2DO3A

Solution structure of the third kow motif of transcription elongation factor spt5
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
GSSGSSGEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVILFSDLTMHELKVLPRDLQLCSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the third KOW motif of transcription elongation factor SPT5
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription elongation factor SPT5
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2do3A01
2LQ8A 2QEXA 3CC4T 1M90U 1NZ9A 1KD1U 5DM7R 1N8RU 1QVFA 1VQLT 2JUFA 2OTJT 1YHQT 3I56A 3I55A 1KQSS 2JNGA 1KC8C 1VQ5A 1VQ8T 1W2BA 3CXCA 3J81E 1XTDA 2G3RA 2KDSA 5J3BA 3CCSA 3CCVA 1Q7YU 3CCUA 1VQ7A 5J26A 2KVQG 3CMAA 1S72A 2MWPA 1YJWA 1EIFA 5FLXE 3CC2A 3KBGA 1Q81U 3CCLA 3G4ST 3CMEA 3CCEA 3TREA 3G71T 1VQOT 3J7AF 3CC7T 3OYYA 1VQKT 1JJ2S 2OTLT 5IT9E 2L3RA 1M1KC 1YJ9A 1QVGA 1YIJA 4RG2A 3OW2A 3CC4A 3CPWS 5IAYA 2CKKA 2OTJA 2JVVA 2E70A 2LVMA 1VQ8A 5A2QE 1VQ4A 1VQ7T 1BKBA 1YBYA 4X34A 3ER0A 5LL6S 2E6ZA 3CCRA 3CCMT 1K8AU 3CCLT 3PIOA 1VQ5T 1QVFS 2XHCA 1VQNT 1Q82U 3G6EA 3CD6A 3CCUT 1W2BS 1YJNA 3CXCS 3J80E 1KC8U 1VQKA 1X6OA 4ZN1A 2OTLA 3P8BB 1N8RC 2QA4T 1IZ6A 1YJ9T 4YTLA 3JAME 1VQPA 3CC7A 1M1KU 2DO3A 2IG0A 1NPPA 1JJ2A 1YITT 3CCJT 1NJIU 4ZN3A 3CCQT 1VQ9T 1QVGS 2LCLA 1K73C 3OW2S 1K9MU 1SSFA 3DB4A 3LGLA 1M1GA 1VQMA 4QQDA 1NJIC 1KQSA 1VQLA 1VQNA 1XNIA 3HKSA 3I56T 1YI2T 3CD6T 1NPRA 3CCST 3CCRT 2EIFA 3CCVT 1VQ6A 3A5ZB 2QEXT 3CPFA 5HY6A 1KHIA 5DLQE 3CCMA 1S72T 2QA4A 3DLLA 2JOYA 1UEBA 1KD1C 1YHQA 1M90C 3G6ET 3I55T 3DB3A 3CMET 1VQPT 3CCET 1YJNT 1RL2A 2MI6A 3LH0A 3G71A 4TVRA 1Q86C 3CMAT 1YJWT 3CC2T 1Q82C 3LGFA 1YITA 1K9MC 3CCJA 4CRIA 1K73U 3CCQA 3G4SA 1Q81C 3PIPA 1K8AC 3CPWA 1YIJT 1VQOA 1VQMT 1Q7YC 1YI2A 2MWOA 1Q86U 1VQ4T 1VQ9A 1VQ6T
chains in the Genus database with same CATH superfamily
3OYHA 1G3WA 4M75F 3FJPA 4J9EA 1YHQT 2ATCB 1VQ7A 1OEBA 4PJLA 3JB9I 1AD5A 2AK5A 1Q81U 3L2QA 1D0ZA 2YUQA 2H3EB 2D1XA 3JB9H 4E7HA 4Z88A 1OQKA 1OV3A 3S3OA 4IURA 4E7LA 4IUQA 1IHWA 2LZ6B 2DRMA 2M0YA 3G4SQ 3EG9B 2ENMA 1G3TA 4IIMA 1LJOA 5CKFA 3VUZA 3E9GA 3C0CA 4HCKA 2E5KA 2M02A 3CD6A 3JCMP 2RD1A 1FYNA 4ZN1A 1KK7A 4PJOD 3MEVA 1PNJA 3UA7A 2FVUA 2V8JA 1KC8R 2CT3A 1VYVA 2VXFA 2XG8D 2F2WA 2RJDA 5A0DA 4R56A 2EQMA 4DOWA 1D1CA 3BDLA 2RJCA 1V29B 1X2KA 2BIVA 2LCLA 2AHJB 2A36A 2P0KA 3QDFA 2A0FB 5HCKA 2LP5A 3I56T 2CGHA 3CCVT 5IHIA 3CCRT 1PRMC 4UC4A 1K9AA 3OMGA 2EKHA 3CMET 5A0LA 2KNBB 1PD0A 1QQJA 2RB6A 1D3BB 1U3OA 4XU2A 4B6MA 3I56Q 4M7DG 5KYXB 1VQMQ 4FW1A 1VQLQ 4CRIA 1OZ2A 3CCVQ 3PIPA 3EH1A 3JCMJ 3I5SA 1UUEA 3HSBA 2A08A 2EYXA 1YI2A 2JTMA 2YUPA 3VUBA 1TU0B 4QVZA 1VQ9A 4OB1B 4QQGA 3CXCP 4WCIA 3HFNA 4JRPA 2EBPA 1H641 3AHUA 1QVPA 2JM9A 4C8QA 2MWPA 1QLYA 2GFUA 3KBGA 1Z9ZA 2L8DA 3CCEA 2FG0A 4JS4A 2PZ1A 3P8HA 4XTWA 4ME7A 2ROLA 2M0OA 2LRQA 1YJ9A 4RG2A 2GQVA 3ZBDA 2QI2A 2L0AA 3EGXA 3U23A 2KGTA 4F04B 2EJ9A 1IXDA 1NG2A 2LVMA 4Y28E 4M78F 4X34A 4OF1A 3DKMA 1RAIB 1G8XA 4N0AC 4QVDA 2FZGB 5D6WA 3WVEB 1YJNA 2OX7A 1X6OA 4XTYA 1VQNQ 3FRNA 5FROA 4C92G 3H41A 1LCKA 4OMNA 3UT1A 1ARKA 1Y96A 1A0NB 3OYCA 3RKYA 2YLBA 3LYIA 2HCKA 2KT1A 4JRKA 2EQKA 3HKSA 1WFWA 3VRZA 2COWA 1VQPQ 4RTWA 4RUGA 1S72T 4XAXB 3V7SA 2DD4A 1M90C 2JS2A 2PVDB 3QJ6A 4BE1A 2MI6A 3LH0A 5GAOl 1WNLA 1NBEB 1SRMA 2CP2A 3OYMA 1AWOA 1PHTA 3LW5E 1K73U 2LQNA 4HA8A 4C5IA 5KYUB 1S72Q 1M8MA 5L8RE 3X20B 1Q7YC 2E3HA 2MWOA 1YFNA 4J6YA 1VQ6T 2RQUA 3PVQA 2B8AA 2EYYA 2DL4A 2DXCA 3NTKA 3UDCA 3CXCA 4OMLA 2EGEA 1PKSA 2R58A 1B3QA 2YDLA 2CDTA 2ZPGB 4KGVB 4RTVA 3TREA 1SEMA 3A1PA 3G71T 4M75E 1VQOT 3EGUA 1KIKA 1T3LA 5IXBA 3CC7T 2OAWA 1MMDA 1QCFA 2HZYA 3GF5A 1VUBA 2ZCFB 2DVJA 7AT1B 4HT8A 1RAGB 2IIMA 4DBHA 3RDVA 3V7RA 3OYDA 5I2MA 2EFIA 4NOYA 1P92A 3JSCA 3QWYA 2E6ZA 4FYWB 1E6HA 2ZGWA 2JMAA 5GAMf 3PIOA 2K4YA 4FT4A 1OOTA 4PJNA 3ZEHA 3G6EA 1FMWA 3ME9A 2LQKA 2YUNA 4CI0C 3KUFA 1QCOA 5C0MA 3X28B 2ZAEA 1V76A 1ABOA 4M7AA 3VYGA 3CCQT 2X4XA 4EMHA 4QW2A 1U06A 1M3BA 2CREA 4ZNXA 1KQSA 4R55A 2CSIA 2PVGB 3JB9J 3FB9A 2VVKA 8AT1B 5HK0A 2QEXT 2VB6A 2V8KA 1KD1C 4PJOA 2RQTA 3QDRB 4NL2A 5GAMg 1B34A 2CUDA 2KMTA 4LDWA 3JCMf 3NHNA 1Q95G 2X9HA 2QGFB 2OAUA 3E19A 4OB3B 3G6EQ 4EPCA 3TU4K 3VJPA 2NUZA 2QTVA 5I2SA 4XTVA 3VS7A 4PLIA 5LJ5h 2KY9A 2QEXA 2HL3A 1Q86R 3EG9A 4JLGA 1KQSS 3REBB 2YRDA 2DERA 4RTXA 1K0SA 3OMCA 4OMOA 3TVTA 2LJ3A 5GMKe 1B34B 2EGCA 4HCBA 2M9UA 4PJOB 2X3WD 3SEMA 2OTLT 2ZZDA 1UGRB 5GAN6 1VQKQ 3VS0A 3OS5A 3THKA 1WPYA 1PG5B 2DZCA 2OJ2A 4AT1B 3CCMQ 1FXXA 1RAFB 4Y91A 1NEBA 4WTOB 3QHSA 5GAOm 2A37A 1HJDA 1OX8A 1X6BA 3A8MB 2DYBA 3CCUT 2HMAA 4GY5A 3QWXX 1RAAB 3SWNA 1WYXA 1YI2Q 1NPPA 4PFPA 1D0YA 2NYSA 3OSVA 1FMVA 4LDVA 1R77A 3KFVA 1WX6A 3I55Q 5LJ5g 3OW2S 4FU6A 4PJOF 3QXEB 2DLPA 2LTOA 2K57A 4IUUA 3G1JA 3CCEQ 3A5ZB 2KT8A 5HY6A 1KHIA 2MCNA 4L6V5 3CCMA 3FDRA 1AVZC 4OMMA 1RLQC 1M1KR 2CS7A 3META 3S6WA 1YJWT 3LGFA 1UGSB 1BBZA 2RQVA 2CZ6B 2B86A 3VS2A 4M7AC 2Y4XA 4LE9A 1RAHB 2K5LA 3HL8A 4HT9A 1ZLMA 1X6GA 5LJ5j 4LDUA 3I5RA 5CKDA 3A98A 3I55A 4B9XA 4F17A 3J81E 1LOJA 4OMFB 3VS6A 4M4ZA 2VGMA 4J8OA 3GLXA 3F70A 2RI5A 4DBRA 1U1TA 4JS5A 3JB9D 3RKWA 1NLOC 4J9HA 4PK4A 2E4HA 1M4ZA 1H92A 1E7OA 1RI0A 5IT9E 1NM7A 3PGGA 1N5ZA 4ZGDB 5FU7C 3CC4A 4C92F 1R0BG 1M30A 3CPWS 2QTXA 1WHKA 2KAFA 2P0PA 2D9TA 1N8RR 1EZZB 1TUDA 2VC8A 1FX7A 1YNZA 3JB9F 2W10A 2BE7D 3OYNA 5GAMd 3CCLT 3MPUB 2RJEA 3UPUA 5CVIA 1QKWA 3WXMB 2ED1A 1GCQA 4M78B 3L2VA 1I4K1 4ANJA 4C92E 4YTLA 2DK3A 2RQWA 2QG9B 1K1ZA 5FWCA 4FSSA 1AWJA 2LT4A 4Y92A 2LJ0A 1ZBXA 2DM1A 3CD6Q 2DL5A 1QP3A 3DB4A 1GFCA 2FZKB 4QQDA 4DBQA 2RHXA 3FLGA 5CIUA 3HP9A 4BI8B 5FRNA 2ZPEB 1YCSB 3BDUA 4HCCA 1XOVA 3RESA 4Z8AA 4FL6A 3M59A 3CBPA 2AZVA 2K3BA 2E65A 2DTOA 1Q81C 3G7ZA 2H3JA 4PJMA 2J7IA 3CC2Q 2YXYA 1H8KA 3V8KA 2DTIA 4JPBW 1PM3A 1VQLT 2JUFA 5IN1A 3I56A 2LQWA 5GAOr 1J3TA 2V26A 2RHIA 2GBQA 2EW3A 1NJIR 4M7DF 2HD0A 2RK1A 2NLUA 2L5QA 2W0ZA 3M55A 1GFDA 1BCMA 1G5VA 4BD3A 2YRVA 4RG8A 4E7ZA 4FYXB 4XU3A 5IXFA 1HYOA 4IUTA 1BK2A 1QVGA 3GNFB 1JEGA 4M75G 4KGXB 1MMAA 2ROTA 4GBQA 2EQIA 1KHCA 4A4HA 1Z9QA 1QP2A 1K8AR 3VYHB 4C0ZA 2JT4A 4RCCA 4M77D 3NMZC 1X75C 2LC4A 1K9MR 1QVFS 3M0RA 4C8QC 3M0TA 1YJ9Q 3QYGB 3OYKA 3C12A 5GAN3 4LDXA 4A4EA 3OBWA 1KQ2A 1TXQA 1AZEA 4F7UA 4LD9K 3M4YA 3JV3A 1UECA 2CH4W 4CC3A 2EPDA 1QVFP 2KQWA 2CP5A 4X1VA 1BI0A 2FL7A 1W2BP 3FEOA 5KCOA 4ESRA 2VWFA 1YJNQ 1Y0MA 3LWIA 5KYWB 3TSZA 3RERA 1VQNA 3VV0A 1N9SA 1VQ6A 5GAMe 4GLKA 1TS9A 3WVDB 2NWMA 3LLRA 3V8LA 2K6DA 4C5GA 4MDXA 4OMPA 1D1AA 1YJNT 2GQIA 3KXTA 1G83A 3QUIA 2DKGA 1ZUYA 1YIJT 5L23A 1FMKA 4J6WA 1VQMT 2KSSA 3EAEA 1AWWA 3MEWA 3OYIA 1EX4A 1M90U 1VYTA 2QQBA 2RN8A 5GAOn 3M53A 1YIJQ 3CCSA 4E7IA 2RQRA 2KVQG 2DIQA 2LX7A 3URGA 1S72A 1SG5A 3DLMA 2F69A 1KFZA 3HHTB 3FC3A 1ZA1B 2ABLA 4F7UG 3TEEA 4KGZB 1NEGA 2CP6A 2KYMA 4QKUA 1WI7A 2QDYB 1ZQ1A 4RTYA 1H3ZA 2E70A 3LX7A 1M3AA 2CP0A 2BUDA 2FHDA 4E7JA 1PSEA 3PFSA 2QA4Q 4MZMA 3CC7Q 2Z0WA 5LJ5d 2X4YA 4O6JA 4A4FA 2MF2A 3J80E 1KC8U 1MUZA 2QQSA 2EYZA 2QA4T 1IZ6A 3PNWC 3RIRA 3GIBA 1TUCA 3I9QA 2ZPBB 4LUDA 1BIBA 4M78G 3GPLA 2HBPA 3CCJT 1TH7A 3SWNC 3V7CA 1NJIC 1QKXA 1MV3A 1VIFA 2LX9A 3CPWP 2EIFA 1AOJA 1Y71A 3CPFA 4A4GA 4BE0A 4A63B 5CKEA 4AG1C 2QGGA 2QA4A 1YHQA 2DRKA 4JUVA 5CO7A 1WQWA 5AYFA 3CC4Q 2ZPFB 3GNGA 1Y07A 4F16A 1YITA 4EMKA 1K8AC 1SRLA 1PC0A 4P5NA 5GAN7 3H6ZA 4KT0E 3H0FA 2DILA 1NLPC 2ESWA 5GJVB 1T0HA 3ASKA 1JJ2P 5D7UA 1LPLA 1ZX6A 4M77B 1KC8C 2QXFA 3SWNB 3EFOA 2AT1B 5J3BA 4RTUA 3OSSC 3ULRB 5HKCA 4FCYA 2P0QA 1SHFA 3HRSA 1I5OB 3EH2A 1M27C 3M9QA 1JU5C 3V8JA 5J39A 1SSHA 1RACB 3N5BB 3FIFA 4QT7A 5IAYA 4FYYB 3REAB 2JTFA 1VQ8A 4PKCC 1YBYA 4C0GA 2CZ1B 3OW2P 2RHYA 4N4GA 4VUBA 4EMGA 5IH2A 2MYSA 1KQ1A 1VQ5T 2YSQA 5GMKi 1T3SA 1VQKA 4D6WA 4HVVA 2D0QB 3VS4A 1UHFA 2O2OA 2CP3A 3MEAA 3C4SA 1M1KU 2H8HA 2CP7A 2VASA 2C0TA 2OI3A 4FYVB 1MNDA 2DEQA 3NGPA 1M2VB 2KEAA 4ZGJB 4MMLA 3MP1A 1YI2T 1OYXA 2DFUA 4F7UE 2NUPA 2K3YA 2AZSA 2JXBA 1I07A 1Q7YR 3I55T 3HFOA 3OS1A 2ECZA 1WJQA 1CKBA 2VYTA 3X25B 4EMKB 4AFUC 2EQUA 2YLCA 1ZUUA 4MDWA 1UTIA 2EAYA 4A54A 5GMKm 3EHRA 2MIOA 2KBTA 3JCMQ 2DBKA 3MO8A 4KH1B 1WQ7A 4DA4A 1N9RA 4OGEA 1IO6A 4L59A 3CCVA 1N27A 1YCYA 1RADB 4KH0B 2COYA 5KE3A 4KBMB 4EDUA 5GANg 1G3SA 4M7AG 5GANd 3J7AF 1CSKA 1KSWA 1RUWA 1W1FA 3LWHA 2FPDA 2KXCA 3M0QA 3EFSA 2DVEA 3EG1A 5LJ3f 2P4RA 5GMKj 4ZTJA 1O75A 4LD6A 2OTJA 3L42A 4PJOE 4FM4B 4PL6A 1U8RA 4XTZA 2LNVA 5I21A 3PMTA 4HVUA 2E10A 2DETA 4M7DE 4J83A 3MCAB 4HCZA 4XTXA 2VV5A 2QQRA 2KE9A 2D0NA 3H8ZA 2AIRB 3CCLQ 4J6XA 2MK5A 1BI1A 1Y57A 2RNAA 3QO3A 2MOXA 2DXTA 1JO8A 2LCCA 4J9CA 1D0XA 4LNPA 4ATOA 3CMAQ 2X4WA 3A8GB 3I35A 4C5EA 2V1RA 1D09B 5KYNA 1C6VX 2XI9A 2QDLA 4JLIA 1C0MA 1WLPB 2RMOA 4MMKA 1M1FA 3DB3A 4BDYA 4BY6B 3CCET 1ZSZB 1RL2A 2RI2A 3CMAT 4O5VA 1UG1A 2FRYA 4PJJA 5FU6C 1RLPC 5CQXA 1TG0A 3M58A 1Y7XA 2GTJA 4M75A 1VQOA 2X51A 4M77G 2XICA 1Q82R 1JB0E 3OYFA 4M77E 4PJOG 2FYKA 1Q86U 2GFAA 2KRMA 2RJFA 1YWPA 2EWNA 1AHJB 2XIDA 2J05A 4QVCA 3QIIA 4XQ3A 1LNXA 5LJ3g 4C92D 1KJWA 1XTDA 5GJWB 2RM4A 3UA6A 5AT1B 3CMAA 2F1LA 4XTUA 3UF4A 1PWTA 1WA7A 2HQEA 4C8QE 3RMSA 1QCNA 1WZOA 3CMEA 3A8HB 4FSXA 1ZSZA 2P4TA 5GAMj 1RI9A 1ZSZC 2J6OA 4ZGEB 1R8OB 2CT4A 2GNCA 2K9GA 3HRTA 5FU6B 2JVVA 3R6OA 3E9FA 4HXJA 5A2QE 1ACMB 4DBFA 2I0NA 3OA6A 3CBOA 2E3IA 2O88A 2HNIA 3M4GA 2EQJA 3O8VA 1Q81R 1UGVA 2O4XB 5CKBA 2VXEA 5GMKl 1TUGB 4M75C 3NPFA 4ELYC 3BE3A 3JAME 5EG2A 2HDAA 4Z02A 4ORZA 2O31A 4M78E 3BFMA 1NJIU 4BUGA 1VQ9T 3OYGA 3A8LB 4AG2C 1M3CA 4C8QG 2DD5A 1X43A 1UE9A 4CC2A 5GAN2 3IQLA 3CD6T 1KG1A 2PNIA 4OP0A 4X9DA 4CC4B 5KYXA 4PFZA 5GAOq 3JCMc 1UJYA 4AMCA 1GL5A 3G6ET 1VQ9Q 3CCRQ 4F7UB 1DJ7B 4LDYA 4TVRA 2M51A 4XU1A 5LJ3e 2J06A 2A28A 1D3BA 1WJSA 1OULA 1VQ8Q 3H0HA 1K4US 1EFNA 2A7YA 1VQ4T 1I5LA 2PU9B 3BY7A 1NE8A 5KCHA 1X2QA 4C8QF 1MGQA 2XKOC 5GAN5 5A0GA 2JNGA 1VQ8T 2G6FX 5GMKh 5FRMA 1H3HA 2XDPA 5J26A 4AFZC 1VQ4Q 3JCMe 2K2MA 4C92C 3OYYA 1VQKT 1IREB 3QKJA 3QJYA 2CZ7B 1M1KC 4M78A 4M77C 1YIJA 4E6RA 1I1JA 4JRIA 3VKIA 2PUKB 3EGDA 1B7TA 5D6XA 4IKFA 4J9GA 3RR6A 4BI3A 2VKNA 2XHCA 4GLMA 2JZ2A 1IGQA 2DPPB 1GXIE 1WXBA 5M9OA 1N8RC 3JCMV 1YJ9T 1K0XA 5GANj 1VQPA 1X01A 4Z89A 4EIKA 2Y4YA 5GANh 1YITT 1WHMA 4C92B 3FJ5A 4M7AE 1WHJA 5GAN4 5GAN8 1E6GA 1W70A 3CCST 4N0AA 2EVRA 2ED0A 1UEBA 2HSPA 1VQPT 3G71A 1VOMA 2F2XA 3O5ZA 2F2VA 2HL5C 1V1CA 1T0JA 2OTJQ 4RCBA 2DBMA 3MHXA 2KYBA 4J5YA 1JQQA 1OPLA 1BI2A 2O9SA 4A53A 2PQWA 2J6FA 4X9CA 2HSEB 1R0CB 5CAIA 1YHQQ 2LCSA 3M0SA 2LQ8A 3JCMd 3CC4T 2R57A 2XDDA 5DM7R 2O9VA 2O01E 2OTJT 4EMKC 2AKLA 2XU8A 4B9WA 5GANf 2RF0A 1I8FA 2DXUA 4J9DA 1TSFA 3CCLA 2FPEA 2RK2A 4OB2B 1C1AA 2F5TX 2GTOA 2JJ9A 3E1SA 3NFCA 3G71Q 4J7FA 4JRQA 2SRCA 1GCPA 4NL3A 5CKHA 1BKBA 4HVWA 3M54A 4C92A 2KK4A 1PSFA 4BE2A 3H0IA 2EYWA 3L2ZA 4E47A 2GF7A 3SFMA 1W2BS 3NTIA 1ZA2B 1ZUKA 2X35A 3MEUA 2LMJA 5FWBA 4M7AF 1QWFA 2LNHB 2M16A 2XDBA 4PLLA 1HD3A 4AFSC 1W6XA 1KQSP 2QQ9A 2MMPA 4LN2A 2DJZA 1W4SA 1QVGS 1K73C 3OB9A 4OMQA 2FPFA 1SSFA 3RNJA 1M1GA 4RTZA 2BZYA 3CCJQ 3SDZA 1WHGA 1XNIA 1HXDA 2GCXA 2ZPIB 4M7AD 5HK3A 3CMEQ 3JB9G 3INZA 1D1BA 5DLQE 3M5AA 4C0FA 1LVKA 1UB4A 1ZBJA 2D8HA 5LJ3d 1RAEB 3L2WA 3QPHA 3SB2A 1OX9A 2QEXQ 4FIBA 3R6NA 1SF9A 3CC2T 4KULA 3EG3A 3QZ5B 1K9MC 1PKTA 3CCQA 1F1BB 3SD4A 3HRUA 2SEMA 2DMOA 1M90R 4R0KA 3CQTA 4RTTA 2JM8A 3OYBA 3T9NA 2HKQB 1UGPB 1OU9A 2K2VA 1VQ5A 4Q5WA 1BIAA 2LT1A 4RMOA 3JCMW 3CC2A 4MZTA 2YT6A 2JTEA 1VIEA 4M7DC 1YN8A 3G4ST 2BZXA 4QQ6A 3CEYA 2JMCA 3JRZA 2RA2A 5I22A 4M77A 2XD0A 2CKKA 1UJ0A 5KYWA 3EGDB 1KD1R 4C0DB 1BB9A 2DX1A 2X3XD 1PCXA 3LH5A 3CCRA 4BY6C 3PMIA 3CCMT 1UDLA 3MP6A 2DXBA 1GRIA 1I81A 5D6YA 1ABQA 2DZ9A 2FEIA 1Q82U 1VQNT 3C94A 1M8VA 5KYYB 3CXCS 1WXTA 4K11A 1VQ5Q 2FB7A 2C0OA 3CCUQ 4J9BA 2K7AA 2O4XA 1SPKA 2DL8A 2DAQA 2EGAA 4II1A 3QYHB 4M7DB 1K73R 3X26B 2PUOB 5KH6A 5IHKA 2LJ1A 3A8OB 1PRLC 2EKOA 3LGLA 3OBYA 1VQMA 3E2UA 3PT9A 3JCMX 1VQLA 5LJ5f 3EFRA 2E64A 1X69A 3EG2A 3VU3C 2MPXC 3VS5A 2E1HA 4J9FA 1BI3A 4BDZA 4M7AB 2EJGA 2NUTB 2DF6A 4D8KA 3CBMA 1CKAA 2VGNA 4N4HA 2HAXA 5KYUA 4M75D 4JDSA 3OS2A 1Q86C 3JCMh 4JJBA 2I2LA 1MHNA 4IUPA 2EYQA 1VQ6Q 2DJQA 4OB0B 4KUIA 5EC7A 5CK9A 1NYFA 1UGQB 4PFOA 4KRTA 3OY9A 3EHQA 5ECAA 3Q1JA 5FU7B 4MZPA 4M75B 3OYLA 2CSQA 2G3RA 1Q7YU 2WSEE 2CYZB 1IHVA 1VQOQ 1YJWA 1EIFA 2ZPHB 2YHTA 2DA9A 3P8DA 1M9SA 2E6NA 1M5Q1 1SHGA 3VRYA 3PTAA 2KROA 2C0IA 3C95A 4M77F 3SHWA 4C8QD 1JJ2S 4IUVA 3M0PA 3TQ7P 4JJDA 2JS0A 5GAMh 3OW2A 4M78C 1QMCA 3L1AA 4LUEA 1UHCA 2RI3A 4M7DD 2K5IA 1YP5A 4JJNK 1VQ7T 5KE2A 2XMFA 3L2RA 5LJ3h 4A4KA 3JCMg 1XJWB 4DEXA 2L89A 4JZ3A 2E5QA 3MKDA 1VQ7Q 1OZ3A 5GANe 2K3XA 4BACA 3CC7A 3PE0A 1GBQA 2IG0A 1NYGA 2KXDA 4XK8E 3ZL7C 2E12A 2V8IA 1JJ2A 3RKXA 2YUOA 1MNEA 4WF2A 1K9MU 2COZA 1IB8A 5GAOp 4E2FB 2L3SA 2DL3A 2D6FA 1NPRA 1YWOA 1Y96B 2FRWA 2DL7A 2EJFA 2L2PA 1WHLA 3DLLA 4NS5A 1OPKA 2RO0A 1RABB 1QW1A 1JRIA 2CUBA 2NUTA 4F14A 1Q82C 2M1HA 3CPWA 2DNUA 5C6SA 1QWEA 2BE9B 2V1QA 2WSFE 2YWWA 1AZGB 4J7IA 4FW2A 2Y90A 2QASA 3RUXA 3GBQA 4KUDK 1NZ9A 5FW9A 1XQHA 1ZHIA 4M7DA 2HQXA 2DEUA 2RHZA 4L5GA 2WACA 1O9SA 2HQHA 3EGXB 3HTRA 1BYMA 2BTTA 2QQAA 2DYIA 1U5SA 5KYYA 3MJXA 1U1SA 4XU0A 1SKUB 4M78D 1UFFA 3QBYA 2PTKA 2LDMA 2KRSA 3QSUA 1TOVA 1X27A 1G2BA 2RHUA 3NTHA 4C8QB 2L3RA 1JBMA 3OS0A 3RMQA 5LJ5e 2X4JA 1BCOA 2CH4A 2L3PA 1VQ4A 3HPWA 3M0UA 3ER0A 3OQ5A 5LL6S 1MMNA 2RPNA 3QG1A 1WIEA 2F5KA 2HEQA 2R5MA 4FT2A 4F7UF 1GCQC 3CCQQ 3QZ9B 1GBRA 1G3YA 1MMGA 2IVWA 3ZFJA 2J6KA 5DLOA 2DIGA 3BW1A 1I0CA 1VYUA 4N4IA 2DTHA 2JN0A 2CZ0B 1JXMA 1WDXA 4ZN3A 2KRNA 1TTHB 1B07A 2P84A 4RKUE 4DOVA 3H9NA 4AFQC 2BKDN 1TWBA 4D8DA 2FZCB 2VUBA 3EG0A 2MAMA 2K5FA 2A3LA 2JOYA 1HSQA 2E41A 5IHNA 2HBWA 3GOXA 2GGRA 3OYEA 2WSCE 3AT1B 2BZ8A 3CCSQ 2NUPB 3OYJA 4DEYA 1AEYA 3RBBB 4PNOA 1M2VA 2KR3A 3L2UA 2JW4A 1OU8A 1M2OA 1KD1U 2XK0A 1N8RU 1QVFA 2OTLQ 1W2BA 2QYZA 4BB7A 1VA7A 2KDSA 3UWNA 3OYAA 1HK9A 2R5AA 6AT1B 3CCUA 5FLXE 4OGCA 2AKKA 4V2SA 1IGUA 4JJCA 4ELZC 4ZTFA 1FWZA 3MP8A 4E7SA 5CR2A 2D8JA 2DE0X 4OVAA 3S3MA 2IPOB 1QVGP 3S3NA 1WGSA 2FO0A 1K8AU 1AT1B 1K76A 2L3QA 1JXOA 2QAZA 4BI4A 1WXUA 2OTLA 3X24B 2K79A 1OI1A 4CC7A 3P8BB 3EFOB 1S1NA 3PVLA 5DY9A 2DO3A 1BU1A 4E7KA 2HKNA 5LJ3j 4IIOA 2RH2A 3TSWA 1MV0B 4PJOC 3D7SB 5I11A 1ZSGA 4C5HA 3JCMb 3M56A 1YITQ 1YJWQ 8ATCB 3VS3A 4DQ2A 3GP8A 2C06A 1AWXA 3UATA 4LXCA 5CQYA 5CCAA 2YRCA 2PVOB 3M57A 2QK0A 3VS1A 4JZ4A 1N6AA 4HKEA 3CCJA 3G4SA 4J9IA 1IRXA 4C0DC 3TCJA 1PD1A 1WJRA 1WHHA 2KI7A 9ATCB
chains in the Genus database with same CATH topology
3OYHA 3MO8A 1G3WA 5LJ5j 4M75F 3OYBA 3T9NA 1WQ7A 4DA4A 3FJPA 4LDUA 1N9RA 1YHQT 1UGPB 4OGEA 5CKDA 3I55A 2K2VA 4B9XA 4L59A 1VQ5A 4Q5WA 1BIAA 3J81E 3CCVA 1VQ7A 1LOJA 1N27A 2LT1A 4RMOA 3JB9I 1YCYA 4OMFB 5KE3A 3JCMW 3CC2A 4KBMB 4MZTA 2VGMA 4EDUA 5GANg 1G3SA 4J8OA 3GLXA 1VIEA 3L2QA 1Q81U 3F70A 4M7DC 3G4ST 4M7AG 2RI5A 4QQ6A 1U1TA 5GANd 3JB9H 3J7AF 4JS5A 3JB9D 3RKWA 3CEYA 4E7HA 1M4ZA 3LWHA 1RI0A 5IT9E 3JRZA 3PGGA 2RA2A 5FU7C 4ZGDB 3EFSA 3S3OA 2DVEA 3CC4A 4IURA 4C92F 4IUQA 4E7LA 5LJ3f 4M77A 2XD0A 3CPWS 2QTXA 5GMKj 4ZTJA 2CKKA 1O75A 2KAFA 4LD6A 2OTJA 3L42A 4PJOE 2P0PA 2D9TA 4FM4B 4C0DB 4PL6A 1G3TA 1U8RA 1LJOA 2VC8A 4XTZA 1FX7A 4BY6C 3PMIA 5CKFA 2LNVA 3CCRA 3JB9F 5I21A 3CCMT 3MP6A 2DXBA 3OYNA 1I81A 3VUZA 5GAMd 3CCLT 3E9GA 2RJEA 3UPUA 5D6YA 2DZ9A 3PMTA 5CVIA 1Q82U 1VQNT 2E10A 3C94A 3CD6A 1M8VA 4M7DE 4J83A 3WXMB 3CXCS 3MCAB 4HCZA 2RD1A 4XTXA 3JCMP 4M78B 4ZN1A 3L2VA 1I4K1 2FB7A 4PJOD 3MEVA 4C92E 2FVUA 2VV5A 4YTLA 2V8JA 2QQRA 2DK3A 2O4XA 2VXFA 2XG8D 2DAQA 2RJDA 5A0DA 3H8ZA 4R56A 4II1A 3QYHB 2EQMA 4J6XA 4DOWA 4M7DB 3X26B 2PUOB 2LT4A 5KH6A 3BDLA 1BI1A 1ZBXA 2RJCA 1V29B 2EKOA 3A8OB 3QO3A 1QP3A 2BIVA 2LCLA 2AHJB 2DXTA 2LCCA 2P0KA 3DB4A 3LGLA 3OBYA 1VQMA 3PT9A 4QQDA 3JCMX 4ATOA 1VQLA 5LJ5f 3EFRA 2E64A 2X4WA 2RHXA 2CGHA 3A8GB 3FLGA 5CIUA 3VU3C 3HP9A 4BI8B 4C5EA 5FRNA 2E1HA 3CCRT 3CCVT 2ZPEB 1BI3A 4BDZA 2XI9A 4M7AB 2EJGA 3BDUA 4HCCA 4JLIA 1XOVA 3RESA 3CBMA 4UC4A 4MMKA 1M1FA 3DB3A 2VGNA 3OMGA 4FL6A 4N4HA 3M59A 4BY6B 5A0LA 1RL2A 2RI2A 4M75D 3CBPA 2HAXA 4JDSA 2RB6A 1D3BB 4XU2A 3OS2A 3JCMh 1Q86C 3CMAT 2E65A 4O5VA 4M7DG 2DTOA 5FU6C 4CRIA 2I2LA 1OZ2A 1MHNA 5CQXA 1Q81C 3G7ZA 4IUPA 3PIPA 3M58A 2H3JA 1Y7XA 3JCMJ 4M75A 1VQOA 2EYQA 4M77G 2XICA 4OB0B 1JB0E 3OYFA 4M77E 3HSBA 2FYKA 4PJOG 4KUIA 2GFAA 2RJFA 3V8KA 2JTMA 5CK9A 1YI2A 1Q86U 3VUBA 2DTIA 2EWNA 4QVZA 1VQ9A 1AHJB 4OB1B 2XIDA 4QQGA 1UGQB 4QVCA 3HFNA 3QIIA 4XQ3A 1LNXA 3OY9A 1VQLT 2JUFA 3GOXA 5IN1A 4JRPA 3I56A 3Q1JA 5FU7B 5LJ3g 4MZPA 1H641 4M75B 5GAOr 4C92D 3OYLA 3AHUA 1XTDA 1QVPA 2G3RA 1Q7YU 2WSEE 2CYZB 2RHIA 2RM4A 4C8QA 3CMAA 2MWPA 1YJWA 4XTUA 1EIFA 4M7DF 2HQEA 4C8QE 2GFUA 2ZPHB 2YHTA 3KBGA 3RMSA 2HD0A 2RK1A 2NLUA 2L5QA 2L8DA 3M55A 3CMEA 3A8HB 4FSXA 3CCEA 3P8DA 1M9SA 2P4TA 2E6NA 1M5Q1 4JS4A 1G5VA 3P8HA 4BD3A 3C95A 4M77F 4XTWA 3PTAA 4ME7A 2YRVA 4RG8A 4C8QD 1JJ2S 2M0OA 4IUVA 4XU3A 5GAMj 2LRQA 4IUTA 4ZGEB 1R8OB 5GAMh 1YJ9A 3GNFB 1QVGA 4RG2A 3OW2A 2GQVA 4M75G 3ZBDA 4M78C 2QI2A 3HRTA 3L1AA 5FU6B 2EJ9A 2JVVA 2RI3A 3E9FA 3R6OA 4M7DD 1KHCA 2LVMA 2K5IA 4A4HA 5A2QE 4JJNK 1VQ7T 4Y28E 1QP2A 5KE2A 4M78F 3OA6A 3CBOA 4X34A 3VYHB 4C0ZA 4RCCA 3L2RA 4OF1A 3DKMA 4M77D 5LJ3h 4A4KA 1X75C 2LC4A 3JCMg 4N0AC 4QVDA 2HNIA 1QVFS 3M4GA 5D6WA 3WVEB 2EQJA 3O8VA 4C8QC 2O4XB 5CKBA 1YJNA 2L89A 3QYGB 3OYKA 3C12A 1X6OA 2VXEA 5GMKl 2E5QA 4XTYA 4M75C 5GAN3 4LDXA 4A4EA 1OZ3A 3OBWA 4ELYC 1KQ2A 3FRNA 5GANe 2K3XA 5FROA 4C92G 4F7UA 3JAME 4LD9K 5EG2A 4BACA 3M4YA 3CC7A 4Z02A 2IG0A 3UT1A 4XK8E 2E12A 2V8IA 4M78E 3RKXA 1JJ2A 2KQWA 1Y96A 3BFMA 1BI0A 2FL7A 3OYCA 4BUGA 1NJIU 1VQ9T 3OYGA 3FEOA 3A8LB 3RKYA 5KCOA 4WF2A 1K9MU 4C8QG 2YLBA 3LYIA 3LWIA 2DD5A 5GAOp 3RERA 5GAN2 4JRKA 1VQNA 2EQKA 3HKSA 3VV0A 3CD6T 1KG1A 2D6FA 4OP0A 1NPRA 1N9SA 4X9DA 1VQ6A 1Y96B 5GAMe 5GAOq 3JCMc 2EJFA 4GLKA 1S72T 3WVDB 3DLLA 4NS5A 3LLRA 3V8LA 2RO0A 4XAXB 3V7SA 1QW1A 2DD4A 4C5GA 1JRIA 2PVDB 3G6ET 3QJ6A 1M90C 4MDXA 4F7UB 4BE1A 1YJNT 2MI6A 3LH0A 5GAOl 1WNLA 3KXTA 1DJ7B 4LDYA 4TVRA 4XU1A 5LJ3e 3OYMA 1Q82C 3LW5E 2M1HA 1K73U 1D3BA 1WJSA 3QUIA 2DKGA 3CPWA 1YIJT 5C6SA 4HA8A 4C5IA 4J6WA 5L8RE 1VQMT 2KSSA 3EAEA 2WSFE 3X20B 1Q7YC 2MWOA 3MEWA 4J7IA 2Y90A 2A7YA 4J6YA 1VQ4T 1I5LA 2PU9B 3RUXA 3OYIA 1VQ6T 3BY7A 1NE8A 5KCHA 4KUDK 4C8QF 1M90U 1NZ9A 1XQHA 1ZHIA 1MGQA 3I56T 2QQBA 2HQXA 2XKOC 5GAN5 4M7DA 2B8AA 5A0GA 2RHZA 5GAOn 3M53A 4L5GA 2WACA 1O9SA 2JNGA 1VQ8T 3CXCA 2DXCA 3NTKA 3UDCA 5GMKh 3CCSA 4E7IA 5FRMA 1BYMA 2XDPA 5J26A 2KVQG 2DIQA 2QQAA 3URGA 1S72A 3DLMA 2R58A 2F69A 3HHTB 1U1SA 4XU0A 3JCMe 3FC3A 4M78D 2ZPGB 3TREA 3QBYA 4M75E 3G71T 4F7UG 3TEEA 1VQOT 2LDMA 4C92C 3CC7T 3OYYA 1VQKT 1IREB 3QSUA 3GF5A 1YI2T 1VUBA 2RHUA 3NTHA 2ZCFB 3QKJA 3QJYA 4C8QB 2CZ7B 1JBMA 2L3RA 4M78A 2QDYB 3OS0A 4M77C 3RMQA 5LJ5e 1YIJA 1M1KC 4JRIA 3VKIA 4HT8A 1ZQ1A 2PUKB 2X4JA 1H3ZA 2E70A 3LX7A 3V7RA 3OYDA 2BUDA 2FHDA 2EFIA 5I2MA 1PSEA 3PFSA 4E7JA 4NOYA 1VQ4A 1P92A 3HPWA 3JSCA 3ER0A 3OQ5A 4MZMA 2E6ZA 5LL6S 5LJ5d 5D6XA 4IKFA 2ZGWA 3QG1A 4BI3A 5GAMf 3PIOA 2F5KA 2K4YA 2X4YA 2R5MA 4FT4A 2XHCA 2JZ2A 3ZEHA 4FT2A 4O6JA 4F7UF 3G6EA 4A4FA 2MF2A 3J80E 1KC8U 2DPPB 3ME9A 3QZ9B 1GXIE 1G3YA 2IVWA 2QQSA 2LQKA 5M9OA 3ZFJA 4CI0C 3KUFA 5DLOA 1N8RC 2QA4T 3JCMV 1IZ6A 2DIGA 5C0MA 3PNWC 3RIRA 1YJ9T 3GIBA 3BW1A 5GANj 1VQPA 1X01A 3X28B 2ZPBB 2Y4YA 5GANh 4N4IA 1BIBA 2DTHA 4M7AA 2JN0A 4M78G 2CZ0B 2HBPA 3VYGA 3GPLA 3CCJT 1YITT 4C92B 4M7AE 1TH7A 4ZN3A 3CCQT 2X4XA 3SWNC 4EMHA 5GAN4 3V7CA 4QW2A 1KQSA 4RKUE 1NJIC 5GAN8 4DOVA 4R55A 2BKDN 1VIFA 2VUBA 2PVGB 2LX9A 2MAMA 3JB9J 3FB9A 3CCST 2EIFA 4N0AA 5HK0A 1Y71A 3CPFA 4A4GA 2QEXT 4BE0A 2K5FA 2V8KA 2A3LA 5CKEA 2QA4A 2JOYA 2E41A 1UEBA 1KD1C 1YHQA 4PJOA 3QDRB 1VQPT 4JUVA 4NL2A 5CO7A 5GAMg 1B34A 1WQWA 2KMTA 4LDWA 5AYFA 2WSCE 3JCMf 3OYEA 3G71A 2OAUA 2ZPFB 3E19A 3GNGA 4OB3B 1Y07A 4EPCA 1YITA 3TU4K 4EMKA 4RCBA 3VJPA 3MHXA 3OYJA 4J5YA 1K8AC 1BI2A 4PNOA 4A53A 2PQWA 5I2SA 4X9CA 4P5NA 4XTVA 3L2UA 5GAN7 3H6ZA 4KT0E 5CAIA 4PLIA 5LJ5h 2KY9A 2LQ8A 3JCMd 2QEXA 3CC4T 2R57A 2XDDA 1KD1U 2XK0A 5DM7R 3ASKA 1N8RU 1QVFA 2O01E 2OTJT 4EMKC 4JLGA 1KQSS 4M77B 1KC8C 2QXFA 3SWNB 1W2BA 2XU8A 4BB7A 2KDSA 5J3BA 3UWNA 4B9WA 3OYAA 5GANf 1HK9A 2R5AA 3OSSC 3CCUA 5HKCA 5FLXE 4OGCA 3OMCA 2P0QA 1I8FA 2DXUA 4V2SA 3HRSA 3CCLA 2RK2A 4ELZC 4ZTFA 1FWZA 5GMKe 1B34B 4OB2B 4HCBA 2M9UA 4PJOB 3MP8A 2F5TX 2OTLT 3E1SA 3NFCA 3M9QA 3V8JA 4J7FA 2ZZDA 1UGRB 5J39A 4JRQA 5GAN6 5CR2A 3N5BB 3OS5A 1WPYA 3FIFA 5IAYA 2DZCA 4NL3A 4OVAA 2JTFA 5CKHA 3S3MA 1VQ8A 1BKBA 1FXXA 1YBYA 4PKCC 3M54A 4Y91A 4C0GA 2CZ1B 2KK4A 3QHSA 1PSFA 2RHYA 4N4GA 4VUBA 4C92A 4EMGA 5GAOm 4BE2A 3S3NA 1WGSA 1K8AU 1KQ1A 3L2ZA 3A8MB 4E47A 1VQ5T 5GMKi 2GF7A 3SFMA 3CCUT 4BI4A 1W2BS 3NTIA 1VQKA 4D6WA 2D0QB 4GY5A 2OTLA 3X24B 1OI1A 2X35A 3MEUA 3P8BB 4M7AF 3MEAA 3SWNA 2M16A 2XDBA 3C4SA 4PLLA 1M1KU 3CMET 5DY9A 2DO3A 1NPPA 4E7KA 2QQ9A 3OSVA 4LDVA 5LJ3j 2RH2A 2MMPA 4PJOC 2DJZA 1W4SA 2DEQA 1QVGS 5LJ5g 1K73C 4C5HA 3OW2S 3OB9A 4FU6A 4ZGJB 1SSFA 4MMLA 3JCMb 3M56A 1M1GA 3MP1A 3SDZA 1XNIA 1OYXA 1HXDA 4PJOF 3QXEB 2GCXA 2ZPIB 4DQ2A 4F7UE 3GP8A 4M7AD 2LTOA 5HK3A 2K57A 4IUUA 2C06A 3JB9G 3A5ZB 2K3YA 3INZA 4L6V5 1KHIA 3M5AA 5CQYA 5DLQE 5HY6A 4C0FA 3FDRA 1UB4A 3CCMA 5CCAA 5LJ3d 3I55T 3HFOA 3QPHA 3L2WA 2PVOB 2CS7A 3SB2A 3M57A 4BDYA 3CCET 4FIBA 3OS1A 3META 1WJQA 2VYTA 3X25B 1N6AA 4EMKB 3S6WA 1YJWT 4HKEA 3CC2T 4KULA 2EQUA 3QZ5B 2YLCA 3LGFA 1UGSB 1K9MC 3CCJA 3CCQA 3G4SA 3SD4A 4C0DC 4MDWA 3TCJA 2EAYA 2CZ6B 1WJRA 4A54A 3HRUA 5GMKm 4M7AC 2Y4XA 4HT9A 2K5LA 3HL8A 3JCMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQ8 A;  2QEX A;  3CC4 T;  1M90 U;  1NZ9 A;  1KD1 U;  5DM7 R;  1N8R U;  1QVF A;  1VQL T;  2JUF A;  2OTJ T;  1YHQ T;  3I56 A;  3I55 A;  1KQS S;  2JNG A;  1KC8 C;  1VQ5 A;  1VQ8 T;  1W2B A;  3CXC A;  3J81 E;  1XTD A;  2G3R A;  2KDS A;  5J3B A;  3CCS A;  3CCV A;  1Q7Y U;  3CCU A;  1VQ7 A;  5J26 A;  2KVQ G;  3CMA A;  1S72 A;  2MWP A;  1YJW A;  1EIF A;  5FLX E;  3CC2 A;  3KBG A;  1Q81 U;  3CCL A;  3G4S T;  3CME A;  3CCE A;  3TRE A;  3G71 T;  1VQO T;  3J7A F;  3CC7 T;  3OYY A;  1VQK T;  1JJ2 S;  2OTL T;  5IT9 E;  2L3R A;  1M1K C;  1YJ9 A;  1QVG A;  1YIJ A;  4RG2 A;  3OW2 A;  3CC4 A;  3CPW S;  5IAY A;  2CKK A;  2OTJ A;  2JVV A;  2E70 A;  2LVM A;  1VQ8 A;  5A2Q E;  1VQ4 A;  1VQ7 T;  1BKB A;  1YBY A;  4X34 A;  3ER0 A;  5LL6 S;  2E6Z A;  3CCR A;  3CCM T;  1K8A U;  3CCL T;  3PIO A;  1VQ5 T;  1QVF S;  2XHC A;  1VQN T;  1Q82 U;  3G6E A;  3CD6 A;  3CCU T;  1W2B S;  1YJN A;  3CXC S;  3J80 E;  1KC8 U;  1VQK A;  1X6O A;  4ZN1 A;  2OTL A;  3P8B B;  1N8R C;  2QA4 T;  1IZ6 A;  1YJ9 T;  4YTL A;  3JAM E;  1VQP A;  3CC7 A;  1M1K U;  2DO3 A;  2IG0 A;  1NPP A;  1JJ2 A;  1YIT T;  3CCJ T;  1NJI U;  4ZN3 A;  3CCQ T;  1VQ9 T;  1QVG S;  2LCL A;  1K73 C;  3OW2 S;  1K9M U;  1SSF A;  3DB4 A;  3LGL A;  1M1G A;  1VQM A;  4QQD A;  1NJI C;  1KQS A;  1VQL A;  1VQN A;  1XNI A;  3HKS A;  3I56 T;  1YI2 T;  3CD6 T;  1NPR A;  3CCS T;  3CCR T;  2EIF A;  3CCV T;  1VQ6 A;  3A5Z B;  2QEX T;  3CPF A;  5HY6 A;  1KHI A;  5DLQ E;  3CCM A;  1S72 T;  2QA4 A;  3DLL A;  2JOY A;  1UEB A;  1KD1 C;  1YHQ A;  1M90 C;  3G6E T;  3I55 T;  3DB3 A;  3CME T;  1VQP T;  3CCE T;  1YJN T;  1RL2 A;  2MI6 A;  3LH0 A;  3G71 A;  4TVR A;  1Q86 C;  3CMA T;  1YJW T;  3CC2 T;  1Q82 C;  3LGF A;  1YIT A;  1K9M C;  3CCJ A;  4CRI A;  1K73 U;  3CCQ A;  3G4S A;  1Q81 C;  3PIP A;  1K8A C;  3CPW A;  1YIJ T;  1VQO A;  1VQM T;  1Q7Y C;  1YI2 A;  2MWO A;  1Q86 U;  1VQ4 T;  1VQ9 A;  1VQ6 T; 
#chains in the Genus database with same CATH topology
 3OYH A;  1G3W A;  4M75 F;  3FJP A;  4J9E A;  1YHQ T;  2ATC B;  1VQ7 A;  1OEB A;  4PJL A;  3JB9 I;  1AD5 A;  2AK5 A;  1Q81 U;  3L2Q A;  1D0Z A;  2YUQ A;  2H3E B;  2D1X A;  3JB9 H;  4E7H A;  4Z88 A;  1OQK A;  1OV3 A;  3S3O A;  4IUR A;  4E7L A;  4IUQ A;  1IHW A;  2LZ6 B;  2DRM A;  2M0Y A;  3G4S Q;  3EG9 B;  2ENM A;  1G3T A;  4IIM A;  1LJO A;  5CKF A;  3VUZ A;  3E9G A;  3C0C A;  4HCK A;  2E5K A;  2M02 A;  3CD6 A;  3JCM P;  2RD1 A;  1FYN A;  4ZN1 A;  1KK7 A;  4PJO D;  3MEV A;  1PNJ A;  3UA7 A;  2FVU A;  2V8J A;  1KC8 R;  2CT3 A;  1VYV A;  2VXF A;  2XG8 D;  2F2W A;  2RJD A;  5A0D A;  4R56 A;  2EQM A;  4DOW A;  1D1C A;  3BDL A;  2RJC A;  1V29 B;  1X2K A;  2BIV A;  2LCL A;  2AHJ B;  2A36 A;  2P0K A;  3QDF A;  2A0F B;  5HCK A;  2LP5 A;  3I56 T;  2CGH A;  3CCV T;  5IHI A;  3CCR T;  1PRM C;  4UC4 A;  1K9A A;  3OMG A;  2EKH A;  3CME T;  5A0L A;  2KNB B;  1PD0 A;  1QQJ A;  2RB6 A;  1D3B B;  1U3O A;  4XU2 A;  4B6M A;  3I56 Q;  4M7D G;  5KYX B;  1VQM Q;  4FW1 A;  1VQL Q;  4CRI A;  1OZ2 A;  3CCV Q;  3PIP A;  3EH1 A;  3JCM J;  3I5S A;  1UUE A;  3HSB A;  2A08 A;  2EYX A;  1YI2 A;  2JTM A;  2YUP A;  3VUB A;  1TU0 B;  4QVZ A;  1VQ9 A;  4OB1 B;  4QQG A;  3CXC P;  4WCI A;  3HFN A;  4JRP A;  2EBP A;  1H64 1;  3AHU A;  1QVP A;  2JM9 A;  4C8Q A;  2MWP A;  1QLY A;  2GFU A;  3KBG A;  1Z9Z A;  2L8D A;  3CCE A;  2FG0 A;  4JS4 A;  2PZ1 A;  3P8H A;  4XTW A;  4ME7 A;  2ROL A;  2M0O A;  2LRQ A;  1YJ9 A;  4RG2 A;  2GQV A;  3ZBD A;  2QI2 A;  2L0A A;  3EGX A;  3U23 A;  2KGT A;  4F04 B;  2EJ9 A;  1IXD A;  1NG2 A;  2LVM A;  4Y28 E;  4M78 F;  4X34 A;  4OF1 A;  3DKM A;  1RAI B;  1G8X A;  4N0A C;  4QVD A;  2FZG B;  5D6W A;  3WVE B;  1YJN A;  2OX7 A;  1X6O A;  4XTY A;  1VQN Q;  3FRN A;  5FRO A;  4C92 G;  3H41 A;  1LCK A;  4OMN A;  3UT1 A;  1ARK A;  1Y96 A;  1A0N B;  3OYC A;  3RKY A;  2YLB A;  3LYI A;  2HCK A;  2KT1 A;  4JRK A;  2EQK A;  3HKS A;  1WFW A;  3VRZ A;  2COW A;  1VQP Q;  4RTW A;  4RUG A;  1S72 T;  4XAX B;  3V7S A;  2DD4 A;  1M90 C;  2JS2 A;  2PVD B;  3QJ6 A;  4BE1 A;  2MI6 A;  3LH0 A;  5GAO l;  1WNL A;  1NBE B;  1SRM A;  2CP2 A;  3OYM A;  1AWO A;  1PHT A;  3LW5 E;  1K73 U;  2LQN A;  4HA8 A;  4C5I A;  5KYU B;  1S72 Q;  1M8M A;  5L8R E;  3X20 B;  1Q7Y C;  2E3H A;  2MWO A;  1YFN A;  4J6Y A;  1VQ6 T;  2RQU A;  3PVQ A;  2B8A A;  2EYY A;  2DL4 A;  2DXC A;  3NTK A;  3UDC A;  3CXC A;  4OML A;  2EGE A;  1PKS A;  2R58 A;  1B3Q A;  2YDL A;  2CDT A;  2ZPG B;  4KGV B;  4RTV A;  3TRE A;  1SEM A;  3A1P A;  3G71 T;  4M75 E;  1VQO T;  3EGU A;  1KIK A;  1T3L A;  5IXB A;  3CC7 T;  2OAW A;  1MMD A;  1QCF A;  2HZY A;  3GF5 A;  1VUB A;  2ZCF B;  2DVJ A;  7AT1 B;  4HT8 A;  1RAG B;  2IIM A;  4DBH A;  3RDV A;  3V7R A;  3OYD A;  5I2M A;  2EFI A;  4NOY A;  1P92 A;  3JSC A;  3QWY A;  2E6Z A;  4FYW B;  1E6H A;  2ZGW A;  2JMA A;  5GAM f;  3PIO A;  2K4Y A;  4FT4 A;  1OOT A;  4PJN A;  3ZEH A;  3G6E A;  1FMW A;  3ME9 A;  2LQK A;  2YUN A;  4CI0 C;  3KUF A;  1QCO A;  5C0M A;  3X28 B;  2ZAE A;  1V76 A;  1ABO A;  4M7A A;  3VYG A;  3CCQ T;  2X4X A;  4EMH A;  4QW2 A;  1U06 A;  1M3B A;  2CRE A;  4ZNX A;  1KQS A;  4R55 A;  2CSI A;  2PVG B;  3JB9 J;  3FB9 A;  2VVK A;  8AT1 B;  5HK0 A;  2QEX T;  2VB6 A;  2V8K A;  1KD1 C;  4PJO A;  2RQT A;  3QDR B;  4NL2 A;  5GAM g;  1B34 A;  2CUD A;  2KMT A;  4LDW A;  3JCM f;  3NHN A;  1Q95 G;  2X9H A;  2QGF B;  2OAU A;  3E19 A;  4OB3 B;  3G6E Q;  4EPC A;  3TU4 K;  3VJP A;  2NUZ A;  2QTV A;  5I2S A;  4XTV A;  3VS7 A;  4PLI A;  5LJ5 h;  2KY9 A;  2QEX A;  2HL3 A;  1Q86 R;  3EG9 A;  4JLG A;  1KQS S;  3REB B;  2YRD A;  2DER A;  4RTX A;  1K0S A;  3OMC A;  4OMO A;  3TVT A;  2LJ3 A;  5GMK e;  1B34 B;  2EGC A;  4HCB A;  2M9U A;  4PJO B;  2X3W D;  3SEM A;  2OTL T;  2ZZD A;  1UGR B;  5GAN 6;  1VQK Q;  3VS0 A;  3OS5 A;  3THK A;  1WPY A;  1PG5 B;  2DZC A;  2OJ2 A;  4AT1 B;  3CCM Q;  1FXX A;  1RAF B;  4Y91 A;  1NEB A;  4WTO B;  3QHS A;  5GAO m;  2A37 A;  1HJD A;  1OX8 A;  1X6B A;  3A8M B;  2DYB A;  3CCU T;  2HMA A;  4GY5 A;  3QWX X;  1RAA B;  3SWN A;  1WYX A;  1YI2 Q;  1NPP A;  4PFP A;  1D0Y A;  2NYS A;  3OSV A;  1FMV A;  4LDV A;  1R77 A;  3KFV A;  1WX6 A;  3I55 Q;  5LJ5 g;  3OW2 S;  4FU6 A;  4PJO F;  3QXE B;  2DLP A;  2LTO A;  2K57 A;  4IUU A;  3G1J A;  3CCE Q;  3A5Z B;  2KT8 A;  5HY6 A;  1KHI A;  2MCN A;  4L6V 5;  3CCM A;  3FDR A;  1AVZ C;  4OMM A;  1RLQ C;  1M1K R;  2CS7 A;  3MET A;  3S6W A;  1YJW T;  3LGF A;  1UGS B;  1BBZ A;  2RQV A;  2CZ6 B;  2B86 A;  3VS2 A;  4M7A C;  2Y4X A;  4LE9 A;  1RAH B;  2K5L A;  3HL8 A;  4HT9 A;  1ZLM A;  1X6G A;  5LJ5 j;  4LDU A;  3I5R A;  5CKD A;  3A98 A;  3I55 A;  4B9X A;  4F17 A;  3J81 E;  1LOJ A;  4OMF B;  3VS6 A;  4M4Z A;  2VGM A;  4J8O A;  3GLX A;  3F70 A;  2RI5 A;  4DBR A;  1U1T A;  4JS5 A;  3JB9 D;  3RKW A;  1NLO C;  4J9H A;  4PK4 A;  2E4H A;  1M4Z A;  1H92 A;  1E7O A;  1RI0 A;  5IT9 E;  1NM7 A;  3PGG A;  1N5Z A;  4ZGD B;  5FU7 C;  3CC4 A;  4C92 F;  1R0B G;  1M30 A;  3CPW S;  2QTX A;  1WHK A;  2KAF A;  2P0P A;  2D9T A;  1N8R R;  1EZZ B;  1TUD A;  2VC8 A;  1FX7 A;  1YNZ A;  3JB9 F;  2W10 A;  2BE7 D;  3OYN A;  5GAM d;  3CCL T;  3MPU B;  2RJE A;  3UPU A;  5CVI A;  1QKW A;  3WXM B;  2ED1 A;  1GCQ A;  4M78 B;  3L2V A;  1I4K 1;  4ANJ A;  4C92 E;  4YTL A;  2DK3 A;  2RQW A;  2QG9 B;  1K1Z A;  5FWC A;  4FSS A;  1AWJ A;  2LT4 A;  4Y92 A;  2LJ0 A;  1ZBX A;  2DM1 A;  3CD6 Q;  2DL5 A;  1QP3 A;  3DB4 A;  1GFC A;  2FZK B;  4QQD A;  4DBQ A;  2RHX A;  3FLG A;  5CIU A;  3HP9 A;  4BI8 B;  5FRN A;  2ZPE B;  1YCS B;  3BDU A;  4HCC A;  1XOV A;  3RES A;  4Z8A A;  4FL6 A;  3M59 A;  3CBP A;  2AZV A;  2K3B A;  2E65 A;  2DTO A;  1Q81 C;  3G7Z A;  2H3J A;  4PJM A;  2J7I A;  3CC2 Q;  2YXY A;  1H8K A;  3V8K A;  2DTI A;  4JPB W;  1PM3 A;  1VQL T;  2JUF A;  5IN1 A;  3I56 A;  2LQW A;  5GAO r;  1J3T A;  2V26 A;  2RHI A;  2GBQ A;  2EW3 A;  1NJI R;  4M7D F;  2HD0 A;  2RK1 A;  2NLU A;  2L5Q A;  2W0Z A;  3M55 A;  1GFD A;  1BCM A;  1G5V A;  4BD3 A;  2YRV A;  4RG8 A;  4E7Z A;  4FYX B;  4XU3 A;  5IXF A;  1HYO A;  4IUT A;  1BK2 A;  1QVG A;  3GNF B;  1JEG A;  4M75 G;  4KGX B;  1MMA A;  2ROT A;  4GBQ A;  2EQI A;  1KHC A;  4A4H A;  1Z9Q A;  1QP2 A;  1K8A R;  3VYH B;  4C0Z A;  2JT4 A;  4RCC A;  4M77 D;  3NMZ C;  1X75 C;  2LC4 A;  1K9M R;  1QVF S;  3M0R A;  4C8Q C;  3M0T A;  1YJ9 Q;  3QYG B;  3OYK A;  3C12 A;  5GAN 3;  4LDX A;  4A4E A;  3OBW A;  1KQ2 A;  1TXQ A;  1AZE A;  4F7U A;  4LD9 K;  3M4Y A;  3JV3 A;  1UEC A;  2CH4 W;  4CC3 A;  2EPD A;  1QVF P;  2KQW A;  2CP5 A;  4X1V A;  1BI0 A;  2FL7 A;  1W2B P;  3FEO A;  5KCO A;  4ESR A;  2VWF A;  1YJN Q;  1Y0M A;  3LWI A;  5KYW B;  3TSZ A;  3RER A;  1VQN A;  3VV0 A;  1N9S A;  1VQ6 A;  5GAM e;  4GLK A;  1TS9 A;  3WVD B;  2NWM A;  3LLR A;  3V8L A;  2K6D A;  4C5G A;  4MDX A;  4OMP A;  1D1A A;  1YJN T;  2GQI A;  3KXT A;  1G83 A;  3QUI A;  2DKG A;  1ZUY A;  1YIJ T;  5L23 A;  1FMK A;  4J6W A;  1VQM T;  2KSS A;  3EAE A;  1AWW A;  3MEW A;  3OYI A;  1EX4 A;  1M90 U;  1VYT A;  2QQB A;  2RN8 A;  5GAO n;  3M53 A;  1YIJ Q;  3CCS A;  4E7I A;  2RQR A;  2KVQ G;  2DIQ A;  2LX7 A;  3URG A;  1S72 A;  1SG5 A;  3DLM A;  2F69 A;  1KFZ A;  3HHT B;  3FC3 A;  1ZA1 B;  2ABL A;  4F7U G;  3TEE A;  4KGZ B;  1NEG A;  2CP6 A;  2KYM A;  4QKU A;  1WI7 A;  2QDY B;  1ZQ1 A;  4RTY A;  1H3Z A;  2E70 A;  3LX7 A;  1M3A A;  2CP0 A;  2BUD A;  2FHD A;  4E7J A;  1PSE A;  3PFS A;  2QA4 Q;  4MZM A;  3CC7 Q;  2Z0W A;  5LJ5 d;  2X4Y A;  4O6J A;  4A4F A;  2MF2 A;  3J80 E;  1KC8 U;  1MUZ A;  2QQS A;  2EYZ A;  2QA4 T;  1IZ6 A;  3PNW C;  3RIR A;  3GIB A;  1TUC A;  3I9Q A;  2ZPB B;  4LUD A;  1BIB A;  4M78 G;  3GPL A;  2HBP A;  3CCJ T;  1TH7 A;  3SWN C;  3V7C A;  1NJI C;  1QKX A;  1MV3 A;  1VIF A;  2LX9 A;  3CPW P;  2EIF A;  1AOJ A;  1Y71 A;  3CPF A;  4A4G A;  4BE0 A;  4A63 B;  5CKE A;  4AG1 C;  2QGG A;  2QA4 A;  1YHQ A;  2DRK A;  4JUV A;  5CO7 A;  1WQW A;  5AYF A;  3CC4 Q;  2ZPF B;  3GNG A;  1Y07 A;  4F16 A;  1YIT A;  4EMK A;  1K8A C;  1SRL A;  1PC0 A;  4P5N A;  5GAN 7;  3H6Z A;  4KT0 E;  3H0F A;  2DIL A;  1NLP C;  2ESW A;  5GJV B;  1T0H A;  3ASK A;  1JJ2 P;  5D7U A;  1LPL A;  1ZX6 A;  4M77 B;  1KC8 C;  2QXF A;  3SWN B;  3EFO A;  2AT1 B;  5J3B A;  4RTU A;  3OSS C;  3ULR B;  5HKC A;  4FCY A;  2P0Q A;  1SHF A;  3HRS A;  1I5O B;  3EH2 A;  1M27 C;  3M9Q A;  1JU5 C;  3V8J A;  5J39 A;  1SSH A;  1RAC B;  3N5B B;  3FIF A;  4QT7 A;  5IAY A;  4FYY B;  3REA B;  2JTF A;  1VQ8 A;  4PKC C;  1YBY A;  4C0G A;  2CZ1 B;  3OW2 P;  2RHY A;  4N4G A;  4VUB A;  4EMG A;  5IH2 A;  2MYS A;  1KQ1 A;  1VQ5 T;  2YSQ A;  5GMK i;  1T3S A;  1VQK A;  4D6W A;  4HVV A;  2D0Q B;  3VS4 A;  1UHF A;  2O2O A;  2CP3 A;  3MEA A;  3C4S A;  1M1K U;  2H8H A;  2CP7 A;  2VAS A;  2C0T A;  2OI3 A;  4FYV B;  1MND A;  2DEQ A;  3NGP A;  1M2V B;  2KEA A;  4ZGJ B;  4MML A;  3MP1 A;  1YI2 T;  1OYX A;  2DFU A;  4F7U E;  2NUP A;  2K3Y A;  2AZS A;  2JXB A;  1I07 A;  1Q7Y R;  3I55 T;  3HFO A;  3OS1 A;  2ECZ A;  1WJQ A;  1CKB A;  2VYT A;  3X25 B;  4EMK B;  4AFU C;  2EQU A;  2YLC A;  1ZUU A;  4MDW A;  1UTI A;  2EAY A;  4A54 A;  5GMK m;  3EHR A;  2MIO A;  2KBT A;  3JCM Q;  2DBK A;  3MO8 A;  4KH1 B;  1WQ7 A;  4DA4 A;  1N9R A;  4OGE A;  1IO6 A;  4L59 A;  3CCV A;  1N27 A;  1YCY A;  1RAD B;  4KH0 B;  2COY A;  5KE3 A;  4KBM B;  4EDU A;  5GAN g;  1G3S A;  4M7A G;  5GAN d;  3J7A F;  1CSK A;  1KSW A;  1RUW A;  1W1F A;  3LWH A;  2FPD A;  2KXC A;  3M0Q A;  3EFS A;  2DVE A;  3EG1 A;  5LJ3 f;  2P4R A;  5GMK j;  4ZTJ A;  1O75 A;  4LD6 A;  2OTJ A;  3L42 A;  4PJO E;  4FM4 B;  4PL6 A;  1U8R A;  4XTZ A;  2LNV A;  5I21 A;  3PMT A;  4HVU A;  2E10 A;  2DET A;  4M7D E;  4J83 A;  3MCA B;  4HCZ A;  4XTX A;  2VV5 A;  2QQR A;  2KE9 A;  2D0N A;  3H8Z A;  2AIR B;  3CCL Q;  4J6X A;  2MK5 A;  1BI1 A;  1Y57 A;  2RNA A;  3QO3 A;  2MOX A;  2DXT A;  1JO8 A;  2LCC A;  4J9C A;  1D0X A;  4LNP A;  4ATO A;  3CMA Q;  2X4W A;  3A8G B;  3I35 A;  4C5E A;  2V1R A;  1D09 B;  5KYN A;  1C6V X;  2XI9 A;  2QDL A;  4JLI A;  1C0M A;  1WLP B;  2RMO A;  4MMK A;  1M1F A;  3DB3 A;  4BDY A;  4BY6 B;  3CCE T;  1ZSZ B;  1RL2 A;  2RI2 A;  3CMA T;  4O5V A;  1UG1 A;  2FRY A;  4PJJ A;  5FU6 C;  1RLP C;  5CQX A;  1TG0 A;  3M58 A;  1Y7X A;  2GTJ A;  4M75 A;  1VQO A;  2X51 A;  4M77 G;  2XIC A;  1Q82 R;  1JB0 E;  3OYF A;  4M77 E;  4PJO G;  2FYK A;  1Q86 U;  2GFA A;  2KRM A;  2RJF A;  1YWP A;  2EWN A;  1AHJ B;  2XID A;  2J05 A;  4QVC A;  3QII A;  4XQ3 A;  1LNX A;  5LJ3 g;  4C92 D;  1KJW A;  1XTD A;  5GJW B;  2RM4 A;  3UA6 A;  5AT1 B;  3CMA A;  2F1L A;  4XTU A;  3UF4 A;  1PWT A;  1WA7 A;  2HQE A;  4C8Q E;  3RMS A;  1QCN A;  1WZO A;  3CME A;  3A8H B;  4FSX A;  1ZSZ A;  2P4T A;  5GAM j;  1RI9 A;  1ZSZ C;  2J6O A;  4ZGE B;  1R8O B;  2CT4 A;  2GNC A;  2K9G A;  3HRT A;  5FU6 B;  2JVV A;  3R6O A;  3E9F A;  4HXJ A;  5A2Q E;  1ACM B;  4DBF A;  2I0N A;  3OA6 A;  3CBO A;  2E3I A;  2O88 A;  2HNI A;  3M4G A;  2EQJ A;  3O8V A;  1Q81 R;  1UGV A;  2O4X B;  5CKB A;  2VXE A;  5GMK l;  1TUG B;  4M75 C;  3NPF A;  4ELY C;  3BE3 A;  3JAM E;  5EG2 A;  2HDA A;  4Z02 A;  4ORZ A;  2O31 A;  4M78 E;  3BFM A;  1NJI U;  4BUG A;  1VQ9 T;  3OYG A;  3A8L B;  4AG2 C;  1M3C A;  4C8Q G;  2DD5 A;  1X43 A;  1UE9 A;  4CC2 A;  5GAN 2;  3IQL A;  3CD6 T;  1KG1 A;  2PNI A;  4OP0 A;  4X9D A;  4CC4 B;  5KYX A;  4PFZ A;  5GAO q;  3JCM c;  1UJY A;  4AMC A;  1GL5 A;  3G6E T;  1VQ9 Q;  3CCR Q;  4F7U B;  1DJ7 B;  4LDY A;  4TVR A;  2M51 A;  4XU1 A;  5LJ3 e;  2J06 A;  2A28 A;  1D3B A;  1WJS A;  1OUL A;  1VQ8 Q;  3H0H A;  1K4U S;  1EFN A;  2A7Y A;  1VQ4 T;  1I5L A;  2PU9 B;  3BY7 A;  1NE8 A;  5KCH A;  1X2Q A;  4C8Q F;  1MGQ A;  2XKO C;  5GAN 5;  5A0G A;  2JNG A;  1VQ8 T;  2G6F X;  5GMK h;  5FRM A;  1H3H A;  2XDP A;  5J26 A;  4AFZ C;  1VQ4 Q;  3JCM e;  2K2M A;  4C92 C;  3OYY A;  1VQK T;  1IRE B;  3QKJ A;  3QJY A;  2CZ7 B;  1M1K C;  4M78 A;  4M77 C;  1YIJ A;  4E6R A;  1I1J A;  4JRI A;  3VKI A;  2PUK B;  3EGD A;  1B7T A;  5D6X A;  4IKF A;  4J9G A;  3RR6 A;  4BI3 A;  2VKN A;  2XHC A;  4GLM A;  2JZ2 A;  1IGQ A;  2DPP B;  1GXI E;  1WXB A;  5M9O A;  1N8R C;  3JCM V;  1YJ9 T;  1K0X A;  5GAN j;  1VQP A;  1X01 A;  4Z89 A;  4EIK A;  2Y4Y A;  5GAN h;  1YIT T;  1WHM A;  4C92 B;  3FJ5 A;  4M7A E;  1WHJ A;  5GAN 4;  5GAN 8;  1E6G A;  1W70 A;  3CCS T;  4N0A A;  2EVR A;  2ED0 A;  1UEB A;  2HSP A;  1VQP T;  3G71 A;  1VOM A;  2F2X A;  3O5Z A;  2F2V A;  2HL5 C;  1V1C A;  1T0J A;  2OTJ Q;  4RCB A;  2DBM A;  3MHX A;  2KYB A;  4J5Y A;  1JQQ A;  1OPL A;  1BI2 A;  2O9S A;  4A53 A;  2PQW A;  2J6F A;  4X9C A;  2HSE B;  1R0C B;  5CAI A;  1YHQ Q;  2LCS A;  3M0S A;  2LQ8 A;  3JCM d;  3CC4 T;  2R57 A;  2XDD A;  5DM7 R;  2O9V A;  2O01 E;  2OTJ T;  4EMK C;  2AKL A;  2XU8 A;  4B9W A;  5GAN f;  2RF0 A;  1I8F A;  2DXU A;  4J9D A;  1TSF A;  3CCL A;  2FPE A;  2RK2 A;  4OB2 B;  1C1A A;  2F5T X;  2GTO A;  2JJ9 A;  3E1S A;  3NFC A;  3G71 Q;  4J7F A;  4JRQ A;  2SRC A;  1GCP A;  4NL3 A;  5CKH A;  1BKB A;  4HVW A;  3M54 A;  4C92 A;  2KK4 A;  1PSF A;  4BE2 A;  3H0I A;  2EYW A;  3L2Z A;  4E47 A;  2GF7 A;  3SFM A;  1W2B S;  3NTI A;  1ZA2 B;  1ZUK A;  2X35 A;  3MEU A;  2LMJ A;  5FWB A;  4M7A F;  1QWF A;  2LNH B;  2M16 A;  2XDB A;  4PLL A;  1HD3 A;  4AFS C;  1W6X A;  1KQS P;  2QQ9 A;  2MMP A;  4LN2 A;  2DJZ A;  1W4S A;  1QVG S;  1K73 C;  3OB9 A;  4OMQ A;  2FPF A;  1SSF A;  3RNJ A;  1M1G A;  4RTZ A;  2BZY A;  3CCJ Q;  3SDZ A;  1WHG A;  1XNI A;  1HXD A;  2GCX A;  2ZPI B;  4M7A D;  5HK3 A;  3CME Q;  3JB9 G;  3INZ A;  1D1B A;  5DLQ E;  3M5A A;  4C0F A;  1LVK A;  1UB4 A;  1ZBJ A;  2D8H A;  5LJ3 d;  1RAE B;  3L2W A;  3QPH A;  3SB2 A;  1OX9 A;  2QEX Q;  4FIB A;  3R6N A;  1SF9 A;  3CC2 T;  4KUL A;  3EG3 A;  3QZ5 B;  1K9M C;  1PKT A;  3CCQ A;  1F1B B;  3SD4 A;  3HRU A;  2SEM A;  2DMO A;  1M90 R;  4R0K A;  3CQT A;  4RTT A;  2JM8 A;  3OYB A;  3T9N A;  2HKQ B;  1UGP B;  1OU9 A;  2K2V A;  1VQ5 A;  4Q5W A;  1BIA A;  2LT1 A;  4RMO A;  3JCM W;  3CC2 A;  4MZT A;  2YT6 A;  2JTE A;  1VIE A;  4M7D C;  1YN8 A;  3G4S T;  2BZX A;  4QQ6 A;  3CEY A;  2JMC A;  3JRZ A;  2RA2 A;  5I22 A;  4M77 A;  2XD0 A;  2CKK A;  1UJ0 A;  5KYW A;  3EGD B;  1KD1 R;  4C0D B;  1BB9 A;  2DX1 A;  2X3X D;  1PCX A;  3LH5 A;  3CCR A;  4BY6 C;  3PMI A;  3CCM T;  1UDL A;  3MP6 A;  2DXB A;  1GRI A;  1I81 A;  5D6Y A;  1ABQ A;  2DZ9 A;  2FEI A;  1Q82 U;  1VQN T;  3C94 A;  1M8V A;  5KYY B;  3CXC S;  1WXT A;  4K11 A;  1VQ5 Q;  2FB7 A;  2C0O A;  3CCU Q;  4J9B A;  2K7A A;  2O4X A;  1SPK A;  2DL8 A;  2DAQ A;  2EGA A;  4II1 A;  3QYH B;  4M7D B;  1K73 R;  3X26 B;  2PUO B;  5KH6 A;  5IHK A;  2LJ1 A;  3A8O B;  1PRL C;  2EKO A;  3LGL A;  3OBY A;  1VQM A;  3E2U A;  3PT9 A;  3JCM X;  1VQL A;  5LJ5 f;  3EFR A;  2E64 A;  1X69 A;  3EG2 A;  3VU3 C;  2MPX C;  3VS5 A;  2E1H A;  4J9F A;  1BI3 A;  4BDZ A;  4M7A B;  2EJG A;  2NUT B;  2DF6 A;  4D8K A;  3CBM A;  1CKA A;  2VGN A;  4N4H A;  2HAX A;  5KYU A;  4M75 D;  4JDS A;  3OS2 A;  1Q86 C;  3JCM h;  4JJB A;  2I2L A;  1MHN A;  4IUP A;  2EYQ A;  1VQ6 Q;  2DJQ A;  4OB0 B;  4KUI A;  5EC7 A;  5CK9 A;  1NYF A;  1UGQ B;  4PFO A;  4KRT A;  3OY9 A;  3EHQ A;  5ECA A;  3Q1J A;  5FU7 B;  4MZP A;  4M75 B;  3OYL A;  2CSQ A;  2G3R A;  1Q7Y U;  2WSE E;  2CYZ B;  1IHV A;  1VQO Q;  1YJW A;  1EIF A;  2ZPH B;  2YHT A;  2DA9 A;  3P8D A;  1M9S A;  2E6N A;  1M5Q 1;  1SHG A;  3VRY A;  3PTA A;  2KRO A;  2C0I A;  3C95 A;  4M77 F;  3SHW A;  4C8Q D;  1JJ2 S;  4IUV A;  3M0P A;  3TQ7 P;  4JJD A;  2JS0 A;  5GAM h;  3OW2 A;  4M78 C;  1QMC A;  3L1A A;  4LUE A;  1UHC A;  2RI3 A;  4M7D D;  2K5I A;  1YP5 A;  4JJN K;  1VQ7 T;  5KE2 A;  2XMF A;  3L2R A;  5LJ3 h;  4A4K A;  3JCM g;  1XJW B;  4DEX A;  2L89 A;  4JZ3 A;  2E5Q A;  3MKD A;  1VQ7 Q;  1OZ3 A;  5GAN e;  2K3X A;  4BAC A;  3CC7 A;  3PE0 A;  1GBQ A;  2IG0 A;  1NYG A;  2KXD A;  4XK8 E;  3ZL7 C;  2E12 A;  2V8I A;  1JJ2 A;  3RKX A;  2YUO A;  1MNE A;  4WF2 A;  1K9M U;  2COZ A;  1IB8 A;  5GAO p;  4E2F B;  2L3S A;  2DL3 A;  2D6F A;  1NPR A;  1YWO A;  1Y96 B;  2FRW A;  2DL7 A;  2EJF A;  2L2P A;  1WHL A;  3DLL A;  4NS5 A;  1OPK A;  2RO0 A;  1RAB B;  1QW1 A;  1JRI A;  2CUB A;  2NUT A;  4F14 A;  1Q82 C;  2M1H A;  3CPW A;  2DNU A;  5C6S A;  1QWE A;  2BE9 B;  2V1Q A;  2WSF E;  2YWW A;  1AZG B;  4J7I A;  4FW2 A;  2Y90 A;  2QAS A;  3RUX A;  3GBQ A;  4KUD K;  1NZ9 A;  5FW9 A;  1XQH A;  1ZHI A;  4M7D A;  2HQX A;  2DEU A;  2RHZ A;  4L5G A;  2WAC A;  1O9S A;  2HQH A;  3EGX B;  3HTR A;  1BYM A;  2BTT A;  2QQA A;  2DYI A;  1U5S A;  5KYY A;  3MJX A;  1U1S A;  4XU0 A;  1SKU B;  4M78 D;  1UFF A;  3QBY A;  2PTK A;  2LDM A;  2KRS A;  3QSU A;  1TOV A;  1X27 A;  1G2B A;  2RHU A;  3NTH A;  4C8Q B;  2L3R A;  1JBM A;  3OS0 A;  3RMQ A;  5LJ5 e;  2X4J A;  1BCO A;  2CH4 A;  2L3P A;  1VQ4 A;  3HPW A;  3M0U A;  3ER0 A;  3OQ5 A;  5LL6 S;  1MMN A;  2RPN A;  3QG1 A;  1WIE A;  2F5K A;  2HEQ A;  2R5M A;  4FT2 A;  4F7U F;  1GCQ C;  3CCQ Q;  3QZ9 B;  1GBR A;  1G3Y A;  1MMG A;  2IVW A;  3ZFJ A;  2J6K A;  5DLO A;  2DIG A;  3BW1 A;  1I0C A;  1VYU A;  4N4I A;  2DTH A;  2JN0 A;  2CZ0 B;  1JXM A;  1WDX A;  4ZN3 A;  2KRN A;  1TTH B;  1B07 A;  2P84 A;  4RKU E;  4DOV A;  3H9N A;  4AFQ C;  2BKD N;  1TWB A;  4D8D A;  2FZC B;  2VUB A;  3EG0 A;  2MAM A;  2K5F A;  2A3L A;  2JOY A;  1HSQ A;  2E41 A;  5IHN A;  2HBW A;  3GOX A;  2GGR A;  3OYE A;  2WSC E;  3AT1 B;  2BZ8 A;  3CCS Q;  2NUP B;  3OYJ A;  4DEY A;  1AEY A;  3RBB B;  4PNO A;  1M2V A;  2KR3 A;  3L2U A;  2JW4 A;  1OU8 A;  1M2O A;  1KD1 U;  2XK0 A;  1N8R U;  1QVF A;  2OTL Q;  1W2B A;  2QYZ A;  4BB7 A;  1VA7 A;  2KDS A;  3UWN A;  3OYA A;  1HK9 A;  2R5A A;  6AT1 B;  3CCU A;  5FLX E;  4OGC A;  2AKK A;  4V2S A;  1IGU A;  4JJC A;  4ELZ C;  4ZTF A;  1FWZ A;  3MP8 A;  4E7S A;  5CR2 A;  2D8J A;  2DE0 X;  4OVA A;  3S3M A;  2IPO B;  1QVG P;  3S3N A;  1WGS A;  2FO0 A;  1K8A U;  1AT1 B;  1K76 A;  2L3Q A;  1JXO A;  2QAZ A;  4BI4 A;  1WXU A;  2OTL A;  3X24 B;  2K79 A;  1OI1 A;  4CC7 A;  3P8B B;  3EFO B;  1S1N A;  3PVL A;  5DY9 A;  2DO3 A;  1BU1 A;  4E7K A;  2HKN A;  5LJ3 j;  4IIO A;  2RH2 A;  3TSW A;  1MV0 B;  4PJO C;  3D7S B;  5I11 A;  1ZSG A;  4C5H A;  3JCM b;  3M56 A;  1YIT Q;  1YJW Q;  8ATC B;  3VS3 A;  4DQ2 A;  3GP8 A;  2C06 A;  1AWX A;  3UAT A;  4LXC A;  5CQY A;  5CCA A;  2YRC A;  2PVO B;  3M57 A;  2QK0 A;  3VS1 A;  4JZ4 A;  1N6A A;  4HKE A;  3CCJ A;  3G4S A;  4J9I A;  1IRX A;  4C0D C;  3TCJ A;  1PD1 A;  1WJR A;  1WHH A;  2KI7 A;  9ATC B; 
#chains in the Genus database with same CATH homology
 3OYH A;  3MO8 A;  1G3W A;  5LJ5 j;  4M75 F;  3OYB A;  3T9N A;  1WQ7 A;  4DA4 A;  3FJP A;  4LDU A;  1N9R A;  1YHQ T;  1UGP B;  4OGE A;  5CKD A;  3I55 A;  2K2V A;  4B9X A;  4L59 A;  1VQ5 A;  4Q5W A;  1BIA A;  3J81 E;  3CCV A;  1VQ7 A;  1LOJ A;  1N27 A;  2LT1 A;  4RMO A;  3JB9 I;  1YCY A;  4OMF B;  5KE3 A;  3JCM W;  3CC2 A;  4KBM B;  4MZT A;  2VGM A;  4EDU A;  5GAN g;  1G3S A;  4J8O A;  3GLX A;  1VIE A;  3L2Q A;  1Q81 U;  3F70 A;  4M7D C;  3G4S T;  4M7A G;  2RI5 A;  4QQ6 A;  1U1T A;  5GAN d;  3JB9 H;  3J7A F;  4JS5 A;  3JB9 D;  3RKW A;  3CEY A;  4E7H A;  1M4Z A;  3LWH A;  1RI0 A;  5IT9 E;  3JRZ A;  3PGG A;  2RA2 A;  5FU7 C;  4ZGD B;  3EFS A;  3S3O A;  2DVE A;  3CC4 A;  4IUR A;  4C92 F;  4IUQ A;  4E7L A;  5LJ3 f;  4M77 A;  2XD0 A;  3CPW S;  2QTX A;  5GMK j;  4ZTJ A;  2CKK A;  1O75 A;  2KAF A;  4LD6 A;  2OTJ A;  3L42 A;  4PJO E;  2P0P A;  2D9T A;  4FM4 B;  4C0D B;  4PL6 A;  1G3T A;  1U8R A;  1LJO A;  2VC8 A;  4XTZ A;  1FX7 A;  4BY6 C;  3PMI A;  5CKF A;  2LNV A;  3CCR A;  3JB9 F;  5I21 A;  3CCM T;  3MP6 A;  2DXB A;  3OYN A;  1I81 A;  3VUZ A;  5GAM d;  3CCL T;  3E9G A;  2RJE A;  3UPU A;  5D6Y A;  2DZ9 A;  3PMT A;  5CVI A;  1Q82 U;  1VQN T;  2E10 A;  3C94 A;  3CD6 A;  1M8V A;  4M7D E;  4J83 A;  3WXM B;  3CXC S;  3MCA B;  4HCZ A;  2RD1 A;  4XTX A;  3JCM P;  4M78 B;  4ZN1 A;  3L2V A;  1I4K 1;  2FB7 A;  4PJO D;  3MEV A;  4C92 E;  2FVU A;  2VV5 A;  4YTL A;  2V8J A;  2QQR A;  2DK3 A;  2O4X A;  2VXF A;  2XG8 D;  2DAQ A;  2RJD A;  5A0D A;  3H8Z A;  4R56 A;  4II1 A;  3QYH B;  2EQM A;  4J6X A;  4DOW A;  4M7D B;  3X26 B;  2PUO B;  2LT4 A;  5KH6 A;  3BDL A;  1BI1 A;  1ZBX A;  2RJC A;  1V29 B;  2EKO A;  3A8O B;  3QO3 A;  1QP3 A;  2BIV A;  2LCL A;  2AHJ B;  2DXT A;  2LCC A;  2P0K A;  3DB4 A;  3LGL A;  3OBY A;  1VQM A;  3PT9 A;  4QQD A;  3JCM X;  4ATO A;  1VQL A;  5LJ5 f;  3EFR A;  2E64 A;  2X4W A;  2RHX A;  2CGH A;  3A8G B;  3FLG A;  5CIU A;  3VU3 C;  3HP9 A;  4BI8 B;  4C5E A;  5FRN A;  2E1H A;  3CCR T;  3CCV T;  2ZPE B;  1BI3 A;  4BDZ A;  2XI9 A;  4M7A B;  2EJG A;  3BDU A;  4HCC A;  4JLI A;  1XOV A;  3RES A;  3CBM A;  4UC4 A;  4MMK A;  1M1F A;  3DB3 A;  2VGN A;  3OMG A;  4FL6 A;  4N4H A;  3M59 A;  4BY6 B;  5A0L A;  1RL2 A;  2RI2 A;  4M75 D;  3CBP A;  2HAX A;  4JDS A;  2RB6 A;  1D3B B;  4XU2 A;  3OS2 A;  3JCM h;  1Q86 C;  3CMA T;  2E65 A;  4O5V A;  4M7D G;  2DTO A;  5FU6 C;  4CRI A;  2I2L A;  1OZ2 A;  1MHN A;  5CQX A;  1Q81 C;  3G7Z A;  4IUP A;  3PIP A;  3M58 A;  2H3J A;  1Y7X A;  3JCM J;  4M75 A;  1VQO A;  2EYQ A;  4M77 G;  2XIC A;  4OB0 B;  1JB0 E;  3OYF A;  4M77 E;  3HSB A;  2FYK A;  4PJO G;  4KUI A;  2GFA A;  2RJF A;  3V8K A;  2JTM A;  5CK9 A;  1YI2 A;  1Q86 U;  3VUB A;  2DTI A;  2EWN A;  4QVZ A;  1VQ9 A;  1AHJ B;  4OB1 B;  2XID A;  4QQG A;  1UGQ B;  4QVC A;  3HFN A;  3QII A;  4XQ3 A;  1LNX A;  3OY9 A;  1VQL T;  2JUF A;  3GOX A;  5IN1 A;  4JRP A;  3I56 A;  3Q1J A;  5FU7 B;  5LJ3 g;  4MZP A;  1H64 1;  4M75 B;  5GAO r;  4C92 D;  3OYL A;  3AHU A;  1XTD A;  1QVP A;  2G3R A;  1Q7Y U;  2WSE E;  2CYZ B;  2RHI A;  2RM4 A;  4C8Q A;  3CMA A;  2MWP A;  1YJW A;  4XTU A;  1EIF A;  4M7D F;  2HQE A;  4C8Q E;  2GFU A;  2ZPH B;  2YHT A;  3KBG A;  3RMS A;  2HD0 A;  2RK1 A;  2NLU A;  2L5Q A;  2L8D A;  3M55 A;  3CME A;  3A8H B;  4FSX A;  3CCE A;  3P8D A;  1M9S A;  2P4T A;  2E6N A;  1M5Q 1;  4JS4 A;  1G5V A;  3P8H A;  4BD3 A;  3C95 A;  4M77 F;  4XTW A;  3PTA A;  4ME7 A;  2YRV A;  4RG8 A;  4C8Q D;  1JJ2 S;  2M0O A;  4IUV A;  4XU3 A;  5GAM j;  2LRQ A;  4IUT A;  4ZGE B;  1R8O B;  5GAM h;  1YJ9 A;  3GNF B;  1QVG A;  4RG2 A;  3OW2 A;  2GQV A;  4M75 G;  3ZBD A;  4M78 C;  2QI2 A;  3HRT A;  3L1A A;  5FU6 B;  2EJ9 A;  2JVV A;  2RI3 A;  3E9F A;  3R6O A;  4M7D D;  1KHC A;  2LVM A;  2K5I A;  4A4H A;  5A2Q E;  4JJN K;  1VQ7 T;  4Y28 E;  1QP2 A;  5KE2 A;  4M78 F;  3OA6 A;  3CBO A;  4X34 A;  3VYH B;  4C0Z A;  4RCC A;  3L2R A;  4OF1 A;  3DKM A;  4M77 D;  5LJ3 h;  4A4K A;  1X75 C;  2LC4 A;  3JCM g;  4N0A C;  4QVD A;  2HNI A;  1QVF S;  3M4G A;  5D6W A;  3WVE B;  2EQJ A;  3O8V A;  4C8Q C;  2O4X B;  5CKB A;  1YJN A;  2L89 A;  3QYG B;  3OYK A;  3C12 A;  1X6O A;  2VXE A;  5GMK l;  2E5Q A;  4XTY A;  4M75 C;  5GAN 3;  4LDX A;  4A4E A;  1OZ3 A;  3OBW A;  4ELY C;  1KQ2 A;  3FRN A;  5GAN e;  2K3X A;  5FRO A;  4C92 G;  4F7U A;  3JAM E;  4LD9 K;  5EG2 A;  4BAC A;  3M4Y A;  3CC7 A;  4Z02 A;  2IG0 A;  3UT1 A;  4XK8 E;  2E12 A;  2V8I A;  4M78 E;  3RKX A;  1JJ2 A;  2KQW A;  1Y96 A;  3BFM A;  1BI0 A;  2FL7 A;  3OYC A;  4BUG A;  1NJI U;  1VQ9 T;  3OYG A;  3FEO A;  3A8L B;  3RKY A;  5KCO A;  4WF2 A;  1K9M U;  4C8Q G;  2YLB A;  3LYI A;  3LWI A;  2DD5 A;  5GAO p;  3RER A;  5GAN 2;  4JRK A;  1VQN A;  2EQK A;  3HKS A;  3VV0 A;  3CD6 T;  1KG1 A;  2D6F A;  4OP0 A;  1NPR A;  1N9S A;  4X9D A;  1VQ6 A;  1Y96 B;  5GAM e;  5GAO q;  3JCM c;  2EJF A;  4GLK A;  1S72 T;  3WVD B;  3DLL A;  4NS5 A;  3LLR A;  3V8L A;  2RO0 A;  4XAX B;  3V7S A;  1QW1 A;  2DD4 A;  4C5G A;  1JRI A;  2PVD B;  3G6E T;  3QJ6 A;  1M90 C;  4MDX A;  4F7U B;  4BE1 A;  1YJN T;  2MI6 A;  3LH0 A;  5GAO l;  1WNL A;  3KXT A;  1DJ7 B;  4LDY A;  4TVR A;  4XU1 A;  5LJ3 e;  3OYM A;  1Q82 C;  3LW5 E;  2M1H A;  1K73 U;  1D3B A;  1WJS A;  3QUI A;  2DKG A;  3CPW A;  1YIJ T;  5C6S A;  4HA8 A;  4C5I A;  4J6W A;  5L8R E;  1VQM T;  2KSS A;  3EAE A;  2WSF E;  3X20 B;  1Q7Y C;  2MWO A;  3MEW A;  4J7I A;  2Y90 A;  2A7Y A;  4J6Y A;  1VQ4 T;  1I5L A;  2PU9 B;  3RUX A;  3OYI A;  1VQ6 T;  3BY7 A;  1NE8 A;  5KCH A;  4KUD K;  4C8Q F;  1M90 U;  1NZ9 A;  1XQH A;  1ZHI A;  1MGQ A;  3I56 T;  2QQB A;  2HQX A;  2XKO C;  5GAN 5;  4M7D A;  2B8A A;  5A0G A;  2RHZ A;  5GAO n;  3M53 A;  4L5G A;  2WAC A;  1O9S A;  2JNG A;  1VQ8 T;  3CXC A;  2DXC A;  3NTK A;  3UDC A;  5GMK h;  3CCS A;  4E7I A;  5FRM A;  1BYM A;  2XDP A;  5J26 A;  2KVQ G;  2DIQ A;  2QQA A;  3URG A;  1S72 A;  3DLM A;  2R58 A;  2F69 A;  3HHT B;  1U1S A;  4XU0 A;  3JCM e;  3FC3 A;  4M78 D;  2ZPG B;  3TRE A;  3QBY A;  4M75 E;  3G71 T;  4F7U G;  3TEE A;  1VQO T;  2LDM A;  4C92 C;  3CC7 T;  3OYY A;  1VQK T;  1IRE B;  3QSU A;  3GF5 A;  1YI2 T;  1VUB A;  2RHU A;  3NTH A;  2ZCF B;  3QKJ A;  3QJY A;  4C8Q B;  2CZ7 B;  1JBM A;  2L3R A;  4M78 A;  2QDY B;  3OS0 A;  4M77 C;  3RMQ A;  5LJ5 e;  1YIJ A;  1M1K C;  4JRI A;  3VKI A;  4HT8 A;  1ZQ1 A;  2PUK B;  2X4J A;  1H3Z A;  2E70 A;  3LX7 A;  3V7R A;  3OYD A;  2BUD A;  2FHD A;  2EFI A;  5I2M A;  1PSE A;  3PFS A;  4E7J A;  4NOY A;  1VQ4 A;  1P92 A;  3HPW A;  3JSC A;  3ER0 A;  3OQ5 A;  4MZM A;  2E6Z A;  5LL6 S;  5LJ5 d;  5D6X A;  4IKF A;  2ZGW A;  3QG1 A;  4BI3 A;  5GAM f;  3PIO A;  2F5K A;  2K4Y A;  2X4Y A;  2R5M A;  4FT4 A;  2XHC A;  2JZ2 A;  3ZEH A;  4FT2 A;  4O6J A;  4F7U F;  3G6E A;  4A4F A;  2MF2 A;  3J80 E;  1KC8 U;  2DPP B;  3ME9 A;  3QZ9 B;  1GXI E;  1G3Y A;  2IVW A;  2QQS A;  2LQK A;  5M9O A;  3ZFJ A;  4CI0 C;  3KUF A;  5DLO A;  1N8R C;  2QA4 T;  3JCM V;  1IZ6 A;  2DIG A;  5C0M A;  3PNW C;  3RIR A;  1YJ9 T;  3GIB A;  3BW1 A;  5GAN j;  1VQP A;  1X01 A;  3X28 B;  2ZPB B;  2Y4Y A;  5GAN h;  4N4I A;  1BIB A;  2DTH A;  4M7A A;  2JN0 A;  4M78 G;  2CZ0 B;  2HBP A;  3VYG A;  3GPL A;  3CCJ T;  1YIT T;  4C92 B;  4M7A E;  1TH7 A;  4ZN3 A;  3CCQ T;  2X4X A;  3SWN C;  4EMH A;  5GAN 4;  3V7C A;  4QW2 A;  1KQS A;  4RKU E;  1NJI C;  5GAN 8;  4DOV A;  4R55 A;  2BKD N;  1VIF A;  2VUB A;  2PVG B;  2LX9 A;  2MAM A;  3JB9 J;  3FB9 A;  3CCS T;  2EIF A;  4N0A A;  5HK0 A;  1Y71 A;  3CPF A;  4A4G A;  2QEX T;  4BE0 A;  2K5F A;  2V8K A;  2A3L A;  5CKE A;  2QA4 A;  2JOY A;  2E41 A;  1UEB A;  1KD1 C;  1YHQ A;  4PJO A;  3QDR B;  1VQP T;  4JUV A;  4NL2 A;  5CO7 A;  5GAM g;  1B34 A;  1WQW A;  2KMT A;  4LDW A;  5AYF A;  2WSC E;  3JCM f;  3OYE A;  3G71 A;  2OAU A;  2ZPF B;  3E19 A;  3GNG A;  4OB3 B;  1Y07 A;  4EPC A;  1YIT A;  3TU4 K;  4EMK A;  4RCB A;  3VJP A;  3MHX A;  3OYJ A;  4J5Y A;  1K8A C;  1BI2 A;  4PNO A;  4A53 A;  2PQW A;  5I2S A;  4X9C A;  4P5N A;  4XTV A;  3L2U A;  5GAN 7;  3H6Z A;  4KT0 E;  5CAI A;  4PLI A;  5LJ5 h;  2KY9 A;  2LQ8 A;  3JCM d;  2QEX A;  3CC4 T;  2R57 A;  2XDD A;  1KD1 U;  2XK0 A;  5DM7 R;  3ASK A;  1N8R U;  1QVF A;  2O01 E;  2OTJ T;  4EMK C;  4JLG A;  1KQS S;  4M77 B;  1KC8 C;  2QXF A;  3SWN B;  1W2B A;  2XU8 A;  4BB7 A;  2KDS A;  5J3B A;  3UWN A;  4B9W A;  3OYA A;  5GAN f;  1HK9 A;  2R5A A;  3OSS C;  3CCU A;  5HKC A;  5FLX E;  4OGC A;  3OMC A;  2P0Q A;  1I8F A;  2DXU A;  4V2S A;  3HRS A;  3CCL A;  2RK2 A;  4ELZ C;  4ZTF A;  1FWZ A;  5GMK e;  1B34 B;  4OB2 B;  4HCB A;  2M9U A;  4PJO B;  3MP8 A;  2F5T X;  2OTL T;  3E1S A;  3NFC A;  3M9Q A;  3V8J A;  4J7F A;  2ZZD A;  1UGR B;  5J39 A;  4JRQ A;  5GAN 6;  5CR2 A;  3N5B B;  3OS5 A;  1WPY A;  3FIF A;  5IAY A;  2DZC A;  4NL3 A;  4OVA A;  2JTF A;  5CKH A;  3S3M A;  1VQ8 A;  1BKB A;  1FXX A;  1YBY A;  4PKC C;  3M54 A;  4Y91 A;  4C0G A;  2CZ1 B;  2KK4 A;  3QHS A;  1PSF A;  2RHY A;  4N4G A;  4VUB A;  4C92 A;  4EMG A;  5GAO m;  4BE2 A;  3S3N A;  1WGS A;  1K8A U;  1KQ1 A;  3L2Z A;  3A8M B;  4E47 A;  1VQ5 T;  5GMK i;  2GF7 A;  3SFM A;  3CCU T;  4BI4 A;  1W2B S;  3NTI A;  1VQK A;  4D6W A;  2D0Q B;  4GY5 A;  2OTL A;  3X24 B;  1OI1 A;  2X35 A;  3MEU A;  3P8B B;  4M7A F;  3MEA A;  3SWN A;  2M16 A;  2XDB A;  3C4S A;  4PLL A;  1M1K U;  3CME T;  5DY9 A;  2DO3 A;  1NPP A;  4E7K A;  2QQ9 A;  3OSV A;  4LDV A;  5LJ3 j;  2RH2 A;  2MMP A;  4PJO C;  2DJZ A;  1W4S A;  2DEQ A;  1QVG S;  5LJ5 g;  1K73 C;  4C5H A;  3OW2 S;  3OB9 A;  4FU6 A;  4ZGJ B;  1SSF A;  4MML A;  3JCM b;  3M56 A;  1M1G A;  3MP1 A;  3SDZ A;  1XNI A;  1OYX A;  1HXD A;  4PJO F;  3QXE B;  2GCX A;  2ZPI B;  4DQ2 A;  4F7U E;  3GP8 A;  4M7A D;  2LTO A;  5HK3 A;  2K57 A;  4IUU A;  2C06 A;  3JB9 G;  3A5Z B;  2K3Y A;  3INZ A;  4L6V 5;  1KHI A;  3M5A A;  5CQY A;  5DLQ E;  5HY6 A;  4C0F A;  3FDR A;  1UB4 A;  3CCM A;  5CCA A;  5LJ3 d;  3I55 T;  3HFO A;  3QPH A;  3L2W A;  2PVO B;  2CS7 A;  3SB2 A;  3M57 A;  4BDY A;  3CCE T;  4FIB A;  3OS1 A;  3MET A;  1WJQ A;  2VYT A;  3X25 B;  1N6A A;  4EMK B;  3S6W A;  1YJW T;  4HKE A;  3CC2 T;  4KUL A;  2EQU A;  3QZ5 B;  2YLC A;  3LGF A;  1UGS B;  1K9M C;  3CCJ A;  3CCQ A;  3G4S A;  3SD4 A;  4C0D C;  4MDW A;  3TCJ A;  2EAY A;  2CZ6 B;  1WJR A;  4A54 A;  3HRU A;  5GMK m;  4M7A C;  2Y4X A;  4HT9 A;  2K5L A;  3HL8 A;  3JCM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...