2DODA

Solution structure of the first ff domain of human transcription factor ca150
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
GSSGSSGARERAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation regulator 1
publication title Solution structure of the first FF domain of human transcription factor CA150
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2dodA00
2CQNA 4FQGA 2DOFA 2KIQA 2KISA 2B7EA 2KZGA 2LKSA 2DOEA 2JUCA 2DODA 1UZCA 2KFDA 2L9VA 2K85A 2E71A
chains in the Genus database with same CATH superfamily
2XPWA 4W97A 2ME0A 1LDKB 4DGWB 3RKXA 3R60A 1V3FA 2K27A 4PSWA 2BV6A 5IT9Z 2CQ7A 5TISC 4XOTA 5DM7F 3TEDA 1ETQA 2L7KA 3PIOF 2VPLA 2R4GA 4IXAA 4A5NA 3IUOA 2HZTA 4Z2YA 2M2EA 1S6LA 4HNTA 2PI0A 2LBFA 4DIQA 2KKOA 2L7ZA 1KZHA 1SVOA 3A0HC 3BLYA 1G3WA 5K7ZA 4PGHA 3PO3J 4RGRA 4HRIA 3H0GJ 1XPXA 1BIAA 5E1XA 1G4DA 1N25A 2L01A 3OL4A 4WXHA 5K7FA 5C4JJ 4Q4ZF 1FOWA 4JQFA 2EBIA 2Y2ZA 4XMYA 3P9CA 2Q1ZB 1G8XA 4BBSJ 2K5CA 1LVKA 3ASOH 1NG7A 4RB0A 1U8BA 2MABA 3RTRA 3OSFA 3OR2C 3KLOA 2YSRA 5DS9A 3UKGA 4G12A 4XN3A 4N9HA 4Y7NJ 1D1CA 3H3ZA 1Z6RA 2V1XA 2NVTJ 2V7FA 3LSTA 2K85A 2Z9OA 2E34A 3D0SA 2OAZA 4KA4A 4HSRA 4KJZA 1XMXA 4P55A 2IPQX 1FMVA 1X1CA 1I27A 3CDIA 5CQEA 4QWQA 1O7FA 1W1WE 3AAFA 2YX7A 1XGNA 3JRDA 4R1HA 3WE2A 2BW3B 3LNQA 1Z7UA 3CJTB 1JKOC 2Z99A 1GHCA 5J1YA 2DLLA 4B48A 1ZRDA 3MWMA 2HOAA 1OCTC 1TQMA 3BG3A 2DFEA 2QYOA 5FO5A 4DYCA 4BYYA 5HS7A 3HSEA 2EWNA 2WADA 2E71A 3FMRA 3S17J 4CO8A 2ZNYA 2GXBA 1W0UA 1SVMA 5CLSA 1OCZH 2ZJRF 1KQ9A 1RZ4A 3HOSA 2GIVA 1OISA 3TW7A 4LJZF 4AIJA 1ZLKA 2RNJA 2DYSH 2H1KA 2BY2A 3V8KA 2V9VA 2L7MP 1OCCH 4HAMA 4C2MJ 3C2HA 1TTYA 2WTEA 3ASNH 5ILVA 2E36A 2M87A 4BBRJ 2DT6A 4FETA 3K4NA 3IP4B 1J75A 1UJ8A 2L02A 1N77A 2A6TA 4PGGA 4IHYA 3QPLA 2KMUA 3QP5A 3QAHA 2X1DA 3GW2A 3DWLE 2P5KA 4HX4A 5HLIA 4ZYGA 2BE5F 3ABTA 5H6QA 5EG0B 5FROA 1G2HA 1OPCA 4Y3OA 1FEXA 4BL0B 1PP7U 5DV5A 3OIQA 2JN6A 4C3IJ 3OS2A 1VZ0A 4ZH4F 2M34A 2A6HF 4BS9A 4XLAA 4HLYA 1E3HA 2ELJA 3AFHA 3Q3SA 3N05A 3ZCOA 2XPVA 1WFXA 3BY6A 3SEQA 3C18A 2Z1DA 3CO6C 5D6FA 3E5UA 1JJ6C 4FE4A 1U9NA 2O0YA 4BUPA 3LMMA 1Y56A 2BY0A 4IJAA 2CQQA 3ZQGA 3F6VA 3CC2I 4L9NA 4XNFA 3K4BA 4DOZA 4BH9A 2V1DA 2LF7A 2ZCWA 3L9FA 4I02A 4P96A 1K4SA 1EV7A 2EZKA 1BA5A 2NS8A 3L2CA 2Q2EB 2V79A 2P5VA 4M6XA 2IEKA 3E3VA 1WHUA 1WJ5A 4FX0A 2VBZA 2VIXA 1G3YA 4M3BA 5H2FC 2E1CA 4BY7J 4A3KJ 5HDGA 1BIBA 2H09A 2Y75A 3RPQA 5FKLA 3QQAA 4A3JJ 3I59B 4Q47A 3BG6A 2Y69H 1U3EM 1BR1A 4YIFA 1MW7A 1VQ4I 1HF0A 3G3ZA 2CV1A 3MAJA 4HEA2 4N0BA 3IKTA 2X6YA 2DMTA 3KEYA 4II2A 5DD4A 4BJ6C 4DYRA 3P5JA 3WGIA 3K4JA 2EIJH 2MFZA 3H5AA 4LG0B 1LFUP 3HOYJ 2DFIA 5HS9A 3ULQB 2E1MB 3FISA 2VT2A 1KQ8A 4QSHA 2LREA 3JRCA 2K9NA 4IVNA 4PFOA 1FSHA 4AD9A 3HSFA 1Z3YA 2R7OA 2F4MB 2PMUA 1MMAA 3BG7A 4OMYA 2E5ZA 1G3SA 2OBPA 4EM2A 4EQQA 3H5NA 3PQKA 3QPHA 2O8KA 1MBKA 3D5LA 4E7JA 4ENKA 2FMYA 2JRTA 4A3FJ 1FX7A 2VC0A 2DMPA 5L3CA 3KZIC 3P9IA 2YR2A 3HRUA 1I50J 2VKDA 3I9V2 3RPUD 3CCUI 2K7LA 2VASA 4ANJA 2ISZA 1QPMA 5EZHA 4I7HA 5EYRA 1XSXA 3TKYA 4CCOA 4YFNF 3RYRA 1JHFA 2K9QA 2AQEA 2YX4A 4RM3A 5H6RA 1YW9A 1J09A 4CYDA 3MKLA 4U7BA 1YJWI 4A3BJ 4DBRA 4O6JA 4UVBA 3K1NA 5DM6F 4AIHA 3HUGA 3ZN0A 5E1WA 2XSDC 1UHSA 2MC3A 1Y1WJ 1D0YA 3OV8A 2FUG2 3V7CA 1HA8A 3HEFA 1RUNA 2DW4A 2BHZA 3O8HA 4AYBN 1USTA 2O6GE 1J0RA 4OIOF 2F2EA 2P6SA 3BPXA 1ETVA 3T1BA 4XORA 5M5YJ 2QKMB 5B5EC 3HXLA 1JGGA 3CJQB 4L9TA 3FXMA 3KP4A 4G6QA 2JUGA 5JLWA 4BGDA 1W0TA 3Q9VA 3GTKJ 5BQTA 2VOOA 3PUBA 3CCRI 2A5WA 3BJOA 1WH5A 1MKMA 3BR2A 4NBQA 3TO7A 1E0EA 3QWLA 2IVMA 1W4MA 1I6HJ 4V2GA 5FFZA 4LFUA 1I3AA 3C3WA 4PK4A 3KX2A 2OQRA 2BYVE 2EFWA 3HTUA 4WF2A 2HXOA 5EEAA 5GAHJ 4BEHB 2Y0MA 2MLKA 3GTLJ 1MBGA 2JA2A 5AONA 3K4KA 3VSKA 3G1MA 1SFXA 1ZH5A 4I99C 2VKEA 3M1CA 2JPCA 1DP7P 3KP7A 4EV0A 5FKKA 2WAQA 1ETYA 4HV6A 4OAYA 1Y1VJ 2L4AA 3CZ6A 4XBFA 4GCVA 3TDZC 1T2KA 4MEYF 4I6ZA 4ABZA 3RDIA 1D8JA 3W6JB 2XAJA 1TW2A 2MLGA 1QQIA 2OTLI 3BZKA 1GXPA 5CKTA 1XG1A 2HQ5A 1FBSA 2FBHA 4A3IJ 5J4YA 4GFBA 1JKRC 2CW7A 1B9NA 3QPSA 3DFGA 1IC8A 3LSKA 4UUSB 2R7TA 4CCJA 4AIDA 4M3GA 3BDDA 4HOBA 2FOWA 1UG0A 3AKZA 3AL0B 3D5RC 1KU2A 2MYSA 1P92A 4DNCA 1FMWA 1WI3A 3MEXA 4RLFA 5HLTA 2R5ZB 2IA0A 5KNLA 3QYEA 4EJVA 3OL3A 4O5VA 1EKEA 1BI3A 2D1VA 4XR6A 5FD5A 4JX4A 4XKWA 5GTIC 2NOJB 4J00A 2JA8J 3H5RA 1SD4A 1JE8A 3ELKA 1ITYA 3PNYA 4CYCA 3M07A 3J7AO 4Y52J 3F23A 3WTXC 1YFHA 4XK4A 4BACA 3AG2H 2V26A 3JRFA 4KDPA 1RETA 4B44A 4PJNA 2XGEA 2Q8KA 3CCEI 2KQRA 1BOAA 4HNUA 1ZGAA 3HM5A 2CQKA 4H4KC 1ZELA 2OV7A 3DPLC 1K78B 2ZJ2A 4RGUA 1R5ID 3EUAA 3FK6A 4F55A 1FWZA 1JUPA 1XCBA 2VKHA 1SMTA 3KYCB 1VI0A 3CJRB 5D5UB 2LMDA 3ZMVA 1QZZA 5F1JA 2M4KA 2R7QA 4G7HF 1JKQC 3FBIB 4L0YB 2RDPA 1HDPA 2CH0A 2VXZA 1VQMI 1PUFB 5KK1A 1VTNC 1IW7F 1U5TB 2ZJQF 3F3XA 1OYIA 1JHHA 4XLNF 2AQFA 4X0GA 4XKVA 2Y9YA 3DBRB 3SDBA 2VXDA 2RQPA 3KP6A 4EEFG 2EIMH 3T5XA 1Q1VA 3CCYA 1DPRA 2HPIA 4J01A 2H6CA 1DQUA 2PMHA 3BR5A 5DCFA 1GXQA 2VKVA 1OMIA 2XKPA 3GBGA 4K2EA 1Y39A 3Q0VA 3WHBA 4E7IA 5TRDA 1SFOJ 4IOCF 1XDUA 3VFZA 1O7LA 4FTHA 3K0LA 2VODA 3KETA 1R9TJ 3AL0C 1T6SA 4ZDOA 1YE9A 1RPWA 2IAIA 1XD7A 2OUMA 1OCRH 4LOCA 1WJCA 1AWCA 4A3CJ 2LKPA 3TO9A 2HVRA 1FP1D 3CLOA 3I56I 3S3OA 3JAMK 3OYBA 2AHQA 2ID6A 2EB7A 4B1RA 2IS1A 1RESA 2V1UA 3HYIA 2LR8A 3R0AA 3MFKA 3FMSA 2VJ5A 2UXNA 4E6KG 3J7YJ 3ROUA 2LBFB 1AKHA 4HF0A 3NAUA 2DPUA 2JJ7A 2XDVA 3CMMA 3TOAA 2GQQA 5J3LA 3BPVA 2RC4A 2DDAA 5CVJA 4XLCA 1MDMB 3CUQC 2KT0A 2I10A 4XRFA 3L2WA 3LSRA 3LSMA 5CYVA 2RVCA 2XGCA 2ZSIB 3ISPA 3M8EA 3VODA 5GAEJ 4A69C 1IDZA 5FKOA 2CWEA 2MC4A 3F6OA 2IS4A 2F6CA 5IYCJ 1S8NA 4OOIA 2ZXIA 5CPRB 4NHJA 5FLVA 3VDXA 3FXUA 3GTMJ 4HF2A 1T98A 3CDHA 4IHTA 1U9OA 3CCLI 1P7IA 3DEEA 1VQ8I 4AC0A 5B1AH 3LSHA 2H8WA 3WTVC 2K40A 1FOKA 4F52A 2QSHX 4MFDA 1G3TA 1VQ6I 5LGNA 4IRIA 2UXXA 5FRNA 2TRTA 3G1LA 4U0WA 3KCCA 2COMA 4WXCA 3EETA 1UELB 1HDDC 2JA7J 3H3VK 3MZ8A 5J40A 2CQNA 2GWRA 1MNEA 2IA2A 3HTSB 3I4NJ 2W85A 2KZVA 4L9JA 5F64A 3LAPA 3EYYA 3HZJA 2HDWA 4M9XA 5LEKA 2KIFA 3OMYA 3M8FA 4OAZA 3HOXJ 4YIRX 2HS5A 5GAGJ 2PLYA 4OIRF 1S7OA 1WZ2A 2VN2A 1Z77A 3A02A 3O6BB 1HBXG 1YHQI 1XS9A 2PG4A 1X19A 2IA1A 4LB6B 1EH7A 1VQ9I 2IS2A 2XF5A 5JR3A 1BW5A 1MMSA 3OS0A 2E7XA 3TP0A 4GGGA 2DU9A 3LSIA 2CUFA 4KMUX 3CCJI 2JTVA 3LQQA 3OIOA 4UB8C 1WQ2A 1JGSA 5C3EJ 3D1NI 3OOUA 3CUQA 4IRGA 2KIQA 3CDLA 3A0BC 2O8XA 2V4JC 2O03A 1HW2A 2B9SA 1U0JA 4NC8A 1OYYA 1F4KA 2M0MA 4M71A 2X6WA 4XQFA 2KDOA 1PYVA 3GXOA 2XSJC 2XAQA 1FTZA 2DO7A 3RKWA 5BMZA 2X9DA 2CFXA 2HTSA 3JTHA 5C4XJ 4UV9A 1MJBA 1QO0D 2BXZA 2CYYA 3V4GA 2WB1A 1YS7A 5IYDJ 4KIBA 3ZXSA 5FKMA 2F5VA 1PUEE 5D4SA 4D9JA 5KCMA 2LFBA 1WRJA 2K3FA 3F8NA 2XPUA 1UHWA 3OY9A 2BZTA 1XDSA 5JI6A 2JRMA 3DTIA 2X4HA 2ZNZA 1MJ9A 3SDGA 3S2HJ 2DJNA 4RDUA 3EPZA 3SZPA 3OYIA 4E7LA 2FEZA 2BXYA 3PNVA 5E20A 1W7PA 5DD8A 1BI1A 3G1OA 1U78A 3ABKH 4JBAA 2DT5A 2GZWA 1OKRA 3GF2A 1K61A 2IGOA 3F8BA 3OOPA 2V9KA 1JUMA 4A6DA 2LG4A 3K10A 2DMQA 3L1PA 3M9AA 3HHHA 3DTKA 4PJ0C 2R0QC 5DUKA 1YOVB 5J6XA 1I6XA 1A6IA 3Q0UA 3CF2A 1XMAA 4U0VA 3ZN1A 4BAYA 2XB0X 5HNHA 2W82A 3ZQLA 1J59A 1FOYA 4BDZA 3ZPLA 4DBQA 4MHGA 1FYLA 1BR4A 1Z05A 3SHFA 3LSGA 2O5RA 4P9FA 3PQJA 3LFKA 3LAJA 3CCVI 3H36A 5GADJ 1USSA 3BOQA 4A0YA 1YJNI 1Z21A 1NTCA 1FIPA 1Z1DA 3CP2A 4CUGA 2NVQJ 2QQAA 3Q9SA 5ILUA 3LA3A 4I0BA 1ZR4A 4FX4A 1W5CC 2MGQA 3Q0WA 1XTAA 2DFHA 2BOLA 2HEOA 5EDNA 3MZHA 1IN7A 3GTPJ 2AS5F 3CTAA 3OYCA 1LJ9A 1D1BA 1K7AA 2OD5A 4BU2A 2MW8A 3V7RA 2V9PA 1FLIA 5CQGA 3O3KA 4KIFA 2XAFA 1GVDA 5DDGA 5FLXK 1TWFJ 2M30A 2MA3A 3COAC 1XSDA 1FOXA 1UFMA 4ASNA 5TJJA 5CVRA 2UWMA 4BQOA 1ENHA 1X58A 2KJCA 4CA0A 1DU0A 1T0FC 1WJDA 2EIKH 1Z3XA 2LTPA 3BTCA 4P5OA 2EFQA 3HPHA 4AWXB 1OFCX 5IP7J 5FLMJ 4ZTFA 5TGTA 1RKTA 2HVQA 1XX5A 1PP8F 4IHXA 4IOAF 2F4IA 3BT9A 3HUGB 1QVTA 4ZDLA 5D8LB 1L3LA 1IN5A 3WE3A 1TL8A 1OCOH 1MH3A 2ELHA 2VBYA 3M1EA 4EM1A 3FHZA 2PFBA 2FU4A 4IEJA 5F6FA 2X51A 3GUDA 4G6DA 1U8RA 4AM3A 4F91B 1Y0NA 2ADUA 4TV7A 5D8KB 5HODA 1REPC 5BPIA 2QSFX 4NC7A 4IL6C 5IY5H 1SAUA 1LQ1A 1Z6TA 4C30A 2RNGA 1XGOA 4U87A 1VQLI 3I71A 2HOTA 1XB4A 3FKJA 3MCZA 5F08A 2K02A 1XC5A 5JVTA 3RQ4A 1IJWC 2XAGA 2ZC2A 1U6GA 4Y33A 2DN0A 2Y9ZA 2P8TA 2EPFA 3IAS2 1AA7A 1O3TA 2DK8A 4CCNA 4PUSA 3JSPA 1KA8A 2QGUA 4E7ZA 4XKCA 1BC8C 1YTYA 1R6RA 3KPHA 1EA3A 2L9NA 4M3FA 3MKWB 1A31A 3WODF 4MEXF 3MKZA 2HTJA 3JREA 5LGTA 3K2ZA 2NOGA 2R7DA 2IBDA 2ID3A 2CS3A 4XN0A 1S9HA 4IF4A 1VQPI 3S1QJ 2ZB9A 3S3NA 2Z16A 5JFRA 1ORKA 1CGPA 3DCFA 3KE2A 1FNNA 3FIWA 4L9VA 2K4BA 4I98B 4B4CA 2R7RA 1GDTA 2DOEA 4IHSA 2K9SA 1A6QA 4MIMA 1Z0XA 2GBYA 2XUBA 3BP8A 2W84A 2XRNA 5HDKA 2FRHA 1A35A 4KNYA 3J7AY 2DTRA 4M3DA 2RGVA 1D5VA 5FGMA 2YU9J 4BXXJ 3S32A 1EH6A 1T0FA 2RQQA 3X2QH 2PBIA 3CC4I 1Q1HA 5ILSA 1J2XA 1X3WB 1IN8A 1NG6A 1B72A 2K9MA 4MLOA 4V19K 1D5YA 1S7AA 2JT1A 3ML6A 5CJ9A 2R5YA 4V2FA 1UB9A 5EJCA 3QYBA 2F5FA 3E6DA 2HQRA 5L3DA 4EMSA 2ZJPF 2DA2A 5JVGF 1JI8A 3G73A 5E3LA 1WJFA 4A3DJ 2ZMEC 4JOMA 4XONA 4U0YA 1LB2A 1U2WA 2F4OB 1YW7A 3GMEA 2JSCA 1WSUA 2QF7A 2WY8Q 3PSFA 4CYCB 3NWTA 3L2VA 1I39A 1QZEA 1ZG5A 3S3MA 5ED4A 2CMPA 5E8GA 4Z6YA 2ZSHB 3E6CC 2A05A 4RS8A 4G9YA 3DU6A 4F93B 4RAYA 5FB2A 3L2UA 4ZTJA 2P5LC 1TT5B 1I1SA 3F8MA 2BGCA 1MD0A 1M1EB 5IOYA 3PFIA 2CU7A 2HXIA 1IG7A 4XIDA 4HNVA 4PJMA 4L5IA 1L0OC 1P4XA 2DA6A 2KPMA 4JX6A 3RI4A 4L0ZB 3K4MA 5M5XJ 2MG4A 1LKXA 2WAQN 2VONA 3BJAA 3IKVA 1XGMA 2FBIA 3FXJA 3S1NJ 4LLGF 5A2QK 5IOZA 2ZFUA 5LHHA 2H1LA 2WV1A 1BW6A 2DMUA 3V42A 3O2PE 4QLCU 1YJ9I 3EDPA 4B3AA 5CVUA 2O61A 4Y17A 3DLLF 3WTSC 1MBFA 2M7BA 2ZKZA 3F8FA 1X2MA 3F72A 1MZBA 1LEAA 2AXLA 3LQRA 4RLQA 3HGYA 3FHNA 3W2VA 3CF5F 1MBHA 2X48A 5IT9K 2EILH 3A01A 3A1YA 5FRMA 2D45A 3EYIA 1T56A 3ABLH 3PFYA 3L2QA 4XM3A 2FJ1A 1CQTA 2HDCA 3KLNA 1R36A 2OZ6A 4D1QA 1JT0A 2ZMEA 3IAM2 2JVHA 3FM3A 4CZCA 2DMNA 3S1MJ 5E3NA 4XICA 1TWHJ 2OJED 4BQAA 3HOUJ 5L3EA 3HSRA 3FK7A 2L9SA 4LGWA 3FM5A 1QBJA 3F8CA 2XGXA 5DCMA 3M3YJ 3F0CA 3B73A 2K86A 3C2GA 3ZMTA 3KYLA 1WKMA 4KISA 2R3SA 2XVCA 2M0CA 2LDUA 2R7ZJ 1ETKA 4E4HA 1AKHB 1ZR2A 4CICA 2I5UA 3DBLB 2IGNA 5M5WJ 1SD6A 3NQOA 3K70C 4G8XA 4YFXF 1JT6A 2LOOA 2IT0A 1N78A 2HDDA 3JRAA 4OIQF 1FPQA 3BZCA 4A0ZA 3OYFA 3ZQCA 1O4XA 3BG9A 1HC8A 2TDXA 4A2UA 5LHIA 2FXAA 4P1WA 4CSWA 4HQMA 1APLC 2EJRA 3KP3A 2HWVA 4BJTA 2WAFA 3K70D 1ODDA 4B43A 3TO6A 1T33A 2DQRA 3K6GA 2ACJA 3VYSB 5BPDA 1FYMA 4DZPA 3ZP5A 2A61A 6PAXA 3L7WA 4FISA 1HLVA 4XSZF 1HSJA 2FF4A 2P81A 2E19A 3DF8A 2MD5A 2LC2A 5B66C 5J1RA 2CG4A 2OPTA 1I1GA 3G4SI 3U2RA 3DKYA 3H9JA 4R79A 3U21A 2DYRH 1HCRA 1EJ9A 3JTGA 4IPAA 5F0CA 2L3DA 4GRIA 2D1HA 4CHUA 2B63J 3U1DA 1KQ0A 4M6VA 4RAFA 2G7HA 2EFNA 4BKXA 1J9IA 2CUZA 2Z2SB 2W57A 5IYBJ 2QLZA 1ULYA 1WCMJ 1LUJB 2J5OA 3U1KA 4CCMA 1SVLA 2DJIA 2HNHA 2O9LA 3QOEA 2CJJA 2DBBA 2DXIA 4DJAA 1HKSA 3HIFA 4G7ZF 2XRLA 1ZRCA 3BCAA 4KYWA 5BOXA 1T8IA 4CXFA 1OCPA 3WTWC 4DYQA 2G0EA 2FBKA 4NUBA 3ESWB 1ON1A 2M8EA 1D8KA 2PJRA 2ISYA 3C2BA 3W6KB 4BHPA 2HYFA 4CCLA 3BJ6A 2M45A 2DFFA 3HOZJ 3CUQB 4RB3C 5L3GA 3BR0A 1QHHD 2X1CA 1OR7C 2XROA 3AG1H 3E97A 5HDNA 2M9HA 3WTUC 3CP8A 3JRHA 4F7ZA 4KIGA 4GO1A 3A4CA 5CVVA 1P6RA 5DTDA 2E2IJ 1JUSA 3GEZA 2MH9A 3S1RJ 1B4AA 1NK2P 3ONQA 4MO7A 4ENJA 2Z3YA 4FASD 2JZYA 3W6VA 1Z7LA 3IHUA 2STTA 2WBMA 1MMNA 1B59A 5FJ8J 3GTJJ 1LFPA 3DKWA 4IRHA 4XLHA 1R1VA 2R7XA 2QBYA 2LLKA 3QP6A 1LFBA 2W48A 3TQNA 2KLOA 4XKBA 2HQAA 3RJPA 4FCYA 2PQ8A 4IQ4A 2DOAA 3E1SA 5K5RA 2XF7A 3W2WA 3S2WA 1KGSA 1BM9A 4ESFA 5M3MJ 2YU3A 3DU5A 1VQKI 2E1OA 1STZA 1W7PB 2QCOA 2W24A 5F27A 4I2OA 3GFJA 4KFCA 4IO9F 1WJEA 1RR7A 4JX5A 3LOCA 3W2AA 1T95A 2KDZA 4LLLA 2ZXWH 2A6EF 3ZOBA 1S7EA 4ZYAA 3A03A 2EZIA 4BNCA 3JR9A 3NRVA 1K79A 3VSLA 1QU3A 5E3OA 1R4NB 3T8RA 1B8IA 2F5DA 2ZXHA 4A5MA 2JA6J 4BHCA 1QGPA 3ECHA 4E7KA 1S5LC 4HQEA 1SD5A 5AIQA 3SFZA 4A6EA 1YI2I 4C9YA 4BQNA 2L9RA 4ZYDA 2X6OA 1ZK8A 2O3FA 4GXOA 3GFIA 4AVZA 2GXGA 1IN4A 2QM3A 3AG3H 3FXOA 3WGGA 4BY1J 1AU7A 3MMYB 2R7WA 4BE0A 1OR7A 2HKXA 1KU9A 4RB2C 2VPRA 2B7EA 3ZMDA 1ZN2A 2JVGA 5JHUA 3QU6A 1YQAA 3DXJF 5J47A 1V55H 3SYTA 2FQ4A 2LY2A 4LMYA 1BL0A 2JPBA 3IH2A 4A3LJ 2IS6A 2XC7A 5F0FA 3BG5A 1Y0UA 2WB1N 1FC3A 1KYWA 1R1UA 1AHDP 2FQ3A 2L4MA 3R0JA 4HZFA 4KN7X 3GZ6A 2BBYA 2GOXB 3QYFA 2FX0A 1MNDA 4HBLA 3V8LA 4MGRA 1RIOH 3R6SA 1XSVA 2ICWG 5KHDA 1O3QA 3VOEA 1BC7C 4XL9A 1R49A 3TMOA 1MH4A 3GX4X 1ZREA 5GP9A 4JP0A 1F1ZA 2P6TA 1IXCA 3J7ZI 3ZMZA 3VWBA 2EINH 3SQNA 3LWFA 4DQ2A 3E5XA 2XIGA 2M5WA 3D5SC 3H9GA 3QU3A 4C3JJ 1RI7A 5EF6A 3CESA 1ZHFA 2OQGA 1GLNA 5KAFC 1K6YA 3HRSA 3LL7A 1O3RA 1IZ1A 1W7PD 1IRGA 3CCQI 4HA8A 1WWXA 3K4CA 3V8JA 1RNLA 4M73A 1TP4A 2XAUA 1D1AA 2XGDA 2QSGX 3FBNB 3DEWA 2HYGD 5D6EA 5EZGA 2W25A 1T08B 3QODA 5L3FA 3JRIA 3N97A 2WC2A 1LVAA 4D7MA 1TLHB 1F5TA 1PDNC 4LD5A 5LD2C 2COBA 1I5ZA 2DDBA 3SEZA 2RN7A 4ZZLA 3WG9A 4QPQA 2P7CB 4G6TB 2DT7B 4ZZDA 1IO2A 1WGXA 1G59A 2GXAA 1MSFC 1VF9A 3I53A 1HW1A 3DKXA 4RB1A 3AG4H 1I3QJ 2ESHA 1B1BA 3T8TA 3G71I 3IL2A 1ZARA 4ZDPA 4N4OB 2LK2A 2IRFG 4EJWA 1ETXA 5FD6A 5HS8A 5D4RA 5HLHA 1SD7A 1SFKA 1DGRM 4PJLA 2KFDA 1IDYA 2LD5A 3NWSA 3GYHX 5DEQA 1PJRA 1QNTA 3HDDA 3SJMA 2X85A 4KN4X 2A3SA 2LY9A 2NNNA 1P9QC 2Y48A 4XSXF 3HRTA 2W4SA 3DTEA 3PJRA 4YEJA 3KYDB 4PDKA 2RKHA 4FQGA 3J81Z 1T39A 2N8GA 2EA4A 4PFPA 5E1ZB 1MSEC 1GV2A 4EJOA 2Y0SA 2JUCA 2KJBA 4DW6A 3OYMA 5E3MA 1B72B 1RUOA 1WH7A 1CF7A 1E3OC 2LYCA 2R5YB 3W3CA 1QZYA 3CD6I 1NHAA 2KIMA 3B02A 2JSPA 5IP6A 4NC6A 1Z91A 1OQYA 3DPUA 3K69A 2CGPA 1HQCA 3CUOA 4AUXA 3UR3C 2NRAC 5HOOA 4I0AA 2QWWA 2QUFA 2VJ4A 1EF4A 2QEXI 3GCMA 4ZYHA 1YITI 1TNTA 2DA5A 4FHTA 3GVAA 2DA4A 2PMZN 4BQQA 4CH7A 2A5YB 4I76A 2A69F 1JJ8C 4UV8A 1ETWA 2K3PA 4HX7A 4W1UA 3R61A 3B6CA 1DDNA 1H0MA 1KU7A 1A36A 2VQLA 2L7FP 1X3UA 2IGMA 4F3QA 5LEJA 1R5GA 4RGXA 2LY1A 2DTZA 2HKOA 4N9IA 4KITB 2D5VA 3K9TA 1ZTRA 4ZC3A 2K4JA 1YX3A 1YS6A 3FF5A 4GYIA 2HGCA 2AO9A 2M1BA 2H94A 5GTHC 2V6EA 4IHWA 3DLAA 5E17F 3NARA 4UB6C 1TQIA 3K2AA 1Z9CA 3ZRGA 1ZRFA 2HYJA 3FX3A 3M7GA 2EZLA 5IP9J 3IRQA 2DQLA 2Z33A 4ZYEA 3FZVA 1MDMA 5EGOA 1TWGJ 1V54H 1Y6IA 2EH3A 5CVIA 1MGTA 2ZXJA 4M72A 4YIIA 4RGSA 5EEGA 4KT6A 2D2WA 3JRGA 4A3EJ 3NEUA 1YIJI 2EV6A 3OYDA 3RYPA 4GYGA 2FA5A 1BI2A 2EZHA 3BWGA 4Q48A 3IV5A 4I09A 4HDUA 1R58A 3S2DJ 1DUXC 4BE1A 4KUMA 5B1BH 3ZGKA 3A01B 1TQPA 1TWAJ 3SFIA 2UV1A 1TZLA 1DU6A 2WV0A 1JKPC 4IKFA 9ANTA 2DAOA 3GO5A 4PSXA 4QPOA 5GPAA 1X1DA 5JLXA 2ZMEB 1SFUA 4NB5A 2M7AA 1TNSA 2VT3A 2DK5A 1RKWA 2M8GX 4LG3A 4IQJA 4PZJA 3QOPA 2XAHA 4MQ9F 4A3GJ 1R23A 2HPMA 5DCMB 5LLQA 3I4MJ 2VQHA 1XGSA 3BQYA 3VB2A 2ESNA 2DPDA 1D0XA 2DOFA 3VYRB 1E2XA 3H3UA 3OWTA 4UXNA 3Q5FA 1IV6A 3PO2J 3WHCA 3KEOA 2PMZA 2HR3A 2RV8A 1YYVA 1VNDA 3EUKL 4O3MA 3OYAA 4CGZA 2R7FA 1F36A 2XF6A 4D5FA 2GLOA 3JCUC 2KHMA 2O7OA 3IRRA 4IHVA 4RBOA 1BN5A 3H35A 1K83J 3CJNA 3HGGA 3L09A 2Z5UA 2R93J 1FBUA 1MMDA 1Y8QB 4PCQA 4R8HA 2OTJI 2F48A 3TDUC 5EEHA 3OYHA 4M9SA 4BHBA 3MKYB 1VQ5I 2H27A 1LE8A 3IWZA 3I4PA 3G6EI 5H20A 3N4MA 1E17A 3UNGC 3WGHA 3HB9A 4ESBA 3GFLA 1F43A 2QZ8A 3HRMA 4NQWA 4UNOA 3KIOA 3ABMH 4B09A 3JRBA 1RRJA 1LDDA 2CW8A 4HLXA 1S72I 1KU3A 3CO7C 1TWCJ 1ZKGA 2VLAA 2LRDA 2E1NA 4U7DA 3IC7A 2ECCA 2VUMJ 1YRNA 3P9KA 4A12A 2E2HJ 2CV2A 4UVAA 2Y31A 3I64A 3BROA 2JMWA 3GFMA 3I3LA 2CUEA 4ETSA 1ZG3A 3H92A 3OYLA 3OYJA 3TBIA 2LSOA 3S93A 4OIPF 4E70A 1FY7A 1JXSA 2DA1A 4EATA 5K7HA 4EGYA 2NYXA 2OCEA 2L5QA 3DQVC 1YO5C 1X1BA 3EUHC 1EH8A 5KAIC 3WTYC 2NXNB 3WG7H 1UMQA 2FOKA 4MTEA 5F0HA 4HF1A 3OYEA 2L54A 1PVEA 4AU7A 3G2BA 4B47A 1BJAA 1MJAA 2DCEA 2LH9A 3OYGA 2PJRB 1SANA 4KMFA 3OIPA 1LPQA 1ACIA 2PEXA 2WA0A 2VJJA 2FSWA 1X3ZB 3GWZA 2BVLA 2F5EA 3WTZA 2YUSA 1JTYA 2V1NA 3HKZN 3O8GA 2VL8A 2LP0A 2OCCH 3FXRA 2E35A 3U9GA 3K1PA 2QKLB 4B3XA 4EJUA 2BY3A 2DODA 5K1YA 4IZZA 5J1UA 4ON0A 4AVPA 3BQZA 2VBXA 2YS9A 5BNGA 3J81K 3BZ6A 4L5JA 2EFPA 4S04A 2R92J 3CMYA 2IP2A 4RAGA 4DZJA 1TBXA 2QQ9A 4MTDA 2QBYB 3ZMSA 3GLLA 1P4WA 1TW3A 2X1EA 3JAMZ 1ONVA 2NNYA 2MD0A 4L5EA 2CW0F 1R00A 3ZR8X 5ICFA 2P0WA 3FXQA 1YLFA 3ERED 1ZGJA 3F9KA 3TGNA 3MVPA 1R71A 4CDGA 4GDFA 2P7VB 3PIPF 4IX7A 3HJEA 5FFXA 2GIZA 2C6YA 1UCRA 2QA4I 2FNAA 4CZZA 1H9GA 3WU2C 3L2RA 1X1PA 3FXLA 4PJJA 4G94A 1QVUA 3PNTA 2GOMA 1KONA 3EQLF 1H88C 3GTGJ 4EM0B 2VE9A 3F22A 1WI9A 2VE8A 3KP5A 3I58A 1B8IB 1FP2A 3E0JB 5FKNA 4HPQA 2DI3A 1GT0C 1HKTA 1XN7A 3RQIA 1RC9A 3PL8A 3SXYA 3EUHA 2CV0A 2BW3A 3OYKA 1BR2A 2ETHA 4WCGA 1LEBA 1Y8RB 2MSYA 1KYZA 2WY7Q 2CRGA 5L3BA 1A04A 4RMNA 3V7SA 4YRVA 2KRHA 4RM2A 2GA2A 2VI6A 4S0HB 1IRZA 2CUJA 2ZBKA 4XOPA 1A5JA 3WU1B 1X4OA 2EQRA 1DP3A 1FJLA 2JA5J 1XMKA 3GTQJ 3H1CA 2VB6A 5K5OA 3E6MA 1W5TA 3OSGA 5LFAA 4C2TA 1J5YA 4ENNA 1X2NA 2KZGA 3HKZA 3JSOA 2NS0A 2ELKA 5LGUA 3RCOA 1TC3C 1D0ZA 4HSTA 2LNBA 1YW8A 1BJZA 5KVRA 1VQNI 2NAZA 3LA7A 1N75A 2K9LA 2AXTC 2IXSA 1YX5A 2XHKA 5ICEA 1T38A 4LB5A 2CFOA 1H8AC 2E2JJ 3KZYA 4L18B 5C44J 2I8DA 4Y4RA 1RR8C 1IGNA 1C0WA 1IXRC 2QVOA 2E1MC 2YPRA 4MFEA 3HPGA 3VYTB 1H9TA 3H9QA 3TL4X 1FIAA 3RPUA 1O3SA 4S05A 3HOTA 3BTIA 3HOWJ 5EG0A 4N4NB 3PSIA 4X1EA 1ZYRF 1IUFA 4XRMA 2E5NA 1ETOA 1G6NA 4HV5A 3QRFF 2M3AA 1WJBA 1ON2A 3R4KA 3E7LA 3CLQA 2H6BA 2MH2A 2UUZA 3ZQHA 4X6AJ 2XB5A 1IF1A 3B6AA 2HI3A 3OS1A 3SZTA 2XASA 1ZGWA 2VQCA 3BR3A 1K4TA 1QPIA 1B6AA 5F1RA 3DPTA 1IN6A 4M74A 1F9NA 2XV4S 3I55I 1IXSB 4XLEA 1FBQA 1IAWA 4ESJA 2OC6A 2UZKA 1GUUA 2PX9A 1UG2A 3KFWX 1OLTA 4H0EA 3S14J 4MNUA 3JW4A 1K6OA 1QHGA 1GVJA 4UHTA 1J7KA 1LNWA 2R7SA 3M8JA 2W1OA 3ZQFA 2VC1A 2HFHA 1UAAA 2Q2EA 1GV5A 2VOPA 3VPRA 1HKQA 3MQ0A 5GPCA 3KZZA 1UHMA 2Q0OA 2R7VA 4AYBA 5D5WB 3LFUA 3LSJA 3ZMUA 1WJAA 3J80Z 4Y15A 1MBJA 1BOBA 1ZAOA 3MD2A 2EA2A 3I59A 5AIPA 4M6YA 3I0TA 2ZO4A 4XRSG 1MNMC 2VQGA 4HX8A 1W36C 1P2FA 2KIUA 3RSNA 2L0KA 3BCBA 2NVYJ 2W7NA 4LG0A 3CMAI 1X4PA 4RAZA 1HXDA 2TCTA 3P7NA 4LK1F 3HL2A 3FDYA 2KL4A 1MBEA 2HQNA 4HW0A 3GLXA 2A07F 4D5CA 2VJIA 3PUFA 2W00A 5J4VA 2DA3A 3ECOA 4M3EA 5LBQA 1LDJA 2IGKA 3TW6A 4C3HJ 1W36D 5J8CA 3MZYA 3BTLA 1QA6A 4UUVA 2CQXA 2NVUB 4LIUA 2EFOA 1SC7A 1CF7B 1W5SA 2FD5A 3FXKA 4CCKA 1ZQ3P 3TOBA 3ERMA 5DUIA 2IJLA 2LKSA 3HG9A 4AIKA 2BEOA 2GA1A 2ECBA 3HC7A 4Q5SF 3A2KA 5ICCA 4ZJZA 4D7NA 1BI0A 4BJ5C 2F5CA 1WVRA 5E79C 5DYMA 2E7WA 1HOMA 1D3YA 2XKOA 1S3JA 2L2OA 4WWCA 4UY8I 4WXDA 1VFCA 1YIOA 5HVQC 2HOSA 3RKQA 2BHYA 1R1TA 3F21A 4FE7A 4F92B 3GTOJ 5FLXZ 1V5FA 4RA2A 1TT0A 2WAEA 2NS7A 2ME6A 2JQ7A 3S15J 4G7OF 2OF7A 3DV8A 4YG2F 1IUYA 3IWFA 2VBWA 4I01A 4WK8F 3KP2A 3PM1A 4LLNA 2KRCA 3E6BA 2RREA 3CQZJ 3FKIJ 4JK1X 4UVCA 5E18F 2EV5A 2KISA 1H89C 1E3PA 2OA4A 2Y30A 1FT9A 1UZCA 1POGA 2PJPA 1SFEA 2CO5A 4HYEA 2LF8A 1B9MA 1P7JA 3LA2A 2OZUA 3GZ5A 2X0LA 2GAUA 3ABUA 4XLPF 3BC8A 3FMQA 1NH3A 1P4AA 3OR1C 2B0LA 5EGOB 4U88A 4OU0A 3DEUA 1AOYA 1O57A 2Y0SN 3DP7A 4ENMA 3KEQA 3L00A 4A93J 2E60A 5J8FA 1NK3P 1S29A 1OJLA 3GZNB 4BEHA 1SAXA 2J5PA 3RZDJ 4OMZA 3C1DA 1BBYA 1QRYA 1ZG1A 1R22A 2G7UA 5B3SH 1VQ7I 1Z67A 2LKXA 3T0YA 1SEUA 5IT3A 4BXUA 5ICGA 2M4GA 3BR1A 5D5XB 2X6XA 5K5QA 1V4RA 4E7HA 3FWEA 4P9UA 4A3MJ 3M4OJ 1DGWY 2FE3A 2L9VA 1FZPB 1MIJA 3I5UA 4NNJA 3HHGA 4LIVA 4BE2A 1SMYF 3SZGA 3WTTC 1DPUA 4MQVA 3S8PA 3DBHB 5HLGA 4EGZA 4OINF 1U5TC 1FTTA 4NDLA 5LRRA 4BXFA 4LITA 1V5EA 2EV0A 4UUSA 4BDYA 1XCVA 2G9WA 1YG2A 1OYWA 3RIRA 2R5ZA 4OWRB 3K7AJ 4A0XA 1IV8A 2RAEA 2QQBA 5HNFA 1HW5A 3REOA 1IRFA 1IRXA 4HG2A 4WX9A 5JHFA 2DA7A 3ZQQA 3RZOJ 2MBFA 5IPAA 5BS6A 1R4MB 2JWTA 1LE8B 2BVMA 4B8XA 3WU0A 5LRSA 3QPTA 3BTJA 3CC7I 3E5QA 2ZFWA 2OU2A 3IH3A 4Y13A 5F04A 1FYKA 3C7JA 3HOVJ 4NQWB 1R7JA 5D5VB 3LSPA 4D0PA 4HDVA 4FT8A 4KT5C 4M9ZA 2LVSA 2HVSA 2PN6A 4II3A 1HSTA 3I54A 3CCMI 1K78A 4JYKA 2KRFA 2IW5A 4J19A 3VEPA 2V6CA 2HZDA 2FNPA 2JK3A 1YRNB 4C2UA 1VQOI 2BY1A 3RKYA 5LHGA 3S16J 5ERIA 2WWYA 2NVXJ 2A68F 1WPKA 3K4LA 2FMLA 4E7SA 4YELA 2GM4A 1ERDA 2KP6A 1V5GA 3TP3A 5E8IA 4QTRA 3CCSI 3CMEI 5M3FJ 2HU9A 2CSOA 3MN2A 4XRSA 1JTXA 1X1AA 2EK5A 2HOEA 2STWA 3HBLA 1R5HA 4YFKF 4KICA 1MMGA 2QQ8A 1PUFA 3ZQ7A 1U5TA 4QIWN 4UUTA 5A2QZ 4LK0F 3J80K 3OYNA 2R7UA 4ITVA 4EJTA 3K1MA 2P4WA 3VYUB 3H0DA 1ZLJA 3ZQIA 2QENA 1FSEA 4EVIA 3BR6A 4XLFA 2H8RA 3IH4A
chains in the Genus database with same CATH topology
2CQNA 4FQGA 2DOFA 2KIQA 2KISA 2B7EA 2KZGA 2LKSA 2DOEA 2JUCA 2DODA 1UZCA 2KFDA 2L9VA 2K85A 2E71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQN A;  4FQG A;  2DOF A;  2KIQ A;  2KIS A;  2B7E A;  2KZG A;  2LKS A;  2DOE A;  2JUC A;  2DOD A;  1UZC A;  2KFD A;  2L9V A;  2K85 A;  2E71 A; 
#chains in the Genus database with same CATH topology
 2XPW A;  4W97 A;  2ME0 A;  1LDK B;  4DGW B;  3RKX A;  3R60 A;  1V3F A;  2K27 A;  4PSW A;  2BV6 A;  5IT9 Z;  2CQ7 A;  5TIS C;  4XOT A;  5DM7 F;  3TED A;  1ETQ A;  2L7K A;  3PIO F;  2VPL A;  2R4G A;  4IXA A;  4A5N A;  3IUO A;  2HZT A;  4Z2Y A;  2M2E A;  1S6L A;  4HNT A;  2PI0 A;  2LBF A;  4DIQ A;  2KKO A;  2L7Z A;  1KZH A;  1SVO A;  3A0H C;  3BLY A;  1G3W A;  5K7Z A;  4PGH A;  3PO3 J;  4RGR A;  4HRI A;  3H0G J;  1XPX A;  1BIA A;  5E1X A;  1G4D A;  1N25 A;  2L01 A;  3OL4 A;  4WXH A;  5K7F A;  5C4J J;  4Q4Z F;  1FOW A;  4JQF A;  2EBI A;  2Y2Z A;  4XMY A;  3P9C A;  2Q1Z B;  1G8X A;  4BBS J;  2K5C A;  1LVK A;  3ASO H;  1NG7 A;  4RB0 A;  1U8B A;  2MAB A;  3RTR A;  3OSF A;  3OR2 C;  3KLO A;  2YSR A;  5DS9 A;  3UKG A;  4G12 A;  4XN3 A;  4N9H A;  4Y7N J;  1D1C A;  3H3Z A;  1Z6R A;  2V1X A;  2NVT J;  2V7F A;  3LST A;  2K85 A;  2Z9O A;  2E34 A;  3D0S A;  2OAZ A;  4KA4 A;  4HSR A;  4KJZ A;  1XMX A;  4P55 A;  2IPQ X;  1FMV A;  1X1C A;  1I27 A;  3CDI A;  5CQE A;  4QWQ A;  1O7F A;  1W1W E;  3AAF A;  2YX7 A;  1XGN A;  3JRD A;  4R1H A;  3WE2 A;  2BW3 B;  3LNQ A;  1Z7U A;  3CJT B;  1JKO C;  2Z99 A;  1GHC A;  5J1Y A;  2DLL A;  4B48 A;  1ZRD A;  3MWM A;  2HOA A;  1OCT C;  1TQM A;  3BG3 A;  2DFE A;  2QYO A;  5FO5 A;  4DYC A;  4BYY A;  5HS7 A;  3HSE A;  2EWN A;  2WAD A;  2E71 A;  3FMR A;  3S17 J;  4CO8 A;  2ZNY A;  2GXB A;  1W0U A;  1SVM A;  5CLS A;  1OCZ H;  2ZJR F;  1KQ9 A;  1RZ4 A;  3HOS A;  2GIV A;  1OIS A;  3TW7 A;  4LJZ F;  4AIJ A;  1ZLK A;  2RNJ A;  2DYS H;  2H1K A;  2BY2 A;  3V8K A;  2V9V A;  2L7M P;  1OCC H;  4HAM A;  4C2M J;  3C2H A;  1TTY A;  2WTE A;  3ASN H;  5ILV A;  2E36 A;  2M87 A;  4BBR J;  2DT6 A;  4FET A;  3K4N A;  3IP4 B;  1J75 A;  1UJ8 A;  2L02 A;  1N77 A;  2A6T A;  4PGG A;  4IHY A;  3QPL A;  2KMU A;  3QP5 A;  3QAH A;  2X1D A;  3GW2 A;  3DWL E;  2P5K A;  4HX4 A;  5HLI A;  4ZYG A;  2BE5 F;  3ABT A;  5H6Q A;  5EG0 B;  5FRO A;  1G2H A;  1OPC A;  4Y3O A;  1FEX A;  4BL0 B;  1PP7 U;  5DV5 A;  3OIQ A;  2JN6 A;  4C3I J;  3OS2 A;  1VZ0 A;  4ZH4 F;  2M34 A;  2A6H F;  4BS9 A;  4XLA A;  4HLY A;  1E3H A;  2ELJ A;  3AFH A;  3Q3S A;  3N05 A;  3ZCO A;  2XPV A;  1WFX A;  3BY6 A;  3SEQ A;  3C18 A;  2Z1D A;  3CO6 C;  5D6F A;  3E5U A;  1JJ6 C;  4FE4 A;  1U9N A;  2O0Y A;  4BUP A;  3LMM A;  1Y56 A;  2BY0 A;  4IJA A;  2CQQ A;  3ZQG A;  3F6V A;  3CC2 I;  4L9N A;  4XNF A;  3K4B A;  4DOZ A;  4BH9 A;  2V1D A;  2LF7 A;  2ZCW A;  3L9F A;  4I02 A;  4P96 A;  1K4S A;  1EV7 A;  2EZK A;  1BA5 A;  2NS8 A;  3L2C A;  2Q2E B;  2V79 A;  2P5V A;  4M6X A;  2IEK A;  3E3V A;  1WHU A;  1WJ5 A;  4FX0 A;  2VBZ A;  2VIX A;  1G3Y A;  4M3B A;  5H2F C;  2E1C A;  4BY7 J;  4A3K J;  5HDG A;  1BIB A;  2H09 A;  2Y75 A;  3RPQ A;  5FKL A;  3QQA A;  4A3J J;  3I59 B;  4Q47 A;  3BG6 A;  2Y69 H;  1U3E M;  1BR1 A;  4YIF A;  1MW7 A;  1VQ4 I;  1HF0 A;  3G3Z A;  2CV1 A;  3MAJ A;  4HEA 2;  4N0B A;  3IKT A;  2X6Y A;  2DMT A;  3KEY A;  4II2 A;  5DD4 A;  4BJ6 C;  4DYR A;  3P5J A;  3WGI A;  3K4J A;  2EIJ H;  2MFZ A;  3H5A A;  4LG0 B;  1LFU P;  3HOY J;  2DFI A;  5HS9 A;  3ULQ B;  2E1M B;  3FIS A;  2VT2 A;  1KQ8 A;  4QSH A;  2LRE A;  3JRC A;  2K9N A;  4IVN A;  4PFO A;  1FSH A;  4AD9 A;  3HSF A;  1Z3Y A;  2R7O A;  2F4M B;  2PMU A;  1MMA A;  3BG7 A;  4OMY A;  2E5Z A;  1G3S A;  2OBP A;  4EM2 A;  4EQQ A;  3H5N A;  3PQK A;  3QPH A;  2O8K A;  1MBK A;  3D5L A;  4E7J A;  4ENK A;  2FMY A;  2JRT A;  4A3F J;  1FX7 A;  2VC0 A;  2DMP A;  5L3C A;  3KZI C;  3P9I A;  2YR2 A;  3HRU A;  1I50 J;  2VKD A;  3I9V 2;  3RPU D;  3CCU I;  2K7L A;  2VAS A;  4ANJ A;  2ISZ A;  1QPM A;  5EZH A;  4I7H A;  5EYR A;  1XSX A;  3TKY A;  4CCO A;  4YFN F;  3RYR A;  1JHF A;  2K9Q A;  2AQE A;  2YX4 A;  4RM3 A;  5H6R A;  1YW9 A;  1J09 A;  4CYD A;  3MKL A;  4U7B A;  1YJW I;  4A3B J;  4DBR A;  4O6J A;  4UVB A;  3K1N A;  5DM6 F;  4AIH A;  3HUG A;  3ZN0 A;  5E1W A;  2XSD C;  1UHS A;  2MC3 A;  1Y1W J;  1D0Y A;  3OV8 A;  2FUG 2;  3V7C A;  1HA8 A;  3HEF A;  1RUN A;  2DW4 A;  2BHZ A;  3O8H A;  4AYB N;  1UST A;  2O6G E;  1J0R A;  4OIO F;  2F2E A;  2P6S A;  3BPX A;  1ETV A;  3T1B A;  4XOR A;  5M5Y J;  2QKM B;  5B5E C;  3HXL A;  1JGG A;  3CJQ B;  4L9T A;  3FXM A;  3KP4 A;  4G6Q A;  2JUG A;  5JLW A;  4BGD A;  1W0T A;  3Q9V A;  3GTK J;  5BQT A;  2VOO A;  3PUB A;  3CCR I;  2A5W A;  3BJO A;  1WH5 A;  1MKM A;  3BR2 A;  4NBQ A;  3TO7 A;  1E0E A;  3QWL A;  2IVM A;  1W4M A;  1I6H J;  4V2G A;  5FFZ A;  4LFU A;  1I3A A;  3C3W A;  4PK4 A;  3KX2 A;  2OQR A;  2BYV E;  2EFW A;  3HTU A;  4WF2 A;  2HXO A;  5EEA A;  5GAH J;  4BEH B;  2Y0M A;  2MLK A;  3GTL J;  1MBG A;  2JA2 A;  5AON A;  3K4K A;  3VSK A;  3G1M A;  1SFX A;  1ZH5 A;  4I99 C;  2VKE A;  3M1C A;  2JPC A;  1DP7 P;  3KP7 A;  4EV0 A;  5FKK A;  2WAQ A;  1ETY A;  4HV6 A;  4OAY A;  1Y1V J;  2L4A A;  3CZ6 A;  4XBF A;  4GCV A;  3TDZ C;  1T2K A;  4MEY F;  4I6Z A;  4ABZ A;  3RDI A;  1D8J A;  3W6J B;  2XAJ A;  1TW2 A;  2MLG A;  1QQI A;  2OTL I;  3BZK A;  1GXP A;  5CKT A;  1XG1 A;  2HQ5 A;  1FBS A;  2FBH A;  4A3I J;  5J4Y A;  4GFB A;  1JKR C;  2CW7 A;  1B9N A;  3QPS A;  3DFG A;  1IC8 A;  3LSK A;  4UUS B;  2R7T A;  4CCJ A;  4AID A;  4M3G A;  3BDD A;  4HOB A;  2FOW A;  1UG0 A;  3AKZ A;  3AL0 B;  3D5R C;  1KU2 A;  2MYS A;  1P92 A;  4DNC A;  1FMW A;  1WI3 A;  3MEX A;  4RLF A;  5HLT A;  2R5Z B;  2IA0 A;  5KNL A;  3QYE A;  4EJV A;  3OL3 A;  4O5V A;  1EKE A;  1BI3 A;  2D1V A;  4XR6 A;  5FD5 A;  4JX4 A;  4XKW A;  5GTI C;  2NOJ B;  4J00 A;  2JA8 J;  3H5R A;  1SD4 A;  1JE8 A;  3ELK A;  1ITY A;  3PNY A;  4CYC A;  3M07 A;  3J7A O;  4Y52 J;  3F23 A;  3WTX C;  1YFH A;  4XK4 A;  4BAC A;  3AG2 H;  2V26 A;  3JRF A;  4KDP A;  1RET A;  4B44 A;  4PJN A;  2XGE A;  2Q8K A;  3CCE I;  2KQR A;  1BOA A;  4HNU A;  1ZGA A;  3HM5 A;  2CQK A;  4H4K C;  1ZEL A;  2OV7 A;  3DPL C;  1K78 B;  2ZJ2 A;  4RGU A;  1R5I D;  3EUA A;  3FK6 A;  4F55 A;  1FWZ A;  1JUP A;  1XCB A;  2VKH A;  1SMT A;  3KYC B;  1VI0 A;  3CJR B;  5D5U B;  2LMD A;  3ZMV A;  1QZZ A;  5F1J A;  2M4K A;  2R7Q A;  4G7H F;  1JKQ C;  3FBI B;  4L0Y B;  2RDP A;  1HDP A;  2CH0 A;  2VXZ A;  1VQM I;  1PUF B;  5KK1 A;  1VTN C;  1IW7 F;  1U5T B;  2ZJQ F;  3F3X A;  1OYI A;  1JHH A;  4XLN F;  2AQF A;  4X0G A;  4XKV A;  2Y9Y A;  3DBR B;  3SDB A;  2VXD A;  2RQP A;  3KP6 A;  4EEF G;  2EIM H;  3T5X A;  1Q1V A;  3CCY A;  1DPR A;  2HPI A;  4J01 A;  2H6C A;  1DQU A;  2PMH A;  3BR5 A;  5DCF A;  1GXQ A;  2VKV A;  1OMI A;  2XKP A;  3GBG A;  4K2E A;  1Y39 A;  3Q0V A;  3WHB A;  4E7I A;  5TRD A;  1SFO J;  4IOC F;  1XDU A;  3VFZ A;  1O7L A;  4FTH A;  3K0L A;  2VOD A;  3KET A;  1R9T J;  3AL0 C;  1T6S A;  4ZDO A;  1YE9 A;  1RPW A;  2IAI A;  1XD7 A;  2OUM A;  1OCR H;  4LOC A;  1WJC A;  1AWC A;  4A3C J;  2LKP A;  3TO9 A;  2HVR A;  1FP1 D;  3CLO A;  3I56 I;  3S3O A;  3JAM K;  3OYB A;  2AHQ A;  2ID6 A;  2EB7 A;  4B1R A;  2IS1 A;  1RES A;  2V1U A;  3HYI A;  2LR8 A;  3R0A A;  3MFK A;  3FMS A;  2VJ5 A;  2UXN A;  4E6K G;  3J7Y J;  3ROU A;  2LBF B;  1AKH A;  4HF0 A;  3NAU A;  2DPU A;  2JJ7 A;  2XDV A;  3CMM A;  3TOA A;  2GQQ A;  5J3L A;  3BPV A;  2RC4 A;  2DDA A;  5CVJ A;  4XLC A;  1MDM B;  3CUQ C;  2KT0 A;  2I10 A;  4XRF A;  3L2W A;  3LSR A;  3LSM A;  5CYV A;  2RVC A;  2XGC A;  2ZSI B;  3ISP A;  3M8E A;  3VOD A;  5GAE J;  4A69 C;  1IDZ A;  5FKO A;  2CWE A;  2MC4 A;  3F6O A;  2IS4 A;  2F6C A;  5IYC J;  1S8N A;  4OOI A;  2ZXI A;  5CPR B;  4NHJ A;  5FLV A;  3VDX A;  3FXU A;  3GTM J;  4HF2 A;  1T98 A;  3CDH A;  4IHT A;  1U9O A;  3CCL I;  1P7I A;  3DEE A;  1VQ8 I;  4AC0 A;  5B1A H;  3LSH A;  2H8W A;  3WTV C;  2K40 A;  1FOK A;  4F52 A;  2QSH X;  4MFD A;  1G3T A;  1VQ6 I;  5LGN A;  4IRI A;  2UXX A;  5FRN A;  2TRT A;  3G1L A;  4U0W A;  3KCC A;  2COM A;  4WXC A;  3EET A;  1UEL B;  1HDD C;  2JA7 J;  3H3V K;  3MZ8 A;  5J40 A;  2CQN A;  2GWR A;  1MNE A;  2IA2 A;  3HTS B;  3I4N J;  2W85 A;  2KZV A;  4L9J A;  5F64 A;  3LAP A;  3EYY A;  3HZJ A;  2HDW A;  4M9X A;  5LEK A;  2KIF A;  3OMY A;  3M8F A;  4OAZ A;  3HOX J;  4YIR X;  2HS5 A;  5GAG J;  2PLY A;  4OIR F;  1S7O A;  1WZ2 A;  2VN2 A;  1Z77 A;  3A02 A;  3O6B B;  1HBX G;  1YHQ I;  1XS9 A;  2PG4 A;  1X19 A;  2IA1 A;  4LB6 B;  1EH7 A;  1VQ9 I;  2IS2 A;  2XF5 A;  5JR3 A;  1BW5 A;  1MMS A;  3OS0 A;  2E7X A;  3TP0 A;  4GGG A;  2DU9 A;  3LSI A;  2CUF A;  4KMU X;  3CCJ I;  2JTV A;  3LQQ A;  3OIO A;  4UB8 C;  1WQ2 A;  1JGS A;  5C3E J;  3D1N I;  3OOU A;  3CUQ A;  4IRG A;  2KIQ A;  3CDL A;  3A0B C;  2O8X A;  2V4J C;  2O03 A;  1HW2 A;  2B9S A;  1U0J A;  4NC8 A;  1OYY A;  1F4K A;  2M0M A;  4M71 A;  2X6W A;  4XQF A;  2KDO A;  1PYV A;  3GXO A;  2XSJ C;  2XAQ A;  1FTZ A;  2DO7 A;  3RKW A;  5BMZ A;  2X9D A;  2CFX A;  2HTS A;  3JTH A;  5C4X J;  4UV9 A;  1MJB A;  1QO0 D;  2BXZ A;  2CYY A;  3V4G A;  2WB1 A;  1YS7 A;  5IYD J;  4KIB A;  3ZXS A;  5FKM A;  2F5V A;  1PUE E;  5D4S A;  4D9J A;  5KCM A;  2LFB A;  1WRJ A;  2K3F A;  3F8N A;  2XPU A;  1UHW A;  3OY9 A;  2BZT A;  1XDS A;  5JI6 A;  2JRM A;  3DTI A;  2X4H A;  2ZNZ A;  1MJ9 A;  3SDG A;  3S2H J;  2DJN A;  4RDU A;  3EPZ A;  3SZP A;  3OYI A;  4E7L A;  2FEZ A;  2BXY A;  3PNV A;  5E20 A;  1W7P A;  5DD8 A;  1BI1 A;  3G1O A;  1U78 A;  3ABK H;  4JBA A;  2DT5 A;  2GZW A;  1OKR A;  3GF2 A;  1K61 A;  2IGO A;  3F8B A;  3OOP A;  2V9K A;  1JUM A;  4A6D A;  2LG4 A;  3K10 A;  2DMQ A;  3L1P A;  3M9A A;  3HHH A;  3DTK A;  4PJ0 C;  2R0Q C;  5DUK A;  1YOV B;  5J6X A;  1I6X A;  1A6I A;  3Q0U A;  3CF2 A;  1XMA A;  4U0V A;  3ZN1 A;  4BAY A;  2XB0 X;  5HNH A;  2W82 A;  3ZQL A;  1J59 A;  1FOY A;  4BDZ A;  3ZPL A;  4DBQ A;  4MHG A;  1FYL A;  1BR4 A;  1Z05 A;  3SHF A;  3LSG A;  2O5R A;  4P9F A;  3PQJ A;  3LFK A;  3LAJ A;  3CCV I;  3H36 A;  5GAD J;  1USS A;  3BOQ A;  4A0Y A;  1YJN I;  1Z21 A;  1NTC A;  1FIP A;  1Z1D A;  3CP2 A;  4CUG A;  2NVQ J;  2QQA A;  3Q9S A;  5ILU A;  3LA3 A;  4I0B A;  1ZR4 A;  4FX4 A;  1W5C C;  2MGQ A;  3Q0W A;  1XTA A;  2DFH A;  2BOL A;  2HEO A;  5EDN A;  3MZH A;  1IN7 A;  3GTP J;  2AS5 F;  3CTA A;  3OYC A;  1LJ9 A;  1D1B A;  1K7A A;  2OD5 A;  4BU2 A;  2MW8 A;  3V7R A;  2V9P A;  1FLI A;  5CQG A;  3O3K A;  4KIF A;  2XAF A;  1GVD A;  5DDG A;  5FLX K;  1TWF J;  2M30 A;  2MA3 A;  3COA C;  1XSD A;  1FOX A;  1UFM A;  4ASN A;  5TJJ A;  5CVR A;  2UWM A;  4BQO A;  1ENH A;  1X58 A;  2KJC A;  4CA0 A;  1DU0 A;  1T0F C;  1WJD A;  2EIK H;  1Z3X A;  2LTP A;  3BTC A;  4P5O A;  2EFQ A;  3HPH A;  4AWX B;  1OFC X;  5IP7 J;  5FLM J;  4ZTF A;  5TGT A;  1RKT A;  2HVQ A;  1XX5 A;  1PP8 F;  4IHX A;  4IOA F;  2F4I A;  3BT9 A;  3HUG B;  1QVT A;  4ZDL A;  5D8L B;  1L3L A;  1IN5 A;  3WE3 A;  1TL8 A;  1OCO H;  1MH3 A;  2ELH A;  2VBY A;  3M1E A;  4EM1 A;  3FHZ A;  2PFB A;  2FU4 A;  4IEJ A;  5F6F A;  2X51 A;  3GUD A;  4G6D A;  1U8R A;  4AM3 A;  4F91 B;  1Y0N A;  2ADU A;  4TV7 A;  5D8K B;  5HOD A;  1REP C;  5BPI A;  2QSF X;  4NC7 A;  4IL6 C;  5IY5 H;  1SAU A;  1LQ1 A;  1Z6T A;  4C30 A;  2RNG A;  1XGO A;  4U87 A;  1VQL I;  3I71 A;  2HOT A;  1XB4 A;  3FKJ A;  3MCZ A;  5F08 A;  2K02 A;  1XC5 A;  5JVT A;  3RQ4 A;  1IJW C;  2XAG A;  2ZC2 A;  1U6G A;  4Y33 A;  2DN0 A;  2Y9Z A;  2P8T A;  2EPF A;  3IAS 2;  1AA7 A;  1O3T A;  2DK8 A;  4CCN A;  4PUS A;  3JSP A;  1KA8 A;  2QGU A;  4E7Z A;  4XKC A;  1BC8 C;  1YTY A;  1R6R A;  3KPH A;  1EA3 A;  2L9N A;  4M3F A;  3MKW B;  1A31 A;  3WOD F;  4MEX F;  3MKZ A;  2HTJ A;  3JRE A;  5LGT A;  3K2Z A;  2NOG A;  2R7D A;  2IBD A;  2ID3 A;  2CS3 A;  4XN0 A;  1S9H A;  4IF4 A;  1VQP I;  3S1Q J;  2ZB9 A;  3S3N A;  2Z16 A;  5JFR A;  1ORK A;  1CGP A;  3DCF A;  3KE2 A;  1FNN A;  3FIW A;  4L9V A;  2K4B A;  4I98 B;  4B4C A;  2R7R A;  1GDT A;  2DOE A;  4IHS A;  2K9S A;  1A6Q A;  4MIM A;  1Z0X A;  2GBY A;  2XUB A;  3BP8 A;  2W84 A;  2XRN A;  5HDK A;  2FRH A;  1A35 A;  4KNY A;  3J7A Y;  2DTR A;  4M3D A;  2RGV A;  1D5V A;  5FGM A;  2YU9 J;  4BXX J;  3S32 A;  1EH6 A;  1T0F A;  2RQQ A;  3X2Q H;  2PBI A;  3CC4 I;  1Q1H A;  5ILS A;  1J2X A;  1X3W B;  1IN8 A;  1NG6 A;  1B72 A;  2K9M A;  4MLO A;  4V19 K;  1D5Y A;  1S7A A;  2JT1 A;  3ML6 A;  5CJ9 A;  2R5Y A;  4V2F A;  1UB9 A;  5EJC A;  3QYB A;  2F5F A;  3E6D A;  2HQR A;  5L3D A;  4EMS A;  2ZJP F;  2DA2 A;  5JVG F;  1JI8 A;  3G73 A;  5E3L A;  1WJF A;  4A3D J;  2ZME C;  4JOM A;  4XON A;  4U0Y A;  1LB2 A;  1U2W A;  2F4O B;  1YW7 A;  3GME A;  2JSC A;  1WSU A;  2QF7 A;  2WY8 Q;  3PSF A;  4CYC B;  3NWT A;  3L2V A;  1I39 A;  1QZE A;  1ZG5 A;  3S3M A;  5ED4 A;  2CMP A;  5E8G A;  4Z6Y A;  2ZSH B;  3E6C C;  2A05 A;  4RS8 A;  4G9Y A;  3DU6 A;  4F93 B;  4RAY A;  5FB2 A;  3L2U A;  4ZTJ A;  2P5L C;  1TT5 B;  1I1S A;  3F8M A;  2BGC A;  1MD0 A;  1M1E B;  5IOY A;  3PFI A;  2CU7 A;  2HXI A;  1IG7 A;  4XID A;  4HNV A;  4PJM A;  4L5I A;  1L0O C;  1P4X A;  2DA6 A;  2KPM A;  4JX6 A;  3RI4 A;  4L0Z B;  3K4M A;  5M5X J;  2MG4 A;  1LKX A;  2WAQ N;  2VON A;  3BJA A;  3IKV A;  1XGM A;  2FBI A;  3FXJ A;  3S1N J;  4LLG F;  5A2Q K;  5IOZ A;  2ZFU A;  5LHH A;  2H1L A;  2WV1 A;  1BW6 A;  2DMU A;  3V42 A;  3O2P E;  4QLC U;  1YJ9 I;  3EDP A;  4B3A A;  5CVU A;  2O61 A;  4Y17 A;  3DLL F;  3WTS C;  1MBF A;  2M7B A;  2ZKZ A;  3F8F A;  1X2M A;  3F72 A;  1MZB A;  1LEA A;  2AXL A;  3LQR A;  4RLQ A;  3HGY A;  3FHN A;  3W2V A;  3CF5 F;  1MBH A;  2X48 A;  5IT9 K;  2EIL H;  3A01 A;  3A1Y A;  5FRM A;  2D45 A;  3EYI A;  1T56 A;  3ABL H;  3PFY A;  3L2Q A;  4XM3 A;  2FJ1 A;  1CQT A;  2HDC A;  3KLN A;  1R36 A;  2OZ6 A;  4D1Q A;  1JT0 A;  2ZME A;  3IAM 2;  2JVH A;  3FM3 A;  4CZC A;  2DMN A;  3S1M J;  5E3N A;  4XIC A;  1TWH J;  2OJE D;  4BQA A;  3HOU J;  5L3E A;  3HSR A;  3FK7 A;  2L9S A;  4LGW A;  3FM5 A;  1QBJ A;  3F8C A;  2XGX A;  5DCM A;  3M3Y J;  3F0C A;  3B73 A;  2K86 A;  3C2G A;  3ZMT A;  3KYL A;  1WKM A;  4KIS A;  2R3S A;  2XVC A;  2M0C A;  2LDU A;  2R7Z J;  1ETK A;  4E4H A;  1AKH B;  1ZR2 A;  4CIC A;  2I5U A;  3DBL B;  2IGN A;  5M5W J;  1SD6 A;  3NQO A;  3K70 C;  4G8X A;  4YFX F;  1JT6 A;  2LOO A;  2IT0 A;  1N78 A;  2HDD A;  3JRA A;  4OIQ F;  1FPQ A;  3BZC A;  4A0Z A;  3OYF A;  3ZQC A;  1O4X A;  3BG9 A;  1HC8 A;  2TDX A;  4A2U A;  5LHI A;  2FXA A;  4P1W A;  4CSW A;  4HQM A;  1APL C;  2EJR A;  3KP3 A;  2HWV A;  4BJT A;  2WAF A;  3K70 D;  1ODD A;  4B43 A;  3TO6 A;  1T33 A;  2DQR A;  3K6G A;  2ACJ A;  3VYS B;  5BPD A;  1FYM A;  4DZP A;  3ZP5 A;  2A61 A;  6PAX A;  3L7W A;  4FIS A;  1HLV A;  4XSZ F;  1HSJ A;  2FF4 A;  2P81 A;  2E19 A;  3DF8 A;  2MD5 A;  2LC2 A;  5B66 C;  5J1R A;  2CG4 A;  2OPT A;  1I1G A;  3G4S I;  3U2R A;  3DKY A;  3H9J A;  4R79 A;  3U21 A;  2DYR H;  1HCR A;  1EJ9 A;  3JTG A;  4IPA A;  5F0C A;  2L3D A;  4GRI A;  2D1H A;  4CHU A;  2B63 J;  3U1D A;  1KQ0 A;  4M6V A;  4RAF A;  2G7H A;  2EFN A;  4BKX A;  1J9I A;  2CUZ A;  2Z2S B;  2W57 A;  5IYB J;  2QLZ A;  1ULY A;  1WCM J;  1LUJ B;  2J5O A;  3U1K A;  4CCM A;  1SVL A;  2DJI A;  2HNH A;  2O9L A;  3QOE A;  2CJJ A;  2DBB A;  2DXI A;  4DJA A;  1HKS A;  3HIF A;  4G7Z F;  2XRL A;  1ZRC A;  3BCA A;  4KYW A;  5BOX A;  1T8I A;  4CXF A;  1OCP A;  3WTW C;  4DYQ A;  2G0E A;  2FBK A;  4NUB A;  3ESW B;  1ON1 A;  2M8E A;  1D8K A;  2PJR A;  2ISY A;  3C2B A;  3W6K B;  4BHP A;  2HYF A;  4CCL A;  3BJ6 A;  2M45 A;  2DFF A;  3HOZ J;  3CUQ B;  4RB3 C;  5L3G A;  3BR0 A;  1QHH D;  2X1C A;  1OR7 C;  2XRO A;  3AG1 H;  3E97 A;  5HDN A;  2M9H A;  3WTU C;  3CP8 A;  3JRH A;  4F7Z A;  4KIG A;  4GO1 A;  3A4C A;  5CVV A;  1P6R A;  5DTD A;  2E2I J;  1JUS A;  3GEZ A;  2MH9 A;  3S1R J;  1B4A A;  1NK2 P;  3ONQ A;  4MO7 A;  4ENJ A;  2Z3Y A;  4FAS D;  2JZY A;  3W6V A;  1Z7L A;  3IHU A;  2STT A;  2WBM A;  1MMN A;  1B59 A;  5FJ8 J;  3GTJ J;  1LFP A;  3DKW A;  4IRH A;  4XLH A;  1R1V A;  2R7X A;  2QBY A;  2LLK A;  3QP6 A;  1LFB A;  2W48 A;  3TQN A;  2KLO A;  4XKB A;  2HQA A;  3RJP A;  4FCY A;  2PQ8 A;  4IQ4 A;  2DOA A;  3E1S A;  5K5R A;  2XF7 A;  3W2W A;  3S2W A;  1KGS A;  1BM9 A;  4ESF A;  5M3M J;  2YU3 A;  3DU5 A;  1VQK I;  2E1O A;  1STZ A;  1W7P B;  2QCO A;  2W24 A;  5F27 A;  4I2O A;  3GFJ A;  4KFC A;  4IO9 F;  1WJE A;  1RR7 A;  4JX5 A;  3LOC A;  3W2A A;  1T95 A;  2KDZ A;  4LLL A;  2ZXW H;  2A6E F;  3ZOB A;  1S7E A;  4ZYA A;  3A03 A;  2EZI A;  4BNC A;  3JR9 A;  3NRV A;  1K79 A;  3VSL A;  1QU3 A;  5E3O A;  1R4N B;  3T8R A;  1B8I A;  2F5D A;  2ZXH A;  4A5M A;  2JA6 J;  4BHC A;  1QGP A;  3ECH A;  4E7K A;  1S5L C;  4HQE A;  1SD5 A;  5AIQ A;  3SFZ A;  4A6E A;  1YI2 I;  4C9Y A;  4BQN A;  2L9R A;  4ZYD A;  2X6O A;  1ZK8 A;  2O3F A;  4GXO A;  3GFI A;  4AVZ A;  2GXG A;  1IN4 A;  2QM3 A;  3AG3 H;  3FXO A;  3WGG A;  4BY1 J;  1AU7 A;  3MMY B;  2R7W A;  4BE0 A;  1OR7 A;  2HKX A;  1KU9 A;  4RB2 C;  2VPR A;  2B7E A;  3ZMD A;  1ZN2 A;  2JVG A;  5JHU A;  3QU6 A;  1YQA A;  3DXJ F;  5J47 A;  1V55 H;  3SYT A;  2FQ4 A;  2LY2 A;  4LMY A;  1BL0 A;  2JPB A;  3IH2 A;  4A3L J;  2IS6 A;  2XC7 A;  5F0F A;  3BG5 A;  1Y0U A;  2WB1 N;  1FC3 A;  1KYW A;  1R1U A;  1AHD P;  2FQ3 A;  2L4M A;  3R0J A;  4HZF A;  4KN7 X;  3GZ6 A;  2BBY A;  2GOX B;  3QYF A;  2FX0 A;  1MND A;  4HBL A;  3V8L A;  4MGR A;  1RIO H;  3R6S A;  1XSV A;  2ICW G;  5KHD A;  1O3Q A;  3VOE A;  1BC7 C;  4XL9 A;  1R49 A;  3TMO A;  1MH4 A;  3GX4 X;  1ZRE A;  5GP9 A;  4JP0 A;  1F1Z A;  2P6T A;  1IXC A;  3J7Z I;  3ZMZ A;  3VWB A;  2EIN H;  3SQN A;  3LWF A;  4DQ2 A;  3E5X A;  2XIG A;  2M5W A;  3D5S C;  3H9G A;  3QU3 A;  4C3J J;  1RI7 A;  5EF6 A;  3CES A;  1ZHF A;  2OQG A;  1GLN A;  5KAF C;  1K6Y A;  3HRS A;  3LL7 A;  1O3R A;  1IZ1 A;  1W7P D;  1IRG A;  3CCQ I;  4HA8 A;  1WWX A;  3K4C A;  3V8J A;  1RNL A;  4M73 A;  1TP4 A;  2XAU A;  1D1A A;  2XGD A;  2QSG X;  3FBN B;  3DEW A;  2HYG D;  5D6E A;  5EZG A;  2W25 A;  1T08 B;  3QOD A;  5L3F A;  3JRI A;  3N97 A;  2WC2 A;  1LVA A;  4D7M A;  1TLH B;  1F5T A;  1PDN C;  4LD5 A;  5LD2 C;  2COB A;  1I5Z A;  2DDB A;  3SEZ A;  2RN7 A;  4ZZL A;  3WG9 A;  4QPQ A;  2P7C B;  4G6T B;  2DT7 B;  4ZZD A;  1IO2 A;  1WGX A;  1G59 A;  2GXA A;  1MSF C;  1VF9 A;  3I53 A;  1HW1 A;  3DKX A;  4RB1 A;  3AG4 H;  1I3Q J;  2ESH A;  1B1B A;  3T8T A;  3G71 I;  3IL2 A;  1ZAR A;  4ZDP A;  4N4O B;  2LK2 A;  2IRF G;  4EJW A;  1ETX A;  5FD6 A;  5HS8 A;  5D4R A;  5HLH A;  1SD7 A;  1SFK A;  1DGR M;  4PJL A;  2KFD A;  1IDY A;  2LD5 A;  3NWS A;  3GYH X;  5DEQ A;  1PJR A;  1QNT A;  3HDD A;  3SJM A;  2X85 A;  4KN4 X;  2A3S A;  2LY9 A;  2NNN A;  1P9Q C;  2Y48 A;  4XSX F;  3HRT A;  2W4S A;  3DTE A;  3PJR A;  4YEJ A;  3KYD B;  4PDK A;  2RKH A;  4FQG A;  3J81 Z;  1T39 A;  2N8G A;  2EA4 A;  4PFP A;  5E1Z B;  1MSE C;  1GV2 A;  4EJO A;  2Y0S A;  2JUC A;  2KJB A;  4DW6 A;  3OYM A;  5E3M A;  1B72 B;  1RUO A;  1WH7 A;  1CF7 A;  1E3O C;  2LYC A;  2R5Y B;  3W3C A;  1QZY A;  3CD6 I;  1NHA A;  2KIM A;  3B02 A;  2JSP A;  5IP6 A;  4NC6 A;  1Z91 A;  1OQY A;  3DPU A;  3K69 A;  2CGP A;  1HQC A;  3CUO A;  4AUX A;  3UR3 C;  2NRA C;  5HOO A;  4I0A A;  2QWW A;  2QUF A;  2VJ4 A;  1EF4 A;  2QEX I;  3GCM A;  4ZYH A;  1YIT I;  1TNT A;  2DA5 A;  4FHT A;  3GVA A;  2DA4 A;  2PMZ N;  4BQQ A;  4CH7 A;  2A5Y B;  4I76 A;  2A69 F;  1JJ8 C;  4UV8 A;  1ETW A;  2K3P A;  4HX7 A;  4W1U A;  3R61 A;  3B6C A;  1DDN A;  1H0M A;  1KU7 A;  1A36 A;  2VQL A;  2L7F P;  1X3U A;  2IGM A;  4F3Q A;  5LEJ A;  1R5G A;  4RGX A;  2LY1 A;  2DTZ A;  2HKO A;  4N9I A;  4KIT B;  2D5V A;  3K9T A;  1ZTR A;  4ZC3 A;  2K4J A;  1YX3 A;  1YS6 A;  3FF5 A;  4GYI A;  2HGC A;  2AO9 A;  2M1B A;  2H94 A;  5GTH C;  2V6E A;  4IHW A;  3DLA A;  5E17 F;  3NAR A;  4UB6 C;  1TQI A;  3K2A A;  1Z9C A;  3ZRG A;  1ZRF A;  2HYJ A;  3FX3 A;  3M7G A;  2EZL A;  5IP9 J;  3IRQ A;  2DQL A;  2Z33 A;  4ZYE A;  3FZV A;  1MDM A;  5EGO A;  1TWG J;  1V54 H;  1Y6I A;  2EH3 A;  5CVI A;  1MGT A;  2ZXJ A;  4M72 A;  4YII A;  4RGS A;  5EEG A;  4KT6 A;  2D2W A;  3JRG A;  4A3E J;  3NEU A;  1YIJ I;  2EV6 A;  3OYD A;  3RYP A;  4GYG A;  2FA5 A;  1BI2 A;  2EZH A;  3BWG A;  4Q48 A;  3IV5 A;  4I09 A;  4HDU A;  1R58 A;  3S2D J;  1DUX C;  4BE1 A;  4KUM A;  5B1B H;  3ZGK A;  3A01 B;  1TQP A;  1TWA J;  3SFI A;  2UV1 A;  1TZL A;  1DU6 A;  2WV0 A;  1JKP C;  4IKF A;  9ANT A;  2DAO A;  3GO5 A;  4PSX A;  4QPO A;  5GPA A;  1X1D A;  5JLX A;  2ZME B;  1SFU A;  4NB5 A;  2M7A A;  1TNS A;  2VT3 A;  2DK5 A;  1RKW A;  2M8G X;  4LG3 A;  4IQJ A;  4PZJ A;  3QOP A;  2XAH A;  4MQ9 F;  4A3G J;  1R23 A;  2HPM A;  5DCM B;  5LLQ A;  3I4M J;  2VQH A;  1XGS A;  3BQY A;  3VB2 A;  2ESN A;  2DPD A;  1D0X A;  2DOF A;  3VYR B;  1E2X A;  3H3U A;  3OWT A;  4UXN A;  3Q5F A;  1IV6 A;  3PO2 J;  3WHC A;  3KEO A;  2PMZ A;  2HR3 A;  2RV8 A;  1YYV A;  1VND A;  3EUK L;  4O3M A;  3OYA A;  4CGZ A;  2R7F A;  1F36 A;  2XF6 A;  4D5F A;  2GLO A;  3JCU C;  2KHM A;  2O7O A;  3IRR A;  4IHV A;  4RBO A;  1BN5 A;  3H35 A;  1K83 J;  3CJN A;  3HGG A;  3L09 A;  2Z5U A;  2R93 J;  1FBU A;  1MMD A;  1Y8Q B;  4PCQ A;  4R8H A;  2OTJ I;  2F48 A;  3TDU C;  5EEH A;  3OYH A;  4M9S A;  4BHB A;  3MKY B;  1VQ5 I;  2H27 A;  1LE8 A;  3IWZ A;  3I4P A;  3G6E I;  5H20 A;  3N4M A;  1E17 A;  3UNG C;  3WGH A;  3HB9 A;  4ESB A;  3GFL A;  1F43 A;  2QZ8 A;  3HRM A;  4NQW A;  4UNO A;  3KIO A;  3ABM H;  4B09 A;  3JRB A;  1RRJ A;  1LDD A;  2CW8 A;  4HLX A;  1S72 I;  1KU3 A;  3CO7 C;  1TWC J;  1ZKG A;  2VLA A;  2LRD A;  2E1N A;  4U7D A;  3IC7 A;  2ECC A;  2VUM J;  1YRN A;  3P9K A;  4A12 A;  2E2H J;  2CV2 A;  4UVA A;  2Y31 A;  3I64 A;  3BRO A;  2JMW A;  3GFM A;  3I3L A;  2CUE A;  4ETS A;  1ZG3 A;  3H92 A;  3OYL A;  3OYJ A;  3TBI A;  2LSO A;  3S93 A;  4OIP F;  4E70 A;  1FY7 A;  1JXS A;  2DA1 A;  4EAT A;  5K7H A;  4EGY A;  2NYX A;  2OCE A;  2L5Q A;  3DQV C;  1YO5 C;  1X1B A;  3EUH C;  1EH8 A;  5KAI C;  3WTY C;  2NXN B;  3WG7 H;  1UMQ A;  2FOK A;  4MTE A;  5F0H A;  4HF1 A;  3OYE A;  2L54 A;  1PVE A;  4AU7 A;  3G2B A;  4B47 A;  1BJA A;  1MJA A;  2DCE A;  2LH9 A;  3OYG A;  2PJR B;  1SAN A;  4KMF A;  3OIP A;  1LPQ A;  1ACI A;  2PEX A;  2WA0 A;  2VJJ A;  2FSW A;  1X3Z B;  3GWZ A;  2BVL A;  2F5E A;  3WTZ A;  2YUS A;  1JTY A;  2V1N A;  3HKZ N;  3O8G A;  2VL8 A;  2LP0 A;  2OCC H;  3FXR A;  2E35 A;  3U9G A;  3K1P A;  2QKL B;  4B3X A;  4EJU A;  2BY3 A;  2DOD A;  5K1Y A;  4IZZ A;  5J1U A;  4ON0 A;  4AVP A;  3BQZ A;  2VBX A;  2YS9 A;  5BNG A;  3J81 K;  3BZ6 A;  4L5J A;  2EFP A;  4S04 A;  2R92 J;  3CMY A;  2IP2 A;  4RAG A;  4DZJ A;  1TBX A;  2QQ9 A;  4MTD A;  2QBY B;  3ZMS A;  3GLL A;  1P4W A;  1TW3 A;  2X1E A;  3JAM Z;  1ONV A;  2NNY A;  2MD0 A;  4L5E A;  2CW0 F;  1R00 A;  3ZR8 X;  5ICF A;  2P0W A;  3FXQ A;  1YLF A;  3ERE D;  1ZGJ A;  3F9K A;  3TGN A;  3MVP A;  1R71 A;  4CDG A;  4GDF A;  2P7V B;  3PIP F;  4IX7 A;  3HJE A;  5FFX A;  2GIZ A;  2C6Y A;  1UCR A;  2QA4 I;  2FNA A;  4CZZ A;  1H9G A;  3WU2 C;  3L2R A;  1X1P A;  3FXL A;  4PJJ A;  4G94 A;  1QVU A;  3PNT A;  2GOM A;  1KON A;  3EQL F;  1H88 C;  3GTG J;  4EM0 B;  2VE9 A;  3F22 A;  1WI9 A;  2VE8 A;  3KP5 A;  3I58 A;  1B8I B;  1FP2 A;  3E0J B;  5FKN A;  4HPQ A;  2DI3 A;  1GT0 C;  1HKT A;  1XN7 A;  3RQI A;  1RC9 A;  3PL8 A;  3SXY A;  3EUH A;  2CV0 A;  2BW3 A;  3OYK A;  1BR2 A;  2ETH A;  4WCG A;  1LEB A;  1Y8R B;  2MSY A;  1KYZ A;  2WY7 Q;  2CRG A;  5L3B A;  1A04 A;  4RMN A;  3V7S A;  4YRV A;  2KRH A;  4RM2 A;  2GA2 A;  2VI6 A;  4S0H B;  1IRZ A;  2CUJ A;  2ZBK A;  4XOP A;  1A5J A;  3WU1 B;  1X4O A;  2EQR A;  1DP3 A;  1FJL A;  2JA5 J;  1XMK A;  3GTQ J;  3H1C A;  2VB6 A;  5K5O A;  3E6M A;  1W5T A;  3OSG A;  5LFA A;  4C2T A;  1J5Y A;  4ENN A;  1X2N A;  2KZG A;  3HKZ A;  3JSO A;  2NS0 A;  2ELK A;  5LGU A;  3RCO A;  1TC3 C;  1D0Z A;  4HST A;  2LNB A;  1YW8 A;  1BJZ A;  5KVR A;  1VQN I;  2NAZ A;  3LA7 A;  1N75 A;  2K9L A;  2AXT C;  2IXS A;  1YX5 A;  2XHK A;  5ICE A;  1T38 A;  4LB5 A;  2CFO A;  1H8A C;  2E2J J;  3KZY A;  4L18 B;  5C44 J;  2I8D A;  4Y4R A;  1RR8 C;  1IGN A;  1C0W A;  1IXR C;  2QVO A;  2E1M C;  2YPR A;  4MFE A;  3HPG A;  3VYT B;  1H9T A;  3H9Q A;  3TL4 X;  1FIA A;  3RPU A;  1O3S A;  4S05 A;  3HOT A;  3BTI A;  3HOW J;  5EG0 A;  4N4N B;  3PSI A;  4X1E A;  1ZYR F;  1IUF A;  4XRM A;  2E5N A;  1ETO A;  1G6N A;  4HV5 A;  3QRF F;  2M3A A;  1WJB A;  1ON2 A;  3R4K A;  3E7L A;  3CLQ A;  2H6B A;  2MH2 A;  2UUZ A;  3ZQH A;  4X6A J;  2XB5 A;  1IF1 A;  3B6A A;  2HI3 A;  3OS1 A;  3SZT A;  2XAS A;  1ZGW A;  2VQC A;  3BR3 A;  1K4T A;  1QPI A;  1B6A A;  5F1R A;  3DPT A;  1IN6 A;  4M74 A;  1F9N A;  2XV4 S;  3I55 I;  1IXS B;  4XLE A;  1FBQ A;  1IAW A;  4ESJ A;  2OC6 A;  2UZK A;  1GUU A;  2PX9 A;  1UG2 A;  3KFW X;  1OLT A;  4H0E A;  3S14 J;  4MNU A;  3JW4 A;  1K6O A;  1QHG A;  1GVJ A;  4UHT A;  1J7K A;  1LNW A;  2R7S A;  3M8J A;  2W1O A;  3ZQF A;  2VC1 A;  2HFH A;  1UAA A;  2Q2E A;  1GV5 A;  2VOP A;  3VPR A;  1HKQ A;  3MQ0 A;  5GPC A;  3KZZ A;  1UHM A;  2Q0O A;  2R7V A;  4AYB A;  5D5W B;  3LFU A;  3LSJ A;  3ZMU A;  1WJA A;  3J80 Z;  4Y15 A;  1MBJ A;  1BOB A;  1ZAO A;  3MD2 A;  2EA2 A;  3I59 A;  5AIP A;  4M6Y A;  3I0T A;  2ZO4 A;  4XRS G;  1MNM C;  2VQG A;  4HX8 A;  1W36 C;  1P2F A;  2KIU A;  3RSN A;  2L0K A;  3BCB A;  2NVY J;  2W7N A;  4LG0 A;  3CMA I;  1X4P A;  4RAZ A;  1HXD A;  2TCT A;  3P7N A;  4LK1 F;  3HL2 A;  3FDY A;  2KL4 A;  1MBE A;  2HQN A;  4HW0 A;  3GLX A;  2A07 F;  4D5C A;  2VJI A;  3PUF A;  2W00 A;  5J4V A;  2DA3 A;  3ECO A;  4M3E A;  5LBQ A;  1LDJ A;  2IGK A;  3TW6 A;  4C3H J;  1W36 D;  5J8C A;  3MZY A;  3BTL A;  1QA6 A;  4UUV A;  2CQX A;  2NVU B;  4LIU A;  2EFO A;  1SC7 A;  1CF7 B;  1W5S A;  2FD5 A;  3FXK A;  4CCK A;  1ZQ3 P;  3TOB A;  3ERM A;  5DUI A;  2IJL A;  2LKS A;  3HG9 A;  4AIK A;  2BEO A;  2GA1 A;  2ECB A;  3HC7 A;  4Q5S F;  3A2K A;  5ICC A;  4ZJZ A;  4D7N A;  1BI0 A;  4BJ5 C;  2F5C A;  1WVR A;  5E79 C;  5DYM A;  2E7W A;  1HOM A;  1D3Y A;  2XKO A;  1S3J A;  2L2O A;  4WWC A;  4UY8 I;  4WXD A;  1VFC A;  1YIO A;  5HVQ C;  2HOS A;  3RKQ A;  2BHY A;  1R1T A;  3F21 A;  4FE7 A;  4F92 B;  3GTO J;  5FLX Z;  1V5F A;  4RA2 A;  1TT0 A;  2WAE A;  2NS7 A;  2ME6 A;  2JQ7 A;  3S15 J;  4G7O F;  2OF7 A;  3DV8 A;  4YG2 F;  1IUY A;  3IWF A;  2VBW A;  4I01 A;  4WK8 F;  3KP2 A;  3PM1 A;  4LLN A;  2KRC A;  3E6B A;  2RRE A;  3CQZ J;  3FKI J;  4JK1 X;  4UVC A;  5E18 F;  2EV5 A;  2KIS A;  1H89 C;  1E3P A;  2OA4 A;  2Y30 A;  1FT9 A;  1UZC A;  1POG A;  2PJP A;  1SFE A;  2CO5 A;  4HYE A;  2LF8 A;  1B9M A;  1P7J A;  3LA2 A;  2OZU A;  3GZ5 A;  2X0L A;  2GAU A;  3ABU A;  4XLP F;  3BC8 A;  3FMQ A;  1NH3 A;  1P4A A;  3OR1 C;  2B0L A;  5EGO B;  4U88 A;  4OU0 A;  3DEU A;  1AOY A;  1O57 A;  2Y0S N;  3DP7 A;  4ENM A;  3KEQ A;  3L00 A;  4A93 J;  2E60 A;  5J8F A;  1NK3 P;  1S29 A;  1OJL A;  3GZN B;  4BEH A;  1SAX A;  2J5P A;  3RZD J;  4OMZ A;  3C1D A;  1BBY A;  1QRY A;  1ZG1 A;  1R22 A;  2G7U A;  5B3S H;  1VQ7 I;  1Z67 A;  2LKX A;  3T0Y A;  1SEU A;  5IT3 A;  4BXU A;  5ICG A;  2M4G A;  3BR1 A;  5D5X B;  2X6X A;  5K5Q A;  1V4R A;  4E7H A;  3FWE A;  4P9U A;  4A3M J;  3M4O J;  1DGW Y;  2FE3 A;  2L9V A;  1FZP B;  1MIJ A;  3I5U A;  4NNJ A;  3HHG A;  4LIV A;  4BE2 A;  1SMY F;  3SZG A;  3WTT C;  1DPU A;  4MQV A;  3S8P A;  3DBH B;  5HLG A;  4EGZ A;  4OIN F;  1U5T C;  1FTT A;  4NDL A;  5LRR A;  4BXF A;  4LIT A;  1V5E A;  2EV0 A;  4UUS A;  4BDY A;  1XCV A;  2G9W A;  1YG2 A;  1OYW A;  3RIR A;  2R5Z A;  4OWR B;  3K7A J;  4A0X A;  1IV8 A;  2RAE A;  2QQB A;  5HNF A;  1HW5 A;  3REO A;  1IRF A;  1IRX A;  4HG2 A;  4WX9 A;  5JHF A;  2DA7 A;  3ZQQ A;  3RZO J;  2MBF A;  5IPA A;  5BS6 A;  1R4M B;  2JWT A;  1LE8 B;  2BVM A;  4B8X A;  3WU0 A;  5LRS A;  3QPT A;  3BTJ A;  3CC7 I;  3E5Q A;  2ZFW A;  2OU2 A;  3IH3 A;  4Y13 A;  5F04 A;  1FYK A;  3C7J A;  3HOV J;  4NQW B;  1R7J A;  5D5V B;  3LSP A;  4D0P A;  4HDV A;  4FT8 A;  4KT5 C;  4M9Z A;  2LVS A;  2HVS A;  2PN6 A;  4II3 A;  1HST A;  3I54 A;  3CCM I;  1K78 A;  4JYK A;  2KRF A;  2IW5 A;  4J19 A;  3VEP A;  2V6C A;  2HZD A;  2FNP A;  2JK3 A;  1YRN B;  4C2U A;  1VQO I;  2BY1 A;  3RKY A;  5LHG A;  3S16 J;  5ERI A;  2WWY A;  2NVX J;  2A68 F;  1WPK A;  3K4L A;  2FML A;  4E7S A;  4YEL A;  2GM4 A;  1ERD A;  2KP6 A;  1V5G A;  3TP3 A;  5E8I A;  4QTR A;  3CCS I;  3CME I;  5M3F J;  2HU9 A;  2CSO A;  3MN2 A;  4XRS A;  1JTX A;  1X1A A;  2EK5 A;  2HOE A;  2STW A;  3HBL A;  1R5H A;  4YFK F;  4KIC A;  1MMG A;  2QQ8 A;  1PUF A;  3ZQ7 A;  1U5T A;  4QIW N;  4UUT A;  5A2Q Z;  4LK0 F;  3J80 K;  3OYN A;  2R7U A;  4ITV A;  4EJT A;  3K1M A;  2P4W A;  3VYU B;  3H0D A;  1ZLJ A;  3ZQI A;  2QEN A;  1FSE A;  4EVI A;  3BR6 A;  4XLF A;  2H8R A;  3IH4 A; 
#chains in the Genus database with same CATH homology
 2CQN A;  4FQG A;  2DOF A;  2KIQ A;  2KIS A;  2B7E A;  2KZG A;  2LKS A;  2DOE A;  2JUC A;  2DOD A;  1UZC A;  2KFD A;  2L9V A;  2K85 A;  2E71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...