A 4FSXA 3CC2Q 4F7UB 2YRCA 3CCLA 1NYGA 2BKDN 1SHGA 2NUPB 1LVKA 2NWMA 2AT1B 3CC2T 2AZSA 1VQLA 2EBPA 3CXCS 3UA6A 2XIDA 5GMKj 2P84A 3H41A 2RF0A 1RI9A 1D3BA 1BCMA 4HCZA 5I11A 3V7SA 4DBQA 2KYBA 1VQKQ 4PLIA 1M9SA 1Y7XA 4II1A 5GAMe 5CIUA 2C0IA 3OYHA 3CMEQ 3M54A 4ATOA 3CCQQ 2QYZA 3M9QA 4E7HA 1E6GA 2DJZA 2NUTA 3J81E 4FL6A 1R77A 2M0OA 4M77C 3OMGA 1IZ6A 2X4JA 4PJNA 1X6OA 4LDXA 2LTOA 4RMOA 1WQWA 4M75B 4NL2A 3MEUA 3TEEA 4DBFA 2CUBA 2DPPB 4N4HA 2R57A 2EQJA 2L89A 1KQSA 2DL8A 3LH5A 1QVFP 4L5GA 3SDZA 5D6XA 3UPUA 3LX7A 4PJOA 1HD3A 1OEBA 1PM3A 2V1QA 5FW9A 1WJSA 4PJOD 1WDXA 2MK5A 1WIEA 3CCSA 4OMNA 5CQYA 1YFNA 1M90C 2LCLA 2CZ0B 4EMKB 4M7AB 4EMGA 2JTFA 4MMKA 2E3IA 1A0NB 1EZZB 4C92B 2HKQB 4J9GA 1KC8R 1PG5B 2CP2A 1Q86C 1WXUA 3RIRA 4D8KA 2W0ZA 3FIFA 5LJ3g 1XQHA 2DKGA 4KGVB 1JEGA 2EYYA 2DXBA 3M0TA 2M51A 2DEUA 1JXMA 2V26A 4RTUA 3BY7A 5HK3A 2ZPBB 3JCMb 1S1NA 1VQLT 4FU6A 3QPHA 2V8KA 3G71T 4MZPA 2XI9A 2NYSA 3VS0A 1LPLA 1PC0A 2E5QA 3CQTA 5LJ3f 2YUPA 3PGGA 2VYTA 2V8JA 4M77B 4OGCA 5LJ5h 2XK0A 2QQRA 4FSSA 4ME7A 5GAN8 1M3AA 3CCEA 2EIFA 2CSIA 2H3EB 1GXIE 1NG2A 3LYIA 4HCKA 3LH0A 1FWZA 2F5KA 2KY9A 2KVQG 3NTHA 4F7UF 2HDAA 1O75A 1QKXA 5J3BA 3GPLA 4XTYA 4J5YA 3I55T 2DF6A 5CR2A 3EAEA 4HA8A 2SEMA 2JMAA 3M0PA 3QDRB 5HCKA 1YIJQ 3RNJA 4E7LA 2YUOA 1E7OA 1PHTA 1YIJT 1KD1C 3G6EQ 1K73R 1VQOA 2CH4W 3I56A 1KK7A 3E9GA 4X34A 1I07A 5KYXA 1VYTA 2LJ0A 5AT1B 4A4HA 3CCVA 3E19A 3JB9J 2MAMA 4GLKA 2DL7A 2O9SA 2VGNA 3M0SA 3GIBA 1C0MA 1BU1A 2DXCA 4C5HA 4J9CA 2RMOA 3SB2A 4F16A 4XTZA 2RM4A 4IIMA 4DQ2A 3M0QA 5I22A 2V8IA 1K8AC 4A4EA 3BE3A 5DM7R 3CCUT 1TUGB 2OTJQ 2LQ8A 1I1JA 5GANh 2G3RA 1OQKA 2QK0A 4C92C 3OSVA 5IH2A 1UGRB 4A4FA 1QWEA 3VS4A 4AT1B 3CCLT 2YUQA 4RKUE 2RD1A 3FB9A 4CC4B 2RJFA 1Y71A 3LGLA 4AG2C 1BI0A 4OB3B 2YDLA 4Y28E 2LRQA 1OZ3A 3AHUA 3OYIA 2H8HA 2M1HA 2QAZA 4E7SA 4M4ZA 2P0KA 2FZKB 4C5IA 1Q86R 2E12A 3VUBA 2VB6A 1BK2A 4O6JA 2JS2A 1JQQA 2K5IA 1ABOA 3JAME 3M0UA 4V2SA 2LP5A 3CCJA 2K6DA 4GLMA 1B7TA 1I5LA 2X51A 1CSKA 1F1BB 4M77F 2QEXQ 5L23A 1AZGB 2ESWA 4DOVA 4KULA 5GAOq 2KAFA 1ZQ1A 4J9FA 1UB4A 1W2BA 3X25B 2XDPA 4BY6C 2IPOB 4M77G 1Q86U 4M75G 3OBWA 1KQ2A 4HCCA 1VQ9T 2PUOB 3THKA 5GAN2 3MHXA 2KT1A 1GCQA 1VQ9Q 2ED1A 4MZTA 2RQVA 2BE9B 4FYWB 3NHNA 1YP5A 1AWXA 3QBYA 4XK8E 4ZGDB 1V76A 4CRIA 2LVMA 3CC7A 2ZPEB 3L1AA 1BBZA 2LQKA 3I5SA 1OV3A 1VQ9A 1WI7A 2DD4A 1YITQ 4PFPA 3CCMA 1UDLA 5ECAA 3M53A 1OU9A 3EFOA 3M4YA 3X26B 2DJQA 2G6FX 4C8QD 4OB1B 3OBYA 1YJ9T 2X35A 2HNIA 1OX8A 3AT1B 2GTOA 2RB6A 4C92F 3H9NA 4OB0B 2JNGA 1ZSGA 3JCMf 3HPWA 6AT1B 3CMEA 4HT9A 5C0MA 5GAMd 1SRMA 3L2ZA 3VUZA 2JTEA 2L3QA 2LX7A 2QA4Q 1M30A 1QLYA 2FL7A 1QQJA 5CCAA 1IREB 2O01E 1N8RU 1QCNA 4LUEA 1PKTA 2KR3A 1EFNA 4C8QA 2GFUA 3M0RA 2OTLT 1SHFA 2K5FA 1GRIA 3X20B 3OW2A 2LQNA 4BE0A 3G6EA 1BYMA 3M58A 3M59A 4UC4A 1UGSB 1IHWA 1RAIB 3A5ZB 1IHVA 3SHWA 4ORZA 1YCSB 1ABQA 4ELYC 1M90R 5A0GA 3H0FA 2FO0A 1TS9A 4A53A 3CCUQ 2E70A 5GANj 2DE0X 2BZXA 1YJWQ 2OTJA 1YI2Q 1ZUUA 4FYXB 4M77A 1OZ2A 3MKDA 4JPBW 2LQWA 3RKXA 2RK2A 4E7ZA 4WCIA 3FEOA 1NBEB 2EJGA 1YJWT 2QQBA 2HEQA 2KMTA 4FYYB 2RJCA 2OAUA 4OMFB 4J9EA 1MNEA 4AFSC 1YWOA 1D0ZA 2DXUA 2QTVA 2NLUA 1S72A 4JLIA 3OYGA 2KYMA 1U5SA 2DTOA 4PJOE 5FU7C 1YHQA 2HKNA 2LDMA 4JS4A 2BE7D 4RTYA 5J26A 1VQ5Q 1K9MU 3CC7Q 1XNIA 3CMAT 2EGAA 4C8QF 2QDYB 1Z9QA 3EGUA 4C0DB 4EIKA 4LXCA 5GAN7 1VQ6T 2X4XA 3VJPA 1VIEA 1QP2A 3VU3C 1M4ZA 2ROTA 2QGFB 2KBTA 5DY9A 3RMSA 2DBMA 1QVFS 4BY6B 5LJ3h 1OU8A 4B6MA 2DMOA 3JV3A 3JB9D 2BUDA 2DLPA 2V1RA 4XQ3A 5KYNA 1PKSA 1JO8A 2ECZA 2A28A 3S3NA 4HT8A 4J7IA 2EGCA 3VRYA 2VWFA 3QDFA 4BDZA 3E1SA 4Z8AA 2X4WA 2EPDA 1FXXA 3WVDB 3OS1A 1YNZA 2VXEA 2LJ3A 3VS1A 3O5ZA 1M1GA 2KROA 4FW2A 3EG1A 1K8AU 3CD6Q 5CAIA 4JRPA 4C8QE 3J80E 1M2VA 4O5VA 2A08A 2RHYA 2RQWA 3CC2A 1J3TA 3CCRQ 1VQ5A 3FC3A 3OQ5A 1LNXA 2L3RA 1OX9A 4M78C 1YITT 2FB7A 5D6WA 2M02A 3H0IA 2JJ9A 1TUCA 4QQ6A 4WF2A 4HCBA 1WFWA 2HMAA 1G3SA 2X9HA 3L2VA 2CP6A 1H92A 9ATCB 3KUFA 1UFFA 3L42A 3CCVT 1NE8A 2CZ6B 2RQUA 2DL3A 2EQKA 1K8AR 2I2LA 1Z9ZA 1JB0E 5A0DA 2DD5A 5KYWA 1AWJA 2OI3A 2AHJB 1M2OA 2O2OA 2HSPA 2XG8D 3NTKA 1CKAA 3JCMd 1O9SA 1B34A 2PVDB 4FCYA 3WXMB 1HSQA 1RAAB 1MMAA 3NGPA 2D9TA 3M57A 4BI3A 1GFDA 2E1HA 2WSFE 2DIQA 1B34B 3EH1A 2GF7A 2PQWA 3SWNC 3CPWA 1G83A 1PSEA 2MWOA 2EJ9A 4RG2A 3ASKA 4QQDA 2KI7A 2K2MA 5A0LA 3NPFA 2A7YA 1OPLA 5GMKl 3HRUA 3QUIA 3H6ZA 5EC7A 3O8VA 3JB9F 3OYNA 2VV5A 1S72T 4E7JA 4M7DD 4KGXB 2EGEA 3M55A 1YJ9Q 2JXBA 2RNAA 4A63B 2CREA 4DA4A 4C92E 4M78B 4FW1A 2D6FA 3CBPA 3CCET 1AD5A 4A4KA 1D3BB 3P8HA 2J6FA 2E10A 1YJNT 1M90U 3CD6T 2FRYA 1WJRA 2A3LA 4DEXA 1JJ2P 3VS7A 1WNLA 2OX7A 2R58A 3JCMX 3SFMA 2QGGA 4QKUA 3EGDA 3WVEB 2HSEB 4PJOG 2RHIA 1B07A 4XU2A 1KQ1A 8AT1B 2CZ1B 1MV0B 2COZA 3EHRA 4NOYA 2EJFA 2DXTA 4R55A 1KC8U 4RTVA 4X9DA 2XMFA 5CKHA 2PVGB 1JU5C 3CXCA 1ARKA 1VQ6Q 2YLBA 2DNUA 3CC4T 2HQXA 1G3WA 1Q81U 3JB9I 2GNCA 2ZAEA 1RUWA 2KT8A 3SWNB 1K9MR 1OOTA 1UHFA 2LMJA 3CC4Q 1D09B 4JRIA 5M9OA 5GAMf 1VQ7Q 3META 2E5KA 3MP6A 2SRCA 2HL5C 2L3PA 1UHCA 4OGEA 5IHKA 1NLOC 2O88A 2P0PA 2EVRA 3CMAA 2KRNA 4M78A 4PJJA 3A1PA 4CC2A 4CC7A 2RO0A 1IRXA 2YLCA 5FRMA 1KJWA 2JS0A 2H3JA 1X75C 1GCPA 5LJ5e 2EKOA 1YJNQ 3L2UA 1G3TA 1VUBA 1RAHB 4DBRA 1AWOA 5CKEA 2K57A 1X43A 3ZBDA 1FMVA 4J83A 5LJ5d 5LL6S 1VQ4A 3QKJA 3EFRA 4NL3A 3H8ZA 2LT1A 1W70A 1VQMQ 1ZSZA 3MEAA 3QJ6A 2Y4YA 4EMKC 1ZSZC 2AIRB 1HJDA 3PVLA 1N5ZA 1ZBXA 4EDUA 1U06A 1QVFA 2R5MA 4LNPA 1IGUA 1NEGA 4HVWA 4JRKA 4A4GA 1YI2T 2K3XA 4QT7A 2JW4A 4PNOA 1NYFA 1VOMA 2FPEA 4WTOB 3OW2P 3ZEHA 2DETA 2BZYA 3QZ5B 3JCMQ 2ZPFB 4PFZA 3S3OA 3FJPA 4OMMA 1Y57A 2HBWA 4DOWA 3L2QA 5CKFA 1OI1A 2K4YA 2E65A 2BZ8A 4HKEA 2F1LA 1RAGB 3HHTB 4ZTFA 3A8HB 5EG2A 5GAOl 5CKBA 3I55A 4RUGA 3MP8A 3OS0A 2YUNA 1B3QA 4KT0E 3PT9A 3QHSA 1KG1A 5LJ3d 3EG2A 4DEYA 1SG5A 3FRNA 1JBMA 2CUDA 3REBB 1I5OB 3GLXA 2X3WD 4YTLA 5KCHA 2LNHB 1RL2A 1VQ7T 3ULRB 4LDWA 5CVIA 1BI2A 1Q7YC 2PVOB 1Q82U 1PD1A 2K3YA 1VQ4T 2NUPA 2FG0A 1DJ7B 3OYAA 3FLGA 3UWNA 1CKBA 1SRLA 1H8KA 1JJ2S 3TSWA 1Q7YR 3UA7A 4JJNK 2ABLA 1XOVA 4XTUA 3VS2A 1T3SA 2K5LA 1G3YA 2ZCFB 1SPKA 5GMKe 3CMET 2EWNA 1AZEA 2A37A 3OYBA 4M7DB 1N9SA 2EYWA 1V1CA 2Z0WA 3INZA 1VQKT 2PNIA 3FDRA 4RTWA 4FM4B 3LWIA 4E6RA 4D8DA 1H641 5DLOA 2LCCA 2KRSA 1WXBA 2MPXC 4LE9A 2PZ1A 5L8RE 1LOJA 2RK1A 2K7AA 5C6SA 2AK5A 4FIBA 4M78F 1MNDA 1WGSA 2QQAA 2EYXA 3PVQA 3E2UA 3EG0A 2KGTA 4N4IA 2ENMA 2MI6A 4MMLA 1K73C 5GAN3 3VYGA 5I21A 1UJYA 2IVWA 3CCEQ 1QVPA 1VIFA 2CP5A 1TG0A 2QDLA 3PIPA 1YHQQ 2QASA 1ZUYA 2LJ1A 5LJ5j 1WZOA 2QEXT 1VYVA 2DYIA 5GANf 2QG9B 3D7SB 2KSSA 1UG1A 2DBKA 5GAOm 3F70A 1YBYA 5CKDA 2GQIA 3L2WA 4A54A 2X3XD 4FYVB 1ACMB 4M7AC 1QVGS 3REAB 4N4GA 3CBMA 3CC4A 1IB8A 2HQHA 4M75A 4RTXA 1SSFA 2ZPHB 1VQOQ 1UJ0A 4AFZC 2D8JA 5I2SA 1MMGA 4JDSA 3CCQT 3C94A 4ELZC 4J8OA 1K73U 5GANe 4OVAA 1Q7YU 1ZX6A 5LJ5f 3CXCP 3NFCA 2KE9A 1UTIA 4E7IA 3JCMe 4OMOA 4K11A 4PL6A 4LDYA 3VKIA 3A8LB 1YJ9A 2FPDA 1GL5A 1U3OA 3QZ9B 1WLPB 2EQUA 4LN2A 3QWXX 2M16A 1VQNT 2VASA 1X6BA 3KFVA 4XU3A 4F04B 4F7UE 2YSQA 1X01A 2QI2A 1JRIA 1WPYA 3UDCA 4C0FA 4IUQA 1LJOA 4JZ3A 5FROA 4F14A 2DAQA 1BIAA 4IIOA 4BUGA 4BD3A 3A98A 2KXDA 2J6OA 1I8FA 1WHJA 2LC4A 4E47A 1QKWA 2L5QA 2DX1A 1K9AA 2QA4A 1EX4A 1G5VA 1I0CA 1TWBA 3A8OB 3EGXA 2J6KA 4E7KA 2DEQA 1R8OB 4PJOB 3G4ST 1VQPT 3OMCA 2CP7A 2IG0A 5KYWB 1BI1A 3G4SQ 2D0QB 3G7ZA 1PRLC 3V8JA 1N27A 1NEBA 3M5AA 4JLGA 1BKBA 1RI0A 4JJCA 2F2XA 4OP0A 3C95A 4VUBA 1WJQA 2C0TA 4X1VA 1VQKA 5GAMg 2B86A 3EG9A 3GOXA 3U23A 3BDLA 1G8XA 4FT4A 4ZTJA 3MCAB 5LJ5g 2ATCB 1VQ8Q 3CCRA 2D0NA 2J06A 3CCJQ 2A0FB 4RCCA 2EAYA 4L59A 4QVCA 2E6NA 3CCJT 2OTLA 3EH2A 2DO3A 2BTTA 1GBRA 3LLRA 4M7DF 1SF9A 1UECA 8ATCB 3PNWC 5FWCA 1X69A 5IHNA 4HVUA 2DA9A 1M1KC 2VUBA 2RI3A 3MPUB 4J9HA 3JCMJ 2FEIA 3OW2S 1VQ6A 5D7UA 2AKLA 3M56A 2XU8A 1KHIA 5HY6A 5GJVB 1KC8C 4EPCA 5HKCA 3I55Q 2E3HA 4M7AE 4XTWA 2F2WA 4AFUC 3HP9A 3GNGA 1QVGP 2YHTA 5FU6B 3MJXA 2VXFA 2CKKA 5IAYA 4HXJA 1VQNQ 2NUTB 2ROLA 3EGDB 4MZMA 4XTXA 3IQLA 1C6VX 3CCLQ 4J6WA 3I56T 4ZGEB 2J7IA 3MO8A 1VQMT 4BI8B 1KIKA 3E9FA 1VQNA 4QVDA 4Q5WA 3VRZA 1D1BA 3RMQA 1M2VB 4C8QC 5KYXB 1NZ9A 1PSFA 1Q95G 2JVVA 5GAN5 1KHCA 4CI0C 1KQSP 2OAWA 3X24B 5FLXE 2CYZB 3OYCA 5KH6A 2E64A 2E6ZA 4QQGA 4NS5A 1HXDA 2RJEA 3QSUA 2WSEE 3GF5A 4JZ4A 1BCOA 5KCOA 1MUZA 2YXYA 1I81A 4HVVA 2MWPA 2VC8A 2RH2A 2E41A 4LD9K 1WHGA 2GFAA 5LJ3e 2XDDA 4M7AD 4R56A 4OMQA 1WHLA 1YN8A 1JJ2A 2CH4A 5FU6C 2WSCE 2EQMA 1T3LA 3HFOA 3OY9A 4M78G 4XAXB 3GNFB 2VGMA 2YRDA 1VQLQ 3JCMW 1ZUKA 1WHHA 2X4YA 3CBOA 2DL4A 3GBQA 3JCMc 1W1FA 3JCMg 2GTJA 1YCYA 2GGRA 3DLMA 1RAEB 4GBQA 2PU9B 4M7AG 4C8QB 5IN1A 1GBQA 4C0ZA 2FVUA 1S72Q 2P4RA 1JXOA 2YWWA 1QVGA 1IGQA 1KSWA 3LWHA 2I0NA 1MV3A 1D0YA 4C92A 1ZHIA 4M78D 1GFCA 4XU0A 3I35A 1TOVA 2D8HA 4CC3A 5KE3A 2XDBA 4Z88A 2QQ9A 5AYFA 2D1XA 2RN8A 1YHQT 4PJMA 1ZA1B 2DERA 4PK4A 4M7AA 3RDVA 4FT2A 1P92A 5CK9A 2MF2A 1UE9A 1VQ8T 2EKHA 2B8AA 1YWPA 2JTMA 2FYKA 4MDXA 4N0AC 4ANJA 2LX9A 4C92D 3CPFA 1NJIR 2DTHA 4XU1A 3BDUA 1VQ8A 2DYBA 1T0HA 3HKSA 4ZGJB 1RABB 4P5NA 2CT4A 2RHUA 3RERA 4M7DG 3ZFJA 4OMLA 4LDVA 2CT3A 1K1ZA 1R0BG 1T0JA 2COYA 1Q82C 3M4GA 4J9BA 4ZNXA 2FHDA 2CZ7B 2COWA 5HK0A 3OB9A 4X9CA 1SEMA 1QMCA 4C8QG 1Q82R 3JB9G 4M75E 5FRNA 4M7AF 5KYUB 4MDWA 1EIFA 4N0AA 2RHZA 1PNJA 1M1KR 2L0AA 2J05A 1VQ4Q 3TQ7P 1YITA 3OYKA 3OYDA 3SEMA 3MEWA 3CCVQ 4BACA 1HK9A 5GAOp 2RHXA 3C12A 1GCQC 1K76A 1YJWA 4PJOC 2C06A 5CQXA 4QVZA 3P8DA 3TCJA 3G6ET 4IURA 3TREA 2A36A 4PLLA 3T9NA 1M1FA 1NLPC 3OYYA 2K79A 2JM8A 5GANg 2O4XA 4PFOA 2ZPGB 4M75C 1VYUA 3JB9H 5GAOn 1ZBJA 2DRMA 5GAN4 2W10A 1XJWB 4E2FB 1M1KU 2DFUA 2KXCA 3DB4A 1BB9A 3EFSA 2YT6A 3HSBA 1X27A 1U1TA 4M78E
chains in the Genus database with same CATH topology
2DBKA 2DMOA 3JV3A 1E6HA 2KNBB 1AWWA 2DLPA 2GQIA 2V1RA 2C0IA 1PKSA 1M3CA 2X3XD 1JO8A 3REAB 1E6GA 2DRKA 2A28A 2ECZA 2RQRA 4F17A 2JM9A 4RTXA 1UJ0A 4AFZC 2D8JA 2EGCA 3VRYA 2VWFA 2DVJA 2FPFA 4Z8AA 2CUBA 2EPDA 2DL8A 3LH5A 2KRMA 1YNZA 3VS3A 1ZX6A 2LJ3A 3VS1A 1WXTA 3O5ZA 1WYXA 2KROA 1HD3A 1OEBA 1UTIA 2KE9A 2V1QA 1PWTA 3EG1A 5FW9A 4OMOA 1WDXA 4K11A 1OPKA 1WIEA 4OMNA 3NMZC 2A08A 2FPDA 2RQWA 1J3TA 1GL5A 1U3OA 1WLPB 4LN2A 1G2BA 1A0NB 3QWXX 4J9GA 1X6BA 3KFVA 2K3BA 2DILA 2ED0A 4AG1C 1WXUA 1M27C 3H0IA 4D8KA 1QWFA 1TUCA 2W0ZA 2YSQA 1WFWA 1H92A 1UFFA 4RTZA 2RQUA 4JZ3A 4F14A 2DL3A 1JEGA 2EYYA 2LZ6B 4IIOA 2EQIA 1Z9ZA 3M0TA 2AKKA 2M51A 1JXMA 4RTUA 3A98A 2KXDA 2J6OA 1AWJA 1M3BA 2OI3A 1QKWA 1S1NA 2DX1A 4R0KA 1K9AA 2O2OA 2HSPA 1CKAA 4OMPA 3VS0A 1I0CA 2J6KA 3CQTA 4Y92A 2YUPA 1HSQA 3NGPA 4FSSA 1GFDA 1M3AA 2LCSA 2CSIA 1NG2A 4HCKA 1AOJA 2GBQA 3H0HA 1G83A 1PRLC 1NEBA 2HDAA 1QKXA 2K2MA 2DF6A 3NPFA 1OPLA 4JJCA 2MCNA 2F2XA 2SEMA 2JMAA 3M0PA 2C0TA 5HCKA 4X1VA 1X6GA 2B86A 3U23A 2FRWA 5EC7A 3RNJA 2YUOA 1E7OA 1PHTA 1TUDA 3I9QA 2D0NA 2J06A 2EGEA 1FYNA 2JXBA 2RNAA 4A63B 3VS6A 2OJ2A 2CREA 2CH4W 3ZL7C 2BTTA 1GBRA 1I07A 1VYTA 2LJ0A 2O31A 3EG3A 1AD5A 1UECA 4LUDA 2CSQA 5FWCA 2VKNA 2AZVA 2DL7A 1X69A 2L3SA 4JJDA 2O9SA 2DA9A 4HVUA 2J6FA 3M0SA 5IHNA 1BU1A 2FRYA 4J9HA 4J9CA 4DEXA 2K9GA 2RMOA 3VS7A 2FEIA 4F16A 3TVTA 4IIMA 3M0QA 5I22A 2AKLA 5GJVB 1B07A 2JMCA 4AFQC 1I1JA 1X2KA 4Z89A 1MV0B 3EHRA 2F2WA 4AFUC 1FMKA 4RTVA 1WA7A 1K0XA 2XMFA 5IH2A 1QWEA 1VA7A 1JU5C 2VVKA 3VS4A 1ARKA 2RPNA 1AEYA 2YUQA 2DNUA 4HXJA 4CC4B 3C0CA 2GNCA 4AG2C 2ROLA 1RUWA 2YDLA 2KT8A 1LCKA 1KFZA 1OOTA 1NM7A 1UHFA 2LMJA 3IQLA 1K4US 2E5KA 2J7IA 2SRCA 1KIKA 2PTKA 2L3PA 1UHCA 1RLPC 5IHKA 1NLOC 2H8HA 2O88A 2EVRA 4M4ZA 3VRZA 2KRNA 1Y0MA 1BK2A 2IIMA 2JS2A 1JQQA 4CC2A 4CC7A 2OAWA 1ABOA 1KJWA 3M0UA 2JS0A 2LP5A 1GCPA 2K6DA 4JZ4A 4GLMA 1MUZA 2KEAA 1AWOA 1CSKA 1X43A 5L23A 4HVVA 3EHQA 1AZGB 2ESWA 3PE0A 2NUZA 1W70A 4J9FA 4KRTA 1H3HA 1HJDA 3PVLA 4OMQA 1N5ZA 1YN8A 2CH4A 1U06A 1QCFA 1M8MA 2M0YA 3THKA 4LNPA 1NEGA 4HVWA 2KT1A 1T3LA 4QT7A 2JW4A 1ZLMA 1GCQA 2ED1A 2RQVA 1NYFA 3FJ5A 2FPEA 1PRMC 2BZYA 3NHNA 1YP5A 1AWXA 1ZUKA 3I5RA 4OMMA 1Y57A 2HBWA 1BBZA 1IO6A 5FWBA 2DL4A 3GBQA 1W1FA 3I5SA 1OV3A 2GTJA 2GGRA 1UUEA 4GBQA 1WI7A 2BZ8A 1UDLA 5ECAA 1GBQA 2JT4A 1K0SA 2P4RA 3UF4A 3TSZA 2DJQA 4RUGA 2G6FX 1JXOA 1KSWA 1WX6A 2I0NA 2YUNA 1MV3A 1B3QA 2GTOA 1GFCA 3EG2A 3I35A 2D8HA 2DM1A 4DEYA 4CC3A 1ZSGA 2CUDA 4Z88A 3REBB 1SRMA 2D1XA 2RN8A 2JTEA 2L3QA 2X3WD 2LX7A 4J9DA 2LNHB 3ULRB 1M30A 1UE9A 4ESRA 1QLYA 2EKHA 1YWPA 2DL5A 4LUEA 2MOXA 1W6XA 1SSHA 1PKTA 2FG0A 2KR3A 1EFNA 2F2VA 3M0RA 1SHFA 1GRIA 2DYBA 1CKBA 1T0HA 1SRLA 1H8KA 2O9VA 3TSWA 2CDTA 2LQNA 5IXBA 2EYZA 2CT4A 3UA7A 5IXFA 2ABLA 1XOVA 2RQTA 4OMLA 5GJWB 3VS2A 1T3SA 2CT3A 1AVZC 1K1ZA 1T0JA 3UATA 4J9BA 4ZNXA 3SHWA 4ORZA 1YCSB 1SPKA 2L2PA 1ABQA 1SEMA 3RBBB 3H0FA 2FO0A 1AZEA 3R6NA 2EW3A 2A37A 1RLQC 2C0OA 2DE0X 2BZXA 2EYWA 1ZUUA 1V1CA 1UGVA 3VS5A 2MIOA 4JPBW 2LQWA 4J9IA 2PNIA 4RTWA 3QWYA 4WCIA 1PNJA 4E6RA 4RTTA 5IHIA 2L0AA 4D8DA 2HEQA 2J05A 4J9EA 2KRSA 1WXBA 4LE9A 4AFSC 3SEMA 1YWOA 2PZ1A 2HCKA 2K7AA 2AK5A 1GCQC 1X2QA 1K76A 2KYMA 4JJBA 1U5SA 2EYXA 3PVQA 3EG0A 2KGTA 2A36A 2ENMA 1NLPC 2K79A 1UJYA 4RTYA 2JM8A 1NYGA 1SHGA 2EGAA 1TG0A 1VYUA 2NWMA 2QDLA 1Z9QA 2AZSA 3EGUA 1ZBJA 2DRMA 2EBPA 4EIKA 3UA6A 2W10A 3H41A 2RF0A 1RI9A 1ZUYA 2LJ1A 2ROTA 5I11A 2KXCA 2KBTA 2DBMA 1VYVA 2KYBA 1BB9A 2YT6A 1X27A 1UG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBK A;  2DMO A;  3JV3 A;  1E6H A;  2KNB B;  1AWW A;  2DLP A;  2GQI A;  2V1R A;  2C0I A;  1PKS A;  1M3C A;  2X3X D;  1JO8 A;  3REA B;  1E6G A;  2DRK A;  2A28 A;  2ECZ A;  2RQR A;  4F17 A;  2JM9 A;  4RTX A;  1UJ0 A;  4AFZ C;  2D8J A;  2EGC A;  3VRY A;  2VWF A;  2DVJ A;  2FPF A;  4Z8A A;  2CUB A;  2EPD A;  2DL8 A;  3LH5 A;  2KRM A;  1YNZ A;  3VS3 A;  1ZX6 A;  2LJ3 A;  3VS1 A;  1WXT A;  3O5Z A;  1WYX A;  2KRO A;  1HD3 A;  1OEB A;  1UTI A;  2KE9 A;  2V1Q A;  1PWT A;  3EG1 A;  5FW9 A;  4OMO A;  1WDX A;  4K11 A;  1OPK A;  1WIE A;  4OMN A;  3NMZ C;  2A08 A;  2FPD A;  2RQW A;  1J3T A;  1GL5 A;  1U3O A;  1WLP B;  4LN2 A;  1G2B A;  1A0N B;  3QWX X;  4J9G A;  1X6B A;  3KFV A;  2K3B A;  2DIL A;  2ED0 A;  4AG1 C;  1WXU A;  1M27 C;  3H0I A;  4D8K A;  1QWF A;  1TUC A;  2W0Z A;  2YSQ A;  1WFW A;  1H92 A;  1UFF A;  4RTZ A;  2RQU A;  4JZ3 A;  4F14 A;  2DL3 A;  1JEG A;  2EYY A;  2LZ6 B;  4IIO A;  2EQI A;  1Z9Z A;  3M0T A;  2AKK A;  2M51 A;  1JXM A;  4RTU A;  3A98 A;  2KXD A;  2J6O A;  1AWJ A;  1M3B A;  2OI3 A;  1QKW A;  1S1N A;  2DX1 A;  4R0K A;  1K9A A;  2O2O A;  2HSP A;  1CKA A;  4OMP A;  3VS0 A;  1I0C A;  2J6K A;  3CQT A;  4Y92 A;  2YUP A;  1HSQ A;  3NGP A;  4FSS A;  1GFD A;  1M3A A;  2LCS A;  2CSI A;  1NG2 A;  4HCK A;  1AOJ A;  2GBQ A;  3H0H A;  1G83 A;  1PRL C;  1NEB A;  2HDA A;  1QKX A;  2K2M A;  2DF6 A;  3NPF A;  1OPL A;  4JJC A;  2MCN A;  2F2X A;  2SEM A;  2JMA A;  3M0P A;  2C0T A;  5HCK A;  4X1V A;  1X6G A;  2B86 A;  3U23 A;  2FRW A;  5EC7 A;  3RNJ A;  2YUO A;  1E7O A;  1PHT A;  1TUD A;  3I9Q A;  2D0N A;  2J06 A;  2EGE A;  1FYN A;  2JXB A;  2RNA A;  4A63 B;  3VS6 A;  2OJ2 A;  2CRE A;  2CH4 W;  3ZL7 C;  2BTT A;  1GBR A;  1I07 A;  1VYT A;  2LJ0 A;  2O31 A;  3EG3 A;  1AD5 A;  1UEC A;  4LUD A;  2CSQ A;  5FWC A;  2VKN A;  2AZV A;  2DL7 A;  1X69 A;  2L3S A;  4JJD A;  2O9S A;  2DA9 A;  4HVU A;  2J6F A;  3M0S A;  5IHN A;  1BU1 A;  2FRY A;  4J9H A;  4J9C A;  4DEX A;  2K9G A;  2RMO A;  3VS7 A;  2FEI A;  4F16 A;  3TVT A;  4IIM A;  3M0Q A;  5I22 A;  2AKL A;  5GJV B;  1B07 A;  2JMC A;  4AFQ C;  1I1J A;  1X2K A;  4Z89 A;  1MV0 B;  3EHR A;  2F2W A;  4AFU C;  1FMK A;  4RTV A;  1WA7 A;  1K0X A;  2XMF A;  5IH2 A;  1QWE A;  1VA7 A;  1JU5 C;  2VVK A;  3VS4 A;  1ARK A;  2RPN A;  1AEY A;  2YUQ A;  2DNU A;  4HXJ A;  4CC4 B;  3C0C A;  2GNC A;  4AG2 C;  2ROL A;  1RUW A;  2YDL A;  2KT8 A;  1LCK A;  1KFZ A;  1OOT A;  1NM7 A;  1UHF A;  2LMJ A;  3IQL A;  1K4U S;  2E5K A;  2J7I A;  2SRC A;  1KIK A;  2PTK A;  2L3P A;  1UHC A;  1RLP C;  5IHK A;  1NLO C;  2H8H A;  2O88 A;  2EVR A;  4M4Z A;  3VRZ A;  2KRN A;  1Y0M A;  1BK2 A;  2IIM A;  2JS2 A;  1JQQ A;  4CC2 A;  4CC7 A;  2OAW A;  1ABO A;  1KJW A;  3M0U A;  2JS0 A;  2LP5 A;  1GCP A;  2K6D A;  4JZ4 A;  4GLM A;  1MUZ A;  2KEA A;  1AWO A;  1CSK A;  1X43 A;  5L23 A;  4HVV A;  3EHQ A;  1AZG B;  2ESW A;  3PE0 A;  2NUZ A;  1W70 A;  4J9F A;  4KRT A;  1H3H A;  1HJD A;  3PVL A;  4OMQ A;  1N5Z A;  1YN8 A;  2CH4 A;  1U06 A;  1QCF A;  1M8M A;  2M0Y A;  3THK A;  4LNP A;  1NEG A;  4HVW A;  2KT1 A;  1T3L A;  4QT7 A;  2JW4 A;  1ZLM A;  1GCQ A;  2ED1 A;  2RQV A;  1NYF A;  3FJ5 A;  2FPE A;  1PRM C;  2BZY A;  3NHN A;  1YP5 A;  1AWX A;  1ZUK A;  3I5R A;  4OMM A;  1Y57 A;  2HBW A;  1BBZ A;  1IO6 A;  5FWB A;  2DL4 A;  3GBQ A;  1W1F A;  3I5S A;  1OV3 A;  2GTJ A;  2GGR A;  1UUE A;  4GBQ A;  1WI7 A;  2BZ8 A;  1UDL A;  5ECA A;  1GBQ A;  2JT4 A;  1K0S A;  2P4R A;  3UF4 A;  3TSZ A;  2DJQ A;  4RUG A;  2G6F X;  1JXO A;  1KSW A;  1WX6 A;  2I0N A;  2YUN A;  1MV3 A;  1B3Q A;  2GTO A;  1GFC A;  3EG2 A;  3I35 A;  2D8H A;  2DM1 A;  4DEY A;  4CC3 A;  1ZSG A;  2CUD A;  4Z88 A;  3REB B;  1SRM A;  2D1X A;  2RN8 A;  2JTE A;  2L3Q A;  2X3W D;  2LX7 A;  4J9D A;  2LNH B;  3ULR B;  1M30 A;  1UE9 A;  4ESR A;  1QLY A;  2EKH A;  1YWP A;  2DL5 A;  4LUE A;  2MOX A;  1W6X A;  1SSH A;  1PKT A;  2FG0 A;  2KR3 A;  1EFN A;  2F2V A;  3M0R A;  1SHF A;  1GRI A;  2DYB A;  1CKB A;  1T0H A;  1SRL A;  1H8K A;  2O9V A;  3TSW A;  2CDT A;  2LQN A;  5IXB A;  2EYZ A;  2CT4 A;  3UA7 A;  5IXF A;  2ABL A;  1XOV A;  2RQT A;  4OML A;  5GJW B;  3VS2 A;  1T3S A;  2CT3 A;  1AVZ C;  1K1Z A;  1T0J A;  3UAT A;  4J9B A;  4ZNX A;  3SHW A;  4ORZ A;  1YCS B;  1SPK A;  2L2P A;  1ABQ A;  1SEM A;  3RBB B;  3H0F A;  2FO0 A;  1AZE A;  3R6N A;  2EW3 A;  2A37 A;  1RLQ C;  2C0O A;  2DE0 X;  2BZX A;  2EYW A;  1ZUU A;  1V1C A;  1UGV A;  3VS5 A;  2MIO A;  4JPB W;  2LQW A;  4J9I A;  2PNI A;  4RTW A;  3QWY A;  4WCI A;  1PNJ A;  4E6R A;  4RTT A;  5IHI A;  2L0A A;  4D8D A;  2HEQ A;  2J05 A;  4J9E A;  2KRS A;  1WXB A;  4LE9 A;  4AFS C;  3SEM A;  1YWO A;  2PZ1 A;  2HCK A;  2K7A A;  2AK5 A;  1GCQ C;  1X2Q A;  1K76 A;  2KYM A;  4JJB A;  1U5S A;  2EYX A;  3PVQ A;  3EG0 A;  2KGT A;  2A36 A;  2ENM A;  1NLP C;  2K79 A;  1UJY A;  4RTY A;  2JM8 A;  1NYG A;  1SHG A;  2EGA A;  1TG0 A;  1VYU A;  2NWM A;  2QDL A;  1Z9Q A;  2AZS A;  3EGU A;  1ZBJ A;  2DRM A;  2EBP A;  4EIK A;  3UA6 A;  2W10 A;  3H41 A;  2RF0 A;  1RI9 A;  1ZUY A;  2LJ1 A;  2ROT A;  5I11 A;  2KXC A;  2KBT A;  2DBM A;  1VYV A;  2KYB A;  1BB9 A;  2YT6 A;  1X27 A;  1UG1 A; 
#chains in the Genus database with same CATH topology
 1E6H A;  1V29 B;  2KNB B;  1AWW A;  1YJN A;  3LW5 E;  1FMW A;  3A8M B;  4IUU A;  1M3C A;  2DRK A;  2RQR A;  4F17 A;  2JM9 A;  1PCX A;  1QP3 A;  4KBM B;  3N5B B;  1OYX A;  3G4S A;  3QII A;  1W2B P;  1IXD A;  2DVJ A;  2FPF A;  1VQM A;  2KK4 A;  2OTL Q;  2LNV A;  5IT9 E;  1YI2 A;  3CC7 T;  4M75 D;  2KRM A;  1TU0 B;  3VS3 A;  1WXT A;  1OUL A;  1WYX A;  4IUV A;  4IUT A;  1N9R A;  4J7F A;  1PWT A;  2XD0 A;  3V7C A;  5A2Q E;  1W2B S;  1OPK A;  3UT1 A;  3NMZ C;  1BIB A;  4M77 D;  3OS2 A;  1ZSZ B;  1G2B A;  5KE2 A;  1KD1 R;  5DLQ E;  3PMI A;  2QTX A;  2ZZD A;  4M7D C;  2K3B A;  2DIL A;  4F7U A;  2ED0 A;  4AG1 C;  3X28 B;  1M27 C;  1QWF A;  5KYY A;  1VQP Q;  1ZA2 B;  3SD4 A;  2WAC A;  4BB7 A;  2JOY A;  3EFO B;  4KGZ B;  2KQW A;  4RTZ A;  1TXQ A;  2OTJ T;  2LZ6 B;  2EQI A;  2AKK A;  3PIO A;  3RKY A;  1M3B A;  3ER0 A;  2ZGW A;  2CS7 A;  4R0K A;  2R5A A;  1UEB A;  1NJI C;  4XTV A;  3RKW A;  4BDY A;  2DK3 A;  4C5E A;  4OMP A;  5GAM h;  2FZC B;  3S3M A;  3PFS A;  4TVR A;  4Y92 A;  5D6Y A;  3DB3 A;  3CPW S;  4JUV A;  2CP0 A;  7AT1 B;  4KUI A;  4M7D A;  4QW2 A;  2LCS A;  2RI2 A;  1D1C A;  4BE1 A;  1AOJ A;  2GBQ A;  3H0H A;  2E4H A;  3RES A;  1C1A A;  3OYF A;  1TTH B;  3V8K A;  4AMC A;  1Q81 C;  1M8V A;  2MCN A;  4D6W A;  3QYH B;  2M9U A;  4LD6 A;  1U1S A;  3S6W A;  1X6G A;  1NPR A;  2FZG B;  1Y96 B;  2FRW A;  2JUF A;  3HRS A;  1TUD A;  3I9Q A;  3QJY A;  3G71 Q;  1FX7 A;  2QA4 T;  2JN0 A;  1FYN A;  3VS6 A;  2OJ2 A;  1BI3 A;  3ZL7 C;  3URG A;  4RCB A;  2O31 A;  3EG3 A;  4LUD A;  2CSQ A;  1XTD A;  2VKN A;  2PUK B;  2BIV A;  2AZV A;  4JJD A;  2L3S A;  1QW1 A;  4OB2 B;  1RAC B;  3CCU A;  2K9G A;  3TVT A;  4IUP A;  3V8L A;  2ZPI B;  2HBP A;  2L8D A;  1TH7 A;  1VQ7 A;  3EG9 B;  2JMC A;  4AFQ C;  3OSS C;  4C5G A;  1X2K A;  4Z89 A;  1KQS S;  1FMK A;  4Z02 A;  3A8G B;  4DBH A;  1WA7 A;  2Y90 A;  1K0X A;  3JCM V;  1VA7 A;  2VVK A;  1AEY A;  2RPN A;  1VQO T;  3G1J A;  3JSC A;  3C0C A;  3R6O A;  5KYY B;  3PMT A;  2EFI A;  1LCK A;  1KFZ A;  1NM7 A;  1K4U S;  2MYS A;  3QXE B;  5KYU A;  4C0D C;  1AHJ B;  2PTK A;  3DKM A;  1RLP C;  4M77 E;  4L6V 5;  3JCM h;  4EMK A;  3Q1J A;  4ZN1 A;  1SKU B;  3OYM A;  1H3Z A;  2XIC A;  2O4X B;  1Y0M A;  2HZY A;  4PJO F;  5FU7 B;  2IIM A;  2K2V A;  2GCX A;  4JRQ A;  4LDU A;  2HL3 A;  2QQS A;  4C0G A;  2P0Q A;  3KXT A;  3KBG A;  3VYH B;  3CCQ A;  2KEA A;  3I56 Q;  1VQ5 T;  3EHQ A;  4M75 F;  2GQV A;  3HRT A;  2HAX A;  3PE0 A;  2NUZ A;  3L2R A;  4RG8 A;  2DTI A;  2YRV A;  3CEY A;  1RAF B;  4KRT A;  5GMK m;  1H3H A;  1VQP A;  3CCS T;  3EGX B;  3JRZ A;  3OYE A;  1M8M A;  1QCF A;  4JS5 A;  1QCO A;  2M0Y A;  2QEX A;  2DVE A;  1W4S A;  3SWN A;  3QYG B;  3OYJ A;  1ZLM A;  3FJ5 A;  1AT1 B;  2JZ2 A;  3CCS Q;  1R0C B;  1PRM C;  3HL8 A;  3NTI A;  3J7A F;  4B9W A;  3I5R A;  1IO6 A;  4B9X A;  1KD1 U;  5FWB A;  1Y07 A;  1UUE A;  1UGP B;  2LT4 A;  2JT4 A;  3OS5 A;  1K0S A;  3VV0 A;  4M7D E;  3RUX A;  3UF4 A;  3JCM P;  3MEV A;  3TSZ A;  4C92 G;  5GAN d;  1D1A A;  1WX6 A;  1PD0 A;  3CCM T;  2HD0 A;  3GP8 A;  3HTR A;  1MMN A;  2CGH A;  4EMH A;  3CMA Q;  3CPW P;  1TSF A;  3OYL A;  2QXF A;  2DM1 A;  2RI5 A;  3V7R A;  3DLL A;  3OA6 A;  2CP3 A;  5GAO r;  3CCM Q;  4PKC C;  4J9D A;  2F69 A;  1WHK A;  5CO7 A;  4Y91 A;  4ESR A;  1MGQ A;  5GAN 6;  3MP1 A;  2DL5 A;  5GMK i;  3QO3 A;  4ZN3 A;  2MOX A;  1W6X A;  5GMK h;  3C4S A;  1SSH A;  2P4T A;  2F2V A;  3ME9 A;  1WQ7 A;  2O9V A;  3CD6 A;  5I2M A;  3G71 A;  3P8B B;  1Q81 R;  2CDT A;  5IXB A;  5GAM j;  2EYZ A;  3QG1 A;  5IXF A;  1K9M C;  2RQT A;  4IKF A;  4J6Y A;  3HFN A;  5LJ3 j;  1MHN A;  1N6A A;  3TU4 K;  4KH1 B;  5GJW B;  1AVZ C;  1N8R C;  3UAT A;  4GY5 A;  4PJL A;  2XKO C;  3PTA A;  2RJD A;  2L2P A;  1YIJ A;  3RBB B;  1HYO A;  1MMD A;  2Y4X A;  2XHC A;  3R6N A;  2EW3 A;  1NPP A;  1RLQ C;  2C0O A;  4KH0 B;  3BFM A;  1N8R R;  3LGF A;  1UGV A;  3VS5 A;  5J39 A;  4KUD K;  2MIO A;  3RR6 A;  1UGQ B;  4J9I A;  1D0X A;  4BI4 A;  3QWY A;  1WHM A;  2KDS A;  1NJI U;  2DZC A;  4BE2 A;  4RTT A;  2EYQ A;  5IHI A;  2MMP A;  1M5Q 1;  1RAD B;  4J6X A;  2DIG A;  1U8R A;  2DZ9 A;  1I4K 1;  2HCK A;  4F7U G;  2HQE A;  2F5T X;  2RA2 A;  3CCR T;  3BW1 A;  1X2Q A;  4JJB A;  4OF1 A;  1Y96 A;  4FSX A;  3CC2 Q;  4F7U B;  2YRC A;  3CCL A;  1NYG A;  2BKD N;  1SHG A;  2NUP B;  1LVK A;  2NWM A;  2AT1 B;  3CC2 T;  2AZS A;  1VQL A;  2EBP A;  3CXC S;  3UA6 A;  2XID A;  5GMK j;  2P84 A;  3H41 A;  2RF0 A;  1RI9 A;  1D3B A;  1BCM A;  4HCZ A;  5I11 A;  3V7S A;  4DBQ A;  2KYB A;  1VQK Q;  4PLI A;  1M9S A;  1Y7X A;  4II1 A;  5GAM e;  5CIU A;  2C0I A;  3OYH A;  3CME Q;  3M54 A;  4ATO A;  3CCQ Q;  2QYZ A;  3M9Q A;  4E7H A;  1E6G A;  2DJZ A;  2NUT A;  3J81 E;  4FL6 A;  1R77 A;  2M0O A;  4M77 C;  3OMG A;  1IZ6 A;  2X4J A;  4PJN A;  1X6O A;  4LDX A;  2LTO A;  4RMO A;  1WQW A;  4M75 B;  4NL2 A;  3MEU A;  3TEE A;  4DBF A;  2CUB A;  2DPP B;  4N4H A;  2R57 A;  2EQJ A;  2L89 A;  1KQS A;  2DL8 A;  3LH5 A;  1QVF P;  4L5G A;  3SDZ A;  5D6X A;  3UPU A;  3LX7 A;  4PJO A;  1HD3 A;  1OEB A;  1PM3 A;  2V1Q A;  5FW9 A;  1WJS A;  4PJO D;  1WDX A;  2MK5 A;  1WIE A;  3CCS A;  4OMN A;  5CQY A;  1YFN A;  1M90 C;  2LCL A;  2CZ0 B;  4EMK B;  4M7A B;  4EMG A;  2JTF A;  4MMK A;  2E3I A;  1A0N B;  1EZZ B;  4C92 B;  2HKQ B;  4J9G A;  1KC8 R;  1PG5 B;  2CP2 A;  1Q86 C;  1WXU A;  3RIR A;  4D8K A;  2W0Z A;  3FIF A;  5LJ3 g;  1XQH A;  2DKG A;  4KGV B;  1JEG A;  2EYY A;  2DXB A;  3M0T A;  2M51 A;  2DEU A;  1JXM A;  2V26 A;  4RTU A;  3BY7 A;  5HK3 A;  2ZPB B;  3JCM b;  1S1N A;  1VQL T;  4FU6 A;  3QPH A;  2V8K A;  3G71 T;  4MZP A;  2XI9 A;  2NYS A;  3VS0 A;  1LPL A;  1PC0 A;  2E5Q A;  3CQT A;  5LJ3 f;  2YUP A;  3PGG A;  2VYT A;  2V8J A;  4M77 B;  4OGC A;  5LJ5 h;  2XK0 A;  2QQR A;  4FSS A;  4ME7 A;  5GAN 8;  1M3A A;  3CCE A;  2EIF A;  2CSI A;  2H3E B;  1GXI E;  1NG2 A;  3LYI A;  4HCK A;  3LH0 A;  1FWZ A;  2F5K A;  2KY9 A;  2KVQ G;  3NTH A;  4F7U F;  2HDA A;  1O75 A;  1QKX A;  5J3B A;  3GPL A;  4XTY A;  4J5Y A;  3I55 T;  2DF6 A;  5CR2 A;  3EAE A;  4HA8 A;  2SEM A;  2JMA A;  3M0P A;  3QDR B;  5HCK A;  1YIJ Q;  3RNJ A;  4E7L A;  2YUO A;  1E7O A;  1PHT A;  1YIJ T;  1KD1 C;  3G6E Q;  1K73 R;  1VQO A;  2CH4 W;  3I56 A;  1KK7 A;  3E9G A;  4X34 A;  1I07 A;  5KYX A;  1VYT A;  2LJ0 A;  5AT1 B;  4A4H A;  3CCV A;  3E19 A;  3JB9 J;  2MAM A;  4GLK A;  2DL7 A;  2O9S A;  2VGN A;  3M0S A;  3GIB A;  1C0M A;  1BU1 A;  2DXC A;  4C5H A;  4J9C A;  2RMO A;  3SB2 A;  4F16 A;  4XTZ A;  2RM4 A;  4IIM A;  4DQ2 A;  3M0Q A;  5I22 A;  2V8I A;  1K8A C;  4A4E A;  3BE3 A;  5DM7 R;  3CCU T;  1TUG B;  2OTJ Q;  2LQ8 A;  1I1J A;  5GAN h;  2G3R A;  1OQK A;  2QK0 A;  4C92 C;  3OSV A;  5IH2 A;  1UGR B;  4A4F A;  1QWE A;  3VS4 A;  4AT1 B;  3CCL T;  2YUQ A;  4RKU E;  2RD1 A;  3FB9 A;  4CC4 B;  2RJF A;  1Y71 A;  3LGL A;  4AG2 C;  1BI0 A;  4OB3 B;  2YDL A;  4Y28 E;  2LRQ A;  1OZ3 A;  3AHU A;  3OYI A;  2H8H A;  2M1H A;  2QAZ A;  4E7S A;  4M4Z A;  2P0K A;  2FZK B;  4C5I A;  1Q86 R;  2E12 A;  3VUB A;  2VB6 A;  1BK2 A;  4O6J A;  2JS2 A;  1JQQ A;  2K5I A;  1ABO A;  3JAM E;  3M0U A;  4V2S A;  2LP5 A;  3CCJ A;  2K6D A;  4GLM A;  1B7T A;  1I5L A;  2X51 A;  1CSK A;  1F1B B;  4M77 F;  2QEX Q;  5L23 A;  1AZG B;  2ESW A;  4DOV A;  4KUL A;  5GAO q;  2KAF A;  1ZQ1 A;  4J9F A;  1UB4 A;  1W2B A;  3X25 B;  2XDP A;  4BY6 C;  2IPO B;  4M77 G;  1Q86 U;  4M75 G;  3OBW A;  1KQ2 A;  4HCC A;  1VQ9 T;  2PUO B;  3THK A;  5GAN 2;  3MHX A;  2KT1 A;  1GCQ A;  1VQ9 Q;  2ED1 A;  4MZT A;  2RQV A;  2BE9 B;  4FYW B;  3NHN A;  1YP5 A;  1AWX A;  3QBY A;  4XK8 E;  4ZGD B;  1V76 A;  4CRI A;  2LVM A;  3CC7 A;  2ZPE B;  3L1A A;  1BBZ A;  2LQK A;  3I5S A;  1OV3 A;  1VQ9 A;  1WI7 A;  2DD4 A;  1YIT Q;  4PFP A;  3CCM A;  1UDL A;  5ECA A;  3M53 A;  1OU9 A;  3EFO A;  3M4Y A;  3X26 B;  2DJQ A;  2G6F X;  4C8Q D;  4OB1 B;  3OBY A;  1YJ9 T;  2X35 A;  2HNI A;  1OX8 A;  3AT1 B;  2GTO A;  2RB6 A;  4C92 F;  3H9N A;  4OB0 B;  2JNG A;  1ZSG A;  3JCM f;  3HPW A;  6AT1 B;  3CME A;  4HT9 A;  5C0M A;  5GAM d;  1SRM A;  3L2Z A;  3VUZ A;  2JTE A;  2L3Q A;  2LX7 A;  2QA4 Q;  1M30 A;  1QLY A;  2FL7 A;  1QQJ A;  5CCA A;  1IRE B;  2O01 E;  1N8R U;  1QCN A;  4LUE A;  1PKT A;  2KR3 A;  1EFN A;  4C8Q A;  2GFU A;  3M0R A;  2OTL T;  1SHF A;  2K5F A;  1GRI A;  3X20 B;  3OW2 A;  2LQN A;  4BE0 A;  3G6E A;  1BYM A;  3M58 A;  3M59 A;  4UC4 A;  1UGS B;  1IHW A;  1RAI B;  3A5Z B;  1IHV A;  3SHW A;  4ORZ A;  1YCS B;  1ABQ A;  4ELY C;  1M90 R;  5A0G A;  3H0F A;  2FO0 A;  1TS9 A;  4A53 A;  3CCU Q;  2E70 A;  5GAN j;  2DE0 X;  2BZX A;  1YJW Q;  2OTJ A;  1YI2 Q;  1ZUU A;  4FYX B;  4M77 A;  1OZ2 A;  3MKD A;  4JPB W;  2LQW A;  3RKX A;  2RK2 A;  4E7Z A;  4WCI A;  3FEO A;  1NBE B;  2EJG A;  1YJW T;  2QQB A;  2HEQ A;  2KMT A;  4FYY B;  2RJC A;  2OAU A;  4OMF B;  4J9E A;  1MNE A;  4AFS C;  1YWO A;  1D0Z A;  2DXU A;  2QTV A;  2NLU A;  1S72 A;  4JLI A;  3OYG A;  2KYM A;  1U5S A;  2DTO A;  4PJO E;  5FU7 C;  1YHQ A;  2HKN A;  2LDM A;  4JS4 A;  2BE7 D;  4RTY A;  5J26 A;  1VQ5 Q;  1K9M U;  3CC7 Q;  1XNI A;  3CMA T;  2EGA A;  4C8Q F;  2QDY B;  1Z9Q A;  3EGU A;  4C0D B;  4EIK A;  4LXC A;  5GAN 7;  1VQ6 T;  2X4X A;  3VJP A;  1VIE A;  1QP2 A;  3VU3 C;  1M4Z A;  2ROT A;  2QGF B;  2KBT A;  5DY9 A;  3RMS A;  2DBM A;  1QVF S;  4BY6 B;  5LJ3 h;  1OU8 A;  4B6M A;  2DMO A;  3JV3 A;  3JB9 D;  2BUD A;  2DLP A;  2V1R A;  4XQ3 A;  5KYN A;  1PKS A;  1JO8 A;  2ECZ A;  2A28 A;  3S3N A;  4HT8 A;  4J7I A;  2EGC A;  3VRY A;  2VWF A;  3QDF A;  4BDZ A;  3E1S A;  4Z8A A;  2X4W A;  2EPD A;  1FXX A;  3WVD B;  3OS1 A;  1YNZ A;  2VXE A;  2LJ3 A;  3VS1 A;  3O5Z A;  1M1G A;  2KRO A;  4FW2 A;  3EG1 A;  1K8A U;  3CD6 Q;  5CAI A;  4JRP A;  4C8Q E;  3J80 E;  1M2V A;  4O5V A;  2A08 A;  2RHY A;  2RQW A;  3CC2 A;  1J3T A;  3CCR Q;  1VQ5 A;  3FC3 A;  3OQ5 A;  1LNX A;  2L3R A;  1OX9 A;  4M78 C;  1YIT T;  2FB7 A;  5D6W A;  2M02 A;  3H0I A;  2JJ9 A;  1TUC A;  4QQ6 A;  4WF2 A;  4HCB A;  1WFW A;  2HMA A;  1G3S A;  2X9H A;  3L2V A;  2CP6 A;  1H92 A;  9ATC B;  3KUF A;  1UFF A;  3L42 A;  3CCV T;  1NE8 A;  2CZ6 B;  2RQU A;  2DL3 A;  2EQK A;  1K8A R;  2I2L A;  1Z9Z A;  1JB0 E;  5A0D A;  2DD5 A;  5KYW A;  1AWJ A;  2OI3 A;  2AHJ B;  1M2O A;  2O2O A;  2HSP A;  2XG8 D;  3NTK A;  1CKA A;  3JCM d;  1O9S A;  1B34 A;  2PVD B;  4FCY A;  3WXM B;  1HSQ A;  1RAA B;  1MMA A;  3NGP A;  2D9T A;  3M57 A;  4BI3 A;  1GFD A;  2E1H A;  2WSF E;  2DIQ A;  1B34 B;  3EH1 A;  2GF7 A;  2PQW A;  3SWN C;  3CPW A;  1G83 A;  1PSE A;  2MWO A;  2EJ9 A;  4RG2 A;  3ASK A;  4QQD A;  2KI7 A;  2K2M A;  5A0L A;  3NPF A;  2A7Y A;  1OPL A;  5GMK l;  3HRU A;  3QUI A;  3H6Z A;  5EC7 A;  3O8V A;  3JB9 F;  3OYN A;  2VV5 A;  1S72 T;  4E7J A;  4M7D D;  4KGX B;  2EGE A;  3M55 A;  1YJ9 Q;  2JXB A;  2RNA A;  4A63 B;  2CRE A;  4DA4 A;  4C92 E;  4M78 B;  4FW1 A;  2D6F A;  3CBP A;  3CCE T;  1AD5 A;  4A4K A;  1D3B B;  3P8H A;  2J6F A;  2E10 A;  1YJN T;  1M90 U;  3CD6 T;  2FRY A;  1WJR A;  2A3L A;  4DEX A;  1JJ2 P;  3VS7 A;  1WNL A;  2OX7 A;  2R58 A;  3JCM X;  3SFM A;  2QGG A;  4QKU A;  3EGD A;  3WVE B;  2HSE B;  4PJO G;  2RHI A;  1B07 A;  4XU2 A;  1KQ1 A;  8AT1 B;  2CZ1 B;  1MV0 B;  2COZ A;  3EHR A;  4NOY A;  2EJF A;  2DXT A;  4R55 A;  1KC8 U;  4RTV A;  4X9D A;  2XMF A;  5CKH A;  2PVG B;  1JU5 C;  3CXC A;  1ARK A;  1VQ6 Q;  2YLB A;  2DNU A;  3CC4 T;  2HQX A;  1G3W A;  1Q81 U;  3JB9 I;  2GNC A;  2ZAE A;  1RUW A;  2KT8 A;  3SWN B;  1K9M R;  1OOT A;  1UHF A;  2LMJ A;  3CC4 Q;  1D09 B;  4JRI A;  5M9O A;  5GAM f;  1VQ7 Q;  3MET A;  2E5K A;  3MP6 A;  2SRC A;  2HL5 C;  2L3P A;  1UHC A;  4OGE A;  5IHK A;  1NLO C;  2O88 A;  2P0P A;  2EVR A;  3CMA A;  2KRN A;  4M78 A;  4PJJ A;  3A1P A;  4CC2 A;  4CC7 A;  2RO0 A;  1IRX A;  2YLC A;  5FRM A;  1KJW A;  2JS0 A;  2H3J A;  1X75 C;  1GCP A;  5LJ5 e;  2EKO A;  1YJN Q;  3L2U A;  1G3T A;  1VUB A;  1RAH B;  4DBR A;  1AWO A;  5CKE A;  2K57 A;  1X43 A;  3ZBD A;  1FMV A;  4J83 A;  5LJ5 d;  5LL6 S;  1VQ4 A;  3QKJ A;  3EFR A;  4NL3 A;  3H8Z A;  2LT1 A;  1W70 A;  1VQM Q;  1ZSZ A;  3MEA A;  3QJ6 A;  2Y4Y A;  4EMK C;  1ZSZ C;  2AIR B;  1HJD A;  3PVL A;  1N5Z A;  1ZBX A;  4EDU A;  1U06 A;  1QVF A;  2R5M A;  4LNP A;  1IGU A;  1NEG A;  4HVW A;  4JRK A;  4A4G A;  1YI2 T;  2K3X A;  4QT7 A;  2JW4 A;  4PNO A;  1NYF A;  1VOM A;  2FPE A;  4WTO B;  3OW2 P;  3ZEH A;  2DET A;  2BZY A;  3QZ5 B;  3JCM Q;  2ZPF B;  4PFZ A;  3S3O A;  3FJP A;  4OMM A;  1Y57 A;  2HBW A;  4DOW A;  3L2Q A;  5CKF A;  1OI1 A;  2K4Y A;  2E65 A;  2BZ8 A;  4HKE A;  2F1L A;  1RAG B;  3HHT B;  4ZTF A;  3A8H B;  5EG2 A;  5GAO l;  5CKB A;  3I55 A;  4RUG A;  3MP8 A;  3OS0 A;  2YUN A;  1B3Q A;  4KT0 E;  3PT9 A;  3QHS A;  1KG1 A;  5LJ3 d;  3EG2 A;  4DEY A;  1SG5 A;  3FRN A;  1JBM A;  2CUD A;  3REB B;  1I5O B;  3GLX A;  2X3W D;  4YTL A;  5KCH A;  2LNH B;  1RL2 A;  1VQ7 T;  3ULR B;  4LDW A;  5CVI A;  1BI2 A;  1Q7Y C;  2PVO B;  1Q82 U;  1PD1 A;  2K3Y A;  1VQ4 T;  2NUP A;  2FG0 A;  1DJ7 B;  3OYA A;  3FLG A;  3UWN A;  1CKB A;  1SRL A;  1H8K A;  1JJ2 S;  3TSW A;  1Q7Y R;  3UA7 A;  4JJN K;  2ABL A;  1XOV A;  4XTU A;  3VS2 A;  1T3S A;  2K5L A;  1G3Y A;  2ZCF B;  1SPK A;  5GMK e;  3CME T;  2EWN A;  1AZE A;  2A37 A;  3OYB A;  4M7D B;  1N9S A;  2EYW A;  1V1C A;  2Z0W A;  3INZ A;  1VQK T;  2PNI A;  3FDR A;  4RTW A;  4FM4 B;  3LWI A;  4E6R A;  4D8D A;  1H64 1;  5DLO A;  2LCC A;  2KRS A;  1WXB A;  2MPX C;  4LE9 A;  2PZ1 A;  5L8R E;  1LOJ A;  2RK1 A;  2K7A A;  5C6S A;  2AK5 A;  4FIB A;  4M78 F;  1MND A;  1WGS A;  2QQA A;  2EYX A;  3PVQ A;  3E2U A;  3EG0 A;  2KGT A;  4N4I A;  2ENM A;  2MI6 A;  4MML A;  1K73 C;  5GAN 3;  3VYG A;  5I21 A;  1UJY A;  2IVW A;  3CCE Q;  1QVP A;  1VIF A;  2CP5 A;  1TG0 A;  2QDL A;  3PIP A;  1YHQ Q;  2QAS A;  1ZUY A;  2LJ1 A;  5LJ5 j;  1WZO A;  2QEX T;  1VYV A;  2DYI A;  5GAN f;  2QG9 B;  3D7S B;  2KSS A;  1UG1 A;  2DBK A;  5GAO m;  3F70 A;  1YBY A;  5CKD A;  2GQI A;  3L2W A;  4A54 A;  2X3X D;  4FYV B;  1ACM B;  4M7A C;  1QVG S;  3REA B;  4N4G A;  3CBM A;  3CC4 A;  1IB8 A;  2HQH A;  4M75 A;  4RTX A;  1SSF A;  2ZPH B;  1VQO Q;  1UJ0 A;  4AFZ C;  2D8J A;  5I2S A;  1MMG A;  4JDS A;  3CCQ T;  3C94 A;  4ELZ C;  4J8O A;  1K73 U;  5GAN e;  4OVA A;  1Q7Y U;  1ZX6 A;  5LJ5 f;  3CXC P;  3NFC A;  2KE9 A;  1UTI A;  4E7I A;  3JCM e;  4OMO A;  4K11 A;  4PL6 A;  4LDY A;  3VKI A;  3A8L B;  1YJ9 A;  2FPD A;  1GL5 A;  1U3O A;  3QZ9 B;  1WLP B;  2EQU A;  4LN2 A;  3QWX X;  2M16 A;  1VQN T;  2VAS A;  1X6B A;  3KFV A;  4XU3 A;  4F04 B;  4F7U E;  2YSQ A;  1X01 A;  2QI2 A;  1JRI A;  1WPY A;  3UDC A;  4C0F A;  4IUQ A;  1LJO A;  4JZ3 A;  5FRO A;  4F14 A;  2DAQ A;  1BIA A;  4IIO A;  4BUG A;  4BD3 A;  3A98 A;  2KXD A;  2J6O A;  1I8F A;  1WHJ A;  2LC4 A;  4E47 A;  1QKW A;  2L5Q A;  2DX1 A;  1K9A A;  2QA4 A;  1EX4 A;  1G5V A;  1I0C A;  1TWB A;  3A8O B;  3EGX A;  2J6K A;  4E7K A;  2DEQ A;  1R8O B;  4PJO B;  3G4S T;  1VQP T;  3OMC A;  2CP7 A;  2IG0 A;  5KYW B;  1BI1 A;  3G4S Q;  2D0Q B;  3G7Z A;  1PRL C;  3V8J A;  1N27 A;  1NEB A;  3M5A A;  4JLG A;  1BKB A;  1RI0 A;  4JJC A;  2F2X A;  4OP0 A;  3C95 A;  4VUB A;  1WJQ A;  2C0T A;  4X1V A;  1VQK A;  5GAM g;  2B86 A;  3EG9 A;  3GOX A;  3U23 A;  3BDL A;  1G8X A;  4FT4 A;  4ZTJ A;  3MCA B;  5LJ5 g;  2ATC B;  1VQ8 Q;  3CCR A;  2D0N A;  2J06 A;  3CCJ Q;  2A0F B;  4RCC A;  2EAY A;  4L59 A;  4QVC A;  2E6N A;  3CCJ T;  2OTL A;  3EH2 A;  2DO3 A;  2BTT A;  1GBR A;  3LLR A;  4M7D F;  1SF9 A;  1UEC A;  8ATC B;  3PNW C;  5FWC A;  1X69 A;  5IHN A;  4HVU A;  2DA9 A;  1M1K C;  2VUB A;  2RI3 A;  3MPU B;  4J9H A;  3JCM J;  2FEI A;  3OW2 S;  1VQ6 A;  5D7U A;  2AKL A;  3M56 A;  2XU8 A;  1KHI A;  5HY6 A;  5GJV B;  1KC8 C;  4EPC A;  5HKC A;  3I55 Q;  2E3H A;  4M7A E;  4XTW A;  2F2W A;  4AFU C;  3HP9 A;  3GNG A;  1QVG P;  2YHT A;  5FU6 B;  3MJX A;  2VXF A;  2CKK A;  5IAY A;  4HXJ A;  1VQN Q;  2NUT B;  2ROL A;  3EGD B;  4MZM A;  4XTX A;  3IQL A;  1C6V X;  3CCL Q;  4J6W A;  3I56 T;  4ZGE B;  2J7I A;  3MO8 A;  1VQM T;  4BI8 B;  1KIK A;  3E9F A;  1VQN A;  4QVD A;  4Q5W A;  3VRZ A;  1D1B A;  3RMQ A;  1M2V B;  4C8Q C;  5KYX B;  1NZ9 A;  1PSF A;  1Q95 G;  2JVV A;  5GAN 5;  1KHC A;  4CI0 C;  1KQS P;  2OAW A;  3X24 B;  5FLX E;  2CYZ B;  3OYC A;  5KH6 A;  2E64 A;  2E6Z A;  4QQG A;  4NS5 A;  1HXD A;  2RJE A;  3QSU A;  2WSE E;  3GF5 A;  4JZ4 A;  1BCO A;  5KCO A;  1MUZ A;  2YXY A;  1I81 A;  4HVV A;  2MWP A;  2VC8 A;  2RH2 A;  2E41 A;  4LD9 K;  1WHG A;  2GFA A;  5LJ3 e;  2XDD A;  4M7A D;  4R56 A;  4OMQ A;  1WHL A;  1YN8 A;  1JJ2 A;  2CH4 A;  5FU6 C;  2WSC E;  2EQM A;  1T3L A;  3HFO A;  3OY9 A;  4M78 G;  4XAX B;  3GNF B;  2VGM A;  2YRD A;  1VQL Q;  3JCM W;  1ZUK A;  1WHH A;  2X4Y A;  3CBO A;  2DL4 A;  3GBQ A;  3JCM c;  1W1F A;  3JCM g;  2GTJ A;  1YCY A;  2GGR A;  3DLM A;  1RAE B;  4GBQ A;  2PU9 B;  4M7A G;  4C8Q B;  5IN1 A;  1GBQ A;  4C0Z A;  2FVU A;  1S72 Q;  2P4R A;  1JXO A;  2YWW A;  1QVG A;  1IGQ A;  1KSW A;  3LWH A;  2I0N A;  1MV3 A;  1D0Y A;  4C92 A;  1ZHI A;  4M78 D;  1GFC A;  4XU0 A;  3I35 A;  1TOV A;  2D8H A;  4CC3 A;  5KE3 A;  2XDB A;  4Z88 A;  2QQ9 A;  5AYF A;  2D1X A;  2RN8 A;  1YHQ T;  4PJM A;  1ZA1 B;  2DER A;  4PK4 A;  4M7A A;  3RDV A;  4FT2 A;  1P92 A;  5CK9 A;  2MF2 A;  1UE9 A;  1VQ8 T;  2EKH A;  2B8A A;  1YWP A;  2JTM A;  2FYK A;  4MDX A;  4N0A C;  4ANJ A;  2LX9 A;  4C92 D;  3CPF A;  1NJI R;  2DTH A;  4XU1 A;  3BDU A;  1VQ8 A;  2DYB A;  1T0H A;  3HKS A;  4ZGJ B;  1RAB B;  4P5N A;  2CT4 A;  2RHU A;  3RER A;  4M7D G;  3ZFJ A;  4OML A;  4LDV A;  2CT3 A;  1K1Z A;  1R0B G;  1T0J A;  2COY A;  1Q82 C;  3M4G A;  4J9B A;  4ZNX A;  2FHD A;  2CZ7 B;  2COW A;  5HK0 A;  3OB9 A;  4X9C A;  1SEM A;  1QMC A;  4C8Q G;  1Q82 R;  3JB9 G;  4M75 E;  5FRN A;  4M7A F;  5KYU B;  4MDW A;  1EIF A;  4N0A A;  2RHZ A;  1PNJ A;  1M1K R;  2L0A A;  2J05 A;  1VQ4 Q;  3TQ7 P;  1YIT A;  3OYK A;  3OYD A;  3SEM A;  3MEW A;  3CCV Q;  4BAC A;  1HK9 A;  5GAO p;  2RHX A;  3C12 A;  1GCQ C;  1K76 A;  1YJW A;  4PJO C;  2C06 A;  5CQX A;  4QVZ A;  3P8D A;  3TCJ A;  3G6E T;  4IUR A;  3TRE A;  2A36 A;  4PLL A;  3T9N A;  1M1F A;  1NLP C;  3OYY A;  2K79 A;  2JM8 A;  5GAN g;  2O4X A;  4PFO A;  2ZPG B;  4M75 C;  1VYU A;  3JB9 H;  5GAO n;  1ZBJ A;  2DRM A;  5GAN 4;  2W10 A;  1XJW B;  4E2F B;  1M1K U;  2DFU A;  2KXC A;  3DB4 A;  1BB9 A;  3EFS A;  2YT6 A;  3HSB A;  1X27 A;  1U1T A;  4M78 E; 
#chains in the Genus database with same CATH homology
 2DBK A;  2DMO A;  3JV3 A;  1E6H A;  2KNB B;  1AWW A;  2DLP A;  2GQI A;  2V1R A;  2C0I A;  1PKS A;  1M3C A;  2X3X D;  1JO8 A;  3REA B;  1E6G A;  2DRK A;  2A28 A;  2ECZ A;  2RQR A;  4F17 A;  2JM9 A;  4RTX A;  1UJ0 A;  4AFZ C;  2D8J A;  2EGC A;  3VRY A;  2VWF A;  2DVJ A;  2FPF A;  4Z8A A;  2CUB A;  2EPD A;  2DL8 A;  3LH5 A;  2KRM A;  1YNZ A;  3VS3 A;  1ZX6 A;  2LJ3 A;  3VS1 A;  1WXT A;  3O5Z A;  1WYX A;  2KRO A;  1HD3 A;  1OEB A;  1UTI A;  2KE9 A;  2V1Q A;  1PWT A;  3EG1 A;  5FW9 A;  4OMO A;  1WDX A;  4K11 A;  1OPK A;  1WIE A;  4OMN A;  3NMZ C;  2A08 A;  2FPD A;  2RQW A;  1J3T A;  1GL5 A;  1U3O A;  1WLP B;  4LN2 A;  1G2B A;  1A0N B;  3QWX X;  4J9G A;  1X6B A;  3KFV A;  2K3B A;  2DIL A;  2ED0 A;  4AG1 C;  1WXU A;  1M27 C;  3H0I A;  4D8K A;  1QWF A;  1TUC A;  2W0Z A;  2YSQ A;  1WFW A;  1H92 A;  1UFF A;  4RTZ A;  2RQU A;  4JZ3 A;  4F14 A;  2DL3 A;  1JEG A;  2EYY A;  2LZ6 B;  4IIO A;  2EQI A;  1Z9Z A;  3M0T A;  2AKK A;  2M51 A;  1JXM A;  4RTU A;  3A98 A;  2KXD A;  2J6O A;  1AWJ A;  1M3B A;  2OI3 A;  1QKW A;  1S1N A;  2DX1 A;  4R0K A;  1K9A A;  2O2O A;  2HSP A;  1CKA A;  4OMP A;  3VS0 A;  1I0C A;  2J6K A;  3CQT A;  4Y92 A;  2YUP A;  1HSQ A;  3NGP A;  4FSS A;  1GFD A;  1M3A A;  2LCS A;  2CSI A;  1NG2 A;  4HCK A;  1AOJ A;  2GBQ A;  3H0H A;  1G83 A;  1PRL C;  1NEB A;  2HDA A;  1QKX A;  2K2M A;  2DF6 A;  3NPF A;  1OPL A;  4JJC A;  2MCN A;  2F2X A;  2SEM A;  2JMA A;  3M0P A;  2C0T A;  5HCK A;  4X1V A;  1X6G A;  2B86 A;  3U23 A;  2FRW A;  5EC7 A;  3RNJ A;  2YUO A;  1E7O A;  1PHT A;  1TUD A;  3I9Q A;  2D0N A;  2J06 A;  2EGE A;  1FYN A;  2JXB A;  2RNA A;  4A63 B;  3VS6 A;  2OJ2 A;  2CRE A;  2CH4 W;  3ZL7 C;  2BTT A;  1GBR A;  1I07 A;  1VYT A;  2LJ0 A;  2O31 A;  3EG3 A;  1AD5 A;  1UEC A;  4LUD A;  2CSQ A;  5FWC A;  2VKN A;  2AZV A;  2DL7 A;  1X69 A;  2L3S A;  4JJD A;  2O9S A;  2DA9 A;  4HVU A;  2J6F A;  3M0S A;  5IHN A;  1BU1 A;  2FRY A;  4J9H A;  4J9C A;  4DEX A;  2K9G A;  2RMO A;  3VS7 A;  2FEI A;  4F16 A;  3TVT A;  4IIM A;  3M0Q A;  5I22 A;  2AKL A;  5GJV B;  1B07 A;  2JMC A;  4AFQ C;  1I1J A;  1X2K A;  4Z89 A;  1MV0 B;  3EHR A;  2F2W A;  4AFU C;  1FMK A;  4RTV A;  1WA7 A;  1K0X A;  2XMF A;  5IH2 A;  1QWE A;  1VA7 A;  1JU5 C;  2VVK A;  3VS4 A;  1ARK A;  2RPN A;  1AEY A;  2YUQ A;  2DNU A;  4HXJ A;  4CC4 B;  3C0C A;  2GNC A;  4AG2 C;  2ROL A;  1RUW A;  2YDL A;  2KT8 A;  1LCK A;  1KFZ A;  1OOT A;  1NM7 A;  1UHF A;  2LMJ A;  3IQL A;  1K4U S;  2E5K A;  2J7I A;  2SRC A;  1KIK A;  2PTK A;  2L3P A;  1UHC A;  1RLP C;  5IHK A;  1NLO C;  2H8H A;  2O88 A;  2EVR A;  4M4Z A;  3VRZ A;  2KRN A;  1Y0M A;  1BK2 A;  2IIM A;  2JS2 A;  1JQQ A;  4CC2 A;  4CC7 A;  2OAW A;  1ABO A;  1KJW A;  3M0U A;  2JS0 A;  2LP5 A;  1GCP A;  2K6D A;  4JZ4 A;  4GLM A;  1MUZ A;  2KEA A;  1AWO A;  1CSK A;  1X43 A;  5L23 A;  4HVV A;  3EHQ A;  1AZG B;  2ESW A;  3PE0 A;  2NUZ A;  1W70 A;  4J9F A;  4KRT A;  1H3H A;  1HJD A;  3PVL A;  4OMQ A;  1N5Z A;  1YN8 A;  2CH4 A;  1U06 A;  1QCF A;  1M8M A;  2M0Y A;  3THK A;  4LNP A;  1NEG A;  4HVW A;  2KT1 A;  1T3L A;  4QT7 A;  2JW4 A;  1ZLM A;  1GCQ A;  2ED1 A;  2RQV A;  1NYF A;  3FJ5 A;  2FPE A;  1PRM C;  2BZY A;  3NHN A;  1YP5 A;  1AWX A;  1ZUK A;  3I5R A;  4OMM A;  1Y57 A;  2HBW A;  1BBZ A;  1IO6 A;  5FWB A;  2DL4 A;  3GBQ A;  1W1F A;  3I5S A;  1OV3 A;  2GTJ A;  2GGR A;  1UUE A;  4GBQ A;  1WI7 A;  2BZ8 A;  1UDL A;  5ECA A;  1GBQ A;  2JT4 A;  1K0S A;  2P4R A;  3UF4 A;  3TSZ A;  2DJQ A;  4RUG A;  2G6F X;  1JXO A;  1KSW A;  1WX6 A;  2I0N A;  2YUN A;  1MV3 A;  1B3Q A;  2GTO A;  1GFC A;  3EG2 A;  3I35 A;  2D8H A;  2DM1 A;  4DEY A;  4CC3 A;  1ZSG A;  2CUD A;  4Z88 A;  3REB B;  1SRM A;  2D1X A;  2RN8 A;  2JTE A;  2L3Q A;  2X3W D;  2LX7 A;  4J9D A;  2LNH B;  3ULR B;  1M30 A;  1UE9 A;  4ESR A;  1QLY A;  2EKH A;  1YWP A;  2DL5 A;  4LUE A;  2MOX A;  1W6X A;  1SSH A;  1PKT A;  2FG0 A;  2KR3 A;  1EFN A;  2F2V A;  3M0R A;  1SHF A;  1GRI A;  2DYB A;  1CKB A;  1T0H A;  1SRL A;  1H8K A;  2O9V A;  3TSW A;  2CDT A;  2LQN A;  5IXB A;  2EYZ A;  2CT4 A;  3UA7 A;  5IXF A;  2ABL A;  1XOV A;  2RQT A;  4OML A;  5GJW B;  3VS2 A;  1T3S A;  2CT3 A;  1AVZ C;  1K1Z A;  1T0J A;  3UAT A;  4J9B A;  4ZNX A;  3SHW A;  4ORZ A;  1YCS B;  1SPK A;  2L2P A;  1ABQ A;  1SEM A;  3RBB B;  3H0F A;  2FO0 A;  1AZE A;  3R6N A;  2EW3 A;  2A37 A;  1RLQ C;  2C0O A;  2DE0 X;  2BZX A;  2EYW A;  1ZUU A;  1V1C A;  1UGV A;  3VS5 A;  2MIO A;  4JPB W;  2LQW A;  4J9I A;  2PNI A;  4RTW A;  3QWY A;  4WCI A;  1PNJ A;  4E6R A;  4RTT A;  5IHI A;  2L0A A;  4D8D A;  2HEQ A;  2J05 A;  4J9E A;  2KRS A;  1WXB A;  4LE9 A;  4AFS C;  3SEM A;  1YWO A;  2PZ1 A;  2HCK A;  2K7A A;  2AK5 A;  1GCQ C;  1X2Q A;  1K76 A;  2KYM A;  4JJB A;  1U5S A;  2EYX A;  3PVQ A;  3EG0 A;  2KGT A;  2A36 A;  2ENM A;  1NLP C;  2K79 A;  1UJY A;  4RTY A;  2JM8 A;  1NYG A;  1SHG A;  2EGA A;  1TG0 A;  1VYU A;  2NWM A;  2QDL A;  1Z9Q A;  2AZS A;  3EGU A;  1ZBJ A;  2DRM A;  2EBP A;  4EIK A;  3UA6 A;  2W10 A;  3H41 A;  2RF0 A;  1RI9 A;  1ZUY A;  2LJ1 A;  2ROT A;  5I11 A;  2KXC A;  2KBT A;  2DBM A;  1VYV A;  2KYB A;  1BB9 A;  2YT6 A;  1X27 A;  1UG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...