2DODA

Solution structure of the first ff domain of human transcription factor ca150
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
b'GSSGSSGARERAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation regulator 1
publication title Solution structure of the first FF domain of human transcription factor CA150
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2dodA00
2DOFA 2LKSA 2KISA 2DODA 4FQGA 1UZCA 2KIQA 2KZGA 2JUCA 2L9VA 2E71A 2DOEA 2B7EA 2K85A 2KFDA 2CQNA
chains in the Genus database with same CATH superfamily
2K86A 2XGEA 3CMAI 2JPBA 2RKHA 3OV8A 3WHBA 4EATA 2R7TA 1QZEA 2L0KA 2KP6A 5H2FC 4D5CA 3KZZA 4ITVA 3F9KA 2ME0A 3JRDA 2O3FA 4W97A 3H35A 1D5VA 1ZHFA 1OYIA 4RLQA 3V7RA 2F2EA 2CS3A 3WGIA 2LY2A 3VODA 2XAGA 1KZHA 1TC3C 3OIQA 2VJIA 3MKWB 3L09A 2QBYA 4XMYA 3K6GA 4RGXA 2E7XA 4XONA 1UG2A 4CCJA 2PJPA 5D8KB 5EGOA 1IRZA 3GW2A 1RPWA 1N78A 2VBWA 4U7DA 4XSXF 1JXSA 3I4PA 5LRSA 1DUXC 2IS6A 1MBEA 1K79A 4JX5A 3GO5A 2JWTA 1O7LA 2XSDC 2A6HF 2PMZA 1JKOC 2GAUA 1D5YA 2X6YA 1P4XA 4NNJA 1RIOH 1U0JA 1WCMJ 3M8JA 1S7AA 4RB3C 3ERED 2M1BA 2KHMA 4XLCA 4KMFA 4EMSA 3HUGA 1MMGA 2FBKA 4LG0B 5CVUA 1Y39A 4HF2A 2FJ1A 5E8IA 4G7OF 1M1EB 2M9HA 2ZXHA 3QU6A 4EJUA 3KEQA 4YIIA 5H20A 3M1EA 2KT0A 4B43A 1P4AA 4BY7J 3BQZA 2W84A 2Y2ZA 3MD2A 1FP2A 3HKZA 2VQHA 3MAJA 3WTTC 4OAYA 4CO8A 4HF0A 5H6QA 1G3WA 4XM3A 4GO1A 4MTEA 1ACIA 2KJBA 1JGSA 1W0UA 2VC0A 2Z99A 4C3IJ 1PUFB 4RAFA 4J00A 2V1NA 3G4SI 2D2WA 2ZCWA 2P5LC 3OR2C 4QPOA 2WB1N 3WTSC 3DPTA 2ME6A 3MN2A 3L1PA 1Z3XA 3A03A 3BWGA 3FKJA 3UKGA 4GXOA 2DMTA 1GUUA 4XL9A 3H5AA 2WADA 1HLVA 1XGNA 3G1MA 3BR1A 4IXAA 3T8RA 3ZMDA 4V19K 3BP8A 1XMKA 3BCBA 2E2IJ 5LHGA 3RSNA 2E1OA 3VYRB 5K7HA 1YS6A 2XGCA 3H3ZA 4M74A 4RB1A 4A3BJ 3N05A 3CCMI 1U78A 3X2QH 1X1CA 3NRVA 2QKLB 2Y69H 4IVNA 5EG0B 3C7JA 3J81Z 4ZTJA 1BIAA 1Y0NA 2ZNYA 3FXLA 4CYCA 4UUTA 2F5CA 5TISC 3PL8A 3D5LA 3HYIA 1TNTA 1LFUP 2CSOA 5DM6F 3CCRI 2EFWA 2DA7A 3S2HJ 4RBOA 2QQ9A 3WE3A 3TOAA 4RS8A 4AUXA 2DA4A 2MLKA 5ILVA 5J1RA 2ZXIA 5KNLA 1U3EM 1E3OC 1GDTA 3P9CA 2G0EA 2M0CA 4PJNA 2MW8A 3OS0A 4BHCA 3PO2J 3U1KA 3ZP5A 4DGWB 2OQGA 2FEZA 3PSFA 1JHFA 3HOTA 5CQEA 4R8HA 3K2ZA 5M3FJ 4IRHA 1JUPA 2DODA 4E7ZA 3FDYA 4LMYA 1IN7A 1ZKGA 4AWXB 3GZ6A 2XAQA 1ZARA 1BI1A 2I5UA 3PIOF 5J6XA 1VQ5I 1R23A 4D5FA 5J1UA 5D5UB 3OYLA 2KPMA 1FBQA 3VPRA 1DP3A 2LDUA 2KZVA 2Y9ZA 2RVCA 3CJNA 3F8CA 3LA7A 3LFUA 3BOQA 2X9DA 2UV1A 2Z3YA 4XR6A 4CICA 2NS0A 3C2HA 1XGSA 3CCSI 2FUG2 1RKWA 1WJ5A 2BXZA 3H92A 4B3AA 1B1BA 3GX4X 2HFHA 1A5JA 5M3MJ 2NS8A 2P4WA 2B0LA 2LTPA 3Q9SA 1BJZA 1K61A 3CC4I 2DXIA 5GAHJ 3G71I 4C9YA 4E7LA 1S7OA 4L9TA 2WY8Q 1NTCA 4UV8A 3EUKL 5LFAA 2XHKA 2ID6A 3CP8A 4HLYA 4BACA 1O3QA 3F3XA 4PGGA 1AKHA 3FX3A 1YQAA 5LEKA 2QLZA 3HTUA 3HOZJ 2FNPA 3WTUC 3JR9A 5E1WA 3LAJA 1W5SA 1SANA 1DU6A 1O4XA 2EFPA 1LEAA 1SMTA 1ZTRA 1IXSB 5EYRA 1QBJA 1ZG1A 4ZZLA 2P6TA 4OOIA 3PFYA 4IO9F 4M3GA 1C0WA 4LITA 4BL0B 5GADJ 1W4MA 1E3HA 4RB0A 1QO0D 1RKTA 2H6CA 2OCEA 3HSEA 1D8JA 3RZDJ 2YUSA 1JI8A 1YW9A 4HRIA 1TQIA 2GIVA 4RB2C 2M8GX 4F93B 3C3WA 2KIMA 5HLHA 3A4CA 3GZNB 1A04A 1Z77A 4N4OB 1QQIA 4P96A 1IUFA 1GLNA 1T6SA 1W7PA 3F8NA 3G1LA 3LSGA 4XLFA 4XKWA 5J1YA 2NVXJ 4W1UA 1TTYA 1QRYA 2GM4A 4L5IA 2KFDA 2X51A 3BG3A 2IRFG 4D7MA 4F3QA 5KAFC 2CW7A 2YPRA 3BPVA 5HLGA 1T2KA 5E17F 3M1CA 4QWQA 4WXCA 2ZJRF 3L2QA 5DCMB 2BVLA 2O03A 4IX7A 4UHTA 4V2FA 2IP2A 2HQ5A 3QPSA 2IXSA 4Z6YA 2LYCA 4Y3OA 1ZRCA 1XMAA 2IW5A 2UXXA 1RRJA 2DJNA 3I9V2 2EFNA 2OF7A 1PVEA 2KZGA 2FA5A 1YE9A 3HEFA 3LSKA 1AOYA 5EEAA 4KITB 1XDUA 3L2UA 3CCEI 3BZ6A 2LOOA 2IJLA 3FXMA 2K9MA 2BHYA 3H3VK 2CUEA 1UG0A 2ZXJA 1TWFJ 5J8CA 1MJBA 1UHSA 4HW0A 4GRIA 1UJ8A 3O8HA 4B47A 1VQPI 2E1MB 4BDYA 4U0VA 1MMNA 2KIUA 2F6CA 3GFIA 2OTJI 2CRGA 5KK1A 4J01A 2DTZA 2VASA 1VQ6I 2XKPA 1I50J 1SD5A 1F9NA 2DN0A 1T95A 4M3DA 3E6CC 1A31A 1SAXA 2BY2A 2QCOA 1FWZA 3E3VA 2WAFA 1YG2A 5D6FA 1O3RA 2MGQA 2HKXA 2HPMA 4PFOA 2L4MA 3LSTA 4LD5A 1WI3A 1XTAA 4JQFA 4B48A 1FSEA 4M73A 3S2WA 3JAMK 1U9NA 2JK3A 3I59B 4XOTA 2M5WA 2GZWA 3NEUA 2HEOA 3GTOJ 3V8KA 2DFIA 1TW2A 3SEQA 4LB5A 1DPUA 2JTVA 3UR3C 3J80Z 1KA8A 2EWNA 1TL8A 1I1GA 1WJCA 4G6DA 4UUSB 2QVOA 3WG9A 2HDWA 4EEFG 1TWGJ 2BHZA 3IH4A 4Q47A 1AHDP 1G59A 1TNSA 5HDKA 2R5YB 3BZKA 2ID3A 1APLC 2V4JC 1T38A 4KUMA 4UB8C 3OYDA 2VT2A 2L7ZA 4A3MJ 5D8LB 4I0BA 2ECBA 4BEHA 5GPAA 3IAM2 2Z2SB 1KQ0A 1HSJA 1B4AA 5LD2C 2HNHA 3K1PA 2JVGA 1R5ID 2EFOA 1BOBA 1YHQI 3LNQA 4X1EA 3VB2A 4KFCA 4A3GJ 1QZYA 5LHHA 2V1DA 2R5ZA 1J75A 6PAXA 1D0XA 4XIDA 2V6EA 4C2TA 1K78A 3COAC 1IN6A 3A02A 4WF2A 2P0WA 3T5XA 5HS7A 3S3NA 5BMZA 3T8TA 4FASD 2LG4A 1HXDA 2CW0F 5F1RA 3CTAA 2V7FA 3E97A 3EETA 4Z2YA 3CP2A 3OMYA 5DS9A 3PM1A 1QPIA 2VE8A 4C3JJ 2CV2A 1F5TA 3FBIB 2VLAA 3VWBA 3ZRGA 3SZTA 4BQNA 1R5HA 1ZK8A 2AS5F 2W1OA 1OCRH 4F7ZA 3M4OJ 2LBFA 3FHNA 3RTRA 2W24A 1XCBA 3PNTA 4HNVA 1MDMA 3WTWC 3R0AA 2XB5A 3Q3SA 1WKMA 1O3TA 1A6QA 5M5WJ 2ZFUA 1MBGA 2ZMEA 1QVUA 3DCFA 4R1HA 2WWYA 1D0YA 3S17J 3WU1B 4AIKA 4AYBA 1O3SA 1OJLA 4OMZA 4RGUA 1IZ1A 3JRAA 2AO9A 3EUHA 2O0YA 4BJTA 3GTGJ 1WH7A 4AVPA 2XPUA 2F5FA 3BT9A 2KLOA 3DEUA 3QAHA 1I3QJ 4BS9A 4UVBA 3P7NA 3L7WA 4RAZA 3HRUA 4LG3A 4MLOA 1ON1A 1LB2A 1YJNI 3QYEA 2IA2A 3DU6A 3E5XA 4ZH4F 1SFOJ 4XOPA 2VL8A 5IYBJ 3ZMZA 4HDVA 2R7OA 3HL2A 5HDGA 4BJ5C 4F55A 1BI2A 4GDFA 3S32A 4ZYGA 3KLNA 3V8JA 2VOOA 1SFKA 3DXJF 2WAQN 3WTVC 3F8BA 1CGPA 3SXYA 3D5RC 2H8WA 3M7GA 5E18F 2P8TA 3Q5FA 3CCJI 2X1EA 3FXQA 1RUOA 3QPLA 3DLLF 1RNLA 3TL4X 2QSFX 4A6EA 1T0FC 3BG9A 4B44A 1J2XA 1U9OA 1WJEA 2WTEA 3B73A 3VOEA 1F4KA 4HBLA 4PUSA 2NVUB 5F64A 2K9NA 3G2BA 1IF1A 2KRHA 1R9TJ 1FTZA 3RIRA 3AL0C 2Y0SA 4I01A 2DAOA 5EEGA 5A2QK 2K3FA 4HA8A 4Y4RA 3NAUA 2X1DA 3CMYA 1FOXA 3ULQB 4LG0A 3RKQA 2DDAA 3TMOA 3J7AO 1KGSA 5FKOA 4DJAA 4A3KJ 1XSDA 2RREA 4FX4A 1FMWA 3RDIA 3MMYB 1Z1DA 4E6KG 5BPDA 2NRAC 5DM7F 3U2RA 1OPCA 1ON2A 2WV0A 2XAHA 3PUBA 3HOVJ 5EF6A 4XSZF 4IHVA 3DPLC 2O7OA 3A1YA 3FF5A 1TLHB 4KYWA 1YS7A 3WGHA 5GTIC 1A6IA 1PUFA 2KISA 3AL0B 1I1SA 3S3MA 3ZR8X 3HM5A 3ZCOA 4CGZA 2F4OB 2HQRA 4LIUA 1NK3P 2IAIA 2P7CB 4JBAA 3ONQA 3ZOBA 4KMUX 3IC7A 2IBDA 1J0RA 3FM5A 2MFZA 2QWWA 2JA2A 1WVRA 5DEQA 3O3KA 3W2VA 2JMWA 2KQRA 2NNNA 4RAYA 3KP5A 3D0SA 3FWEA 2AXTC 1YLFA 3K4JA 2JA7J 2BY1A 2COMA 4EGYA 4G94A 1IV8A 1U5TC 3QU3A 3B6AA 3OYFA 3PQKA 4MFDA 2HYJA 1XSXA 4NC7A 3HRMA 4G9YA 4GGGA 2BV6A 5K5RA 2BW3B 4L18B 2JT1A 2O6GE 4A6DA 5EG0A 3DKWA 2VPLA 3LAPA 1X1AA 2HZTA 2EA4A 5LGTA 2DQLA 1EV7A 4XRFA 1YITI 5L3EA 5J3LA 1TT0A 2DJIA 3BR3A 4QPQA 3IHUA 4A3FJ 3K9TA 2XAJA 1XS9A 1WFXA 5F0HA 5JVGF 1Z9CA 4A93J 1Z67A 3C18A 4LIVA 3BC8A 3VSKA 3JRGA 4NUBA 1ZG3A 3TO7A 3KYCB 2ESHA 2H27A 4M3BA 1U5TB 1S8NA 3E5QA 4ZDLA 3GBGA 5E1XA 3KP6A 4A0XA 4RM2A 4QLCU 2K5CA 5LEJA 3KFWX 1YFHA 2NVTJ 3ECOA 1F36A 3GWZA 4HV6A 3W6KB 4DW6A 1ETXA 2Y0MA 2HQNA 4DZJA 2HVSA 4NQWA 3DEWA 4GYIA 2Z1DA 4P9FA 2B7EA 2DPUA 1FBSA 1S29A 5CQGA 5C44J 3S15J 1P9QC 2GA2A 3JAMZ 3JRCA 1LKXA 4A3CJ 5B5EC 3M8EA 3B02A 3BDDA 4A2UA 1S7EA 3PSIA 2E1CA 5D4SA 2C6YA 1FOKA 4PJJA 1LEBA 1HW2A 2W82A 3TW6A 1G3TA 3VEPA 3B6CA 4E7HA 2WBMA 1MMDA 1WGXA 4IOAF 5J8FA 1BM9A 3H36A 1NHAA 2Y30A 3TBIA 1WHUA 3GFLA 4OIQF 2IGOA 3I54A 3BQYA 4MO7A 1Y8QB 1JKPC 4FE4A 1B8IB 2DA6A 1VQLI 4ENNA 2OZ6A 1WJBA 5CPRB 4RDUA 4EQQA 2DFFA 5JLXA 2XROA 4HEA2 1SMYF 2PMZN 5IT3A 2ELKA 4KA4A 1Y56A 3I53A 3NWTA 4G12A 1ZYRF 3CZ6A 3KP7A 3LSIA 4LGWA 4UVAA 5JFRA 3J7ZI 1YIJI 1O7FA 2VUMJ 1XCVA 2O61A 2CWEA 1Z7LA 3JTHA 1B59A 2JUGA 2VJ4A 4L9JA 2NOGA 3P5JA 3LSJA 2AQEA 5LRRA 4F52A 4RMNA 3VYSB 2HDCA 1LNWA 1ZR4A 1FC3A 4ON0A 4AVZA 1EH7A 2CQXA 2ZKZA 5ILUA 1T39A 2VONA 1N25A 3DBLB 3HOWJ 1TWCJ 1WWXA 2E60A 3DBRB 1VQ9I 2J5OA 2EJRA 1ULYA 2GLOA 1IO2A 3L2RA 3HKZN 3CCVI 1RUNA 4M71A 3WTZA 4FCYA 3DTEA 2AXLA 2CQQA 1W5CC 1HOMA 1ZGAA 4O6JA 2DYRH 4CCLA 2ESNA 4ZDOA 1BC7C 1P7IA 1D1CA 1IXRC 2RQPA 4BDZA 2XF7A 1IN4A 3K1MA 4XKVA 2JSCA 2W7NA 2NS7A 1HA8A 3NARA 2QF7A 1UZCA 4M3FA 5CJ9A 3DQVC 1YOVB 3KIOA 4ENJA 2JA5J 1FEXA 5ILSA 4KT5C 3A0HC 1BR4A 4I7HA 9ANTA 3DKYA 2F48A 3HOSA 2X6OA 1UELB 4BQOA 3K1NA 3E0JB 2PQ8A 4CCKA 1EH6A 2MC4A 1G3YA 5DCMA 3IP4B 5LHIA 4J19A 2EIKH 1FYMA 1XB4A 1IV6A 2KMUA 4OWRB 2KIQA 5FKLA 1QGPA 2A05A 2UWMA 5IYCJ 1CF7A 1XD7A 4OIRF 3CUQC 4LLNA 1ZQ3P 2D1VA 2F4MB 4E4HA 4KN7X 1ZLJA 3A01B 2KDZA 1PP8F 1H89C 2W00A 1BR2A 2DOEA 2LREA 2MBFA 3S14J 3KLOA 2MYSA 3L2WA 3V7CA 2BBYA 3HB9A 5F08A 5A2QZ 2DA5A 2GA1A 2JPCA 1MIJA 1HW5A 4S05A 1IW7F 4ZJZA 2ZNZA 4XICA 1TZLA 2GXAA 2XGXA 3V42A 3FK7A 4XKBA 5FJ8J 4BY1J 2OJED 4FT8A 1W0TA 2CFOA 3I58A 4FE7A 2E36A 2DK5A 2M7BA 1LFBA 1BI0A 1FIPA 4LJZF 5D4RA 1XG1A 2Y75A 4O5VA 3H5RA 3CUQB 3SEZA 1S9HA 2KKOA 4MGRA 2YR2A 1R5GA 1WPKA 2BY0A 2VKVA 2QGUA 4KN4X 4XBFA 2TCTA 1BR1A 1R49A 4HAMA 3KETA 4Q5SF 3N4MA 4A12A 4BNCA 5JI6A 2MC3A 3HOXJ 2HDDA 1X4PA 3CDLA 1WQ2A 4B4CA 3O2PE 4E7JA 2LRDA 1R58A 3TP3A 2VXZA 2EV6A 1BL0A 5K7ZA 4IPAA 3KP2A 4A3IJ 5LGNA 3IRQA 1UCRA 4TV7A 4MQVA 2L02A 1JUSA 1MNEA 2RN7A 5KHDA 2W25A 2K85A 2LF7A 3FMRA 1FMVA 5JHFA 2Q2EA 2HYFA 3S2DJ 1X1BA 4A5NA 2DA1A 1T33A 4UUSA 3CO6C 1WJAA 3CLOA 2ZC2A 2GBYA 2BY3A 2L4AA 2K7LA 2PX9A 2YSRA 2R5YA 2OU2A 2E2HJ 2MD0A 1W5TA 2PMUA 1I6HJ 2L3DA 1N75A 3UNGC 4KJZA 2DW4A 2JQ7A 1D1AA 3QPHA 5L3GA 5FLMJ 4M3EA 3H0GJ 3JRHA 2GXBA 1MBKA 5CVVA 3LSHA 4CA0A 2VC1A 5C3EJ 2VJ5A 4MQ9F 2QBYB 2CW8A 1I5ZA 1XSVA 2FQ3A 3IWFA 5BNGA 5E3NA 2A5YB 1ZGJA 4UV9A 2OA4A 1GV5A 1H0MA 1MH4A 4HZFA 2K9LA 3F8MA 5IPAA 1FLIA 4Y13A 3ZQCA 2LNBA 3BTCA 2VT3A 4HLXA 2VB6A 1Z21A 3JRIA 3DKXA 5FO5A 3ZMTA 2NAZA 3OYAA 2CGPA 2BYVE 5K7FA 5FB2A 1J9IA 3P9IA 3OYGA 4NB5A 1HQCA 4LLGF 1JT0A 4LK1F 4EJOA 2IA1A 3AFHA 1K4SA 4PJLA 4YRVA 4CCOA 3FIWA 4E70A 1G3SA 1GXPA 5DUIA 2DOAA 2VPRA 3HUGB 1A35A 2CJJA 1Y6IA 2UUZA 2Z5UA 1KYZA 3C2BA 1OCPA 3O8GA 4I99C 2D45A 2L7MP 4V2GA 3C2GA 5E3MA 2EIJH 1RC9A 4G6QA 2W4SA 2OTLI 5J4VA 1Z0XA 3FXOA 5HDNA 4X6AJ 4GCVA 1H88C 2FE3A 1B72A 3IH2A 3RKXA 1HF0A 1H9TA 2ISYA 1BBYA 2W85A 4B3XA 2LY9A 2VKDA 2E5NA 2K9QA 3ESWB 3MKYB 2E1MC 3DEEA 1HKTA 3CESA 3FISA 2CQ7A 3D1NI 3HOYJ 3GTJJ 3I3LA 5E3LA 2ACJA 1EKEA 2DDBA 1KU7A 2V1UA 3GLLA 1SFUA 2EZIA 4PJ0C 4UUVA 4XLPF 2ADUA 3OIOA 3SZPA 3TKYA 2CFXA 2ZJ2A 3H5NA 5FD5A 1DDNA 1BA5A 3REOA 3JSOA 1BIBA 2PLYA 1OCTC 3HPGA 5LGUA 3DV8A 4C3HJ 1ETWA 4NDLA 3IL2A 3CMEI 1WRJA 5DD8A 2IGKA 1R4NB 3QYFA 2LKSA 3V7SA 5ED4A 2FRHA 4NC8A 3ZPLA 2XUBA 3HSFA 2EV5A 1YX5A 2JUCA 4D7NA 2ICWG 3D5SC 1TT5B 2LFBA 4HV5A 3IWZA 5D5XB 1MKMA 2QZ8A 1BOAA 1XPXA 1BI3A 3S93A 3TDUC 3ABLH 4PFPA 4FTHA 1LE8A 2R7UA 3OYJA 2Q8KA 1VQMI 1LQ1A 2DT5A 3BJ6A 5J40A 1D8KA 3E6BA 1O57A 2E71A 3ABMH 4CSWA 5EZHA 5CVJA 1VQKI 1E0EA 5JR3A 2JJ7A 3TDZC 2FD5A 5IT9K 1E2XA 3OSFA 4IF4A 4I02A 5F6FA 1V5FA 2EZLA 1JJ6C 2HOTA 3BY6A 2MA3A 2WV1A 1MW7A 2R4GA 1T0FA 2WA0A 3JTGA 4XLEA 5CVIA 3BPXA 3RQIA 4GYGA 1MH3A 2GOXB 5AONA 5H6RA 2DCEA 4WXDA 4FETA 4BXFA 2VIXA 1SC7A 2EQRA 2LF8A 4IRGA 4M72A 3KZYA 3BG6A 5HS9A 2IGMA 5KAIC 2PBIA 2LSOA 1B6AA 4B8XA 1VQ4I 3V8LA 1YW7A 3OS1A 3T1BA 2X85A 2V6CA 3I4MJ 4KDPA 3BROA 1VFCA 3DBHB 2H1KA 3CCLI 3CC2I 4XNFA 2W57A 4P55A 4IZZA 4KIFA 3CCUI 5EZGA 2FNAA 2DMUA 5E1ZB 2NNYA 4YFKF 4QTRA 2WC2A 2XDVA 4A0YA 4BBRJ 3RCOA 1VI0A 2FSWA 3DFGA 4ABZA 5ICEA 3R0JA 3ASOH 2HWVA 2X0LA 4IJAA 2EPFA 2F5VA 3A2KA 2G7UA 1D3YA 5DTDA 4KT6A 4I76A 4S0HB 4WK8F 3EUAA 5AIPA 1X3UA 1TQMA 3KZIC 2QSHX 2OV7A 2LC2A 1J7KA 3DTKA 4Q48A 3M9AA 2I8DA 5FRNA 1R1VA 5DV5A 1FX7A 1SFEA 2V1XA 1U5TA 2PJRB 3F6VA 5EDNA 2M34A 2DFEA 1JKQC 4MEYF 1X2MA 3KYDB 2DU9A 2PG4A 1IJWC 1TP4A 2EA2A 2P6SA 3HJEA 1MJ9A 1ODDA 3KE2A 3RKWA 2GXGA 4HSTA 4AYBN 2LD5A 5FFXA 4LOCA 4LB6B 1A36A 3CDHA 4IQJA 2CO5A 1IRXA 2X48A 3TP0A 2K4BA 2QUFA 3BG5A 3OL3A 2VBXA 1OMIA 1PJRA 2EH3A 2M0MA 4HSRA 2HKOA 1K6YA 3AAFA 2DI3A 1MBHA 2M45A 1XDSA 2JRTA 1OYYA 2B9SA 3LA2A 3TW7A 2HS5A 2A07F 2L9RA 3MKLA 5HODA 3W6VA 3H3UA 4CZZA 1MBFA 2XRLA 1KU2A 4L9NA 3J7YJ 2NVYJ 2E7WA 5FKKA 3BZCA 2YX7A 2Q1ZB 1Y8RB 3BG7A 3L00A 1RR7A 5L3CA 2IGNA 2V9KA 5JVTA 1B8IA 3HGGA 3EPZA 3L2CA 3E1SA 1X58A 4IRIA 4F92B 2OAZA 3I4NJ 1D0ZA 4UVCA 1YX3A 1TBXA 3FMQA 4M6XA 3GYHX 2H8RA 4IHXA 1U2WA 2YS9A 4A3DJ 1XGOA 2Y0SN 1HW1A 2NXNB 2R7WA 4CUGA 1V5EA 1QHGA 2KRCA 3KCCA 3P9KA 1KQ9A 1LFPA 2VXDA 2XVCA 4JP0A 1R00A 2RNGA 5ICCA 1XX5A 3S8PA 4RAGA 1GV2A 5HNHA 2NYXA 2HTJA 3QPTA 4ZYEA 4KISA 1V54H 3L2VA 3VDXA 3Q0WA 1FP1D 5LLQA 2IA0A 1RI7A 3LOCA 5GAGJ 2EBIA 2MABA 4Q4ZF 2CG4A 2E35A 1XC5A 1NG7A 1TW3A 3BTLA 3MZYA 2P5KA 2BOLA 5K5OA 2HGCA 1T08B 5LBQA 4EJWA 1F1ZA 2G9WA 1B9NA 5KVRA 5J47A 2XF6A 2VN2A 2Y48A 5M5XJ 3K4LA 1OLTA 5B66C 1X3ZB 2K9SA 3CLQA 1HBXG 1FYKA 3WODF 2F4IA 3ZQGA 4HQEA 1SD7A 5FLXK 1IRFA 1ZN2A 2M8EA 3FK6A 5BS6A 2YX4A 2FXAA 4Y15A 3GXOA 4G6TB 4HG2A 2CUZA 1ZELA 4YIRX 3R4KA 2XV4S 2OD5A 4XLNF 4XRSG 4CH7A 1YI2I 3F72A 2XB0X 2LY1A 1HKSA 2AQFA 5E20A 1KONA 4ZYHA 2DMNA 1QU3A 2FBIA 4XN3A 1ZR2A 2IT0A 3HGYA 1R1UA 2VE9A 3KP4A 2GQQA 1P92A 3LQRA 2MD5A 3K4CA 3IKVA 2R7VA 4G7HF 3ABUA 4AU7A 4UB6C 1USTA 4IOCF 3E7LA 4RGRA 3BTJA 1IG7A 1YRNB 3ELKA 4JOMA 2V9VA 5DDGA 3LA3A 3A01A 1JE8A 2PMHA 5B1AH 2VKHA 3GTKJ 1FNNA 4U88A 4HPQA 1OQYA 3RI4A 2JA8J 4D9JA 1JT6A 1DGRM 1FT9A 1F43A 3GTQJ 1FYLA 4XLHA 1SVMA 4BJ6C 3K4NA 5IP6A 4BQQA 1REPC 4G7ZF 1UFMA 3FXKA 2XGDA 3H1CA 2R5ZB 2JZYA 4QIWN 4XK4A 1UHWA 4LFUA 1L3LA 1D1BA 5JLWA 4I2OA 3CJRB 3ISPA 4OU0A 2ETHA 3QOPA 1I27A 2LP0A 1GHCA 2X6WA 5IT9Z 3F22A 1MNDA 3O6BB 3OY9A 2ELHA 3CUQA 4A3JJ 2DK8A 1ITYA 4OAZA 3OWTA 2HU9A 3WU2C 2EFQA 1SD4A 2BE5F 3FM3A 1Q1VA 2LMDA 3VFZA 4Y17A 4UNOA 4Y33A 4L0ZB 1EJ9A 4A3EJ 2LLKA 1VF9A 2A69F 3WTYC 1PP7U 1VQ7I 1MDMB 4FHTA 1VNDA 4M9ZA 1UHMA 4AM3A 3F6OA 3ZN1A 1MGTA 4OINF 1S5LC 3HRSA 1TWAJ 2JSPA 2YU9J 3CD6I 2COBA 3I71A 5DCFA 3RYRA 4EM2A 2VBZA 1HSTA 1U8BA 2MH2A 3LSRA 2ZJPF 1JKRC 5BPIA 2JVHA 2RAEA 1DQUA 3ZN0A 2DPDA 2XAFA 3GMEA 1SVLA 4ZZDA 4YEJA 4M9XA 2O8KA 3QQAA 1EA3A 1FJLA 4UY8I 2BXYA 2O9LA 5M5YJ 3U1DA 1K83J 3Q9VA 4DBRA 3GF2A 3KEYA 4Y52J 3CF2A 3SQNA 1P2FA 3GCMA 3U21A 2CYYA 3GFJA 3HXLA 1E3PA 3BR5A 5K5QA 2OBPA 3SDGA 1GVJA 4L5JA 3ZQLA 3OIPA 4RLFA 3PIPF 4K2EA 4GFBA 3LMMA 2STTA 2EK5A 1AA7A 3SHFA 1QHHD 3PNVA 2DYSH 4HX8A 2JN6A 2ELJA 2M4GA 3RZOJ 2E19A 1BW5A 3F0CA 5HOOA 2O5RA 3E6DA 3EDPA 3OYBA 1LJ9A 4YIFA 3AG3H 1LDKB 3FKIJ 4BGDA 3J7AY 3K70C 2R7QA 2IEKA 4BHBA 2IPQX 4JX4A 5D5WB 4D0PA 4XKCA 3S1QJ 4PDKA 1VTNC 1MZBA 2HVQA 5IYDJ 2JA6J 1EH8A 3VYTB 1WJDA 4ENMA 3GFMA 2O8XA 2FX0A 4RGSA 5J4YA 2L2OA 1DU0A 4LLLA 2STWA 2KDOA 2KJCA 3ZQHA 1NH3A 3MEXA 3K7AJ 3LL7A 4BAYA 1MMAA 1HDDC 4FQGA 4HNUA 2CV1A 1Z05A 3RPUD 4DNCA 3OYMA 2AHQA 5TRDA 3BR6A 4ETSA 5GP9A 3W2WA 3HDDA 2H09A 1NK2P 4ENKA 2PFBA 1LDJA 2D5VA 3MZ8A 1L0OC 2HR3A 1GT0C 4A3LJ 1YJ9I 5FLVA 3GTLJ 2GWRA 3E5UA 4OIOF 1SFXA 2QM3A 1ZGWA 1OR7C 2K4JA 2NVQJ 3PJRA 2WB1A 4BXUA 3H9JA 4MFEA 3J80K 3ZXSA 4EJVA 2DQRA 5IY5H 3TEDA 1GVDA 4EM1A 2XRNA 3PO3J 1T56A 4H4KC 1J09A 2L9VA 1MSFC 3OS2A 1EF4A 5F1JA 5ICGA 4E7KA 1QPMA 3PQJA 5IOYA 4IQ4A 3OSGA 3QOEA 5C4JJ 5ICFA 5FKMA 4HF1A 4I6ZA 2QKMB 2X4HA 3BLYA 1ZREA 2KIFA 1WSUA 4DYQA 1Y1VJ 2FU4A 2I10A 2Y9YA 3DLAA 4AC0A 4YELA 1X3WB 1T98A 3BTIA 4BUPA 3LSMA 5TGTA 2GIZA 2RGVA 4IHYA 3K0LA 3IKTA 4BXXJ 2OZUA 2E5ZA 4KICA 1R71A 4D1QA 1H8AC 3M8FA 5BQTA 2RQQA 3K10A 2HOSA 3EQLF 4AIDA 2QQBA 1OYWA 2M87A 3ZMVA 1VQNI 2L01A 2EV0A 4IKFA 2W48A 2X6XA 3PNYA 3BJAA 2OQRA 3PUFA 2D1HA 4CCNA 4WX9A 3OYEA 1KU3A 3I59A 5FGMA 2XIGA 5FLXZ 2QYOA 4NQWB 4EM0B 5IP7J 3QRFF 5EEHA 3G1OA 1QZZA 4HX4A 1R22A 4XLAA 3FXJA 2FOWA 2VQLA 1V5GA 1XMXA 1IDYA 2DO7A 3SZGA 5FKNA 1POGA 1R4MB 3I0TA 4C30A 1ETQA 1RR8C 1RESA 2PN6A 3CQZJ 3DU5A 2DMQA 3TGNA 4O3MA 4U87A 3K70D 1QNTA 5D5VB 5C4XJ 1ENHA 3HG9A 4MIMA 1P4WA 1JTYA 1ZAOA 4NC6A 4NBQA 2HXOA 2L7FP 2UZKA 3LWFA 4OIPF 4IHSA 2ZBKA 5F04A 1STZA 1LVAA 1VZ0A 3GZ5A 3NQOA 2BZTA 1QA6A 2M4KA 2GOMA 3BCAA 1E17A 1TWHJ 3CUOA 5EGOB 1BJAA 2EINH 4U0YA 2KL4A 3KPHA 4RA2A 5B1BH 4KIBA 2QSGX 2DOFA 2A5WA 4HYEA 3H9GA 2EILH 4A5MA 1UMQA 5E3OA 4S04A 5CYVA 3G73A 4B09A 3MKZA 4C2UA 2LKPA 4MTDA 1MMSA 2HYGD 1YYVA 3HC7A 4ZC3A 2H94A 3AKZA 4P5OA 2QA4I 2ECCA 2PJRA 3MWMA 4B1RA 2XC7A 4BBSJ 1R1TA 2H1LA 4NHJA 2CMPA 2L9SA 2LK2A 3LFKA 4P9UA 2DBBA 3PFIA 3F23A 4FISA 1I39A 1ERDA 2HVRA 2K27A 4E7SA 1U6GA 2V26A 4WWCA 1WI9A 1N77A 4I0AA 4F91B 1Z91A 1BC8C 3GEZA 3HSRA 1OISA 1UAAA 1J5YA 1OKRA 1S72I 1FY7A 1V3FA 4L5EA 5FROA 3RYPA 1G8XA 4BE0A 1AWCA 3OYIA 4EVIA 3M3YJ 4UXNA 3FMSA 5DUKA 2MH9A 1JGGA 2PI0A 3V4GA 4ESFA 3C1DA 5JHUA 3OYNA 2DA2A 4G8XA 2R0QC 1FOWA 2R7DA 5K1YA 5ERIA 2V79A 3CC7I 3DPUA 2ZFWA 3FXRA 2P81A 1HC8A 1KQ8A 3IRRA 2MSYA 1IN8A 3AG4H 1LDDA 3A0BC 2CUFA 5HLIA 2L5QA 3HOUJ 2E1NA 2Y31A 1Z6TA 3HPHA 5GAEJ 4BYYA 2YU3A 1MD0A 3W2AA 3CCQI 4BH9A 4YG2F 3CJTB 4DQ2A 3RPQA 3ZQ7A 2R7FA 2TRTA 4CYDA 2CU7A 2HOAA 3ASNH 3HZJA 4U0WA 1IXCA 2RNJA 3ERMA 4IL6C 4EV0A 2HZDA 4DIQA 4BQAA 1W36C 3MCZA 2DT7B 1CF7B 2RC4A 5KCMA 3K69A 3WGGA 3HHHA 4CYCB 3S1RJ 4BKXA 2DTRA 4BHPA 2DT6A 4BE1A 3CF5F 1MNMC 5TJJA 1YJWI 3ZMUA 1ETKA 2DFHA 2VQCA 1J59A 3AG1H 4CHUA 2M30A 3CO7C 1ZH5A 3OL4A 4Y7NJ 4EGZA 2OC6A 1OCCH 2DMPA 4AD9A 3E6MA 4L9VA 1SEUA 4C2MJ 2R7RA 4WCGA 4QSHA 4PK4A 1DGWY 1DPRA 3S3OA 4PJMA 3CDIA 1Y0UA 2K3PA 4U7BA 1ONVA 1RETA 2VBYA 1Z6RA 4XORA 3HBLA 3JRFA 3WTXC 2R92J 3IH3A 5F0CA 2R7SA 2VOPA 2EB7A 3ZQQA 4N9IA 3ECHA 3OYKA 2LKXA 5CLSA 3G6EI 2TDXA 3RQ4A 2IS1A 1X2NA 3F21A 4A69C 2VI6A 5DD4A 3VSLA 3TO9A 3I56I 5F27A 1JJ8C 4ASNA 3CJQB 2ZB9A 2F5EA 1W1WE 3U9GA 3WU0A 2A61A 3Q0VA 3JSPA 1Z7UA 1MBJA 2B63J 2DLLA 5HS8A 2Z9OA 2WAEA 2Q2EB 4IEJA 1FTTA 4E7IA 2ZJQF 3QP6A 2P5VA 4PZJA 2BW3A 2XASA 3RKYA 3SFZA 3IV5A 3W3CA 1WZ2A 1VQOI 3EYIA 2E2JJ 1AU7A 3FXUA 1G6NA 2M2EA 1I3AA 1YRNA 1PDNC 3SYTA 4XRSA 2RV8A 1SAUA 2Z16A 3BR0A 3I5UA 2FMLA 1HDPA 3LQQA 4DYCA 2MLGA 1ETOA 4M6YA 4CCMA 4ANJA 2XPVA 4XRMA 4KNYA 5L3BA 1ZG5A 3QWLA 1AKHB 1R6RA 2CQKA 3WE2A 1S6LA 3KYLA 1ORKA 1ZLKA 4IHWA 4II2A 3N97A 1K7AA 5GTHC 1K4TA 1SD6A 3ZMSA 3JRBA 3GVAA 5EJCA 1XN7A 5L3DA 3IUOA 2OPTA 2A3SA 3GTPJ 3SFIA 4L0YB 5BOXA 3JREA 2QQ8A 5L3FA 1LPQA 3CCYA 4FX0A 3S1MJ 3AG2H 4BU2A 3ZGKA 1ETVA 1FPQA 3MFKA 4JYKA 1FOYA 3OYCA 1U8RA 4PGHA 3FBNB 4AIJA 1WH5A 4XN0A 4X0GA 2HXIA 3R6SA 1K6OA 3M07A 2ZXWH 2X1CA 3RPUA 3H9QA 4II3A 1W36D 1ETYA 1OFCX 2EZHA 2XAUA 1YTYA 2WY7Q 4YFXF 2F5DA 3BJOA 2Z33A 1IAWA 1W7PB 1X19A 2EIMH 2R93J 3VYUB 4M9SA 1VQ8I 1V55H 3KP3A 5D6EA 1FSHA 2RDPA 1B72B 3Q0UA 5FRMA 3SDBA 1YO5C 5E79C 2FF4A 3ROUA 5B3SH 4XQFA 2L54A 3DF8A 2XSJC 2LH9A 3BR2A 3G3ZA 4JK1X 4DOZA 4DYRA 1ZRDA 4A0ZA 2BVMA 3ML6A 3ABKH 2QENA 2CV0A 4IHTA 2QQAA 3LSPA 2FQ4A 5IP9J 1OCOH 1P6RA 3TOBA 2L9NA 4ZTFA 1LUJB 4LK0F 3DTIA 3RJPA 4KIGA 3OYHA 2UXNA 2WAQA 1IRGA 2BGCA 2R7ZJ 1S3JA 3QODA 4HOBA 1WJFA 2OUMA 1JTXA 3J81K 2HQAA 2XPWA 2FOKA 2PEXA 3MVPA 3NWSA 2EZKA 3K4BA 1PYVA 3SJMA 3K2AA 1YW8A 3HTSB 4H0EA 3MQ0A 2LR8A 4I98B 3JW4A 2ISZA 1GXQA 3TQNA 3I64A 4HQMA 1LE8B 2XKOA 2LVSA 3DP7A 3QP5A 4N4NB 2OCCH 1IDZA 4PCQA 4DZPA 3I55I 2HPIA 3KEOA 1HCRA 2HI3A 1YIOA 2CH0A 1OCZH 4CXFA 2DA3A 4MEXF 2K40A 1Q1HA 3GUDA 5GPCA 3JCUC 1H9GA 4HX7A 5CKTA 5AIQA 1IGNA 3CMMA 1X1DA 5HNFA 4PSXA 1ZRFA 2HOEA 4WXHA 4ZYDA 4PSWA 2A68F 4ZDPA 4AIHA 1Y1WJ 2R7XA 2A6TA 1G4DA 2VQGA 1BW6A 5HVQC 3ABTA 1KYWA 1NG6A 1W7PD 4YFNF 4JX6A 4CDGA 1QVTA 2ZSHB 5E8GA 2ZSIB 1R36A 5FD6A 2E34A 1KU9A 4P1WA 5F0FA 3L9FA 2JRMA 4RM3A 3S16J 1X1PA 2M3AA 2FMYA 2M7AA 5DYMA 4R79A 3MZHA 3HHGA 1TQPA 1MJAA 4MHGA 1G2HA 3R61A 1Z3YA 5IOZA 2N8GA 1P7JA 4BEHB 3ZQFA 1MSEC 3OOPA 2ZO4A 3FZVA 2L7KA 2FBHA 2G7HA 3K4KA 2VJJA 3K4MA 1B9MA 2ZMEC 1DP7P 4BE2A 2NOJB 2CUJA 2IVMA 1K78B 3OR1C 2HTSA 2IS4A 3OOUA 2A6EF 4N9HA 5HLTA 2R3SA 1OR7A 3EUHC 3ZQIA 1X4OA 1FZPB 2CQNA 3IAS2 2QEXI 1PUEE 2IS2A 4M6VA 1XGMA 2V9PA 1LVKA 1IUYA 1SVOA 3GLXA 1FIAA 2H6BA 2BEOA 2VKEA 2XF5A 3W6JB 3GTMJ 3R60A 3KX2A 1USSA 2MG4A 3H0DA 2P7VB 2LBFB 4HNTA 1CQTA 3WHCA 2Q0OA 3F8FA 3DWLE 4ESBA 4ESJA 4ZYAA 1IC8A 2KRFA 3TO6A 4HDUA 4CZCA 4OMYA 3WG7H 3HRTA 4I09A 2J5PA 1BN5A 2ZMEB 3HIFA 3QYBA 3T0YA 2VODA 1JUMA 4DBQA 4N0BA 1IN5A 5FFZA 1FBUA 3EYYA 1I6XA 1RZ4A 3FHZA 1T8IA 5CVRA 2K02A 3S1NJ 1UB9A 4EJTA 1JHHA 4MNUA 1R7JA 1HKQA 1V4RA
chains in the Genus database with same CATH topology
2DOFA 2LKSA 2KISA 2DODA 4FQGA 1UZCA 2KIQA 2KZGA 2JUCA 2L9VA 2E71A 2DOEA 2B7EA 2K85A 2KFDA 2CQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOF A;  2LKS A;  2KIS A;  2DOD A;  4FQG A;  1UZC A;  2KIQ A;  2KZG A;  2JUC A;  2L9V A;  2E71 A;  2DOE A;  2B7E A;  2K85 A;  2KFD A;  2CQN A; 
#chains in the Genus database with same CATH topology
 2K86 A;  2XGE A;  3CMA I;  2JPB A;  2RKH A;  3OV8 A;  3WHB A;  4EAT A;  2R7T A;  1QZE A;  2L0K A;  2KP6 A;  5H2F C;  4D5C A;  3KZZ A;  4ITV A;  3F9K A;  2ME0 A;  3JRD A;  2O3F A;  4W97 A;  3H35 A;  1D5V A;  1ZHF A;  1OYI A;  4RLQ A;  3V7R A;  2F2E A;  2CS3 A;  3WGI A;  2LY2 A;  3VOD A;  2XAG A;  1KZH A;  1TC3 C;  3OIQ A;  2VJI A;  3MKW B;  3L09 A;  2QBY A;  4XMY A;  3K6G A;  4RGX A;  2E7X A;  4XON A;  1UG2 A;  4CCJ A;  2PJP A;  5D8K B;  5EGO A;  1IRZ A;  3GW2 A;  1RPW A;  1N78 A;  2VBW A;  4U7D A;  4XSX F;  1JXS A;  3I4P A;  5LRS A;  1DUX C;  2IS6 A;  1MBE A;  1K79 A;  4JX5 A;  3GO5 A;  2JWT A;  1O7L A;  2XSD C;  2A6H F;  2PMZ A;  1JKO C;  2GAU A;  1D5Y A;  2X6Y A;  1P4X A;  4NNJ A;  1RIO H;  1U0J A;  1WCM J;  3M8J A;  1S7A A;  4RB3 C;  3ERE D;  2M1B A;  2KHM A;  4XLC A;  4KMF A;  4EMS A;  3HUG A;  1MMG A;  2FBK A;  4LG0 B;  5CVU A;  1Y39 A;  4HF2 A;  2FJ1 A;  5E8I A;  4G7O F;  1M1E B;  2M9H A;  2ZXH A;  3QU6 A;  4EJU A;  3KEQ A;  4YII A;  5H20 A;  3M1E A;  2KT0 A;  4B43 A;  1P4A A;  4BY7 J;  3BQZ A;  2W84 A;  2Y2Z A;  3MD2 A;  1FP2 A;  3HKZ A;  2VQH A;  3MAJ A;  3WTT C;  4OAY A;  4CO8 A;  4HF0 A;  5H6Q A;  1G3W A;  4XM3 A;  4GO1 A;  4MTE A;  1ACI A;  2KJB A;  1JGS A;  1W0U A;  2VC0 A;  2Z99 A;  4C3I J;  1PUF B;  4RAF A;  4J00 A;  2V1N A;  3G4S I;  2D2W A;  2ZCW A;  2P5L C;  3OR2 C;  4QPO A;  2WB1 N;  3WTS C;  3DPT A;  2ME6 A;  3MN2 A;  3L1P A;  1Z3X A;  3A03 A;  3BWG A;  3FKJ A;  3UKG A;  4GXO A;  2DMT A;  1GUU A;  4XL9 A;  3H5A A;  2WAD A;  1HLV A;  1XGN A;  3G1M A;  3BR1 A;  4IXA A;  3T8R A;  3ZMD A;  4V19 K;  3BP8 A;  1XMK A;  3BCB A;  2E2I J;  5LHG A;  3RSN A;  2E1O A;  3VYR B;  5K7H A;  1YS6 A;  2XGC A;  3H3Z A;  4M74 A;  4RB1 A;  4A3B J;  3N05 A;  3CCM I;  1U78 A;  3X2Q H;  1X1C A;  3NRV A;  2QKL B;  2Y69 H;  4IVN A;  5EG0 B;  3C7J A;  3J81 Z;  4ZTJ A;  1BIA A;  1Y0N A;  2ZNY A;  3FXL A;  4CYC A;  4UUT A;  2F5C A;  5TIS C;  3PL8 A;  3D5L A;  3HYI A;  1TNT A;  1LFU P;  2CSO A;  5DM6 F;  3CCR I;  2EFW A;  2DA7 A;  3S2H J;  4RBO A;  2QQ9 A;  3WE3 A;  3TOA A;  4RS8 A;  4AUX A;  2DA4 A;  2MLK A;  5ILV A;  5J1R A;  2ZXI A;  5KNL A;  1U3E M;  1E3O C;  1GDT A;  3P9C A;  2G0E A;  2M0C A;  4PJN A;  2MW8 A;  3OS0 A;  4BHC A;  3PO2 J;  3U1K A;  3ZP5 A;  4DGW B;  2OQG A;  2FEZ A;  3PSF A;  1JHF A;  3HOT A;  5CQE A;  4R8H A;  3K2Z A;  5M3F J;  4IRH A;  1JUP A;  2DOD A;  4E7Z A;  3FDY A;  4LMY A;  1IN7 A;  1ZKG A;  4AWX B;  3GZ6 A;  2XAQ A;  1ZAR A;  1BI1 A;  2I5U A;  3PIO F;  5J6X A;  1VQ5 I;  1R23 A;  4D5F A;  5J1U A;  5D5U B;  3OYL A;  2KPM A;  1FBQ A;  3VPR A;  1DP3 A;  2LDU A;  2KZV A;  2Y9Z A;  2RVC A;  3CJN A;  3F8C A;  3LA7 A;  3LFU A;  3BOQ A;  2X9D A;  2UV1 A;  2Z3Y A;  4XR6 A;  4CIC A;  2NS0 A;  3C2H A;  1XGS A;  3CCS I;  2FUG 2;  1RKW A;  1WJ5 A;  2BXZ A;  3H92 A;  4B3A A;  1B1B A;  3GX4 X;  2HFH A;  1A5J A;  5M3M J;  2NS8 A;  2P4W A;  2B0L A;  2LTP A;  3Q9S A;  1BJZ A;  1K61 A;  3CC4 I;  2DXI A;  5GAH J;  3G71 I;  4C9Y A;  4E7L A;  1S7O A;  4L9T A;  2WY8 Q;  1NTC A;  4UV8 A;  3EUK L;  5LFA A;  2XHK A;  2ID6 A;  3CP8 A;  4HLY A;  4BAC A;  1O3Q A;  3F3X A;  4PGG A;  1AKH A;  3FX3 A;  1YQA A;  5LEK A;  2QLZ A;  3HTU A;  3HOZ J;  2FNP A;  3WTU C;  3JR9 A;  5E1W A;  3LAJ A;  1W5S A;  1SAN A;  1DU6 A;  1O4X A;  2EFP A;  1LEA A;  1SMT A;  1ZTR A;  1IXS B;  5EYR A;  1QBJ A;  1ZG1 A;  4ZZL A;  2P6T A;  4OOI A;  3PFY A;  4IO9 F;  4M3G A;  1C0W A;  4LIT A;  4BL0 B;  5GAD J;  1W4M A;  1E3H A;  4RB0 A;  1QO0 D;  1RKT A;  2H6C A;  2OCE A;  3HSE A;  1D8J A;  3RZD J;  2YUS A;  1JI8 A;  1YW9 A;  4HRI A;  1TQI A;  2GIV A;  4RB2 C;  2M8G X;  4F93 B;  3C3W A;  2KIM A;  5HLH A;  3A4C A;  3GZN B;  1A04 A;  1Z77 A;  4N4O B;  1QQI A;  4P96 A;  1IUF A;  1GLN A;  1T6S A;  1W7P A;  3F8N A;  3G1L A;  3LSG A;  4XLF A;  4XKW A;  5J1Y A;  2NVX J;  4W1U A;  1TTY A;  1QRY A;  2GM4 A;  4L5I A;  2KFD A;  2X51 A;  3BG3 A;  2IRF G;  4D7M A;  4F3Q A;  5KAF C;  2CW7 A;  2YPR A;  3BPV A;  5HLG A;  1T2K A;  5E17 F;  3M1C A;  4QWQ A;  4WXC A;  2ZJR F;  3L2Q A;  5DCM B;  2BVL A;  2O03 A;  4IX7 A;  4UHT A;  4V2F A;  2IP2 A;  2HQ5 A;  3QPS A;  2IXS A;  4Z6Y A;  2LYC A;  4Y3O A;  1ZRC A;  1XMA A;  2IW5 A;  2UXX A;  1RRJ A;  2DJN A;  3I9V 2;  2EFN A;  2OF7 A;  1PVE A;  2KZG A;  2FA5 A;  1YE9 A;  3HEF A;  3LSK A;  1AOY A;  5EEA A;  4KIT B;  1XDU A;  3L2U A;  3CCE I;  3BZ6 A;  2LOO A;  2IJL A;  3FXM A;  2K9M A;  2BHY A;  3H3V K;  2CUE A;  1UG0 A;  2ZXJ A;  1TWF J;  5J8C A;  1MJB A;  1UHS A;  4HW0 A;  4GRI A;  1UJ8 A;  3O8H A;  4B47 A;  1VQP I;  2E1M B;  4BDY A;  4U0V A;  1MMN A;  2KIU A;  2F6C A;  3GFI A;  2OTJ I;  2CRG A;  5KK1 A;  4J01 A;  2DTZ A;  2VAS A;  1VQ6 I;  2XKP A;  1I50 J;  1SD5 A;  1F9N A;  2DN0 A;  1T95 A;  4M3D A;  3E6C C;  1A31 A;  1SAX A;  2BY2 A;  2QCO A;  1FWZ A;  3E3V A;  2WAF A;  1YG2 A;  5D6F A;  1O3R A;  2MGQ A;  2HKX A;  2HPM A;  4PFO A;  2L4M A;  3LST A;  4LD5 A;  1WI3 A;  1XTA A;  4JQF A;  4B48 A;  1FSE A;  4M73 A;  3S2W A;  3JAM K;  1U9N A;  2JK3 A;  3I59 B;  4XOT A;  2M5W A;  2GZW A;  3NEU A;  2HEO A;  3GTO J;  3V8K A;  2DFI A;  1TW2 A;  3SEQ A;  4LB5 A;  1DPU A;  2JTV A;  3UR3 C;  3J80 Z;  1KA8 A;  2EWN A;  1TL8 A;  1I1G A;  1WJC A;  4G6D A;  4UUS B;  2QVO A;  3WG9 A;  2HDW A;  4EEF G;  1TWG J;  2BHZ A;  3IH4 A;  4Q47 A;  1AHD P;  1G59 A;  1TNS A;  5HDK A;  2R5Y B;  3BZK A;  2ID3 A;  1APL C;  2V4J C;  1T38 A;  4KUM A;  4UB8 C;  3OYD A;  2VT2 A;  2L7Z A;  4A3M J;  5D8L B;  4I0B A;  2ECB A;  4BEH A;  5GPA A;  3IAM 2;  2Z2S B;  1KQ0 A;  1HSJ A;  1B4A A;  5LD2 C;  2HNH A;  3K1P A;  2JVG A;  1R5I D;  2EFO A;  1BOB A;  1YHQ I;  3LNQ A;  4X1E A;  3VB2 A;  4KFC A;  4A3G J;  1QZY A;  5LHH A;  2V1D A;  2R5Z A;  1J75 A;  6PAX A;  1D0X A;  4XID A;  2V6E A;  4C2T A;  1K78 A;  3COA C;  1IN6 A;  3A02 A;  4WF2 A;  2P0W A;  3T5X A;  5HS7 A;  3S3N A;  5BMZ A;  3T8T A;  4FAS D;  2LG4 A;  1HXD A;  2CW0 F;  5F1R A;  3CTA A;  2V7F A;  3E97 A;  3EET A;  4Z2Y A;  3CP2 A;  3OMY A;  5DS9 A;  3PM1 A;  1QPI A;  2VE8 A;  4C3J J;  2CV2 A;  1F5T A;  3FBI B;  2VLA A;  3VWB A;  3ZRG A;  3SZT A;  4BQN A;  1R5H A;  1ZK8 A;  2AS5 F;  2W1O A;  1OCR H;  4F7Z A;  3M4O J;  2LBF A;  3FHN A;  3RTR A;  2W24 A;  1XCB A;  3PNT A;  4HNV A;  1MDM A;  3WTW C;  3R0A A;  2XB5 A;  3Q3S A;  1WKM A;  1O3T A;  1A6Q A;  5M5W J;  2ZFU A;  1MBG A;  2ZME A;  1QVU A;  3DCF A;  4R1H A;  2WWY A;  1D0Y A;  3S17 J;  3WU1 B;  4AIK A;  4AYB A;  1O3S A;  1OJL A;  4OMZ A;  4RGU A;  1IZ1 A;  3JRA A;  2AO9 A;  3EUH A;  2O0Y A;  4BJT A;  3GTG J;  1WH7 A;  4AVP A;  2XPU A;  2F5F A;  3BT9 A;  2KLO A;  3DEU A;  3QAH A;  1I3Q J;  4BS9 A;  4UVB A;  3P7N A;  3L7W A;  4RAZ A;  3HRU A;  4LG3 A;  4MLO A;  1ON1 A;  1LB2 A;  1YJN I;  3QYE A;  2IA2 A;  3DU6 A;  3E5X A;  4ZH4 F;  1SFO J;  4XOP A;  2VL8 A;  5IYB J;  3ZMZ A;  4HDV A;  2R7O A;  3HL2 A;  5HDG A;  4BJ5 C;  4F55 A;  1BI2 A;  4GDF A;  3S32 A;  4ZYG A;  3KLN A;  3V8J A;  2VOO A;  1SFK A;  3DXJ F;  2WAQ N;  3WTV C;  3F8B A;  1CGP A;  3SXY A;  3D5R C;  2H8W A;  3M7G A;  5E18 F;  2P8T A;  3Q5F A;  3CCJ I;  2X1E A;  3FXQ A;  1RUO A;  3QPL A;  3DLL F;  1RNL A;  3TL4 X;  2QSF X;  4A6E A;  1T0F C;  3BG9 A;  4B44 A;  1J2X A;  1U9O A;  1WJE A;  2WTE A;  3B73 A;  3VOE A;  1F4K A;  4HBL A;  4PUS A;  2NVU B;  5F64 A;  2K9N A;  3G2B A;  1IF1 A;  2KRH A;  1R9T J;  1FTZ A;  3RIR A;  3AL0 C;  2Y0S A;  4I01 A;  2DAO A;  5EEG A;  5A2Q K;  2K3F A;  4HA8 A;  4Y4R A;  3NAU A;  2X1D A;  3CMY A;  1FOX A;  3ULQ B;  4LG0 A;  3RKQ A;  2DDA A;  3TMO A;  3J7A O;  1KGS A;  5FKO A;  4DJA A;  4A3K J;  1XSD A;  2RRE A;  4FX4 A;  1FMW A;  3RDI A;  3MMY B;  1Z1D A;  4E6K G;  5BPD A;  2NRA C;  5DM7 F;  3U2R A;  1OPC A;  1ON2 A;  2WV0 A;  2XAH A;  3PUB A;  3HOV J;  5EF6 A;  4XSZ F;  4IHV A;  3DPL C;  2O7O A;  3A1Y A;  3FF5 A;  1TLH B;  4KYW A;  1YS7 A;  3WGH A;  5GTI C;  1A6I A;  1PUF A;  2KIS A;  3AL0 B;  1I1S A;  3S3M A;  3ZR8 X;  3HM5 A;  3ZCO A;  4CGZ A;  2F4O B;  2HQR A;  4LIU A;  1NK3 P;  2IAI A;  2P7C B;  4JBA A;  3ONQ A;  3ZOB A;  4KMU X;  3IC7 A;  2IBD A;  1J0R A;  3FM5 A;  2MFZ A;  2QWW A;  2JA2 A;  1WVR A;  5DEQ A;  3O3K A;  3W2V A;  2JMW A;  2KQR A;  2NNN A;  4RAY A;  3KP5 A;  3D0S A;  3FWE A;  2AXT C;  1YLF A;  3K4J A;  2JA7 J;  2BY1 A;  2COM A;  4EGY A;  4G94 A;  1IV8 A;  1U5T C;  3QU3 A;  3B6A A;  3OYF A;  3PQK A;  4MFD A;  2HYJ A;  1XSX A;  4NC7 A;  3HRM A;  4G9Y A;  4GGG A;  2BV6 A;  5K5R A;  2BW3 B;  4L18 B;  2JT1 A;  2O6G E;  4A6D A;  5EG0 A;  3DKW A;  2VPL A;  3LAP A;  1X1A A;  2HZT A;  2EA4 A;  5LGT A;  2DQL A;  1EV7 A;  4XRF A;  1YIT I;  5L3E A;  5J3L A;  1TT0 A;  2DJI A;  3BR3 A;  4QPQ A;  3IHU A;  4A3F J;  3K9T A;  2XAJ A;  1XS9 A;  1WFX A;  5F0H A;  5JVG F;  1Z9C A;  4A93 J;  1Z67 A;  3C18 A;  4LIV A;  3BC8 A;  3VSK A;  3JRG A;  4NUB A;  1ZG3 A;  3TO7 A;  3KYC B;  2ESH A;  2H27 A;  4M3B A;  1U5T B;  1S8N A;  3E5Q A;  4ZDL A;  3GBG A;  5E1X A;  3KP6 A;  4A0X A;  4RM2 A;  4QLC U;  2K5C A;  5LEJ A;  3KFW X;  1YFH A;  2NVT J;  3ECO A;  1F36 A;  3GWZ A;  4HV6 A;  3W6K B;  4DW6 A;  1ETX A;  2Y0M A;  2HQN A;  4DZJ A;  2HVS A;  4NQW A;  3DEW A;  4GYI A;  2Z1D A;  4P9F A;  2B7E A;  2DPU A;  1FBS A;  1S29 A;  5CQG A;  5C44 J;  3S15 J;  1P9Q C;  2GA2 A;  3JAM Z;  3JRC A;  1LKX A;  4A3C J;  5B5E C;  3M8E A;  3B02 A;  3BDD A;  4A2U A;  1S7E A;  3PSI A;  2E1C A;  5D4S A;  2C6Y A;  1FOK A;  4PJJ A;  1LEB A;  1HW2 A;  2W82 A;  3TW6 A;  1G3T A;  3VEP A;  3B6C A;  4E7H A;  2WBM A;  1MMD A;  1WGX A;  4IOA F;  5J8F A;  1BM9 A;  3H36 A;  1NHA A;  2Y30 A;  3TBI A;  1WHU A;  3GFL A;  4OIQ F;  2IGO A;  3I54 A;  3BQY A;  4MO7 A;  1Y8Q B;  1JKP C;  4FE4 A;  1B8I B;  2DA6 A;  1VQL I;  4ENN A;  2OZ6 A;  1WJB A;  5CPR B;  4RDU A;  4EQQ A;  2DFF A;  5JLX A;  2XRO A;  4HEA 2;  1SMY F;  2PMZ N;  5IT3 A;  2ELK A;  4KA4 A;  1Y56 A;  3I53 A;  3NWT A;  4G12 A;  1ZYR F;  3CZ6 A;  3KP7 A;  3LSI A;  4LGW A;  4UVA A;  5JFR A;  3J7Z I;  1YIJ I;  1O7F A;  2VUM J;  1XCV A;  2O61 A;  2CWE A;  1Z7L A;  3JTH A;  1B59 A;  2JUG A;  2VJ4 A;  4L9J A;  2NOG A;  3P5J A;  3LSJ A;  2AQE A;  5LRR A;  4F52 A;  4RMN A;  3VYS B;  2HDC A;  1LNW A;  1ZR4 A;  1FC3 A;  4ON0 A;  4AVZ A;  1EH7 A;  2CQX A;  2ZKZ A;  5ILU A;  1T39 A;  2VON A;  1N25 A;  3DBL B;  3HOW J;  1TWC J;  1WWX A;  2E60 A;  3DBR B;  1VQ9 I;  2J5O A;  2EJR A;  1ULY A;  2GLO A;  1IO2 A;  3L2R A;  3HKZ N;  3CCV I;  1RUN A;  4M71 A;  3WTZ A;  4FCY A;  3DTE A;  2AXL A;  2CQQ A;  1W5C C;  1HOM A;  1ZGA A;  4O6J A;  2DYR H;  4CCL A;  2ESN A;  4ZDO A;  1BC7 C;  1P7I A;  1D1C A;  1IXR C;  2RQP A;  4BDZ A;  2XF7 A;  1IN4 A;  3K1M A;  4XKV A;  2JSC A;  2W7N A;  2NS7 A;  1HA8 A;  3NAR A;  2QF7 A;  1UZC A;  4M3F A;  5CJ9 A;  3DQV C;  1YOV B;  3KIO A;  4ENJ A;  2JA5 J;  1FEX A;  5ILS A;  4KT5 C;  3A0H C;  1BR4 A;  4I7H A;  9ANT A;  3DKY A;  2F48 A;  3HOS A;  2X6O A;  1UEL B;  4BQO A;  3K1N A;  3E0J B;  2PQ8 A;  4CCK A;  1EH6 A;  2MC4 A;  1G3Y A;  5DCM A;  3IP4 B;  5LHI A;  4J19 A;  2EIK H;  1FYM A;  1XB4 A;  1IV6 A;  2KMU A;  4OWR B;  2KIQ A;  5FKL A;  1QGP A;  2A05 A;  2UWM A;  5IYC J;  1CF7 A;  1XD7 A;  4OIR F;  3CUQ C;  4LLN A;  1ZQ3 P;  2D1V A;  2F4M B;  4E4H A;  4KN7 X;  1ZLJ A;  3A01 B;  2KDZ A;  1PP8 F;  1H89 C;  2W00 A;  1BR2 A;  2DOE A;  2LRE A;  2MBF A;  3S14 J;  3KLO A;  2MYS A;  3L2W A;  3V7C A;  2BBY A;  3HB9 A;  5F08 A;  5A2Q Z;  2DA5 A;  2GA1 A;  2JPC A;  1MIJ A;  1HW5 A;  4S05 A;  1IW7 F;  4ZJZ A;  2ZNZ A;  4XIC A;  1TZL A;  2GXA A;  2XGX A;  3V42 A;  3FK7 A;  4XKB A;  5FJ8 J;  4BY1 J;  2OJE D;  4FT8 A;  1W0T A;  2CFO A;  3I58 A;  4FE7 A;  2E36 A;  2DK5 A;  2M7B A;  1LFB A;  1BI0 A;  1FIP A;  4LJZ F;  5D4R A;  1XG1 A;  2Y75 A;  4O5V A;  3H5R A;  3CUQ B;  3SEZ A;  1S9H A;  2KKO A;  4MGR A;  2YR2 A;  1R5G A;  1WPK A;  2BY0 A;  2VKV A;  2QGU A;  4KN4 X;  4XBF A;  2TCT A;  1BR1 A;  1R49 A;  4HAM A;  3KET A;  4Q5S F;  3N4M A;  4A12 A;  4BNC A;  5JI6 A;  2MC3 A;  3HOX J;  2HDD A;  1X4P A;  3CDL A;  1WQ2 A;  4B4C A;  3O2P E;  4E7J A;  2LRD A;  1R58 A;  3TP3 A;  2VXZ A;  2EV6 A;  1BL0 A;  5K7Z A;  4IPA A;  3KP2 A;  4A3I J;  5LGN A;  3IRQ A;  1UCR A;  4TV7 A;  4MQV A;  2L02 A;  1JUS A;  1MNE A;  2RN7 A;  5KHD A;  2W25 A;  2K85 A;  2LF7 A;  3FMR A;  1FMV A;  5JHF A;  2Q2E A;  2HYF A;  3S2D J;  1X1B A;  4A5N A;  2DA1 A;  1T33 A;  4UUS A;  3CO6 C;  1WJA A;  3CLO A;  2ZC2 A;  2GBY A;  2BY3 A;  2L4A A;  2K7L A;  2PX9 A;  2YSR A;  2R5Y A;  2OU2 A;  2E2H J;  2MD0 A;  1W5T A;  2PMU A;  1I6H J;  2L3D A;  1N75 A;  3UNG C;  4KJZ A;  2DW4 A;  2JQ7 A;  1D1A A;  3QPH A;  5L3G A;  5FLM J;  4M3E A;  3H0G J;  3JRH A;  2GXB A;  1MBK A;  5CVV A;  3LSH A;  4CA0 A;  2VC1 A;  5C3E J;  2VJ5 A;  4MQ9 F;  2QBY B;  2CW8 A;  1I5Z A;  1XSV A;  2FQ3 A;  3IWF A;  5BNG A;  5E3N A;  2A5Y B;  1ZGJ A;  4UV9 A;  2OA4 A;  1GV5 A;  1H0M A;  1MH4 A;  4HZF A;  2K9L A;  3F8M A;  5IPA A;  1FLI A;  4Y13 A;  3ZQC A;  2LNB A;  3BTC A;  2VT3 A;  4HLX A;  2VB6 A;  1Z21 A;  3JRI A;  3DKX A;  5FO5 A;  3ZMT A;  2NAZ A;  3OYA A;  2CGP A;  2BYV E;  5K7F A;  5FB2 A;  1J9I A;  3P9I A;  3OYG A;  4NB5 A;  1HQC A;  4LLG F;  1JT0 A;  4LK1 F;  4EJO A;  2IA1 A;  3AFH A;  1K4S A;  4PJL A;  4YRV A;  4CCO A;  3FIW A;  4E70 A;  1G3S A;  1GXP A;  5DUI A;  2DOA A;  2VPR A;  3HUG B;  1A35 A;  2CJJ A;  1Y6I A;  2UUZ A;  2Z5U A;  1KYZ A;  3C2B A;  1OCP A;  3O8G A;  4I99 C;  2D45 A;  2L7M P;  4V2G A;  3C2G A;  5E3M A;  2EIJ H;  1RC9 A;  4G6Q A;  2W4S A;  2OTL I;  5J4V A;  1Z0X A;  3FXO A;  5HDN A;  4X6A J;  4GCV A;  1H88 C;  2FE3 A;  1B72 A;  3IH2 A;  3RKX A;  1HF0 A;  1H9T A;  2ISY A;  1BBY A;  2W85 A;  4B3X A;  2LY9 A;  2VKD A;  2E5N A;  2K9Q A;  3ESW B;  3MKY B;  2E1M C;  3DEE A;  1HKT A;  3CES A;  3FIS A;  2CQ7 A;  3D1N I;  3HOY J;  3GTJ J;  3I3L A;  5E3L A;  2ACJ A;  1EKE A;  2DDB A;  1KU7 A;  2V1U A;  3GLL A;  1SFU A;  2EZI A;  4PJ0 C;  4UUV A;  4XLP F;  2ADU A;  3OIO A;  3SZP A;  3TKY A;  2CFX A;  2ZJ2 A;  3H5N A;  5FD5 A;  1DDN A;  1BA5 A;  3REO A;  3JSO A;  1BIB A;  2PLY A;  1OCT C;  3HPG A;  5LGU A;  3DV8 A;  4C3H J;  1ETW A;  4NDL A;  3IL2 A;  3CME I;  1WRJ A;  5DD8 A;  2IGK A;  1R4N B;  3QYF A;  2LKS A;  3V7S A;  5ED4 A;  2FRH A;  4NC8 A;  3ZPL A;  2XUB A;  3HSF A;  2EV5 A;  1YX5 A;  2JUC A;  4D7N A;  2ICW G;  3D5S C;  1TT5 B;  2LFB A;  4HV5 A;  3IWZ A;  5D5X B;  1MKM A;  2QZ8 A;  1BOA A;  1XPX A;  1BI3 A;  3S93 A;  3TDU C;  3ABL H;  4PFP A;  4FTH A;  1LE8 A;  2R7U A;  3OYJ A;  2Q8K A;  1VQM I;  1LQ1 A;  2DT5 A;  3BJ6 A;  5J40 A;  1D8K A;  3E6B A;  1O57 A;  2E71 A;  3ABM H;  4CSW A;  5EZH A;  5CVJ A;  1VQK I;  1E0E A;  5JR3 A;  2JJ7 A;  3TDZ C;  2FD5 A;  5IT9 K;  1E2X A;  3OSF A;  4IF4 A;  4I02 A;  5F6F A;  1V5F A;  2EZL A;  1JJ6 C;  2HOT A;  3BY6 A;  2MA3 A;  2WV1 A;  1MW7 A;  2R4G A;  1T0F A;  2WA0 A;  3JTG A;  4XLE A;  5CVI A;  3BPX A;  3RQI A;  4GYG A;  1MH3 A;  2GOX B;  5AON A;  5H6R A;  2DCE A;  4WXD A;  4FET A;  4BXF A;  2VIX A;  1SC7 A;  2EQR A;  2LF8 A;  4IRG A;  4M72 A;  3KZY A;  3BG6 A;  5HS9 A;  2IGM A;  5KAI C;  2PBI A;  2LSO A;  1B6A A;  4B8X A;  1VQ4 I;  3V8L A;  1YW7 A;  3OS1 A;  3T1B A;  2X85 A;  2V6C A;  3I4M J;  4KDP A;  3BRO A;  1VFC A;  3DBH B;  2H1K A;  3CCL I;  3CC2 I;  4XNF A;  2W57 A;  4P55 A;  4IZZ A;  4KIF A;  3CCU I;  5EZG A;  2FNA A;  2DMU A;  5E1Z B;  2NNY A;  4YFK F;  4QTR A;  2WC2 A;  2XDV A;  4A0Y A;  4BBR J;  3RCO A;  1VI0 A;  2FSW A;  3DFG A;  4ABZ A;  5ICE A;  3R0J A;  3ASO H;  2HWV A;  2X0L A;  4IJA A;  2EPF A;  2F5V A;  3A2K A;  2G7U A;  1D3Y A;  5DTD A;  4KT6 A;  4I76 A;  4S0H B;  4WK8 F;  3EUA A;  5AIP A;  1X3U A;  1TQM A;  3KZI C;  2QSH X;  2OV7 A;  2LC2 A;  1J7K A;  3DTK A;  4Q48 A;  3M9A A;  2I8D A;  5FRN A;  1R1V A;  5DV5 A;  1FX7 A;  1SFE A;  2V1X A;  1U5T A;  2PJR B;  3F6V A;  5EDN A;  2M34 A;  2DFE A;  1JKQ C;  4MEY F;  1X2M A;  3KYD B;  2DU9 A;  2PG4 A;  1IJW C;  1TP4 A;  2EA2 A;  2P6S A;  3HJE A;  1MJ9 A;  1ODD A;  3KE2 A;  3RKW A;  2GXG A;  4HST A;  4AYB N;  2LD5 A;  5FFX A;  4LOC A;  4LB6 B;  1A36 A;  3CDH A;  4IQJ A;  2CO5 A;  1IRX A;  2X48 A;  3TP0 A;  2K4B A;  2QUF A;  3BG5 A;  3OL3 A;  2VBX A;  1OMI A;  1PJR A;  2EH3 A;  2M0M A;  4HSR A;  2HKO A;  1K6Y A;  3AAF A;  2DI3 A;  1MBH A;  2M45 A;  1XDS A;  2JRT A;  1OYY A;  2B9S A;  3LA2 A;  3TW7 A;  2HS5 A;  2A07 F;  2L9R A;  3MKL A;  5HOD A;  3W6V A;  3H3U A;  4CZZ A;  1MBF A;  2XRL A;  1KU2 A;  4L9N A;  3J7Y J;  2NVY J;  2E7W A;  5FKK A;  3BZC A;  2YX7 A;  2Q1Z B;  1Y8R B;  3BG7 A;  3L00 A;  1RR7 A;  5L3C A;  2IGN A;  2V9K A;  5JVT A;  1B8I A;  3HGG A;  3EPZ A;  3L2C A;  3E1S A;  1X58 A;  4IRI A;  4F92 B;  2OAZ A;  3I4N J;  1D0Z A;  4UVC A;  1YX3 A;  1TBX A;  3FMQ A;  4M6X A;  3GYH X;  2H8R A;  4IHX A;  1U2W A;  2YS9 A;  4A3D J;  1XGO A;  2Y0S N;  1HW1 A;  2NXN B;  2R7W A;  4CUG A;  1V5E A;  1QHG A;  2KRC A;  3KCC A;  3P9K A;  1KQ9 A;  1LFP A;  2VXD A;  2XVC A;  4JP0 A;  1R00 A;  2RNG A;  5ICC A;  1XX5 A;  3S8P A;  4RAG A;  1GV2 A;  5HNH A;  2NYX A;  2HTJ A;  3QPT A;  4ZYE A;  4KIS A;  1V54 H;  3L2V A;  3VDX A;  3Q0W A;  1FP1 D;  5LLQ A;  2IA0 A;  1RI7 A;  3LOC A;  5GAG J;  2EBI A;  2MAB A;  4Q4Z F;  2CG4 A;  2E35 A;  1XC5 A;  1NG7 A;  1TW3 A;  3BTL A;  3MZY A;  2P5K A;  2BOL A;  5K5O A;  2HGC A;  1T08 B;  5LBQ A;  4EJW A;  1F1Z A;  2G9W A;  1B9N A;  5KVR A;  5J47 A;  2XF6 A;  2VN2 A;  2Y48 A;  5M5X J;  3K4L A;  1OLT A;  5B66 C;  1X3Z B;  2K9S A;  3CLQ A;  1HBX G;  1FYK A;  3WOD F;  2F4I A;  3ZQG A;  4HQE A;  1SD7 A;  5FLX K;  1IRF A;  1ZN2 A;  2M8E A;  3FK6 A;  5BS6 A;  2YX4 A;  2FXA A;  4Y15 A;  3GXO A;  4G6T B;  4HG2 A;  2CUZ A;  1ZEL A;  4YIR X;  3R4K A;  2XV4 S;  2OD5 A;  4XLN F;  4XRS G;  4CH7 A;  1YI2 I;  3F72 A;  2XB0 X;  2LY1 A;  1HKS A;  2AQF A;  5E20 A;  1KON A;  4ZYH A;  2DMN A;  1QU3 A;  2FBI A;  4XN3 A;  1ZR2 A;  2IT0 A;  3HGY A;  1R1U A;  2VE9 A;  3KP4 A;  2GQQ A;  1P92 A;  3LQR A;  2MD5 A;  3K4C A;  3IKV A;  2R7V A;  4G7H F;  3ABU A;  4AU7 A;  4UB6 C;  1UST A;  4IOC F;  3E7L A;  4RGR A;  3BTJ A;  1IG7 A;  1YRN B;  3ELK A;  4JOM A;  2V9V A;  5DDG A;  3LA3 A;  3A01 A;  1JE8 A;  2PMH A;  5B1A H;  2VKH A;  3GTK J;  1FNN A;  4U88 A;  4HPQ A;  1OQY A;  3RI4 A;  2JA8 J;  4D9J A;  1JT6 A;  1DGR M;  1FT9 A;  1F43 A;  3GTQ J;  1FYL A;  4XLH A;  1SVM A;  4BJ6 C;  3K4N A;  5IP6 A;  4BQQ A;  1REP C;  4G7Z F;  1UFM A;  3FXK A;  2XGD A;  3H1C A;  2R5Z B;  2JZY A;  4QIW N;  4XK4 A;  1UHW A;  4LFU A;  1L3L A;  1D1B A;  5JLW A;  4I2O A;  3CJR B;  3ISP A;  4OU0 A;  2ETH A;  3QOP A;  1I27 A;  2LP0 A;  1GHC A;  2X6W A;  5IT9 Z;  3F22 A;  1MND A;  3O6B B;  3OY9 A;  2ELH A;  3CUQ A;  4A3J J;  2DK8 A;  1ITY A;  4OAZ A;  3OWT A;  2HU9 A;  3WU2 C;  2EFQ A;  1SD4 A;  2BE5 F;  3FM3 A;  1Q1V A;  2LMD A;  3VFZ A;  4Y17 A;  4UNO A;  4Y33 A;  4L0Z B;  1EJ9 A;  4A3E J;  2LLK A;  1VF9 A;  2A69 F;  3WTY C;  1PP7 U;  1VQ7 I;  1MDM B;  4FHT A;  1VND A;  4M9Z A;  1UHM A;  4AM3 A;  3F6O A;  3ZN1 A;  1MGT A;  4OIN F;  1S5L C;  3HRS A;  1TWA J;  2JSP A;  2YU9 J;  3CD6 I;  2COB A;  3I71 A;  5DCF A;  3RYR A;  4EM2 A;  2VBZ A;  1HST A;  1U8B A;  2MH2 A;  3LSR A;  2ZJP F;  1JKR C;  5BPI A;  2JVH A;  2RAE A;  1DQU A;  3ZN0 A;  2DPD A;  2XAF A;  3GME A;  1SVL A;  4ZZD A;  4YEJ A;  4M9X A;  2O8K A;  3QQA A;  1EA3 A;  1FJL A;  4UY8 I;  2BXY A;  2O9L A;  5M5Y J;  3U1D A;  1K83 J;  3Q9V A;  4DBR A;  3GF2 A;  3KEY A;  4Y52 J;  3CF2 A;  3SQN A;  1P2F A;  3GCM A;  3U21 A;  2CYY A;  3GFJ A;  3HXL A;  1E3P A;  3BR5 A;  5K5Q A;  2OBP A;  3SDG A;  1GVJ A;  4L5J A;  3ZQL A;  3OIP A;  4RLF A;  3PIP F;  4K2E A;  4GFB A;  3LMM A;  2STT A;  2EK5 A;  1AA7 A;  3SHF A;  1QHH D;  3PNV A;  2DYS H;  4HX8 A;  2JN6 A;  2ELJ A;  2M4G A;  3RZO J;  2E19 A;  1BW5 A;  3F0C A;  5HOO A;  2O5R A;  3E6D A;  3EDP A;  3OYB A;  1LJ9 A;  4YIF A;  3AG3 H;  1LDK B;  3FKI J;  4BGD A;  3J7A Y;  3K70 C;  2R7Q A;  2IEK A;  4BHB A;  2IPQ X;  4JX4 A;  5D5W B;  4D0P A;  4XKC A;  3S1Q J;  4PDK A;  1VTN C;  1MZB A;  2HVQ A;  5IYD J;  2JA6 J;  1EH8 A;  3VYT B;  1WJD A;  4ENM A;  3GFM A;  2O8X A;  2FX0 A;  4RGS A;  5J4Y A;  2L2O A;  1DU0 A;  4LLL A;  2STW A;  2KDO A;  2KJC A;  3ZQH A;  1NH3 A;  3MEX A;  3K7A J;  3LL7 A;  4BAY A;  1MMA A;  1HDD C;  4FQG A;  4HNU A;  2CV1 A;  1Z05 A;  3RPU D;  4DNC A;  3OYM A;  2AHQ A;  5TRD A;  3BR6 A;  4ETS A;  5GP9 A;  3W2W A;  3HDD A;  2H09 A;  1NK2 P;  4ENK A;  2PFB A;  1LDJ A;  2D5V A;  3MZ8 A;  1L0O C;  2HR3 A;  1GT0 C;  4A3L J;  1YJ9 I;  5FLV A;  3GTL J;  2GWR A;  3E5U A;  4OIO F;  1SFX A;  2QM3 A;  1ZGW A;  1OR7 C;  2K4J A;  2NVQ J;  3PJR A;  2WB1 A;  4BXU A;  3H9J A;  4MFE A;  3J80 K;  3ZXS A;  4EJV A;  2DQR A;  5IY5 H;  3TED A;  1GVD A;  4EM1 A;  2XRN A;  3PO3 J;  1T56 A;  4H4K C;  1J09 A;  2L9V A;  1MSF C;  3OS2 A;  1EF4 A;  5F1J A;  5ICG A;  4E7K A;  1QPM A;  3PQJ A;  5IOY A;  4IQ4 A;  3OSG A;  3QOE A;  5C4J J;  5ICF A;  5FKM A;  4HF1 A;  4I6Z A;  2QKM B;  2X4H A;  3BLY A;  1ZRE A;  2KIF A;  1WSU A;  4DYQ A;  1Y1V J;  2FU4 A;  2I10 A;  2Y9Y A;  3DLA A;  4AC0 A;  4YEL A;  1X3W B;  1T98 A;  3BTI A;  4BUP A;  3LSM A;  5TGT A;  2GIZ A;  2RGV A;  4IHY A;  3K0L A;  3IKT A;  4BXX J;  2OZU A;  2E5Z A;  4KIC A;  1R71 A;  4D1Q A;  1H8A C;  3M8F A;  5BQT A;  2RQQ A;  3K10 A;  2HOS A;  3EQL F;  4AID A;  2QQB A;  1OYW A;  2M87 A;  3ZMV A;  1VQN I;  2L01 A;  2EV0 A;  4IKF A;  2W48 A;  2X6X A;  3PNY A;  3BJA A;  2OQR A;  3PUF A;  2D1H A;  4CCN A;  4WX9 A;  3OYE A;  1KU3 A;  3I59 A;  5FGM A;  2XIG A;  5FLX Z;  2QYO A;  4NQW B;  4EM0 B;  5IP7 J;  3QRF F;  5EEH A;  3G1O A;  1QZZ A;  4HX4 A;  1R22 A;  4XLA A;  3FXJ A;  2FOW A;  2VQL A;  1V5G A;  1XMX A;  1IDY A;  2DO7 A;  3SZG A;  5FKN A;  1POG A;  1R4M B;  3I0T A;  4C30 A;  1ETQ A;  1RR8 C;  1RES A;  2PN6 A;  3CQZ J;  3DU5 A;  2DMQ A;  3TGN A;  4O3M A;  4U87 A;  3K70 D;  1QNT A;  5D5V B;  5C4X J;  1ENH A;  3HG9 A;  4MIM A;  1P4W A;  1JTY A;  1ZAO A;  4NC6 A;  4NBQ A;  2HXO A;  2L7F P;  2UZK A;  3LWF A;  4OIP F;  4IHS A;  2ZBK A;  5F04 A;  1STZ A;  1LVA A;  1VZ0 A;  3GZ5 A;  3NQO A;  2BZT A;  1QA6 A;  2M4K A;  2GOM A;  3BCA A;  1E17 A;  1TWH J;  3CUO A;  5EGO B;  1BJA A;  2EIN H;  4U0Y A;  2KL4 A;  3KPH A;  4RA2 A;  5B1B H;  4KIB A;  2QSG X;  2DOF A;  2A5W A;  4HYE A;  3H9G A;  2EIL H;  4A5M A;  1UMQ A;  5E3O A;  4S04 A;  5CYV A;  3G73 A;  4B09 A;  3MKZ A;  4C2U A;  2LKP A;  4MTD A;  1MMS A;  2HYG D;  1YYV A;  3HC7 A;  4ZC3 A;  2H94 A;  3AKZ A;  4P5O A;  2QA4 I;  2ECC A;  2PJR A;  3MWM A;  4B1R A;  2XC7 A;  4BBS J;  1R1T A;  2H1L A;  4NHJ A;  2CMP A;  2L9S A;  2LK2 A;  3LFK A;  4P9U A;  2DBB A;  3PFI A;  3F23 A;  4FIS A;  1I39 A;  1ERD A;  2HVR A;  2K27 A;  4E7S A;  1U6G A;  2V26 A;  4WWC A;  1WI9 A;  1N77 A;  4I0A A;  4F91 B;  1Z91 A;  1BC8 C;  3GEZ A;  3HSR A;  1OIS A;  1UAA A;  1J5Y A;  1OKR A;  1S72 I;  1FY7 A;  1V3F A;  4L5E A;  5FRO A;  3RYP A;  1G8X A;  4BE0 A;  1AWC A;  3OYI A;  4EVI A;  3M3Y J;  4UXN A;  3FMS A;  5DUK A;  2MH9 A;  1JGG A;  2PI0 A;  3V4G A;  4ESF A;  3C1D A;  5JHU A;  3OYN A;  2DA2 A;  4G8X A;  2R0Q C;  1FOW A;  2R7D A;  5K1Y A;  5ERI A;  2V79 A;  3CC7 I;  3DPU A;  2ZFW A;  3FXR A;  2P81 A;  1HC8 A;  1KQ8 A;  3IRR A;  2MSY A;  1IN8 A;  3AG4 H;  1LDD A;  3A0B C;  2CUF A;  5HLI A;  2L5Q A;  3HOU J;  2E1N A;  2Y31 A;  1Z6T A;  3HPH A;  5GAE J;  4BYY A;  2YU3 A;  1MD0 A;  3W2A A;  3CCQ I;  4BH9 A;  4YG2 F;  3CJT B;  4DQ2 A;  3RPQ A;  3ZQ7 A;  2R7F A;  2TRT A;  4CYD A;  2CU7 A;  2HOA A;  3ASN H;  3HZJ A;  4U0W A;  1IXC A;  2RNJ A;  3ERM A;  4IL6 C;  4EV0 A;  2HZD A;  4DIQ A;  4BQA A;  1W36 C;  3MCZ A;  2DT7 B;  1CF7 B;  2RC4 A;  5KCM A;  3K69 A;  3WGG A;  3HHH A;  4CYC B;  3S1R J;  4BKX A;  2DTR A;  4BHP A;  2DT6 A;  4BE1 A;  3CF5 F;  1MNM C;  5TJJ A;  1YJW I;  3ZMU A;  1ETK A;  2DFH A;  2VQC A;  1J59 A;  3AG1 H;  4CHU A;  2M30 A;  3CO7 C;  1ZH5 A;  3OL4 A;  4Y7N J;  4EGZ A;  2OC6 A;  1OCC H;  2DMP A;  4AD9 A;  3E6M A;  4L9V A;  1SEU A;  4C2M J;  2R7R A;  4WCG A;  4QSH A;  4PK4 A;  1DGW Y;  1DPR A;  3S3O A;  4PJM A;  3CDI A;  1Y0U A;  2K3P A;  4U7B A;  1ONV A;  1RET A;  2VBY A;  1Z6R A;  4XOR A;  3HBL A;  3JRF A;  3WTX C;  2R92 J;  3IH3 A;  5F0C A;  2R7S A;  2VOP A;  2EB7 A;  3ZQQ A;  4N9I A;  3ECH A;  3OYK A;  2LKX A;  5CLS A;  3G6E I;  2TDX A;  3RQ4 A;  2IS1 A;  1X2N A;  3F21 A;  4A69 C;  2VI6 A;  5DD4 A;  3VSL A;  3TO9 A;  3I56 I;  5F27 A;  1JJ8 C;  4ASN A;  3CJQ B;  2ZB9 A;  2F5E A;  1W1W E;  3U9G A;  3WU0 A;  2A61 A;  3Q0V A;  3JSP A;  1Z7U A;  1MBJ A;  2B63 J;  2DLL A;  5HS8 A;  2Z9O A;  2WAE A;  2Q2E B;  4IEJ A;  1FTT A;  4E7I A;  2ZJQ F;  3QP6 A;  2P5V A;  4PZJ A;  2BW3 A;  2XAS A;  3RKY A;  3SFZ A;  3IV5 A;  3W3C A;  1WZ2 A;  1VQO I;  3EYI A;  2E2J J;  1AU7 A;  3FXU A;  1G6N A;  2M2E A;  1I3A A;  1YRN A;  1PDN C;  3SYT A;  4XRS A;  2RV8 A;  1SAU A;  2Z16 A;  3BR0 A;  3I5U A;  2FML A;  1HDP A;  3LQQ A;  4DYC A;  2MLG A;  1ETO A;  4M6Y A;  4CCM A;  4ANJ A;  2XPV A;  4XRM A;  4KNY A;  5L3B A;  1ZG5 A;  3QWL A;  1AKH B;  1R6R A;  2CQK A;  3WE2 A;  1S6L A;  3KYL A;  1ORK A;  1ZLK A;  4IHW A;  4II2 A;  3N97 A;  1K7A A;  5GTH C;  1K4T A;  1SD6 A;  3ZMS A;  3JRB A;  3GVA A;  5EJC A;  1XN7 A;  5L3D A;  3IUO A;  2OPT A;  2A3S A;  3GTP J;  3SFI A;  4L0Y B;  5BOX A;  3JRE A;  2QQ8 A;  5L3F A;  1LPQ A;  3CCY A;  4FX0 A;  3S1M J;  3AG2 H;  4BU2 A;  3ZGK A;  1ETV A;  1FPQ A;  3MFK A;  4JYK A;  1FOY A;  3OYC A;  1U8R A;  4PGH A;  3FBN B;  4AIJ A;  1WH5 A;  4XN0 A;  4X0G A;  2HXI A;  3R6S A;  1K6O A;  3M07 A;  2ZXW H;  2X1C A;  3RPU A;  3H9Q A;  4II3 A;  1W36 D;  1ETY A;  1OFC X;  2EZH A;  2XAU A;  1YTY A;  2WY7 Q;  4YFX F;  2F5D A;  3BJO A;  2Z33 A;  1IAW A;  1W7P B;  1X19 A;  2EIM H;  2R93 J;  3VYU B;  4M9S A;  1VQ8 I;  1V55 H;  3KP3 A;  5D6E A;  1FSH A;  2RDP A;  1B72 B;  3Q0U A;  5FRM A;  3SDB A;  1YO5 C;  5E79 C;  2FF4 A;  3ROU A;  5B3S H;  4XQF A;  2L54 A;  3DF8 A;  2XSJ C;  2LH9 A;  3BR2 A;  3G3Z A;  4JK1 X;  4DOZ A;  4DYR A;  1ZRD A;  4A0Z A;  2BVM A;  3ML6 A;  3ABK H;  2QEN A;  2CV0 A;  4IHT A;  2QQA A;  3LSP A;  2FQ4 A;  5IP9 J;  1OCO H;  1P6R A;  3TOB A;  2L9N A;  4ZTF A;  1LUJ B;  4LK0 F;  3DTI A;  3RJP A;  4KIG A;  3OYH A;  2UXN A;  2WAQ A;  1IRG A;  2BGC A;  2R7Z J;  1S3J A;  3QOD A;  4HOB A;  1WJF A;  2OUM A;  1JTX A;  3J81 K;  2HQA A;  2XPW A;  2FOK A;  2PEX A;  3MVP A;  3NWS A;  2EZK A;  3K4B A;  1PYV A;  3SJM A;  3K2A A;  1YW8 A;  3HTS B;  4H0E A;  3MQ0 A;  2LR8 A;  4I98 B;  3JW4 A;  2ISZ A;  1GXQ A;  3TQN A;  3I64 A;  4HQM A;  1LE8 B;  2XKO A;  2LVS A;  3DP7 A;  3QP5 A;  4N4N B;  2OCC H;  1IDZ A;  4PCQ A;  4DZP A;  3I55 I;  2HPI A;  3KEO A;  1HCR A;  2HI3 A;  1YIO A;  2CH0 A;  1OCZ H;  4CXF A;  2DA3 A;  4MEX F;  2K40 A;  1Q1H A;  3GUD A;  5GPC A;  3JCU C;  1H9G A;  4HX7 A;  5CKT A;  5AIQ A;  1IGN A;  3CMM A;  1X1D A;  5HNF A;  4PSX A;  1ZRF A;  2HOE A;  4WXH A;  4ZYD A;  4PSW A;  2A68 F;  4ZDP A;  4AIH A;  1Y1W J;  2R7X A;  2A6T A;  1G4D A;  2VQG A;  1BW6 A;  5HVQ C;  3ABT A;  1KYW A;  1NG6 A;  1W7P D;  4YFN F;  4JX6 A;  4CDG A;  1QVT A;  2ZSH B;  5E8G A;  2ZSI B;  1R36 A;  5FD6 A;  2E34 A;  1KU9 A;  4P1W A;  5F0F A;  3L9F A;  2JRM A;  4RM3 A;  3S16 J;  1X1P A;  2M3A A;  2FMY A;  2M7A A;  5DYM A;  4R79 A;  3MZH A;  3HHG A;  1TQP A;  1MJA A;  4MHG A;  1G2H A;  3R61 A;  1Z3Y A;  5IOZ A;  2N8G A;  1P7J A;  4BEH B;  3ZQF A;  1MSE C;  3OOP A;  2ZO4 A;  3FZV A;  2L7K A;  2FBH A;  2G7H A;  3K4K A;  2VJJ A;  3K4M A;  1B9M A;  2ZME C;  1DP7 P;  4BE2 A;  2NOJ B;  2CUJ A;  2IVM A;  1K78 B;  3OR1 C;  2HTS A;  2IS4 A;  3OOU A;  2A6E F;  4N9H A;  5HLT A;  2R3S A;  1OR7 A;  3EUH C;  3ZQI A;  1X4O A;  1FZP B;  2CQN A;  3IAS 2;  2QEX I;  1PUE E;  2IS2 A;  4M6V A;  1XGM A;  2V9P A;  1LVK A;  1IUY A;  1SVO A;  3GLX A;  1FIA A;  2H6B A;  2BEO A;  2VKE A;  2XF5 A;  3W6J B;  3GTM J;  3R60 A;  3KX2 A;  1USS A;  2MG4 A;  3H0D A;  2P7V B;  2LBF B;  4HNT A;  1CQT A;  3WHC A;  2Q0O A;  3F8F A;  3DWL E;  4ESB A;  4ESJ A;  4ZYA A;  1IC8 A;  2KRF A;  3TO6 A;  4HDU A;  4CZC A;  4OMY A;  3WG7 H;  3HRT A;  4I09 A;  2J5P A;  1BN5 A;  2ZME B;  3HIF A;  3QYB A;  3T0Y A;  2VOD A;  1JUM A;  4DBQ A;  4N0B A;  1IN5 A;  5FFZ A;  1FBU A;  3EYY A;  1I6X A;  1RZ4 A;  3FHZ A;  1T8I A;  5CVR A;  2K02 A;  3S1N J;  1UB9 A;  4EJT A;  1JHH A;  4MNU A;  1R7J A;  1HKQ A;  1V4R A; 
#chains in the Genus database with same CATH homology
 2DOF A;  2LKS A;  2KIS A;  2DOD A;  4FQG A;  1UZC A;  2KIQ A;  2KZG A;  2JUC A;  2L9V A;  2E71 A;  2DOE A;  2B7E A;  2K85 A;  2KFD A;  2CQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...