2DOCA

Solution structure of the fibronectin type-iii domain of human neural cell adhesion molecule 2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
GSSGSSGQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Fibronectin type-III domain of human Neural cell adhesion molecule 2
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Neural cell adhesion molecule 2
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2docA01
2WWKO 1WV7T 4NGHL 3MV9E 4OB5L 2F53B 2M26A 4XHJC 2IALB 5DVKA 2NXZB 1G7LA 1NMAL 4E5XB 5IGXL 3RI5K 1CVSC 1MFBL 5EOTB 3T1WA 5EULV 1NEZB 1NFDA 3BJLA 4OCLC 1Q9LB 4XI5C 4YFLF 3EOAA 3ARED 2AEQL 2AQ3A 3M45A 3CXDL 3CPLA 5GIRA 4AMKL 3C5ZB 1IAIH 4NUGH 5T1LB 3M07A 3RX8A 1TVBB 3SJVB 2Y72A 2EC9U 5L6YH 4N68A 3VXSA 1PX3A 1KEGL 3O3DB 4AG4H 4H8WH 5DQJB 3OR6B 3HE6C 4MNQD 3PIQB 3ZMRA 1TTGA 4PLJC 3U36A 2YRZA 5L8JB 3BIAX 4S11A 3OKNB 5CBEA 3PXJA 5KZCB 1XFPA 4HJJL 5C8JB 4FQXB 5I15L 3MV9D 1E4XH 3K80A 3MNZB 1GGCH 3GRWL 4I48A 4M00A 5SWSD 2DKMA 2IQAB 2YD6A 2GJ6B 2ARWA 1XF5A 3QUXC 3LRSA 5C86A 5KSBB 4L1DA 4ERSL 4MNQA 2NY2B 4OF6A 1YMMD 5D1ZD 4YH6A 2HKHH 4KMLB 2EDWA 4RAUB 3H3PH 5E5MA 2X4NA 2F8OA 4R96B 4H8WL 5KVFH 2HRPL 5CBEB 1KJ2H 1DQJA 3DUHA 2KZWA 3ETBF 3TO4B 5I66B 1P6FA 3L9RB 5HHOA 2ICWJ 5DO2C 5ECJE 1A7QH 4Z5RA 3OHXA 2GEEA 4MAYD 3H0TA 3PIQA 5DGRA 5FF6A 2HJFA 1AJ7L 4U1NA 3VFUA 5GRWA 1EFXD 4X5LA 4MAUH 5ALBL 3SDAD 1N0LA 4TNWK 4PJGA 4FQXD 1IGFL 3Q2CA 4KRMB 4PJCE 1P4LA 1XF1A 4PJBB 3REWB 3W0WA 5I1EH 3TBTA 4LLDB 1KTRL 5IF0A 1PVHA 2PW2A 5F1NA 5AG8A 5CEZE 1TZIB 5SWZB 3MUY1 3RGVA 1A2YB 2GFBB 5GRJL 2W65B 1OCWL 5BRZB 3MNZA 4HK0A 3UYRH 2A74A 1FORL 4I5BA 1QLRB 4FRWA 5KSVA 1LMKA 3S35X 5HI4C 4EKXA 1RZKL 2UUDH 2IPTL 5MEPA 3AGVA 3EJYD 1Z2KA 1IC5H 2XTLA 4MQTB 4OKDA 3VE0A 3PDOB 4L4TE 3OKDA 4N5UA 3ROLB 1OHQA 4IMLA 4RNRA 3RWJA 5A40E 1VFUA 2F9BT 3QH3B 2YD3A 3B83A 3LEVL 5F7MC 1JGLH 1INEH 1WFNA 3TCLB 1T83A 2NZ9D 4XZUA 3SE9L 3VFNB 3DUUA 1NUGA 3LOWA 1QA9A 1SM3L 2W65A 1FRGH 4LIQL 4CMMA 4YE4H 2EO9A 2D7TL 1VSCA 5BO1H 3ELAT 3LEVH 5T5NF 5DJCA 2C4FT 3OXSA 1YNLH 5T3XE 4E41A 3QDGA 4PUBL 4M7JL 5D7LD 5ESAA 4O2CA 1CGTA 4YXHH 3NGBC 4XMKL 1NCDH 1CFVL 4HKXA 4K8RC 3OG6B 4QO1A 5CJ5A 2Y5EA 4Q9RL 4PGBB 3BP6B 3BD5A 5D96C 2BHZA 4XCYA 4YDKL 4NZRL 4HH9A 2YA0A 3ZYJA 5D9SB 3MCG1 2AW2A 2R0ZH 4JHAH 1QFWH 5CJQH 3V79C 3AVEA 3QWQB 3SDCD 1HXMB 3A6BH 5DJZA 2VXQL 1D5IL 5DD3H 3B8YA 1CZ8L 1Q9KA 4KVCH 5TDPB 4FXGA 5C0IA 3VXQA 1SBSH 4R8WH 4DGYL 5B4MC 1LEGA 4L4VB 2DYPD 4HWBL 4TRPH 5IFHL 4HPOL 1G6RA 1TPXB 2R9HD 1E6JH 3LQAC 4NPYB 5E8NA 4N0RA 4RAUA 1QEWB 1LP9E 2HMIC 4AT6A 2A6IB 3W5MA 2IGFH 2ARJB 1QSEB 3CDFA 4UQ2A 4GW5B 4LSPH 2R0WH 4AH2B 4Y1AD 2ATPB 4KXZI 4LSQH 2WBJD 1SJEB 3WIFB 4L3AA 3NN8B 1F90L 2DQEH 4PGBA 4JY6B 3KNBA 4TPRH 1NMBL 1YC7A 4XXCC 3U0PA 1NBZA 3QXAB 5I75C 1NQBA 3AUVA 1I75A 4XBGB 1JPGB 5IHUH 3TFKC 4GBXD 4M6AA 1WC7A 3FFCB 4QRRD 3BX7C 1L9MA 3KDMB 4F7CA 4F2MB 3QIBB 1B2WL 3RI5F 1TJHH 3VI3F 1X5FA 3KPOA 4ODHL 1I9JL 1MPAH 3QP3A 2EH7H 2PTVA 5F88B 4RIRA 1ZSDA 3LKNA 4X5XB 3FAWA 3O3UN 4IDJH 4LSTL 4LNVA 2ZPKL 1KB5L 3C5ZD 3HZKB 1OGAD 5JQ6H 3ULVF 3GMRB 5IB3B 3TN0C 4ELME 4S1SH 3GRWA 3DI2B 4QOKE 3PP3H 1OGAE 1K4DB 1U93B 4OJFL 4DFIA 3IXTB 1RZKC 3ULVH 2BVOB 3BN9C 4JZOA 5IFAL 1K6QL 1T2QH 4NC0B 4Y4KA 1OTTD 2HH0H 5D6CA 5BRZD 5FB8B 2ZSWB 3I6KB 4TUOB 1IC4H 2W0KA 1U8QB 4QRRE 1SY6L 3GUTA 1P4BH 3RNKA 3MRNB 5D93B 1RU9L 1WBXB 1LE5B 3REVB 1OAKH 4U3XA 2NY3B 2LQRA 3UTTB 1F00I 3GHBH 5H2BA 2RB8A 3MV8A 2VR5A 5DD1L 4J3TA 1AGFA 3F7RA 3OAZK 4Y19E 4X7DC 3AREB 1JYVA 1WT5A 1CZ8H 2O61A 2QSQA 2J8UE 3UO1H 1ZANL 3CCHA 1PKQA 4JQVA 4NN7B 3HNTH 4NUJA 5K93A 1X6NA 5E5UB 3ULVC 1BFVH 2FEDD 4DKAA 2P5EA 2DI8A 4XT1C 3GSNB 4HZLB 5GRUL 1IILE 2ADFL 2VLME 4MA7L 6FABL 4YK4B 1A7PH 3TBVB 3EJYC 4OCXH 3FFDB 4KKLC 2YC1A 1VADB 4IRZL 4ZPTA 3EHBD 1O0VA 1F4XL 4NKIL 2R23A 3VFOA 2EKSA 1RUAL 3THMH 3MV9B 1ORSB 2QTEA 3DMMC 1ZVSB 5MI0B 1A9BB 4DJMA 3TT1L 1N2RB 3DSFL 5HGBB 5A2JH 4HFUL 1IT9L 1PYWB 2JJSA 3BGMB 4Y4KD 1YY9C 4L4TA 5C8JA 4H5SA 1L9NA 3QXTA 2BHYA 2N1KA 4EVNA 1EHAA 3KPRE 1NC2D 4KHTH 1BEYH 4JFFD 4PGDA 4QRUB 2DM2A 1HKLL 4PRIB 4MAYB 4MDIA 4BH8B 2B2XH 4UMGA 5DHYB 3HMWL 3BOVA 2XN9A 4GJTB 3QIUD 3CLEL 3MNWB 1U3HB 3F5WB 1R3JA 4X6DF 1LEIB 5I0DA 4YGVB 1Q72L 3U2SA 4EXPX 1BQHB 2LVEA 2WIIB 2V5TA 2QSCH 4LVHC 1H3GA 1IGJB 5DJ0B 4F8TA 4G7YL 4DZ8B 4IOIB 3O2DA 4TVPL 5F6HJ 4WWKB 2HAZA 3CSBA 5IMMA 5HDOA 3ZLQC 4ZO6A 2XQYG 3R1GH 1BJ8A 5E95B 4MQXC 4JRYA 1OM3H 3GIZH 3UC0L 5C6TH 3CSYB 2BVOA 4OJFH 3MROA 4XCEB 4OD2A 5IP4A 4OZFG 2GAZB 4KQ4L 3MA9H 3FT3A 1C12A 2Z93A 2H9GA 3UPAA 4HXBH 4XTRD 3S6CA 5F44A 1NBVH 3BZ4A 4PGJA 3BESR 1ZGLB 2X41A 1ZT4B 2IH1B 3GKWH 5H37H 4HLZH 3DPBA 1NL0L 4KTYA 4M7KH 1I7UA 1M71B 4NQTA 2PO6C 3FCTA 5FA4B 5I1IH 4LSVH 2PXYA 5GGVH 2GTWA 4OLYL 5FV2A 5CILL 3UROR 5I30L 3LY6A 1AO7D 4AIZA 5E4IA 1YEJL 4LAJH 1BIIB 2Y1VA 2MSPA 1H8OA 3U0WL 2BHUA 2X4QA 5I1KL 3QJFB 4QRQB 1P69B 1JK8B 1N8ZA 1CDBA 1GC1L 2DIAA 1DSFL 3AY4A 1KJ3H 5B3JE 4LLUB 4RDQF 2GY5A 3QHFH 3QQ9D 5I9QB 3FONA 3MRIA 1I4FB 4WVRA 3WFCL 4B7IA 3QIBD 1BOGB 4OZHF 4XNMB 1WTGT 3BO8A 1C5CL 4PB9H 2A9MH 3ZKMD 4M1GH 3MBXH 2VKXA 3ILQC 2OJZH 3EDFA 1WWWX 4FOMA 3G6JA 3PF2A 2DBLL 4KTDL 3H9HB 2ICCA 3A0OA 2EIZB 3NFSL 4L8DB 5HGHA 1A7BA 3WFDL 4Y4KC 4WW1B 5T1KA 4MJID 2PXYC 2QBWA 1QLEH 1TVBA 4JPKL 1CWVA 1XF4A 4FQ2L 4DVRL 3NZ8A 4TOYL 4XVSH 4R7DB 4LCYA 5FCUL 1OW0A 1ZLVK 3NIGE 4HEME 4Y5XA 4ZFGH 4JFFE 4M43H 2ADJB 5MP6H 3LPWA 3CU7A 1WWAX 3DGCR 1F13A 4DVRH 3KR3L 2FGWH 3FFCD 1KJMB 5DZNA 3L7FB 5EC2B 5CIPB 5K9KA 4X6DA 3LD8C 1AGDA 1A64A 1JN6B 4AH2A 1CTOA 3K81A 1ZHKA 5DJ8A 3VG0L 3FT4A 5FHAL 1NAKH 1MCLA 1RJCA 4Z7VB 4KPHH 5KOMC 3E2HB 1D6EB 3TBTB 1I3VA 4HS3A 2CUIA 1N64H 4OCWH 5FAAA 4XGZA 4K7PL 1NMAH 2AKRB 3AAZA 3LHPL 4HK0B 5HHOB 1OT1A 1MVUB 4UNUA 1MCWW 3JV4A 1D5XA 1UJ3C 1YYLH 4LPUA 3O4OB 1CS6A 3KYNB 4G6KL 3LKRA 4CW1A 4UB0L 4XPFH 5J89A 1RZ7L 4PJBA 3REWA 4X7CC 1I1FA 1KIRB 4P2OC 3W39B 4C58B 5CEZD 5DEFB 5HD8C 1LO4H 1CF8L 4EUPB 4WHDA 1W0YT 1A2YA 1INDH 2I9LB 1KTKE 3QDMA 5DEZA 1YYMH 5ACLA 5BXFB 5FO8B 1ZA6A 4TSAH 1ES0A 4JDTL 5ICXA 5E8PA 1Y0LA 4NNPL 1CD8A 4WV1A 1S7WB 3AAZB 4JLRB 4ZXBC 4K7PH 4M7LH 2X4SB 3Q5YA 3MRMB 4KKNA 4PRHB 1MI5E 3IRZA 1MHHB 3MGTB 5D2LF 5FYKH 3MXVL 3QIUB 4UOW0 4F3FB 4PJ7A 5SWSA 2B0SL 5HI3D 1HDMA 1DL7H 4JN1H 2HYMA 5EO0A 1CU4L 3ARGD 3L3JB 3NACH 3VGBA 3KPLB 5GGSA 1EXUB 2GUOB 4JKLA 1NANI 4APQC 1GRWA 2YK1L 4NRYA 2YPVL 2M8XA 4OGZA 3MPCA 4YQXL 3CMGA 1QFWI 1KXTB 5T1KB 1ZOXA 2ZNWA 4OGXH 4GW1A 4EDWH 1U9KA 1DLHA 5LGKA 4M6MH 3EOYG 4NQED 3TBVA 3RVVD 2AABH 4XP5L 4KRPB 1OP5H 3B9KD 4MSWA 4PJ7B 5IIEA 1AD0A 2AXHA 4XNYH 2D03H 3L3DB 3S4SG 3TV3H 4GAYB 3VFPB 1HKLH 1MHHA 3ECBA 4JB9L 2AJXH 4AT6B 4L9DA 4X6EA 4Q74A 1AGCA 4MD5A 2YD4A 4QRRA 2XZZA 5L8KB 3QDME 3QO0B 2CRMA 4X9FA 5F71A 2DLGA 1XGQB 3C6LA 4Y5YA 1A7NL 5DJXA 5GRYA 5JUEL 3V6FB 3H3BC 4FQLH 1ADQL 2QQNH 1P7QA 1ED3B 4GT7A 4DUVA 3QDGD 2PYFB 2YD1A 5JDJA 5A3ID 5IQ7H 3VW3H 1D9KC 4JY5L 4YHPB 4GKOA 4PY8I 3R1GL 3EDJA 5J13B 1W0WB 2LFGA 3DROA 5EZJB 4MNGE 4D3CL 1YY8A 3ZKSD 3IDIB 1FYTD 1P6AB 2PW1A 3MJ9H 4A6YB 2CKBB 3RTQA 1RZIB 4M8QB 4U7KA 5JDSB 1DQLH 1MNUH 3MLPA 4Z7UE 1D6VL 1KCSL 1KN4L 1KELL 4K55A 4MSWB 2Z8WC 4CL7A 5IIEB 2MPAL 1B90A 5JLZA 3MOBH 1CI5A 2ITDB 4FP8L 4WFHD 4BSWB 4RMSA 4DEPB 2X4RB 1CFNA 3MV7B 1G0XA 1KIRA 3V4UH 5C0JB 3U79A 4X9HA 7CGTA 3RA7H 1MHPL 2CO6B 4MQ7A 2W9LA 1XR9A 3OKYA 4JRYB 4JZOB 3WKNA 4GH7B 5EUOE 2BSRA 4QNPE 4PJAE 1K85A 4RIRB 4DN4L 3MFFA 5E99H 3VFTA 2LE9A 1VFAA 1J8KA 4OLZH 1RUPH 4HK3N 3V95A 1OAKL 3OX8A 5EOTA 2Q76A 1GIGH 4XP6H 3MLVL 5E24E 4TTDC 1JHTA 2VTFA 3R0MA 2ZP0T 1HQRB 2PCPA 2F5AH 3KPTA 3QQ4B 4D2NA 4WI6A 4M6OH 2J12B 1MIEL 5EU6B 1CK0L 3VGEA 5I8CB 2BXZA 4JFEB 5L7XL 1AXSA 2HVKB 2DICA 2B0SH 5TPWH 3ARGC 4RGOL 4NHCH 1LK3L 1MCPL 4KK5C 5EIQA 1TNNA 4LLYA 5ID0A 5JHLH 1E4XI 2YUWA 2GUOA 1OPGH 3P11L 1FG9C 2R0LH 5IOPA 5ISZA 1A1OB 4NN7C 1MWAB 3OAUL 3N1PC 3HFML 4DN3H 1MJ8H 3BWAB 4JY4B 4BZ2L 3QUMB 4NQVB 4RX4A 4EQ2A 1VGKA 2DQUL 2NX5B 5ANMB 1D5ZA 1KN4H 3FONB 4KJWD 3AMKA 4XNXH 3RZCB 1B2WH 1CXFA 4LCWD 5KVGH 1FL3B 4GBXA 2WLYA 4QHMA 4NQCB 5D2LE 5C0BB 4LAQL 1RURH 3I50H 1NDGA 4P46D 1RUAH 12E8H 1QSFA 3L9RA 4X7EC 3KPMB 3FFDA 4LVNB 4HF5H 4PJHF 1S7XB 4DW2H 3DYPA 4AIXA 3BHBA 4M03A 2NY2D 1KIPB 2EKSB 3LQZA 4JDZA 1U95B 4XP4L 1U8JB 5HPMA 1FBIH 3H7BB 3HRPA 5M95B 3CK0H 1S9WB 2I9TB 4NFDA 5A2LH 5HVFB 2OR7A 3KPSE 4FQCL 2UZIH 1V3LA 2QQLH 1RK0A 2AERT 4JM2C 1FL6B 2F54B 1RJZB 5BS0B 1UCBH 2IH3B 1D6VH 2ENYA 4DZBA 4ONFH 1NAMH 3T65A 5C0BE 4ZS7L 3LSOB 4F8QA 3VE0B 2YOCA 1S7XA 3G6JF 3LV3A 2NY0C 1FL5A 1MCKA 5IKCA 4ORGA 3B9DA 2CIIA 4MXWL 3MROB 3MLRH 4JGUA 2CK0L 2XZQL 4PJGF 4ELKA 5DJ0A 1TXKA 4WY7L 2NW2A 1TJGH 2L7JA 1DL7L 4JN1L 3HCVA 4QF1A 5HHVH 3T2QA 1JF6A 5AD0A 5HPMB 4KQ3L 3MTRA 2F54A 1CICD 1UH4A 3WJJA 4BFEA 2W9DL 3KPRA 3L6FB 1TPXC 1L0XA 3G5XA 3DVNA 4Q9BA 2G60L 1MFAH 1T21A 1XF3B 3MRCA 4PJDA 2OL3L 3QI9C 2GFBA 5I1AB 2X9YA 4D9LL 3KLHC 4JKMA 3JUYA 4S1DD 2I9LA 1F4AA 3NCBB 5I71C 2WP3T 3I2CH 3T65B 5D7SL 3EYUH 2G5BB 4MD0A 4KY1H 4WUUB 3WS3A 1G7JA 4I9WE 3VGDA 1JCKA 1KJVA 1XGPB 2R15A 4L4TD 2VDPL 4I13B 4LPVA 2HN7B 4K3HA 1MIML 4BQBA 5D72L 5DJZB 3RUGE 3GMPB 2BNQE 1BAFL 2AJZA 1TZGL 1BBJA 4QHUB 4XAWH 3IDMB 1E4WH 2DM3A 3C8KB 1MLCB 5GRJH 3RKDD 5ITFA 1I85C 2GK2A 5T1KD 4XCYB 5JNYB 3FN9A 4DUWA 4XB7A 5EIIA 5F9OL 2VDOH 1I9RH 4LIQE 2RHEA 1G9MH 4YDLC 1J9CT 4XWOD 3NAAL 2HFEB 1ZGLP 3MREB 4U2ZA 3SOBL 1SJEA 1JI2A 1XGTA 5FM4A 5DT1H 4LQFL 3S9DB 2BDNH 2ICWA 2CGRH 2HN7A 1ZTXL 2NMSA 5TDPA 4Y4HB 3GHEL 4KK6D 4RAHA 4X6BB 5JPNA 4LVOB 1D5BB 1R3HB 5FECA 2NZIA 1V7MH 3U4BH 4UUJA 1FLTX 2FSEA 4MJ5A 2P47B 2H2SD 2AVGA 2BC4B 3QDJB 3O0RH 2AJUH 3BPLB 4MJ6A 3DURB 1MFEL 2VLJB 4WNQA 2FH8A 2NXYD 4F7MB 4GKSA 2YK1H 5GSVB 4D8PB 1FG2B 5D5ME 1WGOA 5GS1A 1WCQA 5FYJH 2FJGA 3GRWH 5HHPB 1NDGB 3HI1A 3OF6D 1NCAH 3WXVL 1I7ZA 2AV1A 4DEPC 1GCFA 3UTSB 4PG9B 3C6SB 3L7EA 3ARVA 5LCVL 2LAGB 2A77H 1F3JB 2DRUA 4QOKA 4OUOA 4EI5B 4JFDB 4CVZA 1NCBH 5F9WB 1RIHH 2ZOLA 2CR6A 4RCAA 3B9EA 4NKMA 1AO7E 4KJQC 5TQ0H 3UMTA 4LARL 3TZVA 4O51A 2OJEB 1KNOB 3JVGA 2Q7NA 4XCFL 3WNNA 5IJKC 5K59F 4UTAH 1IAIL 4WNQB 2YMXH 3MA7B 3C9NB 2PW1B 3GI8H 2D0FA 3MCKB 4Z77A 2ZWLT 7FABH 3DXAD 4ZFOB 5ACZA 5CJXC 2EDTA 1ITBB 4M62L 2MTPA 1LILA 4Y5VC 2XA3A 5C9JB 2R2CA 3HE6D 4P9MH 4KJYB 3RVXD 4F7MA 3H9YA 4F7TB 4WY7H 5LWYH 3QUXB 4D9RE 5KTEL 1A6ZA 3QIBA 5IUSA 1P84J 2HFFB 1FO0L 4M9PA 5BXFA 5ILTH 1CDGA 1RUQH 5B39B 4FTVB 1P9MA 1QHOA 3D39B 2FD6H 5DVNA 1Y6KR 4FG6D 1JTPA 3O4LA 4O9HH 2HFGH 4Y16C 1Q72H 3QUZC 4IMKC 3VXSD 3DRQB 5LWYL 3U4AA 1YEDB 5DJ6A 3C60C 1TDQA 2FJFA 3EGSB 3G5ZB 4PD4K 4L8BB 2R4SH 3UO1L 4QNPF 1CLCA 1AHWC 2IWGA 3QEHA 4KDTC 1EHLH 3LZFH 2GYSA 2XT1B 3TWCL 3ULUL 3OHXB 3RKDC 1SYSA 3DWTA 4I0CC 4L8SB 5CP3A 2WUBH 2PYEE 1NBVL 5DRNA 2XA8H 2BDNL 2NY0D 3I9GH 4F7PB 5HHOD 5E5RB 3I6KA 2HP4A 3FOMB 4GXVH 3WUZA 5FYLE 4OLWL 1QRKA 2GSIB 5I9QC 1G9ML 4PJHA 2DWEA 5ALCL 3QIUC 5MEOA 4S1DC 3EW3B 3W9DA 1KLUB 1NFDF 5HGDB 1WSST 5D2NA 1MWAA 3ZDXE 4YAQB 3WNOA 2WINA 1X5HA 3GM0A 5IFAH 2FD6L 1L7IL 2AGJH 5IHLB 4X8XA 3EYOB 1CL7H 1PZ5A 4HKZB 1YEDA 2Z0BA 4NO5A 2Z35A 1HK6A 2XI9A 3VI4F 1UM6L 2HTKC 3IYLW 1G0DA 1CICC 5KVGL 3QXDA 4LPCA 5LXGH 5D7KD 2IADA 2A6DB 2DTMH 3K8LA 3WIHL 1KB5H 4QEGA 4DTGH 1BEYL 4JFDE 3RIFF 2ILLA 1UB6A 1TCMA 3OKMB 1JGDB 1RVFH 2AJVL 1X5YA 4UIMA 2YC1B 3NTCL 4OIIL 2JK5B 3LIZL 5DC9B 3BP5A 1WIOA 4UIKL 1JWSA 4PRID 2J1KA 4NJAH 3ULUF 4IRJD 1MCFA 4OCYL 4J8RB 1FSKB 4QHKJ 4ENED 4JG1H 3IJHB 5DMGD 5LJYH 5JHDB 4GQ9L 2JCCA 5HGDA 5INDA 5A2KH 4QCIB 4EIGB 5F9JB 1N2RA 5EU4B 4DKFL 3SDYH 3HZYA 3OJDA 3KLAB 3QFJB 4XP9H 4F9LA 5TGBB 5JXAH 1YEIH 4XMPL 3NIFF 1GIGL 2DJ4A 4XP6L 3BISA 5MERB 5C0JA 3QXDB 4JPWL 5HI5D 1YC8A 4HCRL 3QBTB 3DROB 2CLVA 3VH8G 3ZHLA 2IAMB 1CD1A 4PJXF 4D0CA 3S88H 3HR5A 1BIIA 1G0YR 1JNHB 3RL1A 4HUUA 5ID1B 4R0LC 4O2FB 4LSTH 1CIUA 1F02I 1K3IA 1YQVL 1GZPB 4ZPVA 3NBNA 3FN0L 4FQCH 5FKPB 1A5FH 3CFIC 3DRQA 4TSCH 3WNLA 3X17A 1UA6H 3VFWA 1M7IA 1Q9OB 4GKNA 2VYRE 2VLKB 2XQBL 2E7LC 1H0DA 4C56B 4X5WB 4FQIL 1D5MA 1I3GL 2FB4L 3CSYA 4XCEA 4OZGB 1F4XH 4OZFB 3KLAA 5DRNB 3EFDH 5ICYA 5ERWB 5HJ3A 2H1PH 3MRLB 2V2WA 5F1IB 4EI6B 4MCZB 2X09A 3CLFL 5E2TL 1BX2B 1R3IH 3DV4B 3CGTA 5EDXA 3FO0H 2I5YL 4NO0D 4RBPK 2ITCA 3QUMH 2GTZB 3C5SA 4HWUA 4CBPA 5DHVB 4JM4H 1MUJB 2N56A 5EUOB 3O3BA 2B1HH 1F6AB 1TENA 4TULL 1IBGH 1AY1L 3UBXA 2V5YA 2OM5A 5FFLA 3T3ME 1IT9H 2YRPA 2G60H 5C0BA 2F15A 3IXTA 1EO8L 1KCVL 1OPGL 4ZUUA 3MOBL 5FO7A 4OZGF 4K94C 4V1DE 4ZUWB 1D5ZB 2R2HB 2C3VB 2ITCB 2V2WB 4FG6C 1ZK9A 2EE2A 4WTZA 3QUKB 4Y16D 3LVEA 5EOCH 1ZHNB 1RHHB 4MA7H 1J11A 3SKJH 3N06B 3RVVC 3VWKC 5SV4A 4PJ8D 1NGPL 1HSBB 5EUKA 3RGHA 5K9OA 2R1WB 5E99L 2VDMH 5DI8B 4H0HB 4YPGA 1E6OH 1GC1C 5TF0A 4Z7NE 1MJ8L 3MJ6A 1I1FB 4K94H 1IFHH 3VWJD 2J8HA 3MRJA 4Y5XC 3H7BA 3VXMA 2I24N 4M4RA 2H9GB 2IAMA 1OTTC 4POZC 3V7MA 4WFFE 1SQ2N 5JHLL 3F7YB 2APVA 5BVPH 4NHUA 3IETB 2X4PB 4TTDD 1SVCP 2Y5TA 1MY5A 4OSUL 4ZPVB 5C70A 4U1IA 1I7UB 3VI3E 3BUYB 4PJ9D 1LO4L 4PJIA 4TSBH 3HE6B 3MRPB 2UUDK 4CW1B 1QR4A 3FT4B 2NY3D 3C9NA 1EA9C 4UOJA 1NCWL 3RRQA 5L0QB 2PYEA 3GB7A 3WIHA 4PRDB 4EBQH 1D6EA 4WFED 4LU5H 4W6WB 1TETH 5DUBA 1JF5A 2CJUL 2NR6D 5AZEL 5CJ8A 5BV7H 4R4FL 5ETUB 1O7VA 2J6EL 4WFEE 1JUFB 4U1HA 3ROOB 4OLXH 1FPTL 4OZ4A 3HLAA 4NUGL 2VL5A 4UDTB 4HPYH 2CR3A 5LGHH 1UVQA 1JPSH 2P5WE 3GIVB 5D1QA 1E4KC 3QWRD 4GRWB 3G04B 3SKNA 3U7WL 5CD5D 4O02L 2UVFA 2AXGB 1CXEA 3TVMB 1ONQB 3I3DA 3P4LA 2P5WD 3N9GH 4WW2F 1I1AD 4K71B 4L9LC 3LN5B 1XGUB 4X99B 3IDGB 5J12B 4PJ9B 4FP8H 3QA3A 3CFJB 4QXGH 5JHDD 1VHPA 4QHUA 2LU3A 1JHLL 5EUOA 1GAFL 8FABA 2FGWL 4OQTL 1EBPA 1KFAL 4ZAKD 4CVXB 3TNMB 3L3JA 4MJIE 1IZKA 4ZDHA 4OZIE 1J87A 2EDXA 1MREH 4K23H 3H9HA 3T0VA 3MSPA 2GI7A 4YXHL 4U6HA 2NTFB 3V5HB 3VH8A 2CLRA 3C2AH 5CSZA 2B1AL 3MO1A 2DMBA 3HAEA 4NOFA 5B39G 3NIDE 3MJGX 1CLZH 1C16A 1HDMB 1T0NB 2O93L 1LO2H 4M6NL 4PJ9A 1FV1B 1HNFA 1CQYA 3NTCH 5DT1L 4YHOH 5I6XC 1FFOB 2X4UB 1OSZA 3CXHJ 3OXRA 1I8LA 5F3HA 1AXTL 4K3JH 4LDOB 4GG8B 5TQ0L 4JB9H 4MNGB 5E9DA 3NH7L 3PV6A 4AIZB 3QWOB 5C07D 2XV6B 5HVGB 4BSVB 2XZQH 3AS1A 3PHOB 5LCVH 3LKPA 1WTLA 3CAFA 4W68A 3FO2A 1RUKL 3BMVA 4HS3B 2ED9A 2IBGA 1KBGL 2R56H 1BD2A 1TVHA 1CFNB 1U8PB 1PGRB 3FZUD 3N50A 1A4KA 3NCJL 1R5WB 2FCBA 5D71H 4PV8A 4P2QB 3ZTJG 1OSZB 4JFED 1RUKH 5JORB 2EDLA 1I7RB 1EHNA 4G8GE 1LNUB 1RZIA 4CJ0A 4MD5B 3F65A 1BM3L 2NQCA 4YLQT 3BKJH 1ZHBB 5E9DB 2V2XA 4S1QH 5EZLA 3IJSA 4NM8L 1PD6A 4HSQA 2EDFA 3S3PA 4XCFH 1CE1H 5KJRH 3W81A 2EDOA 1A02N 1HE7A 1C7SA 4NWUL 3EOTH 1J0HA 3GNMH 2XNAB 2B7DT 1FP5A 1T2JA 3DGGA 3V6ZA 2P45B 4U0RB 2VLJE 5EO1A 4HS8L 4RRPA 4Q6IC 4L4VD 3KDMA 4RFNC 4F7CB 3KAAA 4HQQH 3EZJB 2W0LA 1HHGB 3V5DB 1PEZA 4ACPA 1XCQB 5C6PB 3HMXH 2KDGA 3DX8A 3ALXA 2H8PA 3KPOB 2MQ3A 3PWPA 1S9VA 5IMLB 2DD8H 2QV2A 1U8NA 2XZAL 3UYRL 5JOPE 1ZLWH 1EGJA 2F53D 1GGYA 4PB0H 5IEKB 5D7LE 3PV7A 4M43L 3EO0B 5DEGA 4UINH 1FJ1A 5AUMB 4ZS6C 4X6CF 3VXNA 1I7RA 1LNUA 4ZMAT 4PJDE 3BJ91 2KZ1B 1VGKB 4NO2B 2D0GA 2EXWC 3HZKA 4C56A 4JN2B 4PYGA 3TA3D 4RZCB 3ET9F 3LB6D 4UILL 1EIBA 1VFAB 3WFDH 4NRYB 3EJJX 2WP3O 4UU9A 1Z3GH 4M4PA 4HS8H 1S7UB 5D2LB 2N7BA 3INUL 1UKTA 2QHRH 3ZDZE 3TO2A 1AXTH 2YSSA 3EO9L 3VJ6A 1CGWA 2FATL 5HYSB 4FQHA 4MCZA 5AYUL 1CE6A 1C5CH 5L7XH 5IW1B 4CMHC 2GTZA 2HKFH 2YZ1A 3EYOA 4GFTB 2YA1A 4PJEF 3GJFA 3AREA 4ZQKA 4PYHA 4RAVA 4LU5L 3UX9B 4U1JB 3L5XH 1FZOB 1EUTA 1WZ1L 1S7UA 3PQYE 5E70A 1MREL 1F3DH 2APXA 1G6RL 4ODVL 1KJ2A 2RIKA 1QACA 5KVDL 3HB3C 4LVHB 1ED3A 1P7QB 2P8PA 4HZLA 3GSNA 4FQ1H 3K1KC 3KWWB 4I2XB 1PKQB 3U9PH 3C6LD 2E8YA 3V4PH 5DYOB 1IEAB 2NY5H 2BNQA 2RCSL 3HC0B 1FNSL 2HLAB 3MFGB 1BQLH 1TMCB 1E4KA 4F58H 1AR2A 4YDVB 3J8F7 2ZZUT 5DJDB 2Z31A 1UH3A 4PR5B 3V8CA 2YEZB 2B1HL 5INDB 4MVBC 2WIMA 5HHNB 5J1AA 3SDAB 2HJLA 1JPSL 4XP1L 2Q20A 3X13B 3BQUB 4R26L 5DJAA 4CDGC 4HJGA 4KDWA 1YPZA 3QEGL 4OIAA 3QFJA 4ZAKC 1X4XA 4X7SH 2DL2A 2O5XH 5C2BL 3H9SA 2NW3B 4QXUL 1I1YB 4IOFC 3MLRL 2J88L 1NH6A 2Q87A 4MA3B 3THML 1FFPB 1KJ3L 4S0TD 4EVNB 1M05B 3DX7A 3S96B 3QEUA 3NIGF 2Q8BH 1MRDH 3MUHL 4X7SL 4U05A 3P4NA 1QRND 3DTXB 1QG3A 5E7FA 4MCYA 5GS0H 5D1XA 2Z31B 5C2UB 1GL4B 4Z7NF 3WE6A 5L2KD 4FQ2H 1JMXA 1DFBL 1JYNA 4B41A 1PZUB 3I75B 4GOSA 3SDAA 5J1AB 1NKRA 5IQ9B 2IG2H 5JPMB 1MJ7L 3ULUE 2AV7B 4YFDB 2SEBA 5DXWA 3MNWA 3TIEB 4JFQA 2R9HC 4YDVA 3HMWH 3NH7H 1JWMB 4KTDH 1B9ZA 3LMJL 5IR1A 5GPRA 1BJMA 4PBWD 4O4YL 1QSED 2G9HA 4RA3A 5MENA 1DVFC 5D2NC 3FB6B 3NFPA 3ULUC 4IRJA 3VRJB 1QRNA 2ZSVB 4NT6A 3PJSA 5GZOC 4E5XA 3TT3H 1K4CB 4LASL 3B9KC 3IFPA 4CMHB 3TPKA 4RMRA 1CFQB 1FZMA 1UKSA 3QUYC 5AWNL 1H0DB 1I8KB 2X70A 4ODXA 3L5IA 4YXKL 3RZCA 3GM8A 2OX5A 2ZCKH 5T5NG 4NQEB 1BP3B 1PJ9A 1UZ8A 4G9FA 4P2QD 5DK0B 1RUPL 4E42B 3SDCB 2A73A 1S9YB 4U1KB 3HPLA 2UY7A 1JHKH 1WISA 2Q3ZA 1JHLH 2KPNA 1FH5L 3BP6A 4Z7VE 1I3UA 1EAJA 1T0MA 2GTWB 3SDDC 4ZTOL 1Z0MA 5EU6E 1R3KB 4Y16A 4PTUB 1MRFH 3PL6A 5IFJA 4O00A 1FN4B 4MWFB 4WTXA 4X80L 2DIJA 3ARFC 1MCPH 4ODUA 5EU7E 2P8LA 3L3GA 1DFBH 4FZEH 4FQ1L 2AJ3B 2VN4A 3HAEB 2NYYC 3GJEB 4HS6B 2PO6B 1ZLSL 2AK1H 3G6AA 3EHBC 5D7JC 4X9BA 1FNFA 4EOWL 3QDJD 4PJAF 5F96H 3C09C 1PQZB 3D39E 3IFOA 4RFNB 2NCMA 4OM0L 2YUXA 1E27B 4U1MB 4PREB 3WUWB 3DBXA 4G6KH 4HUWB 3UPCA 4XC3L 3X13A 3C08L 4PRIE 2NY7H 4PJEB 4P59L 1UM4L 3VMOA 1NUDA 2IMNA 4L3EA 5DI8A 4OI8A 4PRAB 4YHMH 2R0WL 2FR4B 1Q38A 3VXTB 5IKCB 2EDRA 4ORGB 5CEXA 2CD0A 1C1EL 5HDLA 1RZFH 2VUYA 4G80B 4GS7B 4PBVC 2Y07L 3QEUB 2C26A 2XFXA 4ONHA 3BMWA 3EAKA 1PQZA 3VG0H 1SBSL 2VIRB 3FKUS 4R8WL 5ANME 3RZCD 3CNKA 1TZHB 4S2SB 4OF8A 4J6RL 1P5UA 5DMGC 3NVQA 4K07A 3C6SA 3L7EB 3PWPE 4AQOA 4GMTL 3QCVL 4HULB 1NLBL 5EZLB 5DQ9A 1W0VB 3U46B 1ZE3C 1T22B 1RZKH 1EVUA 1KF9B 3C2SA 4F33B 3O6KH 4UNTA 2VZTA 2ZCLL 3H2WA 2NPLX 3GGWA 1JBJA 1ZA3A 5C0AD 3GSVB 1QSEE 4KJPD 4MX7B 5JUEH 1VDGA 5FDYA 1SEBB 4KROB 1K6QH 1T2QL 3KYAA 3SCMD 1PFCA 5I8KH 2OI9B 4PJ7F 3MOQA 4KXZH 3NOIA 4JRXB 4XBEL 4G8GA 5L2JA 1EUUA 1CXLA 4N0UA 1ITCA 4NJAL 1F8TL 4N0CD 1ZLUK 3QAZC 2R2BB 1Q0XL 3IS1X 4R6UA 1IGCH 3MV8B 1JF1B 1WFUA 3VG9B 2YPKA 4F7PA 1A3RL 5SWQB 2OQJA 2C7UA 2I26N 2GQHA 2PTUA 3BPLC 5FYJE 4PJ8A 1KLGA 1EAPA 4HAGA 5CJQL 1UXWB 4TVPE 3BKYH 2OK0H 5E2UH 1HNGA 1ZHLA 4WEBH 3BP7A 1HXMA 3T0XA 2FJFB 3L5XL 3MRGA 5DK2B 1PG7W 4NKDB 4Y4HC 5D7LB 4JY5H 1FNGB 1MJUL 2F5BH 3D87B 5CFHA 4JKWA 3RDTB 5HXMA 4ZTPH 3G9AB 4X7TB 3CPLB 5GIRB 3VXMD 2EDDA 1YJDL 1N6QL 1UJ3A 1FL3A 4OFVA 3MRBA 3MYJA 4NQSB 2D3VA 2WUCL 2FX8L 5DQJA 2IAMD 4KROC 3FN3A 3DVNB 4O58L 2XN9D 3T0WA 1E6JL 5D2NE 1VKXA 2QHRL 2P5WB 1U2CA 3GMLA 4HG4K 4AJ0A 5JW4M 3L3OA 5EO0B 3MA9L 4ZFFB 4ZOAA 3O2WL 4K7PX 3NABL 1IAOB 3TH3T 1G1YA 3KPLA 1AI1H 1IGIH 4H5SB 5CEXB 3U7AA 1DVFA 3LN4A 2DOCA 3LKSB 3MUGA 4M93B 2P46B 3S88L 2LAAA 4AEHL 5F7HA 4ERSH 3PP4H 4P9HL 2DQDH 4X4YB 4PV8B 4NKDA 4KZEL 1FNGA 4NZTL 4NZRH 3ABZA 3ARTA 3WIFA 4MS8C 4N9OB 3DVIA 5FM5O 4YR6B 4IRSB 1MJUH 1TZGH 3U2SB 3GEWB 3QIBC 2VDRL 4U6TA 3FQUB 4MXVE 1RJZA 4YZFF 4BFGA 2DQEL 4ORZC 2C5DC 4ZUSA 4Z7WE 2BERA 4AEFA 2Y25A 4QXTA 5I0ZA 3ARDB 2ZUQC 2I25N 1S9XA 3LHPH 5AZ2H 5B8CA 3Q6FB 2CMRL 3QJHA 4GKNB 3RVWD 1A1MA 3TBSA 3A67H 4OIBA 5D7SH 4LLDA 2F58L 5IJKA 3D3VB 4MYWB 1XGQA 3UTSE 4M1GL 2GSGA 1NFKA 2DDQL 4X6BA 1ZT7A 3VXUA 4PJ5B 1IJ9A 3PWVB 4LVNC 1W72L 4ZO8A 4F57L 2M1KA 3BKJL 4QTHB 4HKBB 2EYTA 1G84A 4HC1H 4TN9A 1U2HA 4P49A 1A14L 4JRYD 4U6VL 3LPGA 4HUNB 5I8KL 5MERA 2EO1A 3QEQE 5GRXG 1A8JH 1WZMA 2VNCA 3DETC 4KGJA 1ZLWK 3HE7B 5I8EA 4JDVA 4Q6YA 4PB0L 5CZVL 3VXPA 1Q94A 1JV5B 2WM0A 1HHJA 4LVEA 4ZUSB 5GSRB 4FZ8L 1PSKL 1U8HA 4BK5A 5IVZA 2G9HB 5E9DD 5EWIL 4JAMA 5J7CC 1DANT 3WS3B 4L29A 3HI5L 3PP4L 3F58L 2D7QA 2ICES 2FBJH 3EO0A 1KIUA 1CLYL 5DJCB 5J11C 2BVTA 2Z8SA 2BSRB 4P57A 4TULH 3EYSL 4X98B 4NIKB 1N59A 4WDIB 5E56A 1JGEA 3VMNA 3RDTA 2IJ0C 2MOVA 1F6AA 3CFEB 4BK4A 5HVWA 4O2CB 2ESVD 4KRNA 3QRFM 3BRFA 3MRBB 2X2YA 4JFEA 5I76B 3LS5H 2W0FA 3MRRB 5F7WC 3IFNL 1DE4A 1OAQH 5ID0B 3NA9L 5I8EB 2CKNA 3D9AL 1GC1H 1XH3B 2DS4A 3B5GA 2MCPL 4TVPD 2X4TA 3X3GH 4NQCD 4KUCF 4ISVB 2MQCA 4N0FA 4ZFFA 4WU5A 5T3ZD 4XCNA 3GSNL 5FUOH 1I7TB 1KBGH 4EDXB 4KFZC 3IAPA 4QHLB 5JOFA 2NNAB 3FT2A 4OFDA 3TNNA 2AXFA 2JJTC 4PGCA 4ZD3H 1MFEH 2VB5A 4L4VA 3EGSA 4MB3A 1TZIA 4NQUA 4LKXA 4W6XB 2IAMC 3QXWA 1IQWH 1MVFA 5KS9E 2X10A 4YR6A 2DQUH 4XNUL 3VD9A 1U0QA 1QFHA 2OJZL 5CMAB 1TFHA 2AV1B 5FK9A 4D0DB 1F4WH 5JOEA 2BOCA 1PY4A 4NOBA 1AGDB 1JN6A 2DDQH 1U58B 1IC1A 5D1XD 4N8CH 3JV0A 3WHXA 1EGJH 5FGSA 5JOFB 4H88L 1JNHA 2P24B 1A3QA 3QNYA 4R96A 2AXFB 1D9KB 1A3LL 1HH9B 3OGCB 4XMLH 2A6KB 4U49A 2Z93B 3BFOA 4LCWB 1F90H 3GSRA 3E8UL 4C57C 1A47A 5I1KH 3DSNA 1Y6NR 1XF2A 3JWDC 1QBAA 2EIBA 1Q1JL 2NW3A 5B38G 5FHBH 4MXWH 1I3GH 3S4SB 5C0ND 1URLA 4M1CC 5J4MA 1RURL 1BWWA 3SE8H 5IVXB 4QXGL 2P4AB 2UWEA 4G6ML 2FLRT 3QPQC 3RQ3A 4OD2B 3Q6GL 1MFDL 5C0DB 8FABB 1KYOJ 3KYMA 4XNZB 4FMFA 1KB9K 1NGYA 4CVXA 4HBQA 4KUZH 3HG1B 1MCBA 2E7HA 3UPRB 4AMKH 1GOFA 3FMGL 2Y07H 3LH2L 1SJHB 4HX1A 4I4WA 3IVKB 1JGVL 4R4FH 1HH9A 1DQQB 3OGCA 2JELL 4RGOH 3CFJA 1Q1JH 3UTTE 3C5ZC 1AQKH 1UYWH 2EXYC 1BOGA 4XNMA 2XXCB 4WJ5A 4KRLB 1FIGH 4F3FA 4I0PD 4P5TB 4PRBB 3PWJB 2XOTA 3WBDA 2VL5B 4YXLL 5EOQL 5GHWL 4YPJA 3GIVA 2NXZC 1N8ZB 3P3YA 1BQUA 5FXCH 3B9KB 3IFNH 5H94B 2ERJC 4LASH 1B4JH 5TE4H 4JR9L 2O5XL 5C2BH 1J8HE 2PTTA 5HGHB 5JQHC 3MRIB 3KYMB 4R7NB 3S5LB 3OJ2C 1QQDB 4LCCC 4GMTH 2W60B 4HUVA 4E42A 1NBYB 3WMSA 3O6ML 2XPGB 5C3LD 3VRLE 5INCB 3GJEA 2LV4A 1DBJH 2VR4A 4POUB 1QFUH 4FFWC 1U8PA 3DHMA 5LXGL 4JHAL 3QUML 3EZ8A 2PUQT 1FBIL 2P5EE 5FKAA 5J0BA 4BJLA 1D5MB 4K3GA 1GXEA 3CU1A 5J9PA 2EH8H 4BSVA 3UJJH 1V7NL 3O41B 4FABH 3OKLA 5DUPH 5GGUB 1NGZB 4K8RH 1B0WA 4ALAH 1C16B 5IG7B 4P4RA 3BGAA 2UYLB 3L3OB 1QQDA 5GZND 1TVHB 12E8L 3D39D 3HB3D 3OZ9L 1BFTA 4G6FD 2XPGA 3L3IA 5D7IE 4PBXA 1BOYA 4P2QA 3CFKB 3MRFB 3VA2C 2ENSA 3WUWA 2P49B 3QDAA 3QWOA 1CLOH 4IHOA 1JPST 5IT2H 3QNXB 5IB4A 2C4XA 2NY1C 4H20H 5DC4B 2IPKB 2ZSWA 2FHFA 3CC5B 4BKLB 3BW9A 2N4IA 2V5SA 2WIIA 4XH2A 2FR4A 1I7ZB 3G5YA 4PY8J 2C1OB 4DN3L 1YDPB 3DOSA 4RBPH 3U46A 4DZ8A 5IEKA 3BE1L 4MAYC 1G7IA 3VXNB 1FDLL 1ZV5A 3BH9B 4LSSH 2OZ4A 4DVBB 2AABL 1FH5H 4LRIC 3HI1B 4JDTH 4FFZL 3RWCA 2VLRE 1T7XA 2DQGH 4ZO9A 2X7LB 1L7IH 1AE6H 2AGJL 1INDL 5HDQH 4Z78B 3KPPB 2EKJA 5T3ZL 2NY1B 3ULUD 4OLVL 5FYLH 3TVMA 5IWLA 3OKOB 4NRXA 4UINL 1IC7H 3GMRA 1JZ2A 1RHFA 2DQDL 3UXFA 2XZAH 4XBGA 3UTQA 2DB8A 5I1CH 5SV3A 5DFTA 4M1DH 4N0UB 2VDLH 2Q76B 1H5BB 3I50L 2HT3D 1G7MB 3FQXB 4FFWD 4F2MA 3QPQD 5SWSB 3D69B 2XYCA 3U1SL 4BKLA 2A6JA 3O2VL 4F9PC 3SDDD 2VWEE 4OZHE 5J1SC 1G9EA 5JR1L 2FATH 2AS5M 4JGMA 5F9AC 3MRKA 2R8SL 3TC9A 2KH2B 3MRJB 5IVZB 1BFSA 4F7TA 1YUHA 1ZWIA 3U9UA 4GXUN 1N26A 1QPPA 4ODSL 3JWDH 5CBAB 3TO4D 5BRZA 5FM5M 5JTWA 4OB5H 5EBLA 1J5OH 5ESQA 2R2BA 1MCWM 4KGLA 5IW1A 4FXKB 3ZL4L 4Z9KB 2A38A 4OCNC 1NSNL 3TJHD 1I4FA 3DUSB 5FB8A 1NC4A 4MA1C 5C09E 3ZE0E 4BZ1H 5FA3B 5DJ6B 1B0GA 2V7HB 3CFBB 3WD5L 3G08B 4P46A 4F9PA 5CEYB 3O3EB 2W0FB 1J1XH 3E6HA 4ONGH 3BEWA 5J9PB 3QO1B 3ZDZF 3UTZB 3DUUB 1NGXB 5F97E 2P5ED 2R2EB 4HT1L 2R4RH 3C6LB 4Y5YB 2F19L 2VLRA 1T1ZA 2BSTA 5E8OB 1R24A 3G04A 3NPSB 2Q6WA 1WBYB 1IQDA 1A6WL 5HI4D 1KC5L 3OPZH 4XPGL 5KSAA 4E41B 4GRLA 3A67L 1S78C 4F58L 4LHJB 5ITBL 1I3RA 5FGCB 1QFWL 4P5MA 5KN5A 1IC5L 2X1WL 2ED8A 2IG2L 1A6VH 3B2VL 3KS0J 3WFBH 4K7FA 2UWEF 4YPGB 4KHXL 1S7QA 4M7LT 4ONGL 1GGIL 5KS9A 2KKQA 4PLOB 2DLFL 2R2EA 2C1PA 1NFIB 4OZHB 2F8VA 4R4BB 3F5WA 1R3JB 4P9ML 1ND0B 4TUJB 4YO0A 3E1F1 4AEHH 5DRWA 5GS2D 5FOBB 4P23A 1CN4A 2DD8L 5KSAB 4NYLB 5D1ZC 2F54E 4KKBC 1FQ9C 3HC3L 3CFCH 1G9NC 2WAHA 4PP1D 2A83B 4TQEL 5LAXA 1K5NB 1CFTA 4BA8A 5ITBH 1RZGA 3ARWA 4DK3A 4XVTL 5IB1B 1FJ1B 2ZOKA 4M7KL 5FYKL 2JKXA 4K3JL 5JXED 3ME0A 1N3NB 3HTLX 3QZWB 5F70A 3KLHD 1BQLL 4JDVB 2Q8AL 3D69A 1FPTH 5GGTA 1C08B 1MAMH 2DL9A 1H3VA 2PXYD 4JG0H 4XPTH 4Z76A 4XP5H 1EO5A 4NM4H 2DQFB 2FWOB 4WI3A 1U8MB 2VDLL 3BD4A 1WUNT 3OB0K 4FQJL 4PY7A 5EO9A 1E4XL 5ELIA 4YNYA 4Y2DB 1G6RH 4JLRA 4LEXH 1BIHA 4TUKL 5CBAA 3QDGB 4NQXA 2AJSL 1M7IB 1Q9OA 2X05A 2JJTA 4JZNB 4FQJH 2OTPA 1K5NA 2DN7A 1TVDA 4MXQC 5KW9H 4LVOC 1WK0A 1AI1L 4KKLD 2BNRE 4U1JA 1TQBB 3DO3A 3N9GL 2OLDA 1K4CA 4Q9QH 1MFAL 1K3ZA 1V3KA 4RDQG 1NANH 1YNTB 4XC1L 3FZUC 5DDHB 3AM8C 5T1MA 3V6ZB 3SDXF 3V52H 2ORBH 1KTLA 1FC1A 5FA4A 3TP4A 4QYOB 2HKHL 2E8ZA 1PX4A 1A1NA 1HILA 5FHAH 1LO2L 1F11B 1NUNB 5KG9B 4WU5B 3FB7B 4JFEE 1CLOL 1NGPH 5BQ7A 3N1FC 1G7LB 1FV1A 4G8FB 4BFIB 1NEZA 5I76A 2VAAA 3KR3H 3TPUA 3L5JA 1FYHB 4JHBA 2KUTA 3WLBB 1FNAA 4PREA 3LRGA 1DUZB 3QULA 5DD6A 2O26U 4Y89A 3U0TA 2BX5A 4YHYC 3O0RL 3SY0A 2A9NL 3BSZH 3T0EC 5DFVD 3QCVH 4KROD 1QD0A 3DMMD 3ORJA 3GSQA 1LO5B 6FABH 4GKSB 5GSVA 4FZEL 1XF4B 3VMPA 4D8PA 2HVJB 3L3GB 1MHEB 4ZNEE 1KCRL 1M05A 3PWUA 4J3VA 1KENH 2PO6A 2RQ8A 4Y5XB 3RA7L 4JDZB 3FFCA 5D93C 1YNTA 5HY9A 4CNIB 5HSFA 5D1QC 4YHNB 3CXDH 3WO4B 2JB5H 1DZBA 3CZJA 3S34L 2L4OA 4LSRH 3BVNB 4JFYA 4U0QB 1HILB 3PWPD 4NWUH 4AENA 1A6WH 1EERB 1QBLL 5FYKD 1Y0LB 3EDEA 2VDQL 4ZPTB 5SWZD 1JPTH 4JGJA 1AH1A 5CP7A 1PBYA 3TEUA 4ZSOB 4NGHH 3RPIA 4LBEA 1B4JL 5CZXC 5TE4L 3MACH 3MLZL 2DWDA 1N0XL 4LNRB 2ZCLH 3FB5A 4XPHH 4H1LG 1PG7H 3CX2A 5MP6L 5CJBA 3RDTD 4DGVL 3TFKD 3O9WD 5F7KC 3VXMB 2ZUWA 4EIZC 4BZ1L 4JQIL 3WFEH 3BZDA 1GHFL 2DQJL 3QG6B 3RY5A 3T3PE 4P3WA 4JRYE 2QSCL 3BI9X 3SGEI 5FYLD 3ZL4H 1CCZA 1OLLA 1CFQA 3H9SE 4FFVD 3GBMH 3LEXA 1FFNB 1MRFL 1JFQL 4NP4H 1K2DB 4LBEB 1V3JA 2F53E 3BQUD 4YIQB 1OAZL 4KV5F 3QQ9C 4XP4H 3ZE0F 5I1AA 5T3XL 1KPVB 3QH3A 1J1OH 4WHCA 4DW2L 1CR9H 1EHXA 2A0LD 2F19H 5DRXA 1WCBB 3MJ8A 4QGYA 2AK4D 5GJSH 3D0VA 43CAB 2FECL 5I6XB 5AWNH 1Q0YL 1TETL 2HRLA 3WN5C 4DCQB 5TFSH 3OXSB 1P4IL 1BQHG 1JUFA 1C12B 4OD1L 4KUCD 1S5HA 1X9QA 1ONQA 4XWGH 1F11A 2F74B 2NTSP 3VWJC 4AEEA 1H5BC 1IGYA 2QQKH 1HYSC 1AQKL 3ARBB 3HI6H 4JCMA 1CDJA 4UV4L 3D3VE 3WUWG 1HH6B 4NQSA 3VFOB 5H8DA 2WQRA 1U42A 3L95B 1DQDH 3WLBA 3SE3A 1XEDA 1UXWA 5J11B 3N1QC 1UWXH 4PJEA 3OAUH 1OP3K 5F7FA 2QKIB 4N8VB 3HRZB 3IDXH 3HA0A 4M3KB 4E41D 1YN7B 5LBSL 3IKCA 3BYTA 3VXTA 4P2OB 1X44A 3VG9C 5JR1H 3LS4L 1UB6B 1VPOL 1SYVA 2EICA 1MFDH 3P77B 4E41E 1RUMH 1BVLA 1UJ3B 3MV7A 4UUJB 4M5ZL 3T77B 3MJ9L 2GJZB 5FDWA 3HC0A 3GHBL 3WIIH 3FQWA 1HQ4A 1TCRB 3K8KA 4P4KB 4PV9B 3EFFA 4PJFE 1U95A 5E2JA 2H32B 1QEWA 2FGZA 2HJLB 4QGTA 3SDCA 3F6IA 5JMOC 2E7CA 3S37H 4UQ2B 3MYZA 1SEQH 3HZMB 4D0BA 4B5EA 1DJSA 2D7NA 3RUGB 2JIXD 4O4YH 5DF0A 4N90E 1FSKC 1GYAA 3OBAA 2ORBL 2X1PA 4Y1AE 1LO0L 1NLDH 1UG9A 2NXZD 1SY6A 3O9WC 3V0WL 5KSAC 3EKCA 4MD4B 1KTDB 1T6VN 3ZE1F 1IBGL 4HHAA 1BJ1J 3PGCA 3ES6A 3MLYL 2MJWA 4MCYB 4POYA 3GSWA 4Z78A 5M94B 4GRMB 4M6ML 2GJZA 3OB0H 1AC6A 3FL7A 4HUXA 4JPVH 3W2DH 3LQAH 3QUYD 5D7JA 3AB0C 4JO4H 4K9EH 4OZFH 3UTQB 4I3SL 3E3QE 5FYJD 3T3MF 4CJ1A 3AROA 4P46C 4HWBA 3BPNC 4NQVA 2X89D 2NY6D 2EIDA 2BVPB 3Q0HA 4GLRI 3OZ9H 2NLJB 1CFVH 5E6IA 3BPCA 2YPLE 1BZ7A 1J88A 1ZS8A 3DXAE 5A2FA 3L3HB 4POZD 2APTA 1WQVT 1XR8A 3NA9H 5IBTL 3RX5A 4Y2OA 3SDCC 2BY3A 3QEQD 3GNML 3O8XB 4NO0A 5FO9A 2LU7A 4U6XB 1EO8H 3KHQA 4YE4L 1FZJA 1WIUA 1Q9LA 4OF0A 3DV4A 5ESVA 3V5DA 4MQ7B 3UYOD 4NM8H 1D5XB 2YXFA 5FGRA 1EHLL 1HHKA 2CLZA 3MZGB 2UY6A 4PJ8C 3TGXA 4TSAL 2ICWI 1PZ5B 4HKZA 3A6BL 3JBG7 3TESA 3HHRB 1T5WB 1RIHL 2OTWB 2AEWA 2GSIA 1T0MB 3L3HA 1EFXB 4PJDF 1UACH 1AGFB 1LDPL 4QTIH 3CVIH 3T09A 1R3KA 4Y16B 3CLFH 2VQ1A 1FN4A 4MWFA 3SDXA 4XHQA 4WGWB 2NZ9C 5D1QD 2AAVA 4QYOA 4M61A 1IRAY 4B53A 1IM3A 3KJ6H 3MOAH 3F12B 4M7JH 5D7JD 5I1IL 2L0DA 2Q8AH 5A2IH 4RMWA 3CDGA 5CEYA 3GJFB 1T3FA 1T5WA 3EOTL 3IFLL 1ZMYA 4EUPG 3TVMD 1EH9A 3QIWC 5IFHH 2OI9C 3BDYH 5CSBA 3D1MC 5E00A 5MEQA 4N0FB 5ANMA 5EUKB 5K9OB 4ZQKB 4ZNEA 4EDXA 4U1GC 4Z5RB 2EYSA 2JB6A 3OKNA 4XAKD 1NAMB 2MKWA 1XZ0A 3B2UC 4J3OC 4WW2C 1TJIH 1HZHH 2FHCA 4F15C 3OSKA 5EH1A 4Z7WB 1KIQA 1PW3A 5DZOA 2H26B 3G6DH 1DBMH 1IAIM 4XGZB 2WWMC 3PNWA 4KI5C 4CNIA 1NMCC 4I0PB 4P5TD 4L4JA 3S5LG 4RFEB 3FRUA 4CRPA 1D9KD 4O2FA 4PRNB 2E27L 2X42A 3VFGH 1DQMH 4QKXB 5IEHA 4AENB 5CMAA 4I0PC 2VO5A 1BBDH 3VFSB 1A6VL 4GUPA 3IT8D 3KYKL 4Q7DA 4ENEC 3ZE2F 4U7MA 1OTUD 1VEPA 1DBBH 4ODSH 5C71A 1JNJA 4WW2B 4PJFF 3DYMA 43C9B 1MHCA 3RVTC 2WSKA 1RK1A 2VLRD 1CGYA 4PRPD 1S9WA 1AJ7H 1HEZA 4HGMA 2H26A 1MCCA 5H35B 2JCCE 2K7PA 1CXHA 1F8TH 4FFVC 4ZAKA 1NAMA 3ROOA 1J0YA 1YMHB 3EYSH 5IW6A 5D6DA 4X0KB 3ZKQD 1J0JA 5IGXH 1UZ6E 4UZGA 4OFYD 1NCWH 2GCYA 4P0DA 3FRUB 4AEIL 1S78D 3BAEL 3BT2L 4NDMB 5E08L 4P4KD 3K4ZA 3DO7B 4Y7MA 4G7YH 5IEHB 4HIEB 1CL7L 4FZ8H 4W6YB 3MR9B 1AE6L 4XRCB 2B39A 4KMTL 3MXWL 4YDJA 4WO4C 5C0GB 4QY8A 4LDLB 3RWFB 1EAPB 5DJYA 25C8L 4IMLB 4HJ0D 4RNRB 4EN3B 5GGVL 1CD9B 2B2XL 1A14H 4M62H 1OVZA 1DBJL 3ZYZA 4RQQB 3FB6A 5L2KB 5IM7A 2D7TH 2R0KL 3OJMB 4PJ5E 2D9CA 3GHEH 4CVWA 2GCYB 4QRTB 2GY7B 3VXRA 4I3RH 4GG6B 5JNYA 4KI5D 5GGRB 4ZYKA 1LEGB 4MJ4A 1INEL 2EYRA 1ERNA 4O58H 1OTSD 1AO7B 1G7JB 1TQCB 3EBAA 5I8CA 4GO6B 5HHVL 2PTTB 2WBWB 5DD0H 2PO6D 3MMEA 3HPLB 2IFFL 2P44B 3QPXL 4PGEB 1NJ9B 4RGNC 3H0TB 4OF5A 4Y4HA 2IFGA 1PKQE 2OZ4H 3QXUA 2ZUSA 3PHOA 5EZOL 2IPUK 4YJZL 5IMKB 4C56E 3MUGB 3BYYA 3HS0B 1ZHNA 4JPKH 5IOPB 3BP5B 5T33H 2ID5A 1GGTA 2JF1A 4UT6L 4JO4L 5EZJA 1RUML 4Q97A 4LSVL 4X98A 5CJXA 2ESVB 5E8DL 3RJQB 4KUZL 4PRNA 3SY0B 3ULVE 1A7OH 1CDCA 2A1WH 1T89A 5BVJA 1RV6X 1QYGH 1YEEH 1UKQA 2E9BA 3UBXG 3IDXL 4XH2B 3GI8L 3H8NA 5JA9A 4GUPB 2VDML 3K1DA 3PG2A 2DLTA 1HCFX 3TT1H 2OR8A 3DX9B 4JM2D 1TITA 4DVBA 3FQXA 3HS0A 2BY1A 1Y18B 2CIKB 4AL8L 1H3XA 1LVEA 3E8UH 1T2XA 4IRZH 2NY6B 4LHUB 5T3ZH 2V6HA 1IGTB 3RPKA 5D1QB 3SKNB 2H8PB 4AY0A 4OM0H 9CGTA 3KPQB 2C1OA 1YMMA 2DM4A 3TM6A 4RMVA 3MJ7A 2ESVA 2AJUL 4XTRC 3REVA 3DJ9A 1EJOH 3VFWB 3PGFL 1N5YL 1DUYB 3BH9A 4JFOB 4M1CD 1GGUA 5JQ6L 3GSUB 1V7ML 4MJIA 4MQXD 4EUPA 3K4AA 4G8EB 5A16B 3MLSL 4FMKA 1FLRH 4UDUA 1W0VA 1JZ4A 5D96B 5T3ZE 3RWIB 1TJHL 1DEEB 4U1NB 3VFUB 32C2A 1MCNA 3PGFH 1N5YH 1SEBA 4JKKA 3R4DA 3GUTB 1R3IL 3H42H 3T0EE 3TA3A 1EO7A 2E6QA 4LCIL 4UT7H 5EBLB 5TH2B 3ARGB 2VMFA 1GJIA 4NQEE 5CZKA 4MNHA 5H2BB 1U8QA 3QCUH 4FTVA 1NC4B 2FBOJ 5CCKL 4YXKH 2V9TA 1WBXA 2GJ6E 2YPLB 4GRWE 4GQ9H 3WN5B 1EEYB 1BAFH 4GG8A 2JELH 3VFMB 5ADPL 3CDCA 1GH7A 3MRCB 4KK5D 3UBXB 5DS8A 1KCVH 4G6JL 1CIDA 3RWJB 3WJLA 2R1XA 3MO1B 1N6UA 1P7KA 3I6LE 5F7DB 5JIKA 3C8DA 1HYRC 4MA8L 3LZFL 3GJFH 4J6RH 2PR4L 4JRXD 3VFVA 3GMOA 4M9OA 1MQ8A 1LQSR 4K71C 4L9LB 2WLZA 4JM4L 4QRPE 3V7AE 1RJLB 4PGDB 4QRUA 1UEMA 3TVMC 3O4OC 4KJPC 4AM0A 2UVEA 2P8MB 2PETA 5T33L 1DQDL 2WBKA 1OTSC 3VFRA 4NYLA 2P42B 4P2YA 1OTUC 4KMTH 5TPWL 4ODVH 3GO1L 1J1PH 4GAJH 3ARXA 4XMKH 5IHZA 2CK0H 4L4TB 3MBEB 4LMQI 1ORSA 5FUZL 3D85D 3K0WA 2YWYA 5EUOF 3I3BA 1AIFB 3BZEB 4QRSB 1ND0A 4TUJA 2Z31D 2QQNL 3U4EB 3WIIL 1P7KB 5F7DA 2HKFL 4WHYH 4UT9L 4HPOH 4OZIB 4OZFA 3OB8A 5HYFA 4HHAB 1IAKB 1A7QL 3WS6A 1AGBA 3KYOA 5MHSD 3DVFA 3FN0H 3X3FH 4PRPB 2DQIL 1RVFL 2AJVH 4D0BB 1T66C 4GQPH 3WEXA 1W0WA 4LARH 3BIKA 2AJXL 3VWKD 5KOVC 3H6JA 4NQDA 2P43B 2I07B 2DYPA 3DGGB 3C5JA 4JM2B 1YMME 5EN2A 2OL3A 5D1XC 3RWHB 3O6FC 5DRWB 5CS7A 4DWHA 5ID1A 3VXOA 2ITDA 3WFEL 2OXHA 3ARDA 3QQNA 1ZWIB 1QFOA 1S7RA 1RY7B 1IVLA 2AEPL 3NFPB 4HIHB 2DI9A 5IBUG 5BJTB 2VITB 1AGBB 6CGTA 5KSUB 5EPMB 3VWKA 4FXKA 5AUMA 5C08A 1IGFH 4OZIA 2D4FA 1M71A 3FT3B 1JHTB 3NFNA 3S7GA 4UTAL 3MV7D 2XWBB 1GZPA 2IALA 3MV11 1A7RL 1DN2A 4DOHB 2VDKH 4WGVB 4GW4A 4BZ2H 2OTWA 3S98A 1NFDB 5CUSL 3DV6A 1FZJB 2GIYA 2VH5L 4P5KA 2BNRB 1P1ZB 3FB8B 4UT6H 4A2MA 4U6HB 5C09D 5DMYA 2WBJC 4LKCB 2JIXA 4ETQA 3CVHA 3FB7A 1MUJA 1G7HA 1CFSA 2VISB 5K9QG 1ORQA 3O6FA 3PWNB 2VZ1A 4X4ZA 3HUJB 1SBBA 3PDDA 2K3TA 1U3YA 3P4OA 5A1AA 5T5FL 4C55A 4ZXBD 2XRAL 4JREC 2B4CH 4G9DB 2EDNA 1EJ6A 4MJ6B 1FHGA 4BUGA 2J4WH 1IKNC 4ODWA 3S35L 1T1WA 4LPYA 1DN0B 3CFEA 4RGMB 5AYQA 2Y5TB 3IKKA 5F7NC 3HMXL 1VESA 3TT3L 4HUWA 5T1LA 3SJVA 3QFDB 1MAML 3BDXA 4I77H 4RX4D 4ZSOE 1WBZB 4OLUH 2OL3H 2XA8L 3MV8D 3LKPB 4LNRA 3NA4A 4V1DB 4NN5B 4FXLA 1OP5K 3QXAA 4GMSH 4APQD 2DWEB 3BEVB 3O6LL 5IV2B 4OAWB 4P3CL 3TNNB 1YJDC 1CLYH 1EZVY 3MRQB 3IXAB 2E7LA 3KPMA 4H0IA 1A4KB 3ZTNH 2DLEA 3O3AA 2R69H 3TO4A 4WFGD 3FO1B 5EBWA 4MHHG 4OZ4B 1N6QH 5J6HA 1LP9F 4ODWB 1BBDL 1YPZB 3ZSTA 4OGYH 4PRPA 2DLIA 1B6UA 3S35H 1UWGL 2ICEA 1U8JA 3VFGL 3X12A 4J7RA 1INQB 3IU3B 2Z8VC 1LO3L 1FE8H 5KTEH 1KN2L 4FS0A 1CT8A 4JEGB 3RU8L 1U58A 4CGTA 1OGTB 1FC2D 1T1WB 3G5VA 1JRHH 2EZ0D 1NLBH 4ELMB 1HOCA 3KJ4B 1ZLUH 3U0WH 4LHUD 4F33A 5C09A 5D7IF 4WI5A 1J0ZA 4PJCB 1LE9B 4HC1L 2AQ1A 3QG6A 5C07A 1MQKL 2YKLL 3DX6B 2CH8A 4OZGE 3WKML 1LEKB 3KHOA 4Y4KB 3ARFA 4LIQH 5B4MD 1ZA3B 1U8IA 2YUZA 5JPMA 3P4MA 1N64L 4ETYA 5GJTL 4OAWA 1XIWC 2OTUB 1JWMA 5E8EB 3C60D 1CBVH 4RMUA 3OPZL 4MXVF 4XPGH 3VH8B 1U8NB 3H3PL 4P5MB 5F9JA 3U30C 3ZKXB 3GDBA 1FNSH 5E1AB 5I19H 3PABA 3QWRA 4GXUM 4NC1E 2AK4E 4Z8FH 3QT2A 4B0MM 5JOPD 4HBCL 3SKUD 1V05A 4NN6B 1UEYA 4XX1G 3EDDA 1ES0B 5ICXB 5DC0A 1TTFA 4PPTA 4APQA 4DCQA 1A1NB 3LCYA 3QR2A 2R1YB 2H32H 2BP3A 3WD5H 5LVEA 5C92A 1CICA 4Z0XA 5BQ7B 1UGNA 3BWUC 4JPVL 2OBGA 4CN4A 2F74A 4D9QE 3T8XA 1QTYT 4CN6A 1E0OB 2MHAB 4OGYL 3VD5A 4IRJC 5TH2A 1H3PL 3HLAB 4UDTA 1HH6A 4WI9A 3G6AB 3JWDL 3UJIL 3QUZA 4HV8B 4LQFH 3AM8A 4LP5A 3QXVA 4F7EB 4O02H 3EO9H 2VXTL 3ZHDA 1JMZA 3BEWB 4JFPB 5IFJB 5DWUL 5JW4N 3NZHH 5TQ2L 4M7LL 5SWSE 1WWBX 1M6OA 2QQKL 5C0RL 1XGTB 5DFVC 1REIA 3MRLA 3DRTB 3VD3A 4N0YH 1KJ2B 4PY7B 3IS0X 3AS0A 4ZTPL 3MV8E 3SDXE 3RVUC 4UBDD 4OFPA 1DVFB 1AO7A 4EN3C 4LLQA 5EU3A 3UTSD 3CVIL 3D5OF 3TIDA 5I74B 1LO3H 4LLUA 4QRPD 2VZ3A 3FO1A 5EBWB 3PGCB 5CSZB 1BD2D 1T0PB 3VCLB 3TZVC 5JPNB 3EIFA 4JFDD 2ADFH 3U0PB 3VXQB 5FEBA 4WTZG 4OFKA 3EYVA 2UZIL 5JXEC 2CK2A 1BVLB 5BZDA 5TE7L 4R3SA 2Z31C 5FDWB 5DEGB 1AGCB 2CLVB 4P4KA 4NNYA 2HTLD 3TBSB 1KYOK 1RIUH 5HHMD 3O6MH 3VD7A 5BVJB 2ZCHL 1X5KA 1ZS8B 2A83A 5LAXB 3AMLA 1E28A 5E2WL 1CDIA 1IARB 2B20A 3NZ8B 3BZ4B 4TNVK 4XC3H 3WE6B 1RU9H 5AZEH 3OF6A 4NWTL 3GBLA 1J1XL 1T89C 5IJVB 5E03A 4YHZH 5EZIL 3TIEA 1Z5LA 3NCJH 5ESVB 5F96L 2BJML 2H2SC 3GO1H 4GAJL 5DRXB 2GK0B 5C0RH 4YHKH 1NAML 4KAQL 4P2RA 4Q2ZB 1QO3A 5GGSY 1X7QA 1JV5A 1YDPA 1X4ZA 1QBML 3ILQD 2IQ9L 2JLLA 2DKSA 3QJFA 4JPIB 4NCC1 1I85A 4OV5A 1IFHL 5LGJB 4F15B 5BJTA 1DTUA 3P11H 4NHUB 1MI5A 1NLDL 5KSUA 2VWEC 4BQ8A 4PJ9C 2JJSC 5HYJE 3CIQA 3BUYA 2PCPB 3HE6A 2G2RA 1ETZA 4OLXL 4JQIH 1CD0A 4UDUB 3F12A 5F7EL 3KYNA 1EFXA 3UTOA 1EEYA 2BMKA 4UNVA 3C2AL 4PG2A 3MRDB 5EOQH 2CUHA 5GHWH 1OT2A 3RKPA 1BGXH 2GT9A 3BGFB 3SDXB 2OMBA 4LAQH 2A6JB 3OR7B 2YD7A 2RFXA 3NPZB 2CXGA 5HBBA 1WIPA 4WIQA 4OLVH 5E2WH 3CSGA 5KVEH 3PL6B 3JV6A 4JJ5A 3WJJC 4EI5D 2EIEA 5C0AB 5BVPL 4WO4A 1FFNA 4Z7QF 1QBBA 4TTGA 3KXFB 3STLB 3UTPE 3CDGB 1MHPH 4R2GD 5E5MB 1YEGL 4X4YA 4NQCA 3INUH 2EEBA 3RIAF 2BNQD 2ADJA 3VXRE 2YN5A 5HYSA 3CZFA 1MCOH 1MJ7H 3ZSSA 2HMID 4U7SA 5C0EB 1XCTB 1NBQA 3U9PL 2HJFB 1X6LA 2HVJA 4YFEA 2GT9B 2OMNA 2DTML 3JWOL 4KV5E 4RRPG 3MLUL 1IEHA 1VERA 1OY3B 4J2XA 2X1OA 5JW3L 1OQXA 4X6CE 3V5HA 4OCRH 3X14B 2FX7L 3GJFK 3MC0A 5GGQL 1HI6B 2F5AL 4QRSA 4WFHE 1PG7X 1A9BA 1P4BL 3LQMA 4GRMA 3PGDB 5LKNA 2XFXB 4W4OC 1QNZL 2VIRA 3VFSA 3VXSB 1FYTE 3ZTNL 4C4KO 3MGAA 4DN4H 4QTHA 2J2ZA 1JZ6A 4K7FB 5T3XH 1KEMH 3ARUA 4N8PA 1RIUL 5GGVY 1QVOA 4MA3A 4OLWH 2CDGA 2Z4QB 3V52L 5DUBB 5FUCC 1B88A 4JFZL 4OM1L 5KANI 5KN5B 3LMJH 2HFTA 4KPHL 5EU6A 4C59B 3OAZH 1Z3GL 4OBRA 1JFQH 4R4BA 1JNNL 4CU8A 3HAEH 1CGXA 1XMWA 3QG7L 1Z6JT 4NZUH 2DM7A 2Z91B 2UWEE 4OF3A 1E6OL 3S3JA 1J8HA 5DD3L 5KS9B 3IDNA 5FO8A 2NY4D 5IQ9A 4HIHA 2FIKB 4M93C 1LEKA 4WV1B 3UP1A 4B50A 4MDJB 1IKNA 1AD9B 2Q7YB 2DTSA 2WMPA 1QR1A 4F9LC 3SKMA 2OTUA 1EEUA 1N4XL 4JRXA 4ZNCD 1FFQA 1QKZH 2V7NB 4JQXC 5EU6D 2VLJD 1FYTB 2CKBA 3RTQB 5CCKH 1GSMA 1T5XB 1ADQH 3PP3K 1ETZB 4HS6A 3TN0D 4JHWH 5JDSA 5C0GA 3RUGA 3EYQC 3DMMB 2DMCA 4H25A 3VGHA 3ARBC 1OAQL 1YMHA 2BMKB 4J1UB 5EOCJ 4WI2A 4OUUB 4BM7A 1XT5A 5EPMA 5EO9B 4OGAD 1BREA 5IROC 3SJVE 1FZMB 3FQRB 4WHTB 4GG6F 1XH3A 3LH2H 2HFEA 5D6CB 3QRGH 4PIRF 4HG4J 3RZCC 4NDMA 1UZ6F 5HI5C 3V9FA 1YY9D 2VE6A 1CFSB 2NX5D 4GBXC 3VXSE 3RNKB 4K9EC 2W60A 4HUVB 5FGCE 2APWA 3TJEH 1I9JH 3WIHH 3UZQA 3HNVH 3C8KA 4MDJA 1U92A 1NCBL 2BSED 3EJZC 2BOBA 5K59E 1NFDE 2VR9A 3C5SB 3T4YA 1N5AB 2WBJB 3L1OL 3UTPD 4F37F 5HYEA 4ZUUB 5MHSE 3E0GA 4RZCA 3QAZB 5GZNC 4ZUTB 1PEWA 5HGGS 4UU9B 5I71B 3QEQB 1KIQB 2FYYA 3PL6D 4L8CB 4PG9A 5E2VL 5F21B 3TA3C 3RHWF 3D0LA 1DCLA 4RFEA 3RL2A 2W38A 4L3ED 3IDYB 3GKWL 2KL6A 2IEPA 3UBXI 3QDJA 4TVSa 4U3HA 1A9EB 4FNLH 3KPNA 3KPSA 3OKKB 2J6EH 1PY9A 2P8LB 2IPKA 1GGBH 1OGAA 4U1SA 4WUUE 5IMOA 3WSQH 1U92B 3BW9B 1MRCL 1T66D 4ZUTA 3UC0H 3I02A 3RNQB 3QULB 4P3DA 1T21B 25C8H 4MB5A 1BVKA 3CH1B 5DMIH 2EE3A 1OARL 4JM2F 5JZ7C 4XXCA 5D8JL 2G75B 2FZ3A 1QSFB 2Z8RA 3QEQA 3SCMB 3IETA 1GAFH 3MNVA 4PRAA 3RWIA 1S3KL 3X3GL 1QLFB 2CDEB 3O8XD 3HZVB 4P2CG 5DLML 3O4LB 4OLYH 3PWVA 1JE6A 2HT3C 2Q7YA 5IVXA 5D4QA 4RISL 4YHYB 1VA9A 2EEDA 5J1TC 3JSSA 1NGQL 4JFOA 1R0AH 1R5VA 3WSQL 1I8MA 3F62A 5C9KA 1CBVL 5J57B 2X9WA 4KVNH 2N7AA 4OT1H 4HXBL 3GFUA 2LTQC 5IMMB 1ROWA 4KVCL 4EN3A 4XPBL 3C6LC 4Y5YC 3BN3B 5JO5A 3WN5A 1QPXA 4XBEH 1ZT1A 2NY4C 3QHFL 1OM3L 3FQRA 4WHTA 2YSSB 3SGDH 4JFXA 4KK9C 3HZVA 4E0RB 3VFNA 4UOW1 5T1DL 5FOJA 5LQBH 1LD9B 1CE6B 4Z7OE 4O9HL 3SCMA 1S7SB 3SE3C 1MI5B 1ZSDB 3LKNB 4X5XA 4JFQB 5HVHB 3OKEB 3D2UB 5E2UL 5DQDL 4HH9B 3ARBD 4UQ3B 4KTEH 3VWJA 1VGEH 5DMKB 3KPRB 2H2PC 3MRGB 4GAFB 2FJGB 3KXFD 3EO1A 3PHSA 3SE4C 2A6DA 3V4VH 3DVGA 3UTSA 1DLHB 2B5IB 4NT6B 2V2TA 1ZTXH 1S5HB 4L8CA 5GGRY 1X5IA 3KXFE 4S1RH 4PB9L 3BDYL 4OV6F 3BPOB 3I3EA 4NFBA 3VGAB 4HT1H 2AEQH 1T04B 4MDIB 1CLZL 4BH8A 2BFVH 1JWSB 2J5LC 3ZO0A 3ZDYE 5CAYB 4GG6E 4QHNB 3MZTA 2RAMA 3BP7B 5F9OH 5CD5C 1JTOA 1YA5A 1J05B 3KJ6L 3MOAL 1RZJL 4JHWL 3V6OA 1OL0A 4GW5A 1A0QH 4IRSD 5E00B 5MEQB 5FYLL 4ALAL 2VXVL 2YD2A 2E27H 4HIXH 3SDAC 3L1OH 4G5ZL 4IOFD 1T1XA 2BCKB 5AAMA 1J5OL 1ULVA 4LSSL 4EOWH 3RAJL 1CTNA 4U33A 3DX7B 3S96A 4YHLL 1ZEAH 3LQAL 4J3UA 4Y2DC 1JL8A 1B0RA 3WHXB 3BE1H 4P2OA 3BUTA 4JFHE 1TCRA 4WI8A 1X5GA 5J06A 1LK2A 4P23C 2AJ3A 2COQA 1FGVL 1D9KA 1YECL 5DR5L 4ODBD 4S0SD 2VL4A 4JFFB 4M5YL 4PJIF 1L0YA 3CMOH 5E8NB 4GKZA 1I8IB 1JGUH 1CFTB 1PLGL 1S9XB 4Q6IA 3LKSA 5B8CB 1P2CA 2PXYB 1U3HD 3SE8L 4JANA 4MJIB 3ZKNC 3ZT5A 4NHCL 4X4MA 3NFNB 3NIFE 5A16A 3HZYB 3CD4A 1NMBH 1MY7A 1F97A 4P59H 3KPPA 2IFFH 1EPFA 3QPXH 4KH2A 3UDWA 4TVPH 1ACYH 2VJXA 4YDIH 4HUUB 3FO9A 2NY2C 4MJ2A 4LCIH 4UT7L 4RGND 5EORH 4NC1C 2A2QT 5CKAA 1EX0A 3MRNA 4OV5B 1KPRA 5A43C 3GK8H 3IRPX 4JREB 1B6DA 4NBXB 4X4XB 5L8LB 3P9MA 3TZVB 4ISVA 2C3HA 4F37K 1T7YA 1S9VB 1ZVHA 3MR9A 4P2RB 2XWBA 1KG0A 1OAZH 1X7QB 2VXQH 3VRLF 4WJ5B 1BZ7B 1W2KT 3RWFA 3Q5TA 3E6FA 3RAJH 3M8OH 5F1KC 2LABA 2V9QA 1DR9A 5CEZH 3TBYB 1JTTA 5E2TH 2XICA 4KQ3H 1C1EH 5EA0L 3Q5OA 5IK3B 3DIFB 3DVGB 1KTLB 5D70H 4K2UL 2Y6SC 4ODUB 5D7KE 5CD3A 5FUZH 2E7BA 1MRDL 1RZJH 3C08H 5DD0L 2VLLA 2ZUXA 5EZIH 5GSRA 5T1DH 3CFBA 2HT4D 3PUCA 3UDWC 1UYWL 1HINL 3MUZ1 5SX5K 1C7TA 3TZVD 1DBKH 1DLFL 5I8OL 3S3SA 2FSEB 2FX9L 3MV9A 3LKOA 3P9LA 1SHMA 3FOLA 2A6KA 1P84K 4Z7OF 5D6DC 5DD5H 1A7NH 2VDNH 3CZFB 1RULL 1SJXA 4I3RL 3QDGE 1NJ9A 2OQJB 2VDQH 1KT2A 2Q3AA 3QEHB 4FN0A 3U6RB 3T2PA 3K2MC 1ZVYA 2J6EA 4WWKC 1RZ8A 35C8H 4WO4B 4H8WC 2DAVA 1ZHLB 3SPVB 2UYLA 1XF5B 4FQXA 4L5FL 3CK0L 1IEBB 4Y4FC 2IPUG 2Z9TA 3V4PL 3GSOB 4G9FE 1WEJL 4L3EE 2VXUL 1LK2B 4JZJB 1KELH 4S2SA 4OI7A 4HIXL 4M48L 3CFKA 3MRFA 5GS0D 1HN1A 2H1PL 3O9WB 4X6FB 3P0VH 1TJGL 3HG1E 4KC3B 5TDOA 3QCUL 4U1IB 2I27N 5IB1A 2R1WA 2XWTB 1JWUA 2XXMB 3KPSB 3KPNB 3PQYA 3BRGC 4LSPL 3W39A 5TE6H 5TF1L 5ALCH 2FB4H 1TIUA 3P9LB 1K8IA 4YO0B 4I3GA 4OCRL 1NCNA 1GPOH 4U1LA 1FNEB 4KJYA 5C0AE 2W91A 2YD9A 3KLDA 4AK1A 3IGAA 4I18B 3HN3A 4NZDA 5KVFL 3LD8B 3NCEB 3BP4B 2BY0A 2IMMA 4C4KT 2XN9B 3G6JE 4AM0B 3O11B 1OD7A 2ZJSH 3D6GA 1OAXL 1QLFA 4Z0XB 3ARPA 1Q8MA 1CL7I 1A6UL 3PABB 1H3PH 4BUHA 4JZNA 1U8OA 3IDGA 1LK3H 1PSKH 4PRPE 4QCIA 5EORL 5J3HC 5C07B 5ISZE 2R29H 2C7UB 3JTTA 3V8OA 3BN9D 5H35A 1FO0H 1HHHA 4KI1A 4HJJH 3ZKND 5AD0B 3P4MB 4R4ND 5K33A 3K7UA 2R39A 4NCDA 2D7PA 8CGTA 3UEZA 3L5WB 1F58H 5E8EA 4KJQD 2IGFL 1YNLL 5DK2A 1FNEA 3OKLB 5GGUA 2D7OA 4KWUA 5M7QA 3DIFA 3K74B 2I60H 3JWNC 3MLTA 5KS9F 1A4JB 3UAJD 2HLFC 4XNQA 4HIJB 4JVUA 3I9GL 1KPUA 3W9DB 4QWWC 3U7YH 1J1OL 2WQ8A 3CJJA 3JV4B 2AEIT 3H9SD 3NCMA 3QI9A 3GMNA 3S36L 5I1DA 2IANA 4XNUH 3IDJA 4QT5A 5B3JF 2DYPB 3JWOC 5C0FA 2K7QA 3WXWL 3D85A 2VN7A 4WU7A 2VLKD 1ZLVH 1JNLL 3GZKA 2A73B 4YBQC 3EDKA 1S3KH 1BBJB 5J12C 3V7AG 1L7TH 4UV7L 5E94A 1GGCL 4XAWL 4XVUC 2VLKE 4HUMB 4RQQA 5L2KA 1UB5B 5BZDB 1CG9A 3CX5J 4LLVB 5CINH 5BW7A 4HMEA 4Z0BL 2NTFA 3A6CL 2DBJA 3SBWA 5EU3B 3O3AB 4YHNA 2XG5A 3DARA 4K9EL 4XPFL 4ZYKB 5GZOD 3QUMA 2YWZA 3GMNB 3QI9B 4KI5E 4BFBD 3FQWB 1UFUA 4YHIB 4LEOB 5JIIA 4JHZA 2V17H 5DSCB 1F4YH 5FYKU 2YUVA 4G7VL 2OS7A 1BFOA 5FGBA 5I1DB 3EJZD 4XP1H 1NKOA 3MBEA 3QRGL 4Y0GA 1FVDA 2VZOA 4P3CH 4JFZH 4NRZA 4TNVF 5CGYD 1JGLL 1H9VA 3F8UB 4G43B 2QADC 1IE5A 2FL5A 3JUZA 4OZHA 4RSVA 4ETQB 4HXAH 2WWMD 4HGWB 5LG1A 3TN0A 5B38B 3FQNB 1V5JA 3O6FB 1ORQB 3CFCL 2F8XC 3P0GB 4I18A 4HK3J 5IVNA 1NCAL 4W4OA 3BZFB 5ACZB 2XY1A 3F7QA 1A22B 2QR0A 3Q3GB 4E9LA 5IMLA 4Y4FA 3A6CH 3GBNH 4CVZB 2HLFD 2B4CL 1A6TB 4D3CH 5HHXL 4QWWD 3ECBB 3ZHKA 3ALPA 1A6ZB 3MLUH 4O51B 4NNYB 3GSXB 3DX9A 5HYJB 2V2XB 4G43A 5C1MB 5EBMB 3I2CL 1L7TL 5BS0A 4RGNB 4MXQD 1IGIL 1J10A 2BVPA 5I30H 5IB3A 3JZ7A 5ISZD 4APQB 1PAMA 2YMXL 1OB1A 3PL6C 1HWHB 2PN5A 5JW4Q 2CIIB 2ZUYA 3B4NA 1UQSA 4GMSL</