2DOCA

Solution structure of the fibronectin type-iii domain of human neural cell adhesion molecule 2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
GSSGSSGQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Fibronectin type-III domain of human Neural cell adhesion molecule 2
rcsb
molecule keywords Neural cell adhesion molecule 2
molecule tags Cell adhesion
source organism Homo sapiens
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2docA01
4R8WL 3U36B 2Q87A 3G6AA 2BFVH 3BP4A 3NABH 3TNNA 4MAYC 3NCJL 5D7LD 5DK0B 5IROC 2IG2H 1M6OA 5T5FH 3E2HC 4ZTPH 3SCMB 1A2YB 2AJXH 1ZGLM 1UJTA 4M6NL 1XCQB 2Q7NA 3FQTA 4TNVF 4F7PB 2G75B 5FV1L 5CJQH 1TLKA 5JXAL 3MRMB 1CLOL 5T3ZH 1XFPA 1UB6A 1E6OH 5LGHH 1K8IA 2XA8H 3BZ4B 3FN0H 3QUZA 1J7VR 3QIBA 4JFEB 1TZHA 4M7ZB 4JO1L 5EZIL 3QQ3A 3NIDF 2EDFA 3FQNB 5SX5K 4J8RB 1MWAA 1GC1C 4IIQC 4YFEA 3EOTL 3QDGB 1K8DB 3E0GA 3TZVA 3S5LG 1HH6B 4NQDE 4G43B 1HILB 1AY1L 1RZJH 5DUBB 4F7MB 1XR8A 1K5NB 1QKZL 7FABH 4PTTA 2BNRA 3LAFA 1MHEA 4QRSB 1EEZB 4XB7A 1A3QA 4ZUSB 2CXGA 3FONA 1HXYB 1DQJA 1BF2A 1EDQA 4P46B 2XRAL 1ZLUK 5IHUH 4UTBH 5CZVH 4ISVA 2IAMB 4ACPA 5MI0B 3TESA 2VDQH 4NPYA 4UT6H 1AGCB 5I1AB 5BO1L 3VCLB 5DMGC 5B3JF 5BXFB 4HDIA 5D7JD 3GMPB 4JPWL 1D5ZA 3CVHA 3DMMB 1GOGA 2OMNA 3DV6A 1MCSA 1WBXB 4LCUB 5CCKL 5E2WL 4PD4K 5I75B 2R0ZH 3IDUA 4R0LC 1SVZA 5E5MB 1JGUL 3DOSA 3HI6H 4PS4L 3P0YH 3QNZB 1XEDA 3TIEB 2R9HD 5GGSA 1NH6A 2BRRL 1OPGL 4O2FA 3W81A 3RY6A 3TP4A 2BY2A 1BFVL 3WIFB 1PYWB 3CLEL 4MNQE 4G9DB 3IGAB 3B5TA 5FYKE 3RWFA 3UMTA 5TGBB 5DWUH 1I85A 2JJTC 4E5XA 4XVJH 3VI4E 5I18L 4M1GH 2WAHA 1RJLB 5GS2D 1WSST 1YYLH 1T4KB 4NKDB 1X5FA 3CDFA 3BOVA 4UILH 4F2MA 1TENA 2RB8A 1IQWH 1G7QB 3WUZA 2OZ4A 2E7MA 1F58L 5JNYB 5E4EC 3VGAB 2UUDH 3QDGE 4QXGL 4GMSL 4EDWL 4D9LH 3ARUA 2IPUG 4JO4L 1OGTA 4HWZA 3TH3T 2X4UB 4P3WA 1DQMH 4M8QA 4R96B 3S36L 1I9RH 4NQVA 2VUOA 3FRUB 4DGVH 3MRCA 4HSQA 2P7TA 1FDLH 2A74B 4JEGB 3MV7A 5DJ0B 4Q0XH 3MLYH 4LSQH 4BFBD 5L0QB 1S7UA 1IEAA 5HHMD 4LPXA 1S7XA 4Z0BL 3S7GA 1FFNA 3CDCA 4M5YL 4Y4FD 3RDTC 1IEBA 5J56B 3MRJB 4L3CA 3L3IB 1J8KA 4MZ2A 4ODBD 4NO5A 4U33A 4XAWH 5BOZG 1DE4B 3QULB 5ITBL 3ARSA 2D31A 4X8JA 3K80A 1RK1B 2B1AH 1L7TL 5D2LB 5C0BD 3E8UL 2QADC 2OP4H 2WIIA 3IDGB 5FGRA 1TPXB 3NA9H 1N0LA 4ZXBA 4I0KA 1A7QL 1E27A 1MFEL 1P1ZB 3VWJD 1Y6NR 2HJKB 4S10A 1XZ0B 5FM8A 4J4PD 5F44A 3S5LB 3C5SA 2NY4D 4JFOB 2HT2D 3ZKXB 1WFUA 2DDQL 5EZJA 3S3JA 4PP1C 1N5YH 3N0PB 3IAGC 3HMXH 1SJHB 4X5LA 3GSNB 3HE7A 4WUKL 2B4CC 2W65B 4RGND 5ISZA 1X5IA 4CVZB 1MFAH 5GSRB 1JNHB 1OL0A 1KJ3H 3HRZA 3T0BA 5D93B 1KCRH 2Z4QA 3MLWL 5AZEH 5EA0H 5D5ME 1WF5A 4ZOEA 4GS7B 4QHUA 1MCPL 3CFEB 5ESVB 2BCKB 5DUMH 3OV6A 4KTYA 4OSUH 1SMAA 3EFFA 4X6EA 5LBSL 3DHMA 2Y5TA 2XYCA 3VXOB 4BKLB 1NANI 3RTQA 2LVEA 5IF0A 1KIRA 4M1CC 2F74A 2VLKD 4IMLB 4BFGA 4MX7A 1A14H 4H8WC 3RWIA 4E42B 1J87A 4XVTH 1LO5B 5D6DA 3GMMB 2IQAB 1I1AA 5D7JB 1MFBL 4IRZL 4YFLF 2QSCH 2ZCHH 2A0LD 2VXTL 4WI5A 1BFTA 3LEVH 3DBXA 2ZJSH 1YEHL 3KR3H 5D7LE 5IVXB 4UT9H 5E1AA 2QHLA 2R1YA 1YMHA 5D2LE 3O2DA 4H0IA 1LP9A 4NKIH 1BOYA 1TJHL 3NIGF 5DC9B 1YYMH 3R8QA 5BZDA 3GMRA 1XGQB 2AXFB 5ECJE 5T1KA 1B0GB 1P4BL 1NFKA 1GC1L 3DLQR 5DQDH 5I2IB 43CAA 5IESL 1ZT1A 3DWTA 2Z92A 4D0BA 2OJZH 2OTWB 4YHYC 1FZOA 3JV4B 1HH9A 1MOEA 2QR0B 4LSRL 4WGWB 4AIZA 3DROA 5IG7A 2X42A 4YDVB 3HLAA 3IU3B 5TE4H 2CIKA 3D85A 4LLYA 2X1WL 3KWWA 3U0TB 1PZ5A 4PJAF 2AQ3A 5ID0B 5HYSG 2YRZA 4GXUM 5CSBA 2D0HA 4RWYL 1TMCB 5J4MA 4IRSA 4YEFA 5J13B 1T5WB 1MUJA 3GHEH 1NSNL 1KEGL 3SDDC 1YY8A 1MCRA 4N8CH 1KYOK 1Z9MA 4U6VL 2NTFA 1KB9K 3H9SD 3OWEA 3QI9A 1MCFA 3MRPA 3FB6A 2CUMA 4Y5YB 3S34L 4LKXA 3UBXB 4DW2H 4Y4FB 5HHVL 1GXEA 4N0YH 1EVTC 1KN2L 1DQLL 1HNGA 3QO0B 5KANG 1TNNA 1RUQL 1MIMH 4DUVA 4O5LL 1MJ8L 4J6RH 1ZHBA 4JGMA 5C0BB 1UWEH 5IMMA 2ZSWB 3I3DA 3HC0A 5DRZB 4H26A 4FQXA 5HGAA 2LU3A 2H8PB 3HNVL 3FKUS 1UACL 3FB8A 5IVXE 5IB2B 2NY4B 1MI5D 4KI5F 4AH2A 1U0QA 1V05A 1NL0H 2XY2A 4E41D 25C8L 4ZFFA 1YN6A 5FOBB 2YN3A 2QJDA 4N90D 4G7YL 2VR5A 1VA9A 4JFZH 2X7LA 1FGNH 4MQSB 2V17H 4M43H 4LGSB 3AREC 5DMIH 3F12A 1JGEB 4HAFA 2FX9H 3JWOH 4RGNB 2YZ1A 4KRMB 4HXAL 2Z35A 4M61B 5D6CA 1E28A 3UPRA 3L7EA 4WJ5B 2M26A 5F9JB 1DUZB 2XKNA 4LSDA 5F1NB 3M1BA 3HI5L 1A7BA 2WZPD 3DUHA 4JN2A 3RVUC 3UJJL 2G60L 4XBPA 2FR4B 4YZFF 5FYKL 1X7QA 4X4ZA 5L2KD 5H35B 2I60H 5DJYB 1P9MA 1Q1JL 3VGBA 4OLXH 4Q2ZB 1L9MA 2K7QA 2JKXA 2CLVB 4JKWA 1T2JA 5MEPB 5JPMB 4QXWA 1IKFH 4OD2B 3VMOA 3TT1H 3WFBL 1GGBH 3TA3A 4R4BA 5HHME 1BD2D 4P9HL 2Z31B 2GIYA 1FZMB 3BKMH 5C09A 4PPTA 4ZPVA 1AGEA 3GKWL 3HNTL 4A6YB 3CFKA 2A6JB 1YEIL 3NIFE 4LVNC 3WKNA 3OKEB 5C0BE 2MTPA 3U46B 1A6TB 4RX4A 5DLML 3L3GA 1GZPB 4M5ZL 5E2TH 3KPLA 3SGJA 1UJ3B 4Z9KB 4KHXL 1W72L 4PJBA 4KTDH 3BEVB 2FSEA 3QIUC 2B4CL 3MRGB 4RGOH 5LXGL 5F7LB 1A7PL 1HYRC 1SBSH 1TJIH 3VRJB 4NYLA 4RMUA 1NFDB 4I18C 1KPVA 2ZSVB 3WO4C 1E6JH 3OL2A 1N7ML 4GBXC 3FB5B 4OZFG 1WK0A 2FJHA 2DQGL 2YUWA 1Q8MA 1EHLL 4ONOA 3I75A 4RGNE 1UEYA 3ORJA 5C0FB 5CZXC 5DJ8B 4POZC 4I2XE 2EDNA 5T5NF 1M71A 3TO4D 5FEBA 2ARJA 4GAYA 2V7HB 2ZUWA 4QNPE 5AEAA 4G8EB 4KRNA 3MROB 5TQ2H 1CBVH 1PLGL 1WT5C 4XP6H 3Q6FB 1U8JB 4HV8B 4X98A 1K4CA 4HULB 4AQ1B 3PWVA 4ELKB 1I9EA 3GMOB 2VLKE 2R39A 3B3IA 3VWJC 4W81A 2FLRT 3VFNA 4FQCH 2RIKA 4EOWL 1J0YA 5EO1A 1UT9A 4Y19D 5E9DA 1XF3B 1F6FB 3FRPA 2HRPH 2VAJA 5D9SA 1GZQB 1KTRL 3E6HA 2X4SB 5DD1H 4XP4L 3T0EC 2B39A 1OCWL 1OQOA 5JO5A 4G8GD 1RK0B 3RVVC 4U7KA 4F9LA 1S5IH 4NSKB 1ZVSB 4F37K 1C5BL 4XCFL 4QTIL 5IKCB 4PG9A 4NHUB 1BP3B 5DK3A 1DP0A 5C0GB 1HWGB 3M8OH 4DAGL 3JTTA 2BVQA 5LKNA 3VXRA 3QQNA 5C0JA 1LEKB 5FF6B 4PRHA 1NQBA 3SKOA 1FGVL 1DDHA 2EDEA 1PX3A 4LCYB 2DI8A 3RL2A 3AROA 3MX0A 2EIBA 4M4PA 3LS5L 4R2GC 3I50L 2VWEC 5D8JL 2Q8BH 2AW2A 1NFDE 4P99A 1G9MC 2DJSA 4X6CE 1B88A 1U91B 4DCQB 4KZDH 3U7YH 4KPHL 4ZNEA 2BXZA 5DUPH 4L8CB 2A0LC 2BX5A 4PJCE 3ZKQD 4ZFGL 5L2KB 3GNMH 4JANA 5EORL 1AIFA 3GHBL 3IF1A 2VIRA 4JVUA 1Y18A 2VABA 2W9LA 5ALBL 5J12B 3H9SE 1Z6JT 3Q6GH 1VKXB 1T21A 4WW1A 2ADIA 3HG1D 4OZHF 1VFMA 3ILPA 2OQJA 1PQZA 1RJZA 3EJZD 5TDNA 1BD2B 4LDLB 3R1GL 2NXZC 3QPQC 2NW2A 3MV8A 3JUYA 3H7BA 2CDGA 1KCUH 4X0KB 5EBGA 4MZ3A 1KJ2H 4HUKB 3C08H 2VXVH 5JUEH 5T3ZD 1FL3B 3IDNA 1NCAL 3VRIA 4HJ0C 4B7IA 1KEML 1PKQB 1UXSA 1N59A 1RVFH 4UV4H 2HFEA 2PW2A 1NBVL 2BY3A 4P49A 1MI5E 5FA4A 2YPLD 1DN0B 3LRSA 4E41E 1A6ZB 1ETZA 1Y0LA 2P48B 1NC4A 5LCVH 4FTVD 3C2SA 1WISA 4N90E 2B20A 2R15A 1VGEL 2MOVA 1HHHB 3RU8L 5B39A 3QEGL 3X13A 3OX8A 4I3SL 2IF7A 3K74B 4B5EA 5AWNL 2JF1A 5E6ZA 3TO4B 5F3HB 2M2DA 5E00A 2O93L 1A7RH 3AM8A 4Z7WA 3FN9A 1JI2A 1H3TA 5F9OH 2ARJQ 5DRXB 4CADB 3NH7L 5GS1B 4XPHL 3JVGC 2XZCL 4OQTH 3JV5A 4KTEH 4AL8H 5L2KE 1TJGH 3DGGB 5I1HL 4P23D 5FA3A 5FUZL 3LQAC 1T80A 2WBJC 4R7DA 4P5TD 1JPTL 1VFAA 4Y19B 2C7UA 4Z7UB 3GO1H 3IJHA 3KYOB 5EWIH 4ZDHB 1MCOL 2ZG3A 5GSVB 1HKFA 5I1CH 3BZEB 1BD2E 2V2XA 2GTZA 3LKSB 2X1QA 4G8GB 3T3PF 4LCWD 1JZ7A 3RWDA 4LP4A 1DSFH 5AG8A 4YH6A 5I19H 2DBJA 4FFZH 4GRMB 1F2QA 5CD3A 2BHUA 1J1XL 5EBLB 1D9KD 2ICES 3OB8A 2VC2H 1ZT7B 5IROA 2W38A 3PIQA 5TF0A 2AJZA 4NCDA 4NM8H 3T2PA 2D4FA 1YQVH 2GITB 3P9WB 1MCQA 1T22B 5HPMB 5K9JH 2UY6A 1GPOL 3QR2A 3PF2A 3O6LH 3P0VL 5FYJH 1SJEA 1YNLH 2FX7L 1EXUA 5I66A 1DQQB 4MCYB 5I6XB 1MRDH 4PJGB 3G5ZB 5KVEH 2FATH 1OQXA 4CL7A 5D96C 2APTA 1XGRA 3LEXB 5HHOD 5C1MB 3QAZC 1IGJB 2D9CA 2MSPA 4G42A 3G5VA 3IJYA 5KTEL 3RA7L 4H25A 3W2DH 4YDLB 4IIQA 1OD9A 5EDXA 2JJSC 5FV2A 1MJJB 1QA9A 3ARFB 1MH5A 2VL4A 3IYLW 1RULL 2FD6L 3BHBA 3CFJB 5FDWB 4YLQT 2A83A 2IH3A 1MQ8A 2FECL 1IGTB 3IKCB 1P5VA 1Z5LA 3HG1B 4UT7L 3SOBH 1IILE 4Y2DA 5HI4D 4FZEL 2V2WA 4MQ7A 4XRCA 2Y07H 4GMTH 4O2CA 3ZYZA 1S7WA 5C0ND 4OKDA 3BSZH 4Y19E 2YMXL 4Z7UE 5B38G 1CICD 4UIMB 2H2SD 5D2NB 4Z95H 5SWZD 4L4JA 3QUML 1RSFA 5T33L 1KACB 1BPVA 3QPXL 2R2BA 4G8GE 4LSPL 4OFYA 3D18A 3PABB 3U30C 3GBNL 3RWGA 4FQ2L 1FCCA 4G6JL 1P53A 5DGRA 4YIQB 2ATKB 4F7EB 1DCLA 1DBML 3NACL 5I1EH 3SQOL 3UJIH 2YPLB 3BIKB 4UDTA 4K8RH 4PRDA 4MB3A 1D5XB 5HYFA 1ORQA 4FTVB 2O5XL 3GK8L 2E7CA 4P2OC 4YDIL 4OZ4B 5HXMA 5IVNA 1K4DA 4U05A 1U8MB 4U1KA 1A9EA 4QXUL 4G8FB 1KENH 2JJTA 2WIMA 4J3WA 4JHWL 3OGCB 3CC5A 4RAVB 1INDL 4OM0L 2BOCB 3BP7A 1XF5A 4HUVB 1JF1B 4A6YL 1QBBA 4PJGE 5KZCB 3VG9C 4XNMB 4PP2B 4Z77A 4ETQB 4UBDD 1UH4A 2FEDC 4K23L 4EI6B 1KG0B 3L6FA 5HHXH 2AP2A 4RRPA 4QF1B 2J5LB 1DBBH 1RFDH 2CJUH 3L7FA 4XP5L 3MA7B 5GZND 1II4E 4BZ1L 3VXSD 3TYGH 4ZO9A 4P23B 2BVTA 4O02H 5DEGB 5AYQA 4PB9H 4K3DL 4ENED 1WBYA 3ZHDA 1IMHC 2EH7L 5AD0A 3HG1E 1QFPA 3QA3A 3UZQA 5EBMA 4N5UA 4IHOB 4XNZC 1EO7A 2NR6C 3NCYP 1LNUA 4GUPB 4LCWB 5ADOH 4RMVA 5CILH 1YEGL 1T0PB 4L5FH 4MNQA 1WC7B 3ZL4H 1EGJL 4CW1B 4JY5H 2G75A 5TDPB 4LSSL 3D25A 5KVDL 5AG9A 1CD1B 4NNYA 5D2NE 3LRHA 1JUFB 2J8HA 4NO2A 3PHQB 3DVGB 4LMQI 5T3ZE 3RNKB 1EA9C 1S3KL 4YHIA 1D5IL 1P7KB 3PP3H 3WE6B 3FHAA 3WS6C 1GHFL 5TQ0H 4M7LH 1YEDB 3NZHH 5IMKA 1XR9A 3WXVL 2YPLE 2CSPA 4G43A 4NRXB 1I7ZB 5DUBA 1F4HA 3FT3B 4FTVE 2EYSA 3VGHA 5FYJU 2RCSL 2FH6A 3PGDA 4ZO8A 5H8DA 4ZUSA 1C5DB 1QYGL 1FG2B 1Q9OB 3OZ9L 4XWGL 1OTSD 5HHOB 5F1KC 2J4WL 2RHEA 1W72A 1ZHLB 2GUOB 5EO0B 5F7DB 3NGBC 3O41B 2IAMA 8CGTA 4GW1B 5FO7B 3JTSA 3VD5A 1MCHA 2C9AA 1MJ7L 3QDJD 4M00A 4HKXA 1AGCA 3VCLA 2FBOJ 2HLFC 4YXLL 1TZIA 1MFCL 3B2UC 3ZE2E 4JQVC 3U2SA 1FYHB 4FQIL 4RDQF 1WBXA 3QXWA 4LCUA 4YUEL 4ODXB 1F6AB 4GXVL 3IFLH 1CICB 3QNZA 5LGKA 4QGTA 5SWZB 3I85A 1IGYB 1LP9F 1U42A 4LCWE 3OKOA 4DFIA 4JG1L 5MENB 4MAYB 2DD8L 4Y89A 4OBSA 2J8UB 3WUWA 1YECL 3CU7A 2WP3T 3MUGA 1N6QL 5TPWH 4XGZB 3KLHD 1IAIH 3HPLB 1BQSA 3H3PH 5I15L 5IV2B 1VGKB 2K9UA 5D5MA 2ED7A 5DVNA 3V6FB 4KK8C 3WHE1 1QFOA 2YXFA 35C8H 5CEZL 4ZUTA 5GGUB 3O9WD 3D0VA 3UZEA 4LRNH 4K7PX 4OZGA 2Y06H 5FIEA 2NQCA 3FRUA 3SO5A 4MDJB 1S8DA 2Y9RT 1NAMH 4PJ9C 4X9IA 5ICXB 4YX2H 3ZKSD 3SDYH 4L29B 4BH8B 5I71C 3VXSB 1PSKL 1NEZG 5EU7E 1OSPL 5H94B 3TCLB 2IC2A 4EI5D 3QUKB 3FQRB 4JPKL 4PRID 1XH3B 3IJSB 2RAMA 3QULA 5D7LA 3SQBA 1BZ9A 3SDDA 3TGXA 1VB9A 2DS4A 2IMNA 3ME0A 3CDGB 5D2LA 4EN3C 1GOHA 1N4XH 2IQ9L 1F3DJ 3IDGA 3BZFB 2X10A 1PG7L 5B4MC 3MFFB 5MERB 1CWVA 2WM0A 4RZCB 1P1ZA 5HYJD 5L6YH 1IAII 1JIBA 3S5LA 3WL9A 4JAMA 5SWZE 3MNZB 3BP6A 1T20A 1C1EL 2L7JA 2R4RL 5ICZA 3GSRA 2AKRA 2WUCH 3UDWA 3G6JA 3X11A 3S9DB 1CG9A 4R7NA 3RUGE 3S97C 3DVIA 3KNBA 4HUWB 1SJHA 3EGSA 2ATPA 5GJSL 1V7ML 4FQLL 4CVZA 2L7UA 1DLFH 1ZVHA 1JNHA 4ORZC 4JFYB 1HE7A 4LVHB 5H2BB 4MXVE 4D0CA 5J1SC 3CFEA 2IAND 1MCLA 2BCKA 1T83A 5JQ6H 4GXUN 3GBML 4UAOB 2QKIA 2F5BH 3DYPA 4KDVA 2FH8A 2P47B 1JHKL 2W0PA 1AQDA 5I1GL 3HC4H 4TRPL 3RY5A 4WW2B 4ZG1A 2VJXA 2YC1A 3D39D 3QDJB 2HKHH 3GMMA 4KUCF 4OCXL 1H3GA 2IQAA 4OGYH 4X9FA 5JORA 1BQLH 5LWYL 5JZ7D 5CWSA 5D7JA 3MOQA 5ANME 3GSOA 5EZOH 5C2BH 3MLUH 1JPFB 4LNRB 4F7TB 3VXSE 4HS3A 1F4WL 4QEGA 5HHNA 4JCLA 1CZ8L 1BLNB 3CFBB 3EOBB 3ISWA 3TVMD 3H7LA 3W9EA 1JRHI 5AYUL 1LD9A 4AY0A 1QVOA 1MCJA 4ZUUB 4WI7A 3ULVF 1YEJH 5CSGA 4QLRA 4KJWD 4PJ7B 2XTJD 2J2ZA 1KN4L 3RAJL 1QBLL 4YK4C 2AXFA 3IT8D 5GGRB 2FO4A 3EFDL 3DO7A 2YKLL 5E2VH 3V0WL 3VWKB 3VGGA 1OAYL 2OTWA 1KLUA 3JV4A 3L1OH 3BYYA 4P4RB 2CKNA 3LPFA 4QRTB 1F2XK 2BFVL 3U6RB 3UJTH 4TOYH 4XMKL 3IU3A 4JHAL 2W0FB 1H5BC 2IG2L 5F21B 5T5FL 4ZTPL 5ID0A 1CVSC 4J1UB 3O9WB 2AJXL 4QHKI 3QIUA 3EYUH 1N3NA 4MCZB 1T5WA 5CIPA 3WNPA 5C0IB 5F3BA 3LN4A 2MHAB 2NXYC 1NGWA 4I18A 3EYSL 5T3ZL 4PYHA 4GBXA 2R2EA 2VXQH 1JFQH 1ZWIB 3GJFH 5LGHL 2XA8L 5L8LB 2F5AH 3RZCC 5I74C 4EI5B 4CBPA 4LQFH 2XZAH 2XWBB 3QDJE 4KY1H 3NFNB 2IH1A 3EZJB 3FOLA 1WCQA 3FO0H 3PQYD 3NCBB 2P5WD 5C0BA 1RZJL 1UWXK 1WT5A 1PKOA 4PJFB 2DIJA 3BDYH 1Q94B 2B5IB 1A6AB 3ZLQC 3ZMRA 2XZQL 1CT8B 4L8SB 1OP5K 5FGBA 1WEJH 3VWJA 1ROWA 4LCCC 1QHOA 5IHUL 4UTBL 2SEBA 4RMWA 1MJUH 4WCYH 1AGBB 4LOUC 1OTSC 3MLVL 2VDQL 3LN5A 2NY7H 5DT1H 4UT6L 4BZ2H 1G7PA 3V6OC 3ULUH 2BOBA 3V4VH 1KF9B 1C8PA 4X7SH 4I2XA 3QUMA 3QDMA 1IRAY 4HKJA 4NN5C 2R0ZL 3X14B 4X5XA 2IANB 5F9JA 1PG7W 2RGSA 3UROR 5GXBB 2VDOL 4N9OB 1IC7L 3DETD 4AT6A 5H35A 3QFDB 2VLKA 1NFIB 1OGAD 5DJYA 1ZKAA 3B9KC 4WHTB 1BEYH 1BHGA 5DWUL 4Q2ZA 2CLVA 4PJDB 4LLDA 1QTYT 2H2PC 3SDXB 4Z76A 3OAYK 4ELME 1YYLL 2ICWI 1D6EB 4UILL 1I9IH 4O51A 4AMKL 2VITB 2W9DH 1JNNL 2CMRH 3O6FD 1FZMA 1IQWL 1FYTD 3I02B 3IAPA 3VXPA 3SE9L 1A4JA 3IRPX 4PRIE 4P5KA 3TVMB 4KDTC 4U1LB 4ONHB 1KIQB 5BJTA 4D9LL 1RQ5A 4I3RH 3JWOC 2VDRH 5DFVC 4YNYB 1DEEB 3U46A 1I1FB 3BMWA 1FL6A 3RGVD 1I9RL 3IXAB 2XTJB 4DGVL 3QJFA 4J12A 4JVPA 4DKEH 5EH1A 4S1DD 1FDLL 5HYJE 4UNTA 5I1KH 2NMSA 5HYSA 1X5KA 4Q0XL 2FL5A 4NWTH 4Q6YA 4XVSL 2HJLB 4LSQL 4QCIB 5EU4A 2WUBH 3MPCA 4Q7DA 3VRJA 4AEIH 1A3RL 5FYJD 1YNKH 1T1XB 2OK0H 1IFHH 1JHTB 1X5ZA 4NUJB 1A47A 2CLRB 4X6CA 3S35H 1I7UA 1UVQB 2D7MA 3FB5A 3K8MA 2MQCA 2PYED 5KS9E 1EGJA 2B1AL 3QCVH 3ZE1E 1GGIH 3A6CH 1FNAA 3STLB 4PJCA 2OP4L 3Q1SH 1EK3A 1X3DA 5F9AC 5C0FA 2Y25A 5DRWA 3VRLE 3NA9L 4U1NA 1F5WA 4JRXD 4L3ED 3MROA 4HWEH 5JMRA 3D6GA 2IANE 2GK2A 3FOMB 3H9SA 3Q6FA 1N8ZB 4XWOC 1I4FB 2X89D 4MQTB 3S4SG 1QLFB 4ELKA 3GMOA 4MNGB 3C9NB 2ZKHH 4H1LH 4NO0B 5DTFB 3OB0K 1N5YL 1FVEA 4KDWA 4YHKL 4ZNCD 1TQBB 3D39E 2RJMA 4LHJB 1QEWB 2GK0B 1NLBH 4WWKD 3SDXE 4XNYH 3U4EB 3PQYB 4DQOH 2P5WB 4JM2C 4S1QH 4WUUD 2HTKC 1MFAL 3BH9B 1KJ3L 4YWGL 4NRZB 1KCRL 1RK0A 4GKNB 1OT2A 5AZEL 5EA0L 2VDNH 4WV1C 3D3VD 5IQ9A 3QUYC 3RI5K 2XT1B 3KYNA 4X99A 5DI8A 5DUML 4NSKA 4OSUL 2WBJA 5I8KH 4P2YA 1MI5A 3FQXB 1MCEA 3R06A 3HS0B 4NHUA 4E41A 2BSED 5INCA 3BW9A 4PRBA 4Q74A 2GFBB 2J8UF 1JTPA 1A14L 2AEPH 2P1YA 2XTJE 5BVPH 1A1NA 4XVTL 4HS6B 3KPPA 4X83A 4UQ2B 5IW3A 5F8RC 2APVA 4XPFH 5J1AA 3TT3H 1I7RA 5J6GA 2DYPD 2LAAA 2UWEE 4NC1C 3LEVL 4DCQA 4G80B 5JW3H 2ZJSL 3KDMB 2I26N 5E99H 3KR3L 5DSCA 3VFRB 3MV11 2GSIA 5IM7A 1QQDB 5HI3D 2P49B 2YD9A 5J11C 4RAUA 1RURH 5BZWB 3MZTA 5IBLC 1V7NL 1QFWM 3HAEH 4PJEA 3LKPB 3DVFA 5C6PB 2R0LL 4UIKH 1H15B 1CDIA 5DQDL 1DBKH 5E95B 1VKXA 5I73B 3MLTA 1CCZA 4NRYB 2VLLA 2WBWB 1IGCH 1BD2A 3O6FB 1FYTB 5KVMC 1LO0L 4B53A 5HVWA 5TE4L 3C5ZC 4PGCA 3UAJC 3PWNB 4ZUVB 1ADQA 1SEBA 1T1YA 4ZS6C 1EHAA 2CRMA 3PQYE 2P5WE 2P24B 1B0RA 2GJ6D 4DEPC 5DK2B 4J3VA 3G5XA 3GHEL 1KLFA 1NGQL 4OZFA 2DQCH 1I8MB 3T2NH 4MMZC 1I1YA 2ZOKB 5F7NC 2GAZB 4D0DA 5T1DH 1ZA3B 2JIXB 4G6AC 1AJ7H 5IVZB 1KPUB 5GRWA 4N0YL 4OD1L 1NBYA 2ZOLB 2VXSH 1AQKH 4I9WD 4HBCH 1F97A 4RA0C 1MIML 3EAKA 2R23B 1DFBL 1NAKL 2PYEB 1F6LL 3GI8L 4J6RL 3S4SB 4X4MA 1UWEL 4YBQC 5JHLL 4JM4L 3TO4A 3B8SA 5F3HA 2AV7A 3F7RA 4JRXB 4Y4KD 3W9DA 4ZSOA 3ZE0E 1BM3H 4L3EB 4XXDA 4FFYH 2E7HA 2P43B 1BJ1J 4F8TA 4AM0B 3AFLA 5E8DH 5E6IC 1JGVL 3P4OA 1NL0L 4KC3B 1UFUA 3QO1B 4L3AA 1HI6B 3G6DH 2A6KB 2EDLA 4PJ8D 1OGAE 3WFDH 4JFZL 1X44A 1FGNL 2V17L 5GIRB 5IEKB 5HGHA 4Y19A 5I8OL 4F58H 3D5OF 1I8IB 2FX9L 3MXVL 5FB8A 4WUUB 5GSVA 3LKSA 2HFFB 4G8GA 4KROD 4PJIB 1CN4A 3IFNH 4W4NA 4OGAC 2AXGB 4GW4B 5LAXA 1FYTE 2ORBH 2A2QT 2YA1A 4U0QB 2DQIH 3F7VB 1OSZB 2ITDB 3QWOB 4GRMA 4I3GA 1FH5H 5BV7C 2V2TB 4PJ7F 1S7RA 3LQMA 4OGXH 2J6EH 1MCWM 1ZT7A 3V5DB 4OIIH 4BSVA 5CBAA 2I60L 3WKMH 4JN1L 3QG6B 1S7VB 2O26U 3ETBF 4OLXL 2CPCA 1IKFL 1KJMB 4HAGA 3TT1L 5CS7A 3ARVA 1OP3K 1AHWA 4GG6A 4F9PC 5FYJE 3BKML 4HMDA 4WI4A 4HGWB 5DGQA 3PXHA 4Z0XA 1H3PH 4UU9B 2PYEE 2DQHH 2XACC 5DZOA 3LEXA 4NNPH 2ZUTA 3SGEI 4P59H 3WS6A 4P3DB 1IEHA 4JRXE 5E2TL 4L3EE 1HZHH 2XWJA 3SY0B 1S5HA 5EC1A 1IQDA 2GJZB 4PTUB 5B8CC 1EFXA 4DTGH 2PCPA 1IGTA 1U8QB 1W2KT 4Z7QE 2D7TH 2C3GA 3HG1A 1Q0YL 2X9YA 3RGVC 1NDGB 5CGYD 4H0HB 4XPGL 1SBSL 1TJIL 1YN7B 3TN0D 4JZNA 1E6JL 3BD3A 4HQQH 4PJFF 5BQ7A 3SJVD 4UIMA 3BPOC 4Q6IC 4Y5XB 4WUUE 3LHPH 4J7RA 2ZUYA 2GJ6B 4NFBA 5E94B 4XNQB 1PZUB 2IBZX 4PJIE 1RZ8B 5EO9B 4XB8A 1FIEA 5TQ2L 4JQVA 5TFSL 3D3VE 2O61B 2Q6WB 4YIQA 2FIKA 4F7EA 2D7NA 5F8QC 4ODSH 4R8WH 3WFEH 1RUPL 1D5MA 4D8PB 1M7IB 3SPVB 3V52H 3C6LC 4FTVA 3NCJH 1INEH 4U6HB 3SDCC 1TQCB 5EBWA 1FNSH 4EDXB 3DGCR 3OAZK 1FZJB 5KN5B 1U8MA 2HRPL 3PGCA 5DD0L 5DD1L 1RPQA 5GRZA 3VG0H 1B4JL 1J12A 4LMQE 2DWDB 3OGCA 4JLRA 3TBVB 2D4DA 1ORSB 1DN2A 3FZUD 4OZGF 3CH1B 1CLOH 2X4TA 4Y4KB 1JF1A 4WWKC 1VFBB 2VZTA 1S5IL 4JRYB 4WO4D 5EOTA 1MLCB 1KIUA 1XGUB 4XTRC 3GSQA 2FWOA 4G6FB 1VEMA 4PJ8B 4JFPB 1JZ4A 4P23A 3M8OL 4PJDF 2W07A 4FP8H 3PJSA 5D96B 4P5TA 1AY1H 3PL6C 4NN7B 3PNWB 1QKZH 4PBWD 1HWHB 1B4RA 2G9HA 3S96A 1HHJB 1S7SA 4K7FA 4K8RC 1T6VN 1L0YA 4YPGB 3SKMB 4PJ9A 5CLWA 3P73B 4OBRA 4IHOA 4KROB 4GUPA 2Q8BL 4LCWA 2FGZA 1FVDB 1EBPA 4KZDL 1IAKB 1LHZA 3U7YL 4CW1A 1LWRA 3S37H 5JPNB 2YEZA 43C9A 5DUPL 5A3ID 4ZD3H 3RI5F 5CEXB 3ESVF 4ZAKD 1BZQK 3U0PA 3BVNB 4IM8A 1UC6A 3BP5A 5F6HJ 4M6OH 1D9KA 2GJ6E 3PHQA 1NCUA 2DQEH 4HG4J 5GGVH 4GQ9H 3GNML 1CFSB 3G6JF 3IDJA 4JHBA 1F8TH 2ZUSA 3HRPA 1YEDA 4HIIA 1JWMB 3Q6GL 5CCKH 5E2WH 1RZFH 1R5VB 3C09B 5ETUB 1I7ZA 1HN1A 1LEIB 4PLJD 2JJWA 4DFHA 5JXED 4OUUB 2XZZA 5JDSB 4KRLB 1V3LA 4I9WE 3D87B 3MGOA 3BPLC 1KBGH 4AENA 5IR1B 3TBSA 1OPGH 1KCUL 2KZ1B 1Q9OA 2QEJA 1OWRM 3CLEH 2XPGB 9CGTA 4YR6B 2BSSA 1NAMB 1AXSB 2VXVL 4XPAH 1QACA 5I18H 4PGEB 2QQKL 4ZTOH 2VKXA 5FO7A 1VACB 5B38A 1RVFL 4UV4L 4G6ML 3AGVA 1E4KA 2KZWA 3WLBB 1JL8A 5LCVL 1J88A 1BX2A 1F58H 1RZIA 4ZFOB 2VMFA 5ENWB 1J9CT 3TN0B 1F6AA 1UH3A 3EYQC 1T04B 3I6GA 1CICA 5D1ZD 3S36H 1XF1A 3SKUD 5JTWA 1F11A 5SWZA 2AGJH 3KLAA 1EERB 1IGYA 2EEBA 4UQ3B 2E6QA 5F97E 1SJVA 4PY7B 4M7JH 1MAMH 4JFFB 1T2QH 3FTGA 1NGZB 1OAXH 1R5WA 5F9OL 3RL1B 3RUGA 5BS0B 2R2HA 3MLXH 4OQTL 2YRLA 4KK9C 4XP9L 4AL8L 1WV7T 3HMXA 4BM7A 5AAMA 5K9KB 5BW7A 3ULUD 1TITA 2AQ1A 1TJGL 3TLRA 2Y7QA 3BO8B 4JFDD 1C16B 3RKDD 4ZMAT 1P4LB 3SKNB 3FL7A 3GO1L 3MV9D 5EWIL 3AXLB 4RFNB 1BIIB 3ARGD 3ZE0F 1NCTA 1A7QH 4LSVH 5I1CL 5GGUA 2VLRD 4CDHA 3MMEB 5DFTA 4NZUL 2NY5C 3KS0H 2VZ3A 2ERJC 5HYEA 5I19L 4IOIB 2ITCB 1HINH 4JZJB 5EPMB 4FFZL 1Q9WA 3DX8A 2MCPL 4OAWB 2HVKB 4WO4B 4OCWL 4XHJC 5ICXA 3INUH 3PWPB 5ANMA 1TFHA 3WSQH 2DL9A 1IC5L 2VC2L 2BY1A 3MRRB 4KJYA 5CHNB 1H5BA 4MVBD 4HUXB 4NM8L 4KJPC 2VDLL 3TCLA 1YQVL 3QUKA 4XI5D 5K9JL 1XH3A 3IJSA 4O2EB 4MAUH 4GRLD 3NPSC 5HI5C 3MBEB 3O6LL 5K59E 2ESVA 5FYJL 1YNLL 3NGBB 4HC1H 1T1WA 2GTWA 4LPTA 4HXBH 5SWSD 1MRDL 2XICA 2OL3H 5BRZB 1CL7I 3ARBC 5BMFL 3SJVE 2JTDA 3SDAC 3W2DL 1N5AB 5ESQB 1WAAA 5H37H 3GSXB 4JPIA 3BRGC 1MFBH 1NGPL 1SMOA 5F9WB 2R0WL 1FFOA 3H6JA 3LN9A 4HUWA 1EUTA 3RIAK 4NT6B 1BFOB 4WI2A 4BQBA 3QEUB 1ZHKB 4HFWA 4JFYA 5I1DB 4JDZA 1XF2B 1F3JB 3BSZL 3FAXA 3MNWB 4Y88A 1HNFA 3VFVB 1YEFH 1XMWA 1AFVH 4GG8B 4Z7NE 5EUOB 2R1WB 4Z95L 4FFWD 3CAFA 4U7MA 3BD4A 1NUFA 3UC0H 3LDBB 4Q9CA 4JZOA 3WNOA 1CXLA 1H3XA 4WW2A 1A5FL 3GJFB 3BDBA 2WQRA 2PO6B 3QDJA 1U92A 4QT5A 4TQEH 5I1EL 3UJIL 4K8RL 5E8OB 2P8LA 3VXQA 3WJJC 4NUGH 5J8OA 1BLNA 2ADJA 5DD6B 1I8KB 2VQ1A 1X5AA 3NFPB 4O58H 4H1LG 5D1ZB 3VFUB 4NNXA 3GUTB 4RFEB 5I71B 3EYOB 2CUIA 1SY6H 1SM3H 3OXSB 5IOPA 4GKSB 4Y4HD 2FB4H 5GGRA 5HHXL 1QD0A 1KN2H 2EO1A 2XN9E 3N50A 2G5BB 1YA5A 5D7IB 4LGRB 1DBBL 2CJUL 4XZUA 1RUQH 3WFHB 2DLHA 1AC0A 2AV1B 1MJ8H 3QQ4B 4O02L 1B90A 2HRLA 4PB9L 3CD4A 4HZAA 5SX5H 3EBAA 1U8HB 3X17A 2CIIA 3MV9B 4OF0A 3ARGB 3QIWD 4ZPTB 3TJHC 4J1UA 1FZKB 3ARDC 3O9WA 1NEZA 1ZLSH 2CRYA 4TVPD 5E4IA 5CILL 1ONQA 4AYFA 4L5FL 3ZL4L 2Y6SD 5C07A 4JY5L 25C8H 3QQ9D 2NZ9D 1XCTB 5D1XD 5EUOE 1ZLUH 1B2WH 1Q9KB 4KAQL 3BQUD 4HJGB 4YC2C 4NZDA 3KPRD 4ELMA 4GLRI 5JW4M 1F42A 4NBXB 1MLBB 1ZWIA 1PBYA 3BKJH 3ROOB 1RIUH 2A77H 1J1PH 4LCIH 1OT1A 4ZAKC 1ZT4B 3QWRD 4Y5VB 1VFUA 4PRIA 4DVBB 1ZA6A 3DVNB 3OKKB 5TQ0L 4M7LL 3FQUB 3NZHL 4NOFA 3HAEG 4AK1A 4I0PC 2HJFB 2QHRH 1K2DB 2I9LA 4NQCD 4XXCC 1U8OB 4OGZA 1S78D 3HI5H 4BSWB 1JTOA 1A1OB 4L8SA 4MLSA 5FKPB 5JA8B 1IBGH 2HWZL 4IBLT 3SO3C 5HYJA 2NY3C 4LHUD 1JYXA 1N2RB 3KYKL 1YPZA 3T4AA 1IL1B 1FC1A 3O45A 5IB1B 1D3CA 3KGRA 2P42B 2PTTB 2X4RA 4JM2A 5IJVB 3WFBH 4X4XB 3KPMB 4NQEB 5DJDA 5F7HA 5MP6L 4P4KB 3TV3H 5KS9A 1F4YH 4LHUG 5LGJA 4JR9H 4LVEA 4MXWL 5D7IE 3EKCA 3ULUE 3GKWH 1ZANL 2BSRB 3HNTH 5TJWK 1NPUA 4JFDE 3X14A 3A67L 2F54B 3IFLL 2XFXA 4HWNA 3MV9E 4M5ZH 1OB1A 4L9DA 1UZ6F 4M02A 2VLRE 4OLUL 1KCSH 4YBHA 4U6YB 4R4NC 2X44D 5F1SA 2GT9B 1EPFA 4PJEF 1BIHA 1CK0H 3NCEB 3D39A 4X5WB 5IK3A 1UEMA 1KPRB 1T03L 3FT4B 3WFCH 3CNKA 5TPWL 1IAIL 1N7MH 2KQNA 3L5JA 3ZT7A 4FXKB 1LK2A 4HCRH 5I30H 4ZQKB 3CXHJ 3C6SB 2QL1A 2QQQA 3TH4T 5F88A 2I07B 3TVMA 5CJXA 4U1LA 2APBA 3WNNA 4ONHA 4BFEA 3HE6D 4KKBC 5FO9A 4U1HB 3LY6A 5IHZA 3TZVC 3GSWA 3U48A 1I1FA 3QZWG 2Y06L 5SWSE 2Z91A 4B41A 3DPBA 5IBTH 1J05B 3HZKB 1NAML 4Y4HB 2D7OA 3O2WH 3P40A 5IFHL 4ODHL 4U1SB 3P9MB 4BQ9A 3L3JB 3C5ZA 1T3FA 5DHYB 3CDYA 2JELH 3MRDB 4ODWA 1T1XA 2UWEA 1JHTA 2A6IA 5DVMA 2NX5B 4QRRB 1CFTB 6FABH 5E8NB 2OBGA 3ARRA 2R4SL 1DLHA 3QIWB 2BVPA 4WU7B 1N4XL 4XI5C 5BVJB 5IW6A 1BMGA 3TBYA 3TC9A 1Z2KA 4UB0L 4GRLC 5A2FA 1QO3A 3O3BB 4JO2H 4NOBA 3WS3A 4M1DH 5L6YL 3FOMA 5D1XB 3MREA 3CK0H 4WEBL 3BQUB 1A4KB 5KSAB 2YUXA 1JRHL 3EO0A 3WN5B 2NW3A 4KFZC 2WUCL 3C9NA 5DTFA 1FGVH 3RY6C 1S9VA 1WCBB 3VXUA 1P4IL 1P84J 2Q86A 4N5EC 4I5BA 2Q3AA 3D1MC 3I50H 1KV3A 4RCAA 3L3DA 4QHNB 4CKVX 4YHLL 5I17B 3ZDXE 4K94C 3J8F7 3PQYA 5IMOA 2NY0D 1BGXL 1DLFL 4KPHH 1EH9A 3BH9A 4F3FA 1DVFB 1KJ2A 4GKNA 3B9KB 2OX5A 4YAQA 4H0GA 5J6HB 1T7ZA 2FJGA 3VFTB 3V8CA 1JMXA 3KJ4C 4LHUB 5JQ6L 5EORH 3GHBH 2F5BL 3HS0A 3O3DA 5K9OB 1RD6A 4YDJA 5EOCH 4FXGB 2NPLX 3FQWB 5M95B 1BQHG 3OXRA 5KAQF 2PW1B 4HS6A 2HKHL 4OGYL 5KW9L 1FPTH 1T0NA 4KRPD 1CGVA 4OZIB 1WIOA 2VL5B 4LIQH 3OKLB 3GSNH 4B0MM 3B9EA 5EZOL 5C2BL 5IB5B 1QPPA 1FVCA 4R97B 3JWDH 1S7TB 3E6FA 1ZTXL 4RMSA 1CFVH 1FFRA 3T65B 3T1WA 3KDMA 3ES6A 2PXYC 1NCAH 4PJHB 1BQUA 4PGJA 1XIWD 4MJ6B 3UXFA 2D9QB 4NWUH 1YEJL 1CS6A 1QLRB 4TVPE 3ZYIA 4OQTA 4OV6F 2YXMA 3CSYB 4LVOC 4PYGA 1OGAA 3GSVB 1ACYH 3LKPA 5D72H 4ZXBC 3UTQB 4F9PA 4PRAB 3UYPA 4JKMA 3B5HA 4OF3A 3KPSB 5E2VL 1NMCC 3KPRE 4GW5A 4NRYA 3UYOD 5FGCB 5GPRA 1TTGA 2QSVA 3O6FA 1FYTA 3IXTB 1EHNA 3WEXB 4TOYL 3UJTL 3PWNA 3HE6B 4FG6D 3HE7C 3O3AA 3IKKA 3NH7H 3P4LA 1XGTB 3LSOB 3EYUL 4NQCE 4XPHH 5JW5B 3RGVA 5EUKA 2XZCH 1PEZA 3OKNB 1I8MA 1KB5B 4J3SA 2H26B 1BVZA 5TE6H 5I1HH 4GRWB 5DEFA 1JYVA 1E4XI 2VXQL 5FO8B 1JFQL 4MJID 5GGTH 6CGTA 3I84A 3MCKB 3RTQC 4NN6C 5GGVY 4Q6IA 2F5AL 1KCVL 1MCOH 1R3HB 1R24B 1TVHA 3EJYD 4LQFL 2XZAL 4KY1L 5CFHA 3GB7B 4DUWA 2PYEA 2H3NA 1J8HB 3FO0L 3S4SA 4OZIE 4DN3H 4AJ0A 3VXMA 1IM3B 1CDJA 1I1AC 1MAKA 4XCEB 4M62H 3V5HB 3LQZB 2F8VA 3CMGA 4JRXA 4KH2A 2GCYA 4WU5B 2EXWC 1OTUD 3DV4B 4ERSL 1NCWH 3TYFA 2QQLH 1WEJL 4OJFH 3X12B 2AJYH 3SDCA 2CRIA 1OOAA 3CSPA 5GJTH 4PJHE 2X89A 2AK4D 5DJAA 1HI6A 1GPOH 2A6KA 1MJUL 3LKNB 4WCYL 5A16B 1YMMD 5DXWA 4BH7A 5DT1L 2NY7L 5IEKA 3T4YB 4F15C 4WWKA 5C8JB 3AAZA 2GEEA 3ULUL 3D0LA 2H9GB 3MJ9H 2EDDA 1A21A 4LLQB 2G5RA 4PJIA 1R3KB 4U1JB 3WIHH 4JDTH 1HSAA 4RMTA 2WWKO 2R69H 4IRJD 3LH2H 3WHXB 3D3VA 4X6BB 4FS0A 4RAHA 1OSZA 3CMOL 3UTPD 1CFBA 1KT2A 4IJ3B 2J8OA 3MBXL 5GS3A 4WEUD 4WI6A 1XAUA 1LE9A 1EO8H 4KMTH 2DQTH 3TO2B 4IRSC 2NY6C 3VMNA 1BEYL 1S7VA 4CJ1A 3G5YA 5IHBA 1CFNB 1D6VL 5DMKB 2VLJD 4I1NB 4YGAB 4KRPB 2P45B 3QI9C 3LV3B 4MXQD 2ARWA 1AKJD 5C7XH 2DYPA 1I9IL 2NY1D 4N9GA 5DJCB 2W9DL 1DBJL 4JJHA 1IGFL 2CMRL 5GS0C 5ACZB 3N9GH 1JZ6A 3LKQB 1GVIA 2OR8A 3UBXI 3O4LD 3RVXC 4I3RL 4KI1A 1G6VK 2VDRL 1MNUL 4P3DA 1UB5B 4DKEL 3L3KB 3EDDA 5I1KL 4YDIH 1U8QA 2WUBL 2DLTA 3MQIA 3K4ZA 4AEIL 3HZMA 2OK0L 1IFHL 5D1QD 4YXKL 4CNIB 3S35L 3OKMB 4JHWH 1FQ9C 1OTTC 2YSSA 4GKOA 3V9FA 1FN4B 1FLRH 2Y36L 4ODTL 4YHNA 3WLWD 4A6YH 3U82B 3MO1A 1ITBB 1WBZA 4YO0B 4NJAH 3Q1SL 1CD0A 4KQ3L 1RZ8A 3Q3GB 5AZ2L 3KLSA 4HWEL 4HKZB 1VERA 3OAUL 2O61A 1FNHA 4XP5H 4DZ8A 3C8KA 4HJJH 3L3OA 4MD5A 2IPKA 2HTLD 1G7HB 1TVBB 2EE2A 4KK5C 5CSZB 5ALCH 3RRQA 5HYIA 4D8PA 4MJIB 1M7IA 3MCG1 3SPVA 3UTSB 4ALAL 5JMOC 5ICYB 2ZKHL 1FRGL 2HP4A 1B6UA 3VH8G 2WSKA 3NIDE 1P9MC 4EDXA 4KVCL 1AC6A 1NLBL 4QRPD 4XNYL 2DMCA 1YEGH 5H37G 2V5TA 4DQOL 1DQTA 4S1QL 1RHHA 3GMQA 3TBVA 1M7DB 1L0XA 3TA3C 5DQJB 4LSSH 3CH1A 4Y4KA 2VDNL 4L1DA 4S0TD 1PW3A 1VFBA 1U8IA 5FHBL 2JK5A 4E9LA 2NY0C 4Y8AA 5T1MA 3V5KB 2AXHA 5I8KL 5FCSH 1MLCA 1S3KH 1VCAA 5MEQB 5F7EL 2AK4B 3QEHA 2R0KL 4UUJB 1D5IH 1A22B 4L1HA 3O3EA 4NHCH 4PJ8A 4JFPA 2AEPL 2H32H 2HH0H 3WXVH 3RWJB 1A3LH 1A1MA 3QHZL 5J3HC 5B3JE 4ZO6A 3KXFA 5EC2A 5BCAA 2RQ8A 2YD6A 4CU6A 3REWA 3OZ9H 2DLFH 2VKWA 4IRJB 2X4OA 3DX7B 5JW3L 3O4OC 1U95B 5E99L 3LD8C 1EJOH 1HHIB 5JPNA 1HOCB 2L4OA 2HT3C 3ARYA 4JGUA 2ILLA 4KI5D 4TVPL 4WVRA 1JHLH 2ADGA 1RURL 1MJ7H 4LDOB 2YR3A 1KNOA 3HB3D 5JHDD 1WAAF 4XBEH 4XPBL 4YXLH 5DD3L 2IPTH 1XIWC 4UIKL 3DUSB 1DBKL 2QQNL 3UTTD 3PDOA 1IGCL 4GXVH 5ETUA 1AKJB 4MJIE 5CUSL 2EO9A 1CGTA 1UQSB 4UV7H 5JDSA 3G9VA 3F7QA 3FMGH 1QSEA 3OR6B 1A6UL 1P7HL 1AGFB 3ZSTA 1X5YA 3GKZA 3QJHA 4O9HH 3O4LB 1NAMA 4APQD 5FUOH 2ID5A 4N0FB 3V0AC 2DQCL 1QSFD 3FN3A 4H5SB 3QXDA 4L9LB 3U7WL 1N6QH 5TF1H 1WLHA 5E2JA 1FV1B 3UPAA 3B9AA 5T1DL 4TUJB 3WLBA 3BN9D 3AB0C 2AK4E 3JBG7 5F96H 4JKPH 4J23A 4R3SA 4EVNB 4NO3B 4M8VA 1YMME 4HBCL 5HVHB 1FFPB 1U3YA 1T04A 3SCMD 4LRIC 1FNFA 1RI8A 2OL3B 3SJVA 1NKRA 2A1WL 1NDMB 1JZ5A 1RMFH 4WY7H 5CJ5A 3P77A 3FO1A 5DD5H 5I8CB 2MMXA 1BM3L 1QBAA 3MUZ1 3QHFH 4FFYL 2AJVH 2DIBA 3WJJA 3IVKA 3DRTB 3UTPE 3V6BR 4DGIH 5E8DL 1C7TA 1MHPH 3MSPA 1T89C 2VB5A 3OHXB 4JFED 1RIHH 1TIUA 1NGXA 1FFQA 3C2AL 1OTUC 5K9KA 2A6DB 2N1KA 2BNUA 4OIAA 3BWAB 5I9QC 3WFDL 5HGDB 1YY9D 4ONGH 1C16A 3TNMB 4OFVA 3DURB 1GIGH 4F58L 5KSUB 2VLJE 1U8PB 3QRGH 4QRPB 3WV0A 3QNXA 1PX4A 5IMLB 4UDUA 1R3LA 3IFNL 3MMEA 2IALA 1T66D 2XG4A 2DQIL 4JZJA 5EPMA 1CFQB 3GIVB 2R4RH 4I48A 2ADFH 3GM8A 3MJ8B 4OAWA 2HVKA 4P2QD 4WO4A 1U3HD 1FH5L 2ICEB 4L4TD 2LTQC 3O4LE 4EUPB 4LBEA 2BC4B 3B43A 4OGXL 2J6EL 1KB5L 3OQ3B 4OIIL 2BVYA 3UTZA 4FQJH 4AEEA 2AVGA 4HUXA 5T5NG 3I2CH 3ARDA 2AJ3A 1V7MH 2HAZA 1UXWA 4FQLH 2J1KA 4WIQA 1E4JA 2KPNA 2HN7B 1U93A 3DMMD 2A38A 1NC2D 2F15A 4ZS7H 4TUOB 1MY7A 2N56A 1LEGB 2XOTA 2YPVH 3TFKC 2CDEA 5D71H 1WIPA 4X7TB 4NQSA 1XGPB 1HQRA 3PV6B 1JHKH 1H3PL 3FFCD 3HKFA 2DQHL 5ABDE 4NNPL 3FFDA 1NKOA 4ZAKA 2NY1C 2XN9A 4IS6B 4MNHB 2Z8RA 2H1PH 1KXTB 1S7QA 1YPZF 5J89A 4W4OA 3HI1A 3BH8B 4ZYKA 3NIGE 1N5AA 3QUXD 5LWYH 5JHDB 4OLEA 4JM2F 1C08A 4GRWF 4BYHA 5EZLA 3PP4L 3HPJA 3REVA 4DTGL 1Q0XH 2J88H 4XCYB 1JV5B 2D7TL 3QEQD 4NT6A 1F4WH 3UTTB 3VD3A 2NNAA 3QEUA 4E0RA 5HDQH 2VTFA 5JXEA 4QRQA 2D03L 1XF2A 1F3JA 3EW3B 2BHYA 4HQQL 4PY8J 4CMMB 3H9YA 1MCKA 3O8XD 2AK1H 4PJAE 5EUOA 4QRPE 1U8LB 1W0VB 3BD5A 4Q9QL 1UZ8B 3P30H 1KTLA 3LHPL 1NJ9B 5D1QC 2V7NA 32C2B 2IADA 1P6FA 5E8EB 5DMJB 2IFGA 3C60C 1ITCA 1UADC 3EFDH 4YFDB 1QSFB 5ID1A 3GJFA 1AO7A 3V0WH 3VE0A 5DHXB 3G04B 4ODSL 5CD5D 3WFEL 1KULA 2X9XA 5E1HB 3V52L 3VFPA 4XMKH 4JHAH 1INEL 3IFPB 2W9EL 3CZFB 2A9NH 1VADB 3FT2B 4HD9A 1WFNA 4ORGB 4QYOB 1PGRB 1FNSL 1HXMB 2ICWA 4N8VG 3LKOB 3VG0L 5C0EA 5D1ZA 3VFUA 3AVEA 2FGWH 4PGDB 3GUTA 1FAIH 3QXTA 3H0TB 2OS7A 3EYSH 4K9EL 2A73B 4KKCC 1TETH 2W60A 2XKSA 3HR5A 2HT4D 5HY9B 1X4YA 1ZEAH 4KI5E 1T7VA 5I16B 1T5XB 2IJ0C 3IFOB 2X1OA 3F6LA 5D7IA 2ENSA 2FCBA 2YBRB 2NLJB 3NCFB 2BERA 2AV1A 5HGBA 1IAOB 5JHDE 4FP8L 4HX1B 1ERNA 3PHOB 4JFDA 3UX9B 1U8HA 4MHHG 3RVWD 3SN6N 2F58H 3MV9A 3SDAB 4KUZH 1DL7L 2XZQH 3UTTE 1LO4H 2D7QA 4WDIA 2BVUA 3PXJA 2VLRA 5DC4B 4Y2DC 4WWID 3V0VB 1ZGLB 2F8OA 5E0QA 3M07A 1GRWA 3DIFB 4V1DD 3S37L 2E3VA 4P2QB 4ZD3L 5T1LA 1BBJA 1L6ZA 1XCTA 1U3HB 3BGFC 4L4TB 1Q9KA 4CMHC 4ESKA 5F6IC 4YZFE 4HPYH 4M6OL 3MLVH 1MLBA 2DQEL 2FJFA 5GGVL 4GQ9L 4KHTH 1QSFE 4Y5VA 2GYSA 1MHHA 3DYMA 4LF3A 1F8TL 3OKKA 4GRLA 1I3UA 1CXIA 1NC2B 1RZFL 2VLMD 2KDGA 2AEQH 2HJFA 1HEZB 1A7NL 1LK3H 5IW1B 3BGMA 1U8OA 1ZLWH 2R1XB 2XNAA 5SWSA 2BMKA 2OI9B 2VDOH 4BSWA 1IC7H 2VXUH 4PIRF 1QR1B 1KBGL 4U1GC 2HMID 2V5MA 5ESAB 3FFCB 4QOKB 4IOFD 4Z7VF 4PRPB 1YNTA 4XPAL 5EU5B 3QUXB 3ESUF 4PLKD 2PTTA 3ZKMD 4ZTOL 3G08A 1ND0A 1UM4H 3KPMA 4FN0A 3MR9A 4G3YH 5IFJA 2C1PA 2FRGP 4AMKH 1JNNH 3TIDB 3V79C 4PR5B 3OGOE 4JFEE 3QEQB 4Y7MA 1TCMA 3SE9H 4X6FB 5GGQH 5HDLA 2RR3A 2BNRD 5C86A 2DI9A 5E7FA 2HKFH 3KJ6H 3ILQD 3O8XB 2F9BT 3BPCA 4OLYL 5DHVB 3O11B 5FK9A 3CCHA 2AGJL 4BJLA 5DJ6A 4M7JL 1EV2E 3SCMC 1MAML 4XVSH 1T2QL 1U41A 3ZZ1A 1OAXL 1EAPB 3N85H 4N8VB 3LPWA 4H1LA 5FCUH 3MLXL 2QSQA 4P2QE 1A3RH 4L4TE 1R3IH 4KKLC 3MA9H 4OZHB 2JCCB 1NANH 1INQA 2R56L 2PXYA 2GJJA 1G0XA 5DQ9A 4PB0L 2C26A 1OY3B 5D7SH 4QXTA 3MRNA 3WMSA 2AI0H 4P57A 2I07A 4P9HC 4M7ZC 2NY2D 3KYMB 4L8DB 3UBXG 1BBDH 4LSVL 2EICA 5I0ZA 2CKBH 5GISH 5F72S 1XGYH 1DANT 1FLTX 5HBBA 5DS8B 4CVXB 1HINL 1NCDH 4NKQB 2APXA 3TBTA 1J05A 3FFCE 3HUJA 3RPIB 3INUL 5FKAA 4PBXA 5JLZA 1I8LA 3WSQL 4CDGC 4YHKH 4MMXC 3KPNB 4P46C 4X6DB 3QT2A 4XHQA 4LARH 2EYTB 3ECBB 2IAMC 3MYJB 5MI0C 2NYYC 5C70A 4MAUL 3NMEA 4YWGH 4X9GA 4YGVB 3RWEA 3W39B 3QEQE 3QIWA 4HC1L 5C08B 1RUKL 3V6ZA 4OLWH 1JTTA 2HG5B 2F53B 3CPLA 1JGLL 2FZ3A 3ARTA 5BVJA 4KK6D 3W11D 4HXBL 1C7SA 5TDOA 2OL3L 2OM5A 1W8OA 1BOGB 4V1DB 3TPUA 4HUUB 1P2CA 4Z78A 1W8NA 3HAEA 5DDHB 4JDVA 1JCKA 4LLUA 3BQUA 5C9JB 3KPRA 4M7KH 5L7XH 4HZLA 4OKVA 3H3BC 1LO3H 3QWRA 3TNNB 3MRKA 1WCBA 1VHPA 2Z31D 3D69B 3W0WA 1EZVY 3DI3B 1M6OB 1P7QD 4OZHE 5F7YC 1AD0B 5J9PB 3UO1H 5INDA 1JNLL 3KVQA 4NQCA 1MHCA 3FQTB 3ALPA 5J6HA 1GJIA 2FYYA 1RZKH 2MCG1 1YEFL 1AFVL 4JJ5A 4LHUA 1V7NH 2C1OA 2DIAA 4N0UB 5GRUH 3RQ3A 2LU4A 1UB6B 5JIIA 1K8IB 3ROLA 2R0LH 3UC0L 3QUZB 3QIBB 1TZHB 3AS0A 4ODVH 4WTZG 4OV5A 4RISH 1W0WA 1SJXA 1MWAB 4TQEL 1CDYA 3TZVB 3M17A 3T1FA 5ISZD 1LO0H 4OI7A 3F6IA 5L0QC 4NUGL 2BNRB 4LIQE 1MHEB 5HSFA 2FBJH 4NKMA 4RWHA 1HHKA 1WWBX 2I27N 4HH8A 3FONB 5GHWL 5CKAA 1LE5A 1X5LA 4O58L 5KOVC 4PJHA 1NGQH 2VR9A 5IGXL 3K1KC 3PG2A 1PD6A 1BVKB 3RVTD 1SY6L 3GSUB 1J1OH 1TPXC 3X3FH 1SM3L 4PRNA 4LEOB 5HHPB 4V1DE 2VE6B 1QOKA 4Z5RB 4Y16D 2FB4L 4DKDC 3AC0A 4OD1H 4HDIB 3GMNA 3LPGA 1CF8H 3QZWA 1D5ZB 3CVHB 4X7EC 3QRFM 1YUHB 1DFBH 3DV6B 1NAKH 4JY4A 4ZUWA 3GI8H 3IXTA 3ZKXC 2MKWA 3UDWC 5GZOD 3WEXA 1F00I 3P9LB 5JHLH 4JM4H 2NY2B 1G9NL 2XA3A 1UWXH 3N06B 4U1IA 3ZHKA 2VLME 3L3HA 1U8NA 5GGSB 3T3PE 4DGYH 1ZLSL 2BVOA 3LSOA 2I25N 4O2FB 3BKYH 1CE1L 1OP5H 4KU1A 3RNQB 3JWDC 2J6EA 1JGVH 5D93C 3Q5YA 4N0CD 3RVWC 4RDQG 4WNQA 4E5XB 1UKQA 4GS7C 2EXYD 1B2WL 4EIZC 1T83C 2YD5A 4WHDA 4N0UE 3OBAA 4MQXD 4NDMA 2AJUL 1RJYA 3DUUA 3BKJL 5I8OH 3MCKA 1RIUL 2LFGA 2A77L 1J1PL 4LCIL 3MXVH 3CIQA 5E7BA 4DVRL 2R29L 4LHQB 3FO9B 1N0XH 1OGTB 3CU1A 3QFJD 4HWZB 5D7JC 4QTHA 1LO2H 2QHRL 3V5HA 3STBA 4ODUA 2BNRE 4NQVB 3DV4A 3MRCB 1A6WH 2N4IA 1IBGL 2KQMA 3IDYB 4PFEA 3N1PC 4JN1H 1EX0A 3MGTA 1S7UB 1FE8L 1IEAB 3DI2B 1S7XB 1KIPB 3LVEA 3LKNA 2R9HC 1HYSD 1HK6A 3VDAA 4NO5B 5JR1L 1IM9A 2VERN 4D94A 3OAYH 4XCCH 3STZA 3T4YA 1GAFL 15C8H 2D31B 4X8JB 3TV3L 1P7QB 1F4YL 2M1KA 4H88H 4UI2A 4JR9L 2WIIB 4FHBD 2OCFD 3ALXA 1JPST 4U1JA 3T3MF 4ZXBB 1BQHA 4FQXD 1E27B 4NZTH 4H8WH 4X6BA 4J3UA 3EYFB 3NTCH 5CEYB 2JE8A 1NMCB 4XNUH 3MUHL 3G9AB 5KG9B 4G8IA 3VFSB 3P0GB 1KCSL 1C5CL 3BEWA 5HJ3A 3FAWA 4D9RD 2Q76A 5J13C 1Q0YH 1G0YR 1CK0L 5KSBF 4XPGH 4AIOA 2XQYG 3MNVB 3TPKA 5A40E 3HE7B 4N1CA 4OFKA 5EB9A 1CYGA 5L8JB 3LIZL 3WFCL 5ISZB 1D7FA 3HRZB 4DN4H 1HSBA 4HCRL 2Z4QB 5I30L 3QBTB 4Y4FC 1JF5A 3BJLA 4PJXA 3JWNC 1RIVH 3EFFB 4RMRA 2X70A 3DXAD 2Y5TB 5DF0A 1XIWA 1Z0NA 5TFSH 5IF0B 1KIRB 4XMLH 3ZSSA 2F74B 5FM5M 3BISA 1I7TA 4JQIH 4MX7B 1RU9H 3RWIB 3NZ8A 5C0AA 1RUPH 5IBTL 3VMPA 2Z8VC 4KUCD 5F1OB 1CLCA 4Y16B 3AMLA 1KFAL 2H32B 5FGBC 1H3UA 2C3XA 3O2WL 1J5OL 1S9XA 5MEOA 4J4PC 2CLZB 5HVGB 2NY4C 2HT2C 1A7OL 2JELL 2V5RA 3OB0H 4G9FA 4LLWA 4RQQA 4AEFA 5DD0H 1B4JH 3DBXB 5SWQA 5TE7L 4HH9A 5HPOA 1OVZA 6FABL 5E1AB 5LJYH 2VDKH 3F5WB 3QXAA 2EE3A 3SE8H 2YA0A 1YMHB 3ULVD 1CGXA 1LP9B 2J12B 4NIKB 4RGNC 5IBUG 4HKBA 1F90L 3Q3GA 4JO2L 5BZDB 3EUUA 3GMRB 4M1DL 1G7JA 1CLZH 1U8KA 4KWUA 4L8BA 1U3JA 3CK0L 4X4YA 2UY7A 43CAB 1ZT1B 3F7YA 2Z92B 1TVBA 4LRIA 5CMAA 1FZOB 4NCC2 1HH9B 2DQDH 2ZCKL 3OJDB 2LVCA 5IG7B 3DECA 3HLAB 1PY4A 2CIKB 3D85B 3VFWB 4LLYB 3LS4L 3KWWB 1PZ5B 1DANU 1JK8A 5ISZE 1G6RB 3QFJB 1RUAH 3BPNB 1T89A 5ADPH 2NY6B 3A6BH 1MUJB 5DQJA 1T2XA 2EDJA 4OF8A 1MIEH 2DQFB 2VAAA 1FNEB 4XMPH 1YY8B 2NTFB 3V5KA 1A9BA 3ARFD 4ZFZA 2WBKA 2I9TA 3DRQA 1BZ7A 3MRPB 3FB6B 4LKXB 2AK4A 2CDFB 4RFOH 2Q3ZA 3QCUH 5EOCL 3K4AA 3B9DA 2Q7YA 5IVOA 1YMMA 2W1NA 2JCCF 1UJ3C 3PWJA 1FPTL 1ZHBB 4LIQL 3GSNL 4MA1B 5AUMA 1RZGB 5IMMB 3HC0B 1BREA 4H26B 4FQXB 1E4XL 3JWDL 5DMYA 4IRJA 3DX7A 1CFVL 4OLZL 2VZUA 4GT7A 5EOQL 3FRPG 2QQKH 1JWSA 2B2XH 4AH2B 2QSTA 4NWUL 5IEHA 3NVQA 4ZFFB 1LP9E 1YN6B 4G6MH 4JGJA 3EYVA 1ACYL 1GL4B 5D72L 1T7YA 2X7LB 4QY8A 1TCRA 1JPSH 2XI9A 3DUSA 3F12B 4PRHD 2VLJA 4X6DF 3CLFL 2F19L 3Q0HA 4HS8H 2G2RA 1CGYA 1AKJA 2RFXA 4Y2OA 5D6CB 1E28B 4I0CC 3ZTNH 1U2CA 1WZKA 5HDBF 3M1BB 2VDPL 3DXAB 3O4LA 4JN2B 3VW3H 4XBPB 5KZCD 3QFJE 3U9UA 1A64A 1X7QB 3GMLB 1QPXA 4XBGA 1K3IA 4FOMA 1OW0C 4PJ5A 1U58A 4XP9H 4M3KB 5DO2D 5TE6L 3AS1A 5KOMC 3L5XH 5IBUB 4R4BB 2C4FT 3VFOA 1T1ZB 2EKSA 5GGTL 3WCYA 1T0MA 4HC1A 2H6PB 5D1QA 3MV8D 1Z9OA 3VGFA 3JZ7A 1RUMH 1AGEB 4R4FH 3C60A 4NZUH 2OL3A 2XQYK 4DN3L 4HFUH 4M7LT 1AR1D 4M62L 3L3GB 2MCPH 4OCWH 3KPLB 2DAVA 3VH8A 4QHMA 4LPWA 1NCWL 4RNRA 5F71A 2QQLL 4JFXB 1IC5H 4OJFL 3GGWA 2AJYL 4PJBB 3BI9X 1CIUA 2FSEB 5GJTL 2VDLH 2WNGA 1PKQE 4F33B 3EO9H 1OARH 4Z6AT 2A6DA 3BWAA 4KJQD 4D9RE 3O4OB 2UZYB 4JFQA 5HGDA 1BF8A 4X9BA 2FJHB 2P5EA 3CVHL 5KSUA 3LKRA 4PJAA 1OP3H 3I75B 5J12C 5IIEA 3MC0A 3MJ9L 1CD8A 3RFZC 2EIZA 4OTXL 1M71B 2E7LA 5C0DA 3WIHL 1OAUL 2Y23A 4JDTL 5BMFH 1CXKA 2R69L 3LH2L 2P8MA 2F8XC 1MCCA 1X9QA 3MJ8A 4X98B 1K4CB 1X5HA 1ZV5A 1AR2A 3DXAE 2OTPA 2CO7B 2BC4A 3PWVB 1NGPH 1EO8L 1DUYA 2R0WH 1PG7X 2DQTL 4KMTL 1SHMA 3B3IB 1JZ3A 3VFNB 5FYLD 1G9MH 2DI7A 5EO1B 5E8PA 4GFTB 2UYLA 3MCLH 5D9SB 4LKCB 3FHQA 3MJ7B 4LPUA 3O81A 3I3BA 4HK3J 4IOSD 5C7XL 1K85A 4MS8D 4LLMB 4TUOA 4YDKL 3N9GL 1S9YB 1X5JA 4MA7H 4S1RL 1XGPA 1QFWI 4P5MA 1SY6A 2GW5A 3N1GC 4MNHA 3ULVE 3DTXA 4TUKH 1A5FH 4PG9B 4MAYD 5MEND 1EO5A 5I0DA 2HVJA 3ZDYE 3K2UH 3TO4C 5JHDA 3DX9B 4NQDA 2BVQB 1AH1A 1SYVB 5C0JB 5JW4R 3L95A 5IB4A 4PRHB 3SKOB 4LAQH 4XCYA 5EU3A 5GS1C 3JV6B 3UTTA 3RL2B 4HIHA 3CFCL 4QRUA 4X7FC 5I1JH 3OAZH 5DJXB 4PGBA 3RBSA 4CMMA 1FLRL 2VISA 2WWKT 2ZG2A 1J0ZA 2ZG1A 1CE6A 4Z18A 4NJAL 5MHSD 1Q9LB 4APQA 4H20H 1JZ8A 5E8EA 5ITFB 1FCGA 3ZT6A 5C6WH 4JANB 5EIIA 1AIFB 1QSFA 4LLAA 2JB5L 1NLDH 1VDGA 2MPAH 4HJJL 3G04A 3Q5TA 5HYQB 1B9ZA 3U36A 4WW1B 2ADIB 3C8DA 5EIQA 2VR4A 3ILPB 2OQJB 1PQZB 1RJZB 5FUCE 5ALCL 2LE9A 5KVGL 5DK0A 4R6UA 2Q1EA 3CX2A 1VADA 3MV8B 4ORGA 2CD0A 4K3EH 1HXMA 3SCMA 1A2YA 4HHAB 4HIEB 2CDGB 1XCQA 5HHQB 4PGDA 4F7PA 5DMGD 4OFYD 1R0AH 1QFHA 3IDNB 4JREB 2Z93B 1AHWC 3MRMA 3LQAH 2A73A 4KAQH 1UXSB 1N64H 1N59B 2DM4A 3QCTL 5I6XC 4EQ2A 1AXTH 2HFEB 3BZ4A 5E5RB 1UGNA 5FA4B 1T5XA 4JFEA 3LRSB 3HZYB 1ETZB 2YBRA 3FQNA 4NHCL 3VD7A 4J8RA 4YDLC 8FABB 1IAOA 4C57C 3QDGA 1K8DA 2HH0L 4JHZA 4HX1A 3PHOA 1HH6A 3ARFC 1HILA 1A3LL 4F7MA 5B39B 3X13B 1K5NA 4PRHE 1EJ6A 5HTSA 4QRSA 1EEZA 4QKXB 4U6XB 2HWZH 3EJZC 5E00B 4FQ1H 1HXYA 3V0VA 5E08H 2DLFL 4U3XA 4Z7WB 3KYKH 4P46A 1FSKB 3GBLA 1EJOL 5T3XH 1GGCH 1I75A 1U3HA 1DR9A 1JHLL 4OQ1A 5D2NC 3SBWC 5MP6H 5I1AA 1B0WA 5FA3B 5BXFA 4XBEL 3GMPA 5HVFB 4MA8H 1VFAB 4MXWH 3BGAA 2IPTL 4HCRA 3DMMA 3IJHB 1ZANH 3BFOA 3E1F1 1O5DT 3WHE0 2VYRE 2V2XB 2GTZB 1ZLWK 3A67H 1MREH 1CDHA 2P44B 4UV7L 5E5MA 4YBLB 4AZ8A 2CKBB 3FMGL 2R1XA 3MV8E 1KOAA 1I3RB 1RZJC 3RDTD 3TIEA 4BFIB 1QR1A 1G6RL 4OLUH 5ESAA 3FFCA 3WIFA 2DWEB 4O9HL 1PYWA 1HCFX 2PF6A 5CD3B 4JQXC 4G9DA 1WZLA 3IGAA 1JPGB 4OCLC 5TGBA 3I6LD 3NAAL 4PV9B 5FUOL 3NFSL 1FO0H 1RJLA 3E2HB 3LB6D 3PIQB 1RY7B 3QUXA 2AJZB 2QADD 1T03H 1T4KA 5TF1L 3VWKD 5GRJH 4NKDA 4P48A 1H3WM 2LU7A 3T0VA 1MQKH 2OTUB 2ZNXA 1KC5H 1SJEB 5GGRY 1G7QA 5F96L 2J5LC 4JKPL 5I66B 5JNYA 1JYWA 4P23C 4M9OA 2X4UA 2V9RA 4P5TC 4PP1D 3H42H 1DQDH 3VA2C 3OKYA 4R96A 1QBMH 1B6DA 3G5VB 4G42B 1J86A 4H25B 4IIQB 1RMFL 4WY7L 2A74A 5DD5L 5DJ0A 1QA9B 3BUYB 5HHOE 5IFHH 4ODHH 3QHFL 1MH5B 4HMCA 2AJVL 1EAPA 4N8VA 2A83B 2IH3B 3HA0A 4DGIL 1MHPL 3MRJA 3L3IA 4OZHA 1RIHL 1Z5LB 3CFDB 2DLIA 3OPZH 4MQ7B 2PETA 4XRCB 1QFUL 1DE4A 4UINL 1D9KC 2R4SH 3MJGX 2B1HH 1RK1A 5FYLE 4P2RD 1URLA 4ONGL 2C3HA 3BGFB 1GIGL 3RGHA 3KYMA 3VFGH 3LRGA 3QRGL 4JCMA 4UB0H 2W92A 4LNVA 2HFGH 3UP1A 2R2BB 4MB4A 2HJKA 3D18B 1XZ0A 3RWGB 4WEBH 4JFOA 2GI7A 2E9BA 3VDCA 3I9GH 2C4FU 1JRHH 2ADFL 3TJEL 3RPIA 4R0LB 2P46B 5MENE 4PRDB 1ORQB 4PREB 5KVFH 3KPNA 1P4IH 4FQJL 1FJ1B 5BOPA 4YHLH 2J8UE 3I2CL 3GSNA 3T0AA 3ECBA 2W65A 4PY8I 4ZOCA 5EU7C 5E70A 5JIPA 1BGXH 1CDBA 2P4AB 5GSRA 2XKUA 1A9EB 1AD9B 1U36A 4P2CG 1E4KC 4YE4L 2VDML 2DICA 1QNZL 4ZS7L 5ESVA 2CR3A 2HG5A 5HI4C 1KLGB 2YPVL 4OT1H 1ZSDB 5DRNB 5D71L 5DJZB 3VXOA 5C0NC 4Z77B 3ULVL 4BKLA 5DZLA 3EJJX 1MEXH 5DDHA 4IMLA 5C9JA 2FNBA 2H1PL 1CICC 5MHSE 4E42A 1RV6X 2H2SC 5E4EB 1LO5A 5KW9H 4KZEL 4PG2A 4M03A 1WBYB 2RBLA 2EDKA 2BJML 4C59B 4U1MB 2Y4SA 1QRND 3D69A 1Q0XL 2J88L 5AD0B 4MD4B 3SDDD 4UTAL 3QXUA 3QA3B 1AD0A 5J9PA 5EBMB 1ZTXH 5HDQL 1N6VA 1LNUB 2B0SH 5IVXA 5BW7C 2P8PB 2EYRB 4MNQB 2EH8L 3RDTB 2WWMD 4DUXA 4M93C 1KJVB 3D25B 2AK1L 3ZDYF 4NNYB 3EDKA 3P30L 4N0UA 4MA3B 4NO2B 4LPYA 1XGQA 1L0QA 1B0GA 4PJBF 3LOWA 4N68A 5I2IA 2QADB 4CU7A 4YHIB 5GGTA 2QR0A 1NMBL 4UBDC 5IMKB 1XR9B 1NMAL 4FNLH 4NKOB 3DARA 4YDVA 3ZDZF 2EYSB 1TDQA 4RBPK 3PGDB 2A9NL 5GZNC 3U0TA 5FM5O 1LMKA 4W6WB 3MUJA 4PJXF 2FLBT 4ENEC 1N6UA 2FGWL 2UVFA 3ARED 1W72B 3MXWH 1FAIL 3NPZB 1SVCP 4LLVB 4QHKJ 4X9HA 1BVKA 1Q72H 3GSUA 1TETL 1RZKC 3JTSB 3K7UA 4Y5YA 4LEOA 5HHPA 3UBXA 4UNVA 2VE6A 4Z5RA 4HKXB 4Y4FA 5IQ7H 2VSDA 4P0DA 3MOBH 1ZEAL 2AAVA 4NO0D 1KCVH 3QO0A 1TZIB 4KGLA 3U2SB 1YUHA 3RVUD 3MJ9A 1UM5H 4P2RB 3CXHK 1CDUA 1CTOA 4OD3H 2ZSWA 4U6TA 3WIHA 3P9LA 2F58L 5DRZA 4KUZL 1LO4L 4ERSH 2H8PA 3D48R 3BZDA 3OKOB 4J4PA 5IB2A 3RNQA 3Q48A 4LVHC 2BP3A 2PYFB 4UOW0 5FOBA 3WJLC 3WUWB 2D7PA 4PJ7E 3MUGB 1AP2B 1UM6H 2X1XR 3F7PC 4HPYL 4K7PH 3VGDA 3I6LE 3S3PA 4UAOC 4KHTL 1JGEA 5D5MB 5DVOA 4WW2C 3PE9A 2VH5H 4MLIA 3FO9A 1WZ1H 2PNDA 4M61A 4ZUTB 3DYOA 2AEQL 4WJ5A 3D0VB 3QIUD 1DUZA 1LK3L 3CMOH 4OZGB 2B7DT 5F1NA 3RKPA 4XH2B 3MBXH 4XP1L 2VXUL 4YHYB 1VENA 2FR4A 1S8DB 5CP3H 4CN1A 1LDPH 1Z3GH 4GBXD 3UYRH 2JB6B 1KIPA 1D6VH 2EIEA 5JPMA 5MEPA 1I3VA 2Q8AH 4OD2A 2UVEA 2BSTB 5CZXD 4POZD 1UM4L 1VEOA 4G3YL 3BAEL 2Z31A 1P84K 1CLYH 1QRNB 5D7LB 3HR6A 4AG4L 1BZ9B 1DBJH 3D9AL 3O6MH 3A0OA 1CGSH 1IGFH 3RX7A 3I3EA 1P7QA 3SDDB 3LB6C 5GGQL 2ICWJ 3KLHC 3VWKC 4A6YA 2A6JA 4WTZA 5K93A 4P2RE 4Z7OF 1NUNB 2HKFL 3KJ6L 3OKEA 2R8SH 4PJFE 3EYFA 1A6TA 5CEYA 1OAQH 1MNUH 1GZPA 3WL9B 4JAMB 5KG9A 3AU1B 3BP6B 1UJ3A 1T20B 3VFSA 4CN6A 5ICZB 3GSRB 3SGKC 2AKRB 3T0ED 3X11B 3G6JB 3BEVA 3O9WC 2OMBA 1BVLB 5CJBA 5IP4A 3CUPB 1CG9B 2MKLC 3MRGA 2JIXD 4R7NB 3N85L 5FCUL 3KNBB 3VI3F 3MNVA 3EGSB 3RVVD 1R3IL 2ATPB 4LFHD 3MA9L 1NFDA 4BSJA 4YXKH 4C55A 3HMWL 2ZSVA 5FYLL 3BRFA 2AEIT 5D7SL 2Y36H 4ODTH 3QDMD 4D0CB 2AI0L 4F7CB 5DFWH 2WLYA 4EI5C 5DJ8A 1KXQE 4KQ3H 2V7HA 5AZ2H 3ULSB 3O6KH 2BDNL 1BBDL 4G8EA 4Z7WF 3AREB 2CKBL 2QKIB 4LFHG 2DKSA 3R0NA 2DMKA 3OAUH 5GISL 1XGYL 4OZGE 1AQDB 4HV8A 1U8JA 2B5IC 2X05A 1NCDL 4R2GD 2YC1B 3U7AA 2EZ0D 4ALAH 1M05B 4L8SC 4Y16A 5JORB 2H32A 1ZLVK 5CJOH 1FRGH 5CWSB 3R8BB 3GSOB 2CLZA 4J2XA 1OF2B 3OG4B 4KVCH 1XF3A 4HS3B 4LARL 1H8NA 4PJDE 1ED3B 1E0OB 1GZQA 1KTKE 4IMKC 4X7CC 2X4SA 5HHNB 1EBAA 1JGDB 1YEKL 1OHQA 1QRNE 3W9EB 1LD9B 1OAKH 1OW0A 3F5WA 1QVOB 2GY5A 3MRQB 4OLWL 3V7AG 5FHBH 1ZVSA 3O2VL 4I4WB 2YD4A 4JB9L 1NBZB 5IKCA 2EDTA 5F7EH 4OF7A 2R0KH 5C0GA 1T7WA 1ZXQA 2NXZD 2E27L 3QPQD 2FO4B 1BWMA 3DO7B 4M7KL 5L7XL 1QUNA 3VDBA 2X41A 3H9ZA 3QHZH 1KLUB 1LEKA 4LVNB 5FF6A 3G6JE 3VXNB 1ZK9A 3OJDA 4I77H 1LO3L 4LCYA 4KGJA 4HJ0D 3IU4H 3VFWA 3EIFA 4FABH 1U91A 1G6RA 1AE6H 3PGFH 3QFJA 5JZ7C 3UO1L 3QIUB 4L8CA 4G6KL 1N3NB 4JPVH 2UZIH 5CIPB 4TVPH 3QDHA 1RZKL 2DQFA 5F3BB 3LN4B 1FNEA 1JMZA 1NGWB 2XWTB 4I18B 5L2KA 3WO4B 5CJXC 3TVMC 4GBXB 4N0RA 1EEQA 2R2EB 4XPBH 1CXFA 2HLAB 5GRUL 5DD3H 5HHMB 2CDFA 3T8XB 1YC8A 1QR4A 2WWMC 5HDOA 2QQNH 5LG1A 4ODVL 4RIRB 4KJWC 2ENYA 4RISL 2DTML 2XTJC 2IH1B 5CUSH 5B22A 4MNGE 1WICA 4Q58C 3FOLB 2YD2A 4K2UH 4KVNH 4Y1AD 4EEEA 1RZGA 1A6UH 4OM1H 2CO6B 3U1SH 3NCMA 4X0KA 3T0XA 2FBJL 1IGIH 5DA0B 3VWJB 3H9HB 3T2OA 4CGTA 1MCBA 1FL3A 2WBJD 4YJZL 3LEYH 4OCSH 1PKQA 3U7WH 2IPUK 2SEBB 3MLRH 3T0EB 3TF7C 1J1OL 3X3FL 1DN0A 1A6ZA 1NCCH 3LN5B 5CZKA 3AS2A 4W6XB 1G7PB 4TTDD 1MF2H 1CF8L 4YHOH 1YDPB 2BOBB 1OP9A 4XC1L 5C2UB 1HHHA 4I2XB 4LSUL 3QUMB 3QDMB 4HKJB 4KV5E 2A1WH 4X5XB 4U0RC 1F3RB 1TQBC 2X4PB 4HW6A 4JFHD 5A2LH 2FX8H 3DXAA 5F89B 5T3XD 5DRXA 1U9KA 3C5JB 4CADA 4AT6B 4DGYL 1Q38A 3BKYL 3GMLA 4JRYD 2VLKB 5GS1A 2IBBA 4LSTL 4R2GB 5KJRH 3C2AH 4I8DA 5IT2H 2N7AA 3HZVB 3AY4A 4AEHH 2OR7A 4G6FD 3RP1A 4LLDB 3DGGA 4CRPA 3SGEH 4Z76B 4U49A 3ET9F 1U6AH 1T1ZA 4O51B 1JN6B 1MRCL 3QP3A 4Z7UA 4PLNC 3KYOA 3RWHB 2H6PA 3QB7C 4ZDHA 5CEZD 2O5ZH 3VXPB 2X2YA 1A4JB 4P5KB 3V2AR 3BZEA 3K4DA 3K8KA 1N0XL 5DEZA 5BJTB 3IDXL 1WVZA 4R90H 1WFOA 4LU5H 1UKSA 1LO2L 4NQUA 3VI4F 3EO1B 1FL6B 5E5UB 3MOAH 3QJFB 4FFVD 4JFXA 5EBLA 1A6WL 2CUHA 1KB5H 2NXZB 5HYSB 2FL5B 3KHQA 5EU4B 2JJVA 5JA9A 3MLSH 4F33A 4GRWH 2GITA 1T22A 5HPMA 2C3VB 4A2LA 3DETC 3T0EE 5DC0A 2ZPKL 3VJ6B 4C56D 4X6CB 3WXWH 1I7UB 2GHWB 4XCCL 15C8L 4WFHD 4H88L 1DQQA 4MCYA 3MODH 3CH8A 3G5ZA 2DN7A 4PJGA 4PJCB 2M8XA 4LAJH 5I73C 1HDMB 2VOTA 3HHRB 5DRWB 3P11H 4U1NB 3THMH 5FECB 1IGJA 3QDME 2OLDA 4H8WL 4NZTL 1FNLA 3NN8B 3O6FC 4P2OD 2PR4H 3NTCL 4NJ9H 3H9SB 4WTXA 5LQBH 4XNUL 1MJJA 3ARFA 3JSSA 3PP4H 3CFJA 5FDWA 4TVSa 3IKCA 4YXHH 1FVEB 2VWEE 3PWUB 4S1DC 2D03H 4LKCA 4G7VH 3MJ7A 3V7AE 4Y1AB 2FEDD 4DN4L 4LLMA 2EE9A 4KQ4H 5D2NA 4Q9QH