2DOOA

The structure of imp-1 complexed with the detecting reagent (dansylc4sh) by a fluorescent probe
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
216
structure length
216
Chain Sequence
b'LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE IMP-1
molecule tags Hydrolase
source organism Serratia marcescens
publication title Probing, inhibition, and crystallographic characterization of metallo-beta-lactamase (IMP-1) with fluorescent agents containing dansyl and thiol groups
pubmed doi rcsb
total genus 65
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2dooA00
3X2YA 2NZFA 5A5ZA 1BC2A 4Z67A 3X2XA 5HH4A 4C09A 2BGAA 5EVBA 4TZ9A 2FU9A 3MD7A 4C1HA 3PY5A 5IQKA 4ZO3A 3VPEA 4UWRB 3JXPA 3S0ZA 1X8HA 3KL7A 2DKFA 2BG2A 2YNWA 3IE2A 4YSBA 5K4KA 1BMCA 4C1EA 2BIBA 2M5DA 2AZ4A 4GYQA 1XTOA 2E7YA 5LE1A 4RL2A 3RKJA 1A8TA 4ZNBA 3ADRA 4XUKA 1MQOA 2Y8BA 5ACVA 1DXKA 3IE0A 5HH6A 3WXCA 4RL0A 2GCUA 2ZZIA 2M5CA 3P2UA 5LMCA 4EYFA 5KILA 4EFZA 3DHBA 1VMEA 5HISA 5LSCA 3KNSA 2BFKA 4PVOA 5LS3A 3T3OA 1SMLA 3DHCA 3PG4A 1L9YA 2YNTB 3BV6A 1M2XA 3R2UA 4F6ZA 2QINA 4UWSB 5ACRA 3IOFA 3DHAA 2BTNA 5FQBA 5HIPA 1K07A 4C1FA 5ACSA 1XM8A 2FU6A 5A0TA 4HL1A 4KEPA 5ACUA 2NXAA 3IDZA 1QH3A 2YNTA 4LE6A 3SBLA 4H0DA 5LM6A 3I0VA 4EXSA 4RAWA 2FHXB 2FHXA 3AJ3A 3LVZA 5ACWA 2BG7A 2BG6A 5LCAA 1YCHA 3ZNBA 5ACQA 4Z5ZA 5HH5A 3BC2A 4ZEJA 3TP9A 1HLKA 2YNUA 3SPUA 2GFKA 5K4NA 4ZO2A 5AXRA 3SD9A 1E5DA 1X8IA 2DOOA 2H6AA 4FEKA 1DD6A 3I14A 3BK1A 2BMIA 1KO2A 4RAMA 5HIOA 2P97A 1WW1A 3IEKA 3ZR9A 2AIOA 4EXYA 4TZEA 2QDTA 1WRAA 3X2ZA 4J5FA 4B87A 5B1UA 5EV6A 4DILA 1ZKPA 4JO0A 2Q42A 2GFJA 3Q6VA 2QEDA 3QH8A 2WYLA 5ACPA 5LCHA 4UWPB 2ZNBA 2ZWRA 2YCBA 2Q0IA 4AX0B 4GYUA 1VJNA 2FK6A 4Z60A 4Z7RA 5A0VA 4UWOB 4C1GA 4D1TA 5EHTA 3SRXA 2Y8AA 4CHLA 5ACXA 5A87A 4BZ3A 1BVTA 1QH5A 2WRSA 2YZ3A 2ZO4A 4J5HA 2I7TA 1YCFA 2I7VA 2P1EA 4TZFA 5FQAA 3IE1A 2OHIA 5EWAA 5K0WA 5LCFA 2QDSA 2Q9UA 3FCZA 4GCWA 5DPXA 4NQ5A 2A7MA 4RBSA 4D1UA 5FQCA 4WD6A 3H3EA 2BC2A 4D1VA 3BK2A 5AXOA 5AYAA 1JJTA 3PY6A 1JJEA 2GMNA 1A7TA 2BFZB 2XF4A 4TYTA 4NQ4A 2YNVB 4BP0A 4XWTA 3AF6A 5EH9A 4Z6XA 4AX1B 4DIKA 2Y87A 2I7XA 2BG8A 2UYXA 2YNVA 3IEMA 2CBNA 5AEBA 1KO3A 5EW0A 2QJSA 5EVDA 5K4MA 4AWZA 4EY2A 3F9OA 3RPCA 3X30A 2NYPA 4Z5YA 1WUPA 5EV8A 4YSLA 3DH8A 3I15A 1DDKA 1X8GA 2Q0JA 2P4ZA 1KR3A 5EVKA 2P18A 3ESHA 2FU8A 4O98A 3AF5A 4NQ2A 3SFPA 4TZBA 2WYMA 3IELA 3A4YA 4F6HA 4TYFA 4U4LA 4C1CA 4PVTA 5B3RA 3KNRA 4HL2A 2WYMC 3SW3A 2BG8B 3FAIA 2BFLA 2OHHA 2WHGA 4D02A 4RM5A 1WUOA 3I11A 5AHOA 4AD9A 1YCGA 2BFZA 4EYBA 4NQ6A 5AHRA 2GKLA 4FR7A 4C1DA 2FU7A 2BR6A 2R2DA 3IOGA 2OHJA 4D1WA 1ZNBA 3ZWFA 4FSBA 4V0HA 5B15A 4UAMA 5LLDA 3RKKA 5KIKA 2VW8A 2HB9A 2FM6A 3L6NA 3VQZA 4XWWA 3ZQ4A 1ZTCA 4AWYB 4HKYA 5HIQA 3I13A 1P9EA 4KEQA 4UA4A 1VGNA 1Y44A 4YSKA 4P62A 3G1PA 3T9MA 3T3NA 1JT1A 2XR1A 5ACTA 2NZEA 4UBQA 4EYLA
chains in the Genus database with same CATH superfamily
3X2YA 2NZFA 5A5ZA 1BC2A 4Z67A 3X2XA 5HH4A 4C09A 2BGAA 5EVBA 4TZ9A 2FU9A 3MD7A 4C1HA 3PY5A 5IQKA 4ZO3A 3VPEA 4UWRB 3JXPA 3S0ZA 1X8HA 3KL7A 2DKFA 2BG2A 2YNWA 3IE2A 4YSBA 5K4KA 1BMCA 4C1EA 2BIBA 2M5DA 2CG3A 2AZ4A 4GYQA 5A23A 1XTOA 2E7YA 5LE1A 4RL2A 3RKJA 1A8TA 4ZNBA 3ADRA 4XUKA 1MQOA 2Y8BA 5ACVA 1DXKA 3IE0A 5HH6A 3WXCA 4RL0A 2GCUA 2ZZIA 2M5CA 3P2UA 5LMCA 4EYFA 5KILA 4EFZA 3DHBA 1VMEA 5HISA 5LSCA 3KNSA 2BFKA 4PVOA 5LS3A 3T3OA 1SMLA 3DHCA 3PG4A 1L9YA 2YNTB 3BV6A 1M2XA 3R2UA 4F6ZA 2QINA 4UWSB 5ACRA 3IOFA 3DHAA 2BTNA 5FQBA 5HIPA 1K07A 4C1FA 5ACSA 1XM8A 2FU6A 5A0TA 4HL1A 4KEPA 2CG2A 5ACUA 2NXAA 3IDZA 1QH3A 2YNTA 4LE6A 3SBLA 4H0DA 5LM6A 3I0VA 4AV7A 4EXSA 4RAWA 2FHXB 2FHXA 3AJ3A 3LVZA 5ACWA 2BG7A 2BG6A 5LCAA 2CFZA 1YCHA 3ZNBA 5ACQA 4Z5ZA 5HH5A 3BC2A 4ZEJA 3TP9A 1HLKA 2YNUA 3SPUA 2GFKA 5K4NA 4ZO2A 5AXRA 3SD9A 1E5DA 1X8IA 2DOOA 2H6AA 4FEKA 1DD6A 3I14A 3BK1A 2BMIA 1KO2A 4RAMA 5HIOA 2P97A 1WW1A 5AIJA 3IEKA 3ZR9A 2AIOA 4EXYA 4TZEA 2QDTA 1WRAA 3X2ZA 2CFUA 4NURA 4J5FA 4B87A 5B1UA 5EV6A 4DILA 1ZKPA 4JO0A 2Q42A 2GFJA 2YHEA 3Q6VA 2QEDA 3QH8A 2WYLA 5ACPA 5LCHA 4UWPB 2ZNBA 2ZWRA 2YCBA 2Q0IA 4AX0B 4GYUA 1VJNA 2FK6A 4Z60A 4Z7RA 5A0VA 4UWOB 4C1GA 4D1TA 5EHTA 3SRXA 2Y8AA 4CHLA 5ACXA 5A87A 4BZ3A 1BVTA 1QH5A 2WRSA 2YZ3A 2ZO4A 4J5HA 2I7TA 1YCFA 2I7VA 2P1EA 4TZFA 5FQAA 3IE1A 2OHIA 4AXHA 5EWAA 5K0WA 5LCFA 2QDSA 2Q9UA 3FCZA 4GCWA 5DPXA 4NQ5A 2A7MA 4RBSA 4D1UA 5FQCA 4WD6A 3H3EA 2BC2A 4D1VA 3BK2A 5AXOA 5AYAA 1JJTA 3PY6A 1JJEA 2GMNA 1A7TA 2BFZB 2XF4A 4TYTA 4NQ4A 2YNVB 4BP0A 4XWTA 3AF6A 5EH9A 4Z6XA 4AX1B 4DIKA 2Y87A 2I7XA 2BG8A 2UYXA 2YNVA 3IEMA 2CBNA 5AEBA 1KO3A 5EW0A 2QJSA 5AJLA 5EVDA 5K4MA 4AWZA 4EY2A 3F9OA 3RPCA 3X30A 2NYPA 4Z5YA 1WUPA 5EV8A 4YSLA 3DH8A 3I15A 1DDKA 1X8GA 2Q0JA 2P4ZA 1KR3A 5EVKA 2P18A 3ESHA 2FU8A 4O98A 3AF5A 4NQ2A 3SFPA 4TZBA 2WYMA 3IELA 3A4YA 4F6HA 4TYFA 4U4LA 4C1CA 4PDXA 4PVTA 5B3RA 3KNRA 4HL2A 2WYMC 3SW3A 2BG8B 3FAIA 2BFLA 2OHHA 2WHGA 4D02A 4RM5A 1WUOA 3I11A 5AHOA 4AD9A 1YCGA 2BFZA 4EYBA 4NQ6A 5AHRA 2GKLA 4FR7A 4C1DA 2FU7A 2BR6A 2R2DA 3IOGA 2OHJA 4D1WA 1ZNBA 3ZWFA 4FSBA 4V0HA 5B15A 4UAMA 5LLDA 3RKKA 5KIKA 2VW8A 2HB9A 2FM6A 3L6NA 3VQZA 4XWWA 3ZQ4A 1ZTCA 4AWYB 4HKYA 5HIQA 3I13A 1P9EA 4KEQA 4UA4A 1VGNA 1Y44A 4YSKA 4P62A 3G1PA 3T9MA 3T3NA 1JT1A 2XR1A 5ACTA 2NZEA 4UBQA 4EYLA
chains in the Genus database with same CATH topology
3X2YA 2NZFA 5A5ZA 1BC2A 4Z67A 3X2XA 5HH4A 4C09A 2BGAA 5EVBA 4TZ9A 2FU9A 3MD7A 4C1HA 3PY5A 5IQKA 4ZO3A 3VPEA 4UWRB 3JXPA 3S0ZA 1X8HA 3KL7A 2DKFA 2BG2A 2YNWA 3IE2A 4YSBA 5K4KA 1BMCA 4C1EA 2BIBA 2M5DA 2AZ4A 4GYQA 1XTOA 2E7YA 5LE1A 4RL2A 3RKJA 1A8TA 4ZNBA 3ADRA 4XUKA 1MQOA 2Y8BA 5ACVA 1DXKA 3IE0A 5HH6A 3WXCA 4RL0A 2GCUA 2ZZIA 2M5CA 3P2UA 5LMCA 4EYFA 5KILA 4EFZA 3DHBA 1VMEA 5HISA 5LSCA 3KNSA 2BFKA 4PVOA 5LS3A 3T3OA 1SMLA 3DHCA 3PG4A 1L9YA 2YNTB 3BV6A 1M2XA 3R2UA 4F6ZA 2QINA 4UWSB 5ACRA 3IOFA 3DHAA 2BTNA 5FQBA 5HIPA 1K07A 4C1FA 5ACSA 1XM8A 2FU6A 5A0TA 4HL1A 4KEPA 5ACUA 2NXAA 3IDZA 1QH3A 2YNTA 4LE6A 3SBLA 4H0DA 5LM6A 3I0VA 4EXSA 4RAWA 2FHXB 2FHXA 3AJ3A 3LVZA 5ACWA 2BG7A 2BG6A 5LCAA 1YCHA 3ZNBA 5ACQA 4Z5ZA 5HH5A 3BC2A 4ZEJA 3TP9A 1HLKA 2YNUA 3SPUA 2GFKA 5K4NA 4ZO2A 5AXRA 3SD9A 1E5DA 1X8IA 2DOOA 2H6AA 4FEKA 1DD6A 3I14A 3BK1A 2BMIA 1KO2A 4RAMA 5HIOA 2P97A 1WW1A 3IEKA 3ZR9A 2AIOA 4EXYA 4TZEA 2QDTA 1WRAA 3X2ZA 4J5FA 4B87A 5B1UA 5EV6A 4DILA 1ZKPA 4JO0A 2Q42A 2GFJA 3Q6VA 2QEDA 3QH8A 2WYLA 5ACPA 5LCHA 4UWPB 2ZNBA 2ZWRA 2YCBA 2Q0IA 4AX0B 4GYUA 1VJNA 2FK6A 4Z60A 4Z7RA 5A0VA 4UWOB 4C1GA 4D1TA 5EHTA 3SRXA 2Y8AA 4CHLA 5ACXA 5A87A 4BZ3A 1BVTA 1QH5A 2WRSA 2YZ3A 2ZO4A 4J5HA 2I7TA 1YCFA 2I7VA 2P1EA 4TZFA 5FQAA 3IE1A 2OHIA 5EWAA 5K0WA 5LCFA 2QDSA 2Q9UA 3FCZA 4GCWA 5DPXA 4NQ5A 2A7MA 4RBSA 4D1UA 5FQCA 4WD6A 3H3EA 2BC2A 4D1VA 3BK2A 5AXOA 5AYAA 1JJTA 3PY6A 1JJEA 2GMNA 1A7TA 2BFZB 2XF4A 4TYTA 4NQ4A 2YNVB 4BP0A 4XWTA 3AF6A 5EH9A 4Z6XA 4AX1B 4DIKA 2Y87A 2I7XA 2BG8A 2UYXA 2YNVA 3IEMA 2CBNA 5AEBA 1KO3A 5EW0A 2QJSA 5EVDA 5K4MA 4AWZA 4EY2A 3F9OA 3RPCA 3X30A 2NYPA 4Z5YA 1WUPA 5EV8A 4YSLA 3DH8A 3I15A 1DDKA 1X8GA 2Q0JA 2P4ZA 1KR3A 5EVKA 2P18A 3ESHA 2FU8A 4O98A 3AF5A 4NQ2A 3SFPA 4TZBA 2WYMA 3IELA 3A4YA 4F6HA 4TYFA 4U4LA 4C1CA 4PVTA 5B3RA 3KNRA 4HL2A 2WYMC 3SW3A 2BG8B 3FAIA 2BFLA 2OHHA 2WHGA 4D02A 4RM5A 1WUOA 3I11A 5AHOA 4AD9A 1YCGA 2BFZA 4EYBA 4NQ6A 5AHRA 2GKLA 4FR7A 4C1DA 2FU7A 2BR6A 2R2DA 3IOGA 2OHJA 4D1WA 1ZNBA 3ZWFA 4FSBA 4V0HA 5B15A 4UAMA 5LLDA 3RKKA 5KIKA 2VW8A 2HB9A 2FM6A 3L6NA 3VQZA 4XWWA 3ZQ4A 1ZTCA 4AWYB 4HKYA 5HIQA 3I13A 1P9EA 4KEQA 4UA4A 1VGNA 1Y44A 4YSKA 4P62A 3G1PA 3T9MA 3T3NA 1JT1A 2XR1A 5ACTA 2NZEA 4UBQA 4EYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Y A;  2NZF A;  5A5Z A;  1BC2 A;  4Z67 A;  3X2X A;  5HH4 A;  4C09 A;  2BGA A;  5EVB A;  4TZ9 A;  2FU9 A;  3MD7 A;  4C1H A;  3PY5 A;  5IQK A;  4ZO3 A;  3VPE A;  4UWR B;  3JXP A;  3S0Z A;  1X8H A;  3KL7 A;  2DKF A;  2BG2 A;  2YNW A;  3IE2 A;  4YSB A;  5K4K A;  1BMC A;  4C1E A;  2BIB A;  2M5D A;  2AZ4 A;  4GYQ A;  1XTO A;  2E7Y A;  5LE1 A;  4RL2 A;  3RKJ A;  1A8T A;  4ZNB A;  3ADR A;  4XUK A;  1MQO A;  2Y8B A;  5ACV A;  1DXK A;  3IE0 A;  5HH6 A;  3WXC A;  4RL0 A;  2GCU A;  2ZZI A;  2M5C A;  3P2U A;  5LMC A;  4EYF A;  5KIL A;  4EFZ A;  3DHB A;  1VME A;  5HIS A;  5LSC A;  3KNS A;  2BFK A;  4PVO A;  5LS3 A;  3T3O A;  1SML A;  3DHC A;  3PG4 A;  1L9Y A;  2YNT B;  3BV6 A;  1M2X A;  3R2U A;  4F6Z A;  2QIN A;  4UWS B;  5ACR A;  3IOF A;  3DHA A;  2BTN A;  5FQB A;  5HIP A;  1K07 A;  4C1F A;  5ACS A;  1XM8 A;  2FU6 A;  5A0T A;  4HL1 A;  4KEP A;  5ACU A;  2NXA A;  3IDZ A;  1QH3 A;  2YNT A;  4LE6 A;  3SBL A;  4H0D A;  5LM6 A;  3I0V A;  4EXS A;  4RAW A;  2FHX B;  2FHX A;  3AJ3 A;  3LVZ A;  5ACW A;  2BG7 A;  2BG6 A;  5LCA A;  1YCH A;  3ZNB A;  5ACQ A;  4Z5Z A;  5HH5 A;  3BC2 A;  4ZEJ A;  3TP9 A;  1HLK A;  2YNU A;  3SPU A;  2GFK A;  5K4N A;  4ZO2 A;  5AXR A;  3SD9 A;  1E5D A;  1X8I A;  2DOO A;  2H6A A;  4FEK A;  1DD6 A;  3I14 A;  3BK1 A;  2BMI A;  1KO2 A;  4RAM A;  5HIO A;  2P97 A;  1WW1 A;  3IEK A;  3ZR9 A;  2AIO A;  4EXY A;  4TZE A;  2QDT A;  1WRA A;  3X2Z A;  4J5F A;  4B87 A;  5B1U A;  5EV6 A;  4DIL A;  1ZKP A;  4JO0 A;  2Q42 A;  2GFJ A;  3Q6V A;  2QED A;  3QH8 A;  2WYL A;  5ACP A;  5LCH A;  4UWP B;  2ZNB A;  2ZWR A;  2YCB A;  2Q0I A;  4AX0 B;  4GYU A;  1VJN A;  2FK6 A;  4Z60 A;  4Z7R A;  5A0V A;  4UWO B;  4C1G A;  4D1T A;  5EHT A;  3SRX A;  2Y8A A;  4CHL A;  5ACX A;  5A87 A;  4BZ3 A;  1BVT A;  1QH5 A;  2WRS A;  2YZ3 A;  2ZO4 A;  4J5H A;  2I7T A;  1YCF A;  2I7V A;  2P1E A;  4TZF A;  5FQA A;  3IE1 A;  2OHI A;  5EWA A;  5K0W A;  5LCF A;  2QDS A;  2Q9U A;  3FCZ A;  4GCW A;  5DPX A;  4NQ5 A;  2A7M A;  4RBS A;  4D1U A;  5FQC A;  4WD6 A;  3H3E A;  2BC2 A;  4D1V A;  3BK2 A;  5AXO A;  5AYA A;  1JJT A;  3PY6 A;  1JJE A;  2GMN A;  1A7T A;  2BFZ B;  2XF4 A;  4TYT A;  4NQ4 A;  2YNV B;  4BP0 A;  4XWT A;  3AF6 A;  5EH9 A;  4Z6X A;  4AX1 B;  4DIK A;  2Y87 A;  2I7X A;  2BG8 A;  2UYX A;  2YNV A;  3IEM A;  2CBN A;  5AEB A;  1KO3 A;  5EW0 A;  2QJS A;  5EVD A;  5K4M A;  4AWZ A;  4EY2 A;  3F9O A;  3RPC A;  3X30 A;  2NYP A;  4Z5Y A;  1WUP A;  5EV8 A;  4YSL A;  3DH8 A;  3I15 A;  1DDK A;  1X8G A;  2Q0J A;  2P4Z A;  1KR3 A;  5EVK A;  2P18 A;  3ESH A;  2FU8 A;  4O98 A;  3AF5 A;  4NQ2 A;  3SFP A;  4TZB A;  2WYM A;  3IEL A;  3A4Y A;  4F6H A;  4TYF A;  4U4L A;  4C1C A;  4PVT A;  5B3R A;  3KNR A;  4HL2 A;  2WYM C;  3SW3 A;  2BG8 B;  3FAI A;  2BFL A;  2OHH A;  2WHG A;  4D02 A;  4RM5 A;  1WUO A;  3I11 A;  5AHO A;  4AD9 A;  1YCG A;  2BFZ A;  4EYB A;  4NQ6 A;  5AHR A;  2GKL A;  4FR7 A;  4C1D A;  2FU7 A;  2BR6 A;  2R2D A;  3IOG A;  2OHJ A;  4D1W A;  1ZNB A;  3ZWF A;  4FSB A;  4V0H A;  5B15 A;  4UAM A;  5LLD A;  3RKK A;  5KIK A;  2VW8 A;  2HB9 A;  2FM6 A;  3L6N A;  3VQZ A;  4XWW A;  3ZQ4 A;  1ZTC A;  4AWY B;  4HKY A;  5HIQ A;  3I13 A;  1P9E A;  4KEQ A;  4UA4 A;  1VGN A;  1Y44 A;  4YSK A;  4P62 A;  3G1P A;  3T9M A;  3T3N A;  1JT1 A;  2XR1 A;  5ACT A;  2NZE A;  4UBQ A;  4EYL A; 
#chains in the Genus database with same CATH topology
 3X2Y A;  2NZF A;  5A5Z A;  1BC2 A;  4Z67 A;  3X2X A;  5HH4 A;  4C09 A;  2BGA A;  5EVB A;  4TZ9 A;  2FU9 A;  3MD7 A;  4C1H A;  3PY5 A;  5IQK A;  4ZO3 A;  3VPE A;  4UWR B;  3JXP A;  3S0Z A;  1X8H A;  3KL7 A;  2DKF A;  2BG2 A;  2YNW A;  3IE2 A;  4YSB A;  5K4K A;  1BMC A;  4C1E A;  2BIB A;  2M5D A;  2CG3 A;  2AZ4 A;  4GYQ A;  5A23 A;  1XTO A;  2E7Y A;  5LE1 A;  4RL2 A;  3RKJ A;  1A8T A;  4ZNB A;  3ADR A;  4XUK A;  1MQO A;  2Y8B A;  5ACV A;  1DXK A;  3IE0 A;  5HH6 A;  3WXC A;  4RL0 A;  2GCU A;  2ZZI A;  2M5C A;  3P2U A;  5LMC A;  4EYF A;  5KIL A;  4EFZ A;  3DHB A;  1VME A;  5HIS A;  5LSC A;  3KNS A;  2BFK A;  4PVO A;  5LS3 A;  3T3O A;  1SML A;  3DHC A;  3PG4 A;  1L9Y A;  2YNT B;  3BV6 A;  1M2X A;  3R2U A;  4F6Z A;  2QIN A;  4UWS B;  5ACR A;  3IOF A;  3DHA A;  2BTN A;  5FQB A;  5HIP A;  1K07 A;  4C1F A;  5ACS A;  1XM8 A;  2FU6 A;  5A0T A;  4HL1 A;  4KEP A;  2CG2 A;  5ACU A;  2NXA A;  3IDZ A;  1QH3 A;  2YNT A;  4LE6 A;  3SBL A;  4H0D A;  5LM6 A;  3I0V A;  4AV7 A;  4EXS A;  4RAW A;  2FHX B;  2FHX A;  3AJ3 A;  3LVZ A;  5ACW A;  2BG7 A;  2BG6 A;  5LCA A;  2CFZ A;  1YCH A;  3ZNB A;  5ACQ A;  4Z5Z A;  5HH5 A;  3BC2 A;  4ZEJ A;  3TP9 A;  1HLK A;  2YNU A;  3SPU A;  2GFK A;  5K4N A;  4ZO2 A;  5AXR A;  3SD9 A;  1E5D A;  1X8I A;  2DOO A;  2H6A A;  4FEK A;  1DD6 A;  3I14 A;  3BK1 A;  2BMI A;  1KO2 A;  4RAM A;  5HIO A;  2P97 A;  1WW1 A;  5AIJ A;  3IEK A;  3ZR9 A;  2AIO A;  4EXY A;  4TZE A;  2QDT A;  1WRA A;  3X2Z A;  2CFU A;  4NUR A;  4J5F A;  4B87 A;  5B1U A;  5EV6 A;  4DIL A;  1ZKP A;  4JO0 A;  2Q42 A;  2GFJ A;  2YHE A;  3Q6V A;  2QED A;  3QH8 A;  2WYL A;  5ACP A;  5LCH A;  4UWP B;  2ZNB A;  2ZWR A;  2YCB A;  2Q0I A;  4AX0 B;  4GYU A;  1VJN A;  2FK6 A;  4Z60 A;  4Z7R A;  5A0V A;  4UWO B;  4C1G A;  4D1T A;  5EHT A;  3SRX A;  2Y8A A;  4CHL A;  5ACX A;  5A87 A;  4BZ3 A;  1BVT A;  1QH5 A;  2WRS A;  2YZ3 A;  2ZO4 A;  4J5H A;  2I7T A;  1YCF A;  2I7V A;  2P1E A;  4TZF A;  5FQA A;  3IE1 A;  2OHI A;  4AXH A;  5EWA A;  5K0W A;  5LCF A;  2QDS A;  2Q9U A;  3FCZ A;  4GCW A;  5DPX A;  4NQ5 A;  2A7M A;  4RBS A;  4D1U A;  5FQC A;  4WD6 A;  3H3E A;  2BC2 A;  4D1V A;  3BK2 A;  5AXO A;  5AYA A;  1JJT A;  3PY6 A;  1JJE A;  2GMN A;  1A7T A;  2BFZ B;  2XF4 A;  4TYT A;  4NQ4 A;  2YNV B;  4BP0 A;  4XWT A;  3AF6 A;  5EH9 A;  4Z6X A;  4AX1 B;  4DIK A;  2Y87 A;  2I7X A;  2BG8 A;  2UYX A;  2YNV A;  3IEM A;  2CBN A;  5AEB A;  1KO3 A;  5EW0 A;  2QJS A;  5AJL A;  5EVD A;  5K4M A;  4AWZ A;  4EY2 A;  3F9O A;  3RPC A;  3X30 A;  2NYP A;  4Z5Y A;  1WUP A;  5EV8 A;  4YSL A;  3DH8 A;  3I15 A;  1DDK A;  1X8G A;  2Q0J A;  2P4Z A;  1KR3 A;  5EVK A;  2P18 A;  3ESH A;  2FU8 A;  4O98 A;  3AF5 A;  4NQ2 A;  3SFP A;  4TZB A;  2WYM A;  3IEL A;  3A4Y A;  4F6H A;  4TYF A;  4U4L A;  4C1C A;  4PDX A;  4PVT A;  5B3R A;  3KNR A;  4HL2 A;  2WYM C;  3SW3 A;  2BG8 B;  3FAI A;  2BFL A;  2OHH A;  2WHG A;  4D02 A;  4RM5 A;  1WUO A;  3I11 A;  5AHO A;  4AD9 A;  1YCG A;  2BFZ A;  4EYB A;  4NQ6 A;  5AHR A;  2GKL A;  4FR7 A;  4C1D A;  2FU7 A;  2BR6 A;  2R2D A;  3IOG A;  2OHJ A;  4D1W A;  1ZNB A;  3ZWF A;  4FSB A;  4V0H A;  5B15 A;  4UAM A;  5LLD A;  3RKK A;  5KIK A;  2VW8 A;  2HB9 A;  2FM6 A;  3L6N A;  3VQZ A;  4XWW A;  3ZQ4 A;  1ZTC A;  4AWY B;  4HKY A;  5HIQ A;  3I13 A;  1P9E A;  4KEQ A;  4UA4 A;  1VGN A;  1Y44 A;  4YSK A;  4P62 A;  3G1P A;  3T9M A;  3T3N A;  1JT1 A;  2XR1 A;  5ACT A;  2NZE A;  4UBQ A;  4EYL A; 
#chains in the Genus database with same CATH homology
 3X2Y A;  2NZF A;  5A5Z A;  1BC2 A;  4Z67 A;  3X2X A;  5HH4 A;  4C09 A;  2BGA A;  5EVB A;  4TZ9 A;  2FU9 A;  3MD7 A;  4C1H A;  3PY5 A;  5IQK A;  4ZO3 A;  3VPE A;  4UWR B;  3JXP A;  3S0Z A;  1X8H A;  3KL7 A;  2DKF A;  2BG2 A;  2YNW A;  3IE2 A;  4YSB A;  5K4K A;  1BMC A;  4C1E A;  2BIB A;  2M5D A;  2AZ4 A;  4GYQ A;  1XTO A;  2E7Y A;  5LE1 A;  4RL2 A;  3RKJ A;  1A8T A;  4ZNB A;  3ADR A;  4XUK A;  1MQO A;  2Y8B A;  5ACV A;  1DXK A;  3IE0 A;  5HH6 A;  3WXC A;  4RL0 A;  2GCU A;  2ZZI A;  2M5C A;  3P2U A;  5LMC A;  4EYF A;  5KIL A;  4EFZ A;  3DHB A;  1VME A;  5HIS A;  5LSC A;  3KNS A;  2BFK A;  4PVO A;  5LS3 A;  3T3O A;  1SML A;  3DHC A;  3PG4 A;  1L9Y A;  2YNT B;  3BV6 A;  1M2X A;  3R2U A;  4F6Z A;  2QIN A;  4UWS B;  5ACR A;  3IOF A;  3DHA A;  2BTN A;  5FQB A;  5HIP A;  1K07 A;  4C1F A;  5ACS A;  1XM8 A;  2FU6 A;  5A0T A;  4HL1 A;  4KEP A;  5ACU A;  2NXA A;  3IDZ A;  1QH3 A;  2YNT A;  4LE6 A;  3SBL A;  4H0D A;  5LM6 A;  3I0V A;  4EXS A;  4RAW A;  2FHX B;  2FHX A;  3AJ3 A;  3LVZ A;  5ACW A;  2BG7 A;  2BG6 A;  5LCA A;  1YCH A;  3ZNB A;  5ACQ A;  4Z5Z A;  5HH5 A;  3BC2 A;  4ZEJ A;  3TP9 A;  1HLK A;  2YNU A;  3SPU A;  2GFK A;  5K4N A;  4ZO2 A;  5AXR A;  3SD9 A;  1E5D A;  1X8I A;  2DOO A;  2H6A A;  4FEK A;  1DD6 A;  3I14 A;  3BK1 A;  2BMI A;  1KO2 A;  4RAM A;  5HIO A;  2P97 A;  1WW1 A;  3IEK A;  3ZR9 A;  2AIO A;  4EXY A;  4TZE A;  2QDT A;  1WRA A;  3X2Z A;  4J5F A;  4B87 A;  5B1U A;  5EV6 A;  4DIL A;  1ZKP A;  4JO0 A;  2Q42 A;  2GFJ A;  3Q6V A;  2QED A;  3QH8 A;  2WYL A;  5ACP A;  5LCH A;  4UWP B;  2ZNB A;  2ZWR A;  2YCB A;  2Q0I A;  4AX0 B;  4GYU A;  1VJN A;  2FK6 A;  4Z60 A;  4Z7R A;  5A0V A;  4UWO B;  4C1G A;  4D1T A;  5EHT A;  3SRX A;  2Y8A A;  4CHL A;  5ACX A;  5A87 A;  4BZ3 A;  1BVT A;  1QH5 A;  2WRS A;  2YZ3 A;  2ZO4 A;  4J5H A;  2I7T A;  1YCF A;  2I7V A;  2P1E A;  4TZF A;  5FQA A;  3IE1 A;  2OHI A;  5EWA A;  5K0W A;  5LCF A;  2QDS A;  2Q9U A;  3FCZ A;  4GCW A;  5DPX A;  4NQ5 A;  2A7M A;  4RBS A;  4D1U A;  5FQC A;  4WD6 A;  3H3E A;  2BC2 A;  4D1V A;  3BK2 A;  5AXO A;  5AYA A;  1JJT A;  3PY6 A;  1JJE A;  2GMN A;  1A7T A;  2BFZ B;  2XF4 A;  4TYT A;  4NQ4 A;  2YNV B;  4BP0 A;  4XWT A;  3AF6 A;  5EH9 A;  4Z6X A;  4AX1 B;  4DIK A;  2Y87 A;  2I7X A;  2BG8 A;  2UYX A;  2YNV A;  3IEM A;  2CBN A;  5AEB A;  1KO3 A;  5EW0 A;  2QJS A;  5EVD A;  5K4M A;  4AWZ A;  4EY2 A;  3F9O A;  3RPC A;  3X30 A;  2NYP A;  4Z5Y A;  1WUP A;  5EV8 A;  4YSL A;  3DH8 A;  3I15 A;  1DDK A;  1X8G A;  2Q0J A;  2P4Z A;  1KR3 A;  5EVK A;  2P18 A;  3ESH A;  2FU8 A;  4O98 A;  3AF5 A;  4NQ2 A;  3SFP A;  4TZB A;  2WYM A;  3IEL A;  3A4Y A;  4F6H A;  4TYF A;  4U4L A;  4C1C A;  4PVT A;  5B3R A;  3KNR A;  4HL2 A;  2WYM C;  3SW3 A;  2BG8 B;  3FAI A;  2BFL A;  2OHH A;  2WHG A;  4D02 A;  4RM5 A;  1WUO A;  3I11 A;  5AHO A;  4AD9 A;  1YCG A;  2BFZ A;  4EYB A;  4NQ6 A;  5AHR A;  2GKL A;  4FR7 A;  4C1D A;  2FU7 A;  2BR6 A;  2R2D A;  3IOG A;  2OHJ A;  4D1W A;  1ZNB A;  3ZWF A;  4FSB A;  4V0H A;  5B15 A;  4UAM A;  5LLD A;  3RKK A;  5KIK A;  2VW8 A;  2HB9 A;  2FM6 A;  3L6N A;  3VQZ A;  4XWW A;  3ZQ4 A;  1ZTC A;  4AWY B;  4HKY A;  5HIQ A;  3I13 A;  1P9E A;  4KEQ A;  4UA4 A;  1VGN A;  1Y44 A;  4YSK A;  4P62 A;  3G1P A;  3T9M A;  3T3N A;  1JT1 A;  2XR1 A;  5ACT A;  2NZE A;  4UBQ A;  4EYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...