2DPDA

Crystal structure of the replication termination protein in complex with a pseudosymmetric b-site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*AP*TP*GP*AP*AP*CP*AP*TP*AP*AP*TP*GP*TP*TP*CP*AP*
publication title Crystal structure of the Replication Termination Protein in complex with a pseudosymmetric B-site
rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/dna
total genus 36
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dpdA00
5JHUA 2F5FA 3QP5A 4HDUA 1XCBA 4I01A 4L9JA 2RVCA 4CGZA 5CVVA 1K79A 2RV8A 4BNCA 5BMZA 5E1ZB 4GYGA 3L9FA 3IRRA 3H92A 3TGNA 4I7HA 3K0LA 2PJPA 2JPBA 3FWEA 3R60A 4Q47A 3CJNA 1EH8A 3PQJA 4YIIA 3HYIA 4UVAA 3TO6A 5HS9A 1U8RA 1T39A 4A0ZA 5CVJA 5LHGA 4HX8A 5L3FA 2VE8A 1TLHB 2QYOA 2ACJA 3KP4A 2VT3A 2W57A 3GFIA 3BJAA 4FX0A 3GEZA 1R5HA 2OZUA 5FGMA 4IVNA 3GZ5A 1BIBA 2IPQX 1FYKA 1MDMA 1T6SA 1TNTA 3KP2A 2MH2A 2BEOA 4UV9A 2W25A 3S2WA 1USTA 1K78A 4L9NA 4UV8A 5LGNA 3LAJA 4UUVA 4IXAA 1H0MA 1QZZA 4N9IA 2M45A 5D4RA 1V3FA 1BC8C 5LLQA 5K5OA 1F9NA 5E8GA 3M1EA 4EJVA 5K1YA 4I0BA 1XSDA 3JSPA 1U6GA 1JHFA 3DQVC 1IW7F 2H6CA 4XSXF 1GHCA 3GUDA 2Y48A 4TV7A 4I02A 1DPRA 5E17F 1I27A 3FXUA 1QGPA 1FZPB 3IKVA 1XGNA 5DD8A 2HDCA 3HOSA 4P96A 5D8LB 2PQ8A 4KN7X 5F64A 5E20A 4KN4X 3SFZA 3T8TA 5J6XA 3HTUA 4ENMA 1TNSA 1ODDA 2F2EA 3CUQB 2GZWA 5DUKA 1IRFA 3IKTA 2RKHA 3EQLF 4U0VA 5LRSA 5AONA 2GXGA 3F6OA 2O61A 1UFMA 4M71A 3L09A 1STZA 5CVIA 1BM9A 3WGHA 4MTDA 2E7XA 1ON2A 3F72A 2G7HA 1LQ1A 1EV7A 3SXYA 4HW0A 1ZGJA 2CO5A 3MCZA 1HSJA 4O5VA 3EYYA 3M8FA 4G7HF 1O7LA 5CVRA 3F23A 3LFKA 1SMYF 4Z2YA 3F22A 1T2KA 2KJBA 3RIRA 3HSEA 3U9GA 2A5YB 2NAZA 3I64A 1LVAA 2ZMEA 3GW2A 1AOYA 1W4MA 2J5PA 1KU2A 4DQ2A 1H9TA 5BPDA 1TBXA 3WTYC 4L9VA 4CDGA 2NRAC 4MTEA 2ESHA 1FBUA 2P5KA 3GXOA 3BY6A 5HLHA 2KIUA 4HV5A 2RN7A 2DTRA 2DK5A 4ON0A 3HSRA 2CFXA 3CO6C 1KU3A 1SFXA 3P9IA 1FYMA 1IN4A 1HW5A 1YLFA 4KUMA 2NNYA 1FBSA 1HKSA 3V7CA 2VXZA 5DV5A 3ISPA 4LJZF 2W84A 2CG4A 5HS7A 4PGGA 3WG9A 1G3YA 4RGUA 3ZN1A 1F4KA 5HDKA 3PFIA 1OYYA 2DQLA 2XAHA 3F8CA 4NQWA 4JBAA 1R7JA 4M9ZA 3BJOA 1WQ2A 2Q8KA 2FMLA 4KMFA 3ZMDA 5FB2A 4IHSA 5K5QA 4H0EA 3J81Z 2NS0A 3V8KA 3LQRA 5L3EA 3QPHA 2Z5UA 1PUEE 3BDDA 2XHKA 4OINF 1XGMA 4U7DA 6PAXA 4MNUA 1GVJA 2O03A 1PP7U 3MFKA 3K9TA 3F8BA 1MKMA 2PLYA 1O3QA 1NHAA 5LHIA 2ZXJA 3LA7A 1G6NA 3JTGA 1UHMA 3DPTA 1FWZA 1YTYA 1YW9A 4FHTA 3IL2A 4G9YA 2BBYA 4KNYA 3IRQA 4RB3C 3FM5A 4BH9A 2A6EF 5ILSA 4Y13A 3I58A 4LLLA 1GXPA 5E1WA 3ZMZA 1FPQA 2EK5A 2ZMEB 4ZZLA 1HXDA 2EA4A 2FE3A 3GWZA 2XUBA 2VODA 1B4AA 3ZMTA 4ZYGA 3JSOA 1YQAA 3ZP5A 1ULYA 4OOIA 3DP7A 3QAHA 1KA8A 2A68F 3B73A 2CGPA 1ZRFA 1R23A 2FSWA 1RIOH 5F6FA 1WRJA 2NNNA 2OZ6A 2KRFA 2XAGA 1J2XA 1IN6A 2WV0A 4KIFA 3HSFA 2HQRA 4UVCA 1ZARA 2ZNZA 4I0AA 4MQVA 4L0YB 1G4DA 4UVBA 5KVRA 2RDPA 1XDSA 2E1NA 1BI0A 2J5OA 1ZN2A 1FY7A 4EVIA 4RS8A 2ISZA 3OOPA 1B59A 1RI7A 2O0YA 3LA2A 3WGGA 1BC7C 4WXHA 3RPUA 1ZAOA 4CHUA 3TQNA 1KU7A 2FA5A 4BHPA 3T0YA 5ED4A 3C18A 4EQQA 4YFXF 5LHHA 2IA1A 4GO1A 1S3JA 1P92A 2O3FA 2YX4A 1BI1A 3GO5A 4HX4A 1YYVA 2OAZA 2RNJA 4A6EA 2Y0MA 3GFJA 1O3RA 2ISYA 1R1VA 4BHBA 1E17A 4R1HA 3Q9SA 1IAWA 1MJAA 4ENKA 1FLIA 3G3ZA 3C3WA 4PGHA 2IW5A 1FP1D 4EJUA 2CW0F 1XN7A 3WE2A 2OQRA 1MGTA 2AXLA 3VODA 1F1ZA 3TDZC 5LEJA 2DU9A 3DF8A 1P4XA 2Z9OA 1ZH5A 2IRFG 1FOKA 1KQ9A 1CGPA 1QNTA 2XVCA 5L3BA 3HRUA 3KP5A 4MQ9F 3TO9A 1R1UA 4G94A 1USSA 2QM3A 5DCMA 4DNCA 4EGZA 3WTUC 1HW1A 3KE2A 5ICCA 3TKYA 2DT5A 1FSEA 2O8XA 3WODF 4O6JA 4IRHA 4O3MA 3WTWC 3GFMA 1JHHA 2QENA 2MLKA 4BHCA 4E70A 3GVAA 4WXCA 5JVTA 3R6SA 2QUFA 3MZYA 2GWRA 3V8JA 4EM0B 3V8LA 2R3SA 3FXRA 4MHGA 4HF1A 3U2RA 2PBIA 3T5XA 2L54A 4RB2C 3I53A 5LGTA 4R79A 1HW2A 4WK8F 1P2FA 3KEQA 2PFBA 4D0PA 2K7LA 2M1BA 2VBWA 2XKOA 2STTA 2GAUA 3ABTA 1BI3A 3L00A 3R0AA 2ESNA 2OA4A 3F3XA 4L5IA 4EM2A 2R7DA 3ZN0A 5TJJA 1R1TA 2IA2A 2DBBA 2EFOA 1K7AA 3MWMA 3NEUA 1XSXA 4M72A 2HZTA 2UWMA 2ZO4A 4IHTA 3T8RA 3I54A 4HZFA 1MJ9A 1T98A 1IUYA 2B0LA 2FMYA 2XGXA 3COAC 2HS5A 3BROA 1IXSB 1EH6A 4JK1X 4KDPA 1SD5A 4KIBA 2IVMA 2JSCA 2RGVA 5DDGA 1KGSA 4FT8A 5HDGA 3F8FA 1D8JA 2C6YA 4A6DA 3G73A 3C1DA 4LG0B 1SFUA 4G6QA 1I1SA 5D5WB 2G7UA 2YPRA 1XMKA 1S6LA 4KICA 3LA3A 2A07F 5H6RA 3D0SA 1XD7A 2BE5F 4CICA 1BN5A 4GXOA 2UZKA 3E6MA 1J0RA 1C0WA 3L7WA 5D6EA 1OR7A 3Q9VA 2QQAA 1O7FA 1RUOA 4XRFA 5DCFA 2VBXA 4OMZA 5HS8A 2LNBA 2A69F 5FLXK 4IJAA 1B6AA 2QZ8A 4EMSA 4AIKA 1EH7A 3W6JB 1HKQA 1Z9CA 2DFIA 5A2QZ 2BYVE 2WTEA 3D5LA 4WX9A 3FMSA 4HAMA 1F5TA 3ELKA 3GZ6A 5DEQA 4EGYA 3O3KA 3ECOA 3N4MA 2EWNA 2EFWA 1IN5A 2EV5A 5K5RA 4U0WA 3WTVC 2FRHA 3DPLC 2M30A 2QBYA 3JW4A 1MDMB 4IRIA 1YS7A 3M7GA 5FFXA 1H9GA 2GA1A 1YFHA 2JZYA 4NB5A 1XGOA 3IWZA 1K78B 3DXJF 1DUXC 3HRSA 4YIFA 3KP6A 1R00A 1ZLKA 4QLCU 4CZZA 3RDIA 4EV0A 5E18F 2ZBKA 1VTNC 3MEXA 1Y0UA 5FFZA 5HDNA 3HHHA 2ZFWA 1TQPA 4BYYA 4ASNA 1D3YA 2ZKZA 3QP6A 3BP8A 3SZTA 2IJLA 3IHUA 2Q0OA 5JI6A 2H94A 3F6VA 2VOOA 2EFQA 2BGCA 4LB5A 2RC4A 2L4AA 2DW4A 4A12A 3MQ0A 4AWXB 2HOEA 4RGXA 1QZYA 4U0YA 2KIMA 3GF2A 4KYWA 2XASA 1LJ9A 1G3SA 5BPIA 5BQTA 4P9UA 2D1VA 4OIPF 1RZ4A 2DO7A 1BBYA 1OMIA 3E5XA 4OIQF 1W7PA 1P4WA 5CVUA 3FM3A 4L0ZB 3KEOA 5ICFA 1P4AA 1L3LA 4I09A 3K69A 3SQNA 3TOAA 2TDXA 3FXQA 4Y15A 4ENNA 1YW8A 4ZZDA 2XIGA 3B02A 1YIOA 1W7PD 4LB6B 1U5TA 3HRMA 1ZG5A 3DKWA 2YU3A 2JT1A 3GX4X 1S29A 5FO5A 5DYMA 3VOEA 3IC7A 5DD4A 1BIAA 2E1CA 2VT2A 5J8FA 4FX4A 2F5EA 3F21A 4G7ZF 3SZPA 4PDKA 4LGWA 3I59A 5EEGA 4GCVA 1BJAA 2M8EA 2VBZA 3T1BA 3RJPA 2XRNA 5L3GA 2MA3A 4RAZA 5JR3A 4M9XA 3E97A 3WTZA 1SMTA 3ERED 2VC0A 2P5VA 3I71A 5L3DA 1JE8A 5A2QK 2CQKA 4XLPF 3HUGA 3E6DA 4U7BA 1CF7A 4G7OF 3QRFF 2KIFA 2V6CA 4I98B 2FBIA 5ICGA 2FNPA 5ERIA 3MAJA 1WKMA 1I5ZA 3DFGA 1P6RA 4OIOF 4AVPA 2BV6A 1O3TA 5IT9K 4KIGA 5CJ9A 2IA0A 2LSOA 5EEHA 1R22A 1OKRA 2HGCA 4HX7A 1ZLJA 2P6TA 1L0OC 1YG2A 3ECHA 2UXXA 5BOXA 3R4KA 3ZMUA 3FMRA 3V4GA 3OV8A 3WTSC 1ZRDA 3E3VA 2H27A 2CSOA 1J75A 2FF4A 2KKOA 1U2WA 4CO8A 2P7CB 2XAJA 3HHGA 1ON1A 4LMYA 4ENJA 1U3EM 2FEZA 1QQIA 2DLLA 4WWCA 2M5WA 2OQGA 3JTHA 2O6GE 2KJCA 3GFLA 2FQ3A 1AWCA 4QWQA 1Z6RA 1PDNC 2Z99A 3ULQB 5CYVA 2P7VB 4YFNF 2HQNA 2L4MA 3KFWX 3V7RA 1G3WA 1ZG1A 1SD7A 3KETA 2W24A 5F1RA 1QBJA 4KMUX 2PEXA 2STWA 4Q48A 3BPVA 4IRGA 4Y17A 1FNNA 1IXCA 3BZ6A 4M6XA 1SAXA 5ICEA 3QU6A 1D5VA 3RPQA 3K1PA 5HVQC 3K2ZA 4N0BA 2V79A 1YS6A 2FU4A 3NRVA 3QOPA 1LDJA 4HBLA 4MGRA 1S7AA 5FLXZ 2Q2EA 2X4HA 4HOBA 2QQ9A 1FSHA 3GLXA 1CF7B 1HKTA 3M8EA 1IN8A 3H3UA 1HBXG 1QPMA 3R61A 2D45A 2X0LA 5AIQA 1QO0D 1BOAA 2Z3YA 2HKXA 2P4WA 3SHFA 2HEOA 4WF2A 2K4BA 1FBQA 2OBPA 3EDPA 3QU3A 3WTTC 4HV6A 4PCQA 2AS5F 3I4PA 3LWFA 3CUQA 3R0JA 1TQMA 1WSUA 1V4RA 2YR2A 5ILVA 3TOBA 4LLGF 1T38A 3ZPLA 5L3CA 2EV0A 1SFEA 3F8MA 4EJWA 2VE9A 2V1UA 2FBKA 4ZYEA 3HRTA 2VC1A 1FYLA 4AD9A 2FXAA 5D5UB 2P6SA 5LEKA 4F7ZA 2LF8A 4I2OA 2QQBA 2PG4A 5DUIA 4CYDA 2MLGA 4JQFA 1T0FA 1Q1HA 4ESFA 2XROA 1J5YA 1ZREA 4S05A 2QVOA 2OD5A 3DV8A 1TW2A 2MC3A 2GA2A 2M87A 3AAFA 2DI3A 4U88A 4KT5C 4Q4ZF 3J80K 2EV6A 4HA8A 2JPCA 2XV4S 5HLGA 5HLIA 1TTYA 4XSZF 3U1DA 2G9WA 4B09A 3WTXC 4MEYF 1REPC 2HTSA 2OU2A 1RUNA 1XSVA 2P8TA 3BOQA 2DPDA 2DQRA 2FOKA 2LF7A 2A6HF 1IXRC 4LD5A 5D5XB 1W5SA 3CTAA 3H3ZA 4XLNF 1MD0A 4UHTA 1K6OA 1O3SA 1ZGAA 3KZYA 5DCMB 4HQEA 4P5OA 2Y75A 1R58A 4OMYA 3KLNA 3PQKA 1LDKB 1TW3A 1DP7P 2VN2A 2IP2A 3KCCA 3ML6A 2HTJA 3RKXA 4HLYA 5H20A 2XAQA 2L01A 3CUOA 2K27A 3JAMK 5D8KB 3CDHA 4HLXA 3J7AO 5FD6A 1RNLA 2DK8A 5IT3A 1LEBA 4G6DA 2QWWA 3NQOA 2HWVA 3ZMSA 4L18B 4A2UA 4HF0A 2Z33A 2K4JA 4L5JA 4G8XA 4A0YA 5JFRA 1ZHFA 2WWYA 3BWGA 3RI4A 1I1GA 4ZYHA 2L3DA 2H09A 4GGGA 3P9KA 1B1BA 3RYRA 5IT9Z 2NYXA 3HTSB 2F5DA 1U5TC 2LDUA 4ETSA 1FT9A 2QLZA 3I5UA 1KYZA 2F5CA 2D2WA 3KP7A 4CXFA 1DDNA 4OIRF 3WGIA 4L9TA 1YW7A 1YO5C 4UNOA 5ILUA 5LBQA 1FP2A 1IRGA 4P9FA 3ROUA 1LNWA 1JGSA 4HYEA 1O57A 2DPUA 1DPUA 3K1MA 1X3UA 1LDDA 4RGSA 4HDVA 2ADUA 3O6BB 2V1XA 4RGRA 3E5UA 3RTRA 3ABUA 3EUHA 1WI9A 5TRDA 1D8KA 1I6XA 3TDUC 1J7KA 4Q5SF 2ZCWA 1OYIA 4M6YA 1IZ1A 2EB7A 4YFKF 2VBYA 4ZYDA 2V1DA 1E2XA 4RB0A 1XCVA 1Z7UA 2K86A 3LQQA 1PP8F 2MBFA 4LLNA 2W85A 4A5NA 4RB1A 5D6FA 1SD6A 3MZHA 2HKOA 1Z91A 5H6QA 2FBHA 3WU0A 3CLOA 3VB2A 2UXNA 1ZG3A 4BAYA 2ELHA 2A61A 3IWFA 2JRTA 4EJTA 2RQPA 3HIFA 1KQ0A 1B9NA 4RAYA 2EFNA 2CWEA 1WWXA 4P55A 2DAOA 4PZJA 3LSTA 4IPAA 5E1XA 5LGUA 2QBYB 4BXUA 3FMQA 1Z05A 2HYFA 3RKYA 1LB2A 2FNAA 1B9MA 3RYPA 2VONA 4EM1A 2YX7A 2R7FA 1GXQA 1R36A 1JXSA 2PMUA 5FD5A 1A04A 4AIHA 3FZVA 3FHZA 2LKPA 2VOPA 1S8NA 3ZMVA 1LEAA 1XMAA 3QPTA 1U78A 4ESJA 4M73A 1Z6TA 5CLSA 2V9VA 4GYIA 1J9IA 3TO7A 3M9AA 2P5LC 2JTVA 1FC3A 3WU1B 2H6BA 3KZZA 4AIJA 1XB4A 3E6CC 4XBFA 4N9HA 3P9CA 3C7JA 5AIPA 2IT0A 2PI0A 4WCGA 4YG2F 3KP3A 2GIVA 3CO7C 3E6BA 3EETA 3GYHX 2HYGD 2GXBA 3FX3A 1W7PB 2XKPA 4K2EA 1HQCA 2PN6A 2MD5A 3J80Z 2EFPA 1ZRCA 2CYYA 2WC2A 1MJBA 3REOA 3EYIA 1R5GA 1HSTA 1TQIA 1XGSA 3KLOA 3W6KB 1IN7A 1U5TB 5D4SA 3N97A 3P7NA 3F8NA 2GQQA 1XDUA 5D5VB 3RKWA 2ETHA 2PMHA 4M9SA 5HOOA 3VFZA 2E7WA 1ONVA 3FF5A 4KA4A 1G3TA 2ZNYA 3WE3A 1FX7A 3BPXA 1SD4A 3CUQC 1MZBA 5BS6A 4WXDA 1UCRA 2MH9A 2COMA 4LK1F 3O2PE 5E8IA 5J8CA 3BJ6A 3I59B 1OPCA 5LRRA 4B8XA 3L2CA 1OYWA 3ZQ7A 4M74A 1ZYRF 1BI2A 4ZH4F 4HF2A 3E5QA 4S04A 2EJRA 1J59A 1KU9A 4OU0A 4KFCA 4LFUA 2K02A 3J81K 2HR3A 4LK0F 3VEPA 4ESBA 1KYWA 4BQAA 1IF1A 4A5MA 1UB9A 1KQ8A 2HFHA 1S7OA 3JAMZ 4R8HA 4EJOA 2D1HA 2XAFA 3I0TA 1W5TA 5KK1A 3Q5FA 1UHWA 4LG0A 3HOTA 4A0XA 4IF4A 4HQMA 2ZJ2A 3DEUA 4UXNA 2EA2A 2YSRA 4NHJA 4MEXF 3V7SA 2L02A 1Z1DA 2A3SA 3LAPA 3K1NA
chains in the Genus database with same CATH superfamily
3QODA 5JHUA 1A36A 4IOAF 2F5FA 3QP5A 1IUFA 2AO9A 3FIWA 1XCBA 4HDUA 5J1RA 2KLOA 2NVQJ 2BW3A 4ZC3A 4I01A 4L9JA 3HOVJ 1I3QJ 2RVCA 5KHDA 4J00A 4CGZA 5CVVA 1K79A 2RV8A 4BNCA 2IGKA 1QVUA 4RMNA 5BMZA 5E1ZB 2VLAA 4GYGA 3L9FA 3IRRA 1H88C 3H92A 3TGNA 4I7HA 1BR1A 3K0LA 4Y7NJ 3CJQB 2PJPA 2JPBA 3FWEA 3R60A 4Q47A 3CJNA 2R7QA 1FJLA 1EH8A 2LFBA 1R5ID 3PQJA 4YIIA 3HYIA 4UVAA 2FJ1A 3TO6A 3WHCA 5HS9A 1U8RA 1RR7A 5IP6A 1T39A 4A0ZA 4XLAA 5CVJA 5LHGA 4HX8A 5L3FA 2VE8A 1TLHB 3ZQIA 4CCNA 2CUZA 2QYOA 4C3HJ 2ACJA 2HDDA 3KP4A 2VT3A 1IV6A 3K4KA 2EH3A 2V7FA 2W57A 2XAUA 2KIQA 2K3FA 3LSHA 3HBLA 3GFIA 3BJAA 4FX0A 3GEZA 1R5HA 2Y69H 1JJ6C 2OZUA 3ZQFA 1DGRM 2FUG2 5FGMA 1JKPC 4IVNA 4AYBN 4GFBA 3GZ5A 1BIBA 2LLKA 2O9LA 2N8GA 4L5EA 2IPQX 2HZDA 1FYKA 1Y8QB 1MDMA 1T6SA 4E6KG 3BR2A 5C4XJ 1TNTA 3KP2A 2MH2A 3X2QH 2BEOA 4DJAA 4UV9A 2W25A 3S2WA 3K4JA 1USTA 1K78A 1LE8A 4L9NA 4UV8A 5LGNA 3LAJA 5IOZA 4UUVA 1X2NA 3OSGA 2XPWA 1JKRC 3HPGA 4XORA 4IXAA 1H0MA 1QZZA 4N9IA 2M45A 5D4RA 1Y1WJ 1VQ4I 2XSJC 1V3FA 1BC8C 5LLQA 4AIDA 5K5OA 4BEHA 1F9NA 2VASA 4C3JJ 1ZQ3P 5E8GA 1Z67A 3M1EA 4EJVA 2QQ8A 2QSHX 5K1YA 3CCRI 4I0BA 1XSDA 4XMYA 3JSPA 1U6GA 2M3AA 3OR1C 2R0QC 1JHFA 3BR0A 3DQVC 2LH9A 3KYDB 2VJIA 1WZ2A 3CCUI 3VYUB 1IW7F 2H6CA 3SEZA 1LFBA 3H35A 3S14J 4XSXF 3CC4I 1GDTA 4F52A 3OL3A 1GHCA 3GUDA 3PFYA 3MKYB 1X19A 2Y48A 4TV7A 4I02A 1DPRA 5KAFC 1Z7LA 5E17F 2Q2EB 3S3MA 1I27A 2HYJA 5CQEA 3FXUA 2CUEA 3F0CA 1QGPA 1UHSA 1HDDC 1FZPB 4NUBA 1XPXA 3IKVA 3OYFA 3S3OA 2RQQA 1XGNA 5DD8A 4HNUA 3BR5A 2EBIA 2HDCA 1FMVA 3DTKA 3ZOBA 5HLTA 2M8GX 4B47A 3H36A 3LSMA 4P96A 2OPTA 5D8LB 2PQ8A 3HOSA 1R6RA 5C3EJ 1ZGWA 4KN7X 4V2FA 3C2BA 5F64A 2K9SA 2K9NA 5E20A 4KN4X 3SFZA 3T8TA 3UR3C 5J6XA 3HTUA 4BACA 2UUZA 5E3LA 4ENMA 3S1QJ 1TNSA 3E0JB 4N4NB 1E3HA 1ODDA 2F2EA 3CUQB 2GZWA 3FXKA 5DUKA 2HVRA 1IRFA 1XS9A 4CCJA 3IKTA 2R7RA 2RKHA 2L2OA 3EQLF 4U0VA 5LRSA 5E3OA 1Z3YA 2L9NA 4D9JA 5AONA 2GXGA 3F6OA 2O61A 1UFMA 4G6TB 4M71A 3L09A 1YHQI 5F0HA 5GP9A 1STZA 5CVIA 1GT0C 2V9KA 1BM9A 3HDDA 3WGHA 2M2EA 1VQKI 4MTDA 2E7XA 1ON2A 3HC7A 1RKTA 4U87A 1MBEA 3CDIA 3F72A 2G7HA 1LQ1A 2F4IA 4B3XA 1EV7A 3SXYA 4HW0A 4IQ4A 3LSIA 3MKLA 1VI0A 1ZGJA 2CO5A 2KP6A 3DBHB 3MCZA 3GLLA 1HSJA 2L9RA 3I4MJ 1TZLA 2GOXB 4O5VA 3MKWB 3EYYA 2E60A 3SYTA 4UUSA 3G4SI 4BY1J 3M8FA 5CPRB 2M0CA 4G7HF 2NVTJ 1O7LA 2DN0A 1R49A 5CVRA 3LFKA 3F23A 3K4LA 1I3AA 2MSYA 1SMYF 1DU0A 2R7VA 5GTIC 4Z2YA 3F22A 1T2KA 1AA7A 3VWBA 2KJBA 3RIRA 3HSEA 3U9GA 2A5YB 3CCYA 2NAZA 5FRMA 3I64A 1LVAA 2X85A 1NH3A 1YJWI 1JKQC 2ZMEA 1RETA 1BOBA 2ZJPF 3GW2A 1MBKA 1IG7A 1AOYA 3CZ6A 3OMYA 1W4MA 2JA2A 3W2AA 2A6TA 2J5PA 1KU2A 4DQ2A 1H9TA 5BPDA 1TBXA 5TISC 3WTYC 2CUFA 4L9VA 4XR6A 4CDGA 2NRAC 4MTEA 3LNQA 2ESHA 1FBUA 2P5KA 1ETOA 3DWLE 3BY6A 3GXOA 4IEJA 3W3CA 4M3DA 5HLHA 3QQAA 2KIUA 4HV5A 2RN7A 1SFKA 2ELKA 1OCOH 1N75A 2DTRA 2DK5A 2VKHA 1VQNI 4ON0A 4QPQA 3HSRA 1FTTA 2CFXA 2KZGA 1Z3XA 1V54H 4D5CA 4BJ6C 2GIZA 3CO6C 1MBGA 4B1RA 4XKWA 1KU3A 1SFXA 3P9IA 2M34A 3P5JA 1FYMA 1IN4A 4KT6A 1WI3A 1HW5A 2WY8Q 4B48A 2XGEA 1G2HA 2CW8A 1YLFA 3MVPA 4NC7A 4DOZA 2DMUA 4KUMA 2XPUA 2IS2A 1FIAA 2NNYA 1FBSA 2W48A 5IP7J 1X1AA 1HKSA 3V7CA 2VXZA 2YUSA 5DV5A 2FD5A 3ISPA 4LJZF 3W6VA 2W84A 1MMGA 2CG4A 5HS7A 4PGGA 3WG9A 1G3YA 4RGUA 3ZN1A 1F4KA 5HDKA 3PFIA 3ZQCA 1OYYA 4PUSA 2DQLA 2XAHA 3F8CA 4NQWA 1F43A 4JBAA 1R7JA 4BXFA 4M9ZA 4CH7A 3BJOA 1WQ2A 2Q8KA 2FMLA 4EEFG 4KMFA 1W1WE 3ZMDA 4LIUA 4XLFA 1YITI 5FB2A 2LMDA 2X51A 4PJNA 5IOYA 2CV1A 3D5SC 4IHSA 5K5QA 4H0EA 2JRMA 3J81Z 2NS0A 4W1UA 3SDBA 1AKHB 3V8KA 3MZ8A 3LQRA 5L3EA 3QPHA 3LSJA 2Z5UA 2CUJA 1PUEE 3ZQGA 5GPCA 3MMYB 3BDDA 1Z21A 2XHKA 4OINF 1XGMA 4U7DA 1Y0NA 6PAXA 3C2HA 1JGGA 4CCOA 2IBDA 4MNUA 1GVJA 2LYCA 1K4TA 3VSKA 3PNVA 2O03A 2E34A 1PP7U 3MFKA 4FTHA 1YX3A 3K9TA 2DA7A 2HOAA 4XK4A 3F8BA 4A3KJ 3RZDJ 1MKMA 4D5FA 2PLYA 1O3QA 1NHAA 3N05A 3OIPA 3K4NA 5FKLA 5LHIA 2ZXJA 3LA7A 1G6NA 3MN2A 1UHMA 1ZK8A 1FWZA 3DPTA 3G1OA 3JTGA 4G12A 1YTYA 3OYMA 1HF0A 1YW9A 2TCTA 4E4HA 4FHTA 3IL2A 4B3AA 1SVMA 4G9YA 4NC8A 1F36A 4FE7A 1X3ZB 5IP9J 2R92J 2BBYA 3CMYA 4KNYA 4UUSB 3IRQA 4RB3C 2Y30A 4HRIA 1TT5B 3FM5A 2AQEA 4LG3A 4BH9A 3CCLI 2A6EF 5ILSA 4Y13A 4DIQA 2CU7A 3I58A 2NVXJ 2EILH 3HOXJ 4LLLA 1GXPA 5E1WA 1WGXA 3ZMZA 4E7KA 1FPQA 2EK5A 4DBRA 2EZHA 2ZMEB 5TGTA 4ZZLA 3LOCA 2OJED 2VQHA 2ID3A 3S3NA 1HXDA 2EA4A 2FE3A 1WJFA 1S5LC 4C2MJ 3GWZA 2XUBA 3H0GJ 2VODA 1B4AA 3PL8A 1TP4A 3ZMTA 4ZYGA 3A02A 3JSOA 1YQAA 2NS8A 2K9LA 1JUMA 3ZP5A 1ULYA 4F91B 4DGWB 3CJRB 4QPOA 2VJ4A 4OOIA 3BG9A 3DP7A 1HLVA 2V6EA 3QAHA 4XN3A 3M07A 5E3MA 1I39A 1KA8A 2VJJA 5IYCJ 1ACIA 2JA5J 4A3DJ 2A68F 1MSFC 3B73A 2CGPA 1ZRFA 5FROA 5LFAA 1R23A 2FSWA 2DJIA 1RIOH 1UG0A 5F6FA 3OYNA 3FK7A 2KPMA 3KX2A 2K3PA 1WRJA 2NNNA 3HKZA 3L2QA 2R7XA 2OZ6A 5KNLA 2KRFA 2XAGA 2BHZA 1J2XA 2L0KA 1IN6A 4MO7A 2QSFX 2WV0A 3BCAA 4KIFA 2ECBA 2OF7A 3HSFA 5B3SH 5J47A 2HQRA 4UVCA 1ZARA 2ZNZA 2AHQA 4I0AA 4MQVA 3M1CA 2LK2A 2DFEA 4L0YB 1G4DA 4N4OB 4UVBA 5EEAA 2M7BA 5KVRA 5M3FJ 2RDPA 3S15J 3S93A 1XDSA 2K5CA 1RRJA 4BE2A 2E1NA 2XC7A 1BI0A 4PJLA 5C4JJ 4NQWB 2DXIA 3FHNA 1HOMA 1EKEA 2J5OA 1TWFJ 1ZN2A 1JI8A 1YE9A 1TWAJ 4XM3A 1FY7A 5H2FC 4YRVA 3DBRB 4EVIA 2VQCA 4RS8A 2AQFA 3K10A 2ISZA 2OC6A 3BQZA 3OOPA 1B59A 4HEA2 1RI7A 2O0YA 3LA2A 2P81A 2R5ZA 3WGGA 1BC7C 4WXHA 4E7ZA 3RPUA 1ZAOA 4CHUA 3TQNA 4HSRA 1KU7A 2FA5A 2VPRA 3T0YA 4BHPA 3L2WA 5ED4A 3C18A 4EQQA 4YFXF 5LHHA 1HA8A 2IA1A 3RZOJ 4GO1A 1S3JA 1P92A 2O3FA 3LSPA 4BDZA 3ASOH 5F27A 1MBJA 2L7FP 1BI1A 2YX4A 3DLAA 1QZEA 3GO5A 1HCRA 4HX4A 1JT0A 1YYVA 2OAZA 3TL4X 3ZR8X 2NOJB 2RNJA 4A6EA 4PJMA 2Y0MA 3GFJA 1O3RA 1PJRA 2ISYA 3PO2J 2X1CA 2E5ZA 1R1VA 4BHBA 2X6OA 4R1HA 1E17A 5B5EC 3Q9SA 4RAGA 1IAWA 1BL0A 4AVZA 2BHYA 1MJAA 1SAUA 4ENKA 1FLIA 3G3ZA 3EUKL 4ABZA 3C3WA 4PGHA 2EQRA 2IW5A 3RSNA 1FP1D 4EJUA 2CW0F 1XN7A 3WE2A 2OQRA 2I10A 1MGTA 1MH4A 2CS3A 2AXLA 3VODA 1F1ZA 3TDZC 5LEJA 2DU9A 2X1EA 1I50J 3DEWA 3DF8A 1P4XA 3ASNH 2Z9OA 1ZH5A 2IRFG 2LY2A 1FOKA 3QYFA 1KQ9A 4ZYAA 2PJRB 1CGPA 4IX7A 2PMZA 1QNTA 2H1LA 2XVCA 5L3BA 5J1YA 3OS2A 4XRMA 2JA6J 3HRUA 4X1EA 1YRNB 2KQRA 3KP5A 3PNYA 1MBHA 4MQ9F 3TO9A 1R1UA 4G94A 4HSTA 3TMOA 1USSA 5F08A 3BQYA 3H5NA 2QM3A 3OYBA 2Z1DA 4Z6YA 2AXTC 5JVGF 4QIWN 3G71I 1W0TA 5DCMA 3OYDA 1XTAA 4DNCA 4EGZA 3WTUC 1HW1A 4M3FA 3KE2A 2Y9ZA 1EF4A 3H9GA 1RPWA 5ICCA 2XDVA 5J4YA 2ZJRF 5E79C 4BY7J 1V55H 5GADJ 3TKYA 2DT5A 1FSEA 4PSXA 3W2WA 4Y4RA 2O8XA 1YOVB 3WODF 3S8PA 4O6JA 4IRHA 4O3MA 3WTWC 5F0FA 1G8XA 3GFMA 1JHHA 2QENA 3CC2I 2MLKA 4BHCA 4E70A 1H89C 2RNGA 3GVAA 1VQ6I 4WXCA 3CCJI 5JVTA 1JKOC 3MD2A 1U0JA 4DZPA 3BG7A 4FISA 3R6SA 5KCMA 3IH4A 2X9DA 2QUFA 1P9QC 3MZYA 2DA6A 2GWRA 2E36A 3LSGA 3V8JA 4EM0B 3V8LA 2BOLA 2R3SA 3S2DJ 3FXRA 4MHGA 4HF1A 2V1NA 3U2RA 3RQIA 3HM5A 2XB5A 3S2HJ 2XRLA 3ERMA 2PBIA 3T5XA 2L54A 1Z0XA 4RB2C 3I53A 3OYHA 3HOWJ 3A01A 2IEKA 5LGTA 4R79A 1T8IA 1A6IA 4DW6A 4UY8I 1KZHA 1HW2A 3JCUC 1P2FA 4WK8F 3KEQA 2PFBA 2HVSA 1T56A 3JRHA 4D0PA 2R7TA 2K7LA 2VBWA 2M1BA 2XKOA 4C2UA 2STTA 1WJ5A 2GAUA 3ABTA 1SVLA 1BI3A 3L00A 3R0AA 2R5ZB 3OIQA 4M3GA 4ZJZA 2CW7A 2ESNA 2OA4A 3F3XA 4L5IA 1W36D 3PO3J 4EM2A 5EJCA 2R7DA 3ZN0A 3S1RJ 5TJJA 2B9SA 1R1TA 2IA2A 3L1PA 2DBBA 2EFOA 1TWGJ 2KT0A 1K7AA 3MWMA 2EZLA 4D7NA 3NEUA 2KRCA 1XSXA 4M72A 3CCVI 4XKVA 1E3OC 2HZTA 2UWMA 3H1CA 1JT6A 3K4MA 1FOXA 4C3IJ 2ZO4A 3LSKA 4IHTA 3T8RA 1X58A 2LG4A 3I54A 4HZFA 1MJ9A 4IOCF 2EIJH 2KDOA 1T98A 5F04A 4BBRJ 1BR4A 1IUYA 2B0LA 1YJ9I 2FMYA 2XGXA 2E35A 3COAC 1S9HA 2HS5A 2LP0A 3BROA 1IXSB 1OQYA 1EH6A 4JK1X 4KDPA 4ZDLA 1SD5A 4KIBA 1BJZA 2XGCA 2B7EA 3BG6A 2IVMA 2JSCA 2RGVA 2VQLA 1OCPA 5DDGA 3H0DA 1D5YA 1ZR4A 1YJNI 1KGSA 4FT8A 3BR1A 5HDGA 1UZCA 3F8FA 1D8JA 4KJZA 2C6YA 4A6DA 3G73A 2QA4I 3C1DA 4LG0B 1SFUA 4G6QA 1I1SA 5D5WB 2G7UA 1BR2A 1IV8A 3PIOF 4W97A 3CQZJ 2ZMEC 2YPRA 4XOPA 2DT6A 4BE1A 1A35A 1GV5A 1XMKA 2CH0A 3S32A 1S6LA 2WB1A 3H5RA 4P1WA 4KICA 2HQAA 4KISA 3LA3A 3D5RC 2A07F 3AG4H 3D0SA 5H6RA 3DTEA 2DODA 1XD7A 1IRZA 2BE5F 2FX0A 1Y6IA 4CICA 1BN5A 4GXOA 2UZKA 3E6MA 5M5WJ 2D5VA 4IHVA 1J0RA 1C0WA 4ANJA 1UJ8A 3L7WA 1YI2I 2BW3B 5D6EA 2Z16A 5C44J 1OR7A 3Q9VA 2QQAA 1O7FA 2L9VA 1ETXA 1RUOA 4XRFA 4XOTA 3OY9A 2DDBA 3JRAA 2BY1A 1T08B 5DCFA 2VBXA 4E7HA 2I5UA 4OMZA 5HS8A 2LNBA 1DGWY 5FKOA 3OSFA 3EUHC 2BVMA 2A69F 5FLXK 4II3A 2WA0A 4IJAA 1B6AA 3PJRA 3I56I 2QZ8A 4EMSA 4AIKA 1EH7A 3W6JB 1IJWC 1B72A 2BXYA 1HKQA 1D0XA 1Z9CA 2KMUA 2DFIA 1X1BA 5A2QZ 3I3LA 3CP2A 2BYVE 4MFDA 3FXJA 4JP0A 2WTEA 3D5LA 1K83J 4WX9A 1H8AC 3Q0VA 2CMPA 3FMSA 2F4MB 4HAMA 1F5TA 5JLXA 3ELKA 1NK3P 4C9YA 3FISA 3GZ6A 3QPLA 5DEQA 2NOGA 4EGYA 3O3KA 4MIMA 2L7MP 2JJ7A 3ECOA 5J3LA 3SDGA 5GTHC 1VQ7I 3N4MA 3FDYA 2EWNA 4M3BA 1X3WB 2EFWA 1IN5A 1OCZH 1W0UA 4FE4A 1ETKA 3BLYA 2EV5A 5K5RA 2G0EA 4U0WA 3WTVC 2FRHA 3DPLC 2M30A 2QBYA 3JW4A 1MDMB 3G2BA 1N77A 4IRIA 1YS7A 4GRIA 3M7GA 5FFXA 1H9GA 2GA1A 5J40A 4GDFA 1YFHA 2Y31A 4F55A 2DJNA 2JZYA 4NB5A 1XGOA 3W2VA 3IWZA 1K78B 1LE8B 3GTKJ 2K9MA 4E7SA 2A05A 2HXOA 3DXJF 3HRSA 3DU6A 3HB9A 3IAS2 5EZGA 3KP6A 4YIFA 1DUXC 1R00A 2YU9J 3OL4A 3KEYA 3G6EI 1LUJB 3FXOA 4QLCU 1ZLKA 3QOEA 4CZZA 3J7ZI 1N78A 1JUSA 4PFPA 3RDIA 4EV0A 1MBFA 3BG3A 3OYAA 1X4PA 2NVUB 4BEHB 5E18F 2ZBKA 4B44A 1VTNC 3OYKA 3MEXA 1Y0UA 5E3NA 5FJ8J 3OIOA 3CF5F 4A3GJ 5FFZA 4BL0B 1HC8A 5HDNA 3HHHA 4M3EA 2ZFWA 1TQPA 4BYYA 3ZXSA 4CSWA 4ASNA 4A3MJ 1D3YA 2ZKZA 3QP6A 5LD2C 3BP8A 4IO9F 1J09A 3SZTA 3CC7I 2IJLA 3IHUA 2Q0OA 5JI6A 2VL8A 4E7JA 2H94A 2JA7J 3F6VA 2VOOA 2EFQA 2XF7A 4AC0A 2BGCA 2JN6A 4LB5A 2RC4A 2L4AA 2LBFA 5B1AH 1I6HJ 2DW4A 2O8KA 3MQ0A 2XF6A 4AWXB 2HOEA 4A12A 4RGXA 2W7NA 1R9TJ 1QZYA 4U0YA 1JTXA 1K6YA 2KIMA 3GF2A 3I55I 2DOEA 4KYWA 1WJCA 1UELB 2XASA 2BY3A 4Y3OA 1LJ9A 3PNTA 1G3SA 5BPIA 5BQTA 4P9UA 2D1VA 4OIPF 3AG3H 4BBSJ 1RZ4A 2DO7A 1SC7A 1BBYA 4RA2A 2KDZA 2CQ7A 1OMIA 2DCEA 1RESA 3E5XA 4OIQF 1W7PA 5EZHA 1P4WA 5CVUA 3FM3A 3H5AA 2ID6A 4L0ZB 2WAFA 3KEOA 5M5XJ 5ICFA 3GZNB 1P4AA 1L3LA 4I09A 2CQNA 3K69A 1IC8A 3SQNA 3TOAA 2TDXA 5B66C 3FXQA 4Y15A 4ENNA 1YW8A 4ZZDA 1ERDA 1ZKGA 3B6AA 2XIGA 3B02A 1QHGA 3I9V2 1YIOA 1W7PD 4JX6A 3K70C 4LB6B 5FRNA 3KYLA 1GLNA 1YIJI 2JUGA 2Z2SB 1U5TA 4JYKA 3HRMA 1ZG5A 2GOMA 3DKWA 1VQ8I 1TWCJ 2YU3A 2JT1A 3GX4X 1RR8C 5GAHJ 3ABLH 1S29A 5FO5A 4ZDPA 5DYMA 2QEXI 1WH5A 3VOEA 2X6WA 3IC7A 5DD4A 2L5QA 4E7LA 2DDAA 1BIAA 4XIDA 1B72B 2E1CA 1ITYA 2VT2A 1B8IA 5J8FA 3BZKA 4FX4A 5FLVA 2OUMA 2F5EA 4CYCA 2CFOA 3DTIA 4YEJA 3F21A 2V26A 3J7AY 2CQXA 4BJ5C 4G7ZF 3SZPA 4PDKA 3CF2A 2V9PA 4LGWA 3I59A 5EEGA 5EYRA 1S7EA 4GCVA 5J1UA 3FXLA 3AKZA 3BTJA 3IUOA 1GUUA 1BJAA 2M8EA 2VBZA 3T1BA 1W5CC 3RJPA 4AUXA 2XRNA 5L3GA 2MA3A 2VKEA 4RAZA 5JR3A 3NAUA 4M9XA 3HOZJ 3E97A 4V19K 3Q0UA 5K7FA 3WTZA 3HKZN 1SMTA 3ERED 2VC0A 9ANTA 3I4NJ 2P5VA 3I71A 2DFFA 4BUPA 4DYQA 2H8RA 5L3DA 3HXLA 3OYIA 1JE8A 2QGUA 5A2QK 2BXZA 1MMDA 2F5VA 2CQKA 3A0BC 1JJ8C 5HODA 4XLPF 4BDYA 2R5YA 4DYRA 3HUGA 3ABMH 4BU2A 1EA3A 3E6DA 3IV5A 4U7BA 1SVOA 2ZXWH 2O7OA 1MH3A 4V2GA 4C2TA 4C30A 1ZELA 1CF7A 2E2JJ 4G7OF 3QRFF 2KIFA 2BVLA 3E1SA 2Y9YA 2V6CA 4I98B 2FBIA 4II2A 5ICGA 3U1KA 2FNPA 1X1CA 3MKZA 4HNTA 3L2VA 4IHYA 5ERIA 3MAJA 3L2RA 1WKMA 1OISA 2DMNA 1I5ZA 3A1YA 4Y52J 2M4GA 3FBNB 3DFGA 2EZIA 1BW5A 1P6RA 3U21A 4OIOF 5EGOA 1PUFA 4AVPA 1WCMJ 1LKXA 1JTYA 2BV6A 3DPUA 1O3TA 5IT9K 1U9OA 4KIGA 5CJ9A 3LL7A 4FQGA 4A3BJ 1VZ0A 2IA0A 1DQUA 2X1DA 2L9SA 2WAQN 1Y1VJ 3FKIJ 1VFCA 2BY2A 2LSOA 5EEHA 1OFCX 1OKRA 1R22A 2HGCA 3A4CA 3LFUA 4NBQA 4HX7A 1G59A 3PSIA 4JX4A 1ZLJA 2P6TA 1L0OC 1X2MA 1YG2A 3ECHA 4RBOA 2VXDA 5FKMA 2UXXA 4BKXA 5BOXA 3R4KA 3ZMUA 3FMRA 3V4GA 3OV8A 2OV7A 2F48A 4B4CA 3WTSC 1GVDA 2CRGA 1ZRDA 3S1MJ 1OCRH 3BZCA 3E3VA 2H27A 2CSOA 3RCOA 1J75A 2FF4A 3OOUA 3V42A 3K6GA 2KKOA 1U2WA 2M9HA 1U8BA 4CO8A 2WV1A 2GXAA 5DTDA 5IYBJ 2P7CB 2XAJA 1MSEC 3KYCB 1VQ5I 3HHGA 2VIXA 2ZXHA 1ON1A 3VSLA 4Y33A 4LMYA 2Q1ZB 3OR2C 4ENJA 1U3EM 2FEZA 1XMXA 1QQIA 2DLLA 4WWCA 1Y39A 1A6QA 3DEEA 4YIRX 4XNFA 2JK3A 1NG7A 2M5WA 3BC8A 2OQGA 3JTHA 2M4KA 2O6GE 1V5FA 1WJAA 4NC6A 4UB6C 5CQGA 2KJCA 3GFLA 2FQ3A 4JX5A 1AWCA 4QWQA 2ELJA 1YX5A 2E19A 3NWSA 1Z6RA 2Y0SN 1PDNC 3IAM2 2Z99A 2FQ4A 3ULQB 5CYVA 1ETWA 2MYSA 4CCMA 3H3VK 3A0HC 2P7VB 4YFNF 4MFEA 1WHUA 2HQNA 5F0CA 2L4MA 2OCEA 3KFWX 1Y56A 3V7RA 1ETVA 1G3WA 1ZG1A 3K4BA 1SD7A 4BE0A 3KETA 2ICWG 2W24A 5F1RA 4J19A 3AG2H 1CQTA 3O8HA 4KMUX 1QBJA 2PEXA 2STWA 4Q48A 3BPVA 2HI3A 4IRGA 4Y17A 1FOYA 1LFPA 2LD5A 2FOWA 2XGDA 2LRDA 1FNNA 1IXCA 3BZ6A 5EG0A 3C2GA 4M6XA 1SAXA 4KITB 4IHXA 5ICEA 2CV0A 3QU6A 2IGNA 1D5VA 1S72I 3RPQA 1W36C 3K1PA 3CMAI 5HVQC 3K2ZA 2LREA 3WG7H 4N0BA 1FMWA 1WFXA 2CJJA 2V79A 1YS6A 2FU4A 3CDLA 3NRVA 3QOPA 1LDJA 2DOFA 2ME0A 4CA0A 2DMPA 4HBLA 4CCLA 2TRTA 2HOSA 4MGRA 1S7AA 3WU2C 5JLWA 5FLXZ 4ITVA 2Q2EA 2X4HA 4HOBA 4BJTA 2E2IJ 2QQ9A 3TW6A 1FSHA 3GLXA 3BG5A 3FXMA 1CF7B 5J4VA 1HKTA 3M8EA 1IN8A 3H3UA 2ZSIB 1HBXG 5KAIC 1QPMA 3HPHA 3QWLA 1ZTRA 3R61A 4FCYA 2D45A 2JUCA 4DZJA 2X0LA 5AIQA 1WJDA 3AG1H 1QO0D 1AU7A 1BOAA 2VKDA 2HKXA 2P4WA 2Z3YA 1XX5A 4XONA 4WF2A 3SHFA 1QA6A 2HEOA 2K4BA 4IKFA 1FBQA 2DYRH 1PUFB 2OTLI 4A3IJ 2OBPA 2QKLB 3EDPA 3QU3A 3WTTC 4HV6A 1D1AA 4PCQA 2AS5F 2IS4A 4AM3A 3I4PA 3LWFA 3CUQA 3R0JA 4ZTFA 2JMWA 2R7SA 2Y2ZA 3S17J 1TQMA 1WSUA 3H9JA 2IGOA 2JVGA 1V4RA 1LVKA 2YR2A 2A5WA 3FK6A 5ILVA 1SEUA 3TOBA 5DM6F 1OCCH 4LLGF 1T38A 3ZPLA 5L3CA 2EV0A 2L7KA 1SFEA 4ZTJA 3F8MA 4OAYA 3IH3A 5FLMJ 4EJWA 2VE9A 3CP8A 2V1UA 2FBKA 2IS1A 2ZB9A 2KHMA 4ZYEA 3HRTA 2VC1A 1T33A 1FYLA 1WVRA 4AD9A 3LMMA 2FXAA 5D5UB 2P6SA 2ZSHB 3RQ4A 4A3CJ 3SEQA 5LEKA 4F7ZA 2LF8A 2VB6A 1FTZA 1NK2P 4I2OA 2QQBA 2PG4A 5DUIA 1SANA 4CYDA 2MLGA 4JQFA 1T0FA 2NVYJ 3K2AA 1Q1HA 4BQOA 3VYRB 4ESFA 2XROA 3OWTA 1J5YA 1ZREA 4E7IA 4S05A 1M1EB 2QVOA 2OD5A 3DV8A 3ONQA 4D1QA 3ESWB 2B63J 1OR7C 4NNJA 4PSWA 1TW2A 3CMMA 4XL9A 2MC3A 1E3PA 2EZKA 2GA2A 2DA3A 2W00A 2M87A 3AAFA 2DI3A 4U88A 3H9QA 4KT5C 4Q4ZF 2WB1N 3HGGA 3J80K 1P7JA 3UNGC 3CD6I 2RREA 2EV6A 4HA8A 2JPCA 3HGYA 3B6CA 2XV4S 3VYTB 5HLGA 5HLIA 1KONA 4NDLA 2H8WA 1TTYA 1WJBA 4XSZF 3U1DA 2G9WA 1MNDA 2BY0A 4B09A 1N25A 3WTXC 4JOMA 4MEYF 1A31A 3Q3SA 1REPC 2HTSA 2HXIA 3GCMA 3AL0B 2OU2A 1RUNA 3CLQA 1XSVA 2P8TA 3BOQA 4FETA 5EG0B 2DPDA 4MLOA 3S16J 1Y8RB 2DQRA 5DM7F 2XSDC 1SFOJ 2FOKA 2LF7A 3AFHA 2A6HF 2GM4A 1IXRC 4LD5A 5D5XB 1W5SA 3A03A 1R4NB 1RC9A 4AYBA 3CTAA 1D1BA 3H3ZA 3ZCOA 2JSPA 3GTGJ 4A69C 2R7UA 4XLNF 1MD0A 4F3QA 2DA5A 4UHTA 1K6OA 3SFIA 4XKCA 4XRSG 1O3SA 3M8JA 3OYEA 2LY9A 1ZGAA 3KZYA 5DCMB 1QU3A 4HQEA 2HNHA 3PUBA 5GAGJ 4P5OA 2Y75A 1LFUP 4CZCA 2JQ7A 3GTQJ 1R58A 3EPZA 3OS0A 3JRGA 4OMYA 3KLNA 1VQ9I 1VQLI 3JRFA 3CCSI 1UAAA 3GTPJ 3K4CA 4RAFA 3PQKA 1LDKB 2W1OA 3VYSB 1TW3A 2WAEA 1PYVA 3M4OJ 3BTCA 2ECCA 1DP7P 2VN2A 2IP2A 3KCCA 3ML6A 2HTJA 3CESA 1UMQA 3RKXA 4HLYA 5H20A 2XAQA 4BGDA 2L01A 3CUOA 3M3YJ 3O8GA 1MIJA 2MGQA 5DS9A 2K27A 4OWRB 3JAMK 5D8KB 3CDHA 4HLXA 3DKXA 3CJTB 4B43A 3J7AO 1AKHA 1FOWA 1EJ9A 5FD6A 3CCEI 1RNLA 2DK8A 4XN0A 5IT3A 5HNHA 3CCQI 1VNDA 4I6ZA 5EDNA 1LEBA 4A3LJ 4G6DA 2QWWA 3NQOA 4AU7A 2HWVA 2E1MB 3ZMSA 4L18B 3KPHA 4X6AJ 1MMSA 4A2UA 4HF0A 2GBYA 2Z33A 1FEXA 1WH7A 2K4JA 3HJEA 3A01B 4L5JA 3ZGKA 3NARA 4G8XA 4A0YA 2X6XA 2CV2A 5GAEJ 5JFRA 1ZHFA 2GLOA 2WWYA 2VI6A 3BWGA 3RI4A 2DYSH 2KL4A 1I1GA 2X48A 4ZYHA 1VQOI 3HOUJ 1WJEA 2K40A 2L3DA 1QVTA 2LTPA 3TBIA 2H09A 4GGGA 5EF6A 2DA2A 4IZZA 3P9KA 1B1BA 3RYRA 5HNFA 2F4OB 5IT9Z 4A93J 2NYXA 3HTSB 2F5DA 1ORKA 1U5TC 4PJJA 4F93B 1IRXA 2LDUA 3L2UA 4ETSA 4QTRA 2V4JC 2MFZA 4PJ0C 1VQPI 2E5NA 3SZGA 1FT9A 5FKNA 1Z77A 2QLZA 3I5UA 1KYZA 2F5CA 2D2WA 4UUTA 3KP7A 4I76A 4LOCA 4CXFA 2HOTA 3HEFA 3FBIB 4OIRF 1DDNA 2DOAA 1ZR2A 4UB8C 4XQFA 1QHHD 3WGIA 4L9TA 1YW7A 1YO5C 4UNOA 4HNVA 3BR6A 5ILUA 4DBQA 5LBQA 1VF9A 2R4GA 1FP2A 1IRGA 3CMEI 4P9FA 3ROUA 3A2KA 1LNWA 1JGSA 4HYEA 3BR3A 1O57A 3JRDA 5JHFA 2DPUA 1DPUA 4XKBA 3K1MA 1X3UA 3ZQLA 5GPAA 1LDDA 4PK4A 2IXSA 4IL6C 3OYGA 4RGSA 1OCTC 4HDVA 3BT9A 2ADUA 3WHBA 2XF5A 5F1JA 3O6BB 2V1XA 4RGRA 3E5UA 2ZC2A 4YELA 4A3JJ 3RTRA 3ABUA 2IGMA 2LY1A 2LC2A 3VDXA 3EUHA 3JR9A 1QPIA 1WI9A 5K7ZA 2DFHA 5TRDA 4EATA 4RLQA 2IS6A 1D8KA 4RM2A 3OS1A 4XLCA 5CKTA 4S0HB 1I6XA 1MMNA 3TDUC 3BCBA 2NXNB 2E1OA 4M6VA 3HL2A 3DKYA 1J7KA 3VPRA 4Q5SF 2ZCWA 4RLFA 3IP4B 1D0YA 1OYIA 4M6YA 4CCKA 2M0MA 2H1KA 1IZ1A 3KZIC 2EB7A 4XLEA 1D0ZA 4YFKF 2VBYA 1IO2A 4ZYDA 2V1DA 3TP0A 4A3FJ 1E2XA 4RB0A 4FASD 1XCVA 3SJMA 1TL8A 1HDPA 3QYEA 2HU9A 4BQQA 2DMTA 3PUFA 1Z7UA 3GTMJ 2K86A 3K7AJ 3LQQA 3JRIA 1PP8F 3ZQQA 2MBFA 4LLNA 2EINH 1LPQA 2LR8A 2W85A 4OAZA 4A5NA 4IQJA 1NG6A 4RB1A 3TP3A 5D6FA 2NS7A 1SD6A 3MZHA 2HKOA 2DTZA 1Z91A 1FIPA 2K85A 1X1PA 3HG9A 2IAIA 3IH2A 5H6QA 2FBHA 3WU0A 3CLOA 2QKMB 1MNMC 2WY7Q 1TT0A 4BQNA 3VB2A 1TWHJ 2UXNA 2PX9A 2R7ZJ 1P7IA 1ZG3A 1VQMI 5BNGA 3DU5A 1XG1A 4BAYA 2ELHA 2UV1A 4F92B 1DU6A 2A61A 2R7WA 3ZRGA 1V5GA 4HG2A 3IWFA 2JRTA 5IPAA 4EJTA 2RQPA 3HIFA 1KQ0A 1B9NA 4RAYA 2DA4A 2EFNA 2CWEA 1WWXA 4P55A 2DAOA 4PZJA 3LSTA 4IPAA 3OYLA 5E1XA 5LGUA 2EIMH 2QBYB 4BXUA 1MNEA 1OJLA 3FMQA 1Z05A 3DBLB 2BZTA 2HYFA 3BTLA 3RKYA 2EPFA 1LB2A 2WBMA 2VKVA 4QSHA 4RM3A 2FNAA 4PFOA 1BW6A 1B9MA 2JA8J 3RYPA 2VONA 4EM1A 2YX7A 2VUMJ 2R7FA 1GXQA 2E2HJ 2KRHA 1R36A 1JXSA 2PMUA 2PJRA 1ETQA 2M7AA 2JWTA 2QCOA 5FD5A 1A04A 5M3MJ 4AIHA 3FZVA 3FHZA 2LKPA 2VOPA 1S8NA 3ZMVA 3FKJA 2LKXA 1LEAA 1XMAA 3QPTA 1YRNA 1U78A 1APLC 4A3EJ 4ESJA 4M73A 1Z6TA 4DYCA 3QPSA 5CLSA 2COBA 2V9VA 4GYIA 3GBGA 1J9IA 3ABKH 2VJ5A 3GTOJ 1DP3A 3EUAA 3TO7A 3M9AA 2MABA 3QYBA 2P5LC 2JTVA 1FC3A 3WU1B 1A5JA 4H4KC 2H6BA 3PIPF 1PVEA 5IYDJ 1OLTA 3KZZA 4CUGA 2LBFB 4AIJA 1XB4A 3E6CC 4I99C 1UG2A 4XBFA 4XLHA 2LKSA 1R71A 3S1NJ 1AHDP 4N9HA 3P9CA 3C7JA 5AIPA 3AL0C 2IT0A 2PI0A 2EIKH 3Q0WA 4YG2F 4WCGA 3KP3A 1GV2A 2GIVA 4XRSA 4RDUA 3CO7C 1ENHA 2E71A 5FKKA 3TEDA 2HPMA 3TW7A 3E6BA 3EETA 3GYHX 3K70D 2OCCH 2DA1A 2HYGD 3D1NI 2GXBA 3FX3A 2ZFUA 3ZQHA 1W7PB 1TC3C 4ZDOA 2XB0X 2XKPA 4K2EA 4D7MA 1HQCA 2ZJQF 2PN6A 2R93J 2MD5A 3J80Z 1E0EA 3BTIA 3NWTA 2EFPA 2LVSA 3G1LA 2CYYA 1ZRCA 2WC2A 1MJBA 3HZJA 2HVQA 3PSFA 3REOA 1JUPA 5IY5H 3EYIA 3JREA 2LOOA 1R5GA 1HSTA 2MC4A 2RAEA 3CCMI 3KIOA 1TQIA 1XGSA 3KLOA 3W6KB 1IN7A 2W4SA 3OYJA 1U5TB 3G1MA 5D4SA 1T95A 1POGA 2R7OA 3N97A 3P7NA 4BXXJ 2XPVA 3F8NA 2GQQA 1XDUA 2PMZN 3PM1A 2DT7B 5D5VB 3RKWA 1RKWA 2KFDA 2ETHA 1ETYA 2PMHA 4HPQA 4J01A 4M9SA 5HOOA 2K9QA 3VFZA 2E7WA 1ONVA 2KZVA 2YS9A 5M5YJ 3FF5A 2O5RA 4KA4A 1G3TA 2ZNYA 3WE3A 1FX7A 3BPXA 1SD4A 2MG4A 2L7ZA 3CUQC 1MMAA 1X1DA 1B8IB 1MZBA 2I8DA 5BS6A 4WXDA 4CYCB 1UCRA 2MH9A 1R4MB 2KISA 3DCFA 3JRBA 2COMA 1IDZA 4LK1F 3RKQA 3O2PE 2WAQA 5E8IA 2DMQA 5J8CA 1V5EA 3BJ6A 3I59B 4XICA 3E7LA 1OPCA 2F6CA 5LRRA 2X6YA 4B8XA 3L2CA 1OYWA 3ZQ7A 3UKGA 4M74A 2E1MC 1X4OA 1ZYRF 3JRCA 1BI2A 3GMEA 4LIVA 4ZH4F 4HF2A 3E5QA 4S04A 2EJRA 1J59A 1KU9A 4OU0A 2VQGA 3RPUD 4LITA 3GTLJ 4KFCA 2OTJI 2VPLA 1Q1VA 4LFUA 4BS9A 4IHWA 2QF7A 2K02A 3J81K 2HR3A 3J7YJ 4LK0F 3VEPA 4ESBA 1D1CA 1KYWA 1U9NA 4BQAA 1IF1A 4A5MA 1XC5A 1T0FC 1K4SA 1UB9A 2HDWA 2P0WA 2ME6A 4X0GA 1O4XA 2QSGX 1KQ8A 2HFHA 2R5YB 1S7OA 1MW7A 3JAMZ 3HUGB 4R8HA 4EJOA 3OYCA 2HPIA 2D1HA 2XAFA 2WADA 3I0TA 1W5TA 2HQ5A 2W82A 5KK1A 1IGNA 3F9KA 3Q5FA 3HOYJ 1UHWA 1NTCA 4LG0A 3HOTA 4A0XA 4IF4A 2MW8A 2ZXIA 4HQMA 2ZJ2A 3DEUA 4UXNA 2EA2A 2YSRA 2MD0A 4NHJA 4MEXF 2CQQA 3V7SA 3DLLF 2L02A 1QRYA 1IDYA 2Y0SA 1K61A 1Z1DA 2A3SA 3LAPA 5EGOB 3K1NA 3GTJJ 5B1BH 5K7HA 1WPKA 2JVHA 1BA5A 3LSRA
chains in the Genus database with same CATH topology
5JHUA 2F5FA 3QP5A 4HDUA 1XCBA 4I01A 4L9JA 2RVCA 4CGZA 5CVVA 1K79A 2RV8A 4BNCA 5BMZA 5E1ZB 4GYGA 3L9FA 3IRRA 3H92A 3TGNA 4I7HA 3K0LA 2PJPA 2JPBA 3FWEA 3R60A 4Q47A 3CJNA 1EH8A 3PQJA 4YIIA 3HYIA 4UVAA 3TO6A 5HS9A 1U8RA 1T39A 4A0ZA 5CVJA 5LHGA 4HX8A 5L3FA 2VE8A 1TLHB 2QYOA 2ACJA 3KP4A 2VT3A 2W57A 3GFIA 3BJAA 4FX0A 3GEZA 1R5HA 2OZUA 5FGMA 4IVNA 3GZ5A 1BIBA 2IPQX 1FYKA 1MDMA 1T6SA 1TNTA 3KP2A 2MH2A 2BEOA 4UV9A 2W25A 3S2WA 1USTA 1K78A 4L9NA 4UV8A 5LGNA 3LAJA 4UUVA 4IXAA 1H0MA 1QZZA 4N9IA 2M45A 5D4RA 1V3FA 1BC8C 5LLQA 5K5OA 1F9NA 5E8GA 3M1EA 4EJVA 5K1YA 4I0BA 1XSDA 3JSPA 1U6GA 1JHFA 3DQVC 1IW7F 2H6CA 4XSXF 1GHCA 3GUDA 2Y48A 4TV7A 4I02A 1DPRA 5E17F 1I27A 3FXUA 1QGPA 1FZPB 3IKVA 1XGNA 5DD8A 2HDCA 3HOSA 4P96A 5D8LB 2PQ8A 4KN7X 5F64A 5E20A 4KN4X 3SFZA 3T8TA 5J6XA 3HTUA 4ENMA 1TNSA 1ODDA 2F2EA 3CUQB 2GZWA 5DUKA 1IRFA 3IKTA 2RKHA 3EQLF 4U0VA 5LRSA 5AONA 2GXGA 3F6OA 2O61A 1UFMA 4M71A 3L09A 1STZA 5CVIA 1BM9A 3WGHA 4MTDA 2E7XA 1ON2A 3F72A 2G7HA 1LQ1A 1EV7A 3SXYA 4HW0A 1ZGJA 2CO5A 3MCZA 1HSJA 4O5VA 3EYYA 3M8FA 4G7HF 1O7LA 5CVRA 3F23A 3LFKA 1SMYF 4Z2YA 3F22A 1T2KA 2KJBA 3RIRA 3HSEA 3U9GA 2A5YB 2NAZA 3I64A 1LVAA 2ZMEA 3GW2A 1AOYA 1W4MA 2J5PA 1KU2A 4DQ2A 1H9TA 5BPDA 1TBXA 3WTYC 4L9VA 4CDGA 2NRAC 4MTEA 2ESHA 1FBUA 2P5KA 3GXOA 3BY6A 5HLHA 2KIUA 4HV5A 2RN7A 2DTRA 2DK5A 4ON0A 3HSRA 2CFXA 3CO6C 1KU3A 1SFXA 3P9IA 1FYMA 1IN4A 1HW5A 1YLFA 4KUMA 2NNYA 1FBSA 1HKSA 3V7CA 2VXZA 5DV5A 3ISPA 4LJZF 2W84A 2CG4A 5HS7A 4PGGA 3WG9A 1G3YA 4RGUA 3ZN1A 1F4KA 5HDKA 3PFIA 1OYYA 2DQLA 2XAHA 3F8CA 4NQWA 4JBAA 1R7JA 4M9ZA 3BJOA 1WQ2A 2Q8KA 2FMLA 4KMFA 3ZMDA 5FB2A 4IHSA 5K5QA 4H0EA 3J81Z 2NS0A 3V8KA 3LQRA 5L3EA 3QPHA 2Z5UA 1PUEE 3BDDA 2XHKA 4OINF 1XGMA 4U7DA 6PAXA 4MNUA 1GVJA 2O03A 1PP7U 3MFKA 3K9TA 3F8BA 1MKMA 2PLYA 1O3QA 1NHAA 5LHIA 2ZXJA 3LA7A 1G6NA 3JTGA 1UHMA 3DPTA 1FWZA 1YTYA 1YW9A 4FHTA 3IL2A 4G9YA 2BBYA 4KNYA 3IRQA 4RB3C 3FM5A 4BH9A 2A6EF 5ILSA 4Y13A 3I58A 4LLLA 1GXPA 5E1WA 3ZMZA 1FPQA 2EK5A 2ZMEB 4ZZLA 1HXDA 2EA4A 2FE3A 3GWZA 2XUBA 2VODA 1B4AA 3ZMTA 4ZYGA 3JSOA 1YQAA 3ZP5A 1ULYA 4OOIA 3DP7A 3QAHA 1KA8A 2A68F 3B73A 2CGPA 1ZRFA 1R23A 2FSWA 1RIOH 5F6FA 1WRJA 2NNNA 2OZ6A 2KRFA 2XAGA 1J2XA 1IN6A 2WV0A 4KIFA 3HSFA 2HQRA 4UVCA 1ZARA 2ZNZA 4I0AA 4MQVA 4L0YB 1G4DA 4UVBA 5KVRA 2RDPA 1XDSA 2E1NA 1BI0A 2J5OA 1ZN2A 1FY7A 4EVIA 4RS8A 2ISZA 3OOPA 1B59A 1RI7A 2O0YA 3LA2A 3WGGA 1BC7C 4WXHA 3RPUA 1ZAOA 4CHUA 3TQNA 1KU7A 2FA5A 4BHPA 3T0YA 5ED4A 3C18A 4EQQA 4YFXF 5LHHA 2IA1A 4GO1A 1S3JA 1P92A 2O3FA 2YX4A 1BI1A 3GO5A 4HX4A 1YYVA 2OAZA 2RNJA 4A6EA 2Y0MA 3GFJA 1O3RA 2ISYA 1R1VA 4BHBA 1E17A 4R1HA 3Q9SA 1IAWA 1MJAA 4ENKA 1FLIA 3G3ZA 3C3WA 4PGHA 2IW5A 1FP1D 4EJUA 2CW0F 1XN7A 3WE2A 2OQRA 1MGTA 2AXLA 3VODA 1F1ZA 3TDZC 5LEJA 2DU9A 3DF8A 1P4XA 2Z9OA 1ZH5A 2IRFG 1FOKA 1KQ9A 1CGPA 1QNTA 2XVCA 5L3BA 3HRUA 3KP5A 4MQ9F 3TO9A 1R1UA 4G94A 1USSA 2QM3A 5DCMA 4DNCA 4EGZA 3WTUC 1HW1A 3KE2A 5ICCA 3TKYA 2DT5A 1FSEA 2O8XA 3WODF 4O6JA 4IRHA 4O3MA 3WTWC 3GFMA 1JHHA 2QENA 2MLKA 4BHCA 4E70A 3GVAA 4WXCA 5JVTA 3R6SA 2QUFA 3MZYA 2GWRA 3V8JA 4EM0B 3V8LA 2R3SA 3FXRA 4MHGA 4HF1A 3U2RA 2PBIA 3T5XA 2L54A 4RB2C 3I53A 5LGTA 4R79A 1HW2A 4WK8F 1P2FA 3KEQA 2PFBA 4D0PA 2K7LA 2M1BA 2VBWA 2XKOA 2STTA 2GAUA 3ABTA 1BI3A 3L00A 3R0AA 2ESNA 2OA4A 3F3XA 4L5IA 4EM2A 2R7DA 3ZN0A 5TJJA 1R1TA 2IA2A 2DBBA 2EFOA 1K7AA 3MWMA 3NEUA 1XSXA 4M72A 2HZTA 2UWMA 2ZO4A 4IHTA 3T8RA 3I54A 4HZFA 1MJ9A 1T98A 1IUYA 2B0LA 2FMYA 2XGXA 3COAC 2HS5A 3BROA 1IXSB 1EH6A 4JK1X 4KDPA 1SD5A 4KIBA 2IVMA 2JSCA 2RGVA 5DDGA 1KGSA 4FT8A 5HDGA 3F8FA 1D8JA 2C6YA 4A6DA 3G73A 3C1DA 4LG0B 1SFUA 4G6QA 1I1SA 5D5WB 2G7UA 2YPRA 1XMKA 1S6LA 4KICA 3LA3A 2A07F 5H6RA 3D0SA 1XD7A 2BE5F 4CICA 1BN5A 4GXOA 2UZKA 3E6MA 1J0RA 1C0WA 3L7WA 5D6EA 1OR7A 3Q9VA 2QQAA 1O7FA 1RUOA 4XRFA 5DCFA 2VBXA 4OMZA 5HS8A 2LNBA 2A69F 5FLXK 4IJAA 1B6AA 2QZ8A 4EMSA 4AIKA 1EH7A 3W6JB 1HKQA 1Z9CA 2DFIA 5A2QZ 2BYVE 2WTEA 3D5LA 4WX9A 3FMSA 4HAMA 1F5TA 3ELKA 3GZ6A 5DEQA 4EGYA 3O3KA 3ECOA 3N4MA 2EWNA 2EFWA 1IN5A 2EV5A 5K5RA 4U0WA 3WTVC 2FRHA 3DPLC 2M30A 2QBYA 3JW4A 1MDMB 4IRIA 1YS7A 3M7GA 5FFXA 1H9GA 2GA1A 1YFHA 2JZYA 4NB5A 1XGOA 3IWZA 1K78B 3DXJF 1DUXC 3HRSA 4YIFA 3KP6A 1R00A 1ZLKA 4QLCU 4CZZA 3RDIA 4EV0A 5E18F 2ZBKA 1VTNC 3MEXA 1Y0UA 5FFZA 5HDNA 3HHHA 2ZFWA 1TQPA 4BYYA 4ASNA 1D3YA 2ZKZA 3QP6A 3BP8A 3SZTA 2IJLA 3IHUA 2Q0OA 5JI6A 2H94A 3F6VA 2VOOA 2EFQA 2BGCA 4LB5A 2RC4A 2L4AA 2DW4A 4A12A 3MQ0A 4AWXB 2HOEA 4RGXA 1QZYA 4U0YA 2KIMA 3GF2A 4KYWA 2XASA 1LJ9A 1G3SA 5BPIA 5BQTA 4P9UA 2D1VA 4OIPF 1RZ4A 2DO7A 1BBYA 1OMIA 3E5XA 4OIQF 1W7PA 1P4WA 5CVUA 3FM3A 4L0ZB 3KEOA 5ICFA 1P4AA 1L3LA 4I09A 3K69A 3SQNA 3TOAA 2TDXA 3FXQA 4Y15A 4ENNA 1YW8A 4ZZDA 2XIGA 3B02A 1YIOA 1W7PD 4LB6B 1U5TA 3HRMA 1ZG5A 3DKWA 2YU3A 2JT1A 3GX4X 1S29A 5FO5A 5DYMA 3VOEA 3IC7A 5DD4A 1BIAA 2E1CA 2VT2A 5J8FA 4FX4A 2F5EA 3F21A 4G7ZF 3SZPA 4PDKA 4LGWA 3I59A 5EEGA 4GCVA 1BJAA 2M8EA 2VBZA 3T1BA 3RJPA 2XRNA 5L3GA 2MA3A 4RAZA 5JR3A 4M9XA 3E97A 3WTZA 1SMTA 3ERED 2VC0A 2P5VA 3I71A 5L3DA 1JE8A 5A2QK 2CQKA 4XLPF 3HUGA 3E6DA 4U7BA 1CF7A 4G7OF 3QRFF 2KIFA 2V6CA 4I98B 2FBIA 5ICGA 2FNPA 5ERIA 3MAJA 1WKMA 1I5ZA 3DFGA 1P6RA 4OIOF 4AVPA 2BV6A 1O3TA 5IT9K 4KIGA 5CJ9A 2IA0A 2LSOA 5EEHA 1R22A 1OKRA 2HGCA 4HX7A 1ZLJA 2P6TA 1L0OC 1YG2A 3ECHA 2UXXA 5BOXA 3R4KA 3ZMUA 3FMRA 3V4GA 3OV8A 3WTSC 1ZRDA 3E3VA 2H27A 2CSOA 1J75A 2FF4A 2KKOA 1U2WA 4CO8A 2P7CB 2XAJA 3HHGA 1ON1A 4LMYA 4ENJA 1U3EM 2FEZA 1QQIA 2DLLA 4WWCA 2M5WA 2OQGA 3JTHA 2O6GE 2KJCA 3GFLA 2FQ3A 1AWCA 4QWQA 1Z6RA 1PDNC 2Z99A 3ULQB 5CYVA 2P7VB 4YFNF 2HQNA 2L4MA 3KFWX 3V7RA 1G3WA 1ZG1A 1SD7A 3KETA 2W24A 5F1RA 1QBJA 4KMUX 2PEXA 2STWA 4Q48A 3BPVA 4IRGA 4Y17A 1FNNA 1IXCA 3BZ6A 4M6XA 1SAXA 5ICEA 3QU6A 1D5VA 3RPQA 3K1PA 5HVQC 3K2ZA 4N0BA 2V79A 1YS6A 2FU4A 3NRVA 3QOPA 1LDJA 4HBLA 4MGRA 1S7AA 5FLXZ 2Q2EA 2X4HA 4HOBA 2QQ9A 1FSHA 3GLXA 1CF7B 1HKTA 3M8EA 1IN8A 3H3UA 1HBXG 1QPMA 3R61A 2D45A 2X0LA 5AIQA 1QO0D 1BOAA 2Z3YA 2HKXA 2P4WA 3SHFA 2HEOA 4WF2A 2K4BA 1FBQA 2OBPA 3EDPA 3QU3A 3WTTC 4HV6A 4PCQA 2AS5F 3I4PA 3LWFA 3CUQA 3R0JA 1TQMA 1WSUA 1V4RA 2YR2A 5ILVA 3TOBA 4LLGF 1T38A 3ZPLA 5L3CA 2EV0A 1SFEA 3F8MA 4EJWA 2VE9A 2V1UA 2FBKA 4ZYEA 3HRTA 2VC1A 1FYLA 4AD9A 2FXAA 5D5UB 2P6SA 5LEKA 4F7ZA 2LF8A 4I2OA 2QQBA 2PG4A 5DUIA 4CYDA 2MLGA 4JQFA 1T0FA 1Q1HA 4ESFA 2XROA 1J5YA 1ZREA 4S05A 2QVOA 2OD5A 3DV8A 1TW2A 2MC3A 2GA2A 2M87A 3AAFA 2DI3A 4U88A 4KT5C 4Q4ZF 3J80K 2EV6A 4HA8A 2JPCA 2XV4S 5HLGA 5HLIA 1TTYA 4XSZF 3U1DA 2G9WA 4B09A 3WTXC 4MEYF 1REPC 2HTSA 2OU2A 1RUNA 1XSVA 2P8TA 3BOQA 2DPDA 2DQRA 2FOKA 2LF7A 2A6HF 1IXRC 4LD5A 5D5XB 1W5SA 3CTAA 3H3ZA 4XLNF 1MD0A 4UHTA 1K6OA 1O3SA 1ZGAA 3KZYA 5DCMB 4HQEA 4P5OA 2Y75A 1R58A 4OMYA 3KLNA 3PQKA 1LDKB 1TW3A 1DP7P 2VN2A 2IP2A 3KCCA 3ML6A 2HTJA 3RKXA 4HLYA 5H20A 2XAQA 2L01A 3CUOA 2K27A 3JAMK 5D8KB 3CDHA 4HLXA 3J7AO 5FD6A 1RNLA 2DK8A 5IT3A 1LEBA 4G6DA 2QWWA 3NQOA 2HWVA 3ZMSA 4L18B 4A2UA 4HF0A 2Z33A 2K4JA 4L5JA 4G8XA 4A0YA 5JFRA 1ZHFA 2WWYA 3BWGA 3RI4A 1I1GA 4ZYHA 2L3DA 2H09A 4GGGA 3P9KA 1B1BA 3RYRA 5IT9Z 2NYXA 3HTSB 2F5DA 1U5TC 2LDUA 4ETSA 1FT9A 2QLZA 3I5UA 1KYZA 2F5CA 2D2WA 3KP7A 4CXFA 1DDNA 4OIRF 3WGIA 4L9TA 1YW7A 1YO5C 4UNOA 5ILUA 5LBQA 1FP2A 1IRGA 4P9FA 3ROUA 1LNWA 1JGSA 4HYEA 1O57A 2DPUA 1DPUA 3K1MA 1X3UA 1LDDA 4RGSA 4HDVA 2ADUA 3O6BB 2V1XA 4RGRA 3E5UA 3RTRA 3ABUA 3EUHA 1WI9A 5TRDA 1D8KA 1I6XA 3TDUC 1J7KA 4Q5SF 2ZCWA 1OYIA 4M6YA 1IZ1A 2EB7A 4YFKF 2VBYA 4ZYDA 2V1DA 1E2XA 4RB0A 1XCVA 1Z7UA 2K86A 3LQQA 1PP8F 2MBFA 4LLNA 2W85A 4A5NA 4RB1A 5D6FA 1SD6A 3MZHA 2HKOA 1Z91A 5H6QA 2FBHA 3WU0A 3CLOA 3VB2A 2UXNA 1ZG3A 4BAYA 2ELHA 2A61A 3IWFA 2JRTA 4EJTA 2RQPA 3HIFA 1KQ0A 1B9NA 4RAYA 2EFNA 2CWEA 1WWXA 4P55A 2DAOA 4PZJA 3LSTA 4IPAA 5E1XA 5LGUA 2QBYB 4BXUA 3FMQA 1Z05A 2HYFA 3RKYA 1LB2A 2FNAA 1B9MA 3RYPA 2VONA 4EM1A 2YX7A 2R7FA 1GXQA 1R36A 1JXSA 2PMUA 5FD5A 1A04A 4AIHA 3FZVA 3FHZA 2LKPA 2VOPA 1S8NA 3ZMVA 1LEAA 1XMAA 3QPTA 1U78A 4ESJA 4M73A 1Z6TA 5CLSA 2V9VA 4GYIA 1J9IA 3TO7A 3M9AA 2P5LC 2JTVA 1FC3A 3WU1B 2H6BA 3KZZA 4AIJA 1XB4A 3E6CC 4XBFA 4N9HA 3P9CA 3C7JA 5AIPA 2IT0A 2PI0A 4WCGA 4YG2F 3KP3A 2GIVA 3CO7C 3E6BA 3EETA 3GYHX 2HYGD 2GXBA 3FX3A 1W7PB 2XKPA 4K2EA 1HQCA 2PN6A 2MD5A 3J80Z 2EFPA 1ZRCA 2CYYA 2WC2A 1MJBA 3REOA 3EYIA 1R5GA 1HSTA 1TQIA 1XGSA 3KLOA 3W6KB 1IN7A 1U5TB 5D4SA 3N97A 3P7NA 3F8NA 2GQQA 1XDUA 5D5VB 3RKWA 2ETHA 2PMHA 4M9SA 5HOOA 3VFZA 2E7WA 1ONVA 3FF5A 4KA4A 1G3TA 2ZNYA 3WE3A 1FX7A 3BPXA 1SD4A 3CUQC 1MZBA 5BS6A 4WXDA 1UCRA 2MH9A 2COMA 4LK1F 3O2PE 5E8IA 5J8CA 3BJ6A 3I59B 1OPCA 5LRRA 4B8XA 3L2CA 1OYWA 3ZQ7A 4M74A 1ZYRF 1BI2A 4ZH4F 4HF2A 3E5QA 4S04A 2EJRA 1J59A 1KU9A 4OU0A 4KFCA 4LFUA 2K02A 3J81K 2HR3A 4LK0F 3VEPA 4ESBA 1KYWA 4BQAA 1IF1A 4A5MA 1UB9A 1KQ8A 2HFHA 1S7OA 3JAMZ 4R8HA 4EJOA 2D1HA 2XAFA 3I0TA 1W5TA 5KK1A 3Q5FA 1UHWA 4LG0A 3HOTA 4A0XA 4IF4A 4HQMA 2ZJ2A 3DEUA 4UXNA 2EA2A 2YSRA 4NHJA 4MEXF 3V7SA 2L02A 1Z1DA 2A3SA 3LAPA 3K1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHU A;  2F5F A;  3QP5 A;  4HDU A;  1XCB A;  4I01 A;  4L9J A;  2RVC A;  4CGZ A;  5CVV A;  1K79 A;  2RV8 A;  4BNC A;  5BMZ A;  5E1Z B;  4GYG A;  3L9F A;  3IRR A;  3H92 A;  3TGN A;  4I7H A;  3K0L A;  2PJP A;  2JPB A;  3FWE A;  3R60 A;  4Q47 A;  3CJN A;  1EH8 A;  3PQJ A;  4YII A;  3HYI A;  4UVA A;  3TO6 A;  5HS9 A;  1U8R A;  1T39 A;  4A0Z A;  5CVJ A;  5LHG A;  4HX8 A;  5L3F A;  2VE8 A;  1TLH B;  2QYO A;  2ACJ A;  3KP4 A;  2VT3 A;  2W57 A;  3GFI A;  3BJA A;  4FX0 A;  3GEZ A;  1R5H A;  2OZU A;  5FGM A;  4IVN A;  3GZ5 A;  1BIB A;  2IPQ X;  1FYK A;  1MDM A;  1T6S A;  1TNT A;  3KP2 A;  2MH2 A;  2BEO A;  4UV9 A;  2W25 A;  3S2W A;  1UST A;  1K78 A;  4L9N A;  4UV8 A;  5LGN A;  3LAJ A;  4UUV A;  4IXA A;  1H0M A;  1QZZ A;  4N9I A;  2M45 A;  5D4R A;  1V3F A;  1BC8 C;  5LLQ A;  5K5O A;  1F9N A;  5E8G A;  3M1E A;  4EJV A;  5K1Y A;  4I0B A;  1XSD A;  3JSP A;  1U6G A;  1JHF A;  3DQV C;  1IW7 F;  2H6C A;  4XSX F;  1GHC A;  3GUD A;  2Y48 A;  4TV7 A;  4I02 A;  1DPR A;  5E17 F;  1I27 A;  3FXU A;  1QGP A;  1FZP B;  3IKV A;  1XGN A;  5DD8 A;  2HDC A;  3HOS A;  4P96 A;  5D8L B;  2PQ8 A;  4KN7 X;  5F64 A;  5E20 A;  4KN4 X;  3SFZ A;  3T8T A;  5J6X A;  3HTU A;  4ENM A;  1TNS A;  1ODD A;  2F2E A;  3CUQ B;  2GZW A;  5DUK A;  1IRF A;  3IKT A;  2RKH A;  3EQL F;  4U0V A;  5LRS A;  5AON A;  2GXG A;  3F6O A;  2O61 A;  1UFM A;  4M71 A;  3L09 A;  1STZ A;  5CVI A;  1BM9 A;  3WGH A;  4MTD A;  2E7X A;  1ON2 A;  3F72 A;  2G7H A;  1LQ1 A;  1EV7 A;  3SXY A;  4HW0 A;  1ZGJ A;  2CO5 A;  3MCZ A;  1HSJ A;  4O5V A;  3EYY A;  3M8F A;  4G7H F;  1O7L A;  5CVR A;  3F23 A;  3LFK A;  1SMY F;  4Z2Y A;  3F22 A;  1T2K A;  2KJB A;  3RIR A;  3HSE A;  3U9G A;  2A5Y B;  2NAZ A;  3I64 A;  1LVA A;  2ZME A;  3GW2 A;  1AOY A;  1W4M A;  2J5P A;  1KU2 A;  4DQ2 A;  1H9T A;  5BPD A;  1TBX A;  3WTY C;  4L9V A;  4CDG A;  2NRA C;  4MTE A;  2ESH A;  1FBU A;  2P5K A;  3GXO A;  3BY6 A;  5HLH A;  2KIU A;  4HV5 A;  2RN7 A;  2DTR A;  2DK5 A;  4ON0 A;  3HSR A;  2CFX A;  3CO6 C;  1KU3 A;  1SFX A;  3P9I A;  1FYM A;  1IN4 A;  1HW5 A;  1YLF A;  4KUM A;  2NNY A;  1FBS A;  1HKS A;  3V7C A;  2VXZ A;  5DV5 A;  3ISP A;  4LJZ F;  2W84 A;  2CG4 A;  5HS7 A;  4PGG A;  3WG9 A;  1G3Y A;  4RGU A;  3ZN1 A;  1F4K A;  5HDK A;  3PFI A;  1OYY A;  2DQL A;  2XAH A;  3F8C A;  4NQW A;  4JBA A;  1R7J A;  4M9Z A;  3BJO A;  1WQ2 A;  2Q8K A;  2FML A;  4KMF A;  3ZMD A;  5FB2 A;  4IHS A;  5K5Q A;  4H0E A;  3J81 Z;  2NS0 A;  3V8K A;  3LQR A;  5L3E A;  3QPH A;  2Z5U A;  1PUE E;  3BDD A;  2XHK A;  4OIN F;  1XGM A;  4U7D A;  6PAX A;  4MNU A;  1GVJ A;  2O03 A;  1PP7 U;  3MFK A;  3K9T A;  3F8B A;  1MKM A;  2PLY A;  1O3Q A;  1NHA A;  5LHI A;  2ZXJ A;  3LA7 A;  1G6N A;  3JTG A;  1UHM A;  3DPT A;  1FWZ A;  1YTY A;  1YW9 A;  4FHT A;  3IL2 A;  4G9Y A;  2BBY A;  4KNY A;  3IRQ A;  4RB3 C;  3FM5 A;  4BH9 A;  2A6E F;  5ILS A;  4Y13 A;  3I58 A;  4LLL A;  1GXP A;  5E1W A;  3ZMZ A;  1FPQ A;  2EK5 A;  2ZME B;  4ZZL A;  1HXD A;  2EA4 A;  2FE3 A;  3GWZ A;  2XUB A;  2VOD A;  1B4A A;  3ZMT A;  4ZYG A;  3JSO A;  1YQA A;  3ZP5 A;  1ULY A;  4OOI A;  3DP7 A;  3QAH A;  1KA8 A;  2A68 F;  3B73 A;  2CGP A;  1ZRF A;  1R23 A;  2FSW A;  1RIO H;  5F6F A;  1WRJ A;  2NNN A;  2OZ6 A;  2KRF A;  2XAG A;  1J2X A;  1IN6 A;  2WV0 A;  4KIF A;  3HSF A;  2HQR A;  4UVC A;  1ZAR A;  2ZNZ A;  4I0A A;  4MQV A;  4L0Y B;  1G4D A;  4UVB A;  5KVR A;  2RDP A;  1XDS A;  2E1N A;  1BI0 A;  2J5O A;  1ZN2 A;  1FY7 A;  4EVI A;  4RS8 A;  2ISZ A;  3OOP A;  1B59 A;  1RI7 A;  2O0Y A;  3LA2 A;  3WGG A;  1BC7 C;  4WXH A;  3RPU A;  1ZAO A;  4CHU A;  3TQN A;  1KU7 A;  2FA5 A;  4BHP A;  3T0Y A;  5ED4 A;  3C18 A;  4EQQ A;  4YFX F;  5LHH A;  2IA1 A;  4GO1 A;  1S3J A;  1P92 A;  2O3F A;  2YX4 A;  1BI1 A;  3GO5 A;  4HX4 A;  1YYV A;  2OAZ A;  2RNJ A;  4A6E A;  2Y0M A;  3GFJ A;  1O3R A;  2ISY A;  1R1V A;  4BHB A;  1E17 A;  4R1H A;  3Q9S A;  1IAW A;  1MJA A;  4ENK A;  1FLI A;  3G3Z A;  3C3W A;  4PGH A;  2IW5 A;  1FP1 D;  4EJU A;  2CW0 F;  1XN7 A;  3WE2 A;  2OQR A;  1MGT A;  2AXL A;  3VOD A;  1F1Z A;  3TDZ C;  5LEJ A;  2DU9 A;  3DF8 A;  1P4X A;  2Z9O A;  1ZH5 A;  2IRF G;  1FOK A;  1KQ9 A;  1CGP A;  1QNT A;  2XVC A;  5L3B A;  3HRU A;  3KP5 A;  4MQ9 F;  3TO9 A;  1R1U A;  4G94 A;  1USS A;  2QM3 A;  5DCM A;  4DNC A;  4EGZ A;  3WTU C;  1HW1 A;  3KE2 A;  5ICC A;  3TKY A;  2DT5 A;  1FSE A;  2O8X A;  3WOD F;  4O6J A;  4IRH A;  4O3M A;  3WTW C;  3GFM A;  1JHH A;  2QEN A;  2MLK A;  4BHC A;  4E70 A;  3GVA A;  4WXC A;  5JVT A;  3R6S A;  2QUF A;  3MZY A;  2GWR A;  3V8J A;  4EM0 B;  3V8L A;  2R3S A;  3FXR A;  4MHG A;  4HF1 A;  3U2R A;  2PBI A;  3T5X A;  2L54 A;  4RB2 C;  3I53 A;  5LGT A;  4R79 A;  1HW2 A;  4WK8 F;  1P2F A;  3KEQ A;  2PFB A;  4D0P A;  2K7L A;  2M1B A;  2VBW A;  2XKO A;  2STT A;  2GAU A;  3ABT A;  1BI3 A;  3L00 A;  3R0A A;  2ESN A;  2OA4 A;  3F3X A;  4L5I A;  4EM2 A;  2R7D A;  3ZN0 A;  5TJJ A;  1R1T A;  2IA2 A;  2DBB A;  2EFO A;  1K7A A;  3MWM A;  3NEU A;  1XSX A;  4M72 A;  2HZT A;  2UWM A;  2ZO4 A;  4IHT A;  3T8R A;  3I54 A;  4HZF A;  1MJ9 A;  1T98 A;  1IUY A;  2B0L A;  2FMY A;  2XGX A;  3COA C;  2HS5 A;  3BRO A;  1IXS B;  1EH6 A;  4JK1 X;  4KDP A;  1SD5 A;  4KIB A;  2IVM A;  2JSC A;  2RGV A;  5DDG A;  1KGS A;  4FT8 A;  5HDG A;  3F8F A;  1D8J A;  2C6Y A;  4A6D A;  3G73 A;  3C1D A;  4LG0 B;  1SFU A;  4G6Q A;  1I1S A;  5D5W B;  2G7U A;  2YPR A;  1XMK A;  1S6L A;  4KIC A;  3LA3 A;  2A07 F;  5H6R A;  3D0S A;  1XD7 A;  2BE5 F;  4CIC A;  1BN5 A;  4GXO A;  2UZK A;  3E6M A;  1J0R A;  1C0W A;  3L7W A;  5D6E A;  1OR7 A;  3Q9V A;  2QQA A;  1O7F A;  1RUO A;  4XRF A;  5DCF A;  2VBX A;  4OMZ A;  5HS8 A;  2LNB A;  2A69 F;  5FLX K;  4IJA A;  1B6A A;  2QZ8 A;  4EMS A;  4AIK A;  1EH7 A;  3W6J B;  1HKQ A;  1Z9C A;  2DFI A;  5A2Q Z;  2BYV E;  2WTE A;  3D5L A;  4WX9 A;  3FMS A;  4HAM A;  1F5T A;  3ELK A;  3GZ6 A;  5DEQ A;  4EGY A;  3O3K A;  3ECO A;  3N4M A;  2EWN A;  2EFW A;  1IN5 A;  2EV5 A;  5K5R A;  4U0W A;  3WTV C;  2FRH A;  3DPL C;  2M30 A;  2QBY A;  3JW4 A;  1MDM B;  4IRI A;  1YS7 A;  3M7G A;  5FFX A;  1H9G A;  2GA1 A;  1YFH A;  2JZY A;  4NB5 A;  1XGO A;  3IWZ A;  1K78 B;  3DXJ F;  1DUX C;  3HRS A;  4YIF A;  3KP6 A;  1R00 A;  1ZLK A;  4QLC U;  4CZZ A;  3RDI A;  4EV0 A;  5E18 F;  2ZBK A;  1VTN C;  3MEX A;  1Y0U A;  5FFZ A;  5HDN A;  3HHH A;  2ZFW A;  1TQP A;  4BYY A;  4ASN A;  1D3Y A;  2ZKZ A;  3QP6 A;  3BP8 A;  3SZT A;  2IJL A;  3IHU A;  2Q0O A;  5JI6 A;  2H94 A;  3F6V A;  2VOO A;  2EFQ A;  2BGC A;  4LB5 A;  2RC4 A;  2L4A A;  2DW4 A;  4A12 A;  3MQ0 A;  4AWX B;  2HOE A;  4RGX A;  1QZY A;  4U0Y A;  2KIM A;  3GF2 A;  4KYW A;  2XAS A;  1LJ9 A;  1G3S A;  5BPI A;  5BQT A;  4P9U A;  2D1V A;  4OIP F;  1RZ4 A;  2DO7 A;  1BBY A;  1OMI A;  3E5X A;  4OIQ F;  1W7P A;  1P4W A;  5CVU A;  3FM3 A;  4L0Z B;  3KEO A;  5ICF A;  1P4A A;  1L3L A;  4I09 A;  3K69 A;  3SQN A;  3TOA A;  2TDX A;  3FXQ A;  4Y15 A;  4ENN A;  1YW8 A;  4ZZD A;  2XIG A;  3B02 A;  1YIO A;  1W7P D;  4LB6 B;  1U5T A;  3HRM A;  1ZG5 A;  3DKW A;  2YU3 A;  2JT1 A;  3GX4 X;  1S29 A;  5FO5 A;  5DYM A;  3VOE A;  3IC7 A;  5DD4 A;  1BIA A;  2E1C A;  2VT2 A;  5J8F A;  4FX4 A;  2F5E A;  3F21 A;  4G7Z F;  3SZP A;  4PDK A;  4LGW A;  3I59 A;  5EEG A;  4GCV A;  1BJA A;  2M8E A;  2VBZ A;  3T1B A;  3RJP A;  2XRN A;  5L3G A;  2MA3 A;  4RAZ A;  5JR3 A;  4M9X A;  3E97 A;  3WTZ A;  1SMT A;  3ERE D;  2VC0 A;  2P5V A;  3I71 A;  5L3D A;  1JE8 A;  5A2Q K;  2CQK A;  4XLP F;  3HUG A;  3E6D A;  4U7B A;  1CF7 A;  4G7O F;  3QRF F;  2KIF A;  2V6C A;  4I98 B;  2FBI A;  5ICG A;  2FNP A;  5ERI A;  3MAJ A;  1WKM A;  1I5Z A;  3DFG A;  1P6R A;  4OIO F;  4AVP A;  2BV6 A;  1O3T A;  5IT9 K;  4KIG A;  5CJ9 A;  2IA0 A;  2LSO A;  5EEH A;  1R22 A;  1OKR A;  2HGC A;  4HX7 A;  1ZLJ A;  2P6T A;  1L0O C;  1YG2 A;  3ECH A;  2UXX A;  5BOX A;  3R4K A;  3ZMU A;  3FMR A;  3V4G A;  3OV8 A;  3WTS C;  1ZRD A;  3E3V A;  2H27 A;  2CSO A;  1J75 A;  2FF4 A;  2KKO A;  1U2W A;  4CO8 A;  2P7C B;  2XAJ A;  3HHG A;  1ON1 A;  4LMY A;  4ENJ A;  1U3E M;  2FEZ A;  1QQI A;  2DLL A;  4WWC A;  2M5W A;  2OQG A;  3JTH A;  2O6G E;  2KJC A;  3GFL A;  2FQ3 A;  1AWC A;  4QWQ A;  1Z6R A;  1PDN C;  2Z99 A;  3ULQ B;  5CYV A;  2P7V B;  4YFN F;  2HQN A;  2L4M A;  3KFW X;  3V7R A;  1G3W A;  1ZG1 A;  1SD7 A;  3KET A;  2W24 A;  5F1R A;  1QBJ A;  4KMU X;  2PEX A;  2STW A;  4Q48 A;  3BPV A;  4IRG A;  4Y17 A;  1FNN A;  1IXC A;  3BZ6 A;  4M6X A;  1SAX A;  5ICE A;  3QU6 A;  1D5V A;  3RPQ A;  3K1P A;  5HVQ C;  3K2Z A;  4N0B A;  2V79 A;  1YS6 A;  2FU4 A;  3NRV A;  3QOP A;  1LDJ A;  4HBL A;  4MGR A;  1S7A A;  5FLX Z;  2Q2E A;  2X4H A;  4HOB A;  2QQ9 A;  1FSH A;  3GLX A;  1CF7 B;  1HKT A;  3M8E A;  1IN8 A;  3H3U A;  1HBX G;  1QPM A;  3R61 A;  2D45 A;  2X0L A;  5AIQ A;  1QO0 D;  1BOA A;  2Z3Y A;  2HKX A;  2P4W A;  3SHF A;  2HEO A;  4WF2 A;  2K4B A;  1FBQ A;  2OBP A;  3EDP A;  3QU3 A;  3WTT C;  4HV6 A;  4PCQ A;  2AS5 F;  3I4P A;  3LWF A;  3CUQ A;  3R0J A;  1TQM A;  1WSU A;  1V4R A;  2YR2 A;  5ILV A;  3TOB A;  4LLG F;  1T38 A;  3ZPL A;  5L3C A;  2EV0 A;  1SFE A;  3F8M A;  4EJW A;  2VE9 A;  2V1U A;  2FBK A;  4ZYE A;  3HRT A;  2VC1 A;  1FYL A;  4AD9 A;  2FXA A;  5D5U B;  2P6S A;  5LEK A;  4F7Z A;  2LF8 A;  4I2O A;  2QQB A;  2PG4 A;  5DUI A;  4CYD A;  2MLG A;  4JQF A;  1T0F A;  1Q1H A;  4ESF A;  2XRO A;  1J5Y A;  1ZRE A;  4S05 A;  2QVO A;  2OD5 A;  3DV8 A;  1TW2 A;  2MC3 A;  2GA2 A;  2M87 A;  3AAF A;  2DI3 A;  4U88 A;  4KT5 C;  4Q4Z F;  3J80 K;  2EV6 A;  4HA8 A;  2JPC A;  2XV4 S;  5HLG A;  5HLI A;  1TTY A;  4XSZ F;  3U1D A;  2G9W A;  4B09 A;  3WTX C;  4MEY F;  1REP C;  2HTS A;  2OU2 A;  1RUN A;  1XSV A;  2P8T A;  3BOQ A;  2DPD A;  2DQR A;  2FOK A;  2LF7 A;  2A6H F;  1IXR C;  4LD5 A;  5D5X B;  1W5S A;  3CTA A;  3H3Z A;  4XLN F;  1MD0 A;  4UHT A;  1K6O A;  1O3S A;  1ZGA A;  3KZY A;  5DCM B;  4HQE A;  4P5O A;  2Y75 A;  1R58 A;  4OMY A;  3KLN A;  3PQK A;  1LDK B;  1TW3 A;  1DP7 P;  2VN2 A;  2IP2 A;  3KCC A;  3ML6 A;  2HTJ A;  3RKX A;  4HLY A;  5H20 A;  2XAQ A;  2L01 A;  3CUO A;  2K27 A;  3JAM K;  5D8K B;  3CDH A;  4HLX A;  3J7A O;  5FD6 A;  1RNL A;  2DK8 A;  5IT3 A;  1LEB A;  4G6D A;  2QWW A;  3NQO A;  2HWV A;  3ZMS A;  4L18 B;  4A2U A;  4HF0 A;  2Z33 A;  2K4J A;  4L5J A;  4G8X A;  4A0Y A;  5JFR A;  1ZHF A;  2WWY A;  3BWG A;  3RI4 A;  1I1G A;  4ZYH A;  2L3D A;  2H09 A;  4GGG A;  3P9K A;  1B1B A;  3RYR A;  5IT9 Z;  2NYX A;  3HTS B;  2F5D A;  1U5T C;  2LDU A;  4ETS A;  1FT9 A;  2QLZ A;  3I5U A;  1KYZ A;  2F5C A;  2D2W A;  3KP7 A;  4CXF A;  1DDN A;  4OIR F;  3WGI A;  4L9T A;  1YW7 A;  1YO5 C;  4UNO A;  5ILU A;  5LBQ A;  1FP2 A;  1IRG A;  4P9F A;  3ROU A;  1LNW A;  1JGS A;  4HYE A;  1O57 A;  2DPU A;  1DPU A;  3K1M A;  1X3U A;  1LDD A;  4RGS A;  4HDV A;  2ADU A;  3O6B B;  2V1X A;  4RGR A;  3E5U A;  3RTR A;  3ABU A;  3EUH A;  1WI9 A;  5TRD A;  1D8K A;  1I6X A;  3TDU C;  1J7K A;  4Q5S F;  2ZCW A;  1OYI A;  4M6Y A;  1IZ1 A;  2EB7 A;  4YFK F;  2VBY A;  4ZYD A;  2V1D A;  1E2X A;  4RB0 A;  1XCV A;  1Z7U A;  2K86 A;  3LQQ A;  1PP8 F;  2MBF A;  4LLN A;  2W85 A;  4A5N A;  4RB1 A;  5D6F A;  1SD6 A;  3MZH A;  2HKO A;  1Z91 A;  5H6Q A;  2FBH A;  3WU0 A;  3CLO A;  3VB2 A;  2UXN A;  1ZG3 A;  4BAY A;  2ELH A;  2A61 A;  3IWF A;  2JRT A;  4EJT A;  2RQP A;  3HIF A;  1KQ0 A;  1B9N A;  4RAY A;  2EFN A;  2CWE A;  1WWX A;  4P55 A;  2DAO A;  4PZJ A;  3LST A;  4IPA A;  5E1X A;  5LGU A;  2QBY B;  4BXU A;  3FMQ A;  1Z05 A;  2HYF A;  3RKY A;  1LB2 A;  2FNA A;  1B9M A;  3RYP A;  2VON A;  4EM1 A;  2YX7 A;  2R7F A;  1GXQ A;  1R36 A;  1JXS A;  2PMU A;  5FD5 A;  1A04 A;  4AIH A;  3FZV A;  3FHZ A;  2LKP A;  2VOP A;  1S8N A;  3ZMV A;  1LEA A;  1XMA A;  3QPT A;  1U78 A;  4ESJ A;  4M73 A;  1Z6T A;  5CLS A;  2V9V A;  4GYI A;  1J9I A;  3TO7 A;  3M9A A;  2P5L C;  2JTV A;  1FC3 A;  3WU1 B;  2H6B A;  3KZZ A;  4AIJ A;  1XB4 A;  3E6C C;  4XBF A;  4N9H A;  3P9C A;  3C7J A;  5AIP A;  2IT0 A;  2PI0 A;  4WCG A;  4YG2 F;  3KP3 A;  2GIV A;  3CO7 C;  3E6B A;  3EET A;  3GYH X;  2HYG D;  2GXB A;  3FX3 A;  1W7P B;  2XKP A;  4K2E A;  1HQC A;  2PN6 A;  2MD5 A;  3J80 Z;  2EFP A;  1ZRC A;  2CYY A;  2WC2 A;  1MJB A;  3REO A;  3EYI A;  1R5G A;  1HST A;  1TQI A;  1XGS A;  3KLO A;  3W6K B;  1IN7 A;  1U5T B;  5D4S A;  3N97 A;  3P7N A;  3F8N A;  2GQQ A;  1XDU A;  5D5V B;  3RKW A;  2ETH A;  2PMH A;  4M9S A;  5HOO A;  3VFZ A;  2E7W A;  1ONV A;  3FF5 A;  4KA4 A;  1G3T A;  2ZNY A;  3WE3 A;  1FX7 A;  3BPX A;  1SD4 A;  3CUQ C;  1MZB A;  5BS6 A;  4WXD A;  1UCR A;  2MH9 A;  2COM A;  4LK1 F;  3O2P E;  5E8I A;  5J8C A;  3BJ6 A;  3I59 B;  1OPC A;  5LRR A;  4B8X A;  3L2C A;  1OYW A;  3ZQ7 A;  4M74 A;  1ZYR F;  1BI2 A;  4ZH4 F;  4HF2 A;  3E5Q A;  4S04 A;  2EJR A;  1J59 A;  1KU9 A;  4OU0 A;  4KFC A;  4LFU A;  2K02 A;  3J81 K;  2HR3 A;  4LK0 F;  3VEP A;  4ESB A;  1KYW A;  4BQA A;  1IF1 A;  4A5M A;  1UB9 A;  1KQ8 A;  2HFH A;  1S7O A;  3JAM Z;  4R8H A;  4EJO A;  2D1H A;  2XAF A;  3I0T A;  1W5T A;  5KK1 A;  3Q5F A;  1UHW A;  4LG0 A;  3HOT A;  4A0X A;  4IF4 A;  4HQM A;  2ZJ2 A;  3DEU A;  4UXN A;  2EA2 A;  2YSR A;  4NHJ A;  4MEX F;  3V7S A;  2L02 A;  1Z1D A;  2A3S A;  3LAP A;  3K1N A; 
#chains in the Genus database with same CATH topology
 3QOD A;  5JHU A;  1A36 A;  4IOA F;  2F5F A;  3QP5 A;  1IUF A;  2AO9 A;  3FIW A;  1XCB A;  4HDU A;  5J1R A;  2KLO A;  2NVQ J;  2BW3 A;  4ZC3 A;  4I01 A;  4L9J A;  3HOV J;  1I3Q J;  2RVC A;  5KHD A;  4J00 A;  4CGZ A;  5CVV A;  1K79 A;  2RV8 A;  4BNC A;  2IGK A;  1QVU A;  4RMN A;  5BMZ A;  5E1Z B;  2VLA A;  4GYG A;  3L9F A;  3IRR A;  1H88 C;  3H92 A;  3TGN A;  4I7H A;  1BR1 A;  3K0L A;  4Y7N J;  3CJQ B;  2PJP A;  2JPB A;  3FWE A;  3R60 A;  4Q47 A;  3CJN A;  2R7Q A;  1FJL A;  1EH8 A;  2LFB A;  1R5I D;  3PQJ A;  4YII A;  3HYI A;  4UVA A;  2FJ1 A;  3TO6 A;  3WHC A;  5HS9 A;  1U8R A;  1RR7 A;  5IP6 A;  1T39 A;  4A0Z A;  4XLA A;  5CVJ A;  5LHG A;  4HX8 A;  5L3F A;  2VE8 A;  1TLH B;  3ZQI A;  4CCN A;  2CUZ A;  2QYO A;  4C3H J;  2ACJ A;  2HDD A;  3KP4 A;  2VT3 A;  1IV6 A;  3K4K A;  2EH3 A;  2V7F A;  2W57 A;  2XAU A;  2KIQ A;  2K3F A;  3LSH A;  3HBL A;  3GFI A;  3BJA A;  4FX0 A;  3GEZ A;  1R5H A;  2Y69 H;  1JJ6 C;  2OZU A;  3ZQF A;  1DGR M;  2FUG 2;  5FGM A;  1JKP C;  4IVN A;  4AYB N;  4GFB A;  3GZ5 A;  1BIB A;  2LLK A;  2O9L A;  2N8G A;  4L5E A;  2IPQ X;  2HZD A;  1FYK A;  1Y8Q B;  1MDM A;  1T6S A;  4E6K G;  3BR2 A;  5C4X J;  1TNT A;  3KP2 A;  2MH2 A;  3X2Q H;  2BEO A;  4DJA A;  4UV9 A;  2W25 A;  3S2W A;  3K4J A;  1UST A;  1K78 A;  1LE8 A;  4L9N A;  4UV8 A;  5LGN A;  3LAJ A;  5IOZ A;  4UUV A;  1X2N A;  3OSG A;  2XPW A;  1JKR C;  3HPG A;  4XOR A;  4IXA A;  1H0M A;  1QZZ A;  4N9I A;  2M45 A;  5D4R A;  1Y1W J;  1VQ4 I;  2XSJ C;  1V3F A;  1BC8 C;  5LLQ A;  4AID A;  5K5O A;  4BEH A;  1F9N A;  2VAS A;  4C3J J;  1ZQ3 P;  5E8G A;  1Z67 A;  3M1E A;  4EJV A;  2QQ8 A;  2QSH X;  5K1Y A;  3CCR I;  4I0B A;  1XSD A;  4XMY A;  3JSP A;  1U6G A;  2M3A A;  3OR1 C;  2R0Q C;  1JHF A;  3BR0 A;  3DQV C;  2LH9 A;  3KYD B;  2VJI A;  1WZ2 A;  3CCU I;  3VYU B;  1IW7 F;  2H6C A;  3SEZ A;  1LFB A;  3H35 A;  3S14 J;  4XSX F;  3CC4 I;  1GDT A;  4F52 A;  3OL3 A;  1GHC A;  3GUD A;  3PFY A;  3MKY B;  1X19 A;  2Y48 A;  4TV7 A;  4I02 A;  1DPR A;  5KAF C;  1Z7L A;  5E17 F;  2Q2E B;  3S3M A;  1I27 A;  2HYJ A;  5CQE A;  3FXU A;  2CUE A;  3F0C A;  1QGP A;  1UHS A;  1HDD C;  1FZP B;  4NUB A;  1XPX A;  3IKV A;  3OYF A;  3S3O A;  2RQQ A;  1XGN A;  5DD8 A;  4HNU A;  3BR5 A;  2EBI A;  2HDC A;  1FMV A;  3DTK A;  3ZOB A;  5HLT A;  2M8G X;  4B47 A;  3H36 A;  3LSM A;  4P96 A;  2OPT A;  5D8L B;  2PQ8 A;  3HOS A;  1R6R A;  5C3E J;  1ZGW A;  4KN7 X;  4V2F A;  3C2B A;  5F64 A;  2K9S A;  2K9N A;  5E20 A;  4KN4 X;  3SFZ A;  3T8T A;  3UR3 C;  5J6X A;  3HTU A;  4BAC A;  2UUZ A;  5E3L A;  4ENM A;  3S1Q J;  1TNS A;  3E0J B;  4N4N B;  1E3H A;  1ODD A;  2F2E A;  3CUQ B;  2GZW A;  3FXK A;  5DUK A;  2HVR A;  1IRF A;  1XS9 A;  4CCJ A;  3IKT A;  2R7R A;  2RKH A;  2L2O A;  3EQL F;  4U0V A;  5LRS A;  5E3O A;  1Z3Y A;  2L9N A;  4D9J A;  5AON A;  2GXG A;  3F6O A;  2O61 A;  1UFM A;  4G6T B;  4M71 A;  3L09 A;  1YHQ I;  5F0H A;  5GP9 A;  1STZ A;  5CVI A;  1GT0 C;  2V9K A;  1BM9 A;  3HDD A;  3WGH A;  2M2E A;  1VQK I;  4MTD A;  2E7X A;  1ON2 A;  3HC7 A;  1RKT A;  4U87 A;  1MBE A;  3CDI A;  3F72 A;  2G7H A;  1LQ1 A;  2F4I A;  4B3X A;  1EV7 A;  3SXY A;  4HW0 A;  4IQ4 A;  3LSI A;  3MKL A;  1VI0 A;  1ZGJ A;  2CO5 A;  2KP6 A;  3DBH B;  3MCZ A;  3GLL A;  1HSJ A;  2L9R A;  3I4M J;  1TZL A;  2GOX B;  4O5V A;  3MKW B;  3EYY A;  2E60 A;  3SYT A;  4UUS A;  3G4S I;  4BY1 J;  3M8F A;  5CPR B;  2M0C A;  4G7H F;  2NVT J;  1O7L A;  2DN0 A;  1R49 A;  5CVR A;  3LFK A;  3F23 A;  3K4L A;  1I3A A;  2MSY A;  1SMY F;  1DU0 A;  2R7V A;  5GTI C;  4Z2Y A;  3F22 A;  1T2K A;  1AA7 A;  3VWB A;  2KJB A;  3RIR A;  3HSE A;  3U9G A;  2A5Y B;  3CCY A;  2NAZ A;  5FRM A;  3I64 A;  1LVA A;  2X85 A;  1NH3 A;  1YJW I;  1JKQ C;  2ZME A;  1RET A;  1BOB A;  2ZJP F;  3GW2 A;  1MBK A;  1IG7 A;  1AOY A;  3CZ6 A;  3OMY A;  1W4M A;  2JA2 A;  3W2A A;  2A6T A;  2J5P A;  1KU2 A;  4DQ2 A;  1H9T A;  5BPD A;  1TBX A;  5TIS C;  3WTY C;  2CUF A;  4L9V A;  4XR6 A;  4CDG A;  2NRA C;  4MTE A;  3LNQ A;  2ESH A;  1FBU A;  2P5K A;  1ETO A;  3DWL E;  3BY6 A;  3GXO A;  4IEJ A;  3W3C A;  4M3D A;  5HLH A;  3QQA A;  2KIU A;  4HV5 A;  2RN7 A;  1SFK A;  2ELK A;  1OCO H;  1N75 A;  2DTR A;  2DK5 A;  2VKH A;  1VQN I;  4ON0 A;  4QPQ A;  3HSR A;  1FTT A;  2CFX A;  2KZG A;  1Z3X A;  1V54 H;  4D5C A;  4BJ6 C;  2GIZ A;  3CO6 C;  1MBG A;  4B1R A;  4XKW A;  1KU3 A;  1SFX A;  3P9I A;  2M34 A;  3P5J A;  1FYM A;  1IN4 A;  4KT6 A;  1WI3 A;  1HW5 A;  2WY8 Q;  4B48 A;  2XGE A;  1G2H A;  2CW8 A;  1YLF A;  3MVP A;  4NC7 A;  4DOZ A;  2DMU A;  4KUM A;  2XPU A;  2IS2 A;  1FIA A;  2NNY A;  1FBS A;  2W48 A;  5IP7 J;  1X1A A;  1HKS A;  3V7C A;  2VXZ A;  2YUS A;  5DV5 A;  2FD5 A;  3ISP A;  4LJZ F;  3W6V A;  2W84 A;  1MMG A;  2CG4 A;  5HS7 A;  4PGG A;  3WG9 A;  1G3Y A;  4RGU A;  3ZN1 A;  1F4K A;  5HDK A;  3PFI A;  3ZQC A;  1OYY A;  4PUS A;  2DQL A;  2XAH A;  3F8C A;  4NQW A;  1F43 A;  4JBA A;  1R7J A;  4BXF A;  4M9Z A;  4CH7 A;  3BJO A;  1WQ2 A;  2Q8K A;  2FML A;  4EEF G;  4KMF A;  1W1W E;  3ZMD A;  4LIU A;  4XLF A;  1YIT I;  5FB2 A;  2LMD A;  2X51 A;  4PJN A;  5IOY A;  2CV1 A;  3D5S C;  4IHS A;  5K5Q A;  4H0E A;  2JRM A;  3J81 Z;  2NS0 A;  4W1U A;  3SDB A;  1AKH B;  3V8K A;  3MZ8 A;  3LQR A;  5L3E A;  3QPH A;  3LSJ A;  2Z5U A;  2CUJ A;  1PUE E;  3ZQG A;  5GPC A;  3MMY B;  3BDD A;  1Z21 A;  2XHK A;  4OIN F;  1XGM A;  4U7D A;  1Y0N A;  6PAX A;  3C2H A;  1JGG A;  4CCO A;  2IBD A;  4MNU A;  1GVJ A;  2LYC A;  1K4T A;  3VSK A;  3PNV A;  2O03 A;  2E34 A;  1PP7 U;  3MFK A;  4FTH A;  1YX3 A;  3K9T A;  2DA7 A;  2HOA A;  4XK4 A;  3F8B A;  4A3K J;  3RZD J;  1MKM A;  4D5F A;  2PLY A;  1O3Q A;  1NHA A;  3N05 A;  3OIP A;  3K4N A;  5FKL A;  5LHI A;  2ZXJ A;  3LA7 A;  1G6N A;  3MN2 A;  1UHM A;  1ZK8 A;  1FWZ A;  3DPT A;  3G1O A;  3JTG A;  4G12 A;  1YTY A;  3OYM A;  1HF0 A;  1YW9 A;  2TCT A;  4E4H A;  4FHT A;  3IL2 A;  4B3A A;  1SVM A;  4G9Y A;  4NC8 A;  1F36 A;  4FE7 A;  1X3Z B;  5IP9 J;  2R92 J;  2BBY A;  3CMY A;  4KNY A;  4UUS B;  3IRQ A;  4RB3 C;  2Y30 A;  4HRI A;  1TT5 B;  3FM5 A;  2AQE A;  4LG3 A;  4BH9 A;  3CCL I;  2A6E F;  5ILS A;  4Y13 A;  4DIQ A;  2CU7 A;  3I58 A;  2NVX J;  2EIL H;  3HOX J;  4LLL A;  1GXP A;  5E1W A;  1WGX A;  3ZMZ A;  4E7K A;  1FPQ A;  2EK5 A;  4DBR A;  2EZH A;  2ZME B;  5TGT A;  4ZZL A;  3LOC A;  2OJE D;  2VQH A;  2ID3 A;  3S3N A;  1HXD A;  2EA4 A;  2FE3 A;  1WJF A;  1S5L C;  4C2M J;  3GWZ A;  2XUB A;  3H0G J;  2VOD A;  1B4A A;  3PL8 A;  1TP4 A;  3ZMT A;  4ZYG A;  3A02 A;  3JSO A;  1YQA A;  2NS8 A;  2K9L A;  1JUM A;  3ZP5 A;  1ULY A;  4F91 B;  4DGW B;  3CJR B;  4QPO A;  2VJ4 A;  4OOI A;  3BG9 A;  3DP7 A;  1HLV A;  2V6E A;  3QAH A;  4XN3 A;  3M07 A;  5E3M A;  1I39 A;  1KA8 A;  2VJJ A;  5IYC J;  1ACI A;  2JA5 J;  4A3D J;  2A68 F;  1MSF C;  3B73 A;  2CGP A;  1ZRF A;  5FRO A;  5LFA A;  1R23 A;  2FSW A;  2DJI A;  1RIO H;  1UG0 A;  5F6F A;  3OYN A;  3FK7 A;  2KPM A;  3KX2 A;  2K3P A;  1WRJ A;  2NNN A;  3HKZ A;  3L2Q A;  2R7X A;  2OZ6 A;  5KNL A;  2KRF A;  2XAG A;  2BHZ A;  1J2X A;  2L0K A;  1IN6 A;  4MO7 A;  2QSF X;  2WV0 A;  3BCA A;  4KIF A;  2ECB A;  2OF7 A;  3HSF A;  5B3S H;  5J47 A;  2HQR A;  4UVC A;  1ZAR A;  2ZNZ A;  2AHQ A;  4I0A A;  4MQV A;  3M1C A;  2LK2 A;  2DFE A;  4L0Y B;  1G4D A;  4N4O B;  4UVB A;  5EEA A;  2M7B A;  5KVR A;  5M3F J;  2RDP A;  3S15 J;  3S93 A;  1XDS A;  2K5C A;  1RRJ A;  4BE2 A;  2E1N A;  2XC7 A;  1BI0 A;  4PJL A;  5C4J J;  4NQW B;  2DXI A;  3FHN A;  1HOM A;  1EKE A;  2J5O A;  1TWF J;  1ZN2 A;  1JI8 A;  1YE9 A;  1TWA J;  4XM3 A;  1FY7 A;  5H2F C;  4YRV A;  3DBR B;  4EVI A;  2VQC A;  4RS8 A;  2AQF A;  3K10 A;  2ISZ A;  2OC6 A;  3BQZ A;  3OOP A;  1B59 A;  4HEA 2;  1RI7 A;  2O0Y A;  3LA2 A;  2P81 A;  2R5Z A;  3WGG A;  1BC7 C;  4WXH A;  4E7Z A;  3RPU A;  1ZAO A;  4CHU A;  3TQN A;  4HSR A;  1KU7 A;  2FA5 A;  2VPR A;  3T0Y A;  4BHP A;  3L2W A;  5ED4 A;  3C18 A;  4EQQ A;  4YFX F;  5LHH A;  1HA8 A;  2IA1 A;  3RZO J;  4GO1 A;  1S3J A;  1P92 A;  2O3F A;  3LSP A;  4BDZ A;  3ASO H;  5F27 A;  1MBJ A;  2L7F P;  1BI1 A;  2YX4 A;  3DLA A;  1QZE A;  3GO5 A;  1HCR A;  4HX4 A;  1JT0 A;  1YYV A;  2OAZ A;  3TL4 X;  3ZR8 X;  2NOJ B;  2RNJ A;  4A6E A;  4PJM A;  2Y0M A;  3GFJ A;  1O3R A;  1PJR A;  2ISY A;  3PO2 J;  2X1C A;  2E5Z A;  1R1V A;  4BHB A;  2X6O A;  4R1H A;  1E17 A;  5B5E C;  3Q9S A;  4RAG A;  1IAW A;  1BL0 A;  4AVZ A;  2BHY A;  1MJA A;  1SAU A;  4ENK A;  1FLI A;  3G3Z A;  3EUK L;  4ABZ A;  3C3W A;  4PGH A;  2EQR A;  2IW5 A;  3RSN A;  1FP1 D;  4EJU A;  2CW0 F;  1XN7 A;  3WE2 A;  2OQR A;  2I10 A;  1MGT A;  1MH4 A;  2CS3 A;  2AXL A;  3VOD A;  1F1Z A;  3TDZ C;  5LEJ A;  2DU9 A;  2X1E A;  1I50 J;  3DEW A;  3DF8 A;  1P4X A;  3ASN H;  2Z9O A;  1ZH5 A;  2IRF G;  2LY2 A;  1FOK A;  3QYF A;  1KQ9 A;  4ZYA A;  2PJR B;  1CGP A;  4IX7 A;  2PMZ A;  1QNT A;  2H1L A;  2XVC A;  5L3B A;  5J1Y A;  3OS2 A;  4XRM A;  2JA6 J;  3HRU A;  4X1E A;  1YRN B;  2KQR A;  3KP5 A;  3PNY A;  1MBH A;  4MQ9 F;  3TO9 A;  1R1U A;  4G94 A;  4HST A;  3TMO A;  1USS A;  5F08 A;  3BQY A;  3H5N A;  2QM3 A;  3OYB A;  2Z1D A;  4Z6Y A;  2AXT C;  5JVG F;  4QIW N;  3G71 I;  1W0T A;  5DCM A;  3OYD A;  1XTA A;  4DNC A;  4EGZ A;  3WTU C;  1HW1 A;  4M3F A;  3KE2 A;  2Y9Z A;  1EF4 A;  3H9G A;  1RPW A;  5ICC A;  2XDV A;  5J4Y A;  2ZJR F;  5E79 C;  4BY7 J;  1V55 H;  5GAD J;  3TKY A;  2DT5 A;  1FSE A;  4PSX A;  3W2W A;  4Y4R A;  2O8X A;  1YOV B;  3WOD F;  3S8P A;  4O6J A;  4IRH A;  4O3M A;  3WTW C;  5F0F A;  1G8X A;  3GFM A;  1JHH A;  2QEN A;  3CC2 I;  2MLK A;  4BHC A;  4E70 A;  1H89 C;  2RNG A;  3GVA A;  1VQ6 I;  4WXC A;  3CCJ I;  5JVT A;  1JKO C;  3MD2 A;  1U0J A;  4DZP A;  3BG7 A;  4FIS A;  3R6S A;  5KCM A;  3IH4 A;  2X9D A;  2QUF A;  1P9Q C;  3MZY A;  2DA6 A;  2GWR A;  2E36 A;  3LSG A;  3V8J A;  4EM0 B;  3V8L A;  2BOL A;  2R3S A;  3S2D J;  3FXR A;  4MHG A;  4HF1 A;  2V1N A;  3U2R A;  3RQI A;  3HM5 A;  2XB5 A;  3S2H J;  2XRL A;  3ERM A;  2PBI A;  3T5X A;  2L54 A;  1Z0X A;  4RB2 C;  3I53 A;  3OYH A;  3HOW J;  3A01 A;  2IEK A;  5LGT A;  4R79 A;  1T8I A;  1A6I A;  4DW6 A;  4UY8 I;  1KZH A;  1HW2 A;  3JCU C;  1P2F A;  4WK8 F;  3KEQ A;  2PFB A;  2HVS A;  1T56 A;  3JRH A;  4D0P A;  2R7T A;  2K7L A;  2VBW A;  2M1B A;  2XKO A;  4C2U A;  2STT A;  1WJ5 A;  2GAU A;  3ABT A;  1SVL A;  1BI3 A;  3L00 A;  3R0A A;  2R5Z B;  3OIQ A;  4M3G A;  4ZJZ A;  2CW7 A;  2ESN A;  2OA4 A;  3F3X A;  4L5I A;  1W36 D;  3PO3 J;  4EM2 A;  5EJC A;  2R7D A;  3ZN0 A;  3S1R J;  5TJJ A;  2B9S A;  1R1T A;  2IA2 A;  3L1P A;  2DBB A;  2EFO A;  1TWG J;  2KT0 A;  1K7A A;  3MWM A;  2EZL A;  4D7N A;  3NEU A;  2KRC A;  1XSX A;  4M72 A;  3CCV I;  4XKV A;  1E3O C;  2HZT A;  2UWM A;  3H1C A;  1JT6 A;  3K4M A;  1FOX A;  4C3I J;  2ZO4 A;  3LSK A;  4IHT A;  3T8R A;  1X58 A;  2LG4 A;  3I54 A;  4HZF A;  1MJ9 A;  4IOC F;  2EIJ H;  2KDO A;  1T98 A;  5F04 A;  4BBR J;  1BR4 A;  1IUY A;  2B0L A;  1YJ9 I;  2FMY A;  2XGX A;  2E35 A;  3COA C;  1S9H A;  2HS5 A;  2LP0 A;  3BRO A;  1IXS B;  1OQY A;  1EH6 A;  4JK1 X;  4KDP A;  4ZDL A;  1SD5 A;  4KIB A;  1BJZ A;  2XGC A;  2B7E A;  3BG6 A;  2IVM A;  2JSC A;  2RGV A;  2VQL A;  1OCP A;  5DDG A;  3H0D A;  1D5Y A;  1ZR4 A;  1YJN I;  1KGS A;  4FT8 A;  3BR1 A;  5HDG A;  1UZC A;  3F8F A;  1D8J A;  4KJZ A;  2C6Y A;  4A6D A;  3G73 A;  2QA4 I;  3C1D A;  4LG0 B;  1SFU A;  4G6Q A;  1I1S A;  5D5W B;  2G7U A;  1BR2 A;  1IV8 A;  3PIO F;  4W97 A;  3CQZ J;  2ZME C;  2YPR A;  4XOP A;  2DT6 A;  4BE1 A;  1A35 A;  1GV5 A;  1XMK A;  2CH0 A;  3S32 A;  1S6L A;  2WB1 A;  3H5R A;  4P1W A;  4KIC A;  2HQA A;  4KIS A;  3LA3 A;  3D5R C;  2A07 F;  3AG4 H;  3D0S A;  5H6R A;  3DTE A;  2DOD A;  1XD7 A;  1IRZ A;  2BE5 F;  2FX0 A;  1Y6I A;  4CIC A;  1BN5 A;  4GXO A;  2UZK A;  3E6M A;  5M5W J;  2D5V A;  4IHV A;  1J0R A;  1C0W A;  4ANJ A;  1UJ8 A;  3L7W A;  1YI2 I;  2BW3 B;  5D6E A;  2Z16 A;  5C44 J;  1OR7 A;  3Q9V A;  2QQA A;  1O7F A;  2L9V A;  1ETX A;  1RUO A;  4XRF A;  4XOT A;  3OY9 A;  2DDB A;  3JRA A;  2BY1 A;  1T08 B;  5DCF A;  2VBX A;  4E7H A;  2I5U A;  4OMZ A;  5HS8 A;  2LNB A;  1DGW Y;  5FKO A;  3OSF A;  3EUH C;  2BVM A;  2A69 F;  5FLX K;  4II3 A;  2WA0 A;  4IJA A;  1B6A A;  3PJR A;  3I56 I;  2QZ8 A;  4EMS A;  4AIK A;  1EH7 A;  3W6J B;  1IJW C;  1B72 A;  2BXY A;  1HKQ A;  1D0X A;  1Z9C A;  2KMU A;  2DFI A;  1X1B A;  5A2Q Z;  3I3L A;  3CP2 A;  2BYV E;  4MFD A;  3FXJ A;  4JP0 A;  2WTE A;  3D5L A;  1K83 J;  4WX9 A;  1H8A C;  3Q0V A;  2CMP A;  3FMS A;  2F4M B;  4HAM A;  1F5T A;  5JLX A;  3ELK A;  1NK3 P;  4C9Y A;  3FIS A;  3GZ6 A;  3QPL A;  5DEQ A;  2NOG A;  4EGY A;  3O3K A;  4MIM A;  2L7M P;  2JJ7 A;  3ECO A;  5J3L A;  3SDG A;  5GTH C;  1VQ7 I;  3N4M A;  3FDY A;  2EWN A;  4M3B A;  1X3W B;  2EFW A;  1IN5 A;  1OCZ H;  1W0U A;  4FE4 A;  1ETK A;  3BLY A;  2EV5 A;  5K5R A;  2G0E A;  4U0W A;  3WTV C;  2FRH A;  3DPL C;  2M30 A;  2QBY A;  3JW4 A;  1MDM B;  3G2B A;  1N77 A;  4IRI A;  1YS7 A;  4GRI A;  3M7G A;  5FFX A;  1H9G A;  2GA1 A;  5J40 A;  4GDF A;  1YFH A;  2Y31 A;  4F55 A;  2DJN A;  2JZY A;  4NB5 A;  1XGO A;  3W2V A;  3IWZ A;  1K78 B;  1LE8 B;  3GTK J;  2K9M A;  4E7S A;  2A05 A;  2HXO A;  3DXJ F;  3HRS A;  3DU6 A;  3HB9 A;  3IAS 2;  5EZG A;  3KP6 A;  4YIF A;  1DUX C;  1R00 A;  2YU9 J;  3OL4 A;  3KEY A;  3G6E I;  1LUJ B;  3FXO A;  4QLC U;  1ZLK A;  3QOE A;  4CZZ A;  3J7Z I;  1N78 A;  1JUS A;  4PFP A;  3RDI A;  4EV0 A;  1MBF A;  3BG3 A;  3OYA A;  1X4P A;  2NVU B;  4BEH B;  5E18 F;  2ZBK A;  4B44 A;  1VTN C;  3OYK A;  3MEX A;  1Y0U A;  5E3N A;  5FJ8 J;  3OIO A;  3CF5 F;  4A3G J;  5FFZ A;  4BL0 B;  1HC8 A;  5HDN A;  3HHH A;  4M3E A;  2ZFW A;  1TQP A;  4BYY A;  3ZXS A;  4CSW A;  4ASN A;  4A3M J;  1D3Y A;  2ZKZ A;  3QP6 A;  5LD2 C;  3BP8 A;  4IO9 F;  1J09 A;  3SZT A;  3CC7 I;  2IJL A;  3IHU A;  2Q0O A;  5JI6 A;  2VL8 A;  4E7J A;  2H94 A;  2JA7 J;  3F6V A;  2VOO A;  2EFQ A;  2XF7 A;  4AC0 A;  2BGC A;  2JN6 A;  4LB5 A;  2RC4 A;  2L4A A;  2LBF A;  5B1A H;  1I6H J;  2DW4 A;  2O8K A;  3MQ0 A;  2XF6 A;  4AWX B;  2HOE A;  4A12 A;  4RGX A;  2W7N A;  1R9T J;  1QZY A;  4U0Y A;  1JTX A;  1K6Y A;  2KIM A;  3GF2 A;  3I55 I;  2DOE A;  4KYW A;  1WJC A;  1UEL B;  2XAS A;  2BY3 A;  4Y3O A;  1LJ9 A;  3PNT A;  1G3S A;  5BPI A;  5BQT A;  4P9U A;  2D1V A;  4OIP F;  3AG3 H;  4BBS J;  1RZ4 A;  2DO7 A;  1SC7 A;  1BBY A;  4RA2 A;  2KDZ A;  2CQ7 A;  1OMI A;  2DCE A;  1RES A;  3E5X A;  4OIQ F;  1W7P A;  5EZH A;  1P4W A;  5CVU A;  3FM3 A;  3H5A A;  2ID6 A;  4L0Z B;  2WAF A;  3KEO A;  5M5X J;  5ICF A;  3GZN B;  1P4A A;  1L3L A;  4I09 A;  2CQN A;  3K69 A;  1IC8 A;  3SQN A;  3TOA A;  2TDX A;  5B66 C;  3FXQ A;  4Y15 A;  4ENN A;  1YW8 A;  4ZZD A;  1ERD A;  1ZKG A;  3B6A A;  2XIG A;  3B02 A;  1QHG A;  3I9V 2;  1YIO A;  1W7P D;  4JX6 A;  3K70 C;  4LB6 B;  5FRN A;  3KYL A;  1GLN A;  1YIJ I;  2JUG A;  2Z2S B;  1U5T A;  4JYK A;  3HRM A;  1ZG5 A;  2GOM A;  3DKW A;  1VQ8 I;  1TWC J;  2YU3 A;  2JT1 A;  3GX4 X;  1RR8 C;  5GAH J;  3ABL H;  1S29 A;  5FO5 A;  4ZDP A;  5DYM A;  2QEX I;  1WH5 A;  3VOE A;  2X6W A;  3IC7 A;  5DD4 A;  2L5Q A;  4E7L A;  2DDA A;  1BIA A;  4XID A;  1B72 B;  2E1C A;  1ITY A;  2VT2 A;  1B8I A;  5J8F A;  3BZK A;  4FX4 A;  5FLV A;  2OUM A;  2F5E A;  4CYC A;  2CFO A;  3DTI A;  4YEJ A;  3F21 A;  2V26 A;  3J7A Y;  2CQX A;  4BJ5 C;  4G7Z F;  3SZP A;  4PDK A;  3CF2 A;  2V9P A;  4LGW A;  3I59 A;  5EEG A;  5EYR A;  1S7E A;  4GCV A;  5J1U A;  3FXL A;  3AKZ A;  3BTJ A;  3IUO A;  1GUU A;  1BJA A;  2M8E A;  2VBZ A;  3T1B A;  1W5C C;  3RJP A;  4AUX A;  2XRN A;  5L3G A;  2MA3 A;  2VKE A;  4RAZ A;  5JR3 A;  3NAU A;  4M9X A;  3HOZ J;  3E97 A;  4V19 K;  3Q0U A;  5K7F A;  3WTZ A;  3HKZ N;  1SMT A;  3ERE D;  2VC0 A;  9ANT A;  3I4N J;  2P5V A;  3I71 A;  2DFF A;  4BUP A;  4DYQ A;  2H8R A;  5L3D A;  3HXL A;  3OYI A;  1JE8 A;  2QGU A;  5A2Q K;  2BXZ A;  1MMD A;  2F5V A;  2CQK A;  3A0B C;  1JJ8 C;  5HOD A;  4XLP F;  4BDY A;  2R5Y A;  4DYR A;  3HUG A;  3ABM H;  4BU2 A;  1EA3 A;  3E6D A;  3IV5 A;  4U7B A;  1SVO A;  2ZXW H;  2O7O A;  1MH3 A;  4V2G A;  4C2T A;  4C30 A;  1ZEL A;  1CF7 A;  2E2J J;  4G7O F;  3QRF F;  2KIF A;  2BVL A;  3E1S A;  2Y9Y A;  2V6C A;  4I98 B;  2FBI A;  4II2 A;  5ICG A;  3U1K A;  2FNP A;  1X1C A;  3MKZ A;  4HNT A;  3L2V A;  4IHY A;  5ERI A;  3MAJ A;  3L2R A;  1WKM A;  1OIS A;  2DMN A;  1I5Z A;  3A1Y A;  4Y52 J;  2M4G A;  3FBN B;  3DFG A;  2EZI A;  1BW5 A;  1P6R A;  3U21 A;  4OIO F;  5EGO A;  1PUF A;  4AVP A;  1WCM J;  1LKX A;  1JTY A;  2BV6 A;  3DPU A;  1O3T A;  5IT9 K;  1U9O A;  4KIG A;  5CJ9 A;  3LL7 A;  4FQG A;  4A3B J;  1VZ0 A;  2IA0 A;  1DQU A;  2X1D A;  2L9S A;  2WAQ N;  1Y1V J;  3FKI J;  1VFC A;  2BY2 A;  2LSO A;  5EEH A;  1OFC X;  1OKR A;  1R22 A;  2HGC A;  3A4C A;  3LFU A;  4NBQ A;  4HX7 A;  1G59 A;  3PSI A;  4JX4 A;  1ZLJ A;  2P6T A;  1L0O C;  1X2M A;  1YG2 A;  3ECH A;  4RBO A;  2VXD A;  5FKM A;  2UXX A;  4BKX A;  5BOX A;  3R4K A;  3ZMU A;  3FMR A;  3V4G A;  3OV8 A;  2OV7 A;  2F48 A;  4B4C A;  3WTS C;  1GVD A;  2CRG A;  1ZRD A;  3S1M J;  1OCR H;  3BZC A;  3E3V A;  2H27 A;  2CSO A;  3RCO A;  1J75 A;  2FF4 A;  3OOU A;  3V42 A;  3K6G A;  2KKO A;  1U2W A;  2M9H A;  1U8B A;  4CO8 A;  2WV1 A;  2GXA A;  5DTD A;  5IYB J;  2P7C B;  2XAJ A;  1MSE C;  3KYC B;  1VQ5 I;  3HHG A;  2VIX A;  2ZXH A;  1ON1 A;  3VSL A;  4Y33 A;  4LMY A;  2Q1Z B;  3OR2 C;  4ENJ A;  1U3E M;  2FEZ A;  1XMX A;  1QQI A;  2DLL A;  4WWC A;  1Y39 A;  1A6Q A;  3DEE A;  4YIR X;  4XNF A;  2JK3 A;  1NG7 A;  2M5W A;  3BC8 A;  2OQG A;  3JTH A;  2M4K A;  2O6G E;  1V5F A;  1WJA A;  4NC6 A;  4UB6 C;  5CQG A;  2KJC A;  3GFL A;  2FQ3 A;  4JX5 A;  1AWC A;  4QWQ A;  2ELJ A;  1YX5 A;  2E19 A;  3NWS A;  1Z6R A;  2Y0S N;  1PDN C;  3IAM 2;  2Z99 A;  2FQ4 A;  3ULQ B;  5CYV A;  1ETW A;  2MYS A;  4CCM A;  3H3V K;  3A0H C;  2P7V B;  4YFN F;  4MFE A;  1WHU A;  2HQN A;  5F0C A;  2L4M A;  2OCE A;  3KFW X;  1Y56 A;  3V7R A;  1ETV A;  1G3W A;  1ZG1 A;  3K4B A;  1SD7 A;  4BE0 A;  3KET A;  2ICW G;  2W24 A;  5F1R A;  4J19 A;  3AG2 H;  1CQT A;  3O8H A;  4KMU X;  1QBJ A;  2PEX A;  2STW A;  4Q48 A;  3BPV A;  2HI3 A;  4IRG A;  4Y17 A;  1FOY A;  1LFP A;  2LD5 A;  2FOW A;  2XGD A;  2LRD A;  1FNN A;  1IXC A;  3BZ6 A;  5EG0 A;  3C2G A;  4M6X A;  1SAX A;  4KIT B;  4IHX A;  5ICE A;  2CV0 A;  3QU6 A;  2IGN A;  1D5V A;  1S72 I;  3RPQ A;  1W36 C;  3K1P A;  3CMA I;  5HVQ C;  3K2Z A;  2LRE A;  3WG7 H;  4N0B A;  1FMW A;  1WFX A;  2CJJ A;  2V79 A;  1YS6 A;  2FU4 A;  3CDL A;  3NRV A;  3QOP A;  1LDJ A;  2DOF A;  2ME0 A;  4CA0 A;  2DMP A;  4HBL A;  4CCL A;  2TRT A;  2HOS A;  4MGR A;  1S7A A;  3WU2 C;  5JLW A;  5FLX Z;  4ITV A;  2Q2E A;  2X4H A;  4HOB A;  4BJT A;  2E2I J;  2QQ9 A;  3TW6 A;  1FSH A;  3GLX A;  3BG5 A;  3FXM A;  1CF7 B;  5J4V A;  1HKT A;  3M8E A;  1IN8 A;  3H3U A;  2ZSI B;  1HBX G;  5KAI C;  1QPM A;  3HPH A;  3QWL A;  1ZTR A;  3R61 A;  4FCY A;  2D45 A;  2JUC A;  4DZJ A;  2X0L A;  5AIQ A;  1WJD A;  3AG1 H;  1QO0 D;  1AU7 A;  1BOA A;  2VKD A;  2HKX A;  2P4W A;  2Z3Y A;  1XX5 A;  4XON A;  4WF2 A;  3SHF A;  1QA6 A;  2HEO A;  2K4B A;  4IKF A;  1FBQ A;  2DYR H;  1PUF B;  2OTL I;  4A3I J;  2OBP A;  2QKL B;  3EDP A;  3QU3 A;  3WTT C;  4HV6 A;  1D1A A;  4PCQ A;  2AS5 F;  2IS4 A;  4AM3 A;  3I4P A;  3LWF A;  3CUQ A;  3R0J A;  4ZTF A;  2JMW A;  2R7S A;  2Y2Z A;  3S17 J;  1TQM A;  1WSU A;  3H9J A;  2IGO A;  2JVG A;  1V4R A;  1LVK A;  2YR2 A;  2A5W A;  3FK6 A;  5ILV A;  1SEU A;  3TOB A;  5DM6 F;  1OCC H;  4LLG F;  1T38 A;  3ZPL A;  5L3C A;  2EV0 A;  2L7K A;  1SFE A;  4ZTJ A;  3F8M A;  4OAY A;  3IH3 A;  5FLM J;  4EJW A;  2VE9 A;  3CP8 A;  2V1U A;  2FBK A;  2IS1 A;  2ZB9 A;  2KHM A;  4ZYE A;  3HRT A;  2VC1 A;  1T33 A;  1FYL A;  1WVR A;  4AD9 A;  3LMM A;  2FXA A;  5D5U B;  2P6S A;  2ZSH B;  3RQ4 A;  4A3C J;  3SEQ A;  5LEK A;  4F7Z A;  2LF8 A;  2VB6 A;  1FTZ A;  1NK2 P;  4I2O A;  2QQB A;  2PG4 A;  5DUI A;  1SAN A;  4CYD A;  2MLG A;  4JQF A;  1T0F A;  2NVY J;  3K2A A;  1Q1H A;  4BQO A;  3VYR B;  4ESF A;  2XRO A;  3OWT A;  1J5Y A;  1ZRE A;  4E7I A;  4S05 A;  1M1E B;  2QVO A;  2OD5 A;  3DV8 A;  3ONQ A;  4D1Q A;  3ESW B;  2B63 J;  1OR7 C;  4NNJ A;  4PSW A;  1TW2 A;  3CMM A;  4XL9 A;  2MC3 A;  1E3P A;  2EZK A;  2GA2 A;  2DA3 A;  2W00 A;  2M87 A;  3AAF A;  2DI3 A;  4U88 A;  3H9Q A;  4KT5 C;  4Q4Z F;  2WB1 N;  3HGG A;  3J80 K;  1P7J A;  3UNG C;  3CD6 I;  2RRE A;  2EV6 A;  4HA8 A;  2JPC A;  3HGY A;  3B6C A;  2XV4 S;  3VYT B;  5HLG A;  5HLI A;  1KON A;  4NDL A;  2H8W A;  1TTY A;  1WJB A;  4XSZ F;  3U1D A;  2G9W A;  1MND A;  2BY0 A;  4B09 A;  1N25 A;  3WTX C;  4JOM A;  4MEY F;  1A31 A;  3Q3S A;  1REP C;  2HTS A;  2HXI A;  3GCM A;  3AL0 B;  2OU2 A;  1RUN A;  3CLQ A;  1XSV A;  2P8T A;  3BOQ A;  4FET A;  5EG0 B;  2DPD A;  4MLO A;  3S16 J;  1Y8R B;  2DQR A;  5DM7 F;  2XSD C;  1SFO J;  2FOK A;  2LF7 A;  3AFH A;  2A6H F;  2GM4 A;  1IXR C;  4LD5 A;  5D5X B;  1W5S A;  3A03 A;  1R4N B;  1RC9 A;  4AYB A;  3CTA A;  1D1B A;  3H3Z A;  3ZCO A;  2JSP A;  3GTG J;  4A69 C;  2R7U A;  4XLN F;  1MD0 A;  4F3Q A;  2DA5 A;  4UHT A;  1K6O A;  3SFI A;  4XKC A;  4XRS G;  1O3S A;  3M8J A;  3OYE A;  2LY9 A;  1ZGA A;  3KZY A;  5DCM B;  1QU3 A;  4HQE A;  2HNH A;  3PUB A;  5GAG J;  4P5O A;  2Y75 A;  1LFU P;  4CZC A;  2JQ7 A;  3GTQ J;  1R58 A;  3EPZ A;  3OS0 A;  3JRG A;  4OMY A;  3KLN A;  1VQ9 I;  1VQL I;  3JRF A;  3CCS I;  1UAA A;  3GTP J;  3K4C A;  4RAF A;  3PQK A;  1LDK B;  2W1O A;  3VYS B;  1TW3 A;  2WAE A;  1PYV A;  3M4O J;  3BTC A;  2ECC A;  1DP7 P;  2VN2 A;  2IP2 A;  3KCC A;  3ML6 A;  2HTJ A;  3CES A;  1UMQ A;  3RKX A;  4HLY A;  5H20 A;  2XAQ A;  4BGD A;  2L01 A;  3CUO A;  3M3Y J;  3O8G A;  1MIJ A;  2MGQ A;  5DS9 A;  2K27 A;  4OWR B;  3JAM K;  5D8K B;  3CDH A;  4HLX A;  3DKX A;  3CJT B;  4B43 A;  3J7A O;  1AKH A;  1FOW A;  1EJ9 A;  5FD6 A;  3CCE I;  1RNL A;  2DK8 A;  4XN0 A;  5IT3 A;  5HNH A;  3CCQ I;  1VND A;  4I6Z A;  5EDN A;  1LEB A;  4A3L J;  4G6D A;  2QWW A;  3NQO A;  4AU7 A;  2HWV A;  2E1M B;  3ZMS A;  4L18 B;  3KPH A;  4X6A J;  1MMS A;  4A2U A;  4HF0 A;  2GBY A;  2Z33 A;  1FEX A;  1WH7 A;  2K4J A;  3HJE A;  3A01 B;  4L5J A;  3ZGK A;  3NAR A;  4G8X A;  4A0Y A;  2X6X A;  2CV2 A;  5GAE J;  5JFR A;  1ZHF A;  2GLO A;  2WWY A;  2VI6 A;  3BWG A;  3RI4 A;  2DYS H;  2KL4 A;  1I1G A;  2X48 A;  4ZYH A;  1VQO I;  3HOU J;  1WJE A;  2K40 A;  2L3D A;  1QVT A;  2LTP A;  3TBI A;  2H09 A;  4GGG A;  5EF6 A;  2DA2 A;  4IZZ A;  3P9K A;  1B1B A;  3RYR A;  5HNF A;  2F4O B;  5IT9 Z;  4A93 J;  2NYX A;  3HTS B;  2F5D A;  1ORK A;  1U5T C;  4PJJ A;  4F93 B;  1IRX A;  2LDU A;  3L2U A;  4ETS A;  4QTR A;  2V4J C;  2MFZ A;  4PJ0 C;  1VQP I;  2E5N A;  3SZG A;  1FT9 A;  5FKN A;  1Z77 A;  2QLZ A;  3I5U A;  1KYZ A;  2F5C A;  2D2W A;  4UUT A;  3KP7 A;  4I76 A;  4LOC A;  4CXF A;  2HOT A;  3HEF A;  3FBI B;  4OIR F;  1DDN A;  2DOA A;  1ZR2 A;  4UB8 C;  4XQF A;  1QHH D;  3WGI A;  4L9T A;  1YW7 A;  1YO5 C;  4UNO A;  4HNV A;  3BR6 A;  5ILU A;  4DBQ A;  5LBQ A;  1VF9 A;  2R4G A;  1FP2 A;  1IRG A;  3CME I;  4P9F A;  3ROU A;  3A2K A;  1LNW A;  1JGS A;  4HYE A;  3BR3 A;  1O57 A;  3JRD A;  5JHF A;  2DPU A;  1DPU A;  4XKB A;  3K1M A;  1X3U A;  3ZQL A;  5GPA A;  1LDD A;  4PK4 A;  2IXS A;  4IL6 C;  3OYG A;  4RGS A;  1OCT C;  4HDV A;  3BT9 A;  2ADU A;  3WHB A;  2XF5 A;  5F1J A;  3O6B B;  2V1X A;  4RGR A;  3E5U A;  2ZC2 A;  4YEL A;  4A3J J;  3RTR A;  3ABU A;  2IGM A;  2LY1 A;  2LC2 A;  3VDX A;  3EUH A;  3JR9 A;  1QPI A;  1WI9 A;  5K7Z A;  2DFH A;  5TRD A;  4EAT A;  4RLQ A;  2IS6 A;  1D8K A;  4RM2 A;  3OS1 A;  4XLC A;  5CKT A;  4S0H B;  1I6X A;  1MMN A;  3TDU C;  3BCB A;  2NXN B;  2E1O A;  4M6V A;  3HL2 A;  3DKY A;  1J7K A;  3VPR A;  4Q5S F;  2ZCW A;  4RLF A;  3IP4 B;  1D0Y A;  1OYI A;  4M6Y A;  4CCK A;  2M0M A;  2H1K A;  1IZ1 A;  3KZI C;  2EB7 A;  4XLE A;  1D0Z A;  4YFK F;  2VBY A;  1IO2 A;  4ZYD A;  2V1D A;  3TP0 A;  4A3F J;  1E2X A;  4RB0 A;  4FAS D;  1XCV A;  3SJM A;  1TL8 A;  1HDP A;  3QYE A;  2HU9 A;  4BQQ A;  2DMT A;  3PUF A;  1Z7U A;  3GTM J;  2K86 A;  3K7A J;  3LQQ A;  3JRI A;  1PP8 F;  3ZQQ A;  2MBF A;  4LLN A;  2EIN H;  1LPQ A;  2LR8 A;  2W85 A;  4OAZ A;  4A5N A;  4IQJ A;  1NG6 A;  4RB1 A;  3TP3 A;  5D6F A;  2NS7 A;  1SD6 A;  3MZH A;  2HKO A;  2DTZ A;  1Z91 A;  1FIP A;  2K85 A;  1X1P A;  3HG9 A;  2IAI A;  3IH2 A;  5H6Q A;  2FBH A;  3WU0 A;  3CLO A;  2QKM B;  1MNM C;  2WY7 Q;  1TT0 A;  4BQN A;  3VB2 A;  1TWH J;  2UXN A;  2PX9 A;  2R7Z J;  1P7I A;  1ZG3 A;  1VQM I;  5BNG A;  3DU5 A;  1XG1 A;  4BAY A;  2ELH A;  2UV1 A;  4F92 B;  1DU6 A;  2A61 A;  2R7W A;  3ZRG A;  1V5G A;  4HG2 A;  3IWF A;  2JRT A;  5IPA A;  4EJT A;  2RQP A;  3HIF A;  1KQ0 A;  1B9N A;  4RAY A;  2DA4 A;  2EFN A;  2CWE A;  1WWX A;  4P55 A;  2DAO A;  4PZJ A;  3LST A;  4IPA A;  3OYL A;  5E1X A;  5LGU A;  2EIM H;  2QBY B;  4BXU A;  1MNE A;  1OJL A;  3FMQ A;  1Z05 A;  3DBL B;  2BZT A;  2HYF A;  3BTL A;  3RKY A;  2EPF A;  1LB2 A;  2WBM A;  2VKV A;  4QSH A;  4RM3 A;  2FNA A;  4PFO A;  1BW6 A;  1B9M A;  2JA8 J;  3RYP A;  2VON A;  4EM1 A;  2YX7 A;  2VUM J;  2R7F A;  1GXQ A;  2E2H J;  2KRH A;  1R36 A;  1JXS A;  2PMU A;  2PJR A;  1ETQ A;  2M7A A;  2JWT A;  2QCO A;  5FD5 A;  1A04 A;  5M3M J;  4AIH A;  3FZV A;  3FHZ A;  2LKP A;  2VOP A;  1S8N A;  3ZMV A;  3FKJ A;  2LKX A;  1LEA A;  1XMA A;  3QPT A;  1YRN A;  1U78 A;  1APL C;  4A3E J;  4ESJ A;  4M73 A;  1Z6T A;  4DYC A;  3QPS A;  5CLS A;  2COB A;  2V9V A;  4GYI A;  3GBG A;  1J9I A;  3ABK H;  2VJ5 A;  3GTO J;  1DP3 A;  3EUA A;  3TO7 A;  3M9A A;  2MAB A;  3QYB A;  2P5L C;  2JTV A;  1FC3 A;  3WU1 B;  1A5J A;  4H4K C;  2H6B A;  3PIP F;  1PVE A;  5IYD J;  1OLT A;  3KZZ A;  4CUG A;  2LBF B;  4AIJ A;  1XB4 A;  3E6C C;  4I99 C;  1UG2 A;  4XBF A;  4XLH A;  2LKS A;  1R71 A;  3S1N J;  1AHD P;  4N9H A;  3P9C A;  3C7J A;  5AIP A;  3AL0 C;  2IT0 A;  2PI0 A;  2EIK H;  3Q0W A;  4YG2 F;  4WCG A;  3KP3 A;  1GV2 A;  2GIV A;  4XRS A;  4RDU A;  3CO7 C;  1ENH A;  2E71 A;  5FKK A;  3TED A;  2HPM A;  3TW7 A;  3E6B A;  3EET A;  3GYH X;  3K70 D;  2OCC H;  2DA1 A;  2HYG D;  3D1N I;  2GXB A;  3FX3 A;  2ZFU A;  3ZQH A;  1W7P B;  1TC3 C;  4ZDO A;  2XB0 X;  2XKP A;  4K2E A;  4D7M A;  1HQC A;  2ZJQ F;  2PN6 A;  2R93 J;  2MD5 A;  3J80 Z;  1E0E A;  3BTI A;  3NWT A;  2EFP A;  2LVS A;  3G1L A;  2CYY A;  1ZRC A;  2WC2 A;  1MJB A;  3HZJ A;  2HVQ A;  3PSF A;  3REO A;  1JUP A;  5IY5 H;  3EYI A;  3JRE A;  2LOO A;  1R5G A;  1HST A;  2MC4 A;  2RAE A;  3CCM I;  3KIO A;  1TQI A;  1XGS A;  3KLO A;  3W6K B;  1IN7 A;  2W4S A;  3OYJ A;  1U5T B;  3G1M A;  5D4S A;  1T95 A;  1POG A;  2R7O A;  3N97 A;  3P7N A;  4BXX J;  2XPV A;  3F8N A;  2GQQ A;  1XDU A;  2PMZ N;  3PM1 A;  2DT7 B;  5D5V B;  3RKW A;  1RKW A;  2KFD A;  2ETH A;  1ETY A;  2PMH A;  4HPQ A;  4J01 A;  4M9S A;  5HOO A;  2K9Q A;  3VFZ A;  2E7W A;  1ONV A;  2KZV A;  2YS9 A;  5M5Y J;  3FF5 A;  2O5R A;  4KA4 A;  1G3T A;  2ZNY A;  3WE3 A;  1FX7 A;  3BPX A;  1SD4 A;  2MG4 A;  2L7Z A;  3CUQ C;  1MMA A;  1X1D A;  1B8I B;  1MZB A;  2I8D A;  5BS6 A;  4WXD A;  4CYC B;  1UCR A;  2MH9 A;  1R4M B;  2KIS A;  3DCF A;  3JRB A;  2COM A;  1IDZ A;  4LK1 F;  3RKQ A;  3O2P E;  2WAQ A;  5E8I A;  2DMQ A;  5J8C A;  1V5E A;  3BJ6 A;  3I59 B;  4XIC A;  3E7L A;  1OPC A;  2F6C A;  5LRR A;  2X6Y A;  4B8X A;  3L2C A;  1OYW A;  3ZQ7 A;  3UKG A;  4M74 A;  2E1M C;  1X4O A;  1ZYR F;  3JRC A;  1BI2 A;  3GME A;  4LIV A;  4ZH4 F;  4HF2 A;  3E5Q A;  4S04 A;  2EJR A;  1J59 A;  1KU9 A;  4OU0 A;  2VQG A;  3RPU D;  4LIT A;  3GTL J;  4KFC A;  2OTJ I;  2VPL A;  1Q1V A;  4LFU A;  4BS9 A;  4IHW A;  2QF7 A;  2K02 A;  3J81 K;  2HR3 A;  3J7Y J;  4LK0 F;  3VEP A;  4ESB A;  1D1C A;  1KYW A;  1U9N A;  4BQA A;  1IF1 A;  4A5M A;  1XC5 A;  1T0F C;  1K4S A;  1UB9 A;  2HDW A;  2P0W A;  2ME6 A;  4X0G A;  1O4X A;  2QSG X;  1KQ8 A;  2HFH A;  2R5Y B;  1S7O A;  1MW7 A;  3JAM Z;  3HUG B;  4R8H A;  4EJO A;  3OYC A;  2HPI A;  2D1H A;  2XAF A;  2WAD A;  3I0T A;  1W5T A;  2HQ5 A;  2W82 A;  5KK1 A;  1IGN A;  3F9K A;  3Q5F A;  3HOY J;  1UHW A;  1NTC A;  4LG0 A;  3HOT A;  4A0X A;  4IF4 A;  2MW8 A;  2ZXI A;  4HQM A;  2ZJ2 A;  3DEU A;  4UXN A;  2EA2 A;  2YSR A;  2MD0 A;  4NHJ A;  4MEX F;  2CQQ A;  3V7S A;  3DLL F;  2L02 A;  1QRY A;  1IDY A;  2Y0S A;  1K61 A;  1Z1D A;  2A3S A;  3LAP A;  5EGO B;  3K1N A;  3GTJ J;  5B1B H;  5K7H A;  1WPK A;  2JVH A;  1BA5 A;  3LSR A; 
#chains in the Genus database with same CATH homology
 5JHU A;  2F5F A;  3QP5 A;  4HDU A;  1XCB A;  4I01 A;  4L9J A;  2RVC A;  4CGZ A;  5CVV A;  1K79 A;  2RV8 A;  4BNC A;  5BMZ A;  5E1Z B;  4GYG A;  3L9F A;  3IRR A;  3H92 A;  3TGN A;  4I7H A;  3K0L A;  2PJP A;  2JPB A;  3FWE A;  3R60 A;  4Q47 A;  3CJN A;  1EH8 A;  3PQJ A;  4YII A;  3HYI A;  4UVA A;  3TO6 A;  5HS9 A;  1U8R A;  1T39 A;  4A0Z A;  5CVJ A;  5LHG A;  4HX8 A;  5L3F A;  2VE8 A;  1TLH B;  2QYO A;  2ACJ A;  3KP4 A;  2VT3 A;  2W57 A;  3GFI A;  3BJA A;  4FX0 A;  3GEZ A;  1R5H A;  2OZU A;  5FGM A;  4IVN A;  3GZ5 A;  1BIB A;  2IPQ X;  1FYK A;  1MDM A;  1T6S A;  1TNT A;  3KP2 A;  2MH2 A;  2BEO A;  4UV9 A;  2W25 A;  3S2W A;  1UST A;  1K78 A;  4L9N A;  4UV8 A;  5LGN A;  3LAJ A;  4UUV A;  4IXA A;  1H0M A;  1QZZ A;  4N9I A;  2M45 A;  5D4R A;  1V3F A;  1BC8 C;  5LLQ A;  5K5O A;  1F9N A;  5E8G A;  3M1E A;  4EJV A;  5K1Y A;  4I0B A;  1XSD A;  3JSP A;  1U6G A;  1JHF A;  3DQV C;  1IW7 F;  2H6C A;  4XSX F;  1GHC A;  3GUD A;  2Y48 A;  4TV7 A;  4I02 A;  1DPR A;  5E17 F;  1I27 A;  3FXU A;  1QGP A;  1FZP B;  3IKV A;  1XGN A;  5DD8 A;  2HDC A;  3HOS A;  4P96 A;  5D8L B;  2PQ8 A;  4KN7 X;  5F64 A;  5E20 A;  4KN4 X;  3SFZ A;  3T8T A;  5J6X A;  3HTU A;  4ENM A;  1TNS A;  1ODD A;  2F2E A;  3CUQ B;  2GZW A;  5DUK A;  1IRF A;  3IKT A;  2RKH A;  3EQL F;  4U0V A;  5LRS A;  5AON A;  2GXG A;  3F6O A;  2O61 A;  1UFM A;  4M71 A;  3L09 A;  1STZ A;  5CVI A;  1BM9 A;  3WGH A;  4MTD A;  2E7X A;  1ON2 A;  3F72 A;  2G7H A;  1LQ1 A;  1EV7 A;  3SXY A;  4HW0 A;  1ZGJ A;  2CO5 A;  3MCZ A;  1HSJ A;  4O5V A;  3EYY A;  3M8F A;  4G7H F;  1O7L A;  5CVR A;  3F23 A;  3LFK A;  1SMY F;  4Z2Y A;  3F22 A;  1T2K A;  2KJB A;  3RIR A;  3HSE A;  3U9G A;  2A5Y B;  2NAZ A;  3I64 A;  1LVA A;  2ZME A;  3GW2 A;  1AOY A;  1W4M A;  2J5P A;  1KU2 A;  4DQ2 A;  1H9T A;  5BPD A;  1TBX A;  3WTY C;  4L9V A;  4CDG A;  2NRA C;  4MTE A;  2ESH A;  1FBU A;  2P5K A;  3GXO A;  3BY6 A;  5HLH A;  2KIU A;  4HV5 A;  2RN7 A;  2DTR A;  2DK5 A;  4ON0 A;  3HSR A;  2CFX A;  3CO6 C;  1KU3 A;  1SFX A;  3P9I A;  1FYM A;  1IN4 A;  1HW5 A;  1YLF A;  4KUM A;  2NNY A;  1FBS A;  1HKS A;  3V7C A;  2VXZ A;  5DV5 A;  3ISP A;  4LJZ F;  2W84 A;  2CG4 A;  5HS7 A;  4PGG A;  3WG9 A;  1G3Y A;  4RGU A;  3ZN1 A;  1F4K A;  5HDK A;  3PFI A;  1OYY A;  2DQL A;  2XAH A;  3F8C A;  4NQW A;  4JBA A;  1R7J A;  4M9Z A;  3BJO A;  1WQ2 A;  2Q8K A;  2FML A;  4KMF A;  3ZMD A;  5FB2 A;  4IHS A;  5K5Q A;  4H0E A;  3J81 Z;  2NS0 A;  3V8K A;  3LQR A;  5L3E A;  3QPH A;  2Z5U A;  1PUE E;  3BDD A;  2XHK A;  4OIN F;  1XGM A;  4U7D A;  6PAX A;  4MNU A;  1GVJ A;  2O03 A;  1PP7 U;  3MFK A;  3K9T A;  3F8B A;  1MKM A;  2PLY A;  1O3Q A;  1NHA A;  5LHI A;  2ZXJ A;  3LA7 A;  1G6N A;  3JTG A;  1UHM A;  3DPT A;  1FWZ A;  1YTY A;  1YW9 A;  4FHT A;  3IL2 A;  4G9Y A;  2BBY A;  4KNY A;  3IRQ A;  4RB3 C;  3FM5 A;  4BH9 A;  2A6E F;  5ILS A;  4Y13 A;  3I58 A;  4LLL A;  1GXP A;  5E1W A;  3ZMZ A;  1FPQ A;  2EK5 A;  2ZME B;  4ZZL A;  1HXD A;  2EA4 A;  2FE3 A;  3GWZ A;  2XUB A;  2VOD A;  1B4A A;  3ZMT A;  4ZYG A;  3JSO A;  1YQA A;  3ZP5 A;  1ULY A;  4OOI A;  3DP7 A;  3QAH A;  1KA8 A;  2A68 F;  3B73 A;  2CGP A;  1ZRF A;  1R23 A;  2FSW A;  1RIO H;  5F6F A;  1WRJ A;  2NNN A;  2OZ6 A;  2KRF A;  2XAG A;  1J2X A;  1IN6 A;  2WV0 A;  4KIF A;  3HSF A;  2HQR A;  4UVC A;  1ZAR A;  2ZNZ A;  4I0A A;  4MQV A;  4L0Y B;  1G4D A;  4UVB A;  5KVR A;  2RDP A;  1XDS A;  2E1N A;  1BI0 A;  2J5O A;  1ZN2 A;  1FY7 A;  4EVI A;  4RS8 A;  2ISZ A;  3OOP A;  1B59 A;  1RI7 A;  2O0Y A;  3LA2 A;  3WGG A;  1BC7 C;  4WXH A;  3RPU A;  1ZAO A;  4CHU A;  3TQN A;  1KU7 A;  2FA5 A;  4BHP A;  3T0Y A;  5ED4 A;  3C18 A;  4EQQ A;  4YFX F;  5LHH A;  2IA1 A;  4GO1 A;  1S3J A;  1P92 A;  2O3F A;  2YX4 A;  1BI1 A;  3GO5 A;  4HX4 A;  1YYV A;  2OAZ A;  2RNJ A;  4A6E A;  2Y0M A;  3GFJ A;  1O3R A;  2ISY A;  1R1V A;  4BHB A;  1E17 A;  4R1H A;  3Q9S A;  1IAW A;  1MJA A;  4ENK A;  1FLI A;  3G3Z A;  3C3W A;  4PGH A;  2IW5 A;  1FP1 D;  4EJU A;  2CW0 F;  1XN7 A;  3WE2 A;  2OQR A;  1MGT A;  2AXL A;  3VOD A;  1F1Z A;  3TDZ C;  5LEJ A;  2DU9 A;  3DF8 A;  1P4X A;  2Z9O A;  1ZH5 A;  2IRF G;  1FOK A;  1KQ9 A;  1CGP A;  1QNT A;  2XVC A;  5L3B A;  3HRU A;  3KP5 A;  4MQ9 F;  3TO9 A;  1R1U A;  4G94 A;  1USS A;  2QM3 A;  5DCM A;  4DNC A;  4EGZ A;  3WTU C;  1HW1 A;  3KE2 A;  5ICC A;  3TKY A;  2DT5 A;  1FSE A;  2O8X A;  3WOD F;  4O6J A;  4IRH A;  4O3M A;  3WTW C;  3GFM A;  1JHH A;  2QEN A;  2MLK A;  4BHC A;  4E70 A;  3GVA A;  4WXC A;  5JVT A;  3R6S A;  2QUF A;  3MZY A;  2GWR A;  3V8J A;  4EM0 B;  3V8L A;  2R3S A;  3FXR A;  4MHG A;  4HF1 A;  3U2R A;  2PBI A;  3T5X A;  2L54 A;  4RB2 C;  3I53 A;  5LGT A;  4R79 A;  1HW2 A;  4WK8 F;  1P2F A;  3KEQ A;  2PFB A;  4D0P A;  2K7L A;  2M1B A;  2VBW A;  2XKO A;  2STT A;  2GAU A;  3ABT A;  1BI3 A;  3L00 A;  3R0A A;  2ESN A;  2OA4 A;  3F3X A;  4L5I A;  4EM2 A;  2R7D A;  3ZN0 A;  5TJJ A;  1R1T A;  2IA2 A;  2DBB A;  2EFO A;  1K7A A;  3MWM A;  3NEU A;  1XSX A;  4M72 A;  2HZT A;  2UWM A;  2ZO4 A;  4IHT A;  3T8R A;  3I54 A;  4HZF A;  1MJ9 A;  1T98 A;  1IUY A;  2B0L A;  2FMY A;  2XGX A;  3COA C;  2HS5 A;  3BRO A;  1IXS B;  1EH6 A;  4JK1 X;  4KDP A;  1SD5 A;  4KIB A;  2IVM A;  2JSC A;  2RGV A;  5DDG A;  1KGS A;  4FT8 A;  5HDG A;  3F8F A;  1D8J A;  2C6Y A;  4A6D A;  3G73 A;  3C1D A;  4LG0 B;  1SFU A;  4G6Q A;  1I1S A;  5D5W B;  2G7U A;  2YPR A;  1XMK A;  1S6L A;  4KIC A;  3LA3 A;  2A07 F;  5H6R A;  3D0S A;  1XD7 A;  2BE5 F;  4CIC A;  1BN5 A;  4GXO A;  2UZK A;  3E6M A;  1J0R A;  1C0W A;  3L7W A;  5D6E A;  1OR7 A;  3Q9V A;  2QQA A;  1O7F A;  1RUO A;  4XRF A;  5DCF A;  2VBX A;  4OMZ A;  5HS8 A;  2LNB A;  2A69 F;  5FLX K;  4IJA A;  1B6A A;  2QZ8 A;  4EMS A;  4AIK A;  1EH7 A;  3W6J B;  1HKQ A;  1Z9C A;  2DFI A;  5A2Q Z;  2BYV E;  2WTE A;  3D5L A;  4WX9 A;  3FMS A;  4HAM A;  1F5T A;  3ELK A;  3GZ6 A;  5DEQ A;  4EGY A;  3O3K A;  3ECO A;  3N4M A;  2EWN A;  2EFW A;  1IN5 A;  2EV5 A;  5K5R A;  4U0W A;  3WTV C;  2FRH A;  3DPL C;  2M30 A;  2QBY A;  3JW4 A;  1MDM B;  4IRI A;  1YS7 A;  3M7G A;  5FFX A;  1H9G A;  2GA1 A;  1YFH A;  2JZY A;  4NB5 A;  1XGO A;  3IWZ A;  1K78 B;  3DXJ F;  1DUX C;  3HRS A;  4YIF A;  3KP6 A;  1R00 A;  1ZLK A;  4QLC U;  4CZZ A;  3RDI A;  4EV0 A;  5E18 F;  2ZBK A;  1VTN C;  3MEX A;  1Y0U A;  5FFZ A;  5HDN A;  3HHH A;  2ZFW A;  1TQP A;  4BYY A;  4ASN A;  1D3Y A;  2ZKZ A;  3QP6 A;  3BP8 A;  3SZT A;  2IJL A;  3IHU A;  2Q0O A;  5JI6 A;  2H94 A;  3F6V A;  2VOO A;  2EFQ A;  2BGC A;  4LB5 A;  2RC4 A;  2L4A A;  2DW4 A;  4A12 A;  3MQ0 A;  4AWX B;  2HOE A;  4RGX A;  1QZY A;  4U0Y A;  2KIM A;  3GF2 A;  4KYW A;  2XAS A;  1LJ9 A;  1G3S A;  5BPI A;  5BQT A;  4P9U A;  2D1V A;  4OIP F;  1RZ4 A;  2DO7 A;  1BBY A;  1OMI A;  3E5X A;  4OIQ F;  1W7P A;  1P4W A;  5CVU A;  3FM3 A;  4L0Z B;  3KEO A;  5ICF A;  1P4A A;  1L3L A;  4I09 A;  3K69 A;  3SQN A;  3TOA A;  2TDX A;  3FXQ A;  4Y15 A;  4ENN A;  1YW8 A;  4ZZD A;  2XIG A;  3B02 A;  1YIO A;  1W7P D;  4LB6 B;  1U5T A;  3HRM A;  1ZG5 A;  3DKW A;  2YU3 A;  2JT1 A;  3GX4 X;  1S29 A;  5FO5 A;  5DYM A;  3VOE A;  3IC7 A;  5DD4 A;  1BIA A;  2E1C A;  2VT2 A;  5J8F A;  4FX4 A;  2F5E A;  3F21 A;  4G7Z F;  3SZP A;  4PDK A;  4LGW A;  3I59 A;  5EEG A;  4GCV A;  1BJA A;  2M8E A;  2VBZ A;  3T1B A;  3RJP A;  2XRN A;  5L3G A;  2MA3 A;  4RAZ A;  5JR3 A;  4M9X A;  3E97 A;  3WTZ A;  1SMT A;  3ERE D;  2VC0 A;  2P5V A;  3I71 A;  5L3D A;  1JE8 A;  5A2Q K;  2CQK A;  4XLP F;  3HUG A;  3E6D A;  4U7B A;  1CF7 A;  4G7O F;  3QRF F;  2KIF A;  2V6C A;  4I98 B;  2FBI A;  5ICG A;  2FNP A;  5ERI A;  3MAJ A;  1WKM A;  1I5Z A;  3DFG A;  1P6R A;  4OIO F;  4AVP A;  2BV6 A;  1O3T A;  5IT9 K;  4KIG A;  5CJ9 A;  2IA0 A;  2LSO A;  5EEH A;  1R22 A;  1OKR A;  2HGC A;  4HX7 A;  1ZLJ A;  2P6T A;  1L0O C;  1YG2 A;  3ECH A;  2UXX A;  5BOX A;  3R4K A;  3ZMU A;  3FMR A;  3V4G A;  3OV8 A;  3WTS C;  1ZRD A;  3E3V A;  2H27 A;  2CSO A;  1J75 A;  2FF4 A;  2KKO A;  1U2W A;  4CO8 A;  2P7C B;  2XAJ A;  3HHG A;  1ON1 A;  4LMY A;  4ENJ A;  1U3E M;  2FEZ A;  1QQI A;  2DLL A;  4WWC A;  2M5W A;  2OQG A;  3JTH A;  2O6G E;  2KJC A;  3GFL A;  2FQ3 A;  1AWC A;  4QWQ A;  1Z6R A;  1PDN C;  2Z99 A;  3ULQ B;  5CYV A;  2P7V B;  4YFN F;  2HQN A;  2L4M A;  3KFW X;  3V7R A;  1G3W A;  1ZG1 A;  1SD7 A;  3KET A;  2W24 A;  5F1R A;  1QBJ A;  4KMU X;  2PEX A;  2STW A;  4Q48 A;  3BPV A;  4IRG A;  4Y17 A;  1FNN A;  1IXC A;  3BZ6 A;  4M6X A;  1SAX A;  5ICE A;  3QU6 A;  1D5V A;  3RPQ A;  3K1P A;  5HVQ C;  3K2Z A;  4N0B A;  2V79 A;  1YS6 A;  2FU4 A;  3NRV A;  3QOP A;  1LDJ A;  4HBL A;  4MGR A;  1S7A A;  5FLX Z;  2Q2E A;  2X4H A;  4HOB A;  2QQ9 A;  1FSH A;  3GLX A;  1CF7 B;  1HKT A;  3M8E A;  1IN8 A;  3H3U A;  1HBX G;  1QPM A;  3R61 A;  2D45 A;  2X0L A;  5AIQ A;  1QO0 D;  1BOA A;  2Z3Y A;  2HKX A;  2P4W A;  3SHF A;  2HEO A;  4WF2 A;  2K4B A;  1FBQ A;  2OBP A;  3EDP A;  3QU3 A;  3WTT C;  4HV6 A;  4PCQ A;  2AS5 F;  3I4P A;  3LWF A;  3CUQ A;  3R0J A;  1TQM A;  1WSU A;  1V4R A;  2YR2 A;  5ILV A;  3TOB A;  4LLG F;  1T38 A;  3ZPL A;  5L3C A;  2EV0 A;  1SFE A;  3F8M A;  4EJW A;  2VE9 A;  2V1U A;  2FBK A;  4ZYE A;  3HRT A;  2VC1 A;  1FYL A;  4AD9 A;  2FXA A;  5D5U B;  2P6S A;  5LEK A;  4F7Z A;  2LF8 A;  4I2O A;  2QQB A;  2PG4 A;  5DUI A;  4CYD A;  2MLG A;  4JQF A;  1T0F A;  1Q1H A;  4ESF A;  2XRO A;  1J5Y A;  1ZRE A;  4S05 A;  2QVO A;  2OD5 A;  3DV8 A;  1TW2 A;  2MC3 A;  2GA2 A;  2M87 A;  3AAF A;  2DI3 A;  4U88 A;  4KT5 C;  4Q4Z F;  3J80 K;  2EV6 A;  4HA8 A;  2JPC A;  2XV4 S;  5HLG A;  5HLI A;  1TTY A;  4XSZ F;  3U1D A;  2G9W A;  4B09 A;  3WTX C;  4MEY F;  1REP C;  2HTS A;  2OU2 A;  1RUN A;  1XSV A;  2P8T A;  3BOQ A;  2DPD A;  2DQR A;  2FOK A;  2LF7 A;  2A6H F;  1IXR C;  4LD5 A;  5D5X B;  1W5S A;  3CTA A;  3H3Z A;  4XLN F;  1MD0 A;  4UHT A;  1K6O A;  1O3S A;  1ZGA A;  3KZY A;  5DCM B;  4HQE A;  4P5O A;  2Y75 A;  1R58 A;  4OMY A;  3KLN A;  3PQK A;  1LDK B;  1TW3 A;  1DP7 P;  2VN2 A;  2IP2 A;  3KCC A;  3ML6 A;  2HTJ A;  3RKX A;  4HLY A;  5H20 A;  2XAQ A;  2L01 A;  3CUO A;  2K27 A;  3JAM K;  5D8K B;  3CDH A;  4HLX A;  3J7A O;  5FD6 A;  1RNL A;  2DK8 A;  5IT3 A;  1LEB A;  4G6D A;  2QWW A;  3NQO A;  2HWV A;  3ZMS A;  4L18 B;  4A2U A;  4HF0 A;  2Z33 A;  2K4J A;  4L5J A;  4G8X A;  4A0Y A;  5JFR A;  1ZHF A;  2WWY A;  3BWG A;  3RI4 A;  1I1G A;  4ZYH A;  2L3D A;  2H09 A;  4GGG A;  3P9K A;  1B1B A;  3RYR A;  5IT9 Z;  2NYX A;  3HTS B;  2F5D A;  1U5T C;  2LDU A;  4ETS A;  1FT9 A;  2QLZ A;  3I5U A;  1KYZ A;  2F5C A;  2D2W A;  3KP7 A;  4CXF A;  1DDN A;  4OIR F;  3WGI A;  4L9T A;  1YW7 A;  1YO5 C;  4UNO A;  5ILU A;  5LBQ A;  1FP2 A;  1IRG A;  4P9F A;  3ROU A;  1LNW A;  1JGS A;  4HYE A;  1O57 A;  2DPU A;  1DPU A;  3K1M A;  1X3U A;  1LDD A;  4RGS A;  4HDV A;  2ADU A;  3O6B B;  2V1X A;  4RGR A;  3E5U A;  3RTR A;  3ABU A;  3EUH A;  1WI9 A;  5TRD A;  1D8K A;  1I6X A;  3TDU C;  1J7K A;  4Q5S F;  2ZCW A;  1OYI A;  4M6Y A;  1IZ1 A;  2EB7 A;  4YFK F;  2VBY A;  4ZYD A;  2V1D A;  1E2X A;  4RB0 A;  1XCV A;  1Z7U A;  2K86 A;  3LQQ A;  1PP8 F;  2MBF A;  4LLN A;  2W85 A;  4A5N A;  4RB1 A;  5D6F A;  1SD6 A;  3MZH A;  2HKO A;  1Z91 A;  5H6Q A;  2FBH A;  3WU0 A;  3CLO A;  3VB2 A;  2UXN A;  1ZG3 A;  4BAY A;  2ELH A;  2A61 A;  3IWF A;  2JRT A;  4EJT A;  2RQP A;  3HIF A;  1KQ0 A;  1B9N A;  4RAY A;  2EFN A;  2CWE A;  1WWX A;  4P55 A;  2DAO A;  4PZJ A;  3LST A;  4IPA A;  5E1X A;  5LGU A;  2QBY B;  4BXU A;  3FMQ A;  1Z05 A;  2HYF A;  3RKY A;  1LB2 A;  2FNA A;  1B9M A;  3RYP A;  2VON A;  4EM1 A;  2YX7 A;  2R7F A;  1GXQ A;  1R36 A;  1JXS A;  2PMU A;  5FD5 A;  1A04 A;  4AIH A;  3FZV A;  3FHZ A;  2LKP A;  2VOP A;  1S8N A;  3ZMV A;  1LEA A;  1XMA A;  3QPT A;  1U78 A;  4ESJ A;  4M73 A;  1Z6T A;  5CLS A;  2V9V A;  4GYI A;  1J9I A;  3TO7 A;  3M9A A;  2P5L C;  2JTV A;  1FC3 A;  3WU1 B;  2H6B A;  3KZZ A;  4AIJ A;  1XB4 A;  3E6C C;  4XBF A;  4N9H A;  3P9C A;  3C7J A;  5AIP A;  2IT0 A;  2PI0 A;  4WCG A;  4YG2 F;  3KP3 A;  2GIV A;  3CO7 C;  3E6B A;  3EET A;  3GYH X;  2HYG D;  2GXB A;  3FX3 A;  1W7P B;  2XKP A;  4K2E A;  1HQC A;  2PN6 A;  2MD5 A;  3J80 Z;  2EFP A;  1ZRC A;  2CYY A;  2WC2 A;  1MJB A;  3REO A;  3EYI A;  1R5G A;  1HST A;  1TQI A;  1XGS A;  3KLO A;  3W6K B;  1IN7 A;  1U5T B;  5D4S A;  3N97 A;  3P7N A;  3F8N A;  2GQQ A;  1XDU A;  5D5V B;  3RKW A;  2ETH A;  2PMH A;  4M9S A;  5HOO A;  3VFZ A;  2E7W A;  1ONV A;  3FF5 A;  4KA4 A;  1G3T A;  2ZNY A;  3WE3 A;  1FX7 A;  3BPX A;  1SD4 A;  3CUQ C;  1MZB A;  5BS6 A;  4WXD A;  1UCR A;  2MH9 A;  2COM A;  4LK1 F;  3O2P E;  5E8I A;  5J8C A;  3BJ6 A;  3I59 B;  1OPC A;  5LRR A;  4B8X A;  3L2C A;  1OYW A;  3ZQ7 A;  4M74 A;  1ZYR F;  1BI2 A;  4ZH4 F;  4HF2 A;  3E5Q A;  4S04 A;  2EJR A;  1J59 A;  1KU9 A;  4OU0 A;  4KFC A;  4LFU A;  2K02 A;  3J81 K;  2HR3 A;  4LK0 F;  3VEP A;  4ESB A;  1KYW A;  4BQA A;  1IF1 A;  4A5M A;  1UB9 A;  1KQ8 A;  2HFH A;  1S7O A;  3JAM Z;  4R8H A;  4EJO A;  2D1H A;  2XAF A;  3I0T A;  1W5T A;  5KK1 A;  3Q5F A;  1UHW A;  4LG0 A;  3HOT A;  4A0X A;  4IF4 A;  4HQM A;  2ZJ2 A;  3DEU A;  4UXN A;  2EA2 A;  2YSR A;  4NHJ A;  4MEX F;  3V7S A;  2L02 A;  1Z1D A;  2A3S A;  3LAP A;  3K1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...