2DPDA

Crystal structure of the replication termination protein in complex with a pseudosymmetric b-site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*AP*TP*GP*AP*AP*CP*AP*TP*AP*AP*TP*GP*TP*TP*CP*AP*
publication title Crystal structure of the Replication Termination Protein in complex with a pseudosymmetric B-site
rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/dna
total genus 36
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dpdA00
1Z05A 3U2RA 4WWCA 1MDMA 1C0WA 4I98B 3ZQ7A 1D5VA 4HLYA 4GXOA 2CWEA 2VN2A 1DDNA 3TOAA 1KU3A 1WRJA 5F6FA 3H92A 1G3WA 2MA3A 3EQLF 2AS5F 1IXRC 2NAZA 5AONA 1R58A 2UXNA 1PUEE 1FSHA 1FYMA 2F5FA 2J5OA 4BQAA 1W5TA 1YG2A 1X3UA 2ZKZA 2IA2A 4LJZF 2PFBA 1S3JA 5ICEA 5ICGA 2MH9A 1I1GA 2M87A 3LA2A 4ON0A 4HV5A 4I0AA 2YX4A 3D5LA 5D4RA 2PI0A 1GXPA 2JZYA 2KIFA 4ZZLA 1MGTA 1WKMA 2VT3A 1ZG5A 1FT9A 2P6SA 3K2ZA 3IL2A 2Z99A 1F4KA 5DD8A 2Z9OA 3LFKA 2EFQA 1P4XA 2MH2A 3LQRA 1BC7C 4ENNA 1RIOH 2VBXA 3QU6A 4HX4A 2XASA 4UVCA 2OU2A 3M9AA 2VBYA 2L3DA 1JE8A 4P55A 4HF2A 1L0OC 4Y13A 4XSXF 4TV7A 2VT2A 1JHHA 2Z33A 1YW9A 3K9TA 3ZMDA 1XSVA 5H6QA 2HTSA 2RVCA 2LDUA 1W7PD 3RKWA 5DUKA 3DP7A 4ZYDA 1CF7B 4IHSA 1QZYA 2A07F 3TGNA 1HKQA 3F8MA 2EJRA 1MJBA 2BBYA 4OIQF 2OBPA 2PLYA 4RGRA 4MGRA 1WSUA 4NB5A 2FEZA 2PMHA 1OYIA 4JBAA 4HF1A 2XAHA 3EYYA 1QGPA 4A0YA 2CYYA 2JT1A 3RKXA 3HRMA 3RTRA 1MJAA 1R22A 4EJWA 4O3MA 4Z2YA 4U0YA 1FNNA 4P9UA 2M1BA 4Q48A 3BWGA 4I7HA 2ZNZA 2ELHA 2M5WA 1F5TA 1J7KA 3HHHA 2Y0MA 4GYGA 2V1DA 1HW1A 2V1XA 4KUMA 3V7CA 1G6NA 2QWWA 5LEKA 5FGMA 2Y48A 1YO5C 1BIBA 5E17F 4ZYEA 1D3YA 4KIFA 1IN5A 4A5NA 5EEGA 1MKMA 2W25A 4IRGA 3WTUC 3JSOA 1P4AA 5E8IA 1PDNC 3GO5A 3JTHA 2A69F 3I53A 2EK5A 3HOSA 1FSEA 2A6HF 1DP7P 1T39A 2STTA 1WQ2A 4MQ9F 2EFPA 1RI7A 5HS9A 2OZ6A 4Q5SF 2BE5F 3E6MA 4BHCA 1XCBA 5DEQA 1R23A 2A68F 4L9NA 3EYIA 2ESNA 4BHPA 4HF0A 3T8TA 1NHAA 2IA0A 1U5TB 1GHCA 1HW5A 4XLNF 5L3GA 3GZ5A 5JR3A 1G3YA 2DI3A 4EJTA 3L7WA 4IRIA 1W7PA 5E1XA 1UB9A 3FM3A 4LG0A 3GF2A 2EFWA 3J80K 1LDKB 3LAPA 4EM0B 3MCZA 3TOBA 2DO7A 3GWZA 1IXCA 1SMYF 5ED4A 1J0RA 4KMUX 2HKOA 3JAMK 4AIHA 5D5VB 2R3SA 2X4HA 5HLIA 2NYXA 4M71A 3SZPA 2DQRA 1FBUA 1WWXA 4RGSA 4IXAA 2RQPA 2GA2A 3WGGA 3NEUA 3R61A 4G7ZF 2AXLA 4UNOA 1S6LA 2XUBA 1DPRA 1Z91A 2Z5UA 3TDZC 2DK5A 2HKXA 2VBZA 3I58A 1K78B 1R1TA 5L3FA 4YG2F 1QO0D 1KQ0A 3R4KA 4UV8A 3PQKA 2MD5A 3F6OA 1XN7A 4JQFA 3M8EA 1G3SA 4LK1F 3TDUC 3I59A 4HX8A 4AWXB 5DUIA 1T38A 3MAJA 4YIFA 3BJOA 2P7VB 4PZJA 3E5UA 2EV5A 2XIGA 2FNPA 4MTDA 5KK1A 3HSRA 2QYOA 5L3DA 3FMQA 3QP6A 1FBSA 1HKTA 4D0PA 3MEXA 1IXSB 2MLGA 2PQ8A 4IVNA 1O3QA 1R36A 5IT9Z 4M9XA 4G8XA 1TNTA 4PDKA 3M1EA 1BI2A 1O3SA 3KZYA 3L09A 1U3EM 1Y0UA 1F9NA 4MTEA 2NNNA 5BPDA 2JPCA 5DYMA 4RB3C 4L5IA 3IWZA 2VE9A 2FMYA 2XGXA 4UV9A 3P9CA 4Y17A 4BYYA 3FXUA 2ISZA 2BYVE 1I1SA 1W7PB 4LG0B 3E6BA 1P92A 2IVMA 5CVUA 3DQVC 1FOKA 4L9VA 2O3FA 2VOPA 2DT5A 2DQLA 2XAGA 4KNYA 3E5XA 3GZ6A 3I64A 4M9SA 3CLOA 1XGMA 1TBXA 2OQRA 1IAWA 5EEHA 5L3BA 4ESBA 3BP8A 3K1PA 1RUOA 3F8CA 1ZLKA 2D1HA 3F8BA 2NNYA 3DPTA 5CVRA 4OMZA 1YYVA 2HQNA 3WE3A 4A12A 1IUYA 2PMUA 2XKOA 2K4BA 2DAOA 3HRUA 4AIKA 4EVIA 1ZN2A 3K69A 3KZZA 1QNTA 2VBWA 5ILUA 5DDGA 1PP8F 2NRAC 2FU4A 5L3CA 1XCVA 2YR2A 3LAJA 4L5JA 3HOTA 2PJPA 2FOKA 3R0AA 3F21A 2BEOA 3I59B 1G3TA 3J7AO 3QP5A 3RJPA 4L0ZB 1IN8A 4YFKF 3MFKA 3DEUA 5DD4A 2R7DA 1HXDA 3ML6A 4UVBA 3T1BA 4I0BA 4EGZA 2FA5A 3E6CC 4EJVA 4KFCA 1I27A 2WV0A 1U6GA 2HYFA 1Z9CA 4BHBA 1MD0A 1O7LA 3VB2A 1YIOA 4A2UA 4GGGA 2MC3A 3QPHA 5D5XB 4M74A 1ZRFA 3IKTA 2KJBA 1FPQA 1KYWA 1SMTA 2L01A 1YFHA 3IRRA 2KIMA 4A5MA 1F1ZA 2VC0A 2XVCA 2D1VA 4HYEA 5JVTA 1W5SA 4CZZA 4RAYA 1EH8A 3LWFA 4OU0A 2P5LC 2FE3A 5AIQA 5BQTA 2HS5A 3CUOA 1IRGA 1FWZA 1B1BA 2VC1A 4OOIA 4A6DA 2A3SA 5ILSA 3S2WA 1EV7A 2ISYA 3F8FA 2DTRA 4YIIA 1BI0A 5JFRA 3J81K 4EJUA 3EDPA 3SHFA 3K1MA 4HQMA 1TNSA 4WXHA 2IPQX 3BROA 2Y75A 1GXQA 3SFZA 1OYWA 3VODA 2O8XA 1GVJA 5LGNA 5HDKA 4RB0A 2K7LA 3LSTA 2PEXA 3IWFA 2CW0F 3MZYA 4M6XA 5TJJA 1QQIA 1RUNA 4B8XA 4H0EA 3P9KA 3B02A 5HDGA 2ETHA 3HTUA 4WXCA 4F7ZA 2HTJA 1XSDA 3GFJA 3V7RA 1ODDA 3GYHX 3C18A 3FXQA 3W6JB 5HOOA 1XMKA 3ZPLA 2FSWA 5F1RA 3F6VA 2COMA 3PQJA 2BGCA 2GZWA 4U7DA 1IN7A 2YX7A 5K5QA 4RAZA 2M8EA 5BMZA 4AVPA 4KT5C 2V79A 2RV8A 2IT0A 3ULQB 1L3LA 1HKSA 2EFNA 1XMAA 4WF2A 3FF5A 1SAXA 3HSFA 1MDMB 3DKWA 3R0JA 1FY7A 1BI3A 1G4DA 3VEPA 3ZMVA 1ZLJA 4KICA 2HYGD 4G7HF 1UHWA 2RNJA 2GXGA 3F8NA 3T5XA 1EH6A 1ZHFA 1REPC 2QLZA 3FWEA 3SQNA 3WODF 3KEOA 3BZ6A 3ZN0A 1KA8A 4XLPF 3CTAA 2Z3YA 2DFIA 3KETA 1U78A 4OIOF 1OMIA 3JTGA 4LB5A 4OIRF 1TLHB 5D5WB 2LSOA 3TKYA 1BBYA 4I01A 4EV0A 3GFIA 1T98A 3WGHA 1XGOA 1O57A 3HTSB 2HEOA 5IT9K 1U8RA 3WTTC 3Q9SA 1ZGJA 2MLKA 3L00A 1FX7A 2G7UA 2DW4A 5LGUA 3E97A 1HBXG 2ZXJA 1BM9A 4M73A 4L9TA 3RPQA 2OD5A 1B9NA 3KP2A 2JRTA 2FBHA 2XRNA 2XAJA 5J8FA 5DCFA 5BOXA 1PP7U 1QZZA 2ZO4A 3N97A 2IW5A 3KP7A 5L3EA 4EM2A 5FLXZ 3ZN1A 5IT3A 1Z7UA 2XV4S 1TTYA 1KQ8A 3MZHA 3TO9A 4FHTA 5HS8A 2P4WA 3DFGA 2FBKA 5FD6A 4IF4A 1T6SA 4Q47A 1AOYA 3QPTA 4I2OA 2EFOA 1U5TC 2GWRA 4RB2C 1R1UA 2ESHA 3FZVA 3BPXA 1J9IA 1Z6RA 4UVAA 4I09A 2QVOA 3QAHA 3VOEA 2EB7A 3IC7A 1O7FA 4RB1A 1YQAA 4OINF 3TO7A 4LB6B 3CJNA 2DU9A 1KGSA 1JGSA 2KIUA 2EV6A 1KYZA 2HZTA 2O61A 3IKVA 2ACJA 1S7OA 2E1CA 2O6GE 1E2XA 1SD4A 3PFIA 2E7WA 4EM1A 2QQBA 3U1DA 4K2EA 5E1WA 5CVVA 4U0WA 3F22A 2W24A 2VONA 4LLNA 1QBJA 2F2EA 2WC2A 2M30A 2QBYA 1EH7A 5ERIA 1SFUA 1R00A 3P7NA 4BAYA 3ECOA 4HLXA 3V8KA 2FXAA 3T8RA 4P96A 3C3WA 2IP2A 2R7FA 2VOOA 1H9GA 3B73A 1R5HA 1O3RA 4IHTA 3FHZA 3SXYA 3LA3A 1B59A 4CICA 4ESJA 4HW0A 1LEAA 4BH9A 1R1VA 4A0XA 2RC4A 1P4WA 5LEJA 2H09A 4M6YA 1KU9A 1YS6A 3REOA 1USTA 4M9ZA 1OR7A 1IN6A 4IPAA 3BJ6A 3MQ0A 1S8NA 4A0ZA 4G9YA 5F64A 2A6EF 1FC3A 3V8JA 1HW2A 2L54A 5LGTA 1BOAA 2BV6A 2VODA 4A6EA 3GFMA 4RGXA 4KA4A 4U7BA 4O6JA 1RZ4A 4HA8A 1ZG3A 5LHHA 1BIAA 4E70A 1HSJA 4XRFA 1ZYRF 4R1HA 3RYRA 4S04A 4ZH4F 4LLGF 5D4SA 4NHJA 2E1NA 2W85A 4L9JA 2XAQA 4MEXF 1A04A 1OKRA 2P5VA 4S05A 1S7AA 1UHMA 3KP4A 2UWMA 3QRFF 3C1DA 2B0LA 3HRTA 3E3VA 3J80Z 3SZTA 2K86A 4HV6A 3WTZA 1STZA 4EMSA 1ZRCA 4MEYF 1BJAA 2XAFA 2QM3A 2A5YB 4N0BA 4LLLA 2QBYB 2GA1A 1ON1A 3FMRA 5HLHA 4MHGA 2EA4A 3JAMZ 3G3ZA 5BPIA 1S29A 5LLQA 1V3FA 3CDHA 1K6OA 2C6YA 2IRFG 3GFLA 3COAC 2QUFA 1QPMA 3FMSA 4PGGA 1B9MA 3V4GA 3FM5A 3WG9A 2F5DA 3GX4X 2K02A 5AIPA 3WTVC 4Y15A 2CO5A 3DV8A 2DPDA 1K7AA 4CHUA 3KLNA 4HZFA 3KEQA 3O3KA 2CGPA 4PCQA 4PGHA 3CUQC 1P6RA 4N9IA 2OZUA 2CFXA 3RIRA 4P9FA 3RYPA 1TW3A 3K0LA 3W6KB 2XKPA 4ZZDA 1V4RA 3F72A 1RNLA 3M8FA 3TQNA 1SFEA 2HR3A 5HS7A 2KKOA 1Z1DA 5E18F 2HGCA 4CO8A 1XGSA 2LNBA 4FX0A 3DXJF 3L2CA 4EGYA 4ESFA 2QZ8A 2ZNYA 3G73A 3E6DA 2HOEA 4KIBA 2GAUA 3IRQA 3BOQA 4HOBA 3RDIA 1LB2A 4AIJA 1SD7A 3LQQA 3T0YA 1FLIA 2OAZA 3WGIA 4WX9A 2KJCA 5H6RA 4CDGA 5LBQA 2X0LA 4KYWA 2ZMEA 4EJOA 1P2FA 4QLCU 2YU3A 3TO6A 4NQWA 2HFHA 1TW2A 3ISPA 5FLXK 4WXDA 2RN7A 3KP6A 2IA1A 4HDUA 4HDVA 1MZBA 4OMYA 4R8HA 3H3UA 2V1UA 4HX7A 2HDCA 2VXZA 5CLSA 2O03A 2GIVA 1ZG1A 2V6CA 1FBQA 1H0MA 2EWNA 2ZCWA 1I6XA 5D8LB 2K27A 4ASNA 1AWCA 2A61A 3EUHA 2MBFA 2F5CA 4GO1A 1XD7A 2JSCA 5LHGA 4ETSA 5E8GA 4UUVA 1J59A 3GXOA 1E17A 1U5TA 3ELKA 2Q0OA 3ABTA 2Q2EA 2PG4A 1J5YA 3WU0A 1BN5A 2DBBA 5D6EA 3WTSC 4GYIA 4O5VA 1LEBA 4R79A 5E20A 5K1YA 5JI6A 1TQMA 4CYDA 2XROA 4CGZA 4P5OA 3ZMZA 5HVQC 2D45A 3O6BB 3ERED 3MWMA 1ZRDA 1IN4A 3R60A 2EA2A 3I0TA 5A2QZ 3D0SA 3O2PE 3AAFA 2QQAA 1USSA 1ZH5A 1BC8C 5HDNA 2UZKA 2H27A 2TDXA 3HRSA 1IW7F 2W84A 5CVJA 3ZMTA 4LK0F 4HBLA 1FP1D 3I54A 4U0VA 2W57A 2FQ3A 3DPLC 4WK8F 5CYVA 2ZMEB 1TQIA 1B6AA 1FZPB 4L18B 1K78A 2WWYA 4UXNA 4L0YB 3KE2A 3GVAA 1LQ1A 3KFWX 1ONVA 3GW2A 3Q9VA 1IF1A 3HIFA 2P5KA 1UCRA 1YW7A 3WTWC 1W4MA 2FBIA 1HSTA 1YTYA 5ILVA 4G94A 2H6BA 2J5PA 3KLOA 2CSOA 2V9VA 3HHGA 3BDDA 3WTXC 4CXFA 3FX3A 1ON2A 3CO7C 2UXXA 1LDJA 4QWQA 5JHUA 2L02A 5CVIA 1J2XA 1YLFA 2KRFA 3FXRA 3J81Z 3VFZA 3P9IA 2ADUA 1UFMA 4I02A 4IRHA 1R7JA 4B09A 4XBFA 1IRFA 1K79A 3RI4A 4DQ2A 1YS7A 4BXUA 3OV8A 2G7HA 2GQQA 1FP2A 2QENA 3KP3A 5DCMA 3BPVA 5LRSA 2LF8A 3WE2A 4KMFA 1DPUA 3NQOA 2RDPA 4RGUA 2DPUA 2ZBKA 4KDPA 2D2WA 5E1ZB 5LHIA 3ZP5A 3M7GA 1XDUA 3F3XA 2ZFWA 4YFXF 2YSRA 2LKPA 2LF7A 3CO6C 3ZMUA 1D8KA 2FF4A 2FRHA 4FX4A 4KIGA 3HSEA 2NS0A 3GEZA 4IJAA 2GXBA 4HAMA 2H94A 1R5GA 5BS6A 5ICFA 1SFXA 3N4MA 5TRDA 5J6XA 3ROUA 5CJ9A 4N9HA 3V8LA 2FNAA 1XB4A 3GUDA 1SD5A 3KCCA 1KU2A 4LGWA 4ENMA 3JW4A 2P6TA 1FYKA 1OYYA 3C7JA 4MNUA 1J75A 3GLXA 2DLLA 2M45A 2L4MA 3LA7A 5FFXA 1ZARA 3F23A 3CUQA 3RKYA 4ZYGA 5FB2A 1IZ1A 3NRVA 1CGPA 4OIPF 1T0FA 2HQRA 3OOPA 4G6DA 3HYIA 1TQPA 2RKHA 4MQVA 2FMLA 2WTEA 1XSXA 1HQCA 2DK8A 1O3TA 5D6FA 1D8JA 1FYLA 4RS8A 1OPCA 4JK1X 1Z6TA 3KP5A 2EV0A 2PBIA 3U9GA 5DV5A 1XGNA 3E5QA 4HQEA 3ECHA 3I71A 2HWVA 5HLGA 1LVAA 1KU7A 5FFZA 2JPBA 1T2KA 2RGVA 4DNCA 1ULYA 2Q8KA 1H9TA 1JHFA 5DCMB 3HUGA 5D5UB 3WU1B 3ABUA 4YFNF 1DUXC 1LDDA 5LRRA 4G6QA 4WCGA 4LFUA 2YPRA 3Q5FA 3R6SA 3I4PA 1ZREA 2H6CA 4ENKA 5FD5A 3ZMSA 1SD6A 1LNWA 2CG4A 3IHUA 1YW8A 1B4AA 4XSZF 3K1NA 5FO5A 2STWA 3I5UA 4M72A 3QU3A 6PAXA 4Q4ZF 4EQQA 5K5OA 4U88A 4LD5A 5H20A 2JTVA 1U2WA 3WTYC 2K4JA 4UHTA 1ZAOA 3BJAA 2PN6A 1JXSA 2VE8A 2IJLA 1ZGAA 1BI1A 4AD9A 1MJ9A 3DF8A 1KQ9A 1Q1HA 2P8TA 2QQ9A 2OQGA 3H3ZA 3V7SA 1I5ZA 2O0YA 4LMYA 2G9WA 2ZJ2A 4BNCA 5K5RA 3CUQB 5KVRA 4KN4X 2L4AA 2P7CB 1XDSA 5A2QK 3RPUA 3QOPA 5D8KB 1CF7A 3L9FA 3JSPA 2OA4A 4ENJA 5ICCA 4KN7X 4G7OF 2F5EA 4ZYHA 1WI9A 1VTNC 3BY6A 2E7XA 2XHKA 4GCVA 2CQKA 5J8CA 1LJ9A 4FT8A 3EETA
chains in the Genus database with same CATH superfamily
3LL7A 3CQZJ 3K7AJ 4QPQA 4C3HJ 4Y33A 1BL0A 1Z05A 3U2RA 5JLWA 4WWCA 1MDMA 1JKOC 1C0WA 5GPAA 5J4VA 4I98B 3ZQ7A 1D5VA 4HLYA 4GXOA 2CWEA 2Y0SA 2VN2A 2X1CA 1DDNA 3TOAA 1KU3A 1WRJA 2WA0A 5F6FA 4ZJZA 4IOCF 1MBKA 3H92A 1G3WA 2MA3A 3EQLF 1YX5A 2AS5F 1OQYA 1IXRC 1V5FA 2NAZA 1VQLI 5AONA 1R58A 2DJNA 1VFCA 1Y1WJ 4Z6YA 2UXNA 4DIQA 2X1EA 1PUEE 2FUG2 1FYMA 1FSHA 2M2EA 2F5FA 2J5OA 3L1PA 4BQAA 1W5TA 3PUFA 1YG2A 1X3UA 1MW7A 2ZKZA 1POGA 2IA2A 3A01B 3TMOA 4LJZF 2PFBA 4XNFA 1S3JA 1A6QA 5ICEA 5ICGA 2MH9A 1I1GA 2EQRA 4XLFA 2M87A 2VASA 2DOEA 3LA2A 4ON0A 1HC8A 4HV5A 2P81A 4I0AA 5EYRA 4BQOA 4KT6A 2OUMA 1OCZH 2YX4A 3D5LA 5D4RA 5B1BH 2PI0A 1GXPA 3GCMA 2JZYA 2KIFA 1LPQA 2X6OA 4BE0A 1MSFC 4ZZLA 3DWLE 4XR6A 1MGTA 1RRJA 2XF5A 1WKMA 2RREA 1U9OA 3QYEA 2VT3A 3PO3J 1ZG5A 1FT9A 4BU2A 2P6SA 1I3QJ 3K2ZA 4CZCA 3G1OA 3ESWB 3IL2A 4CCJA 3L2RA 1R5ID 2LH9A 2Z99A 2K9LA 2M8GX 4D7MA 1F4KA 5DD8A 2Z9OA 3LFKA 2EFQA 1P4XA 2MH2A 2XAUA 3LQRA 1BC7C 3BR1A 4ENNA 2EH3A 1RIOH 2VBXA 2PX9A 3TP0A 3QU6A 2RQQA 4HX4A 2XASA 4PUSA 4UVCA 3AG3H 2UUZA 4YEJA 2VQCA 5IP6A 2OU2A 2LY1A 3M9AA 2VBYA 2L3DA 1JE8A 4P55A 5KCMA 4HF2A 2JK3A 2ZB9A 1L0OC 4B47A 4XIDA 1WJCA 4Y13A 4XSXF 5BNGA 4TV7A 3RQIA 2VT2A 3L2UA 1X58A 1JHHA 1Z77A 2Z33A 1K4SA 3P5JA 4PFOA 1FEXA 1YW9A 1D1BA 1YRNB 4CSWA 2R7XA 2F48A 3K9TA 3ZMDA 1LFUP 1XSVA 5H6QA 1B8IB 2HTSA 3IAM2 2RVCA 3SDGA 1IDZA 2LDUA 1W7PD 1OJLA 2DFEA 1IC8A 3RKWA 3MKLA 3CC7I 5DUKA 2ZJRF 3DP7A 4ZYDA 1CF7B 1SFKA 3CCUI 1EJ9A 4IHSA 1QZYA 3H5AA 2A07F 4C30A 3TGNA 1D5YA 1HKQA 5F0HA 2CH0A 2LRDA 3F8MA 1NG6A 2ZXHA 2VXDA 2EJRA 4G6TB 1Y6IA 2MG4A 1MJBA 2CJJA 5C4JJ 2BBYA 2HU9A 4OIQF 2OBPA 2E2IJ 4DBQA 2PLYA 3I9V2 5IOYA 2CW8A 4RGRA 2L7MP 4MGRA 1WSUA 3H5NA 3KEYA 3BG3A 4NB5A 1RR7A 2FEZA 1VZ0A 2PMHA 5GTHC 3RKQA 4E7LA 4V2FA 2DMTA 2XPUA 5M5XJ 1OYIA 2HDDA 4JBAA 2DJIA 4HF1A 4N4OB 2XAHA 1ETWA 3EYYA 2HOTA 1QGPA 4A0YA 2CYYA 3PSIA 2JT1A 3RKXA 3HRMA 2VJJA 3RTRA 1MJAA 4UUTA 2X6WA 2HXIA 1R22A 2GIZA 4EJWA 4O3MA 4UY8I 3LSJA 4Z2YA 4U0YA 1ETVA 3CC2I 1FNNA 4P9UA 2M1BA 2R7OA 2XPWA 2VPLA 3CF5F 4Q48A 3DTKA 1BR1A 1DGRM 3BWGA 4I7HA 2JVHA 3GTPJ 2ZNZA 2ELHA 1Y8QB 2L5QA 2M5WA 4HNTA 1F5TA 1J7KA 3HHHA 1X1DA 1JJ6C 2Y0MA 4GYGA 5B66C 1MBFA 1OFCX 2V1DA 1HW1A 2V1XA 4KUMA 3V7CA 1G6NA 2QWWA 5LEKA 5FGMA 2Y48A 1YO5C 1BIBA 3M1CA 4XOPA 5E17F 4ZYEA 1D3YA 4U87A 1W5CC 4DZJA 4KIFA 1IN5A 4JX6A 4A5NA 5EEGA 2ZJQF 1MKMA 2W25A 1XMXA 4IRGA 3WTUC 4C2UA 4LIVA 3JSOA 1P4AA 3SJMA 5E8IA 4BBRJ 1PDNC 4NBQA 4NNJA 3OYDA 4A3DJ 3GO5A 4ZTFA 3JTHA 2A69F 3I53A 1JKQC 3LSIA 3DBHB 2EK5A 3EUAA 4BXFA 3HOSA 1FSEA 4XL9A 2DT7B 2HZDA 5HODA 2A6HF 4D9JA 1DP7P 1T39A 1IRXA 3CDIA 2STTA 1WQ2A 2QSFX 2UV1A 4MQ9F 2EFPA 2BY1A 1RI7A 4HSTA 3A03A 2M7AA 3K70C 1LUJB 5HS9A 2GXAA 2OZ6A 4Q5SF 2BE5F 2BW3A 3TW6A 4PSXA 3E6MA 4BHCA 3BZCA 3HXLA 5J4YA 1XCBA 3TEDA 5DEQA 3O8GA 1R23A 2A68F 4L9NA 3CCJI 3EYIA 2CRGA 1MNEA 1IO2A 2BOLA 2ESNA 4JYKA 2ZFUA 4BHPA 4HF0A 3GTQJ 3T8TA 1NHAA 3F9KA 2IA0A 3A0HC 3S1NJ 1U5TB 4YIRX 1GHCA 3WU2C 2Q2EB 5IP7J 3OYCA 2ME0A 3S17J 3JRAA 4CCKA 1HW5A 3QOEA 4XLNF 4C2MJ 5L3GA 3GZ5A 5JR3A 1GVDA 1G3YA 4DYCA 2DI3A 4PJLA 4EJTA 3L7WA 4IRIA 1W7PA 3CMAI 1OCTC 5E1XA 1UB9A 3FM3A 4LG0A 3CDLA 3GF2A 2EFWA 3J80K 2JSPA 2NOJB 5EF6A 1LDKB 3QQAA 3LAPA 1W36C 3ZQFA 4EM0B 3MCZA 3TOBA 3LSPA 2DO7A 3GWZA 3S3MA 1IXCA 1SMYF 2VPRA 5ED4A 4AM3A 2V7FA 1J0RA 4KMUX 2AXTC 2HKOA 4BJTA 4AIHA 2E5ZA 3JAMK 1PUFA 5D5VB 2R3SA 2X4HA 3Q0UA 5HLIA 2NYXA 3FXOA 4C3IJ 4M71A 2E1OA 3SZPA 2DQRA 3VPRA 1FBUA 1WWXA 4XLHA 5IOZA 4RGSA 1T56A 4II2A 3G2BA 4IXAA 2RQPA 4IZZA 2LTPA 2M0CA 1NK2P 2ZXWH 2GA2A 3S3NA 3DKXA 1UG2A 1TP4A 3WGGA 3ZXSA 3NEUA 2E5NA 1JUSA 3R61A 4G7ZF 2AXLA 4UNOA 2MW8A 1S6LA 5CQGA 2XUBA 1DPRA 1Z91A 4LIUA 3CCQI 4A3EJ 2Z5UA 3TDZC 1GDTA 2TCTA 2QQ8A 2DK5A 4I99C 4CYCA 2HKXA 2VBZA 3G1MA 4AU7A 3I58A 3FBNB 1K78B 1R1TA 5L3FA 3LSHA 3WHBA 1VF9A 4YG2F 1QO0D 1KQ0A 3R4KA 4UV8A 3AG4H 3PQKA 3PNYA 2MD5A 2LY9A 1AA7A 3F6OA 2V4JC 1XN7A 4JQFA 3M8EA 1G3SA 1JTYA 4X1EA 4LK1F 3TDUC 3I59A 2CUEA 4HX8A 4AWXB 5DUIA 1TWAJ 3C2HA 1T38A 4A3LJ 3MAJA 2KRHA 3BJOA 4YIFA 1MSEC 3BQYA 2DFFA 2DYRH 1IG7A 2P7VB 4PZJA 3E5UA 5J1YA 1VQ9I 2EV5A 2XIGA 3FXJA 2DA6A 3GTKJ 2FNPA 4MTDA 5KK1A 4B3XA 5EGOB 3OSGA 4BJ6C 3HSRA 1D0YA 2QYOA 2QKLB 3FMQA 5L3DA 3QP6A 4JP0A 4ZDPA 1FBSA 4B43A 4XM3A 4B44A 1HKTA 4D0PA 2XRLA 1ZTRA 1IXSB 3MEXA 2MLGA 1YJ9I 1XTAA 2PQ8A 4IVNA 1UMQA 2R7WA 2B7EA 1O3QA 2DOAA 1R36A 5IT9Z 3CJRB 2BW3B 2EINH 2I10A 1YJNI 1YIJI 1QA6A 3S1QJ 4M9XA 4G8XA 1TNTA 2TRTA 3M1EA 4PDKA 3MKZA 1LKXA 1AKHA 3HOVJ 1BI2A 1O3SA 3KZYA 3L09A 1U3EM 3H0GJ 1MBGA 1F9NA 1Y0UA 5F0CA 5K7HA 4MTEA 2NNNA 1QVUA 5BPDA 2JPCA 1XPXA 1WH7A 2WAEA 2KHMA 4OWRB 3PJRA 2NVTJ 1GT0C 5DYMA 1XG1A 2IGOA 4RB3C 4L5IA 3IWZA 2QF7A 2XSJC 2FMYA 2XGXA 2V9PA 2VE9A 2LMDA 4UV9A 1S9HA 3P9CA 4Y17A 4BYYA 3FXUA 2ISZA 5J1UA 3HGGA 1D1CA 2BYVE 1I1SA 1W7PB 4LG0B 3E6BA 3FBIB 1OCRH 1P92A 4MFDA 3I3LA 3DPUA 3SEZA 2IVMA 2MYSA 5CVUA 3DQVC 1FOKA 2W00A 2ZC2A 2R5YA 2KISA 2NVQJ 4L9VA 2O3FA 2VOPA 2K3PA 2DT5A 2DQLA 2XAGA 4KNYA 1Z0XA 3LMMA 3ZQGA 2KIQA 3CJQB 1Z67A 2LVSA 1DGWY 2EILH 5B3SH 3E5XA 1SVLA 3GZ6A 4M3BA 2CU7A 2F4MB 2K5CA 1R71A 3ABLH 3I64A 1OCCH 2VKEA 4M9SA 4RMNA 3CLOA 1XGMA 4JX5A 1TBXA 2RAEA 2OQRA 1IAWA 3CF2A 2M34A 1V54H 5EEHA 5EG0A 3ZOBA 5L3BA 1VQOI 4ESBA 1WJFA 2K9NA 3BP8A 1ENHA 3K1PA 1RUOA 3F8CA 1ZLKA 3DTIA 5FKOA 1E3OC 1YJWI 2EPFA 4UB8C 1JUPA 1SANA 2D1HA 5LFAA 3F8BA 2NNYA 3DPTA 5CVRA 5E3OA 3VYSB 1MMDA 4OMZA 1YYVA 3QYFA 3MKYB 3VWBA 1QVTA 2HQNA 3WE3A 4A12A 1IGNA 1IUYA 3E1SA 2R7SA 2PMUA 2XKOA 3PIOF 2K4BA 2DAOA 2MSYA 1Y1VJ 3HRUA 2XF6A 4BY7J 4AIKA 4EVIA 1G8XA 1R6RA 1WGXA 1ZN2A 3K69A 4XQFA 5C44J 3K70D 4BBSJ 3KZZA 5E3LA 1QNTA 2VBWA 2YS9A 3BZKA 5DDGA 5ILUA 1PP8F 1LE8A 1RESA 2ID3A 2NRAC 1ITYA 2FU4A 4BQQA 1MBJA 3KIOA 4BACA 3HKZN 5L3CA 1XCVA 2YR2A 3LAJA 1V5GA 4L5JA 3HOTA 2PJPA 2VQGA 2FOKA 3R0AA 3F21A 3ASOH 4CCLA 2BEOA 3I59B 1G3TA 5FKKA 3J7AO 1DP3A 3QP5A 3HPGA 3G4SI 3RJPA 4RAGA 3M07A 4PJNA 4L0ZB 1IN8A 4YFKF 3MFKA 3U21A 3DEUA 5DD4A 4BE2A 2R7DA 1HXDA 3AKZA 3ML6A 4UVBA 3T1BA 2I5UA 1PYVA 4I0BA 1FTTA 4EGZA 2FA5A 2VLAA 2IEKA 3JRHA 3E6CC 4EJVA 5DS9A 2EZKA 4KFCA 1I27A 1W36D 1EF4A 1ETOA 4E7IA 4FE4A 2WV0A 1U6GA 2DDBA 3Q0VA 2HYFA 3OL3A 3OS0A 1Z9CA 4BHBA 2CUZA 1MD0A 2L9SA 1K4TA 3S8PA 2DTZA 4BL0B 1O7LA 3HG9A 3I55I 4V19K 3W2WA 2LR8A 3VB2A 3HOUJ 1P7IA 3PNVA 1YIOA 3ASNH 3VYRB 5EEAA 1X3ZB 4A2UA 3JRFA 2QA4I 1AKHB 3S16J 4GGGA 4DJAA 3QYBA 2MC3A 1J09A 3QPHA 2R7ZJ 5D5XB 2VKDA 4B3AA 1MMAA 4M74A 1ZRFA 3IKTA 2KJBA 2CUFA 1OR7C 1FPQA 1KYWA 1SMTA 2L01A 3BR6A 3H9JA 1Z21A 3IRRA 2KIMA 1YFHA 4A5MA 5J3LA 4M3GA 2L7FP 4ITVA 1F1ZA 1S5LC 3A1YA 2VC0A 1IDYA 1R49A 2XVCA 5IYBJ 2D1VA 4HYEA 5K7FA 3OMYA 5JVTA 1W5SA 4CZZA 4RAYA 1EH8A 2CQXA 3LWFA 3HUGB 1U8BA 4OU0A 2P5LC 2JN6A 2FE3A 2R5YB 3W2AA 5FLVA 2HYJA 3IAS2 3KYCB 5AIQA 5BQTA 3CLQA 2HS5A 3CUOA 2ZSHB 2BXYA 2QSGX 1IRGA 1JI8A 5JLXA 1FWZA 1G2HA 4BE1A 1K61A 1B1BA 2VC1A 2ELJA 4OOIA 4J00A 1VQ8I 5LD2C 2VB6A 4A6DA 2L0KA 2A3SA 5ILSA 1A36A 3S2WA 1EV7A 2NVXJ 2CQ7A 2ISYA 2K40A 3F8FA 4QIWN 2DTRA 4YIIA 1BI0A 1VNDA 5JFRA 3ZR8X 4E4HA 3FK6A 2XC7A 5EG0B 2E36A 1X2MA 2XGDA 3K10A 3BCBA 2KT0A 5F04A 3J81K 3MZ8A 1TT5B 4EJUA 2IXSA 2G0EA 3EDPA 3SHFA 2K85A 3J7AY 4IO9F 5C3EJ 3K1MA 3NWSA 2Y69H 3K6GA 4HQMA 2R7VA 4QPOA 1TNSA 5DM7F 4WXHA 2IPQX 2A5WA 3BROA 2Y75A 5HNHA 1GXQA 2I8DA 3OYLA 3SFZA 1UHSA 1OYWA 4XKWA 3VODA 3DCFA 2O8XA 2H8RA 1GVJA 3K4BA 4NC7A 4IL6C 3HJEA 3MMYB 5LGNA 5HDKA 4RB0A 1AU7A 4ABZA 2IGNA 2K7LA 1LE8B 3LSTA 3K4JA 3OYBA 2PEXA 3UKGA 3IWFA 1IRZA 2A6TA 3OIPA 5FRMA 2CW0F 2ICWG 1WFXA 4B1RA 2E1MC 1ZKGA 3MZYA 2LBFA 4M6XA 1QHHD 5TJJA 3ZCOA 1QQIA 1RUNA 4B8XA 1X1CA 4H0EA 2R5ZA 1SEUA 3P9KA 3B02A 1GUUA 5HDGA 2ETHA 3HTUA 4E7SA 4WXCA 4F7ZA 3X2QH 3OS1A 2HTJA 2M0MA 1WI3A 4E7JA 1XSDA 2BY0A 1R9TJ 3GFJA 3V7RA 1ODDA 3BG6A 2X48A 3GYHX 1QHGA 3C18A 3FXQA 3W6JB 5HOOA 1XMKA 2VKVA 3ZPLA 2FSWA 5F1RA 3F6VA 4UUSA 1X4OA 2COMA 3PQJA 2QSHX 2BGCA 2BY2A 2GZWA 2O7OA 3IH4A 1X1BA 4Y7NJ 4U7DA 1IN7A 2YX7A 5K5QA 3ABMH 2BHZA 2CMPA 2M8EA 3KZIC 4RAZA 4HRIA 5BMZA 1S7EA 2LREA 4KT5C 4AVPA 3K4CA 2V79A 2RV8A 2IAIA 2ZJPF 2IT0A 3S1MJ 3ULQB 1L3LA 4RLFA 1HKSA 2EFNA 3OL4A 3GTMJ 1XMAA 3KYDB 4XORA 4WF2A 3FF5A 1VQ7I 3RQ4A 1SAXA 2IS6A 3HSFA 1MDMB 1VQ4I 2VI6A 4XKBA 2H1KA 2HVRA 1NTCA 3DKWA 3R0JA 4BDZA 1FOWA 1FY7A 1BI3A 3B6CA 2K9MA 3GZNB 1G4DA 2WADA 3VEPA 3ZMVA 1X4PA 1ZLJA 3K4KA 4KICA 1I39A 5EZGA 4GRIA 2OV7A 2HYGD 4G7HF 1UHWA 2RNJA 2GXGA 4IEJA 1OCPA 3F8NA 3T5XA 2JWTA 1EH6A 1ZHFA 2DN0A 3ZQLA 1REPC 2QLZA 3FWEA 3SQNA 1BW6A 3WODF 3KEOA 2X51A 4A3MJ 3WHCA 3BZ6A 3ZN0A 4W1UA 2WB1A 4KITB 1KA8A 3ABKH 4XLPF 3CTAA 2Z3YA 1Z3XA 2DFIA 2Z2SB 1JUMA 2IS4A 1VQMI 3KETA 1U78A 2EIMH 3H5RA 3F0CA 1MBHA 4OIOF 1OCOH 3ZQQA 2CS3A 1OMIA 4FASD 3JTGA 3G6EI 4LB5A 4OIRF 1TLHB 4Y4RA 5D5WB 2LSOA 3TKYA 3IV5A 1BBYA 5E3MA 4I01A 2ZMEC 4EV0A 3GFIA 3MN2A 5CPRB 1T98A 3WGHA 1XGOA 1O57A 1R4MB 4IHWA 3HTSB 2HEOA 4XN0A 3IUOA 5IT9K 5FKMA 3GTLJ 4YRVA 2WB1N 1U8RA 3JRIA 2DDAA 2HVSA 3WTTC 2R92J 3Q9SA 1ZGJA 2MLKA 3L00A 1FX7A 1ETXA 2G7UA 5IP9J 2DW4A 1JJ8C 5LGUA 1T08B 3E97A 5DTDA 1HBXG 2ZXJA 1BM9A 4M73A 4OAYA 4B48A 1LVKA 4L9TA 3RPQA 2HVQA 2OD5A 4ZC3A 5FKLA 1UZCA 1B9NA 2HNHA 3KP2A 3HOXJ 1LFBA 2JRTA 4BS9A 2FBHA 2KRCA 1AHDP 2XRNA 2XAJA 1PJRA 3U1KA 5J8FA 1GV5A 5DCFA 1DU6A 5BOXA 1PP7U 1UG0A 3G1LA 1QZZA 3PL8A 5CKTA 2ZO4A 1TZLA 2CV0A 3HPHA 3OWTA 3N97A 2IW5A 3KP7A 5L3EA 2LBFB 2MD0A 4EM2A 5FLXZ 3ZN1A 3HDDA 5IT3A 1Z7UA 3JREA 2R5ZB 2XV4S 4XMYA 3UNGC 3L2WA 3EUHC 1TTYA 1KQ8A 3MZHA 4PJMA 1QPIA 3TO9A 4FHTA 4L5EA 5HS8A 2P4WA 1N75A 2WAFA 4FE7A 3DFGA 2FBKA 4OAZA 5FD6A 3HC7A 1NK3P 4IF4A 1QRYA 3BR0A 1T6SA 4Q47A 1G59A 1FIPA 5J1RA 3HL2A 1MNMC 2EZIA 3QPTA 1AOYA 4I2OA 2EFOA 4CA0A 1U5TC 2GWRA 1IJWC 4RB2C 1R1UA 2ESHA 4CCNA 3FZVA 3BPXA 1J9IA 1Z6RA 4UVAA 4I09A 2KDOA 2QVOA 4LOCA 3QAHA 1F36A 3VOEA 2EB7A 3IC7A 3IH3A 4Y52J 1O7FA 5H2FC 1MMSA 4RB1A 1YQAA 4OINF 3TO7A 4D7NA 4LB6B 2O8KA 3CJNA 1BJZA 2DU9A 2XPVA 2JA7J 1KGSA 3UR3C 3B6AA 4DBRA 3PIPF 5JVGF 5IPAA 1JGSA 2KIUA 2EV6A 1MH3A 3BQZA 1KYZA 2X6YA 2HZTA 5KAFC 2F6CA 3IKVA 3QPSA 2V9KA 2ACJA 2O61A 4ANJA 1XC5A 1S7OA 2E1CA 4XKCA 2O6GE 1E2XA 1SD4A 3PFIA 2E7WA 4EM1A 2HXOA 5EJCA 2QQBA 3U1DA 1X1PA 4K2EA 3CD6I 3ZRGA 2HQAA 2A05A 5E1WA 5CVVA 1FMWA 3ERMA 3S3OA 2ID6A 3JRCA 4U0WA 3F22A 3D5SC 5IY5H 3OYGA 2W24A 2VONA 2K3FA 4LLNA 2Z1DA 1QBJA 2K9QA 2M9HA 3FXLA 2F2EA 4DW6A 5GP9A 2WC2A 2WBMA 2M30A 3LSRA 2QBYA 2BVMA 1EH7A 5ERIA 5EZHA 1SFUA 4IHXA 1ZGWA 2LFBA 2HQ5A 1WCMJ 1ETQA 1R00A 2XGCA 2X6XA 5EDNA 3OS2A 3P7NA 3BTJA 4BAYA 3ECOA 3HBLA 3K4LA 4HLXA 3O8HA 3GBGA 1UAAA 2BZTA 1Q1VA 3V8KA 2FXAA 3T8RA 4XLCA 1SFOJ 3AL0C 4P96A 1JKRC 4B4CA 3BR5A 3C3WA 4ZTJA 2QKMB 2IP2A 2R7FA 2DMPA 3ZGKA 1A35A 2VOOA 1H9GA 2DMQA 3B73A 1R5HA 1Y56A 1ZQ3P 2VQHA 1O3RA 4NUBA 1T95A 4IHTA 3FHZA 3SXYA 3LA3A 2ECBA 1B59A 4CICA 4M6VA 2YUSA 4RDUA 4ESJA 4HW0A 1LEAA 4BH9A 2DMUA 4W97A 1R1VA 4A0XA 2QEXI 3M4OJ 3W3CA 2RC4A 4A3BJ 1P4WA 2ELKA 5LEJA 3ZQCA 2H09A 4M6YA 3S15J 1KU9A 1YS6A 3REOA 3GTGJ 3FXMA 4FQGA 3SDBA 1USTA 4M9ZA 3K2AA 4BEHA 4I6ZA 2R7RA 1OR7A 3N05A 3CJTB 1RC9A 3SZGA 2LD5A 1IN6A 4XRSA 2E2HJ 2BY3A 1X1AA 2K9SA 4HSRA 4IPAA 3BJ6A 3MQ0A 2LY2A 1S8NA 2QGUA 4A0ZA 1OISA 2HOSA 5F08A 2DT6A 2E34A 4G9YA 2DODA 5F64A 5C4XJ 2A6EF 1FC3A 3V8JA 3S2DJ 1HW2A 2L54A 2OPTA 3NWTA 5LGTA 1BOAA 2JA8J 5HLTA 2BV6A 1PUFB 2D5VA 1FOXA 4XN3A 2VODA 5FJ8J 4A6EA 3GFMA 4UB6C 4RGXA 4KA4A 4U7BA 3CCSI 4O6JA 1RZ4A 4HA8A 1ZG3A 5LHHA 1BIAA 4E70A 1HSJA 4XRFA 2VKHA 1SVMA 3PSFA 3C2GA 1MIJA 1WH5A 1ZYRF 2JRMA 3HKZA 4V2GA 1GV2A 4R1HA 3RYRA 4S04A 4HPQA 4ZH4F 4LLGF 3MKWB 5D4SA 3OR2C 4NHJA 4XONA 1E3HA 2CV2A 2E1NA 3CCRI 2W85A 2Y30A 2AO9A 4L9JA 2XAQA 2E2JJ 3BC8A 4MEXF 1A04A 1OKRA 2P5VA 4S05A 1ZELA 4J01A 1S7AA 1UHMA 1V5EA 3KP4A 2Y9ZA 2UWMA 2Y2ZA 3QRFF 3C1DA 4BUPA 2B0LA 4IOAF 2H8WA 4CCOA 1A31A 4CYCB 2N8GA 3HRTA 3CP2A 3E3VA 4PJJA 2W82A 3JCUC 3J80Z 4MIMA 5F27A 3SZTA 2CUJA 2K86A 1KONA 4HV6A 3WTZA 1STZA 2Y31A 4EMSA 2CFOA 1HLVA 1ZRCA 4MEYF 1NG7A 1BJAA 2XAFA 4LITA 2QM3A 4HEA2 2A5YB 2Q1ZB 4N0BA 2XF7A 4LLLA 2QBYB 3H3VK 2GA1A 3S1RJ 1ON1A 3FMRA 1NH3A 3ONQA 5HLHA 4MHGA 2IS2A 2KMUA 2EA4A 3JAMZ 3G3ZA 5BPIA 1S29A 5LLQA 1V3FA 3CDHA 4HNVA 1K6OA 2C6YA 2IRFG 2KP6A 3GFLA 4XLAA 3COAC 1HCRA 2QUFA 5GPCA 1QPMA 3FMSA 4XRSG 3OYKA 4PGGA 1B9MA 4D5CA 3E7LA 3FDYA 3V4GA 4BKXA 3FM5A 3WG9A 2F5DA 4RLQA 3GX4X 1OLTA 2K02A 5AIPA 3WTVC 4Y15A 2CO5A 3BG5A 3DV8A 2DPDA 1Z3YA 1K7AA 4CHUA 3J7YJ 1TWHJ 4II3A 3KLNA 3AG2H 4HZFA 3M8JA 2R93J 1YRNA 2PMZA 3KEQA 3O3KA 2CGPA 3BLYA 4PCQA 4PGHA 3CUQC 2JUGA 3JRDA 1P6RA 1SAUA 4FCYA 1YI2I 2L7KA 4N9IA 1T0FC 5M3MJ 2OZUA 1ERDA 2KZGA 1ZR2A 4KJZA 2CFXA 4PFPA 3RIRA 2JA2A 4CUGA 2ZSIB 4P9FA 2HOAA 3BG7A 4IKFA 2KPMA 3Q0WA 3LNQA 5FKNA 1EKEA 3RYPA 1TW3A 3K0LA 3CP8A 2NVUB 5GAGJ 2YU9J 4DGWB 4PK4A 3W6KB 2DFHA 2XKPA 5E3NA 1KZHA 4ZZDA 1V4RA 1UELB 3F72A 3CC4I 1RNLA 2PMZN 3M8FA 4A3IJ 3TQNA 1SFEA 2HR3A 5HS7A 2KKOA 1Z1DA 5E18F 2HGCA 4CO8A 1XGSA 2LNBA 3DBRB 4FX0A 3IH2A 3OR1C 3DXJF 4EEFG 3L2CA 5F1JA 1DU0A 3LFUA 3DEEA 4EGYA 2VJ5A 2QZ8A 4ESFA 2ZNYA 3G73A 2FQ4A 3E6DA 4AVZA 5FLMJ 2W48A 2HOEA 4KIBA 2GAUA 3IRQA 3BOQA 4HOBA 3RDIA 3CMEI 1LB2A 5E79C 1SD7A 4AIJA 3LQQA 3T0YA 1FLIA 2OAZA 3TL4X 4WX9A 3WGIA 1SC7A 1BA5A 2NS8A 2KJCA 5H6RA 4CDGA 1LFPA 2HDWA 2X0LA 4G12A 5LBQA 3OY9A 1RR8C 4KYWA 2ZMEA 2DA4A 2HI3A 4F93B 4EJOA 1P2FA 2KFDA 4QLCU 2YU3A 3VYUB 1R4NB 4P1WA 3TO6A 1RPWA 4NQWA 2W7NA 3D1NI 3M3YJ 2HFHA 1TW2A 2Y0SN 3ISPA 1D1AA 5FLXK 2FOWA 2WAQA 1WJEA 2LYCA 4WXDA 3WG7H 2RN7A 3KP6A 3FXKA 4AUXA 2IA1A 4HDUA 4HNUA 3CMYA 4HDVA 3CZ6A 2OTJI 3LSKA 3GTOJ 3H36A 1MZBA 4OMYA 2V1NA 4R8HA 2KL4A 3H3UA 3FKJA 2V1UA 4HX7A 4RM2A 2KZVA 3FK7A 1TWFJ 3HB9A 1YX3A 1W0UA 2IGKA 3NAUA 1K6YA 2O5RA 2VXZA 2O03A 1JT6A 5CLSA 4J19A 2HDCA 1FIAA 1X3WB 3BT9A 2GIVA 3KYLA 2E35A 1ZG1A 2V6CA 2XDVA 1FBQA 2IS1A 4FETA 1H0MA 2EWNA 3OYNA 4C2TA 2E1MB 2ZCWA 1I6XA 5D8LB 2WAQN 2CQQA 2K27A 4ASNA 4F92B 3AFHA 2VJ4A 1AWCA 3H35A 2A61A 3EUHA 4NC6A 3FKIJ 4DOZA 2OTLI 2MBFA 2F5CA 1TT0A 4GO1A 3OYAA 1QU3A 1XD7A 1WVRA 2JSCA 5LHGA 4ETSA 4A69C 5E8GA 3CCEI 2OCCH 4UUVA 1X2NA 1JKPC 1J59A 1F43A 2NXNB 1XS9A 3GXOA 1E17A 2FD5A 1U5TA 3ELKA 1EA3A 2Q0OA 3BTLA 4IQ4A 3ABTA 2Q2EA 3JRBA 3CCYA 2PG4A 2MABA 1J5YA 3DU6A 3WU0A 1BN5A 1APLC 2DBBA 3CCLI 3QODA 4BXXJ 5D6EA 3WTSC 3K4MA 4GYIA 4O5VA 1LEBA 4R79A 5E20A 1IV8A 5K1YA 3G71I 3D5RC 2DCEA 1UJ8A 1ZK8A 5JI6A 1TQMA 4CYDA 2XROA 1I3AA 2PJRA 4P5OA 4CGZA 1VQNI 2LKXA 2OCEA 3ZMZA 5HVQC 2D45A 1T8IA 2F5VA 3BCAA 2JJ7A 3BG9A 1FTZA 3O6BB 5KAIC 2BVLA 3DU5A 3S93A 5DM6F 1WHUA 4I76A 4X6AJ 2EZLA 1WJDA 2DA2A 2EZHA 3ERED 3MWMA 4CH7A 1ZRDA 1IN4A 3R60A 2EA2A 2X9DA 2GLOA 2AQFA 2VJIA 3I0TA 3TP3A 4BDYA 5A2QZ 3D0SA 3O2PE 3AAFA 2H1LA 5GTIC 4YELA 2QQAA 1USSA 3HM5A 2ME6A 1BC8C 1ZH5A 1A5JA 5HDNA 3OYIA 2UZKA 2DA5A 1WJBA 2DOFA 3IP4B 2H27A 2TDXA 3HRSA 1IW7F 3HZJA 2W84A 2X1DA 5CVJA 3ZMTA 4XICA 2DYSH 2DXIA 3GMEA 2DA1A 4C9YA 4LK0F 4BGDA 4HBLA 1FP1D 3I54A 4U0VA 2W4SA 2W57A 1B72A 2DMNA 2F4OB 2FQ3A 2LLKA 3DPLC 4LG3A 4WK8F 2BHYA 2LOOA 2ZMEB 5CYVA 1HF0A 5KNLA 2OJED 1TQIA 4MLOA 2M7BA 1B6AA 2R7TA 3I4MJ 1FZPB 4L18B 3GLLA 4D5FA 1IUFA 4NQWB 1K78A 2WWYA 4UXNA 2MC4A 3KE2A 4L0YB 2WY8Q 5F0FA 1JTXA 9ANTA 3GVAA 1LQ1A 2F4IA 3KFWX 2HPMA 1ONVA 3VYTB 1N78A 3GW2A 3Q9VA 3OIQA 1YHQI 1IF1A 1JGGA 3ZQHA 3HIFA 1Z7LA 2P5KA 1ORKA 3S14J 1UCRA 1YW7A 3WTWC 3KPHA 1W4MA 2FBIA 1HSTA 1YTYA 4ZYAA 5ILVA 1RETA 4G94A 2H6BA 4CCMA 2ZXIA 1Y0NA 2J5PA 2M4GA 1P7JA 2CSOA 2V9VA 3KLOA 3SYTA 4M3DA 4XK4A 2VIXA 3SFIA 2NS7A 3I56I 3HHGA 3BDDA 4A3KJ 5EGOA 2LG4A 3FIWA 3WTXC 1U0JA 4CXFA 3FX3A 2B63J 1ON2A 3CO7C 4PSWA 2UXXA 2R7UA 5B1AH 4F3QA 1LDJA 4QWQA 4EATA 5JHUA 2L02A 2NOGA 4XRMA 5CVIA 3H9GA 3MVPA 4HG2A 5GAEJ 4X0GA 4E6KG 1J2XA 1YLFA 2KRFA 3FXRA 3J81Z 3VFZA 1VQ5I 3P9IA 2ADUA 1UFMA 4RM3A 4I02A 4M3FA 3RZDJ 4IRHA 1R7JA 4B09A 2DA7A 4XBFA 1IRFA 2EIJH 1K79A 2LK2A 3RI4A 4DQ2A 1FOYA 2CW7A 4UUSB 3LSGA 2DA3A 3VSKA 1YS7A 2GOXB 5IYCJ 4BXUA 2IBDA 3OV8A 1Y39A 2COBA 4BJ5C 3VSLA 4QSHA 2LC2A 2G7HA 2GQQA 1FP2A 2QENA 3KP3A 5DCMA 3BPVA 1O4XA 5LRSA 4E7HA 1XX5A 2PJRB 2LF8A 3WE2A 3DLLF 2VL8A 4KMFA 4A3FJ 1DPUA 5B5EC 1H89C 2XB5A 2L7ZA 3NQOA 2RDPA 5J40A 4BQNA 3W6VA 2MFZA 4RGUA 1ETKA 2DPUA 2ZBKA 1VQKI 4KDPA 1E3PA 2D2WA 5E1ZB 5KHDA 3M7GA 1FMVA 1XDUA 1VI0A 2EIKH 3HEFA 5LHIA 3OYFA 3ZP5A 3HOWJ 1MBEA 2R7QA 3F3XA 4NDLA 1MNDA 2AHQA 3OOUA 3V42A 4N4NB 2ZFWA 3PFYA 4YFXF 1SVOA 2YSRA 4IHYA 4IX7A 2LKPA 1X19A 2FX0A 2LF7A 4MO7A 3S32A 3CO6C 3PO2J 3ZMUA 4GFBA 3BTIA 2E60A 1D8KA 2R4GA 4RBOA 2FF4A 5M3FJ 2FRHA 4XKVA 4XLEA 4FX4A 4F55A 4KIGA 4E7ZA 3CESA 2R0QC 1N25A 2M4KA 3HSEA 4F91B 2NS0A 4E7KA 4RA2A 1FJLA 3GEZA 1B72B 2Y9YA 4IJAA 3GTJJ 2GXBA 4HAMA 4Y3OA 2H94A 3TW7A 3A4CA 4A3GJ 2E71A 3DTEA 1R5GA 4ZDLA 1RKWA 1MH4A 3K4NA 3FHNA 2NVYJ 5BS6A 5ICFA 1SFXA 2AQEA 3N4MA 5TRDA 5J6XA 3PM1A 3ROUA 1WJ5A 5CJ9A 1TL8A 2O9LA 4N9HA 3V8LA 2FNAA 1XB4A 2L9RA 3GUDA 2L2OA 1ACIA 3PNTA 1SD5A 3KCCA 1KU2A 4LGWA 4C3JJ 4ENMA 3JW4A 2P6TA 1S72I 1FYKA 2IGMA 1U9NA 5GAHJ 4A3JJ 3AL0B 2CV1A 2L9VA 1OYYA 1TWCJ 3C7JA 4MNUA 1W1WE 2RNGA 3A0BC 3PUBA 4RAFA 1J75A 3GLXA 2DLLA 2M45A 3I4NJ 2L4MA 1M1EB 3LA7A 4DYQA 5FFXA 5K7ZA 5HNFA 1ZARA 1RKTA 1PVEA 3F23A 3RPUD 3CUQA 3RKYA 4ZYGA 5FB2A 1IZ1A 3NRVA 3S2HJ 2XSDC 1CGPA 1YOVB 4QTRA 1YE9A 2X85A 4OIPF 3QPLA 2LP0A 1T0FA 2HQRA 3OOPA 4G6DA 3HYIA 3OYJA 1TQPA 2RKHA 4MQVA 2M3AA 2JMWA 2FMLA 2WTEA 1P9QC 1XSXA 3A2KA 1HQCA 2DK8A 1O3TA 4PJ0C 1K83J 4JX4A 5D6FA 4F52A 1D8JA 2FJ1A 4RS8A 1FYLA 4DZPA 1OPCA 1TWGJ 4JK1X 1H88C 1Z6TA 2XGEA 2EV0A 3KP5A 1HOMA 2PBIA 3U9GA 1WZ2A 5DV5A 4M3EA 3HOYJ 1XGNA 3NARA 3E5QA 4HQEA 3ECHA 2KDZA 3L2QA 2EBIA 1TC3C 3RZOJ 3I71A 2Z16A 4DYRA 2HWVA 4MFEA 5IYDJ 1A6IA 2WV1A 2XB0X 5HLGA 1LVAA 1KU7A 4AC0A 1D0XA 3L2VA 2L9NA 5FFZA 2JPBA 3DKYA 3QWLA 1YITI 2WY7Q 3BR2A 3JRGA 2RGVA 1T2KA 2W1OA 1BW5A 4DNCA 4XOTA 3CCMI 1ZR4A 1ULYA 3BR3A 2Q8KA 3HGYA 1E0EA 3C2BA 1H9TA 1JHFA 5DCMB 4A3CJ 3HUGA 5D5UB 3WU1B 3ABUA 2VUMJ 3OSFA 4YFNF 1DUXC 2BXZA 2KQRA 1LDDA 5LRRA 4G6QA 3EUKL 4WCGA 4LFUA 3OYHA 2B9SA 2VQLA 2YPRA 5J47A 2JA6J 3Q5FA 3A01A 2JQ7A 3R6SA 1MMGA 3I4PA 1ZREA 2H6CA 3JR9A 4JOMA 4ENKA 1IV6A 5GADJ 1ETYA 3W2VA 2GM4A 5FD5A 3ZMSA 1SD6A 3DBLB 3KX2A 1LNWA 2CG4A 3IHUA 3H9QA 1YW8A 1B4AA 4XSZF 3K1NA 5FO5A 2STWA 3I5UA 4M72A 3QU3A 3FISA 2CQNA 4Q4ZF 6PAXA 3VDXA 3EPZA 1BR2A 4EQQA 1HDDC 4FTHA 5K5OA 4U88A 4LD5A 5TGTA 1HDPA 1WPKA 4BY1J 5H20A 3H1CA 1V55H 2JTVA 3A02A 1CQTA 4KISA 1U2WA 4FISA 4D1QA 1I6HJ 2JVGA 2JUCA 3WTYC 2K4JA 4UHTA 1T33A 3ZQIA 3LSMA 1ZAOA 3DEWA 2GBYA 3BJAA 3RCOA 1I50J 2PN6A 5M5YJ 1JXSA 1JT0A 1HA8A 2VE8A 3TBIA 2IJLA 5TISC 1ZGAA 4ZDOA 3OYMA 1BI1A 4AD9A 2P0WA 3DF8A 1MJ9A 1VQPI 1KQ9A 2OF7A 2HPIA 5FROA 1Q1HA 2MGQA 2P8TA 2QQ9A 1GLNA 4AYBA 2OQGA 3H3ZA 2V6EA 1BR4A 3V7SA 3CCVI 2V26A 1I5ZA 2O0YA 4LMYA 3BTCA 3Q3SA 3RSNA 2G9WA 2ZJ2A 3LOCA 2OC6A 3CMMA 4BNCA 4A93J 5K5RA 2GOMA 5FRNA 1VQ6I 3HOZJ 5CQEA 2LKSA 1B8IA 1DQUA 3CUQB 3DLAA 3AG1H 4NC8A 3OIOA 2KLOA 5KVRA 4KN4X 5M5WJ 2L4AA 2P7CB 1XDSA 3SEQA 1W0TA 5A2QK 3RPUA 3QOPA 5D8KB 1QZEA 5JHFA 1CF7A 4IQJA 2E19A 1H8AC 3OYEA 1D0ZA 3E0JB 3L9FA 3JSPA 2OA4A 4H4KC 3MD2A 4S0HB 4ENJA 1Y8RB 5ICCA 4KN7X 4AYBN 4G7OF 2F5EA 3J7ZI 4AIDA 1WI9A 4ZYHA 3H0DA 4BEHB 1VTNC 3BY6A 2E7XA 2XHKA 1N77A 4GDFA 1MMNA 2JA5J 2QCOA 4GCVA 1BOBA 2CQKA 5J8CA 1LJ9A 4FT8A 4IHVA 1WJAA 3EETA 2ECCA
chains in the Genus database with same CATH topology
1Z05A 3U2RA 4WWCA 1MDMA 1C0WA 4I98B 3ZQ7A 1D5VA 4HLYA 4GXOA 2CWEA 2VN2A 1DDNA 3TOAA 1KU3A 1WRJA 5F6FA 3H92A 1G3WA 2MA3A 3EQLF 2AS5F 1IXRC 2NAZA 5AONA 1R58A 2UXNA 1PUEE 1FSHA 1FYMA 2F5FA 2J5OA 4BQAA 1W5TA 1YG2A 1X3UA 2ZKZA 2IA2A 4LJZF 2PFBA 1S3JA 5ICEA 5ICGA 2MH9A 1I1GA 2M87A 3LA2A 4ON0A 4HV5A 4I0AA 2YX4A 3D5LA 5D4RA 2PI0A 1GXPA 2JZYA 2KIFA 4ZZLA 1MGTA 1WKMA 2VT3A 1ZG5A 1FT9A 2P6SA 3K2ZA 3IL2A 2Z99A 1F4KA 5DD8A 2Z9OA 3LFKA 2EFQA 1P4XA 2MH2A 3LQRA 1BC7C 4ENNA 1RIOH 2VBXA 3QU6A 4HX4A 2XASA 4UVCA 2OU2A 3M9AA 2VBYA 2L3DA 1JE8A 4P55A 4HF2A 1L0OC 4Y13A 4XSXF 4TV7A 2VT2A 1JHHA 2Z33A 1YW9A 3K9TA 3ZMDA 1XSVA 5H6QA 2HTSA 2RVCA 2LDUA 1W7PD 3RKWA 5DUKA 3DP7A 4ZYDA 1CF7B 4IHSA 1QZYA 2A07F 3TGNA 1HKQA 3F8MA 2EJRA 1MJBA 2BBYA 4OIQF 2OBPA 2PLYA 4RGRA 4MGRA 1WSUA 4NB5A 2FEZA 2PMHA 1OYIA 4JBAA 4HF1A 2XAHA 3EYYA 1QGPA 4A0YA 2CYYA 2JT1A 3RKXA 3HRMA 3RTRA 1MJAA 1R22A 4EJWA 4O3MA 4Z2YA 4U0YA 1FNNA 4P9UA 2M1BA 4Q48A 3BWGA 4I7HA 2ZNZA 2ELHA 2M5WA 1F5TA 1J7KA 3HHHA 2Y0MA 4GYGA 2V1DA 1HW1A 2V1XA 4KUMA 3V7CA 1G6NA 2QWWA 5LEKA 5FGMA 2Y48A 1YO5C 1BIBA 5E17F 4ZYEA 1D3YA 4KIFA 1IN5A 4A5NA 5EEGA 1MKMA 2W25A 4IRGA 3WTUC 3JSOA 1P4AA 5E8IA 1PDNC 3GO5A 3JTHA 2A69F 3I53A 2EK5A 3HOSA 1FSEA 2A6HF 1DP7P 1T39A 2STTA 1WQ2A 4MQ9F 2EFPA 1RI7A 5HS9A 2OZ6A 4Q5SF 2BE5F 3E6MA 4BHCA 1XCBA 5DEQA 1R23A 2A68F 4L9NA 3EYIA 2ESNA 4BHPA 4HF0A 3T8TA 1NHAA 2IA0A 1U5TB 1GHCA 1HW5A 4XLNF 5L3GA 3GZ5A 5JR3A 1G3YA 2DI3A 4EJTA 3L7WA 4IRIA 1W7PA 5E1XA 1UB9A 3FM3A 4LG0A 3GF2A 2EFWA 3J80K 1LDKB 3LAPA 4EM0B 3MCZA 3TOBA 2DO7A 3GWZA 1IXCA 1SMYF 5ED4A 1J0RA 4KMUX 2HKOA 3JAMK 4AIHA 5D5VB 2R3SA 2X4HA 5HLIA 2NYXA 4M71A 3SZPA 2DQRA 1FBUA 1WWXA 4RGSA 4IXAA 2RQPA 2GA2A 3WGGA 3NEUA 3R61A 4G7ZF 2AXLA 4UNOA 1S6LA 2XUBA 1DPRA 1Z91A 2Z5UA 3TDZC 2DK5A 2HKXA 2VBZA 3I58A 1K78B 1R1TA 5L3FA 4YG2F 1QO0D 1KQ0A 3R4KA 4UV8A 3PQKA 2MD5A 3F6OA 1XN7A 4JQFA 3M8EA 1G3SA 4LK1F 3TDUC 3I59A 4HX8A 4AWXB 5DUIA 1T38A 3MAJA 4YIFA 3BJOA 2P7VB 4PZJA 3E5UA 2EV5A 2XIGA 2FNPA 4MTDA 5KK1A 3HSRA 2QYOA 5L3DA 3FMQA 3QP6A 1FBSA 1HKTA 4D0PA 3MEXA 1IXSB 2MLGA 2PQ8A 4IVNA 1O3QA 1R36A 5IT9Z 4M9XA 4G8XA 1TNTA 4PDKA 3M1EA 1BI2A 1O3SA 3KZYA 3L09A 1U3EM 1Y0UA 1F9NA 4MTEA 2NNNA 5BPDA 2JPCA 5DYMA 4RB3C 4L5IA 3IWZA 2VE9A 2FMYA 2XGXA 4UV9A 3P9CA 4Y17A 4BYYA 3FXUA 2ISZA 2BYVE 1I1SA 1W7PB 4LG0B 3E6BA 1P92A 2IVMA 5CVUA 3DQVC 1FOKA 4L9VA 2O3FA 2VOPA 2DT5A 2DQLA 2XAGA 4KNYA 3E5XA 3GZ6A 3I64A 4M9SA 3CLOA 1XGMA 1TBXA 2OQRA 1IAWA 5EEHA 5L3BA 4ESBA 3BP8A 3K1PA 1RUOA 3F8CA 1ZLKA 2D1HA 3F8BA 2NNYA 3DPTA 5CVRA 4OMZA 1YYVA 2HQNA 3WE3A 4A12A 1IUYA 2PMUA 2XKOA 2K4BA 2DAOA 3HRUA 4AIKA 4EVIA 1ZN2A 3K69A 3KZZA 1QNTA 2VBWA 5ILUA 5DDGA 1PP8F 2NRAC 2FU4A 5L3CA 1XCVA 2YR2A 3LAJA 4L5JA 3HOTA 2PJPA 2FOKA 3R0AA 3F21A 2BEOA 3I59B 1G3TA 3J7AO 3QP5A 3RJPA 4L0ZB 1IN8A 4YFKF 3MFKA 3DEUA 5DD4A 2R7DA 1HXDA 3ML6A 4UVBA 3T1BA 4I0BA 4EGZA 2FA5A 3E6CC 4EJVA 4KFCA 1I27A 2WV0A 1U6GA 2HYFA 1Z9CA 4BHBA 1MD0A 1O7LA 3VB2A 1YIOA 4A2UA 4GGGA 2MC3A 3QPHA 5D5XB 4M74A 1ZRFA 3IKTA 2KJBA 1FPQA 1KYWA 1SMTA 2L01A 1YFHA 3IRRA 2KIMA 4A5MA 1F1ZA 2VC0A 2XVCA 2D1VA 4HYEA 5JVTA 1W5SA 4CZZA 4RAYA 1EH8A 3LWFA 4OU0A 2P5LC 2FE3A 5AIQA 5BQTA 2HS5A 3CUOA 1IRGA 1FWZA 1B1BA 2VC1A 4OOIA 4A6DA 2A3SA 5ILSA 3S2WA 1EV7A 2ISYA 3F8FA 2DTRA 4YIIA 1BI0A 5JFRA 3J81K 4EJUA 3EDPA 3SHFA 3K1MA 4HQMA 1TNSA 4WXHA 2IPQX 3BROA 2Y75A 1GXQA 3SFZA 1OYWA 3VODA 2O8XA 1GVJA 5LGNA 5HDKA 4RB0A 2K7LA 3LSTA 2PEXA 3IWFA 2CW0F 3MZYA 4M6XA 5TJJA 1QQIA 1RUNA 4B8XA 4H0EA 3P9KA 3B02A 5HDGA 2ETHA 3HTUA 4WXCA 4F7ZA 2HTJA 1XSDA 3GFJA 3V7RA 1ODDA 3GYHX 3C18A 3FXQA 3W6JB 5HOOA 1XMKA 3ZPLA 2FSWA 5F1RA 3F6VA 2COMA 3PQJA 2BGCA 2GZWA 4U7DA 1IN7A 2YX7A 5K5QA 4RAZA 2M8EA 5BMZA 4AVPA 4KT5C 2V79A 2RV8A 2IT0A 3ULQB 1L3LA 1HKSA 2EFNA 1XMAA 4WF2A 3FF5A 1SAXA 3HSFA 1MDMB 3DKWA 3R0JA 1FY7A 1BI3A 1G4DA 3VEPA 3ZMVA 1ZLJA 4KICA 2HYGD 4G7HF 1UHWA 2RNJA 2GXGA 3F8NA 3T5XA 1EH6A 1ZHFA 1REPC 2QLZA 3FWEA 3SQNA 3WODF 3KEOA 3BZ6A 3ZN0A 1KA8A 4XLPF 3CTAA 2Z3YA 2DFIA 3KETA 1U78A 4OIOF 1OMIA 3JTGA 4LB5A 4OIRF 1TLHB 5D5WB 2LSOA 3TKYA 1BBYA 4I01A 4EV0A 3GFIA 1T98A 3WGHA 1XGOA 1O57A 3HTSB 2HEOA 5IT9K 1U8RA 3WTTC 3Q9SA 1ZGJA 2MLKA 3L00A 1FX7A 2G7UA 2DW4A 5LGUA 3E97A 1HBXG 2ZXJA 1BM9A 4M73A 4L9TA 3RPQA 2OD5A 1B9NA 3KP2A 2JRTA 2FBHA 2XRNA 2XAJA 5J8FA 5DCFA 5BOXA 1PP7U 1QZZA 2ZO4A 3N97A 2IW5A 3KP7A 5L3EA 4EM2A 5FLXZ 3ZN1A 5IT3A 1Z7UA 2XV4S 1TTYA 1KQ8A 3MZHA 3TO9A 4FHTA 5HS8A 2P4WA 3DFGA 2FBKA 5FD6A 4IF4A 1T6SA 4Q47A 1AOYA 3QPTA 4I2OA 2EFOA 1U5TC 2GWRA 4RB2C 1R1UA 2ESHA 3FZVA 3BPXA 1J9IA 1Z6RA 4UVAA 4I09A 2QVOA 3QAHA 3VOEA 2EB7A 3IC7A 1O7FA 4RB1A 1YQAA 4OINF 3TO7A 4LB6B 3CJNA 2DU9A 1KGSA 1JGSA 2KIUA 2EV6A 1KYZA 2HZTA 2O61A 3IKVA 2ACJA 1S7OA 2E1CA 2O6GE 1E2XA 1SD4A 3PFIA 2E7WA 4EM1A 2QQBA 3U1DA 4K2EA 5E1WA 5CVVA 4U0WA 3F22A 2W24A 2VONA 4LLNA 1QBJA 2F2EA 2WC2A 2M30A 2QBYA 1EH7A 5ERIA 1SFUA 1R00A 3P7NA 4BAYA 3ECOA 4HLXA 3V8KA 2FXAA 3T8RA 4P96A 3C3WA 2IP2A 2R7FA 2VOOA 1H9GA 3B73A 1R5HA 1O3RA 4IHTA 3FHZA 3SXYA 3LA3A 1B59A 4CICA 4ESJA 4HW0A 1LEAA 4BH9A 1R1VA 4A0XA 2RC4A 1P4WA 5LEJA 2H09A 4M6YA 1KU9A 1YS6A 3REOA 1USTA 4M9ZA 1OR7A 1IN6A 4IPAA 3BJ6A 3MQ0A 1S8NA 4A0ZA 4G9YA 5F64A 2A6EF 1FC3A 3V8JA 1HW2A 2L54A 5LGTA 1BOAA 2BV6A 2VODA 4A6EA 3GFMA 4RGXA 4KA4A 4U7BA 4O6JA 1RZ4A 4HA8A 1ZG3A 5LHHA 1BIAA 4E70A 1HSJA 4XRFA 1ZYRF 4R1HA 3RYRA 4S04A 4ZH4F 4LLGF 5D4SA 4NHJA 2E1NA 2W85A 4L9JA 2XAQA 4MEXF 1A04A 1OKRA 2P5VA 4S05A 1S7AA 1UHMA 3KP4A 2UWMA 3QRFF 3C1DA 2B0LA 3HRTA 3E3VA 3J80Z 3SZTA 2K86A 4HV6A 3WTZA 1STZA 4EMSA 1ZRCA 4MEYF 1BJAA 2XAFA 2QM3A 2A5YB 4N0BA 4LLLA 2QBYB 2GA1A 1ON1A 3FMRA 5HLHA 4MHGA 2EA4A 3JAMZ 3G3ZA 5BPIA 1S29A 5LLQA 1V3FA 3CDHA 1K6OA 2C6YA 2IRFG 3GFLA 3COAC 2QUFA 1QPMA 3FMSA 4PGGA 1B9MA 3V4GA 3FM5A 3WG9A 2F5DA 3GX4X 2K02A 5AIPA 3WTVC 4Y15A 2CO5A 3DV8A 2DPDA 1K7AA 4CHUA 3KLNA 4HZFA 3KEQA 3O3KA 2CGPA 4PCQA 4PGHA 3CUQC 1P6RA 4N9IA 2OZUA 2CFXA 3RIRA 4P9FA 3RYPA 1TW3A 3K0LA 3W6KB 2XKPA 4ZZDA 1V4RA 3F72A 1RNLA 3M8FA 3TQNA 1SFEA 2HR3A 5HS7A 2KKOA 1Z1DA 5E18F 2HGCA 4CO8A 1XGSA 2LNBA 4FX0A 3DXJF 3L2CA 4EGYA 4ESFA 2QZ8A 2ZNYA 3G73A 3E6DA 2HOEA 4KIBA 2GAUA 3IRQA 3BOQA 4HOBA 3RDIA 1LB2A 4AIJA 1SD7A 3LQQA 3T0YA 1FLIA 2OAZA 3WGIA 4WX9A 2KJCA 5H6RA 4CDGA 5LBQA 2X0LA 4KYWA 2ZMEA 4EJOA 1P2FA 4QLCU 2YU3A 3TO6A 4NQWA 2HFHA 1TW2A 3ISPA 5FLXK 4WXDA 2RN7A 3KP6A 2IA1A 4HDUA 4HDVA 1MZBA 4OMYA 4R8HA 3H3UA 2V1UA 4HX7A 2HDCA 2VXZA 5CLSA 2O03A 2GIVA 1ZG1A 2V6CA 1FBQA 1H0MA 2EWNA 2ZCWA 1I6XA 5D8LB 2K27A 4ASNA 1AWCA 2A61A 3EUHA 2MBFA 2F5CA 4GO1A 1XD7A 2JSCA 5LHGA 4ETSA 5E8GA 4UUVA 1J59A 3GXOA 1E17A 1U5TA 3ELKA 2Q0OA 3ABTA 2Q2EA 2PG4A 1J5YA 3WU0A 1BN5A 2DBBA 5D6EA 3WTSC 4GYIA 4O5VA 1LEBA 4R79A 5E20A 5K1YA 5JI6A 1TQMA 4CYDA 2XROA 4CGZA 4P5OA 3ZMZA 5HVQC 2D45A 3O6BB 3ERED 3MWMA 1ZRDA 1IN4A 3R60A 2EA2A 3I0TA 5A2QZ 3D0SA 3O2PE 3AAFA 2QQAA 1USSA 1ZH5A 1BC8C 5HDNA 2UZKA 2H27A 2TDXA 3HRSA 1IW7F 2W84A 5CVJA 3ZMTA 4LK0F 4HBLA 1FP1D 3I54A 4U0VA 2W57A 2FQ3A 3DPLC 4WK8F 5CYVA 2ZMEB 1TQIA 1B6AA 1FZPB 4L18B 1K78A 2WWYA 4UXNA 4L0YB 3KE2A 3GVAA 1LQ1A 3KFWX 1ONVA 3GW2A 3Q9VA 1IF1A 3HIFA 2P5KA 1UCRA 1YW7A 3WTWC 1W4MA 2FBIA 1HSTA 1YTYA 5ILVA 4G94A 2H6BA 2J5PA 3KLOA 2CSOA 2V9VA 3HHGA 3BDDA 3WTXC 4CXFA 3FX3A 1ON2A 3CO7C 2UXXA 1LDJA 4QWQA 5JHUA 2L02A 5CVIA 1J2XA 1YLFA 2KRFA 3FXRA 3J81Z 3VFZA 3P9IA 2ADUA 1UFMA 4I02A 4IRHA 1R7JA 4B09A 4XBFA 1IRFA 1K79A 3RI4A 4DQ2A 1YS7A 4BXUA 3OV8A 2G7HA 2GQQA 1FP2A 2QENA 3KP3A 5DCMA 3BPVA 5LRSA 2LF8A 3WE2A 4KMFA 1DPUA 3NQOA 2RDPA 4RGUA 2DPUA 2ZBKA 4KDPA 2D2WA 5E1ZB 5LHIA 3ZP5A 3M7GA 1XDUA 3F3XA 2ZFWA 4YFXF 2YSRA 2LKPA 2LF7A 3CO6C 3ZMUA 1D8KA 2FF4A 2FRHA 4FX4A 4KIGA 3HSEA 2NS0A 3GEZA 4IJAA 2GXBA 4HAMA 2H94A 1R5GA 5BS6A 5ICFA 1SFXA 3N4MA 5TRDA 5J6XA 3ROUA 5CJ9A 4N9HA 3V8LA 2FNAA 1XB4A 3GUDA 1SD5A 3KCCA 1KU2A 4LGWA 4ENMA 3JW4A 2P6TA 1FYKA 1OYYA 3C7JA 4MNUA 1J75A 3GLXA 2DLLA 2M45A 2L4MA 3LA7A 5FFXA 1ZARA 3F23A 3CUQA 3RKYA 4ZYGA 5FB2A 1IZ1A 3NRVA 1CGPA 4OIPF 1T0FA 2HQRA 3OOPA 4G6DA 3HYIA 1TQPA 2RKHA 4MQVA 2FMLA 2WTEA 1XSXA 1HQCA 2DK8A 1O3TA 5D6FA 1D8JA 1FYLA 4RS8A 1OPCA 4JK1X 1Z6TA 3KP5A 2EV0A 2PBIA 3U9GA 5DV5A 1XGNA 3E5QA 4HQEA 3ECHA 3I71A 2HWVA 5HLGA 1LVAA 1KU7A 5FFZA 2JPBA 1T2KA 2RGVA 4DNCA 1ULYA 2Q8KA 1H9TA 1JHFA 5DCMB 3HUGA 5D5UB 3WU1B 3ABUA 4YFNF 1DUXC 1LDDA 5LRRA 4G6QA 4WCGA 4LFUA 2YPRA 3Q5FA 3R6SA 3I4PA 1ZREA 2H6CA 4ENKA 5FD5A 3ZMSA 1SD6A 1LNWA 2CG4A 3IHUA 1YW8A 1B4AA 4XSZF 3K1NA 5FO5A 2STWA 3I5UA 4M72A 3QU3A 6PAXA 4Q4ZF 4EQQA 5K5OA 4U88A 4LD5A 5H20A 2JTVA 1U2WA 3WTYC 2K4JA 4UHTA 1ZAOA 3BJAA 2PN6A 1JXSA 2VE8A 2IJLA 1ZGAA 1BI1A 4AD9A 1MJ9A 3DF8A 1KQ9A 1Q1HA 2P8TA 2QQ9A 2OQGA 3H3ZA 3V7SA 1I5ZA 2O0YA 4LMYA 2G9WA 2ZJ2A 4BNCA 5K5RA 3CUQB 5KVRA 4KN4X 2L4AA 2P7CB 1XDSA 5A2QK 3RPUA 3QOPA 5D8KB 1CF7A 3L9FA 3JSPA 2OA4A 4ENJA 5ICCA 4KN7X 4G7OF 2F5EA 4ZYHA 1WI9A 1VTNC 3BY6A 2E7XA 2XHKA 4GCVA 2CQKA 5J8CA 1LJ9A 4FT8A 3EETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z05 A;  3U2R A;  4WWC A;  1MDM A;  1C0W A;  4I98 B;  3ZQ7 A;  1D5V A;  4HLY A;  4GXO A;  2CWE A;  2VN2 A;  1DDN A;  3TOA A;  1KU3 A;  1WRJ A;  5F6F A;  3H92 A;  1G3W A;  2MA3 A;  3EQL F;  2AS5 F;  1IXR C;  2NAZ A;  5AON A;  1R58 A;  2UXN A;  1PUE E;  1FSH A;  1FYM A;  2F5F A;  2J5O A;  4BQA A;  1W5T A;  1YG2 A;  1X3U A;  2ZKZ A;  2IA2 A;  4LJZ F;  2PFB A;  1S3J A;  5ICE A;  5ICG A;  2MH9 A;  1I1G A;  2M87 A;  3LA2 A;  4ON0 A;  4HV5 A;  4I0A A;  2YX4 A;  3D5L A;  5D4R A;  2PI0 A;  1GXP A;  2JZY A;  2KIF A;  4ZZL A;  1MGT A;  1WKM A;  2VT3 A;  1ZG5 A;  1FT9 A;  2P6S A;  3K2Z A;  3IL2 A;  2Z99 A;  1F4K A;  5DD8 A;  2Z9O A;  3LFK A;  2EFQ A;  1P4X A;  2MH2 A;  3LQR A;  1BC7 C;  4ENN A;  1RIO H;  2VBX A;  3QU6 A;  4HX4 A;  2XAS A;  4UVC A;  2OU2 A;  3M9A A;  2VBY A;  2L3D A;  1JE8 A;  4P55 A;  4HF2 A;  1L0O C;  4Y13 A;  4XSX F;  4TV7 A;  2VT2 A;  1JHH A;  2Z33 A;  1YW9 A;  3K9T A;  3ZMD A;  1XSV A;  5H6Q A;  2HTS A;  2RVC A;  2LDU A;  1W7P D;  3RKW A;  5DUK A;  3DP7 A;  4ZYD A;  1CF7 B;  4IHS A;  1QZY A;  2A07 F;  3TGN A;  1HKQ A;  3F8M A;  2EJR A;  1MJB A;  2BBY A;  4OIQ F;  2OBP A;  2PLY A;  4RGR A;  4MGR A;  1WSU A;  4NB5 A;  2FEZ A;  2PMH A;  1OYI A;  4JBA A;  4HF1 A;  2XAH A;  3EYY A;  1QGP A;  4A0Y A;  2CYY A;  2JT1 A;  3RKX A;  3HRM A;  3RTR A;  1MJA A;  1R22 A;  4EJW A;  4O3M A;  4Z2Y A;  4U0Y A;  1FNN A;  4P9U A;  2M1B A;  4Q48 A;  3BWG A;  4I7H A;  2ZNZ A;  2ELH A;  2M5W A;  1F5T A;  1J7K A;  3HHH A;  2Y0M A;  4GYG A;  2V1D A;  1HW1 A;  2V1X A;  4KUM A;  3V7C A;  1G6N A;  2QWW A;  5LEK A;  5FGM A;  2Y48 A;  1YO5 C;  1BIB A;  5E17 F;  4ZYE A;  1D3Y A;  4KIF A;  1IN5 A;  4A5N A;  5EEG A;  1MKM A;  2W25 A;  4IRG A;  3WTU C;  3JSO A;  1P4A A;  5E8I A;  1PDN C;  3GO5 A;  3JTH A;  2A69 F;  3I53 A;  2EK5 A;  3HOS A;  1FSE A;  2A6H F;  1DP7 P;  1T39 A;  2STT A;  1WQ2 A;  4MQ9 F;  2EFP A;  1RI7 A;  5HS9 A;  2OZ6 A;  4Q5S F;  2BE5 F;  3E6M A;  4BHC A;  1XCB A;  5DEQ A;  1R23 A;  2A68 F;  4L9N A;  3EYI A;  2ESN A;  4BHP A;  4HF0 A;  3T8T A;  1NHA A;  2IA0 A;  1U5T B;  1GHC A;  1HW5 A;  4XLN F;  5L3G A;  3GZ5 A;  5JR3 A;  1G3Y A;  2DI3 A;  4EJT A;  3L7W A;  4IRI A;  1W7P A;  5E1X A;  1UB9 A;  3FM3 A;  4LG0 A;  3GF2 A;  2EFW A;  3J80 K;  1LDK B;  3LAP A;  4EM0 B;  3MCZ A;  3TOB A;  2DO7 A;  3GWZ A;  1IXC A;  1SMY F;  5ED4 A;  1J0R A;  4KMU X;  2HKO A;  3JAM K;  4AIH A;  5D5V B;  2R3S A;  2X4H A;  5HLI A;  2NYX A;  4M71 A;  3SZP A;  2DQR A;  1FBU A;  1WWX A;  4RGS A;  4IXA A;  2RQP A;  2GA2 A;  3WGG A;  3NEU A;  3R61 A;  4G7Z F;  2AXL A;  4UNO A;  1S6L A;  2XUB A;  1DPR A;  1Z91 A;  2Z5U A;  3TDZ C;  2DK5 A;  2HKX A;  2VBZ A;  3I58 A;  1K78 B;  1R1T A;  5L3F A;  4YG2 F;  1QO0 D;  1KQ0 A;  3R4K A;  4UV8 A;  3PQK A;  2MD5 A;  3F6O A;  1XN7 A;  4JQF A;  3M8E A;  1G3S A;  4LK1 F;  3TDU C;  3I59 A;  4HX8 A;  4AWX B;  5DUI A;  1T38 A;  3MAJ A;  4YIF A;  3BJO A;  2P7V B;  4PZJ A;  3E5U A;  2EV5 A;  2XIG A;  2FNP A;  4MTD A;  5KK1 A;  3HSR A;  2QYO A;  5L3D A;  3FMQ A;  3QP6 A;  1FBS A;  1HKT A;  4D0P A;  3MEX A;  1IXS B;  2MLG A;  2PQ8 A;  4IVN A;  1O3Q A;  1R36 A;  5IT9 Z;  4M9X A;  4G8X A;  1TNT A;  4PDK A;  3M1E A;  1BI2 A;  1O3S A;  3KZY A;  3L09 A;  1U3E M;  1Y0U A;  1F9N A;  4MTE A;  2NNN A;  5BPD A;  2JPC A;  5DYM A;  4RB3 C;  4L5I A;  3IWZ A;  2VE9 A;  2FMY A;  2XGX A;  4UV9 A;  3P9C A;  4Y17 A;  4BYY A;  3FXU A;  2ISZ A;  2BYV E;  1I1S A;  1W7P B;  4LG0 B;  3E6B A;  1P92 A;  2IVM A;  5CVU A;  3DQV C;  1FOK A;  4L9V A;  2O3F A;  2VOP A;  2DT5 A;  2DQL A;  2XAG A;  4KNY A;  3E5X A;  3GZ6 A;  3I64 A;  4M9S A;  3CLO A;  1XGM A;  1TBX A;  2OQR A;  1IAW A;  5EEH A;  5L3B A;  4ESB A;  3BP8 A;  3K1P A;  1RUO A;  3F8C A;  1ZLK A;  2D1H A;  3F8B A;  2NNY A;  3DPT A;  5CVR A;  4OMZ A;  1YYV A;  2HQN A;  3WE3 A;  4A12 A;  1IUY A;  2PMU A;  2XKO A;  2K4B A;  2DAO A;  3HRU A;  4AIK A;  4EVI A;  1ZN2 A;  3K69 A;  3KZZ A;  1QNT A;  2VBW A;  5ILU A;  5DDG A;  1PP8 F;  2NRA C;  2FU4 A;  5L3C A;  1XCV A;  2YR2 A;  3LAJ A;  4L5J A;  3HOT A;  2PJP A;  2FOK A;  3R0A A;  3F21 A;  2BEO A;  3I59 B;  1G3T A;  3J7A O;  3QP5 A;  3RJP A;  4L0Z B;  1IN8 A;  4YFK F;  3MFK A;  3DEU A;  5DD4 A;  2R7D A;  1HXD A;  3ML6 A;  4UVB A;  3T1B A;  4I0B A;  4EGZ A;  2FA5 A;  3E6C C;  4EJV A;  4KFC A;  1I27 A;  2WV0 A;  1U6G A;  2HYF A;  1Z9C A;  4BHB A;  1MD0 A;  1O7L A;  3VB2 A;  1YIO A;  4A2U A;  4GGG A;  2MC3 A;  3QPH A;  5D5X B;  4M74 A;  1ZRF A;  3IKT A;  2KJB A;  1FPQ A;  1KYW A;  1SMT A;  2L01 A;  1YFH A;  3IRR A;  2KIM A;  4A5M A;  1F1Z A;  2VC0 A;  2XVC A;  2D1V A;  4HYE A;  5JVT A;  1W5S A;  4CZZ A;  4RAY A;  1EH8 A;  3LWF A;  4OU0 A;  2P5L C;  2FE3 A;  5AIQ A;  5BQT A;  2HS5 A;  3CUO A;  1IRG A;  1FWZ A;  1B1B A;  2VC1 A;  4OOI A;  4A6D A;  2A3S A;  5ILS A;  3S2W A;  1EV7 A;  2ISY A;  3F8F A;  2DTR A;  4YII A;  1BI0 A;  5JFR A;  3J81 K;  4EJU A;  3EDP A;  3SHF A;  3K1M A;  4HQM A;  1TNS A;  4WXH A;  2IPQ X;  3BRO A;  2Y75 A;  1GXQ A;  3SFZ A;  1OYW A;  3VOD A;  2O8X A;  1GVJ A;  5LGN A;  5HDK A;  4RB0 A;  2K7L A;  3LST A;  2PEX A;  3IWF A;  2CW0 F;  3MZY A;  4M6X A;  5TJJ A;  1QQI A;  1RUN A;  4B8X A;  4H0E A;  3P9K A;  3B02 A;  5HDG A;  2ETH A;  3HTU A;  4WXC A;  4F7Z A;  2HTJ A;  1XSD A;  3GFJ A;  3V7R A;  1ODD A;  3GYH X;  3C18 A;  3FXQ A;  3W6J B;  5HOO A;  1XMK A;  3ZPL A;  2FSW A;  5F1R A;  3F6V A;  2COM A;  3PQJ A;  2BGC A;  2GZW A;  4U7D A;  1IN7 A;  2YX7 A;  5K5Q A;  4RAZ A;  2M8E A;  5BMZ A;  4AVP A;  4KT5 C;  2V79 A;  2RV8 A;  2IT0 A;  3ULQ B;  1L3L A;  1HKS A;  2EFN A;  1XMA A;  4WF2 A;  3FF5 A;  1SAX A;  3HSF A;  1MDM B;  3DKW A;  3R0J A;  1FY7 A;  1BI3 A;  1G4D A;  3VEP A;  3ZMV A;  1ZLJ A;  4KIC A;  2HYG D;  4G7H F;  1UHW A;  2RNJ A;  2GXG A;  3F8N A;  3T5X A;  1EH6 A;  1ZHF A;  1REP C;  2QLZ A;  3FWE A;  3SQN A;  3WOD F;  3KEO A;  3BZ6 A;  3ZN0 A;  1KA8 A;  4XLP F;  3CTA A;  2Z3Y A;  2DFI A;  3KET A;  1U78 A;  4OIO F;  1OMI A;  3JTG A;  4LB5 A;  4OIR F;  1TLH B;  5D5W B;  2LSO A;  3TKY A;  1BBY A;  4I01 A;  4EV0 A;  3GFI A;  1T98 A;  3WGH A;  1XGO A;  1O57 A;  3HTS B;  2HEO A;  5IT9 K;  1U8R A;  3WTT C;  3Q9S A;  1ZGJ A;  2MLK A;  3L00 A;  1FX7 A;  2G7U A;  2DW4 A;  5LGU A;  3E97 A;  1HBX G;  2ZXJ A;  1BM9 A;  4M73 A;  4L9T A;  3RPQ A;  2OD5 A;  1B9N A;  3KP2 A;  2JRT A;  2FBH A;  2XRN A;  2XAJ A;  5J8F A;  5DCF A;  5BOX A;  1PP7 U;  1QZZ A;  2ZO4 A;  3N97 A;  2IW5 A;  3KP7 A;  5L3E A;  4EM2 A;  5FLX Z;  3ZN1 A;  5IT3 A;  1Z7U A;  2XV4 S;  1TTY A;  1KQ8 A;  3MZH A;  3TO9 A;  4FHT A;  5HS8 A;  2P4W A;  3DFG A;  2FBK A;  5FD6 A;  4IF4 A;  1T6S A;  4Q47 A;  1AOY A;  3QPT A;  4I2O A;  2EFO A;  1U5T C;  2GWR A;  4RB2 C;  1R1U A;  2ESH A;  3FZV A;  3BPX A;  1J9I A;  1Z6R A;  4UVA A;  4I09 A;  2QVO A;  3QAH A;  3VOE A;  2EB7 A;  3IC7 A;  1O7F A;  4RB1 A;  1YQA A;  4OIN F;  3TO7 A;  4LB6 B;  3CJN A;  2DU9 A;  1KGS A;  1JGS A;  2KIU A;  2EV6 A;  1KYZ A;  2HZT A;  2O61 A;  3IKV A;  2ACJ A;  1S7O A;  2E1C A;  2O6G E;  1E2X A;  1SD4 A;  3PFI A;  2E7W A;  4EM1 A;  2QQB A;  3U1D A;  4K2E A;  5E1W A;  5CVV A;  4U0W A;  3F22 A;  2W24 A;  2VON A;  4LLN A;  1QBJ A;  2F2E A;  2WC2 A;  2M30 A;  2QBY A;  1EH7 A;  5ERI A;  1SFU A;  1R00 A;  3P7N A;  4BAY A;  3ECO A;  4HLX A;  3V8K A;  2FXA A;  3T8R A;  4P96 A;  3C3W A;  2IP2 A;  2R7F A;  2VOO A;  1H9G A;  3B73 A;  1R5H A;  1O3R A;  4IHT A;  3FHZ A;  3SXY A;  3LA3 A;  1B59 A;  4CIC A;  4ESJ A;  4HW0 A;  1LEA A;  4BH9 A;  1R1V A;  4A0X A;  2RC4 A;  1P4W A;  5LEJ A;  2H09 A;  4M6Y A;  1KU9 A;  1YS6 A;  3REO A;  1UST A;  4M9Z A;  1OR7 A;  1IN6 A;  4IPA A;  3BJ6 A;  3MQ0 A;  1S8N A;  4A0Z A;  4G9Y A;  5F64 A;  2A6E F;  1FC3 A;  3V8J A;  1HW2 A;  2L54 A;  5LGT A;  1BOA A;  2BV6 A;  2VOD A;  4A6E A;  3GFM A;  4RGX A;  4KA4 A;  4U7B A;  4O6J A;  1RZ4 A;  4HA8 A;  1ZG3 A;  5LHH A;  1BIA A;  4E70 A;  1HSJ A;  4XRF A;  1ZYR F;  4R1H A;  3RYR A;  4S04 A;  4ZH4 F;  4LLG F;  5D4S A;  4NHJ A;  2E1N A;  2W85 A;  4L9J A;  2XAQ A;  4MEX F;  1A04 A;  1OKR A;  2P5V A;  4S05 A;  1S7A A;  1UHM A;  3KP4 A;  2UWM A;  3QRF F;  3C1D A;  2B0L A;  3HRT A;  3E3V A;  3J80 Z;  3SZT A;  2K86 A;  4HV6 A;  3WTZ A;  1STZ A;  4EMS A;  1ZRC A;  4MEY F;  1BJA A;  2XAF A;  2QM3 A;  2A5Y B;  4N0B A;  4LLL A;  2QBY B;  2GA1 A;  1ON1 A;  3FMR A;  5HLH A;  4MHG A;  2EA4 A;  3JAM Z;  3G3Z A;  5BPI A;  1S29 A;  5LLQ A;  1V3F A;  3CDH A;  1K6O A;  2C6Y A;  2IRF G;  3GFL A;  3COA C;  2QUF A;  1QPM A;  3FMS A;  4PGG A;  1B9M A;  3V4G A;  3FM5 A;  3WG9 A;  2F5D A;  3GX4 X;  2K02 A;  5AIP A;  3WTV C;  4Y15 A;  2CO5 A;  3DV8 A;  2DPD A;  1K7A A;  4CHU A;  3KLN A;  4HZF A;  3KEQ A;  3O3K A;  2CGP A;  4PCQ A;  4PGH A;  3CUQ C;  1P6R A;  4N9I A;  2OZU A;  2CFX A;  3RIR A;  4P9F A;  3RYP A;  1TW3 A;  3K0L A;  3W6K B;  2XKP A;  4ZZD A;  1V4R A;  3F72 A;  1RNL A;  3M8F A;  3TQN A;  1SFE A;  2HR3 A;  5HS7 A;  2KKO A;  1Z1D A;  5E18 F;  2HGC A;  4CO8 A;  1XGS A;  2LNB A;  4FX0 A;  3DXJ F;  3L2C A;  4EGY A;  4ESF A;  2QZ8 A;  2ZNY A;  3G73 A;  3E6D A;  2HOE A;  4KIB A;  2GAU A;  3IRQ A;  3BOQ A;  4HOB A;  3RDI A;  1LB2 A;  4AIJ A;  1SD7 A;  3LQQ A;  3T0Y A;  1FLI A;  2OAZ A;  3WGI A;  4WX9 A;  2KJC A;  5H6R A;  4CDG A;  5LBQ A;  2X0L A;  4KYW A;  2ZME A;  4EJO A;  1P2F A;  4QLC U;  2YU3 A;  3TO6 A;  4NQW A;  2HFH A;  1TW2 A;  3ISP A;  5FLX K;  4WXD A;  2RN7 A;  3KP6 A;  2IA1 A;  4HDU A;  4HDV A;  1MZB A;  4OMY A;  4R8H A;  3H3U A;  2V1U A;  4HX7 A;  2HDC A;  2VXZ A;  5CLS A;  2O03 A;  2GIV A;  1ZG1 A;  2V6C A;  1FBQ A;  1H0M A;  2EWN A;  2ZCW A;  1I6X A;  5D8L B;  2K27 A;  4ASN A;  1AWC A;  2A61 A;  3EUH A;  2MBF A;  2F5C A;  4GO1 A;  1XD7 A;  2JSC A;  5LHG A;  4ETS A;  5E8G A;  4UUV A;  1J59 A;  3GXO A;  1E17 A;  1U5T A;  3ELK A;  2Q0O A;  3ABT A;  2Q2E A;  2PG4 A;  1J5Y A;  3WU0 A;  1BN5 A;  2DBB A;  5D6E A;  3WTS C;  4GYI A;  4O5V A;  1LEB A;  4R79 A;  5E20 A;  5K1Y A;  5JI6 A;  1TQM A;  4CYD A;  2XRO A;  4CGZ A;  4P5O A;  3ZMZ A;  5HVQ C;  2D45 A;  3O6B B;  3ERE D;  3MWM A;  1ZRD A;  1IN4 A;  3R60 A;  2EA2 A;  3I0T A;  5A2Q Z;  3D0S A;  3O2P E;  3AAF A;  2QQA A;  1USS A;  1ZH5 A;  1BC8 C;  5HDN A;  2UZK A;  2H27 A;  2TDX A;  3HRS A;  1IW7 F;  2W84 A;  5CVJ A;  3ZMT A;  4LK0 F;  4HBL A;  1FP1 D;  3I54 A;  4U0V A;  2W57 A;  2FQ3 A;  3DPL C;  4WK8 F;  5CYV A;  2ZME B;  1TQI A;  1B6A A;  1FZP B;  4L18 B;  1K78 A;  2WWY A;  4UXN A;  4L0Y B;  3KE2 A;  3GVA A;  1LQ1 A;  3KFW X;  1ONV A;  3GW2 A;  3Q9V A;  1IF1 A;  3HIF A;  2P5K A;  1UCR A;  1YW7 A;  3WTW C;  1W4M A;  2FBI A;  1HST A;  1YTY A;  5ILV A;  4G94 A;  2H6B A;  2J5P A;  3KLO A;  2CSO A;  2V9V A;  3HHG A;  3BDD A;  3WTX C;  4CXF A;  3FX3 A;  1ON2 A;  3CO7 C;  2UXX A;  1LDJ A;  4QWQ A;  5JHU A;  2L02 A;  5CVI A;  1J2X A;  1YLF A;  2KRF A;  3FXR A;  3J81 Z;  3VFZ A;  3P9I A;  2ADU A;  1UFM A;  4I02 A;  4IRH A;  1R7J A;  4B09 A;  4XBF A;  1IRF A;  1K79 A;  3RI4 A;  4DQ2 A;  1YS7 A;  4BXU A;  3OV8 A;  2G7H A;  2GQQ A;  1FP2 A;  2QEN A;  3KP3 A;  5DCM A;  3BPV A;  5LRS A;  2LF8 A;  3WE2 A;  4KMF A;  1DPU A;  3NQO A;  2RDP A;  4RGU A;  2DPU A;  2ZBK A;  4KDP A;  2D2W A;  5E1Z B;  5LHI A;  3ZP5 A;  3M7G A;  1XDU A;  3F3X A;  2ZFW A;  4YFX F;  2YSR A;  2LKP A;  2LF7 A;  3CO6 C;  3ZMU A;  1D8K A;  2FF4 A;  2FRH A;  4FX4 A;  4KIG A;  3HSE A;  2NS0 A;  3GEZ A;  4IJA A;  2GXB A;  4HAM A;  2H94 A;  1R5G A;  5BS6 A;  5ICF A;  1SFX A;  3N4M A;  5TRD A;  5J6X A;  3ROU A;  5CJ9 A;  4N9H A;  3V8L A;  2FNA A;  1XB4 A;  3GUD A;  1SD5 A;  3KCC A;  1KU2 A;  4LGW A;  4ENM A;  3JW4 A;  2P6T A;  1FYK A;  1OYY A;  3C7J A;  4MNU A;  1J75 A;  3GLX A;  2DLL A;  2M45 A;  2L4M A;  3LA7 A;  5FFX A;  1ZAR A;  3F23 A;  3CUQ A;  3RKY A;  4ZYG A;  5FB2 A;  1IZ1 A;  3NRV A;  1CGP A;  4OIP F;  1T0F A;  2HQR A;  3OOP A;  4G6D A;  3HYI A;  1TQP A;  2RKH A;  4MQV A;  2FML A;  2WTE A;  1XSX A;  1HQC A;  2DK8 A;  1O3T A;  5D6F A;  1D8J A;  1FYL A;  4RS8 A;  1OPC A;  4JK1 X;  1Z6T A;  3KP5 A;  2EV0 A;  2PBI A;  3U9G A;  5DV5 A;  1XGN A;  3E5Q A;  4HQE A;  3ECH A;  3I71 A;  2HWV A;  5HLG A;  1LVA A;  1KU7 A;  5FFZ A;  2JPB A;  1T2K A;  2RGV A;  4DNC A;  1ULY A;  2Q8K A;  1H9T A;  1JHF A;  5DCM B;  3HUG A;  5D5U B;  3WU1 B;  3ABU A;  4YFN F;  1DUX C;  1LDD A;  5LRR A;  4G6Q A;  4WCG A;  4LFU A;  2YPR A;  3Q5F A;  3R6S A;  3I4P A;  1ZRE A;  2H6C A;  4ENK A;  5FD5 A;  3ZMS A;  1SD6 A;  1LNW A;  2CG4 A;  3IHU A;  1YW8 A;  1B4A A;  4XSZ F;  3K1N A;  5FO5 A;  2STW A;  3I5U A;  4M72 A;  3QU3 A;  6PAX A;  4Q4Z F;  4EQQ A;  5K5O A;  4U88 A;  4LD5 A;  5H20 A;  2JTV A;  1U2W A;  3WTY C;  2K4J A;  4UHT A;  1ZAO A;  3BJA A;  2PN6 A;  1JXS A;  2VE8 A;  2IJL A;  1ZGA A;  1BI1 A;  4AD9 A;  1MJ9 A;  3DF8 A;  1KQ9 A;  1Q1H A;  2P8T A;  2QQ9 A;  2OQG A;  3H3Z A;  3V7S A;  1I5Z A;  2O0Y A;  4LMY A;  2G9W A;  2ZJ2 A;  4BNC A;  5K5R A;  3CUQ B;  5KVR A;  4KN4 X;  2L4A A;  2P7C B;  1XDS A;  5A2Q K;  3RPU A;  3QOP A;  5D8K B;  1CF7 A;  3L9F A;  3JSP A;  2OA4 A;  4ENJ A;  5ICC A;  4KN7 X;  4G7O F;  2F5E A;  4ZYH A;  1WI9 A;  1VTN C;  3BY6 A;  2E7X A;  2XHK A;  4GCV A;  2CQK A;  5J8C A;  1LJ9 A;  4FT8 A;  3EET A; 
#chains in the Genus database with same CATH topology
 3LL7 A;  3CQZ J;  3K7A J;  4QPQ A;  4C3H J;  4Y33 A;  1BL0 A;  1Z05 A;  3U2R A;  5JLW A;  4WWC A;  1MDM A;  1JKO C;  1C0W A;  5GPA A;  5J4V A;  4I98 B;  3ZQ7 A;  1D5V A;  4HLY A;  4GXO A;  2CWE A;  2Y0S A;  2VN2 A;  2X1C A;  1DDN A;  3TOA A;  1KU3 A;  1WRJ A;  2WA0 A;  5F6F A;  4ZJZ A;  4IOC F;  1MBK A;  3H92 A;  1G3W A;  2MA3 A;  3EQL F;  1YX5 A;  2AS5 F;  1OQY A;  1IXR C;  1V5F A;  2NAZ A;  1VQL I;  5AON A;  1R58 A;  2DJN A;  1VFC A;  1Y1W J;  4Z6Y A;  2UXN A;  4DIQ A;  2X1E A;  1PUE E;  2FUG 2;  1FYM A;  1FSH A;  2M2E A;  2F5F A;  2J5O A;  3L1P A;  4BQA A;  1W5T A;  3PUF A;  1YG2 A;  1X3U A;  1MW7 A;  2ZKZ A;  1POG A;  2IA2 A;  3A01 B;  3TMO A;  4LJZ F;  2PFB A;  4XNF A;  1S3J A;  1A6Q A;  5ICE A;  5ICG A;  2MH9 A;  1I1G A;  2EQR A;  4XLF A;  2M87 A;  2VAS A;  2DOE A;  3LA2 A;  4ON0 A;  1HC8 A;  4HV5 A;  2P81 A;  4I0A A;  5EYR A;  4BQO A;  4KT6 A;  2OUM A;  1OCZ H;  2YX4 A;  3D5L A;  5D4R A;  5B1B H;  2PI0 A;  1GXP A;  3GCM A;  2JZY A;  2KIF A;  1LPQ A;  2X6O A;  4BE0 A;  1MSF C;  4ZZL A;  3DWL E;  4XR6 A;  1MGT A;  1RRJ A;  2XF5 A;  1WKM A;  2RRE A;  1U9O A;  3QYE A;  2VT3 A;  3PO3 J;  1ZG5 A;  1FT9 A;  4BU2 A;  2P6S A;  1I3Q J;  3K2Z A;  4CZC A;  3G1O A;  3ESW B;  3IL2 A;  4CCJ A;  3L2R A;  1R5I D;  2LH9 A;  2Z99 A;  2K9L A;  2M8G X;  4D7M A;  1F4K A;  5DD8 A;  2Z9O A;  3LFK A;  2EFQ A;  1P4X A;  2MH2 A;  2XAU A;  3LQR A;  1BC7 C;  3BR1 A;  4ENN A;  2EH3 A;  1RIO H;  2VBX A;  2PX9 A;  3TP0 A;  3QU6 A;  2RQQ A;  4HX4 A;  2XAS A;  4PUS A;  4UVC A;  3AG3 H;  2UUZ A;  4YEJ A;  2VQC A;  5IP6 A;  2OU2 A;  2LY1 A;  3M9A A;  2VBY A;  2L3D A;  1JE8 A;  4P55 A;  5KCM A;  4HF2 A;  2JK3 A;  2ZB9 A;  1L0O C;  4B47 A;  4XID A;  1WJC A;  4Y13 A;  4XSX F;  5BNG A;  4TV7 A;  3RQI A;  2VT2 A;  3L2U A;  1X58 A;  1JHH A;  1Z77 A;  2Z33 A;  1K4S A;  3P5J A;  4PFO A;  1FEX A;  1YW9 A;  1D1B A;  1YRN B;  4CSW A;  2R7X A;  2F48 A;  3K9T A;  3ZMD A;  1LFU P;  1XSV A;  5H6Q A;  1B8I B;  2HTS A;  3IAM 2;  2RVC A;  3SDG A;  1IDZ A;  2LDU A;  1W7P D;  1OJL A;  2DFE A;  1IC8 A;  3RKW A;  3MKL A;  3CC7 I;  5DUK A;  2ZJR F;  3DP7 A;  4ZYD A;  1CF7 B;  1SFK A;  3CCU I;  1EJ9 A;  4IHS A;  1QZY A;  3H5A A;  2A07 F;  4C30 A;  3TGN A;  1D5Y A;  1HKQ A;  5F0H A;  2CH0 A;  2LRD A;  3F8M A;  1NG6 A;  2ZXH A;  2VXD A;  2EJR A;  4G6T B;  1Y6I A;  2MG4 A;  1MJB A;  2CJJ A;  5C4J J;  2BBY A;  2HU9 A;  4OIQ F;  2OBP A;  2E2I J;  4DBQ A;  2PLY A;  3I9V 2;  5IOY A;  2CW8 A;  4RGR A;  2L7M P;  4MGR A;  1WSU A;  3H5N A;  3KEY A;  3BG3 A;  4NB5 A;  1RR7 A;  2FEZ A;  1VZ0 A;  2PMH A;  5GTH C;  3RKQ A;  4E7L A;  4V2F A;  2DMT A;  2XPU A;  5M5X J;  1OYI A;  2HDD A;  4JBA A;  2DJI A;  4HF1 A;  4N4O B;  2XAH A;  1ETW A;  3EYY A;  2HOT A;  1QGP A;  4A0Y A;  2CYY A;  3PSI A;  2JT1 A;  3RKX A;  3HRM A;  2VJJ A;  3RTR A;  1MJA A;  4UUT A;  2X6W A;  2HXI A;  1R22 A;  2GIZ A;  4EJW A;  4O3M A;  4UY8 I;  3LSJ A;  4Z2Y A;  4U0Y A;  1ETV A;  3CC2 I;  1FNN A;  4P9U A;  2M1B A;  2R7O A;  2XPW A;  2VPL A;  3CF5 F;  4Q48 A;  3DTK A;  1BR1 A;  1DGR M;  3BWG A;  4I7H A;  2JVH A;  3GTP J;  2ZNZ A;  2ELH A;  1Y8Q B;  2L5Q A;  2M5W A;  4HNT A;  1F5T A;  1J7K A;  3HHH A;  1X1D A;  1JJ6 C;  2Y0M A;  4GYG A;  5B66 C;  1MBF A;  1OFC X;  2V1D A;  1HW1 A;  2V1X A;  4KUM A;  3V7C A;  1G6N A;  2QWW A;  5LEK A;  5FGM A;  2Y48 A;  1YO5 C;  1BIB A;  3M1C A;  4XOP A;  5E17 F;  4ZYE A;  1D3Y A;  4U87 A;  1W5C C;  4DZJ A;  4KIF A;  1IN5 A;  4JX6 A;  4A5N A;  5EEG A;  2ZJQ F;  1MKM A;  2W25 A;  1XMX A;  4IRG A;  3WTU C;  4C2U A;  4LIV A;  3JSO A;  1P4A A;  3SJM A;  5E8I A;  4BBR J;  1PDN C;  4NBQ A;  4NNJ A;  3OYD A;  4A3D J;  3GO5 A;  4ZTF A;  3JTH A;  2A69 F;  3I53 A;  1JKQ C;  3LSI A;  3DBH B;  2EK5 A;  3EUA A;  4BXF A;  3HOS A;  1FSE A;  4XL9 A;  2DT7 B;  2HZD A;  5HOD A;  2A6H F;  4D9J A;  1DP7 P;  1T39 A;  1IRX A;  3CDI A;  2STT A;  1WQ2 A;  2QSF X;  2UV1 A;  4MQ9 F;  2EFP A;  2BY1 A;  1RI7 A;  4HST A;  3A03 A;  2M7A A;  3K70 C;  1LUJ B;  5HS9 A;  2GXA A;  2OZ6 A;  4Q5S F;  2BE5 F;  2BW3 A;  3TW6 A;  4PSX A;  3E6M A;  4BHC A;  3BZC A;  3HXL A;  5J4Y A;  1XCB A;  3TED A;  5DEQ A;  3O8G A;  1R23 A;  2A68 F;  4L9N A;  3CCJ I;  3EYI A;  2CRG A;  1MNE A;  1IO2 A;  2BOL A;  2ESN A;  4JYK A;  2ZFU A;  4BHP A;  4HF0 A;  3GTQ J;  3T8T A;  1NHA A;  3F9K A;  2IA0 A;  3A0H C;  3S1N J;  1U5T B;  4YIR X;  1GHC A;  3WU2 C;  2Q2E B;  5IP7 J;  3OYC A;  2ME0 A;  3S17 J;  3JRA A;  4CCK A;  1HW5 A;  3QOE A;  4XLN F;  4C2M J;  5L3G A;  3GZ5 A;  5JR3 A;  1GVD A;  1G3Y A;  4DYC A;  2DI3 A;  4PJL A;  4EJT A;  3L7W A;  4IRI A;  1W7P A;  3CMA I;  1OCT C;  5E1X A;  1UB9 A;  3FM3 A;  4LG0 A;  3CDL A;  3GF2 A;  2EFW A;  3J80 K;  2JSP A;  2NOJ B;  5EF6 A;  1LDK B;  3QQA A;  3LAP A;  1W36 C;  3ZQF A;  4EM0 B;  3MCZ A;  3TOB A;  3LSP A;  2DO7 A;  3GWZ A;  3S3M A;  1IXC A;  1SMY F;  2VPR A;  5ED4 A;  4AM3 A;  2V7F A;  1J0R A;  4KMU X;  2AXT C;  2HKO A;  4BJT A;  4AIH A;  2E5Z A;  3JAM K;  1PUF A;  5D5V B;  2R3S A;  2X4H A;  3Q0U A;  5HLI A;  2NYX A;  3FXO A;  4C3I J;  4M71 A;  2E1O A;  3SZP A;  2DQR A;  3VPR A;  1FBU A;  1WWX A;  4XLH A;  5IOZ A;  4RGS A;  1T56 A;  4II2 A;  3G2B A;  4IXA A;  2RQP A;  4IZZ A;  2LTP A;  2M0C A;  1NK2 P;  2ZXW H;  2GA2 A;  3S3N A;  3DKX A;  1UG2 A;  1TP4 A;  3WGG A;  3ZXS A;  3NEU A;  2E5N A;  1JUS A;  3R61 A;  4G7Z F;  2AXL A;  4UNO A;  2MW8 A;  1S6L A;  5CQG A;  2XUB A;  1DPR A;  1Z91 A;  4LIU A;  3CCQ I;  4A3E J;  2Z5U A;  3TDZ C;  1GDT A;  2TCT A;  2QQ8 A;  2DK5 A;  4I99 C;  4CYC A;  2HKX A;  2VBZ A;  3G1M A;  4AU7 A;  3I58 A;  3FBN B;  1K78 B;  1R1T A;  5L3F A;  3LSH A;  3WHB A;  1VF9 A;  4YG2 F;  1QO0 D;  1KQ0 A;  3R4K A;  4UV8 A;  3AG4 H;  3PQK A;  3PNY A;  2MD5 A;  2LY9 A;  1AA7 A;  3F6O A;  2V4J C;  1XN7 A;  4JQF A;  3M8E A;  1G3S A;  1JTY A;  4X1E A;  4LK1 F;  3TDU C;  3I59 A;  2CUE A;  4HX8 A;  4AWX B;  5DUI A;  1TWA J;  3C2H A;  1T38 A;  4A3L J;  3MAJ A;  2KRH A;  3BJO A;  4YIF A;  1MSE C;  3BQY A;  2DFF A;  2DYR H;  1IG7 A;  2P7V B;  4PZJ A;  3E5U A;  5J1Y A;  1VQ9 I;  2EV5 A;  2XIG A;  3FXJ A;  2DA6 A;  3GTK J;  2FNP A;  4MTD A;  5KK1 A;  4B3X A;  5EGO B;  3OSG A;  4BJ6 C;  3HSR A;  1D0Y A;  2QYO A;  2QKL B;  3FMQ A;  5L3D A;  3QP6 A;  4JP0 A;  4ZDP A;  1FBS A;  4B43 A;  4XM3 A;  4B44 A;  1HKT A;  4D0P A;  2XRL A;  1ZTR A;  1IXS B;  3MEX A;  2MLG A;  1YJ9 I;  1XTA A;  2PQ8 A;  4IVN A;  1UMQ A;  2R7W A;  2B7E A;  1O3Q A;  2DOA A;  1R36 A;  5IT9 Z;  3CJR B;  2BW3 B;  2EIN H;  2I10 A;  1YJN I;  1YIJ I;  1QA6 A;  3S1Q J;  4M9X A;  4G8X A;  1TNT A;  2TRT A;  3M1E A;  4PDK A;  3MKZ A;  1LKX A;  1AKH A;  3HOV J;  1BI2 A;  1O3S A;  3KZY A;  3L09 A;  1U3E M;  3H0G J;  1MBG A;  1F9N A;  1Y0U A;  5F0C A;  5K7H A;  4MTE A;  2NNN A;  1QVU A;  5BPD A;  2JPC A;  1XPX A;  1WH7 A;  2WAE A;  2KHM A;  4OWR B;  3PJR A;  2NVT J;  1GT0 C;  5DYM A;  1XG1 A;  2IGO A;  4RB3 C;  4L5I A;  3IWZ A;  2QF7 A;  2XSJ C;  2FMY A;  2XGX A;  2V9P A;  2VE9 A;  2LMD A;  4UV9 A;  1S9H A;  3P9C A;  4Y17 A;  4BYY A;  3FXU A;  2ISZ A;  5J1U A;  3HGG A;  1D1C A;  2BYV E;  1I1S A;  1W7P B;  4LG0 B;  3E6B A;  3FBI B;  1OCR H;  1P92 A;  4MFD A;  3I3L A;  3DPU A;  3SEZ A;  2IVM A;  2MYS A;  5CVU A;  3DQV C;  1FOK A;  2W00 A;  2ZC2 A;  2R5Y A;  2KIS A;  2NVQ J;  4L9V A;  2O3F A;  2VOP A;  2K3P A;  2DT5 A;  2DQL A;  2XAG A;  4KNY A;  1Z0X A;  3LMM A;  3ZQG A;  2KIQ A;  3CJQ B;  1Z67 A;  2LVS A;  1DGW Y;  2EIL H;  5B3S H;  3E5X A;  1SVL A;  3GZ6 A;  4M3B A;  2CU7 A;  2F4M B;  2K5C A;  1R71 A;  3ABL H;  3I64 A;  1OCC H;  2VKE A;  4M9S A;  4RMN A;  3CLO A;  1XGM A;  4JX5 A;  1TBX A;  2RAE A;  2OQR A;  1IAW A;  3CF2 A;  2M34 A;  1V54 H;  5EEH A;  5EG0 A;  3ZOB A;  5L3B A;  1VQO I;  4ESB A;  1WJF A;  2K9N A;  3BP8 A;  1ENH A;  3K1P A;  1RUO A;  3F8C A;  1ZLK A;  3DTI A;  5FKO A;  1E3O C;  1YJW I;  2EPF A;  4UB8 C;  1JUP A;  1SAN A;  2D1H A;  5LFA A;  3F8B A;  2NNY A;  3DPT A;  5CVR A;  5E3O A;  3VYS B;  1MMD A;  4OMZ A;  1YYV A;  3QYF A;  3MKY B;  3VWB A;  1QVT A;  2HQN A;  3WE3 A;  4A12 A;  1IGN A;  1IUY A;  3E1S A;  2R7S A;  2PMU A;  2XKO A;  3PIO F;  2K4B A;  2DAO A;  2MSY A;  1Y1V J;  3HRU A;  2XF6 A;  4BY7 J;  4AIK A;  4EVI A;  1G8X A;  1R6R A;  1WGX A;  1ZN2 A;  3K69 A;  4XQF A;  5C44 J;  3K70 D;  4BBS J;  3KZZ A;  5E3L A;  1QNT A;  2VBW A;  2YS9 A;  3BZK A;  5DDG A;  5ILU A;  1PP8 F;  1LE8 A;  1RES A;  2ID3 A;  2NRA C;  1ITY A;  2FU4 A;  4BQQ A;  1MBJ A;  3KIO A;  4BAC A;  3HKZ N;  5L3C A;  1XCV A;  2YR2 A;  3LAJ A;  1V5G A;  4L5J A;  3HOT A;  2PJP A;  2VQG A;  2FOK A;  3R0A A;  3F21 A;  3ASO H;  4CCL A;  2BEO A;  3I59 B;  1G3T A;  5FKK A;  3J7A O;  1DP3 A;  3QP5 A;  3HPG A;  3G4S I;  3RJP A;  4RAG A;  3M07 A;  4PJN A;  4L0Z B;  1IN8 A;  4YFK F;  3MFK A;  3U21 A;  3DEU A;  5DD4 A;  4BE2 A;  2R7D A;  1HXD A;  3AKZ A;  3ML6 A;  4UVB A;  3T1B A;  2I5U A;  1PYV A;  4I0B A;  1FTT A;  4EGZ A;  2FA5 A;  2VLA A;  2IEK A;  3JRH A;  3E6C C;  4EJV A;  5DS9 A;  2EZK A;  4KFC A;  1I27 A;  1W36 D;  1EF4 A;  1ETO A;  4E7I A;  4FE4 A;  2WV0 A;  1U6G A;  2DDB A;  3Q0V A;  2HYF A;  3OL3 A;  3OS0 A;  1Z9C A;  4BHB A;  2CUZ A;  1MD0 A;  2L9S A;  1K4T A;  3S8P A;  2DTZ A;  4BL0 B;  1O7L A;  3HG9 A;  3I55 I;  4V19 K;  3W2W A;  2LR8 A;  3VB2 A;  3HOU J;  1P7I A;  3PNV A;  1YIO A;  3ASN H;  3VYR B;  5EEA A;  1X3Z B;  4A2U A;  3JRF A;  2QA4 I;  1AKH B;  3S16 J;  4GGG A;  4DJA A;  3QYB A;  2MC3 A;  1J09 A;  3QPH A;  2R7Z J;  5D5X B;  2VKD A;  4B3A A;  1MMA A;  4M74 A;  1ZRF A;  3IKT A;  2KJB A;  2CUF A;  1OR7 C;  1FPQ A;  1KYW A;  1SMT A;  2L01 A;  3BR6 A;  3H9J A;  1Z21 A;  3IRR A;  2KIM A;  1YFH A;  4A5M A;  5J3L A;  4M3G A;  2L7F P;  4ITV A;  1F1Z A;  1S5L C;  3A1Y A;  2VC0 A;  1IDY A;  1R49 A;  2XVC A;  5IYB J;  2D1V A;  4HYE A;  5K7F A;  3OMY A;  5JVT A;  1W5S A;  4CZZ A;  4RAY A;  1EH8 A;  2CQX A;  3LWF A;  3HUG B;  1U8B A;  4OU0 A;  2P5L C;  2JN6 A;  2FE3 A;  2R5Y B;  3W2A A;  5FLV A;  2HYJ A;  3IAS 2;  3KYC B;  5AIQ A;  5BQT A;  3CLQ A;  2HS5 A;  3CUO A;  2ZSH B;  2BXY A;  2QSG X;  1IRG A;  1JI8 A;  5JLX A;  1FWZ A;  1G2H A;  4BE1 A;  1K61 A;  1B1B A;  2VC1 A;  2ELJ A;  4OOI A;  4J00 A;  1VQ8 I;  5LD2 C;  2VB6 A;  4A6D A;  2L0K A;  2A3S A;  5ILS A;  1A36 A;  3S2W A;  1EV7 A;  2NVX J;  2CQ7 A;  2ISY A;  2K40 A;  3F8F A;  4QIW N;  2DTR A;  4YII A;  1BI0 A;  1VND A;  5JFR A;  3ZR8 X;  4E4H A;  3FK6 A;  2XC7 A;  5EG0 B;  2E36 A;  1X2M A;  2XGD A;  3K10 A;  3BCB A;  2KT0 A;  5F04 A;  3J81 K;  3MZ8 A;  1TT5 B;  4EJU A;  2IXS A;  2G0E A;  3EDP A;  3SHF A;  2K85 A;  3J7A Y;  4IO9 F;  5C3E J;  3K1M A;  3NWS A;  2Y69 H;  3K6G A;  4HQM A;  2R7V A;  4QPO A;  1TNS A;  5DM7 F;  4WXH A;  2IPQ X;  2A5W A;  3BRO A;  2Y75 A;  5HNH A;  1GXQ A;  2I8D A;  3OYL A;  3SFZ A;  1UHS A;  1OYW A;  4XKW A;  3VOD A;  3DCF A;  2O8X A;  2H8R A;  1GVJ A;  3K4B A;  4NC7 A;  4IL6 C;  3HJE A;  3MMY B;  5LGN A;  5HDK A;  4RB0 A;  1AU7 A;  4ABZ A;  2IGN A;  2K7L A;  1LE8 B;  3LST A;  3K4J A;  3OYB A;  2PEX A;  3UKG A;  3IWF A;  1IRZ A;  2A6T A;  3OIP A;  5FRM A;  2CW0 F;  2ICW G;  1WFX A;  4B1R A;  2E1M C;  1ZKG A;  3MZY A;  2LBF A;  4M6X A;  1QHH D;  5TJJ A;  3ZCO A;  1QQI A;  1RUN A;  4B8X A;  1X1C A;  4H0E A;  2R5Z A;  1SEU A;  3P9K A;  3B02 A;  1GUU A;  5HDG A;  2ETH A;  3HTU A;  4E7S A;  4WXC A;  4F7Z A;  3X2Q H;  3OS1 A;  2HTJ A;  2M0M A;  1WI3 A;  4E7J A;  1XSD A;  2BY0 A;  1R9T J;  3GFJ A;  3V7R A;  1ODD A;  3BG6 A;  2X48 A;  3GYH X;  1QHG A;  3C18 A;  3FXQ A;  3W6J B;  5HOO A;  1XMK A;  2VKV A;  3ZPL A;  2FSW A;  5F1R A;  3F6V A;  4UUS A;  1X4O A;  2COM A;  3PQJ A;  2QSH X;  2BGC A;  2BY2 A;  2GZW A;  2O7O A;  3IH4 A;  1X1B A;  4Y7N J;  4U7D A;  1IN7 A;  2YX7 A;  5K5Q A;  3ABM H;  2BHZ A;  2CMP A;  2M8E A;  3KZI C;  4RAZ A;  4HRI A;  5BMZ A;  1S7E A;  2LRE A;  4KT5 C;  4AVP A;  3K4C A;  2V79 A;  2RV8 A;  2IAI A;  2ZJP F;  2IT0 A;  3S1M J;  3ULQ B;  1L3L A;  4RLF A;  1HKS A;  2EFN A;  3OL4 A;  3GTM J;  1XMA A;  3KYD B;  4XOR A;  4WF2 A;  3FF5 A;  1VQ7 I;  3RQ4 A;  1SAX A;  2IS6 A;  3HSF A;  1MDM B;  1VQ4 I;  2VI6 A;  4XKB A;  2H1K A;  2HVR A;  1NTC A;  3DKW A;  3R0J A;  4BDZ A;  1FOW A;  1FY7 A;  1BI3 A;  3B6C A;  2K9M A;  3GZN B;  1G4D A;  2WAD A;  3VEP A;  3ZMV A;  1X4P A;  1ZLJ A;  3K4K A;  4KIC A;  1I39 A;  5EZG A;  4GRI A;  2OV7 A;  2HYG D;  4G7H F;  1UHW A;  2RNJ A;  2GXG A;  4IEJ A;  1OCP A;  3F8N A;  3T5X A;  2JWT A;  1EH6 A;  1ZHF A;  2DN0 A;  3ZQL A;  1REP C;  2QLZ A;  3FWE A;  3SQN A;  1BW6 A;  3WOD F;  3KEO A;  2X51 A;  4A3M J;  3WHC A;  3BZ6 A;  3ZN0 A;  4W1U A;  2WB1 A;  4KIT B;  1KA8 A;  3ABK H;  4XLP F;  3CTA A;  2Z3Y A;  1Z3X A;  2DFI A;  2Z2S B;  1JUM A;  2IS4 A;  1VQM I;  3KET A;  1U78 A;  2EIM H;  3H5R A;  3F0C A;  1MBH A;  4OIO F;  1OCO H;  3ZQQ A;  2CS3 A;  1OMI A;  4FAS D;  3JTG A;  3G6E I;  4LB5 A;  4OIR F;  1TLH B;  4Y4R A;  5D5W B;  2LSO A;  3TKY A;  3IV5 A;  1BBY A;  5E3M A;  4I01 A;  2ZME C;  4EV0 A;  3GFI A;  3MN2 A;  5CPR B;  1T98 A;  3WGH A;  1XGO A;  1O57 A;  1R4M B;  4IHW A;  3HTS B;  2HEO A;  4XN0 A;  3IUO A;  5IT9 K;  5FKM A;  3GTL J;  4YRV A;  2WB1 N;  1U8R A;  3JRI A;  2DDA A;  2HVS A;  3WTT C;  2R92 J;  3Q9S A;  1ZGJ A;  2MLK A;  3L00 A;  1FX7 A;  1ETX A;  2G7U A;  5IP9 J;  2DW4 A;  1JJ8 C;  5LGU A;  1T08 B;  3E97 A;  5DTD A;  1HBX G;  2ZXJ A;  1BM9 A;  4M73 A;  4OAY A;  4B48 A;  1LVK A;  4L9T A;  3RPQ A;  2HVQ A;  2OD5 A;  4ZC3 A;  5FKL A;  1UZC A;  1B9N A;  2HNH A;  3KP2 A;  3HOX J;  1LFB A;  2JRT A;  4BS9 A;  2FBH A;  2KRC A;  1AHD P;  2XRN A;  2XAJ A;  1PJR A;  3U1K A;  5J8F A;  1GV5 A;  5DCF A;  1DU6 A;  5BOX A;  1PP7 U;  1UG0 A;  3G1L A;  1QZZ A;  3PL8 A;  5CKT A;  2ZO4 A;  1TZL A;  2CV0 A;  3HPH A;  3OWT A;  3N97 A;  2IW5 A;  3KP7 A;  5L3E A;  2LBF B;  2MD0 A;  4EM2 A;  5FLX Z;  3ZN1 A;  3HDD A;  5IT3 A;  1Z7U A;  3JRE A;  2R5Z B;  2XV4 S;  4XMY A;  3UNG C;  3L2W A;  3EUH C;  1TTY A;  1KQ8 A;  3MZH A;  4PJM A;  1QPI A;  3TO9 A;  4FHT A;  4L5E A;  5HS8 A;  2P4W A;  1N75 A;  2WAF A;  4FE7 A;  3DFG A;  2FBK A;  4OAZ A;  5FD6 A;  3HC7 A;  1NK3 P;  4IF4 A;  1QRY A;  3BR0 A;  1T6S A;  4Q47 A;  1G59 A;  1FIP A;  5J1R A;  3HL2 A;  1MNM C;  2EZI A;  3QPT A;  1AOY A;  4I2O A;  2EFO A;  4CA0 A;  1U5T C;  2GWR A;  1IJW C;  4RB2 C;  1R1U A;  2ESH A;  4CCN A;  3FZV A;  3BPX A;  1J9I A;  1Z6R A;  4UVA A;  4I09 A;  2KDO A;  2QVO A;  4LOC A;  3QAH A;  1F36 A;  3VOE A;  2EB7 A;  3IC7 A;  3IH3 A;  4Y52 J;  1O7F A;  5H2F C;  1MMS A;  4RB1 A;  1YQA A;  4OIN F;  3TO7 A;  4D7N A;  4LB6 B;  2O8K A;  3CJN A;  1BJZ A;  2DU9 A;  2XPV A;  2JA7 J;  1KGS A;  3UR3 C;  3B6A A;  4DBR A;  3PIP F;  5JVG F;  5IPA A;  1JGS A;  2KIU A;  2EV6 A;  1MH3 A;  3BQZ A;  1KYZ A;  2X6Y A;  2HZT A;  5KAF C;  2F6C A;  3IKV A;  3QPS A;  2V9K A;  2ACJ A;  2O61 A;  4ANJ A;  1XC5 A;  1S7O A;  2E1C A;  4XKC A;  2O6G E;  1E2X A;  1SD4 A;  3PFI A;  2E7W A;  4EM1 A;  2HXO A;  5EJC A;  2QQB A;  3U1D A;  1X1P A;  4K2E A;  3CD6 I;  3ZRG A;  2HQA A;  2A05 A;  5E1W A;  5CVV A;  1FMW A;  3ERM A;  3S3O A;  2ID6 A;  3JRC A;  4U0W A;  3F22 A;  3D5S C;  5IY5 H;  3OYG A;  2W24 A;  2VON A;  2K3F A;  4LLN A;  2Z1D A;  1QBJ A;  2K9Q A;  2M9H A;  3FXL A;  2F2E A;  4DW6 A;  5GP9 A;  2WC2 A;  2WBM A;  2M30 A;  3LSR A;  2QBY A;  2BVM A;  1EH7 A;  5ERI A;  5EZH A;  1SFU A;  4IHX A;  1ZGW A;  2LFB A;  2HQ5 A;  1WCM J;  1ETQ A;  1R00 A;  2XGC A;  2X6X A;  5EDN A;  3OS2 A;  3P7N A;  3BTJ A;  4BAY A;  3ECO A;  3HBL A;  3K4L A;  4HLX A;  3O8H A;  3GBG A;  1UAA A;  2BZT A;  1Q1V A;  3V8K A;  2FXA A;  3T8R A;  4XLC A;  1SFO J;  3AL0 C;  4P96 A;  1JKR C;  4B4C A;  3BR5 A;  3C3W A;  4ZTJ A;  2QKM B;  2IP2 A;  2R7F A;  2DMP A;  3ZGK A;  1A35 A;  2VOO A;  1H9G A;  2DMQ A;  3B73 A;  1R5H A;  1Y56 A;  1ZQ3 P;  2VQH A;  1O3R A;  4NUB A;  1T95 A;  4IHT A;  3FHZ A;  3SXY A;  3LA3 A;  2ECB A;  1B59 A;  4CIC A;  4M6V A;  2YUS A;  4RDU A;  4ESJ A;  4HW0 A;  1LEA A;  4BH9 A;  2DMU A;  4W97 A;  1R1V A;  4A0X A;  2QEX I;  3M4O J;  3W3C A;  2RC4 A;  4A3B J;  1P4W A;  2ELK A;  5LEJ A;  3ZQC A;  2H09 A;  4M6Y A;  3S15 J;  1KU9 A;  1YS6 A;  3REO A;  3GTG J;  3FXM A;  4FQG A;  3SDB A;  1UST A;  4M9Z A;  3K2A A;  4BEH A;  4I6Z A;  2R7R A;  1OR7 A;  3N05 A;  3CJT B;  1RC9 A;  3SZG A;  2LD5 A;  1IN6 A;  4XRS A;  2E2H J;  2BY3 A;  1X1A A;  2K9S A;  4HSR A;  4IPA A;  3BJ6 A;  3MQ0 A;  2LY2 A;  1S8N A;  2QGU A;  4A0Z A;  1OIS A;  2HOS A;  5F08 A;  2DT6 A;  2E34 A;  4G9Y A;  2DOD A;  5F64 A;  5C4X J;  2A6E F;  1FC3 A;  3V8J A;  3S2D J;  1HW2 A;  2L54 A;  2OPT A;  3NWT A;  5LGT A;  1BOA A;  2JA8 J;  5HLT A;  2BV6 A;  1PUF B;  2D5V A;  1FOX A;  4XN3 A;  2VOD A;  5FJ8 J;  4A6E A;  3GFM A;  4UB6 C;  4RGX A;  4KA4 A;  4U7B A;  3CCS I;  4O6J A;  1RZ4 A;  4HA8 A;  1ZG3 A;  5LHH A;  1BIA A;  4E70 A;  1HSJ A;  4XRF A;  2VKH A;  1SVM A;  3PSF A;  3C2G A;  1MIJ A;  1WH5 A;  1ZYR F;  2JRM A;  3HKZ A;  4V2G A;  1GV2 A;  4R1H A;  3RYR A;  4S04 A;  4HPQ A;  4ZH4 F;  4LLG F;  3MKW B;  5D4S A;  3OR2 C;  4NHJ A;  4XON A;  1E3H A;  2CV2 A;  2E1N A;  3CCR I;  2W85 A;  2Y30 A;  2AO9 A;  4L9J A;  2XAQ A;  2E2J J;  3BC8 A;  4MEX F;  1A04 A;  1OKR A;  2P5V A;  4S05 A;  1ZEL A;  4J01 A;  1S7A A;  1UHM A;  1V5E A;  3KP4 A;  2Y9Z A;  2UWM A;  2Y2Z A;  3QRF F;  3C1D A;  4BUP A;  2B0L A;  4IOA F;  2H8W A;  4CCO A;  1A31 A;  4CYC B;  2N8G A;  3HRT A;  3CP2 A;  3E3V A;  4PJJ A;  2W82 A;  3JCU C;  3J80 Z;  4MIM A;  5F27 A;  3SZT A;  2CUJ A;  2K86 A;  1KON A;  4HV6 A;  3WTZ A;  1STZ A;  2Y31 A;  4EMS A;  2CFO A;  1HLV A;  1ZRC A;  4MEY F;  1NG7 A;  1BJA A;  2XAF A;  4LIT A;  2QM3 A;  4HEA 2;  2A5Y B;  2Q1Z B;  4N0B A;  2XF7 A;  4LLL A;  2QBY B;  3H3V K;  2GA1 A;  3S1R J;  1ON1 A;  3FMR A;  1NH3 A;  3ONQ A;  5HLH A;  4MHG A;  2IS2 A;  2KMU A;  2EA4 A;  3JAM Z;  3G3Z A;  5BPI A;  1S29 A;  5LLQ A;  1V3F A;  3CDH A;  4HNV A;  1K6O A;  2C6Y A;  2IRF G;  2KP6 A;  3GFL A;  4XLA A;  3COA C;  1HCR A;  2QUF A;  5GPC A;  1QPM A;  3FMS A;  4XRS G;  3OYK A;  4PGG A;  1B9M A;  4D5C A;  3E7L A;  3FDY A;  3V4G A;  4BKX A;  3FM5 A;  3WG9 A;  2F5D A;  4RLQ A;  3GX4 X;  1OLT A;  2K02 A;  5AIP A;  3WTV C;  4Y15 A;  2CO5 A;  3BG5 A;  3DV8 A;  2DPD A;  1Z3Y A;  1K7A A;  4CHU A;  3J7Y J;  1TWH J;  4II3 A;  3KLN A;  3AG2 H;  4HZF A;  3M8J A;  2R93 J;  1YRN A;  2PMZ A;  3KEQ A;  3O3K A;  2CGP A;  3BLY A;  4PCQ A;  4PGH A;  3CUQ C;  2JUG A;  3JRD A;  1P6R A;  1SAU A;  4FCY A;  1YI2 I;  2L7K A;  4N9I A;  1T0F C;  5M3M J;  2OZU A;  1ERD A;  2KZG A;  1ZR2 A;  4KJZ A;  2CFX A;  4PFP A;  3RIR A;  2JA2 A;  4CUG A;  2ZSI B;  4P9F A;  2HOA A;  3BG7 A;  4IKF A;  2KPM A;  3Q0W A;  3LNQ A;  5FKN A;  1EKE A;  3RYP A;  1TW3 A;  3K0L A;  3CP8 A;  2NVU B;  5GAG J;  2YU9 J;  4DGW B;  4PK4 A;  3W6K B;  2DFH A;  2XKP A;  5E3N A;  1KZH A;  4ZZD A;  1V4R A;  1UEL B;  3F72 A;  3CC4 I;  1RNL A;  2PMZ N;  3M8F A;  4A3I J;  3TQN A;  1SFE A;  2HR3 A;  5HS7 A;  2KKO A;  1Z1D A;  5E18 F;  2HGC A;  4CO8 A;  1XGS A;  2LNB A;  3DBR B;  4FX0 A;  3IH2 A;  3OR1 C;  3DXJ F;  4EEF G;  3L2C A;  5F1J A;  1DU0 A;  3LFU A;  3DEE A;  4EGY A;  2VJ5 A;  2QZ8 A;  4ESF A;  2ZNY A;  3G73 A;  2FQ4 A;  3E6D A;  4AVZ A;  5FLM J;  2W48 A;  2HOE A;  4KIB A;  2GAU A;  3IRQ A;  3BOQ A;  4HOB A;  3RDI A;  3CME I;  1LB2 A;  5E79 C;  1SD7 A;  4AIJ A;  3LQQ A;  3T0Y A;  1FLI A;  2OAZ A;  3TL4 X;  4WX9 A;  3WGI A;  1SC7 A;  1BA5 A;  2NS8 A;  2KJC A;  5H6R A;  4CDG A;  1LFP A;  2HDW A;  2X0L A;  4G12 A;  5LBQ A;  3OY9 A;  1RR8 C;  4KYW A;  2ZME A;  2DA4 A;  2HI3 A;  4F93 B;  4EJO A;  1P2F A;  2KFD A;  4QLC U;  2YU3 A;  3VYU B;  1R4N B;  4P1W A;  3TO6 A;  1RPW A;  4NQW A;  2W7N A;  3D1N I;  3M3Y J;  2HFH A;  1TW2 A;  2Y0S N;  3ISP A;  1D1A A;  5FLX K;  2FOW A;  2WAQ A;  1WJE A;  2LYC A;  4WXD A;  3WG7 H;  2RN7 A;  3KP6 A;  3FXK A;  4AUX A;  2IA1 A;  4HDU A;  4HNU A;  3CMY A;  4HDV A;  3CZ6 A;  2OTJ I;  3LSK A;  3GTO J;  3H36 A;  1MZB A;  4OMY A;  2V1N A;  4R8H A;  2KL4 A;  3H3U A;  3FKJ A;  2V1U A;  4HX7 A;  4RM2 A;  2KZV A;  3FK7 A;  1TWF J;  3HB9 A;  1YX3 A;  1W0U A;  2IGK A;  3NAU A;  1K6Y A;  2O5R A;  2VXZ A;  2O03 A;  1JT6 A;  5CLS A;  4J19 A;  2HDC A;  1FIA A;  1X3W B;  3BT9 A;  2GIV A;  3KYL A;  2E35 A;  1ZG1 A;  2V6C A;  2XDV A;  1FBQ A;  2IS1 A;  4FET A;  1H0M A;  2EWN A;  3OYN A;  4C2T A;  2E1M B;  2ZCW A;  1I6X A;  5D8L B;  2WAQ N;  2CQQ A;  2K27 A;  4ASN A;  4F92 B;  3AFH A;  2VJ4 A;  1AWC A;  3H35 A;  2A61 A;  3EUH A;  4NC6 A;  3FKI J;  4DOZ A;  2OTL I;  2MBF A;  2F5C A;  1TT0 A;  4GO1 A;  3OYA A;  1QU3 A;  1XD7 A;  1WVR A;  2JSC A;  5LHG A;  4ETS A;  4A69 C;  5E8G A;  3CCE I;  2OCC H;  4UUV A;  1X2N A;  1JKP C;  1J59 A;  1F43 A;  2NXN B;  1XS9 A;  3GXO A;  1E17 A;  2FD5 A;  1U5T A;  3ELK A;  1EA3 A;  2Q0O A;  3BTL A;  4IQ4 A;  3ABT A;  2Q2E A;  3JRB A;  3CCY A;  2PG4 A;  2MAB A;  1J5Y A;  3DU6 A;  3WU0 A;  1BN5 A;  1APL C;  2DBB A;  3CCL I;  3QOD A;  4BXX J;  5D6E A;  3WTS C;  3K4M A;  4GYI A;  4O5V A;  1LEB A;  4R79 A;  5E20 A;  1IV8 A;  5K1Y A;  3G71 I;  3D5R C;  2DCE A;  1UJ8 A;  1ZK8 A;  5JI6 A;  1TQM A;  4CYD A;  2XRO A;  1I3A A;  2PJR A;  4P5O A;  4CGZ A;  1VQN I;  2LKX A;  2OCE A;  3ZMZ A;  5HVQ C;  2D45 A;  1T8I A;  2F5V A;  3BCA A;  2JJ7 A;  3BG9 A;  1FTZ A;  3O6B B;  5KAI C;  2BVL A;  3DU5 A;  3S93 A;  5DM6 F;  1WHU A;  4I76 A;  4X6A J;  2EZL A;  1WJD A;  2DA2 A;  2EZH A;  3ERE D;  3MWM A;  4CH7 A;  1ZRD A;  1IN4 A;  3R60 A;  2EA2 A;  2X9D A;  2GLO A;  2AQF A;  2VJI A;  3I0T A;  3TP3 A;  4BDY A;  5A2Q Z;  3D0S A;  3O2P E;  3AAF A;  2H1L A;  5GTI C;  4YEL A;  2QQA A;  1USS A;  3HM5 A;  2ME6 A;  1BC8 C;  1ZH5 A;  1A5J A;  5HDN A;  3OYI A;  2UZK A;  2DA5 A;  1WJB A;  2DOF A;  3IP4 B;  2H27 A;  2TDX A;  3HRS A;  1IW7 F;  3HZJ A;  2W84 A;  2X1D A;  5CVJ A;  3ZMT A;  4XIC A;  2DYS H;  2DXI A;  3GME A;  2DA1 A;  4C9Y A;  4LK0 F;  4BGD A;  4HBL A;  1FP1 D;  3I54 A;  4U0V A;  2W4S A;  2W57 A;  1B72 A;  2DMN A;  2F4O B;  2FQ3 A;  2LLK A;  3DPL C;  4LG3 A;  4WK8 F;  2BHY A;  2LOO A;  2ZME B;  5CYV A;  1HF0 A;  5KNL A;  2OJE D;  1TQI A;  4MLO A;  2M7B A;  1B6A A;  2R7T A;  3I4M J;  1FZP B;  4L18 B;  3GLL A;  4D5F A;  1IUF A;  4NQW B;  1K78 A;  2WWY A;  4UXN A;  2MC4 A;  3KE2 A;  4L0Y B;  2WY8 Q;  5F0F A;  1JTX A;  9ANT A;  3GVA A;  1LQ1 A;  2F4I A;  3KFW X;  2HPM A;  1ONV A;  3VYT B;  1N78 A;  3GW2 A;  3Q9V A;  3OIQ A;  1YHQ I;  1IF1 A;  1JGG A;  3ZQH A;  3HIF A;  1Z7L A;  2P5K A;  1ORK A;  3S14 J;  1UCR A;  1YW7 A;  3WTW C;  3KPH A;  1W4M A;  2FBI A;  1HST A;  1YTY A;  4ZYA A;  5ILV A;  1RET A;  4G94 A;  2H6B A;  4CCM A;  2ZXI A;  1Y0N A;  2J5P A;  2M4G A;  1P7J A;  2CSO A;  2V9V A;  3KLO A;  3SYT A;  4M3D A;  4XK4 A;  2VIX A;  3SFI A;  2NS7 A;  3I56 I;  3HHG A;  3BDD A;  4A3K J;  5EGO A;  2LG4 A;  3FIW A;  3WTX C;  1U0J A;  4CXF A;  3FX3 A;  2B63 J;  1ON2 A;  3CO7 C;  4PSW A;  2UXX A;  2R7U A;  5B1A H;  4F3Q A;  1LDJ A;  4QWQ A;  4EAT A;  5JHU A;  2L02 A;  2NOG A;  4XRM A;  5CVI A;  3H9G A;  3MVP A;  4HG2 A;  5GAE J;  4X0G A;  4E6K G;  1J2X A;  1YLF A;  2KRF A;  3FXR A;  3J81 Z;  3VFZ A;  1VQ5 I;  3P9I A;  2ADU A;  1UFM A;  4RM3 A;  4I02 A;  4M3F A;  3RZD J;  4IRH A;  1R7J A;  4B09 A;  2DA7 A;  4XBF A;  1IRF A;  2EIJ H;  1K79 A;  2LK2 A;  3RI4 A;  4DQ2 A;  1FOY A;  2CW7 A;  4UUS B;  3LSG A;  2DA3 A;  3VSK A;  1YS7 A;  2GOX B;  5IYC J;  4BXU A;  2IBD A;  3OV8 A;  1Y39 A;  2COB A;  4BJ5 C;  3VSL A;  4QSH A;  2LC2 A;  2G7H A;  2GQQ A;  1FP2 A;  2QEN A;  3KP3 A;  5DCM A;  3BPV A;  1O4X A;  5LRS A;  4E7H A;  1XX5 A;  2PJR B;  2LF8 A;  3WE2 A;  3DLL F;  2VL8 A;  4KMF A;  4A3F J;  1DPU A;  5B5E C;  1H89 C;  2XB5 A;  2L7Z A;  3NQO A;  2RDP A;  5J40 A;  4BQN A;  3W6V A;  2MFZ A;  4RGU A;  1ETK A;  2DPU A;  2ZBK A;  1VQK I;  4KDP A;  1E3P A;  2D2W A;  5E1Z B;  5KHD A;  3M7G A;  1FMV A;  1XDU A;  1VI0 A;  2EIK H;  3HEF A;  5LHI A;  3OYF A;  3ZP5 A;  3HOW J;  1MBE A;  2R7Q A;  3F3X A;  4NDL A;  1MND A;  2AHQ A;  3OOU A;  3V42 A;  4N4N B;  2ZFW A;  3PFY A;  4YFX F;  1SVO A;  2YSR A;  4IHY A;  4IX7 A;  2LKP A;  1X19 A;  2FX0 A;  2LF7 A;  4MO7 A;  3S32 A;  3CO6 C;  3PO2 J;  3ZMU A;  4GFB A;  3BTI A;  2E60 A;  1D8K A;  2R4G A;  4RBO A;  2FF4 A;  5M3F J;  2FRH A;  4XKV A;  4XLE A;  4FX4 A;  4F55 A;  4KIG A;  4E7Z A;  3CES A;  2R0Q C;  1N25 A;  2M4K A;  3HSE A;  4F91 B;  2NS0 A;  4E7K A;  4RA2 A;  1FJL A;  3GEZ A;  1B72 B;  2Y9Y A;  4IJA A;  3GTJ J;  2GXB A;  4HAM A;  4Y3O A;  2H94 A;  3TW7 A;  3A4C A;  4A3G J;  2E71 A;  3DTE A;  1R5G A;  4ZDL A;  1RKW A;  1MH4 A;  3K4N A;  3FHN A;  2NVY J;  5BS6 A;  5ICF A;  1SFX A;  2AQE A;  3N4M A;  5TRD A;  5J6X A;  3PM1 A;  3ROU A;  1WJ5 A;  5CJ9 A;  1TL8 A;  2O9L A;  4N9H A;  3V8L A;  2FNA A;  1XB4 A;  2L9R A;  3GUD A;  2L2O A;  1ACI A;  3PNT A;  1SD5 A;  3KCC A;  1KU2 A;  4LGW A;  4C3J J;  4ENM A;  3JW4 A;  2P6T A;  1S72 I;  1FYK A;  2IGM A;  1U9N A;  5GAH J;  4A3J J;  3AL0 B;  2CV1 A;  2L9V A;  1OYY A;  1TWC J;  3C7J A;  4MNU A;  1W1W E;  2RNG A;  3A0B C;  3PUB A;  4RAF A;  1J75 A;  3GLX A;  2DLL A;  2M45 A;  3I4N J;  2L4M A;  1M1E B;  3LA7 A;  4DYQ A;  5FFX A;  5K7Z A;  5HNF A;  1ZAR A;  1RKT A;  1PVE A;  3F23 A;  3RPU D;  3CUQ A;  3RKY A;  4ZYG A;  5FB2 A;  1IZ1 A;  3NRV A;  3S2H J;  2XSD C;  1CGP A;  1YOV B;  4QTR A;  1YE9 A;  2X85 A;  4OIP F;  3QPL A;  2LP0 A;  1T0F A;  2HQR A;  3OOP A;  4G6D A;  3HYI A;  3OYJ A;  1TQP A;  2RKH A;  4MQV A;  2M3A A;  2JMW A;  2FML A;  2WTE A;  1P9Q C;  1XSX A;  3A2K A;  1HQC A;  2DK8 A;  1O3T A;  4PJ0 C;  1K83 J;  4JX4 A;  5D6F A;  4F52 A;  1D8J A;  2FJ1 A;  4RS8 A;  1FYL A;  4DZP A;  1OPC A;  1TWG J;  4JK1 X;  1H88 C;  1Z6T A;  2XGE A;  2EV0 A;  3KP5 A;  1HOM A;  2PBI A;  3U9G A;  1WZ2 A;  5DV5 A;  4M3E A;  3HOY J;  1XGN A;  3NAR A;  3E5Q A;  4HQE A;  3ECH A;  2KDZ A;  3L2Q A;  2EBI A;  1TC3 C;  3RZO J;  3I71 A;  2Z16 A;  4DYR A;  2HWV A;  4MFE A;  5IYD J;  1A6I A;  2WV1 A;  2XB0 X;  5HLG A;  1LVA A;  1KU7 A;  4AC0 A;  1D0X A;  3L2V A;  2L9N A;  5FFZ A;  2JPB A;  3DKY A;  3QWL A;  1YIT I;  2WY7 Q;  3BR2 A;  3JRG A;  2RGV A;  1T2K A;  2W1O A;  1BW5 A;  4DNC A;  4XOT A;  3CCM I;  1ZR4 A;  1ULY A;  3BR3 A;  2Q8K A;  3HGY A;  1E0E A;  3C2B A;  1H9T A;  1JHF A;  5DCM B;  4A3C J;  3HUG A;  5D5U B;  3WU1 B;  3ABU A;  2VUM J;  3OSF A;  4YFN F;  1DUX C;  2BXZ A;  2KQR A;  1LDD A;  5LRR A;  4G6Q A;  3EUK L;  4WCG A;  4LFU A;  3OYH A;  2B9S A;  2VQL A;  2YPR A;  5J47 A;  2JA6 J;  3Q5F A;  3A01 A;  2JQ7 A;  3R6S A;  1MMG A;  3I4P A;  1ZRE A;  2H6C A;  3JR9 A;  4JOM A;  4ENK A;  1IV6 A;  5GAD J;  1ETY A;  3W2V A;  2GM4 A;  5FD5 A;  3ZMS A;  1SD6 A;  3DBL B;  3KX2 A;  1LNW A;  2CG4 A;  3IHU A;  3H9Q A;  1YW8 A;  1B4A A;  4XSZ F;  3K1N A;  5FO5 A;  2STW A;  3I5U A;  4M72 A;  3QU3 A;  3FIS A;  2CQN A;  4Q4Z F;  6PAX A;  3VDX A;  3EPZ A;  1BR2 A;  4EQQ A;  1HDD C;  4FTH A;  5K5O A;  4U88 A;  4LD5 A;  5TGT A;  1HDP A;  1WPK A;  4BY1 J;  5H20 A;  3H1C A;  1V55 H;  2JTV A;  3A02 A;  1CQT A;  4KIS A;  1U2W A;  4FIS A;  4D1Q A;  1I6H J;  2JVG A;  2JUC A;  3WTY C;  2K4J A;  4UHT A;  1T33 A;  3ZQI A;  3LSM A;  1ZAO A;  3DEW A;  2GBY A;  3BJA A;  3RCO A;  1I50 J;  2PN6 A;  5M5Y J;  1JXS A;  1JT0 A;  1HA8 A;  2VE8 A;  3TBI A;  2IJL A;  5TIS C;  1ZGA A;  4ZDO A;  3OYM A;  1BI1 A;  4AD9 A;  2P0W A;  3DF8 A;  1MJ9 A;  1VQP I;  1KQ9 A;  2OF7 A;  2HPI A;  5FRO A;  1Q1H A;  2MGQ A;  2P8T A;  2QQ9 A;  1GLN A;  4AYB A;  2OQG A;  3H3Z A;  2V6E A;  1BR4 A;  3V7S A;  3CCV I;  2V26 A;  1I5Z A;  2O0Y A;  4LMY A;  3BTC A;  3Q3S A;  3RSN A;  2G9W A;  2ZJ2 A;  3LOC A;  2OC6 A;  3CMM A;  4BNC A;  4A93 J;  5K5R A;  2GOM A;  5FRN A;  1VQ6 I;  3HOZ J;  5CQE A;  2LKS A;  1B8I A;  1DQU A;  3CUQ B;  3DLA A;  3AG1 H;  4NC8 A;  3OIO A;  2KLO A;  5KVR A;  4KN4 X;  5M5W J;  2L4A A;  2P7C B;  1XDS A;  3SEQ A;  1W0T A;  5A2Q K;  3RPU A;  3QOP A;  5D8K B;  1QZE A;  5JHF A;  1CF7 A;  4IQJ A;  2E19 A;  1H8A C;  3OYE A;  1D0Z A;  3E0J B;  3L9F A;  3JSP A;  2OA4 A;  4H4K C;  3MD2 A;  4S0H B;  4ENJ A;  1Y8R B;  5ICC A;  4KN7 X;  4AYB N;  4G7O F;  2F5E A;  3J7Z I;  4AID A;  1WI9 A;  4ZYH A;  3H0D A;  4BEH B;  1VTN C;  3BY6 A;  2E7X A;  2XHK A;  1N77 A;  4GDF A;  1MMN A;  2JA5 J;  2QCO A;  4GCV A;  1BOB A;  2CQK A;  5J8C A;  1LJ9 A;  4FT8 A;  4IHV A;  1WJA A;  3EET A;  2ECC A; 
#chains in the Genus database with same CATH homology
 1Z05 A;  3U2R A;  4WWC A;  1MDM A;  1C0W A;  4I98 B;  3ZQ7 A;  1D5V A;  4HLY A;  4GXO A;  2CWE A;  2VN2 A;  1DDN A;  3TOA A;  1KU3 A;  1WRJ A;  5F6F A;  3H92 A;  1G3W A;  2MA3 A;  3EQL F;  2AS5 F;  1IXR C;  2NAZ A;  5AON A;  1R58 A;  2UXN A;  1PUE E;  1FSH A;  1FYM A;  2F5F A;  2J5O A;  4BQA A;  1W5T A;  1YG2 A;  1X3U A;  2ZKZ A;  2IA2 A;  4LJZ F;  2PFB A;  1S3J A;  5ICE A;  5ICG A;  2MH9 A;  1I1G A;  2M87 A;  3LA2 A;  4ON0 A;  4HV5 A;  4I0A A;  2YX4 A;  3D5L A;  5D4R A;  2PI0 A;  1GXP A;  2JZY A;  2KIF A;  4ZZL A;  1MGT A;  1WKM A;  2VT3 A;  1ZG5 A;  1FT9 A;  2P6S A;  3K2Z A;  3IL2 A;  2Z99 A;  1F4K A;  5DD8 A;  2Z9O A;  3LFK A;  2EFQ A;  1P4X A;  2MH2 A;  3LQR A;  1BC7 C;  4ENN A;  1RIO H;  2VBX A;  3QU6 A;  4HX4 A;  2XAS A;  4UVC A;  2OU2 A;  3M9A A;  2VBY A;  2L3D A;  1JE8 A;  4P55 A;  4HF2 A;  1L0O C;  4Y13 A;  4XSX F;  4TV7 A;  2VT2 A;  1JHH A;  2Z33 A;  1YW9 A;  3K9T A;  3ZMD A;  1XSV A;  5H6Q A;  2HTS A;  2RVC A;  2LDU A;  1W7P D;  3RKW A;  5DUK A;  3DP7 A;  4ZYD A;  1CF7 B;  4IHS A;  1QZY A;  2A07 F;  3TGN A;  1HKQ A;  3F8M A;  2EJR A;  1MJB A;  2BBY A;  4OIQ F;  2OBP A;  2PLY A;  4RGR A;  4MGR A;  1WSU A;  4NB5 A;  2FEZ A;  2PMH A;  1OYI A;  4JBA A;  4HF1 A;  2XAH A;  3EYY A;  1QGP A;  4A0Y A;  2CYY A;  2JT1 A;  3RKX A;  3HRM A;  3RTR A;  1MJA A;  1R22 A;  4EJW A;  4O3M A;  4Z2Y A;  4U0Y A;  1FNN A;  4P9U A;  2M1B A;  4Q48 A;  3BWG A;  4I7H A;  2ZNZ A;  2ELH A;  2M5W A;  1F5T A;  1J7K A;  3HHH A;  2Y0M A;  4GYG A;  2V1D A;  1HW1 A;  2V1X A;  4KUM A;  3V7C A;  1G6N A;  2QWW A;  5LEK A;  5FGM A;  2Y48 A;  1YO5 C;  1BIB A;  5E17 F;  4ZYE A;  1D3Y A;  4KIF A;  1IN5 A;  4A5N A;  5EEG A;  1MKM A;  2W25 A;  4IRG A;  3WTU C;  3JSO A;  1P4A A;  5E8I A;  1PDN C;  3GO5 A;  3JTH A;  2A69 F;  3I53 A;  2EK5 A;  3HOS A;  1FSE A;  2A6H F;  1DP7 P;  1T39 A;  2STT A;  1WQ2 A;  4MQ9 F;  2EFP A;  1RI7 A;  5HS9 A;  2OZ6 A;  4Q5S F;  2BE5 F;  3E6M A;  4BHC A;  1XCB A;  5DEQ A;  1R23 A;  2A68 F;  4L9N A;  3EYI A;  2ESN A;  4BHP A;  4HF0 A;  3T8T A;  1NHA A;  2IA0 A;  1U5T B;  1GHC A;  1HW5 A;  4XLN F;  5L3G A;  3GZ5 A;  5JR3 A;  1G3Y A;  2DI3 A;  4EJT A;  3L7W A;  4IRI A;  1W7P A;  5E1X A;  1UB9 A;  3FM3 A;  4LG0 A;  3GF2 A;  2EFW A;  3J80 K;  1LDK B;  3LAP A;  4EM0 B;  3MCZ A;  3TOB A;  2DO7 A;  3GWZ A;  1IXC A;  1SMY F;  5ED4 A;  1J0R A;  4KMU X;  2HKO A;  3JAM K;  4AIH A;  5D5V B;  2R3S A;  2X4H A;  5HLI A;  2NYX A;  4M71 A;  3SZP A;  2DQR A;  1FBU A;  1WWX A;  4RGS A;  4IXA A;  2RQP A;  2GA2 A;  3WGG A;  3NEU A;  3R61 A;  4G7Z F;  2AXL A;  4UNO A;  1S6L A;  2XUB A;  1DPR A;  1Z91 A;  2Z5U A;  3TDZ C;  2DK5 A;  2HKX A;  2VBZ A;  3I58 A;  1K78 B;  1R1T A;  5L3F A;  4YG2 F;  1QO0 D;  1KQ0 A;  3R4K A;  4UV8 A;  3PQK A;  2MD5 A;  3F6O A;  1XN7 A;  4JQF A;  3M8E A;  1G3S A;  4LK1 F;  3TDU C;  3I59 A;  4HX8 A;  4AWX B;  5DUI A;  1T38 A;  3MAJ A;  4YIF A;  3BJO A;  2P7V B;  4PZJ A;  3E5U A;  2EV5 A;  2XIG A;  2FNP A;  4MTD A;  5KK1 A;  3HSR A;  2QYO A;  5L3D A;  3FMQ A;  3QP6 A;  1FBS A;  1HKT A;  4D0P A;  3MEX A;  1IXS B;  2MLG A;  2PQ8 A;  4IVN A;  1O3Q A;  1R36 A;  5IT9 Z;  4M9X A;  4G8X A;  1TNT A;  4PDK A;  3M1E A;  1BI2 A;  1O3S A;  3KZY A;  3L09 A;  1U3E M;  1Y0U A;  1F9N A;  4MTE A;  2NNN A;  5BPD A;  2JPC A;  5DYM A;  4RB3 C;  4L5I A;  3IWZ A;  2VE9 A;  2FMY A;  2XGX A;  4UV9 A;  3P9C A;  4Y17 A;  4BYY A;  3FXU A;  2ISZ A;  2BYV E;  1I1S A;  1W7P B;  4LG0 B;  3E6B A;  1P92 A;  2IVM A;  5CVU A;  3DQV C;  1FOK A;  4L9V A;  2O3F A;  2VOP A;  2DT5 A;  2DQL A;  2XAG A;  4KNY A;  3E5X A;  3GZ6 A;  3I64 A;  4M9S A;  3CLO A;  1XGM A;  1TBX A;  2OQR A;  1IAW A;  5EEH A;  5L3B A;  4ESB A;  3BP8 A;  3K1P A;  1RUO A;  3F8C A;  1ZLK A;  2D1H A;  3F8B A;  2NNY A;  3DPT A;  5CVR A;  4OMZ A;  1YYV A;  2HQN A;  3WE3 A;  4A12 A;  1IUY A;  2PMU A;  2XKO A;  2K4B A;  2DAO A;  3HRU A;  4AIK A;  4EVI A;  1ZN2 A;  3K69 A;  3KZZ A;  1QNT A;  2VBW A;  5ILU A;  5DDG A;  1PP8 F;  2NRA C;  2FU4 A;  5L3C A;  1XCV A;  2YR2 A;  3LAJ A;  4L5J A;  3HOT A;  2PJP A;  2FOK A;  3R0A A;  3F21 A;  2BEO A;  3I59 B;  1G3T A;  3J7A O;  3QP5 A;  3RJP A;  4L0Z B;  1IN8 A;  4YFK F;  3MFK A;  3DEU A;  5DD4 A;  2R7D A;  1HXD A;  3ML6 A;  4UVB A;  3T1B A;  4I0B A;  4EGZ A;  2FA5 A;  3E6C C;  4EJV A;  4KFC A;  1I27 A;  2WV0 A;  1U6G A;  2HYF A;  1Z9C A;  4BHB A;  1MD0 A;  1O7L A;  3VB2 A;  1YIO A;  4A2U A;  4GGG A;  2MC3 A;  3QPH A;  5D5X B;  4M74 A;  1ZRF A;  3IKT A;  2KJB A;  1FPQ A;  1KYW A;  1SMT A;  2L01 A;  1YFH A;  3IRR A;  2KIM A;  4A5M A;  1F1Z A;  2VC0 A;  2XVC A;  2D1V A;  4HYE A;  5JVT A;  1W5S A;  4CZZ A;  4RAY A;  1EH8 A;  3LWF A;  4OU0 A;  2P5L C;  2FE3 A;  5AIQ A;  5BQT A;  2HS5 A;  3CUO A;  1IRG A;  1FWZ A;  1B1B A;  2VC1 A;  4OOI A;  4A6D A;  2A3S A;  5ILS A;  3S2W A;  1EV7 A;  2ISY A;  3F8F A;  2DTR A;  4YII A;  1BI0 A;  5JFR A;  3J81 K;  4EJU A;  3EDP A;  3SHF A;  3K1M A;  4HQM A;  1TNS A;  4WXH A;  2IPQ X;  3BRO A;  2Y75 A;  1GXQ A;  3SFZ A;  1OYW A;  3VOD A;  2O8X A;  1GVJ A;  5LGN A;  5HDK A;  4RB0 A;  2K7L A;  3LST A;  2PEX A;  3IWF A;  2CW0 F;  3MZY A;  4M6X A;  5TJJ A;  1QQI A;  1RUN A;  4B8X A;  4H0E A;  3P9K A;  3B02 A;  5HDG A;  2ETH A;  3HTU A;  4WXC A;  4F7Z A;  2HTJ A;  1XSD A;  3GFJ A;  3V7R A;  1ODD A;  3GYH X;  3C18 A;  3FXQ A;  3W6J B;  5HOO A;  1XMK A;  3ZPL A;  2FSW A;  5F1R A;  3F6V A;  2COM A;  3PQJ A;  2BGC A;  2GZW A;  4U7D A;  1IN7 A;  2YX7 A;  5K5Q A;  4RAZ A;  2M8E A;  5BMZ A;  4AVP A;  4KT5 C;  2V79 A;  2RV8 A;  2IT0 A;  3ULQ B;  1L3L A;  1HKS A;  2EFN A;  1XMA A;  4WF2 A;  3FF5 A;  1SAX A;  3HSF A;  1MDM B;  3DKW A;  3R0J A;  1FY7 A;  1BI3 A;  1G4D A;  3VEP A;  3ZMV A;  1ZLJ A;  4KIC A;  2HYG D;  4G7H F;  1UHW A;  2RNJ A;  2GXG A;  3F8N A;  3T5X A;  1EH6 A;  1ZHF A;  1REP C;  2QLZ A;  3FWE A;  3SQN A;  3WOD F;  3KEO A;  3BZ6 A;  3ZN0 A;  1KA8 A;  4XLP F;  3CTA A;  2Z3Y A;  2DFI A;  3KET A;  1U78 A;  4OIO F;  1OMI A;  3JTG A;  4LB5 A;  4OIR F;  1TLH B;  5D5W B;  2LSO A;  3TKY A;  1BBY A;  4I01 A;  4EV0 A;  3GFI A;  1T98 A;  3WGH A;  1XGO A;  1O57 A;  3HTS B;  2HEO A;  5IT9 K;  1U8R A;  3WTT C;  3Q9S A;  1ZGJ A;  2MLK A;  3L00 A;  1FX7 A;  2G7U A;  2DW4 A;  5LGU A;  3E97 A;  1HBX G;  2ZXJ A;  1BM9 A;  4M73 A;  4L9T A;  3RPQ A;  2OD5 A;  1B9N A;  3KP2 A;  2JRT A;  2FBH A;  2XRN A;  2XAJ A;  5J8F A;  5DCF A;  5BOX A;  1PP7 U;  1QZZ A;  2ZO4 A;  3N97 A;  2IW5 A;  3KP7 A;  5L3E A;  4EM2 A;  5FLX Z;  3ZN1 A;  5IT3 A;  1Z7U A;  2XV4 S;  1TTY A;  1KQ8 A;  3MZH A;  3TO9 A;  4FHT A;  5HS8 A;  2P4W A;  3DFG A;  2FBK A;  5FD6 A;  4IF4 A;  1T6S A;  4Q47 A;  1AOY A;  3QPT A;  4I2O A;  2EFO A;  1U5T C;  2GWR A;  4RB2 C;  1R1U A;  2ESH A;  3FZV A;  3BPX A;  1J9I A;  1Z6R A;  4UVA A;  4I09 A;  2QVO A;  3QAH A;  3VOE A;  2EB7 A;  3IC7 A;  1O7F A;  4RB1 A;  1YQA A;  4OIN F;  3TO7 A;  4LB6 B;  3CJN A;  2DU9 A;  1KGS A;  1JGS A;  2KIU A;  2EV6 A;  1KYZ A;  2HZT A;  2O61 A;  3IKV A;  2ACJ A;  1S7O A;  2E1C A;  2O6G E;  1E2X A;  1SD4 A;  3PFI A;  2E7W A;  4EM1 A;  2QQB A;  3U1D A;  4K2E A;  5E1W A;  5CVV A;  4U0W A;  3F22 A;  2W24 A;  2VON A;  4LLN A;  1QBJ A;  2F2E A;  2WC2 A;  2M30 A;  2QBY A;  1EH7 A;  5ERI A;  1SFU A;  1R00 A;  3P7N A;  4BAY A;  3ECO A;  4HLX A;  3V8K A;  2FXA A;  3T8R A;  4P96 A;  3C3W A;  2IP2 A;  2R7F A;  2VOO A;  1H9G A;  3B73 A;  1R5H A;  1O3R A;  4IHT A;  3FHZ A;  3SXY A;  3LA3 A;  1B59 A;  4CIC A;  4ESJ A;  4HW0 A;  1LEA A;  4BH9 A;  1R1V A;  4A0X A;  2RC4 A;  1P4W A;  5LEJ A;  2H09 A;  4M6Y A;  1KU9 A;  1YS6 A;  3REO A;  1UST A;  4M9Z A;  1OR7 A;  1IN6 A;  4IPA A;  3BJ6 A;  3MQ0 A;  1S8N A;  4A0Z A;  4G9Y A;  5F64 A;  2A6E F;  1FC3 A;  3V8J A;  1HW2 A;  2L54 A;  5LGT A;  1BOA A;  2BV6 A;  2VOD A;  4A6E A;  3GFM A;  4RGX A;  4KA4 A;  4U7B A;  4O6J A;  1RZ4 A;  4HA8 A;  1ZG3 A;  5LHH A;  1BIA A;  4E70 A;  1HSJ A;  4XRF A;  1ZYR F;  4R1H A;  3RYR A;  4S04 A;  4ZH4 F;  4LLG F;  5D4S A;  4NHJ A;  2E1N A;  2W85 A;  4L9J A;  2XAQ A;  4MEX F;  1A04 A;  1OKR A;  2P5V A;  4S05 A;  1S7A A;  1UHM A;  3KP4 A;  2UWM A;  3QRF F;  3C1D A;  2B0L A;  3HRT A;  3E3V A;  3J80 Z;  3SZT A;  2K86 A;  4HV6 A;  3WTZ A;  1STZ A;  4EMS A;  1ZRC A;  4MEY F;  1BJA A;  2XAF A;  2QM3 A;  2A5Y B;  4N0B A;  4LLL A;  2QBY B;  2GA1 A;  1ON1 A;  3FMR A;  5HLH A;  4MHG A;  2EA4 A;  3JAM Z;  3G3Z A;  5BPI A;  1S29 A;  5LLQ A;  1V3F A;  3CDH A;  1K6O A;  2C6Y A;  2IRF G;  3GFL A;  3COA C;  2QUF A;  1QPM A;  3FMS A;  4PGG A;  1B9M A;  3V4G A;  3FM5 A;  3WG9 A;  2F5D A;  3GX4 X;  2K02 A;  5AIP A;  3WTV C;  4Y15 A;  2CO5 A;  3DV8 A;  2DPD A;  1K7A A;  4CHU A;  3KLN A;  4HZF A;  3KEQ A;  3O3K A;  2CGP A;  4PCQ A;  4PGH A;  3CUQ C;  1P6R A;  4N9I A;  2OZU A;  2CFX A;  3RIR A;  4P9F A;  3RYP A;  1TW3 A;  3K0L A;  3W6K B;  2XKP A;  4ZZD A;  1V4R A;  3F72 A;  1RNL A;  3M8F A;  3TQN A;  1SFE A;  2HR3 A;  5HS7 A;  2KKO A;  1Z1D A;  5E18 F;  2HGC A;  4CO8 A;  1XGS A;  2LNB A;  4FX0 A;  3DXJ F;  3L2C A;  4EGY A;  4ESF A;  2QZ8 A;  2ZNY A;  3G73 A;  3E6D A;  2HOE A;  4KIB A;  2GAU A;  3IRQ A;  3BOQ A;  4HOB A;  3RDI A;  1LB2 A;  4AIJ A;  1SD7 A;  3LQQ A;  3T0Y A;  1FLI A;  2OAZ A;  3WGI A;  4WX9 A;  2KJC A;  5H6R A;  4CDG A;  5LBQ A;  2X0L A;  4KYW A;  2ZME A;  4EJO A;  1P2F A;  4QLC U;  2YU3 A;  3TO6 A;  4NQW A;  2HFH A;  1TW2 A;  3ISP A;  5FLX K;  4WXD A;  2RN7 A;  3KP6 A;  2IA1 A;  4HDU A;  4HDV A;  1MZB A;  4OMY A;  4R8H A;  3H3U A;  2V1U A;  4HX7 A;  2HDC A;  2VXZ A;  5CLS A;  2O03 A;  2GIV A;  1ZG1 A;  2V6C A;  1FBQ A;  1H0M A;  2EWN A;  2ZCW A;  1I6X A;  5D8L B;  2K27 A;  4ASN A;  1AWC A;  2A61 A;  3EUH A;  2MBF A;  2F5C A;  4GO1 A;  1XD7 A;  2JSC A;  5LHG A;  4ETS A;  5E8G A;  4UUV A;  1J59 A;  3GXO A;  1E17 A;  1U5T A;  3ELK A;  2Q0O A;  3ABT A;  2Q2E A;  2PG4 A;  1J5Y A;  3WU0 A;  1BN5 A;  2DBB A;  5D6E A;  3WTS C;  4GYI A;  4O5V A;  1LEB A;  4R79 A;  5E20 A;  5K1Y A;  5JI6 A;  1TQM A;  4CYD A;  2XRO A;  4CGZ A;  4P5O A;  3ZMZ A;  5HVQ C;  2D45 A;  3O6B B;  3ERE D;  3MWM A;  1ZRD A;  1IN4 A;  3R60 A;  2EA2 A;  3I0T A;  5A2Q Z;  3D0S A;  3O2P E;  3AAF A;  2QQA A;  1USS A;  1ZH5 A;  1BC8 C;  5HDN A;  2UZK A;  2H27 A;  2TDX A;  3HRS A;  1IW7 F;  2W84 A;  5CVJ A;  3ZMT A;  4LK0 F;  4HBL A;  1FP1 D;  3I54 A;  4U0V A;  2W57 A;  2FQ3 A;  3DPL C;  4WK8 F;  5CYV A;  2ZME B;  1TQI A;  1B6A A;  1FZP B;  4L18 B;  1K78 A;  2WWY A;  4UXN A;  4L0Y B;  3KE2 A;  3GVA A;  1LQ1 A;  3KFW X;  1ONV A;  3GW2 A;  3Q9V A;  1IF1 A;  3HIF A;  2P5K A;  1UCR A;  1YW7 A;  3WTW C;  1W4M A;  2FBI A;  1HST A;  1YTY A;  5ILV A;  4G94 A;  2H6B A;  2J5P A;  3KLO A;  2CSO A;  2V9V A;  3HHG A;  3BDD A;  3WTX C;  4CXF A;  3FX3 A;  1ON2 A;  3CO7 C;  2UXX A;  1LDJ A;  4QWQ A;  5JHU A;  2L02 A;  5CVI A;  1J2X A;  1YLF A;  2KRF A;  3FXR A;  3J81 Z;  3VFZ A;  3P9I A;  2ADU A;  1UFM A;  4I02 A;  4IRH A;  1R7J A;  4B09 A;  4XBF A;  1IRF A;  1K79 A;  3RI4 A;  4DQ2 A;  1YS7 A;  4BXU A;  3OV8 A;  2G7H A;  2GQQ A;  1FP2 A;  2QEN A;  3KP3 A;  5DCM A;  3BPV A;  5LRS A;  2LF8 A;  3WE2 A;  4KMF A;  1DPU A;  3NQO A;  2RDP A;  4RGU A;  2DPU A;  2ZBK A;  4KDP A;  2D2W A;  5E1Z B;  5LHI A;  3ZP5 A;  3M7G A;  1XDU A;  3F3X A;  2ZFW A;  4YFX F;  2YSR A;  2LKP A;  2LF7 A;  3CO6 C;  3ZMU A;  1D8K A;  2FF4 A;  2FRH A;  4FX4 A;  4KIG A;  3HSE A;  2NS0 A;  3GEZ A;  4IJA A;  2GXB A;  4HAM A;  2H94 A;  1R5G A;  5BS6 A;  5ICF A;  1SFX A;  3N4M A;  5TRD A;  5J6X A;  3ROU A;  5CJ9 A;  4N9H A;  3V8L A;  2FNA A;  1XB4 A;  3GUD A;  1SD5 A;  3KCC A;  1KU2 A;  4LGW A;  4ENM A;  3JW4 A;  2P6T A;  1FYK A;  1OYY A;  3C7J A;  4MNU A;  1J75 A;  3GLX A;  2DLL A;  2M45 A;  2L4M A;  3LA7 A;  5FFX A;  1ZAR A;  3F23 A;  3CUQ A;  3RKY A;  4ZYG A;  5FB2 A;  1IZ1 A;  3NRV A;  1CGP A;  4OIP F;  1T0F A;  2HQR A;  3OOP A;  4G6D A;  3HYI A;  1TQP A;  2RKH A;  4MQV A;  2FML A;  2WTE A;  1XSX A;  1HQC A;  2DK8 A;  1O3T A;  5D6F A;  1D8J A;  1FYL A;  4RS8 A;  1OPC A;  4JK1 X;  1Z6T A;  3KP5 A;  2EV0 A;  2PBI A;  3U9G A;  5DV5 A;  1XGN A;  3E5Q A;  4HQE A;  3ECH A;  3I71 A;  2HWV A;  5HLG A;  1LVA A;  1KU7 A;  5FFZ A;  2JPB A;  1T2K A;  2RGV A;  4DNC A;  1ULY A;  2Q8K A;  1H9T A;  1JHF A;  5DCM B;  3HUG A;  5D5U B;  3WU1 B;  3ABU A;  4YFN F;  1DUX C;  1LDD A;  5LRR A;  4G6Q A;  4WCG A;  4LFU A;  2YPR A;  3Q5F A;  3R6S A;  3I4P A;  1ZRE A;  2H6C A;  4ENK A;  5FD5 A;  3ZMS A;  1SD6 A;  1LNW A;  2CG4 A;  3IHU A;  1YW8 A;  1B4A A;  4XSZ F;  3K1N A;  5FO5 A;  2STW A;  3I5U A;  4M72 A;  3QU3 A;  6PAX A;  4Q4Z F;  4EQQ A;  5K5O A;  4U88 A;  4LD5 A;  5H20 A;  2JTV A;  1U2W A;  3WTY C;  2K4J A;  4UHT A;  1ZAO A;  3BJA A;  2PN6 A;  1JXS A;  2VE8 A;  2IJL A;  1ZGA A;  1BI1 A;  4AD9 A;  1MJ9 A;  3DF8 A;  1KQ9 A;  1Q1H A;  2P8T A;  2QQ9 A;  2OQG A;  3H3Z A;  3V7S A;  1I5Z A;  2O0Y A;  4LMY A;  2G9W A;  2ZJ2 A;  4BNC A;  5K5R A;  3CUQ B;  5KVR A;  4KN4 X;  2L4A A;  2P7C B;  1XDS A;  5A2Q K;  3RPU A;  3QOP A;  5D8K B;  1CF7 A;  3L9F A;  3JSP A;  2OA4 A;  4ENJ A;  5ICC A;  4KN7 X;  4G7O F;  2F5E A;  4ZYH A;  1WI9 A;  1VTN C;  3BY6 A;  2E7X A;  2XHK A;  4GCV A;  2CQK A;  5J8C A;  1LJ9 A;  4FT8 A;  3EET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...