2DO3A

Solution structure of the third kow motif of transcription elongation factor spt5
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
b'GSSGSSGEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVILFSDLTMHELKVLPRDLQLCSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation factor SPT5
publication title Solution structure of the third KOW motif of transcription elongation factor SPT5
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2do3A01
3DB3A 3I56A 3CCUT 1YIJA 1YITA 3CCLT 1YHQA 2KVQG 1QVFA 3CXCA 2JOYA 3OYYA 2KDSA 1VQ9T 3CCMT 2EIFA 1YJ9T 1K8AU 3CC4T 2XHCA 4TVRA 1VQ6A 3CCQA 5HY6A 3LGLA 1KD1U 3CD6A 1KQSA 3G71A 3LH0A 3CPWS 3G4ST 3CCRA 3J80E 3DLLA 3CCJA 1VQ8T 1RL2A 1M90U 1VQOT 3CCVA 1IZ6A 2LQ8A 5IAYA 1YJWA 1K9MU 1S72A 1YJNT 2MWOA 3CMET 1YI2A 3CCSA 3I55A 3G6ET 4YTLA 3P8BB 1VQPA 2MWPA 1JJ2S 1VQ5A 2IG0A 2DO3A 1Q7YU 3OW2A 1VQ7A 1VQKT 1Q81U 3CCLA 1VQNA 2OTJT 1KHIA 2OTLA 4ZN3A 3CC7A 1N8RU 1VQ4T 2QA4T 1VQMT 3CC4A 1Q82U 3CMAA 1NJIU 1Q86U 1QVGA 3I56T 5IT9E 1K73C 1KD1C 3A5ZB 1YIJT 1W2BA 1YHQT 1VQ8A 1NPRA 2MI6A 2E6ZA 1VQOA 2QEXA 3CC2A 1M1GA 1BKBA 1QVFS 3CXCS 3ER0A 1VQLA 3OW2S 3CCUA 1VQ6T 3DB4A 5J26A 3CCQT 1EIFA 3CD6T 2G3RA 1NZ9A 3JAME 3G71T 1VQLT 2LVMA 3CCJT 2E70A 3CCVT 1KC8U 3CCMA 1VQ9A 1KQSS 2JNGA 1YJ9A 3CPWA 3KBGA 1YJWT 1K8AC 1M1KU 1S72T 3CCET 2JVVA 2QA4A 3HKSA 1YI2T 1X6OA 5DM7R 1YITT 1Q82C 1NJIC 3G4SA 3CCST 3I55T 1XTDA 1VQPT 1Q86C 1VQ5T 2CKKA 1VQ7T 1VQNT 2L3RA 1M90C 1UEBA 5DLQE 5FLXE 3TREA 2OTLT 5J3BA 1JJ2A 1YJNA 3CMEA 5A2QE 1K9MC 3CC7T 4CRIA 4RG2A 3J81E 1YBYA 1XNIA 5LL6S 3CMAT 3G6EA 1K73U 1VQKA 3CCRT 2LCLA 3J7AF 1Q7YC 2OTJA 1Q81C 3LGFA 4ZN1A 2QEXT 4QQDA 2JUFA 3CC2T 1QVGS 1VQ4A 1N8RC 3PIPA 1KC8C 1W2BS 1VQMA 1SSFA 3CPFA 3CCEA 1M1KC 1NPPA 4X34A 3PIOA
chains in the Genus database with same CATH superfamily
4RUGA 3OS1A 4M78A 2PQWA 4M75C 2DYIA 4M7AD 3NHNA 2KT1A 1BI1A 5CK9A 2SRCA 1VQ6A 1XQHA 4RTWA 3P8HA 3E9FA 1QP3A 5GAOm 3OYLA 3H0HA 3CCVA 3I35A 4PJOC 1GCPA 4LUDA 3S3NA 2KY9A 2OAWA 2J6FA 1KG1A 3G6EQ 3CCQQ 4YTLA 3CD6Q 4OMOA 2F1LA 1OPLA 2RQRA 2ZGWA 5IN1A 3H0FA 2E1HA 1EZZB 1WHHA 1OV3A 3NTIA 1QCNA 4FW2A 1W70A 5FRNA 2QYZA 3X26B 8ATCB 2CZ0B 3TSWA 2JN0A 2JXBA 2NUTB 3QJYA 2F5TX 3GBQA 3QBYA 1KQ2A 2P0PA 3E19A 3HRUA 4MZPA 1TTHB 3GNGA 2JS2A 1BIAA 2ED0A 1X27A 2G6FX 2E70A 1KC8U 1KQSS 4FYVB 5KYYA 1S72Q 3VYHB 2RB6A 4OB1B 2F2XA 2BIVA 5HK0A 2VGNA 3OQ5A 3CCSQ 2M02A 2L3QA 5LJ3d 1NJIR 3M58A 2J06A 4D6WA 1BCOA 2KR3A 5A2QE 4RKUE 4M4ZA 4F7UG 4J9CA 3VS3A 3GOXA 3HL8A 5LJ3g 3CCRT 3O5ZA 1VQ8Q 2EQMA 1VQOQ 2DTOA 3H41A 3KUFA 3JCMd 1B07A 2CP0A 2FZKB 1D3BA 1UUEA 4D8KA 2HNIA 2F5KA 1I5LA 4O5VA 5GAOr 4QQ6A 4M7DF 3JCMg 3QWYA 1ZSZA 2VVKA 5C0MA 4L5GA 1NYGA 4KGVB 5ECAA 3PNWC 3OA6A 3G71A 3CPWS 4PJNA 4X9CA 4Z02A 2AKKA 2GQVA 3FEOA 2EPDA 1ZHIA 4P5NA 1VQ5A 2MYSA 1K1ZA 3I55A 1BU1A 2DEUA 1YFNA 2OTJT 2PTKA 4F17A 2FG0A 1QWEA 4BB7A 2QA4T 4C92D 1N9RA 1Q86U 3E9GA 1H641 2DYBA 3TQ7P 3T9NA 2PVGB 2E10A 1VOMA 1Q95G 4ZGDB 1M3AA 3MCAB 4EDUA 1AZEA 2RQVA 2QI2A 2BTTA 2YLBA 4EIKA 1IGQA 2BZXA 4IUTA 1AWJA 4KGZB 3RDVA 3CCET 4OMNA 3H8ZA 1B7TA 3EG3A 1NEGA 2EFIA 1AOJA 4M7AB 1WIEA 3PMTA 3DLMA 3RKXA 3QDFA 2EQJA 2HMAA 2WSCE 4C92C 2KMTA 3CMAT 3RESA 2EQIA 4XU1A 4ZNXA 2DXBA 3CBMA 3MEUA 3LGFA 1PKTA 3QZ5B 5GAOn 1LVKA 1M3CA 3CC2T 1QVGS 1CSKA 3QKJA 4PJMA 1W2BS 5I2MA 4N0AC 4C8QA 2DXTA 4F7UE 4X34A 1GBQA 4R55A 1PWTA 3CCLT 1YIJA 2FHDA 3META 4M77A 5EC7A 2CP3A 4Y91A 1KSWA 2RM4A 5IH2A 4IUPA 3VS5A 2OJ2A 3TEEA 2LQWA 4M7DC 3EGUA 4X9DA 9ATCB 2KBTA 1M90U 4F14A 1YHQQ 4PFZA 3RBBB 1K76A 4F7UF 1BB9A 1T0HA 2DVEA 1Y7XA 4BI3A 1RLQC 2V1RA 5A0DA 1IXDA 3X25B 3O8VA 3S6WA 3RMQA 3F70A 1WXUA 2GQIA 1G3SA 2PNIA 3EGDA 2DBKA 2DF6A 2LNVA 2LT1A 3BFMA 3A8MB 2QEXA 1WZOA 3M0SA 1Q82R 2E12A 3QDRB 1PD1A 2X4JA 3ER0A 4XQ3A 3EGXB 2O9SA 2K5LA 3R6OA 2L3SA 2AK5A 3CCQT 3CD6T 2V8KA 2QDLA 3JAME 2HQHA 4ORZA 2E5QA 1VQ9A 1SSHA 1K8AC 5AYFA 2BE9B 2RHXA 5DY9A 2RQUA 3AT1B 3LX7A 4OB2B 2J6OA 3GNFB 2K7AA 2RI5A 4AMCA 2VUBA 3BE3A 4L59A 2D8JA 3S3OA 1BCMA 1RAIB 2GGRA 4RTYA 3PFSA 4GBQA 4E7LA 1KFZA 3VS6A 2YUOA 1E7OA 3M5AA 1VQKA 3HP9A 4EPCA 3VRYA 4C0GA 3EHQA 2QQ9A 1YWPA 3CPFA 2L2PA 4PJOG 2FO0A 3I56A 3N5BB 2CH4W 2CYZB 2EYQA 2IVWA 2LX9A 2O4XB 3OYYA 1HSQA 2YUQA 3PGGA 4KGXB 4C92B 2CS7A 2DD4A 2CP5A 1ZSZB 2DX1A 1QCFA 3DLLA 1VQ8T 1SF9A 4A63B 1VQOT 1WXTA 4PKCC 1M8VA 1KHCA 8AT1B 1UGSB 2DIQA 3M4GA 2ZAEA 1BI3A 4M7AG 3CPWP 5CKHA 4DOVA 4BY6B 1X01A 1VQNA 3V8JA 3MKDA 1KK7A 1WJQA 3CCVQ 2VXFA 2OX7A 3A8OB 1T3LA 4JRIA 5LJ5f 2RMOA 4Z88A 1X75C 2E6ZA 5KYUB 2RO0A 3QUIA 2YDLA 4CC3A 5GANh 2KAFA 2EYZA 2YHTA 1K9MR 2RJCA 3A98A 1NZ9A 1C0MA 1AWWA 4CI0C 5KH6A 2QTVA 3CCMA 1Y96B 2JNGA 2KT8A 2DTHA 3EG2A 4HVUA 1X6OA 2CZ1B 1NJIC 1ZQ1A 2YRCA 3G4SA 2JTFA 5FLXE 4EMKC 3LW5E 2M16A 3M0QA 3GF5A 4RCCA 1U3OA 1WDXA 1GXIE 1XNIA 1GFDA 1MNEA 1TXQA 1ARKA 1Y71A 4BUGA 4RG8A 1UHFA 2KRSA 4XTUA 5GANj 2JUFA 1VQ4A 2VGMA 3OYDA 1VQLT 2HSPA 5CO7A 1RLPC 2DZ9A 4C8QB 5IHNA 4FM4B 1IRXA 1QVGP 2DJQA 2KNBB 2LQKA 1X6GA 1W2BP 4M77B 2VB6A 3MP1A 1U1SA 2O31A 1C6VX 2V26A 4PLLA 4PJOE 4KT0E 2CZ7B 4OP0A 3SWNA 4GY5A 3OMGA 3TVTA 4XU2A 2EVRA 1YI2A 2COYA 2DL4A 3SHWA 4XK8E 1WX6A 1W1FA 1D1AA 2OTJQ 4DEYA 1ZSGA 2LCSA 2RHUA 2DNUA 4Q5WA 4DOWA 3GIBA 3CC7A 1N8RU 2Z0WA 3LWHA 2K5FA 4PJOF 4A4EA 3I55Q 5KYWB 1YHQT 3OYHA 1OEBA 1M1FA 3EGDB 5GAOp 2RQTA 3VV0A 2RK1A 1BKBA 5FWBA 1C1AA 1S1NA 2NUPA 1GFCA 3A8HB 5LJ3h 2HBWA 2L89A 2J6KA 1PKSA 4PK4A 5GANe 2HQEA 2KE9A 4B9XA 4C92G 2GFUA 5FRMA 4V2SA 1UECA 1MGQA 1N9SA 3BW1A 2CSQA 4M7AF 1WJSA 5FROA 2CKKA 4M75A 2VASA 2OTLT 3EG0A 1YJNA 2F2VA 3LH5A 2BZYA 3H0IA 1N6AA 5GAMd 5LJ5e 2DL5A 2QQAA 5LL6S 3CMAQ 4C0ZA 2YRDA 2K57A 4ZN1A 1MNDA 1D1CA 2F2WA 3CC2Q 1QQJA 1N27A 2HKNA 5LJ3j 5I22A 2CZ6B 5GAMg 3VKIA 4E7JA 1YITA 3M0RA 3UT1A 1QVFA 2DETA 4J9FA 1GRIA 5I21A 2KDSA 2AKLA 1FMWA 1TUGB 4FIBA 2I2LA 2ZZDA 4RTTA 4J6YA 4MZTA 2EKOA 1PD0A 1U5SA 1U1TA 3M0PA 3OYEA 1PM3A 1JBMA 1K73R 1KD1R 3OYNA 2MWOA 5FW9A 3MEAA 2LDMA 4A4HA 2D8HA 3NTHA 3THKA 4F16A 1JJ2S 1RI9A 2DD5A 2H3JA 2F69A 2C06A 4LNPA 1KHIA 2FPFA 1NLOC 4PJLA 2VYTA 1MMAA 3GPLA 3EFOA 1I8FA 5IHIA 3FDRA 1NJIU 3QZ9B 3C4SA 3G7ZA 1LJOA 3C0CA 1WHMA 2KRMA 2PU9B 4IURA 1T0JA 3FRNA 1X2KA 1VQ6T 1YCYA 1VUBA 2G3RA 2K5IA 2JTEA 2CP7A 1K0SA 4M78D 1T3SA 3CCVT 4NL2A 1G8XA 2QEXQ 1YJ9A 1Q81R 4II1A 4KUIA 1D1BA 2O2OA 3SB2A 4O6JA 1XTDA 5CR2A 1G2BA 3I5SA 2KROA 2L3RA 1M90C 4M7AC 4C92E 5D6XA 2EGEA 3QPHA 1I1JA 1YBYA 2FZCB 2NWMA 1J3TA 4OMPA 3D7SB 2E64A 2QXFA 2M1HA 4B6MA 1BBZA 4UC4A 5GMKh 3JCMX 3LYIA 4GLMA 3OS5A 2ECZA 1B34A 1VQMA 1WJRA 1JXMA 4BDZA 3MP6A 4AG2C 2FVUA 1M1KR 1OX9A 3CXCA 4M7DE 4C92F 1FMKA 2DA9A 4PL6A 2V8IA 3KXTA 1ZA1B 4PFPA 1KQ1A 2ZPHB 3NMZC 1M5Q1 1PCXA 3MP8A 3LH0A 3CCRA 4IUUA 2NLUA 2RJFA 3L2RA 3ZBDA 3SWNB 4GLKA 1DJ7B 1PRLC 6AT1B 4JUVA 3P8BB 1VQPA 2MWPA 3C95A 2P4TA 1WHGA 1KJWA 2E3IA 1K9AA 3M59A 2DAQA 2PUKB 1AZGB 1R0BG 2A28A 5IXFA 2LP5A 1HYOA 2MI6A 1VQNQ 2DL8A 2ZPBB 4ESRA 1X6BA 5GAN8 5CCAA 1NG2A 3CCUA 3KFVA 2YT6A 1IB8A 3G71T 3OSSC 4QW2A 4KBMB 4WF2A 2RQWA 3QYGB 4MDXA 1Q7YR 4N0AA 2EQKA 1I81A 1M27C 2QA4A 1WQ7A 1M4ZA 4LD6A 2HDAA 4EMGA 1VQ5T 3I55T 1KC8R 1XOVA 3OBYA 2HEQA 1UDLA 2MF2A 4M7DA 4AG1C 1ZUUA 2XU8A 1M9SA 1TUDA 5L8RE 5CKFA 2DZCA 4KH0B 3SDZA 2VC8A 3TSZA 1X43A 2J7IA 4FSSA 3CCEA 1WXBA 1VQLQ 2ED1A 4L6V5 4FT2A 4C0DB 3HRSA 4HVWA 2KI7A 2V1QA 1I07A 1YN8A 1WPYA 3VS4A 4LXCA 1IGUA 2XDPA 5EG2A 2KSSA 2E5KA 1ZSZC 3CCJA 4KRTA 2VV5A 2FPEA 4J9GA 2AIRB 3FJPA 1F1BB 1PHTA 2DL3A 1OULA 5GAN5 2R57A 4BACA 4BY6C 1VQ7A 3UA7A 3CCLA 4M78B 5GAN3 2XKOC 4ZN3A 1AVZC 1RAFB 4FYYB 2QQRA 2XD0A 1JJ2P 1YI2Q 4WCIA 4QT7A 2K9GA 1ZBJA 1E6HA 1YIJT 5GMKm 1FWZA 2YLCA 2M0YA 3BDLA 2DLPA 1JRIA 4MZMA 5GAOl 1Q86R 2MPXC 1G3WA 5C6SA 3DB4A 5J26A 4C8QD 4DA4A 3QSUA 1NEBA 2ABLA 4E7KA 1VYUA 4M77D 1V76A 4XTVA 3NGPA 3HKSA 1VIFA 2JMAA 1UG1A 5HK3A 5CKBA 5I2SA 2OTLQ 3TREA 1HK9A 1M2VA 3CC4Q 2E65A 3UDCA 3G6EA 3NFCA 4PLIA 5KYXA 2LCLA 2NYSA 1OOTA 2DRMA 2XG8D 5CVIA 1UGVA 2QEXT 4J6XA 1N8RC 5KYYB 2P0QA 4N4GA 3I5RA 4C8QC 4F7UA 3PMIA 1Z9QA 4JJBA 5HCKA 4M77C 1VQ9T 3PVLA 1LNXA 3HFNA 3X20B 2RHZA 2XI9A 3P8DA 2LJ0A 2JTMA 2O88A 4A54A 1ACMB 1K9MU 2MCNA 1S72A 4LN2A 3OYBA 1WQWA 4K11A 1P92A 2V8JA 3CCSA 2DO3A 1VQKT 1D3BB 2LNHB 2MK5A 3JCMc 3OMCA 4J5YA 3M53A 4OGEA 4NS5A 4Z89A 1UJ0A 3MHXA 1M8MA 3RIRA 1QVFP 2A7YA 2K3XA 4MMKA 1GCQC 3I56T 3OYAA 1VQ8A 1VQOA 2XMFA 1U06A 1UGQB 2EGAA 2FYKA 4EMKA 5GANf 4EMHA 3JCMQ 1W6XA 2D0NA 1VQ6Q 1G3YA 2ZPIB 1TG0A 1EIFA 1MV0B 5GAOq 4RTZA 3INZA 2X4XA 3V7CA 3OY9A 2MOXA 2D9TA 5GJWB 5CQYA 4XU3A 4HCCA 3JCMP 2IPOB 3JRZA 2EBPA 2WSFE 1VQNT 4A4GA 2YRVA 3ZFJA 3CMEA 4JLIA 3CBOA 1SPKA 1WLPB 3ASKA 4M78G 3VU3C 3JCMb 1D0ZA 2COZA 2DE0X 3UWNA 2E4HA 2QDYB 3AHUA 4CC2A 2DRKA 2CT3A 2X4YA 4QQDA 4IKFA 1I5OB 3ZL7C 1TU0B 1M1KC 2P4RA 2D0QB 2C0TA 2CH4A 2XIDA 4CC7A 2QASA 2YSQA 2YUNA 2C0IA 1BYMA 2E41A 3CCMT 1RI0A 3EHRA 2M9UA 2GTOA 2RD1A 1VQMQ 4QVZA 4RTUA 2LC4A 3EH1A 3G4ST 2GCXA 5FU7B 1TWBA 2DJZA 2NUTA 4Y28E 3RNJA 1YJWA 2MAMA 4DBQA 2K6DA 2PVDB 5A0LA 1ZX6A 1ZBXA 2RA2A 2R5AA 1FXXA 4XTWA 2KXCA 1BI2A 2CDTA 2CT4A 3URGA 1VQ4T 5CKDA 3CXCP 4ELYC 5L23A 2ROTA 4AFZC 1G3TA 1H8KA 1UGPB 2PUOB 1FYNA 4J83A 2H3EB 2A3LA 2LCCA 4FCYA 1CKBA 1MMNA 5LJ3f 1M1GA 1SRMA 1EX4A 4HXJA 2FRWA 1WHKA 2JS0A 3ME9A 4Z8AA 1NLPC 3JSCA 3G71Q 4E7ZA 3JCMV 1B3QA 2K3YA 1JQQA 3KBGA 5DLOA 2EJFA 4ANJA 4M7AE 1YI2T 2ENMA 2LZ6B 1TOVA 2DIGA 5DM7R 1VQ5Q 3JCMf 1QWFA 3EG1A 1OU8A 2K2VA 1YNZA 3VS7A 2K2MA 1AWOA 4BI4A 2XK0A 1AEYA 1NM7A 3CC7T 1WHLA 3V8LA 1AT1B 3H9NA 3EFRA 4KULA 1K73U 1O9SA 4OF1A 2X3WD 3NPFA 2DEQA 3MEWA 2DILA 4LDYA 5KYXB 4WTOB 4LDWA 1H92A 4LE9A 5FWCA 1BIBA 2EW3A 3Q1JA 1I4K1 3REAB 3JCMh 3UATA 3VS0A 1NYFA 4F7UB 1MMGA 2KRNA 2CUBA 4DBHA 1RAGB 3CC4T 1TUCA 4TVRA 3JCMW 4JZ3A 4FU6A 3SD4A 1KQSA 4BD3A 3RERA 5A0GA 1BK2A 4PNOA 4PJOA 1QKWA 3ZEHA 3SWNC 2LQ8A 3L42A 3JB9G 1YJNT 1JEGA 3OBWA 4M78F 4X1VA 3UA6A 1UGRB 3EH2A 1Q81U 3IQLA 4M75D 5J39A 3CCJQ 2DMOA 1M3BA 1PSFA 2HL5C 2O9VA 2L8DA 4FYXB 3CBPA 5IT9E 1YIJQ 1K8AR 4JPBW 4M7AA 5GANd 3MJXA 2QQBA 4XTZA 2JZ2A 1D09B 1YCSB 1YP5A 3OS2A 5GANg 4OMQA 1O75A 2JJ9A 3M0UA 1AWXA 3CPWA 1M1KU 3OYMA 2DPPB 1V29B 5LJ5d 2JMCA 3PVQA 3HTRA 4JRPA 2RJDA 2XICA 1Q82C 1EFNA 2RHYA 4ELZC 2DVJA 2LJ1A 2LJ3A 2CSIA 5DLQE 3QYHB 1WYXA 4OMLA 3A8LB 5J3BA 4C8QG 2C0OA 5LJ5g 4RG2A 2FEIA 2GF7A 3E2UA 4M77G 1GBRA 1PG5B 3J7AF 3L2UA 5LJ3e 4HT9A 3HFOA 3L2WA 4OB3B 4JJCA 4DBFA 2DTIA 4ZGEB 4C0FA 1SSFA 1MV3A 1QVPA 4C0DC 2CP6A 3SEMA 4J8OA 5FU6B 4B9WA 1VQ9Q 1KIKA 4OMFB 3M4YA 3JCMe 2EIFA 1YJ9T 1OQKA 4RCBA 2MIOA 1PRMC 4BE1A 1H3ZA 3RMSA 3EGXA 2WACA 2BZ8A 2HKQB 2W0ZA 1RABB 2DL7A 1VQKQ 3UPUA 1Q7YU 3OW2A 2EGCA 4M78C 2ATCB 3C94A 2X3XD 3HSBA 2K4YA 2HL3A 1VQMT 2LMJA 1LOJA 3I56Q 3OB9A 3BY7A 1QVGA 4IIMA 4JJNK 1W2BA 2LRQA 1NPRA 1ZUKA 4HA8A 4PJJA 2B86A 2Y4YA 2HSEB 1SKUB 4A53A 5GMKj 4VUBA 1QVFS 2M0OA 4HCZA 2I0NA 4FL6A 2AZVA 1OZ3A 3FLGA 1QP2A 2YUPA 3E1SA 3JB9F 3VUZA 2EQUA 4BE2A 1UE9A 1VA7A 4AFUC 4ATOA 4J7IA 3S3MA 2Y90A 2O4XA 1VQPT 1X2QA 2HCKA 1JB0E 4MDWA 2KGTA 1G83A 3A1PA 4C92A 1K9MC 1AHJB 3OYGA 3J81E 1GL5A 4JZ4A 2GFAA 3PT9A 1PNJA 2NUPB 1HXDA 4OGCA 5AT1B 2OTJA 1UTIA 1RUWA 4C8QE 2LTOA 3SFMA 3OYIA 3CMEQ 1NPPA 2FRYA 3CCUT 2ZPEB 4M77E 3WVDB 4JRQA 2KYMA 2JT4A 2NUZA 3UF4A 3M57A 4M75B 3JB9H 5D6YA 3CCMQ 2DBMA 2XHCA 2RHIA 4C5GA 3QJ6A 2DM1A 3LGLA 3L2ZA 2ZCFB 1VYTA 4Y92A 2JM9A 3G4SQ 1SHFA 5KYUA 1M30A 1JXOA 2EJ9A 3MO8A 5IAYA 5GMKe 4E7IA 2EKHA 4C8QF 4PJOB 4FT4A 3LLRA 3JB9D 4E7SA 4M77F 2VWFA 2H8HA 3QXEB 1IREB 1Y96A 3U23A 3EFSA 1W4SA 1VQ4Q 1YJWQ 4M7DD 1Q82U 3CMAA 2RH2A 3TCJA 3VYGA 2RI3A 4OMMA 1FMVA 2PVOB 3CC2A 4OB0B 1ZA2B 4HVVA 2QGGA 2WSEE 3CXCS 3OW2S 4HT8A 4DQ2A 2X51A 2ZPGB 3CCJT 2YXYA 4MMLA 2CP2A 4NOYA 1ABQA 7AT1B 2RK2A 1IHWA 3EFOB 2W10A 3A8GB 4LD9K 3OSVA 1VQ7T 1QKXA 3VS2A 4AFSC 3JCMJ 1UEBA 4JJDA 1AD5A 3FB9A 3CC7Q 3PE0A 4CRIA 3ULRB 2L5QA 1SEMA 4IUVA 1R0CB 2JW4A 4D8DA 4N4IA 2CREA 4IIOA 4BI8B 2BE7D 4PFOA 1XJWB 5KE2A 2LT4A 4BE0A 3PIPA 1RADB 2EYXA 3PIOA 3DB3A 3EAEA 2SEMA 2QQSA 2KVQG 5GMKi 2JOYA 2IIMA 3VS1A 2RF0A 2A08A 2XDDA 4JDSA 2HAXA 5CIUA 3RUXA 2LQNA 1D0XA 4RMOA 3M56A 3CCQA 1GCQA 2E3HA 4C5HA 3CD6A 3CEYA 5KYWA 5FU7C 1UHCA 1H3HA 1JU5C 1N5ZA 1RL2A 4IUQA 1MMDA 2DXUA 2X4WA 5HKCA 1YJNQ 3V7SA 2DERA 5KCHA 4A4FA 1YWOA 3C12A 1B34B 2LX7A 2DKGA 3G6ET 2EJGA 1FX7A 1MHNA 3QHSA 3WVEB 3RKYA 4ZGJB 3EG9A 1QW1A 1PSEA 3L2QA 1QLYA 1YITQ 1ABOA 2ESWA 1K73C 3A5ZB 1KD1C 4FSXA 2QK0A 2FZGB 4J9BA 5KE3A 2BUDA 2GTJA 4ME7A 1KQSP 1Z9ZA 4N4HA 1U8RA 1M90R 4C5IA 2QAZA 1QMCA 2ZPFB 4M75G 2PZ1A 3I9QA 2P0KA 5GAMf 2LVMA 3NTKA 3V8KA 3FC3A 1SRLA 3TU4K 2AZSA 3JB9I 1VYVA 3LWIA 1S72T 1ZUYA 2A0FB 2JVVA 4J7FA 1V1CA 2RN8A 1TSFA 4HCKA 1TH7A 3CCST 4E6RA 2B8AA 1HJDA 1LPLA 1E6GA 2R58A 4RTXA 3REBB 2L3PA 4HCBA 2OAUA 1CKAA 3VUBA 3V7RA 1OPKA 1A0NB 1Q81C 5GAN6 2CGHA 4XAXB 5GAMh 4JLGA 2EWNA 1WFWA 2RI2A 2VXEA 5D7UA 3WXMB 2KK4A 1G5VA 4E2FB 1JO8A 3JB9J 1YJ9Q 1HD3A 3HRTA 1UFFA 3X28B 1PC0A 4M7DB 3QIIA 5HY6A 3M0TA 1X69A 3CQTA 1UB4A 3HPWA 3J80E 2FB7A 5I11A 1I0CA 4LDXA 2MMPA 4C5EA 3CMET 1NBEB 5GAMj 1WI7A 3VJPA 5GAN7 4HKEA 1Y57A 4J9IA 2IG0A 2FPDA 1R77A 4AFQC 3PTAA 2FL7A 4FW1A 4RTVA 3JV3A 3M55A 3QO3A 5D6WA 5GAN4 1D0YA 2GBQA 2E6NA 3OYFA 3QWXX 1K0XA 3RR6A 2KEAA 2GNCA 1OX8A 5LJ5h 4R56A 5KCOA 1VQLA 3RKWA 3R6NA 1WA7A 4JRKA 3CCRQ 2HD0A 4LUEA 3FIFA 4QQGA 2CUDA 1YJWT 3OW2P 1OU9A 4QVCA 4J6WA 1UJYA 3OYJA 5IXBA 1MUZA 4M75E 1VQPQ 1RACB 2HQXA 1WHJA 1WGSA 1OI1A 3MPUB 3GP8A 1JJ2A 2L0AA 5GMKl 2ROLA 2KQWA 2DFUA 3L2VA 4FYWB 5GJVB 4CC4B 5LJ5j 4BDYA 1Q7YC 1SHGA 3HHTB 3OS0A 2KYBA 2D6FA 4JS4A 2Y4XA 4NL3A 4E47A 1WNLA 1KC8C 5GAMe 2BKDN 3H6ZA 3L1AA 3CCUQ 2VKNA 4M75F 1M2OA 1YHQA 4JS5A 2A36A 5FU6C 2K3BA 2YWWA 4QKUA 2X35A 1K8AU 1OYXA 2AHJB 2X9HA 4J9EA 2QA4Q 2P84A 4OVAA 1KD1U 1M2VB 3G1JA 1IZ6A 2KXDA 3OYCA 2R5MA 2COWA 5M9OA 4XTYA 1Y0MA 4F04B 2J05A 5CAIA 4M78E 5CQXA 4ZTJA 2O01E 3QG1A 3DKMA 4R0KA 2HBPA 2M51A 4J9DA 4J9HA 2OTLA 1QCOA 4ZTFA 3CC4A 3CCEQ 5CKEA 2EYWA 1K4US 4KUDK 3BDUA 2K79A 3EG9B 2OI3A 4KH1B 1RAAB 2A37A 1VIEA 1IHVA 1RAHB 5IHKA 4XU0A 2D1XA 1IO6A 1TS9A 2EAYA 5GAN2 4M7DG 5KYNA 4QVDA 3M9QA 4A4KA 4AT1B 2QTXA 4DBRA 1R8OB 1YITT 3FJ5A 1OZ2A 3MEVA 1N8RR 1VQ7Q 1Q86C 2QG9B 1Y07A 3CCLQ 3VRZA 2RNAA 2DXCA 4PJOD 4DEXA 2RPNA 3M54A 4EMKB 2QGFB 1NE8A 2DK3A 4XTXA 2JM8A 3X24B 2AT1B 1LCKA 1BI0A 4LDUA 1ZLMA 1RAEB 1SG5A 2EYYA 2XDBA 4LDVA 4E7HA 3GLXA 2RJEA 2HZYA 3OYKA
chains in the Genus database with same CATH topology
3CCUT 4N4GA 2ZPEB 4M77E 5CO7A 4C8QC 3WVDB 4F7UA 3OS1A 4M78A 2DZ9A 4JRQA 2PQWA 4C8QB 3PMIA 4M75C 4M7AD 4FM4B 3M57A 2LQKA 4M75B 3JB9H 4M77C 5D6YA 1VQ9T 4M77B 3MP1A 1LNXA 2XHCA 2RHIA 3HFNA 4C5GA 1BI1A 3QJ6A 5CK9A 1U1SA 1VQ6A 1XQHA 2RHZA 2XI9A 3L2ZA 2ZCFB 3LGLA 3P8HA 3E9FA 3P8DA 4PLLA 1QP3A 4PJOE 1YIJA 4KT0E 2CZ7B 4OP0A 3SWNA 5GAOm 2JTMA 3OYLA 4GY5A 2EJ9A 3MO8A 3CCVA 5IAYA 5GMKe 4E7IA 4PJOC 4A54A 3OMGA 4C8QF 1K9MU 4FT4A 4XU2A 3S3NA 1S72A 2KY9A 4PJOB 3OYBA 3LLRA 1YI2A 1KG1A 3JB9D 1WQWA 4XK8E 1P92A 2V8JA 4M77F 4YTLA 3CCSA 2DO3A 1IREB 3QXEB 1D3BB 1VQKT 3JCMc 1Y96A 3OMCA 2RHUA 4J5YA 3M53A 2ZGWA 4OGEA 4Q5WA 4NS5A 4DOWA 5IN1A 3GIBA 3EFSA 3CC7A 1N8RU 1W4SA 2E1HA 3MHXA 3RIRA 2A7YA 4M7DD 2K3XA 1Q82U 4MMKA 3CMAA 3LWHA 2K5FA 3NTIA 4PJOF 4A4EA 3I56T 2RH2A 3OYAA 3TCJA 1YHQT 3OYHA 3VYGA 1VQ8A 1M1FA 2RI3A 5GAOp 1VQOA 1UGQB 4EMKA 2FYKA 2PVOB 3CC2A 5FRNA 4OB0B 3X26B 5GANf 2CZ0B 2JN0A 3VV0A 4EMHA 2RK1A 1BKBA 2WSEE 3JCMQ 3QJYA 3CXCS 2F5TX 3QBYA 3OW2S 1G3YA 2ZPIB 1KQ2A 2P0PA 3A8HB 1EIFA 5LJ3h 5GAOq 2L89A 4HT8A 4DQ2A 3E19A 3HRUA 4MZPA 3GNGA 2ZPGB 5GANe 1BIAA 2HQEA 4B9XA 4C92G 3CCJT 3INZA 2GFUA 5FRMA 2E70A 4MMLA 1KC8U 4V2SA 1KQSS 1MGQA 1N9SA 2X4XA 4NOYA 3V7CA 3OY9A 3BW1A 3VYHB 2RB6A 2RK2A 4OB1B 2D9TA 2BIVA 5CQYA 4XU3A 5HK0A 2VGNA 3OQ5A 4M7AF 1WJSA 3A8GB 4HCCA 4LD9K 3OSVA 3JCMP 5FROA 3JRZA 1VQ7T 2CKKA 4M75A 2WSFE 1VQNT 5LJ3d 4A4GA 3JCMJ 3M58A 1UEBA 4D6WA 2OTLT 2YRVA 3FB9A 1YJNA 3ZFJA 5A2QE 3CMEA 4RKUE 4JLIA 4CRIA 3CBOA 4F7UG 1N6AA 5GAMd 3ASKA 5LJ5e 4M78G 2L5QA 2QQAA 5LL6S 4IUVA 3VU3C 3GOXA 3JCMb 3HL8A 5LJ3g 3CCRT 4C0ZA 3UWNA 4N4IA 2K57A 2QDYB 4BI8B 3AHUA 2EQMA 4ZN1A 2X4YA 4QQDA 1N27A 5KE2A 2DTOA 2LT4A 5LJ3j 2CZ6B 5GAMg 3VKIA 3PIPA 4BE0A 3KUFA 4IKFA 3JCMd 1M1KC 2D0QB 3PIOA 3DB3A 1D3BA 3EAEA 2XIDA 4E7JA 1YITA 2HNIA 2QQSA 3UT1A 2KVQG 5GMKi 1QVFA 2JOYA 2F5KA 1I5LA 4O5VA 5I21A 5GAOr 1BYMA 4QQ6A 4M7DF 2KDSA 2XDDA 4JDSA 3JCMg 2E41A 2HAXA 3CCMT 5CIUA 1RI0A 3RUXA 4FIBA 2I2LA 2M9UA 2ZZDA 5C0MA 4J6YA 4RMOA 2RD1A 3M56A 2EKOA 4L5GA 4MZTA 3PNWC 4C5HA 3CCQA 3CEYA 4QVZA 3OA6A 3CD6A 5FU7C 3G71A 2LC4A 1U1TA 3G4ST 2GCXA 5FU7B 3OYEA 3CPWS 1RL2A 2DJZA 4IUQA 4Y28E 1JBMA 2DXUA 2X4WA 5HKCA 4X9CA 4Z02A 2MAMA 1YJWA 3V7SA 3OYNA 2MWOA 2GQVA 5KCHA 4A4FA 3FEOA 3MEAA 2PVDB 5A0LA 1ZHIA 3C12A 1B34B 4P5NA 2DKGA 2LDMA 4A4HA 3NTHA 1VQ5A 3I55A 3G6ET 2EJGA 1ZBXA 1JJ2S 1FX7A 2DD5A 2H3JA 2RA2A 2OTJT 2F69A 1MHNA 2R5AA 2C06A 1FXXA 1KHIA 4XTWA 2VYTA 3QHSA 3WVEB 3GPLA 1BI2A 3URGA 4BB7A 1I8FA 3RKYA 5CKDA 4C92D 4ZGJB 2QA4T 1VQ4T 3FDRA 1N9RA 4ELYC 1NJIU 3QZ9B 3C4SA 1QW1A 1Q86U 1G3TA 3G7ZA 1PSEA 1H641 1UGPB 2PUOB 3E9GA 3L2QA 1K73C 1KD1C 1LJOA 3T9NA 3A5ZB 4FSXA 2PU9B 5KE3A 4J83A 2BUDA 2A3LA 2LCCA 4IURA 2PVGB 2E10A 4ME7A 4N4HA 5LJ3f 1M1GA 4ZGDB 1U8RA 3MCAB 4C5IA 2ZPFB 3FRNA 4EDUA 4M75G 1VQ6T 3ME9A 1YCYA 1VUBA 2G3RA 2K5IA 3JSCA 2P0KA 5GAMf 1YITT 2LVMA 2QI2A 3NTKA 3JCMV 3V8KA 3FC3A 3TU4K 4M78D 3JB9I 2K3YA 2YLBA 4NL2A 3CCVT 1YJ9A 4IUTA 3KBGA 5DLOA 3LWIA 1S72T 3CCET 2JVVA 4II1A 4KUIA 2EJFA 4M7AE 1YI2T 4J7FA 3H8ZA 3SB2A 4O6JA 2DIGA 5DM7R 1TH7A 3JCMf 3CCST 1XTDA 5CR2A 2B8AA 2L3RA 2K2VA 1M90C 4M7AC 2EFIA 4C92E 4M7AB 3PMTA 3DLMA 5D6XA 4BI4A 3QPHA 2XK0A 3RKXA 2R58A 2EQJA 3CC7T 4HCBA 2WSCE 2OAUA 3V8LA 1YBYA 4C92C 2KMTA 3VUBA 3V7RA 3RESA 3CMAT 4XU1A 3EFRA 4KULA 1K73U 1O9SA 2DXBA 3CBMA 3MEUA 2E64A 4OF1A 2QXFA 2M1HA 5GAN6 5GMKh 2CGHA 2DEQA 3MEWA 3LGFA 3LYIA 4UC4A 4XAXB 3JCMX 5GAMh 3QZ5B 4LDYA 5GAOn 1Q81C 3OS5A 3CC2T 1QVGS 4JLGA 3QKJA 1Q82C 1B34A 4LDWA 1VQMA 5I2MA 1W2BS 1WJRA 4N0AC 2EWNA 4C8QA 2DXTA 4F7UE 4X34A 4BDZA 2RI2A 3MP6A 2FVUA 1BIBA 2VXEA 4R55A 3WXMB 2KK4A 2FHDA 3META 3Q1JA 1I4K1 3CCLT 1G5VA 4M77A 3CXCA 3JCMh 4M7DE 4C92F 4Y91A 4F7UB 3JB9J 2RM4A 4IUPA 4PL6A 3HRTA 3TEEA 3CC4T 4M7DC 2V8IA 4TVRA 3JCMW 3KXTA 3X28B 4M7DB 3QIIA 4FU6A 5HY6A 3SD4A 1KQ1A 4X9DA 2ZPHB 1KQSA 1M5Q1 4BD3A 5A0GA 3MP8A 3RERA 3LH0A 1UB4A 4PNOA 3HPWA 3J80E 4IUUA 3CCRA 4PJOA 1M90U 2FB7A 2NLUA 3ZEHA 2RJFA 3SWNC 2LQ8A 3L2RA 4LDXA 3ZBDA 2MMPA 4C5EA 3L42A 3SWNB 3JB9G 1YJNT 4GLKA 3CMET 4F7UF 1DJ7B 3OBWA 5GAMj 4M78F 3VJPA 1UGRB 5GAN7 4HKEA 4JUVA 2DVEA 3P8BB 2MWPA 1VQPA 1Y7XA 2IG0A 4BI3A 3C95A 2P4TA 1Q81U 4M75D 5J39A 3PTAA 2FL7A 5A0DA 3X25B 3O8VA 3M55A 3S6WA 3M59A 2DAQA 3QO3A 2PUKB 5D6WA 1PSFA 3RMQA 3F70A 5GAN4 2L8DA 3OYFA 2E6NA 1G3SA 3CBPA 5IT9E 2LNVA 4M7AA 2MI6A 2LT1A 3BFMA 5GANd 2QQBA 3A8MB 2QEXA 2E12A 3QDRB 5LJ5h 4XTZA 4R56A 2JZ2A 2ZPBB 2X4JA 3ER0A 4XQ3A 5CCAA 5KCOA 3RKWA 5GAN8 2K5LA 3R6OA 3CCUA 1VQLA 3CCQT 4JRKA 3CD6T 2V8KA 3OS2A 5GANg 3JAME 3G71T 3OSSC 1O75A 4KBMB 2HD0A 4QW2A 4WF2A 3QYGB 2E5QA 1VQ9A 3FIFA 4MDXA 4QQGA 3CPWA 4N0AA 1YJWT 1K8AC 3OYMA 2DPPB 5AYFA 1M1KU 2EQKA 2RHXA 1I81A 4J6WA 4QVCA 5DY9A 1WQ7A 1V29B 3OYJA 2QA4A 3LX7A 5LJ5d 4JRPA 2RJDA 2XICA 1M4ZA 4M75E 4LD6A 4OB2B 3GNFB 4EMGA 2RI5A 2RHYA 3I55T 2VUBA 4ELZC 1NJIC 1VQ5T 4L59A 1XOVA 3OBYA 3S3OA 5DLQE 2HQXA 3QYHB 1WGSA 1OI1A 3A8LB 5J3BA 4C8QG 3PFSA 3GP8A 2MF2A 1JJ2A 5GMKl 2KQWA 4M7DA 5LJ5g 4RG2A 2GF7A 3L2VA 2XU8A 4E7LA 4M77G 3M5AA 1VQKA 3J7AF 3L2UA 5LJ5j 1Q7YC 4BDYA 5LJ3e 1M9SA 3HHTB 3HP9A 5L8RE 5CKFA 3HFOA 4EPCA 3OS0A 4C0GA 3L2WA 4HT9A 2DZCA 4OB3B 2D6FA 4JS4A 2Y4XA 3SDZA 2VC8A 2DTIA 4NL3A 2QQ9A 1WNLA 4C0FA 4E47A 5GAMe 4ZGEB 1KC8C 4ATOA 1SSFA 3CPFA 3CCEA 1QVPA 2BKDN 3H6ZA 3L1AA 4PJOG 4L6V5 4C0DC 3I56A 3N5BB 4M75F 4FT2A 2CYZB 3HRSA 4C0DB 1YHQA 4JS5A 2EYQA 2IVWA 2LX9A 5FU6C 4J8OA 3OYDA 2O4XB 5FU6B 3OYYA 4B9WA 2X35A 1WPYA 4OMFB 3M4YA 3JCMe 2XDPA 2EIFA 1OYXA 1YJ9T 5EG2A 2AHJB 3PGGA 2KSSA 1K8AU 4C92B 2CS7A 2DD4A 4OVAA 1KD1U 4RCBA 3DLLA 3CCJA 1VQ8T 2VV5A 1VQOT 4BE1A 1IZ6A 4PKCC 3OYCA 1M8VA 1KHCA 2R5MA 1H3ZA 3RMSA 1UGSB 3FJPA 5M9OA 4XTYA 2WACA 2DIQA 3M4GA 5GAN5 2R57A 5CAIA 4M78E 5CQXA 1BI3A 4M7AG 4BACA 4BY6C 4ZTJA 5CKHA 2O01E 4DOVA 3QG1A 1VQ7A 3UPUA 3DKMA 1X01A 4BY6B 1Q7YU 3OW2A 3CCLA 1VQNA 2HBPA 4M78C 3V8JA 3C94A 4M78B 5GAN3 2OTLA 3HSBA 2XKOC 1WJQA 2K4YA 4ZN3A 2VXFA 2QQRA 2XD0A 4ZTFA 1VQMT 3CC4A 5CKEA 1LOJA 3OB9A 3BY7A 1QVGA 4JJNK 1YIJT 2LRQA 3A8OB 3BDUA 5GMKm 1FWZA 4JRIA 5LJ5f 1W2BA 1NPRA 4KUDK 1X75C 4HA8A 2E6ZA 2YLCA 2Y4YA 3BDLA 2RO0A 3QUIA 1VIEA 1JRIA 4MZMA 5GAOl 4A53A 5GMKj 4VUBA 1QVFS 2M0OA 5GANh 1G3WA 5C6SA 4HCZA 2KAFA 3DB4A 4XU0A 5J26A 4C8QD 4DA4A 3QSUA 4FL6A 2YHTA 2RJCA 1NZ9A 4E7KA 4CI0C 2EAYA 5GAN2 5KH6A 4M7DG 4M77D 1OZ3A 3FLGA 3CCMA 4QVDA 3M9QA 1Y96B 1QP2A 4A4KA 2JNGA 2QTXA 3E1SA 3JB9F 4XTVA 3VUZA 2DTHA 2EQUA 3HKSA 4BE2A 1VIFA 1R8OB 1X6OA 2CZ1B 3MEVA 1OZ2A 1ZQ1A 4J7IA 3G4SA 5HK3A 2JTFA 2Y90A 2O4XA 3S3MA 1VQPT 1Q86C 1Y07A 5CKBA 2DXCA 5I2SA 4PJOD 1JB0E 5FLXE 4MDWA 3TREA 4EMKC 3LW5E 2M16A 3M54A 3GF5A 4C92A 1K9MC 1HK9A 4EMKB 4RCCA 1AHJB 1NE8A 3J81E 2DK3A 3OYGA 2E65A 4XTXA 1GXIE 1XNIA 3UDCA 2GFAA 3PT9A 3G6EA 3NFCA 3X24B 4PLIA 1HXDA 1Y71A 4OGCA 2LCLA 2OTJA 4BUGA 4RG8A 1BI0A 4LDUA 4XTUA 2XG8D 5GANj 5CVIA 2QEXT 4J6XA 2JUFA 3X20B 1VQ4A 1N8RC 4C8QE 2XDBA 2LTOA 4LDVA 2VGMA 3SFMA 3OYIA 3GLXA 4E7HA 2RJEA 1NPPA 2P0QA 1VQLT 3OYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB3 A;  3I56 A;  3CCU T;  1YIJ A;  1YIT A;  3CCL T;  1YHQ A;  2KVQ G;  1QVF A;  3CXC A;  2JOY A;  3OYY A;  2KDS A;  1VQ9 T;  3CCM T;  2EIF A;  1YJ9 T;  1K8A U;  3CC4 T;  2XHC A;  4TVR A;  1VQ6 A;  3CCQ A;  5HY6 A;  3LGL A;  1KD1 U;  3CD6 A;  1KQS A;  3G71 A;  3LH0 A;  3CPW S;  3G4S T;  3CCR A;  3J80 E;  3DLL A;  3CCJ A;  1VQ8 T;  1RL2 A;  1M90 U;  1VQO T;  3CCV A;  1IZ6 A;  2LQ8 A;  5IAY A;  1YJW A;  1K9M U;  1S72 A;  1YJN T;  2MWO A;  3CME T;  1YI2 A;  3CCS A;  3I55 A;  3G6E T;  4YTL A;  3P8B B;  1VQP A;  2MWP A;  1JJ2 S;  1VQ5 A;  2IG0 A;  2DO3 A;  1Q7Y U;  3OW2 A;  1VQ7 A;  1VQK T;  1Q81 U;  3CCL A;  1VQN A;  2OTJ T;  1KHI A;  2OTL A;  4ZN3 A;  3CC7 A;  1N8R U;  1VQ4 T;  2QA4 T;  1VQM T;  3CC4 A;  1Q82 U;  3CMA A;  1NJI U;  1Q86 U;  1QVG A;  3I56 T;  5IT9 E;  1K73 C;  1KD1 C;  3A5Z B;  1YIJ T;  1W2B A;  1YHQ T;  1VQ8 A;  1NPR A;  2MI6 A;  2E6Z A;  1VQO A;  2QEX A;  3CC2 A;  1M1G A;  1BKB A;  1QVF S;  3CXC S;  3ER0 A;  1VQL A;  3OW2 S;  3CCU A;  1VQ6 T;  3DB4 A;  5J26 A;  3CCQ T;  1EIF A;  3CD6 T;  2G3R A;  1NZ9 A;  3JAM E;  3G71 T;  1VQL T;  2LVM A;  3CCJ T;  2E70 A;  3CCV T;  1KC8 U;  3CCM A;  1VQ9 A;  1KQS S;  2JNG A;  1YJ9 A;  3CPW A;  3KBG A;  1YJW T;  1K8A C;  1M1K U;  1S72 T;  3CCE T;  2JVV A;  2QA4 A;  3HKS A;  1YI2 T;  1X6O A;  5DM7 R;  1YIT T;  1Q82 C;  1NJI C;  3G4S A;  3CCS T;  3I55 T;  1XTD A;  1VQP T;  1Q86 C;  1VQ5 T;  2CKK A;  1VQ7 T;  1VQN T;  2L3R A;  1M90 C;  1UEB A;  5DLQ E;  5FLX E;  3TRE A;  2OTL T;  5J3B A;  1JJ2 A;  1YJN A;  3CME A;  5A2Q E;  1K9M C;  3CC7 T;  4CRI A;  4RG2 A;  3J81 E;  1YBY A;  1XNI A;  5LL6 S;  3CMA T;  3G6E A;  1K73 U;  1VQK A;  3CCR T;  2LCL A;  3J7A F;  1Q7Y C;  2OTJ A;  1Q81 C;  3LGF A;  4ZN1 A;  2QEX T;  4QQD A;  2JUF A;  3CC2 T;  1QVG S;  1VQ4 A;  1N8R C;  3PIP A;  1KC8 C;  1W2B S;  1VQM A;  1SSF A;  3CPF A;  3CCE A;  1M1K C;  1NPP A;  4X34 A;  3PIO A; 
#chains in the Genus database with same CATH topology
 4RUG A;  3OS1 A;  4M78 A;  2PQW A;  4M75 C;  2DYI A;  4M7A D;  3NHN A;  2KT1 A;  1BI1 A;  5CK9 A;  2SRC A;  1VQ6 A;  1XQH A;  4RTW A;  3P8H A;  3E9F A;  1QP3 A;  5GAO m;  3OYL A;  3H0H A;  3CCV A;  3I35 A;  4PJO C;  1GCP A;  4LUD A;  3S3N A;  2KY9 A;  2OAW A;  2J6F A;  1KG1 A;  3G6E Q;  3CCQ Q;  4YTL A;  3CD6 Q;  4OMO A;  2F1L A;  1OPL A;  2RQR A;  2ZGW A;  5IN1 A;  3H0F A;  2E1H A;  1EZZ B;  1WHH A;  1OV3 A;  3NTI A;  1QCN A;  4FW2 A;  1W70 A;  5FRN A;  2QYZ A;  3X26 B;  8ATC B;  2CZ0 B;  3TSW A;  2JN0 A;  2JXB A;  2NUT B;  3QJY A;  2F5T X;  3GBQ A;  3QBY A;  1KQ2 A;  2P0P A;  3E19 A;  3HRU A;  4MZP A;  1TTH B;  3GNG A;  2JS2 A;  1BIA A;  2ED0 A;  1X27 A;  2G6F X;  2E70 A;  1KC8 U;  1KQS S;  4FYV B;  5KYY A;  1S72 Q;  3VYH B;  2RB6 A;  4OB1 B;  2F2X A;  2BIV A;  5HK0 A;  2VGN A;  3OQ5 A;  3CCS Q;  2M02 A;  2L3Q A;  5LJ3 d;  1NJI R;  3M58 A;  2J06 A;  4D6W A;  1BCO A;  2KR3 A;  5A2Q E;  4RKU E;  4M4Z A;  4F7U G;  4J9C A;  3VS3 A;  3GOX A;  3HL8 A;  5LJ3 g;  3CCR T;  3O5Z A;  1VQ8 Q;  2EQM A;  1VQO Q;  2DTO A;  3H41 A;  3KUF A;  3JCM d;  1B07 A;  2CP0 A;  2FZK B;  1D3B A;  1UUE A;  4D8K A;  2HNI A;  2F5K A;  1I5L A;  4O5V A;  5GAO r;  4QQ6 A;  4M7D F;  3JCM g;  3QWY A;  1ZSZ A;  2VVK A;  5C0M A;  4L5G A;  1NYG A;  4KGV B;  5ECA A;  3PNW C;  3OA6 A;  3G71 A;  3CPW S;  4PJN A;  4X9C A;  4Z02 A;  2AKK A;  2GQV A;  3FEO A;  2EPD A;  1ZHI A;  4P5N A;  1VQ5 A;  2MYS A;  1K1Z A;  3I55 A;  1BU1 A;  2DEU A;  1YFN A;  2OTJ T;  2PTK A;  4F17 A;  2FG0 A;  1QWE A;  4BB7 A;  2QA4 T;  4C92 D;  1N9R A;  1Q86 U;  3E9G A;  1H64 1;  2DYB A;  3TQ7 P;  3T9N A;  2PVG B;  2E10 A;  1VOM A;  1Q95 G;  4ZGD B;  1M3A A;  3MCA B;  4EDU A;  1AZE A;  2RQV A;  2QI2 A;  2BTT A;  2YLB A;  4EIK A;  1IGQ A;  2BZX A;  4IUT A;  1AWJ A;  4KGZ B;  3RDV A;  3CCE T;  4OMN A;  3H8Z A;  1B7T A;  3EG3 A;  1NEG A;  2EFI A;  1AOJ A;  4M7A B;  1WIE A;  3PMT A;  3DLM A;  3RKX A;  3QDF A;  2EQJ A;  2HMA A;  2WSC E;  4C92 C;  2KMT A;  3CMA T;  3RES A;  2EQI A;  4XU1 A;  4ZNX A;  2DXB A;  3CBM A;  3MEU A;  3LGF A;  1PKT A;  3QZ5 B;  5GAO n;  1LVK A;  1M3C A;  3CC2 T;  1QVG S;  1CSK A;  3QKJ A;  4PJM A;  1W2B S;  5I2M A;  4N0A C;  4C8Q A;  2DXT A;  4F7U E;  4X34 A;  1GBQ A;  4R55 A;  1PWT A;  3CCL T;  1YIJ A;  2FHD A;  3MET A;  4M77 A;  5EC7 A;  2CP3 A;  4Y91 A;  1KSW A;  2RM4 A;  5IH2 A;  4IUP A;  3VS5 A;  2OJ2 A;  3TEE A;  2LQW A;  4M7D C;  3EGU A;  4X9D A;  9ATC B;  2KBT A;  1M90 U;  4F14 A;  1YHQ Q;  4PFZ A;  3RBB B;  1K76 A;  4F7U F;  1BB9 A;  1T0H A;  2DVE A;  1Y7X A;  4BI3 A;  1RLQ C;  2V1R A;  5A0D A;  1IXD A;  3X25 B;  3O8V A;  3S6W A;  3RMQ A;  3F70 A;  1WXU A;  2GQI A;  1G3S A;  2PNI A;  3EGD A;  2DBK A;  2DF6 A;  2LNV A;  2LT1 A;  3BFM A;  3A8M B;  2QEX A;  1WZO A;  3M0S A;  1Q82 R;  2E12 A;  3QDR B;  1PD1 A;  2X4J A;  3ER0 A;  4XQ3 A;  3EGX B;  2O9S A;  2K5L A;  3R6O A;  2L3S A;  2AK5 A;  3CCQ T;  3CD6 T;  2V8K A;  2QDL A;  3JAM E;  2HQH A;  4ORZ A;  2E5Q A;  1VQ9 A;  1SSH A;  1K8A C;  5AYF A;  2BE9 B;  2RHX A;  5DY9 A;  2RQU A;  3AT1 B;  3LX7 A;  4OB2 B;  2J6O A;  3GNF B;  2K7A A;  2RI5 A;  4AMC A;  2VUB A;  3BE3 A;  4L59 A;  2D8J A;  3S3O A;  1BCM A;  1RAI B;  2GGR A;  4RTY A;  3PFS A;  4GBQ A;  4E7L A;  1KFZ A;  3VS6 A;  2YUO A;  1E7O A;  3M5A A;  1VQK A;  3HP9 A;  4EPC A;  3VRY A;  4C0G A;  3EHQ A;  2QQ9 A;  1YWP A;  3CPF A;  2L2P A;  4PJO G;  2FO0 A;  3I56 A;  3N5B B;  2CH4 W;  2CYZ B;  2EYQ A;  2IVW A;  2LX9 A;  2O4X B;  3OYY A;  1HSQ A;  2YUQ A;  3PGG A;  4KGX B;  4C92 B;  2CS7 A;  2DD4 A;  2CP5 A;  1ZSZ B;  2DX1 A;  1QCF A;  3DLL A;  1VQ8 T;  1SF9 A;  4A63 B;  1VQO T;  1WXT A;  4PKC C;  1M8V A;  1KHC A;  8AT1 B;  1UGS B;  2DIQ A;  3M4G A;  2ZAE A;  1BI3 A;  4M7A G;  3CPW P;  5CKH A;  4DOV A;  4BY6 B;  1X01 A;  1VQN A;  3V8J A;  3MKD A;  1KK7 A;  1WJQ A;  3CCV Q;  2VXF A;  2OX7 A;  3A8O B;  1T3L A;  4JRI A;  5LJ5 f;  2RMO A;  4Z88 A;  1X75 C;  2E6Z A;  5KYU B;  2RO0 A;  3QUI A;  2YDL A;  4CC3 A;  5GAN h;  2KAF A;  2EYZ A;  2YHT A;  1K9M R;  2RJC A;  3A98 A;  1NZ9 A;  1C0M A;  1AWW A;  4CI0 C;  5KH6 A;  2QTV A;  3CCM A;  1Y96 B;  2JNG A;  2KT8 A;  2DTH A;  3EG2 A;  4HVU A;  1X6O A;  2CZ1 B;  1NJI C;  1ZQ1 A;  2YRC A;  3G4S A;  2JTF A;  5FLX E;  4EMK C;  3LW5 E;  2M16 A;  3M0Q A;  3GF5 A;  4RCC A;  1U3O A;  1WDX A;  1GXI E;  1XNI A;  1GFD A;  1MNE A;  1TXQ A;  1ARK A;  1Y71 A;  4BUG A;  4RG8 A;  1UHF A;  2KRS A;  4XTU A;  5GAN j;  2JUF A;  1VQ4 A;  2VGM A;  3OYD A;  1VQL T;  2HSP A;  5CO7 A;  1RLP C;  2DZ9 A;  4C8Q B;  5IHN A;  4FM4 B;  1IRX A;  1QVG P;  2DJQ A;  2KNB B;  2LQK A;  1X6G A;  1W2B P;  4M77 B;  2VB6 A;  3MP1 A;  1U1S A;  2O31 A;  1C6V X;  2V26 A;  4PLL A;  4PJO E;  4KT0 E;  2CZ7 B;  4OP0 A;  3SWN A;  4GY5 A;  3OMG A;  3TVT A;  4XU2 A;  2EVR A;  1YI2 A;  2COY A;  2DL4 A;  3SHW A;  4XK8 E;  1WX6 A;  1W1F A;  1D1A A;  2OTJ Q;  4DEY A;  1ZSG A;  2LCS A;  2RHU A;  2DNU A;  4Q5W A;  4DOW A;  3GIB A;  3CC7 A;  1N8R U;  2Z0W A;  3LWH A;  2K5F A;  4PJO F;  4A4E A;  3I55 Q;  5KYW B;  1YHQ T;  3OYH A;  1OEB A;  1M1F A;  3EGD B;  5GAO p;  2RQT A;  3VV0 A;  2RK1 A;  1BKB A;  5FWB A;  1C1A A;  1S1N A;  2NUP A;  1GFC A;  3A8H B;  5LJ3 h;  2HBW A;  2L89 A;  2J6K A;  1PKS A;  4PK4 A;  5GAN e;  2HQE A;  2KE9 A;  4B9X A;  4C92 G;  2GFU A;  5FRM A;  4V2S A;  1UEC A;  1MGQ A;  1N9S A;  3BW1 A;  2CSQ A;  4M7A F;  1WJS A;  5FRO A;  2CKK A;  4M75 A;  2VAS A;  2OTL T;  3EG0 A;  1YJN A;  2F2V A;  3LH5 A;  2BZY A;  3H0I A;  1N6A A;  5GAM d;  5LJ5 e;  2DL5 A;  2QQA A;  5LL6 S;  3CMA Q;  4C0Z A;  2YRD A;  2K57 A;  4ZN1 A;  1MND A;  1D1C A;  2F2W A;  3CC2 Q;  1QQJ A;  1N27 A;  2HKN A;  5LJ3 j;  5I22 A;  2CZ6 B;  5GAM g;  3VKI A;  4E7J A;  1YIT A;  3M0R A;  3UT1 A;  1QVF A;  2DET A;  4J9F A;  1GRI A;  5I21 A;  2KDS A;  2AKL A;  1FMW A;  1TUG B;  4FIB A;  2I2L A;  2ZZD A;  4RTT A;  4J6Y A;  4MZT A;  2EKO A;  1PD0 A;  1U5S A;  1U1T A;  3M0P A;  3OYE A;  1PM3 A;  1JBM A;  1K73 R;  1KD1 R;  3OYN A;  2MWO A;  5FW9 A;  3MEA A;  2LDM A;  4A4H A;  2D8H A;  3NTH A;  3THK A;  4F16 A;  1JJ2 S;  1RI9 A;  2DD5 A;  2H3J A;  2F69 A;  2C06 A;  4LNP A;  1KHI A;  2FPF A;  1NLO C;  4PJL A;  2VYT A;  1MMA A;  3GPL A;  3EFO A;  1I8F A;  5IHI A;  3FDR A;  1NJI U;  3QZ9 B;  3C4S A;  3G7Z A;  1LJO A;  3C0C A;  1WHM A;  2KRM A;  2PU9 B;  4IUR A;  1T0J A;  3FRN A;  1X2K A;  1VQ6 T;  1YCY A;  1VUB A;  2G3R A;  2K5I A;  2JTE A;  2CP7 A;  1K0S A;  4M78 D;  1T3S A;  3CCV T;  4NL2 A;  1G8X A;  2QEX Q;  1YJ9 A;  1Q81 R;  4II1 A;  4KUI A;  1D1B A;  2O2O A;  3SB2 A;  4O6J A;  1XTD A;  5CR2 A;  1G2B A;  3I5S A;  2KRO A;  2L3R A;  1M90 C;  4M7A C;  4C92 E;  5D6X A;  2EGE A;  3QPH A;  1I1J A;  1YBY A;  2FZC B;  2NWM A;  1J3T A;  4OMP A;  3D7S B;  2E64 A;  2QXF A;  2M1H A;  4B6M A;  1BBZ A;  4UC4 A;  5GMK h;  3JCM X;  3LYI A;  4GLM A;  3OS5 A;  2ECZ A;  1B34 A;  1VQM A;  1WJR A;  1JXM A;  4BDZ A;  3MP6 A;  4AG2 C;  2FVU A;  1M1K R;  1OX9 A;  3CXC A;  4M7D E;  4C92 F;  1FMK A;  2DA9 A;  4PL6 A;  2V8I A;  3KXT A;  1ZA1 B;  4PFP A;  1KQ1 A;  2ZPH B;  3NMZ C;  1M5Q 1;  1PCX A;  3MP8 A;  3LH0 A;  3CCR A;  4IUU A;  2NLU A;  2RJF A;  3L2R A;  3ZBD A;  3SWN B;  4GLK A;  1DJ7 B;  1PRL C;  6AT1 B;  4JUV A;  3P8B B;  1VQP A;  2MWP A;  3C95 A;  2P4T A;  1WHG A;  1KJW A;  2E3I A;  1K9A A;  3M59 A;  2DAQ A;  2PUK B;  1AZG B;  1R0B G;  2A28 A;  5IXF A;  2LP5 A;  1HYO A;  2MI6 A;  1VQN Q;  2DL8 A;  2ZPB B;  4ESR A;  1X6B A;  5GAN 8;  5CCA A;  1NG2 A;  3CCU A;  3KFV A;  2YT6 A;  1IB8 A;  3G71 T;  3OSS C;  4QW2 A;  4KBM B;  4WF2 A;  2RQW A;  3QYG B;  4MDX A;  1Q7Y R;  4N0A A;  2EQK A;  1I81 A;  1M27 C;  2QA4 A;  1WQ7 A;  1M4Z A;  4LD6 A;  2HDA A;  4EMG A;  1VQ5 T;  3I55 T;  1KC8 R;  1XOV A;  3OBY A;  2HEQ A;  1UDL A;  2MF2 A;  4M7D A;  4AG1 C;  1ZUU A;  2XU8 A;  1M9S A;  1TUD A;  5L8R E;  5CKF A;  2DZC A;  4KH0 B;  3SDZ A;  2VC8 A;  3TSZ A;  1X43 A;  2J7I A;  4FSS A;  3CCE A;  1WXB A;  1VQL Q;  2ED1 A;  4L6V 5;  4FT2 A;  4C0D B;  3HRS A;  4HVW A;  2KI7 A;  2V1Q A;  1I07 A;  1YN8 A;  1WPY A;  3VS4 A;  4LXC A;  1IGU A;  2XDP A;  5EG2 A;  2KSS A;  2E5K A;  1ZSZ C;  3CCJ A;  4KRT A;  2VV5 A;  2FPE A;  4J9G A;  2AIR B;  3FJP A;  1F1B B;  1PHT A;  2DL3 A;  1OUL A;  5GAN 5;  2R57 A;  4BAC A;  4BY6 C;  1VQ7 A;  3UA7 A;  3CCL A;  4M78 B;  5GAN 3;  2XKO C;  4ZN3 A;  1AVZ C;  1RAF B;  4FYY B;  2QQR A;  2XD0 A;  1JJ2 P;  1YI2 Q;  4WCI A;  4QT7 A;  2K9G A;  1ZBJ A;  1E6H A;  1YIJ T;  5GMK m;  1FWZ A;  2YLC A;  2M0Y A;  3BDL A;  2DLP A;  1JRI A;  4MZM A;  5GAO l;  1Q86 R;  2MPX C;  1G3W A;  5C6S A;  3DB4 A;  5J26 A;  4C8Q D;  4DA4 A;  3QSU A;  1NEB A;  2ABL A;  4E7K A;  1VYU A;  4M77 D;  1V76 A;  4XTV A;  3NGP A;  3HKS A;  1VIF A;  2JMA A;  1UG1 A;  5HK3 A;  5CKB A;  5I2S A;  2OTL Q;  3TRE A;  1HK9 A;  1M2V A;  3CC4 Q;  2E65 A;  3UDC A;  3G6E A;  3NFC A;  4PLI A;  5KYX A;  2LCL A;  2NYS A;  1OOT A;  2DRM A;  2XG8 D;  5CVI A;  1UGV A;  2QEX T;  4J6X A;  1N8R C;  5KYY B;  2P0Q A;  4N4G A;  3I5R A;  4C8Q C;  4F7U A;  3PMI A;  1Z9Q A;  4JJB A;  5HCK A;  4M77 C;  1VQ9 T;  3PVL A;  1LNX A;  3HFN A;  3X20 B;  2RHZ A;  2XI9 A;  3P8D A;  2LJ0 A;  2JTM A;  2O88 A;  4A54 A;  1ACM B;  1K9M U;  2MCN A;  1S72 A;  4LN2 A;  3OYB A;  1WQW A;  4K11 A;  1P92 A;  2V8J A;  3CCS A;  2DO3 A;  1VQK T;  1D3B B;  2LNH B;  2MK5 A;  3JCM c;  3OMC A;  4J5Y A;  3M53 A;  4OGE A;  4NS5 A;  4Z89 A;  1UJ0 A;  3MHX A;  1M8M A;  3RIR A;  1QVF P;  2A7Y A;  2K3X A;  4MMK A;  1GCQ C;  3I56 T;  3OYA A;  1VQ8 A;  1VQO A;  2XMF A;  1U06 A;  1UGQ B;  2EGA A;  2FYK A;  4EMK A;  5GAN f;  4EMH A;  3JCM Q;  1W6X A;  2D0N A;  1VQ6 Q;  1G3Y A;  2ZPI B;  1TG0 A;  1EIF A;  1MV0 B;  5GAO q;  4RTZ A;  3INZ A;  2X4X A;  3V7C A;  3OY9 A;  2MOX A;  2D9T A;  5GJW B;  5CQY A;  4XU3 A;  4HCC A;  3JCM P;  2IPO B;  3JRZ A;  2EBP A;  2WSF E;  1VQN T;  4A4G A;  2YRV A;  3ZFJ A;  3CME A;  4JLI A;  3CBO A;  1SPK A;  1WLP B;  3ASK A;  4M78 G;  3VU3 C;  3JCM b;  1D0Z A;  2COZ A;  2DE0 X;  3UWN A;  2E4H A;  2QDY B;  3AHU A;  4CC2 A;  2DRK A;  2CT3 A;  2X4Y A;  4QQD A;  4IKF A;  1I5O B;  3ZL7 C;  1TU0 B;  1M1K C;  2P4R A;  2D0Q B;  2C0T A;  2CH4 A;  2XID A;  4CC7 A;  2QAS A;  2YSQ A;  2YUN A;  2C0I A;  1BYM A;  2E41 A;  3CCM T;  1RI0 A;  3EHR A;  2M9U A;  2GTO A;  2RD1 A;  1VQM Q;  4QVZ A;  4RTU A;  2LC4 A;  3EH1 A;  3G4S T;  2GCX A;  5FU7 B;  1TWB A;  2DJZ A;  2NUT A;  4Y28 E;  3RNJ A;  1YJW A;  2MAM A;  4DBQ A;  2K6D A;  2PVD B;  5A0L A;  1ZX6 A;  1ZBX A;  2RA2 A;  2R5A A;  1FXX A;  4XTW A;  2KXC A;  1BI2 A;  2CDT A;  2CT4 A;  3URG A;  1VQ4 T;  5CKD A;  3CXC P;  4ELY C;  5L23 A;  2ROT A;  4AFZ C;  1G3T A;  1H8K A;  1UGP B;  2PUO B;  1FYN A;  4J83 A;  2H3E B;  2A3L A;  2LCC A;  4FCY A;  1CKB A;  1MMN A;  5LJ3 f;  1M1G A;  1SRM A;  1EX4 A;  4HXJ A;  2FRW A;  1WHK A;  2JS0 A;  3ME9 A;  4Z8A A;  1NLP C;  3JSC A;  3G71 Q;  4E7Z A;  3JCM V;  1B3Q A;  2K3Y A;  1JQQ A;  3KBG A;  5DLO A;  2EJF A;  4ANJ A;  4M7A E;  1YI2 T;  2ENM A;  2LZ6 B;  1TOV A;  2DIG A;  5DM7 R;  1VQ5 Q;  3JCM f;  1QWF A;  3EG1 A;  1OU8 A;  2K2V A;  1YNZ A;  3VS7 A;  2K2M A;  1AWO A;  4BI4 A;  2XK0 A;  1AEY A;  1NM7 A;  3CC7 T;  1WHL A;  3V8L A;  1AT1 B;  3H9N A;  3EFR A;  4KUL A;  1K73 U;  1O9S A;  4OF1 A;  2X3W D;  3NPF A;  2DEQ A;  3MEW A;  2DIL A;  4LDY A;  5KYX B;  4WTO B;  4LDW A;  1H92 A;  4LE9 A;  5FWC A;  1BIB A;  2EW3 A;  3Q1J A;  1I4K 1;  3REA B;  3JCM h;  3UAT A;  3VS0 A;  1NYF A;  4F7U B;  1MMG A;  2KRN A;  2CUB A;  4DBH A;  1RAG B;  3CC4 T;  1TUC A;  4TVR A;  3JCM W;  4JZ3 A;  4FU6 A;  3SD4 A;  1KQS A;  4BD3 A;  3RER A;  5A0G A;  1BK2 A;  4PNO A;  4PJO A;  1QKW A;  3ZEH A;  3SWN C;  2LQ8 A;  3L42 A;  3JB9 G;  1YJN T;  1JEG A;  3OBW A;  4M78 F;  4X1V A;  3UA6 A;  1UGR B;  3EH2 A;  1Q81 U;  3IQL A;  4M75 D;  5J39 A;  3CCJ Q;  2DMO A;  1M3B A;  1PSF A;  2HL5 C;  2O9V A;  2L8D A;  4FYX B;  3CBP A;  5IT9 E;  1YIJ Q;  1K8A R;  4JPB W;  4M7A A;  5GAN d;  3MJX A;  2QQB A;  4XTZ A;  2JZ2 A;  1D09 B;  1YCS B;  1YP5 A;  3OS2 A;  5GAN g;  4OMQ A;  1O75 A;  2JJ9 A;  3M0U A;  1AWX A;  3CPW A;  1M1K U;  3OYM A;  2DPP B;  1V29 B;  5LJ5 d;  2JMC A;  3PVQ A;  3HTR A;  4JRP A;  2RJD A;  2XIC A;  1Q82 C;  1EFN A;  2RHY A;  4ELZ C;  2DVJ A;  2LJ1 A;  2LJ3 A;  2CSI A;  5DLQ E;  3QYH B;  1WYX A;  4OML A;  3A8L B;  5J3B A;  4C8Q G;  2C0O A;  5LJ5 g;  4RG2 A;  2FEI A;  2GF7 A;  3E2U A;  4M77 G;  1GBR A;  1PG5 B;  3J7A F;  3L2U A;  5LJ3 e;  4HT9 A;  3HFO A;  3L2W A;  4OB3 B;  4JJC A;  4DBF A;  2DTI A;  4ZGE B;  4C0F A;  1SSF A;  1MV3 A;  1QVP A;  4C0D C;  2CP6 A;  3SEM A;  4J8O A;  5FU6 B;  4B9W A;  1VQ9 Q;  1KIK A;  4OMF B;  3M4Y A;  3JCM e;  2EIF A;  1YJ9 T;  1OQK A;  4RCB A;  2MIO A;  1PRM C;  4BE1 A;  1H3Z A;  3RMS A;  3EGX A;  2WAC A;  2BZ8 A;  2HKQ B;  2W0Z A;  1RAB B;  2DL7 A;  1VQK Q;  3UPU A;  1Q7Y U;  3OW2 A;  2EGC A;  4M78 C;  2ATC B;  3C94 A;  2X3X D;  3HSB A;  2K4Y A;  2HL3 A;  1VQM T;  2LMJ A;  1LOJ A;  3I56 Q;  3OB9 A;  3BY7 A;  1QVG A;  4IIM A;  4JJN K;  1W2B A;  2LRQ A;  1NPR A;  1ZUK A;  4HA8 A;  4PJJ A;  2B86 A;  2Y4Y A;  2HSE B;  1SKU B;  4A53 A;  5GMK j;  4VUB A;  1QVF S;  2M0O A;  4HCZ A;  2I0N A;  4FL6 A;  2AZV A;  1OZ3 A;  3FLG A;  1QP2 A;  2YUP A;  3E1S A;  3JB9 F;  3VUZ A;  2EQU A;  4BE2 A;  1UE9 A;  1VA7 A;  4AFU C;  4ATO A;  4J7I A;  3S3M A;  2Y90 A;  2O4X A;  1VQP T;  1X2Q A;  2HCK A;  1JB0 E;  4MDW A;  2KGT A;  1G83 A;  3A1P A;  4C92 A;  1K9M C;  1AHJ B;  3OYG A;  3J81 E;  1GL5 A;  4JZ4 A;  2GFA A;  3PT9 A;  1PNJ A;  2NUP B;  1HXD A;  4OGC A;  5AT1 B;  2OTJ A;  1UTI A;  1RUW A;  4C8Q E;  2LTO A;  3SFM A;  3OYI A;  3CME Q;  1NPP A;  2FRY A;  3CCU T;  2ZPE B;  4M77 E;  3WVD B;  4JRQ A;  2KYM A;  2JT4 A;  2NUZ A;  3UF4 A;  3M57 A;  4M75 B;  3JB9 H;  5D6Y A;  3CCM Q;  2DBM A;  2XHC A;  2RHI A;  4C5G A;  3QJ6 A;  2DM1 A;  3LGL A;  3L2Z A;  2ZCF B;  1VYT A;  4Y92 A;  2JM9 A;  3G4S Q;  1SHF A;  5KYU A;  1M30 A;  1JXO A;  2EJ9 A;  3MO8 A;  5IAY A;  5GMK e;  4E7I A;  2EKH A;  4C8Q F;  4PJO B;  4FT4 A;  3LLR A;  3JB9 D;  4E7S A;  4M77 F;  2VWF A;  2H8H A;  3QXE B;  1IRE B;  1Y96 A;  3U23 A;  3EFS A;  1W4S A;  1VQ4 Q;  1YJW Q;  4M7D D;  1Q82 U;  3CMA A;  2RH2 A;  3TCJ A;  3VYG A;  2RI3 A;  4OMM A;  1FMV A;  2PVO B;  3CC2 A;  4OB0 B;  1ZA2 B;  4HVV A;  2QGG A;  2WSE E;  3CXC S;  3OW2 S;  4HT8 A;  4DQ2 A;  2X51 A;  2ZPG B;  3CCJ T;  2YXY A;  4MML A;  2CP2 A;  4NOY A;  1ABQ A;  7AT1 B;  2RK2 A;  1IHW A;  3EFO B;  2W10 A;  3A8G B;  4LD9 K;  3OSV A;  1VQ7 T;  1QKX A;  3VS2 A;  4AFS C;  3JCM J;  1UEB A;  4JJD A;  1AD5 A;  3FB9 A;  3CC7 Q;  3PE0 A;  4CRI A;  3ULR B;  2L5Q A;  1SEM A;  4IUV A;  1R0C B;  2JW4 A;  4D8D A;  4N4I A;  2CRE A;  4IIO A;  4BI8 B;  2BE7 D;  4PFO A;  1XJW B;  5KE2 A;  2LT4 A;  4BE0 A;  3PIP A;  1RAD B;  2EYX A;  3PIO A;  3DB3 A;  3EAE A;  2SEM A;  2QQS A;  2KVQ G;  5GMK i;  2JOY A;  2IIM A;  3VS1 A;  2RF0 A;  2A08 A;  2XDD A;  4JDS A;  2HAX A;  5CIU A;  3RUX A;  2LQN A;  1D0X A;  4RMO A;  3M56 A;  3CCQ A;  1GCQ A;  2E3H A;  4C5H A;  3CD6 A;  3CEY A;  5KYW A;  5FU7 C;  1UHC A;  1H3H A;  1JU5 C;  1N5Z A;  1RL2 A;  4IUQ A;  1MMD A;  2DXU A;  2X4W A;  5HKC A;  1YJN Q;  3V7S A;  2DER A;  5KCH A;  4A4F A;  1YWO A;  3C12 A;  1B34 B;  2LX7 A;  2DKG A;  3G6E T;  2EJG A;  1FX7 A;  1MHN A;  3QHS A;  3WVE B;  3RKY A;  4ZGJ B;  3EG9 A;  1QW1 A;  1PSE A;  3L2Q A;  1QLY A;  1YIT Q;  1ABO A;  2ESW A;  1K73 C;  3A5Z B;  1KD1 C;  4FSX A;  2QK0 A;  2FZG B;  4J9B A;  5KE3 A;  2BUD A;  2GTJ A;  4ME7 A;  1KQS P;  1Z9Z A;  4N4H A;  1U8R A;  1M90 R;  4C5I A;  2QAZ A;  1QMC A;  2ZPF B;  4M75 G;  2PZ1 A;  3I9Q A;  2P0K A;  5GAM f;  2LVM A;  3NTK A;  3V8K A;  3FC3 A;  1SRL A;  3TU4 K;  2AZS A;  3JB9 I;  1VYV A;  3LWI A;  1S72 T;  1ZUY A;  2A0F B;  2JVV A;  4J7F A;  1V1C A;  2RN8 A;  1TSF A;  4HCK A;  1TH7 A;  3CCS T;  4E6R A;  2B8A A;  1HJD A;  1LPL A;  1E6G A;  2R58 A;  4RTX A;  3REB B;  2L3P A;  4HCB A;  2OAU A;  1CKA A;  3VUB A;  3V7R A;  1OPK A;  1A0N B;  1Q81 C;  5GAN 6;  2CGH A;  4XAX B;  5GAM h;  4JLG A;  2EWN A;  1WFW A;  2RI2 A;  2VXE A;  5D7U A;  3WXM B;  2KK4 A;  1G5V A;  4E2F B;  1JO8 A;  3JB9 J;  1YJ9 Q;  1HD3 A;  3HRT A;  1UFF A;  3X28 B;  1PC0 A;  4M7D B;  3QII A;  5HY6 A;  3M0T A;  1X69 A;  3CQT A;  1UB4 A;  3HPW A;  3J80 E;  2FB7 A;  5I11 A;  1I0C A;  4LDX A;  2MMP A;  4C5E A;  3CME T;  1NBE B;  5GAM j;  1WI7 A;  3VJP A;  5GAN 7;  4HKE A;  1Y57 A;  4J9I A;  2IG0 A;  2FPD A;  1R77 A;  4AFQ C;  3PTA A;  2FL7 A;  4FW1 A;  4RTV A;  3JV3 A;  3M55 A;  3QO3 A;  5D6W A;  5GAN 4;  1D0Y A;  2GBQ A;  2E6N A;  3OYF A;  3QWX X;  1K0X A;  3RR6 A;  2KEA A;  2GNC A;  1OX8 A;  5LJ5 h;  4R56 A;  5KCO A;  1VQL A;  3RKW A;  3R6N A;  1WA7 A;  4JRK A;  3CCR Q;  2HD0 A;  4LUE A;  3FIF A;  4QQG A;  2CUD A;  1YJW T;  3OW2 P;  1OU9 A;  4QVC A;  4J6W A;  1UJY A;  3OYJ A;  5IXB A;  1MUZ A;  4M75 E;  1VQP Q;  1RAC B;  2HQX A;  1WHJ A;  1WGS A;  1OI1 A;  3MPU B;  3GP8 A;  1JJ2 A;  2L0A A;  5GMK l;  2ROL A;  2KQW A;  2DFU A;  3L2V A;  4FYW B;  5GJV B;  4CC4 B;  5LJ5 j;  4BDY A;  1Q7Y C;  1SHG A;  3HHT B;  3OS0 A;  2KYB A;  2D6F A;  4JS4 A;  2Y4X A;  4NL3 A;  4E47 A;  1WNL A;  1KC8 C;  5GAM e;  2BKD N;  3H6Z A;  3L1A A;  3CCU Q;  2VKN A;  4M75 F;  1M2O A;  1YHQ A;  4JS5 A;  2A36 A;  5FU6 C;  2K3B A;  2YWW A;  4QKU A;  2X35 A;  1K8A U;  1OYX A;  2AHJ B;  2X9H A;  4J9E A;  2QA4 Q;  2P84 A;  4OVA A;  1KD1 U;  1M2V B;  3G1J A;  1IZ6 A;  2KXD A;  3OYC A;  2R5M A;  2COW A;  5M9O A;  4XTY A;  1Y0M A;  4F04 B;  2J05 A;  5CAI A;  4M78 E;  5CQX A;  4ZTJ A;  2O01 E;  3QG1 A;  3DKM A;  4R0K A;  2HBP A;  2M51 A;  4J9D A;  4J9H A;  2OTL A;  1QCO A;  4ZTF A;  3CC4 A;  3CCE Q;  5CKE A;  2EYW A;  1K4U S;  4KUD K;  3BDU A;  2K79 A;  3EG9 B;  2OI3 A;  4KH1 B;  1RAA B;  2A37 A;  1VIE A;  1IHV A;  1RAH B;  5IHK A;  4XU0 A;  2D1X A;  1IO6 A;  1TS9 A;  2EAY A;  5GAN 2;  4M7D G;  5KYN A;  4QVD A;  3M9Q A;  4A4K A;  4AT1 B;  2QTX A;  4DBR A;  1R8O B;  1YIT T;  3FJ5 A;  1OZ2 A;  3MEV A;  1N8R R;  1VQ7 Q;  1Q86 C;  2QG9 B;  1Y07 A;  3CCL Q;  3VRZ A;  2RNA A;  2DXC A;  4PJO D;  4DEX A;  2RPN A;  3M54 A;  4EMK B;  2QGF B;  1NE8 A;  2DK3 A;  4XTX A;  2JM8 A;  3X24 B;  2AT1 B;  1LCK A;  1BI0 A;  4LDU A;  1ZLM A;  1RAE B;  1SG5 A;  2EYY A;  2XDB A;  4LDV A;  4E7H A;  3GLX A;  2RJE A;  2HZY A;  3OYK A; 
#chains in the Genus database with same CATH homology
 3CCU T;  4N4G A;  2ZPE B;  4M77 E;  5CO7 A;  4C8Q C;  3WVD B;  4F7U A;  3OS1 A;  4M78 A;  2DZ9 A;  4JRQ A;  2PQW A;  4C8Q B;  3PMI A;  4M75 C;  4M7A D;  4FM4 B;  3M57 A;  2LQK A;  4M75 B;  3JB9 H;  4M77 C;  5D6Y A;  1VQ9 T;  4M77 B;  3MP1 A;  1LNX A;  2XHC A;  2RHI A;  3HFN A;  4C5G A;  1BI1 A;  3QJ6 A;  5CK9 A;  1U1S A;  1VQ6 A;  1XQH A;  2RHZ A;  2XI9 A;  3L2Z A;  2ZCF B;  3LGL A;  3P8H A;  3E9F A;  3P8D A;  4PLL A;  1QP3 A;  4PJO E;  1YIJ A;  4KT0 E;  2CZ7 B;  4OP0 A;  3SWN A;  5GAO m;  2JTM A;  3OYL A;  4GY5 A;  2EJ9 A;  3MO8 A;  3CCV A;  5IAY A;  5GMK e;  4E7I A;  4PJO C;  4A54 A;  3OMG A;  4C8Q F;  1K9M U;  4FT4 A;  4XU2 A;  3S3N A;  1S72 A;  2KY9 A;  4PJO B;  3OYB A;  3LLR A;  1YI2 A;  1KG1 A;  3JB9 D;  1WQW A;  4XK8 E;  1P92 A;  2V8J A;  4M77 F;  4YTL A;  3CCS A;  2DO3 A;  1IRE B;  3QXE B;  1D3B B;  1VQK T;  3JCM c;  1Y96 A;  3OMC A;  2RHU A;  4J5Y A;  3M53 A;  2ZGW A;  4OGE A;  4Q5W A;  4NS5 A;  4DOW A;  5IN1 A;  3GIB A;  3EFS A;  3CC7 A;  1N8R U;  1W4S A;  2E1H A;  3MHX A;  3RIR A;  2A7Y A;  4M7D D;  2K3X A;  1Q82 U;  4MMK A;  3CMA A;  3LWH A;  2K5F A;  3NTI A;  4PJO F;  4A4E A;  3I56 T;  2RH2 A;  3OYA A;  3TCJ A;  1YHQ T;  3OYH A;  3VYG A;  1VQ8 A;  1M1F A;  2RI3 A;  5GAO p;  1VQO A;  1UGQ B;  4EMK A;  2FYK A;  2PVO B;  3CC2 A;  5FRN A;  4OB0 B;  3X26 B;  5GAN f;  2CZ0 B;  2JN0 A;  3VV0 A;  4EMH A;  2RK1 A;  1BKB A;  2WSE E;  3JCM Q;  3QJY A;  3CXC S;  2F5T X;  3QBY A;  3OW2 S;  1G3Y A;  2ZPI B;  1KQ2 A;  2P0P A;  3A8H B;  1EIF A;  5LJ3 h;  5GAO q;  2L89 A;  4HT8 A;  4DQ2 A;  3E19 A;  3HRU A;  4MZP A;  3GNG A;  2ZPG B;  5GAN e;  1BIA A;  2HQE A;  4B9X A;  4C92 G;  3CCJ T;  3INZ A;  2GFU A;  5FRM A;  2E70 A;  4MML A;  1KC8 U;  4V2S A;  1KQS S;  1MGQ A;  1N9S A;  2X4X A;  4NOY A;  3V7C A;  3OY9 A;  3BW1 A;  3VYH B;  2RB6 A;  2RK2 A;  4OB1 B;  2D9T A;  2BIV A;  5CQY A;  4XU3 A;  5HK0 A;  2VGN A;  3OQ5 A;  4M7A F;  1WJS A;  3A8G B;  4HCC A;  4LD9 K;  3OSV A;  3JCM P;  5FRO A;  3JRZ A;  1VQ7 T;  2CKK A;  4M75 A;  2WSF E;  1VQN T;  5LJ3 d;  4A4G A;  3JCM J;  3M58 A;  1UEB A;  4D6W A;  2OTL T;  2YRV A;  3FB9 A;  1YJN A;  3ZFJ A;  5A2Q E;  3CME A;  4RKU E;  4JLI A;  4CRI A;  3CBO A;  4F7U G;  1N6A A;  5GAM d;  3ASK A;  5LJ5 e;  4M78 G;  2L5Q A;  2QQA A;  5LL6 S;  4IUV A;  3VU3 C;  3GOX A;  3JCM b;  3HL8 A;  5LJ3 g;  3CCR T;  4C0Z A;  3UWN A;  4N4I A;  2K57 A;  2QDY B;  4BI8 B;  3AHU A;  2EQM A;  4ZN1 A;  2X4Y A;  4QQD A;  1N27 A;  5KE2 A;  2DTO A;  2LT4 A;  5LJ3 j;  2CZ6 B;  5GAM g;  3VKI A;  3PIP A;  4BE0 A;  3KUF A;  4IKF A;  3JCM d;  1M1K C;  2D0Q B;  3PIO A;  3DB3 A;  1D3B A;  3EAE A;  2XID A;  4E7J A;  1YIT A;  2HNI A;  2QQS A;  3UT1 A;  2KVQ G;  5GMK i;  1QVF A;  2JOY A;  2F5K A;  1I5L A;  4O5V A;  5I21 A;  5GAO r;  1BYM A;  4QQ6 A;  4M7D F;  2KDS A;  2XDD A;  4JDS A;  3JCM g;  2E41 A;  2HAX A;  3CCM T;  5CIU A;  1RI0 A;  3RUX A;  4FIB A;  2I2L A;  2M9U A;  2ZZD A;  5C0M A;  4J6Y A;  4RMO A;  2RD1 A;  3M56 A;  2EKO A;  4L5G A;  4MZT A;  3PNW C;  4C5H A;  3CCQ A;  3CEY A;  4QVZ A;  3OA6 A;  3CD6 A;  5FU7 C;  3G71 A;  2LC4 A;  1U1T A;  3G4S T;  2GCX A;  5FU7 B;  3OYE A;  3CPW S;  1RL2 A;  2DJZ A;  4IUQ A;  4Y28 E;  1JBM A;  2DXU A;  2X4W A;  5HKC A;  4X9C A;  4Z02 A;  2MAM A;  1YJW A;  3V7S A;  3OYN A;  2MWO A;  2GQV A;  5KCH A;  4A4F A;  3FEO A;  3MEA A;  2PVD B;  5A0L A;  1ZHI A;  3C12 A;  1B34 B;  4P5N A;  2DKG A;  2LDM A;  4A4H A;  3NTH A;  1VQ5 A;  3I55 A;  3G6E T;  2EJG A;  1ZBX A;  1JJ2 S;  1FX7 A;  2DD5 A;  2H3J A;  2RA2 A;  2OTJ T;  2F69 A;  1MHN A;  2R5A A;  2C06 A;  1FXX A;  1KHI A;  4XTW A;  2VYT A;  3QHS A;  3WVE B;  3GPL A;  1BI2 A;  3URG A;  4BB7 A;  1I8F A;  3RKY A;  5CKD A;  4C92 D;  4ZGJ B;  2QA4 T;  1VQ4 T;  3FDR A;  1N9R A;  4ELY C;  1NJI U;  3QZ9 B;  3C4S A;  1QW1 A;  1Q86 U;  1G3T A;  3G7Z A;  1PSE A;  1H64 1;  1UGP B;  2PUO B;  3E9G A;  3L2Q A;  1K73 C;  1KD1 C;  1LJO A;  3T9N A;  3A5Z B;  4FSX A;  2PU9 B;  5KE3 A;  4J83 A;  2BUD A;  2A3L A;  2LCC A;  4IUR A;  2PVG B;  2E10 A;  4ME7 A;  4N4H A;  5LJ3 f;  1M1G A;  4ZGD B;  1U8R A;  3MCA B;  4C5I A;  2ZPF B;  3FRN A;  4EDU A;  4M75 G;  1VQ6 T;  3ME9 A;  1YCY A;  1VUB A;  2G3R A;  2K5I A;  3JSC A;  2P0K A;  5GAM f;  1YIT T;  2LVM A;  2QI2 A;  3NTK A;  3JCM V;  3V8K A;  3FC3 A;  3TU4 K;  4M78 D;  3JB9 I;  2K3Y A;  2YLB A;  4NL2 A;  3CCV T;  1YJ9 A;  4IUT A;  3KBG A;  5DLO A;  3LWI A;  1S72 T;  3CCE T;  2JVV A;  4II1 A;  4KUI A;  2EJF A;  4M7A E;  1YI2 T;  4J7F A;  3H8Z A;  3SB2 A;  4O6J A;  2DIG A;  5DM7 R;  1TH7 A;  3JCM f;  3CCS T;  1XTD A;  5CR2 A;  2B8A A;  2L3R A;  2K2V A;  1M90 C;  4M7A C;  2EFI A;  4C92 E;  4M7A B;  3PMT A;  3DLM A;  5D6X A;  4BI4 A;  3QPH A;  2XK0 A;  3RKX A;  2R58 A;  2EQJ A;  3CC7 T;  4HCB A;  2WSC E;  2OAU A;  3V8L A;  1YBY A;  4C92 C;  2KMT A;  3VUB A;  3V7R A;  3RES A;  3CMA T;  4XU1 A;  3EFR A;  4KUL A;  1K73 U;  1O9S A;  2DXB A;  3CBM A;  3MEU A;  2E64 A;  4OF1 A;  2QXF A;  2M1H A;  5GAN 6;  5GMK h;  2CGH A;  2DEQ A;  3MEW A;  3LGF A;  3LYI A;  4UC4 A;  4XAX B;  3JCM X;  5GAM h;  3QZ5 B;  4LDY A;  5GAO n;  1Q81 C;  3OS5 A;  3CC2 T;  1QVG S;  4JLG A;  3QKJ A;  1Q82 C;  1B34 A;  4LDW A;  1VQM A;  5I2M A;  1W2B S;  1WJR A;  4N0A C;  2EWN A;  4C8Q A;  2DXT A;  4F7U E;  4X34 A;  4BDZ A;  2RI2 A;  3MP6 A;  2FVU A;  1BIB A;  2VXE A;  4R55 A;  3WXM B;  2KK4 A;  2FHD A;  3MET A;  3Q1J A;  1I4K 1;  3CCL T;  1G5V A;  4M77 A;  3CXC A;  3JCM h;  4M7D E;  4C92 F;  4Y91 A;  4F7U B;  3JB9 J;  2RM4 A;  4IUP A;  4PL6 A;  3HRT A;  3TEE A;  3CC4 T;  4M7D C;  2V8I A;  4TVR A;  3JCM W;  3KXT A;  3X28 B;  4M7D B;  3QII A;  4FU6 A;  5HY6 A;  3SD4 A;  1KQ1 A;  4X9D A;  2ZPH B;  1KQS A;  1M5Q 1;  4BD3 A;  5A0G A;  3MP8 A;  3RER A;  3LH0 A;  1UB4 A;  4PNO A;  3HPW A;  3J80 E;  4IUU A;  3CCR A;  4PJO A;  1M90 U;  2FB7 A;  2NLU A;  3ZEH A;  2RJF A;  3SWN C;  2LQ8 A;  3L2R A;  4LDX A;  3ZBD A;  2MMP A;  4C5E A;  3L42 A;  3SWN B;  3JB9 G;  1YJN T;  4GLK A;  3CME T;  4F7U F;  1DJ7 B;  3OBW A;  5GAM j;  4M78 F;  3VJP A;  1UGR B;  5GAN 7;  4HKE A;  4JUV A;  2DVE A;  3P8B B;  2MWP A;  1VQP A;  1Y7X A;  2IG0 A;  4BI3 A;  3C95 A;  2P4T A;  1Q81 U;  4M75 D;  5J39 A;  3PTA A;  2FL7 A;  5A0D A;  3X25 B;  3O8V A;  3M55 A;  3S6W A;  3M59 A;  2DAQ A;  3QO3 A;  2PUK B;  5D6W A;  1PSF A;  3RMQ A;  3F70 A;  5GAN 4;  2L8D A;  3OYF A;  2E6N A;  1G3S A;  3CBP A;  5IT9 E;  2LNV A;  4M7A A;  2MI6 A;  2LT1 A;  3BFM A;  5GAN d;  2QQB A;  3A8M B;  2QEX A;  2E12 A;  3QDR B;  5LJ5 h;  4XTZ A;  4R56 A;  2JZ2 A;  2ZPB B;  2X4J A;  3ER0 A;  4XQ3 A;  5CCA A;  5KCO A;  3RKW A;  5GAN 8;  2K5L A;  3R6O A;  3CCU A;  1VQL A;  3CCQ T;  4JRK A;  3CD6 T;  2V8K A;  3OS2 A;  5GAN g;  3JAM E;  3G71 T;  3OSS C;  1O75 A;  4KBM B;  2HD0 A;  4QW2 A;  4WF2 A;  3QYG B;  2E5Q A;  1VQ9 A;  3FIF A;  4MDX A;  4QQG A;  3CPW A;  4N0A A;  1YJW T;  1K8A C;  3OYM A;  2DPP B;  5AYF A;  1M1K U;  2EQK A;  2RHX A;  1I81 A;  4J6W A;  4QVC A;  5DY9 A;  1WQ7 A;  1V29 B;  3OYJ A;  2QA4 A;  3LX7 A;  5LJ5 d;  4JRP A;  2RJD A;  2XIC A;  1M4Z A;  4M75 E;  4LD6 A;  4OB2 B;  3GNF B;  4EMG A;  2RI5 A;  2RHY A;  3I55 T;  2VUB A;  4ELZ C;  1NJI C;  1VQ5 T;  4L59 A;  1XOV A;  3OBY A;  3S3O A;  5DLQ E;  2HQX A;  3QYH B;  1WGS A;  1OI1 A;  3A8L B;  5J3B A;  4C8Q G;  3PFS A;  3GP8 A;  2MF2 A;  1JJ2 A;  5GMK l;  2KQW A;  4M7D A;  5LJ5 g;  4RG2 A;  2GF7 A;  3L2V A;  2XU8 A;  4E7L A;  4M77 G;  3M5A A;  1VQK A;  3J7A F;  3L2U A;  5LJ5 j;  1Q7Y C;  4BDY A;  5LJ3 e;  1M9S A;  3HHT B;  3HP9 A;  5L8R E;  5CKF A;  3HFO A;  4EPC A;  3OS0 A;  4C0G A;  3L2W A;  4HT9 A;  2DZC A;  4OB3 B;  2D6F A;  4JS4 A;  2Y4X A;  3SDZ A;  2VC8 A;  2DTI A;  4NL3 A;  2QQ9 A;  1WNL A;  4C0F A;  4E47 A;  5GAM e;  4ZGE B;  1KC8 C;  4ATO A;  1SSF A;  3CPF A;  3CCE A;  1QVP A;  2BKD N;  3H6Z A;  3L1A A;  4PJO G;  4L6V 5;  4C0D C;  3I56 A;  3N5B B;  4M75 F;  4FT2 A;  2CYZ B;  3HRS A;  4C0D B;  1YHQ A;  4JS5 A;  2EYQ A;  2IVW A;  2LX9 A;  5FU6 C;  4J8O A;  3OYD A;  2O4X B;  5FU6 B;  3OYY A;  4B9W A;  2X35 A;  1WPY A;  4OMF B;  3M4Y A;  3JCM e;  2XDP A;  2EIF A;  1OYX A;  1YJ9 T;  5EG2 A;  2AHJ B;  3PGG A;  2KSS A;  1K8A U;  4C92 B;  2CS7 A;  2DD4 A;  4OVA A;  1KD1 U;  4RCB A;  3DLL A;  3CCJ A;  1VQ8 T;  2VV5 A;  1VQO T;  4BE1 A;  1IZ6 A;  4PKC C;  3OYC A;  1M8V A;  1KHC A;  2R5M A;  1H3Z A;  3RMS A;  1UGS B;  3FJP A;  5M9O A;  4XTY A;  2WAC A;  2DIQ A;  3M4G A;  5GAN 5;  2R57 A;  5CAI A;  4M78 E;  5CQX A;  1BI3 A;  4M7A G;  4BAC A;  4BY6 C;  4ZTJ A;  5CKH A;  2O01 E;  4DOV A;  3QG1 A;  1VQ7 A;  3UPU A;  3DKM A;  1X01 A;  4BY6 B;  1Q7Y U;  3OW2 A;  3CCL A;  1VQN A;  2HBP A;  4M78 C;  3V8J A;  3C94 A;  4M78 B;  5GAN 3;  2OTL A;  3HSB A;  2XKO C;  1WJQ A;  2K4Y A;  4ZN3 A;  2VXF A;  2QQR A;  2XD0 A;  4ZTF A;  1VQM T;  3CC4 A;  5CKE A;  1LOJ A;  3OB9 A;  3BY7 A;  1QVG A;  4JJN K;  1YIJ T;  2LRQ A;  3A8O B;  3BDU A;  5GMK m;  1FWZ A;  4JRI A;  5LJ5 f;  1W2B A;  1NPR A;  4KUD K;  1X75 C;  4HA8 A;  2E6Z A;  2YLC A;  2Y4Y A;  3BDL A;  2RO0 A;  3QUI A;  1VIE A;  1JRI A;  4MZM A;  5GAO l;  4A53 A;  5GMK j;  4VUB A;  1QVF S;  2M0O A;  5GAN h;  1G3W A;  5C6S A;  4HCZ A;  2KAF A;  3DB4 A;  4XU0 A;  5J26 A;  4C8Q D;  4DA4 A;  3QSU A;  4FL6 A;  2YHT A;  2RJC A;  1NZ9 A;  4E7K A;  4CI0 C;  2EAY A;  5GAN 2;  5KH6 A;  4M7D G;  4M77 D;  1OZ3 A;  3FLG A;  3CCM A;  4QVD A;  3M9Q A;  1Y96 B;  1QP2 A;  4A4K A;  2JNG A;  2QTX A;  3E1S A;  3JB9 F;  4XTV A;  3VUZ A;  2DTH A;  2EQU A;  3HKS A;  4BE2 A;  1VIF A;  1R8O B;  1X6O A;  2CZ1 B;  3MEV A;  1OZ2 A;  1ZQ1 A;  4J7I A;  3G4S A;  5HK3 A;  2JTF A;  2Y90 A;  2O4X A;  3S3M A;  1VQP T;  1Q86 C;  1Y07 A;  5CKB A;  2DXC A;  5I2S A;  4PJO D;  1JB0 E;  5FLX E;  4MDW A;  3TRE A;  4EMK C;  3LW5 E;  2M16 A;  3M54 A;  3GF5 A;  4C92 A;  1K9M C;  1HK9 A;  4EMK B;  4RCC A;  1AHJ B;  1NE8 A;  3J81 E;  2DK3 A;  3OYG A;  2E65 A;  4XTX A;  1GXI E;  1XNI A;  3UDC A;  2GFA A;  3PT9 A;  3G6E A;  3NFC A;  3X24 B;  4PLI A;  1HXD A;  1Y71 A;  4OGC A;  2LCL A;  2OTJ A;  4BUG A;  4RG8 A;  1BI0 A;  4LDU A;  4XTU A;  2XG8 D;  5GAN j;  5CVI A;  2QEX T;  4J6X A;  2JUF A;  3X20 B;  1VQ4 A;  1N8R C;  4C8Q E;  2XDB A;  2LTO A;  4LDV A;  2VGM A;  3SFM A;  3OYI A;  3GLX A;  4E7H A;  2RJE A;  1NPP A;  2P0Q A;  1VQL T;  3OYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...