2DO9A

Solution structure of the pyrin/paad-dapin domain in mouse nalp10 (nacht, leucine rich repeat and pyd containing 10)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
115
structure length
115
Chain Sequence
GSSGSSGMALARANSPQEALLWALNDLEENSFKTLKFHLRDVTQFHLARGELESLSQVDLASKLISMYGAQEAVRVVSRSLLAMNLMELVDYLNQVCLNDYREIYREHVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Pyrin/PAAD-DAPIN domain in mouse NALP10 (NACHT, leucine rich repeat and PYD containing 10)
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords NACHT-, LRR- and PYD-containing protein 10
total genus 22
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2do9A01
1Z6TA 1PN5A 4F42A 3YGSP 1A1ZA 4A2WA 2P1HA 1D2ZA 2KN6A 4E9MA 2F1SA 2YU0A 2YGSA 1FADA 1DGNA 2A5YB 4LWDA 2N7ZA 4EWIA 4RHWA 4A2QA 3QF2A 1N3KA 2A9IA 3MOPA 2N00A 2MB9A 2NAQA 1CWWA 3MOPG 4M9ZA 1YGOA 1E41A 3CRDA 2GF5A 2N97A 4M9XA 1WH4A 3YGSC 2NZ7A 4JQWA 4P4HA 1WXPA 2MPCA 2BBRA 2LWEA 2D96A 2OF5A 4IZ5E 2DO9A 4F44A 3LQQA 4I16A 4IZ7B 2IB1A 3MOPK 4UZ0A 2KM6A 4ZBWA 2BBZA 2O71A 2OF5H 2YQFA 4JUPA 2M5VA 4O9FA 4N1JA 3EZQB 3LQRA 2LS7A 2MS8A 1DDFA 2L9MA 3CL3A 4N1KA 1NGRA 4DWNA 2LWDA 2N1FA 4FH0A 2L6AA 3T6PA 3J6JA 4N1LA 4NQKA 4QOBA 4IZAB 4P4HI 2B1WA 2NSNA 3J63A 2DBHA 2MN4A 2VGQA 1D2ZB 4O7QA 1UCPA 4M9SA 4RHWE 1WMGA 1E3YA 2HM2Q 1C15A 2N80A 4D8OA 2DBFA 3KATA 2DBDA 2YVIA 4O9LA 2MS7A 1ICHA 1A1WA 4O6XA 3EZQA 2N83A 1CY5A 2DBGA 2G7RA
chains in the Genus database with same CATH superfamily
1Z6TA 1PN5A 4F42A 3YGSP 1A1ZA 2XV9A 4A2WA 2P1HA 1D2ZA 2KN6A 4E9MA 2F1SA 2YU0A 2YGSA 1FADA 1DGNA 2A5YB 4LWDA 2N7ZA 4EWIA 4RHWA 4A2QA 3QF2A 1N3KA 2A9IA 3MOPA 2N00A 2MB9A 2NAQA 1CWWA 3MOPG 4M9ZA 1YGOA 1E41A 3CRDA 2GF5A 2N97A 4M9XA 1WH4A 3YGSC 2NZ7A 4JQWA 4P4HA 1WXPA 2MPCA 2BBRA 2LWEA 2D96A 2OF5A 4IZ5E 2DO9A 4F44A 3LQQA 4I16A 4IZ7B 2IB1A 3MOPK 4UZ0A 2KM6A 4ZBWA 2BBZA 2O71A 2OF5H 2YQFA 4JUPA 2M5VA 4O9FA 4N1JA 3EZQB 3LQRA 2LS7A 2MS8A 1DDFA 2L9MA 3CL3A 4N1KA 1NGRA 4DWNA 2LWDA 2N1FA 4FH0A 2L6AA 3T6PA 3J6JA 4N1LA 4NQKA 4QOBA 4IZAB 4P4HI 2B1WA 2NSNA 3J63A 2DBHA 2MN4A 2VGQA 1D2ZB 4O7QA 1UCPA 4M9SA 4RHWE 1WMGA 1E3YA 2HM2Q 1C15A 2N80A 4D8OA 2DBFA 3KATA 2DBDA 2YVIA 4O9LA 2MS7A 1ICHA 1A1WA 4O6XA 3EZQA 2MJMA 2N83A 1CY5A 2DBGA 2G7RA
chains in the Genus database with same CATH topology
1Z6TA 1PN5A 4F42A 3YGSP 1A1ZA 2XV9A 4A2WA 2P1HA 1D2ZA 2KN6A 4E9MA 2F1SA 2YU0A 2YGSA 1FADA 1DGNA 2A5YB 4LWDA 2N7ZA 4EWIA 4RHWA 4A2QA 3QF2A 1N3KA 2A9IA 3MOPA 2N00A 2MB9A 2NAQA 1CWWA 3MOPG 4M9ZA 1YGOA 1E41A 3CRDA 2GF5A 2N97A 4M9XA 1WH4A 3YGSC 2NZ7A 4JQWA 4P4HA 1WXPA 2MPCA 2BBRA 2LWEA 2D96A 2OF5A 4IZ5E 2DO9A 4F44A 3LQQA 4I16A 4IZ7B 2IB1A 3MOPK 4UZ0A 2KM6A 4ZBWA 2BBZA 2O71A 2OF5H 2YQFA 4JUPA 2M5VA 4O9FA 4N1JA 3EZQB 3LQRA 2LS7A 2MS8A 1DDFA 2L9MA 3CL3A 4N1KA 1NGRA 4DWNA 2LWDA 2N1FA 4FH0A 2L6AA 3T6PA 3J6JA 4N1LA 4NQKA 4QOBA 4IZAB 4P4HI 2B1WA 2NSNA 3J63A 2DBHA 2MN4A 2VGQA 1D2ZB 4O7QA 1UCPA 4M9SA 4RHWE 1WMGA 1E3YA 2HM2Q 1C15A 2N80A 4D8OA 2DBFA 3KATA 2DBDA 2YVIA 4O9LA 2MS7A 1ICHA 1A1WA 4O6XA 3EZQA 2MJMA 2N83A 1CY5A 2DBGA 2G7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6T A;  1PN5 A;  4F42 A;  3YGS P;  1A1Z A;  4A2W A;  2P1H A;  1D2Z A;  2KN6 A;  4E9M A;  2F1S A;  2YU0 A;  2YGS A;  1FAD A;  1DGN A;  2A5Y B;  4LWD A;  2N7Z A;  4EWI A;  4RHW A;  4A2Q A;  3QF2 A;  1N3K A;  2A9I A;  3MOP A;  2N00 A;  2MB9 A;  2NAQ A;  1CWW A;  3MOP G;  4M9Z A;  1YGO A;  1E41 A;  3CRD A;  2GF5 A;  2N97 A;  4M9X A;  1WH4 A;  3YGS C;  2NZ7 A;  4JQW A;  4P4H A;  1WXP A;  2MPC A;  2BBR A;  2LWE A;  2D96 A;  2OF5 A;  4IZ5 E;  2DO9 A;  4F44 A;  3LQQ A;  4I16 A;  4IZ7 B;  2IB1 A;  3MOP K;  4UZ0 A;  2KM6 A;  4ZBW A;  2BBZ A;  2O71 A;  2OF5 H;  2YQF A;  4JUP A;  2M5V A;  4O9F A;  4N1J A;  3EZQ B;  3LQR A;  2LS7 A;  2MS8 A;  1DDF A;  2L9M A;  3CL3 A;  4N1K A;  1NGR A;  4DWN A;  2LWD A;  2N1F A;  4FH0 A;  2L6A A;  3T6P A;  3J6J A;  4N1L A;  4NQK A;  4QOB A;  4IZA B;  4P4H I;  2B1W A;  2NSN A;  3J63 A;  2DBH A;  2MN4 A;  2VGQ A;  1D2Z B;  4O7Q A;  1UCP A;  4M9S A;  4RHW E;  1WMG A;  1E3Y A;  2HM2 Q;  1C15 A;  2N80 A;  4D8O A;  2DBF A;  3KAT A;  2DBD A;  2YVI A;  4O9L A;  2MS7 A;  1ICH A;  1A1W A;  4O6X A;  3EZQ A;  2N83 A;  1CY5 A;  2DBG A;  2G7R A; 
#chains in the Genus database with same CATH topology
 1Z6T A;  1PN5 A;  4F42 A;  3YGS P;  1A1Z A;  2XV9 A;  4A2W A;  2P1H A;  1D2Z A;  2KN6 A;  4E9M A;  2F1S A;  2YU0 A;  2YGS A;  1FAD A;  1DGN A;  2A5Y B;  4LWD A;  2N7Z A;  4EWI A;  4RHW A;  4A2Q A;  3QF2 A;  1N3K A;  2A9I A;  3MOP A;  2N00 A;  2MB9 A;  2NAQ A;  1CWW A;  3MOP G;  4M9Z A;  1YGO A;  1E41 A;  3CRD A;  2GF5 A;  2N97 A;  4M9X A;  1WH4 A;  3YGS C;  2NZ7 A;  4JQW A;  4P4H A;  1WXP A;  2MPC A;  2BBR A;  2LWE A;  2D96 A;  2OF5 A;  4IZ5 E;  2DO9 A;  4F44 A;  3LQQ A;  4I16 A;  4IZ7 B;  2IB1 A;  3MOP K;  4UZ0 A;  2KM6 A;  4ZBW A;  2BBZ A;  2O71 A;  2OF5 H;  2YQF A;  4JUP A;  2M5V A;  4O9F A;  4N1J A;  3EZQ B;  3LQR A;  2LS7 A;  2MS8 A;  1DDF A;  2L9M A;  3CL3 A;  4N1K A;  1NGR A;  4DWN A;  2LWD A;  2N1F A;  4FH0 A;  2L6A A;  3T6P A;  3J6J A;  4N1L A;  4NQK A;  4QOB A;  4IZA B;  4P4H I;  2B1W A;  2NSN A;  3J63 A;  2DBH A;  2MN4 A;  2VGQ A;  1D2Z B;  4O7Q A;  1UCP A;  4M9S A;  4RHW E;  1WMG A;  1E3Y A;  2HM2 Q;  1C15 A;  2N80 A;  4D8O A;  2DBF A;  3KAT A;  2DBD A;  2YVI A;  4O9L A;  2MS7 A;  1ICH A;  1A1W A;  4O6X A;  3EZQ A;  2MJM A;  2N83 A;  1CY5 A;  2DBG A;  2G7R A; 
#chains in the Genus database with same CATH homology
 1Z6T A;  1PN5 A;  4F42 A;  3YGS P;  1A1Z A;  2XV9 A;  4A2W A;  2P1H A;  1D2Z A;  2KN6 A;  4E9M A;  2F1S A;  2YU0 A;  2YGS A;  1FAD A;  1DGN A;  2A5Y B;  4LWD A;  2N7Z A;  4EWI A;  4RHW A;  4A2Q A;  3QF2 A;  1N3K A;  2A9I A;  3MOP A;  2N00 A;  2MB9 A;  2NAQ A;  1CWW A;  3MOP G;  4M9Z A;  1YGO A;  1E41 A;  3CRD A;  2GF5 A;  2N97 A;  4M9X A;  1WH4 A;  3YGS C;  2NZ7 A;  4JQW A;  4P4H A;  1WXP A;  2MPC A;  2BBR A;  2LWE A;  2D96 A;  2OF5 A;  4IZ5 E;  2DO9 A;  4F44 A;  3LQQ A;  4I16 A;  4IZ7 B;  2IB1 A;  3MOP K;  4UZ0 A;  2KM6 A;  4ZBW A;  2BBZ A;  2O71 A;  2OF5 H;  2YQF A;  4JUP A;  2M5V A;  4O9F A;  4N1J A;  3EZQ B;  3LQR A;  2LS7 A;  2MS8 A;  1DDF A;  2L9M A;  3CL3 A;  4N1K A;  1NGR A;  4DWN A;  2LWD A;  2N1F A;  4FH0 A;  2L6A A;  3T6P A;  3J6J A;  4N1L A;  4NQK A;  4QOB A;  4IZA B;  4P4H I;  2B1W A;  2NSN A;  3J63 A;  2DBH A;  2MN4 A;  2VGQ A;  1D2Z B;  4O7Q A;  1UCP A;  4M9S A;  4RHW E;  1WMG A;  1E3Y A;  2HM2 Q;  1C15 A;  2N80 A;  4D8O A;  2DBF A;  3KAT A;  2DBD A;  2YVI A;  4O9L A;  2MS7 A;  1ICH A;  1A1W A;  4O6X A;  3EZQ A;  2MJM A;  2N83 A;  1CY5 A;  2DBG A;  2G7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...