2DPEA

Crystal structure of a secretory 40kda glycoprotein from sheep at 2.0a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a secretory signalling glycoprotein from sheep at 2.0A resolution
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dpeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dpeA01
3VGDA 1GHSA 1GJUA 1K9EA 4GI8A 1QPKA 3ARXA 4KWUA 1FH9A 1HJQA 1Q6EA 1H41A 1QVBA 1TCMA 2IUZA 2BXZA 8CGTA 3WNKA 3ECQA 5DMYA 1J01A 2EBNA 1GQIA 1GOIA 3SCQA 3QHOA 1UHVA 4X0VA 4B15A 1B3YA 2ZIDA 1FA2A 1E3XA 1OB0A 5M3WA 4WJXA 3VMOA 1BSIA 3AXXA 4BQ2A 1HVXA 3T2PA 1QI5A 3CPUA 2DT3A 3PZOA 5A6LA 4FLRA 4TXEA 1J10A 3G6LA 3F5LA 2IXVA 1UD4A 4WLCA 4HOWA 5IHRA 3SUVA 2GJPA 5E09A 5IFTA 2WHKA 4CVUA 1GPFA 1I75A 3WN6A 4H41A 4OUEA 3MSDA 2X0HA 4XX6A 2IXUA 5E6ZA 2UY2A 1EHAA 3MU7A 2CBJA 3TTQA 2F2HA 2VR5A 1UZ4A 1UKQA 3W37A 1R8LA 1Y7VA 1JXKA 3BAWA 3LPPA 5FCZA 2WANA 4E8DA 1PZ3A 1JI1A 3AHXA 5A8QA 3GTNA 1A47A 1E43A 1V3IA 4PYSA 5C71A 4UFLA 3LPGA 3OLDA 4F9JA 1L8NA 2V3FA 1J11A 4U5KA 1KXVA 4PRWA 3VOCA 1R86A 3AHZA 3VD5A 4QLLA 1JAEA 1Q6DA 1O7AA 3B9AA 1V6VA 3PZGA 5M03A 3PZMA 2Y4SA 3BLPX 3WENA 4ZE4A 1XD0A 1XHGA 1EA9C 3TONA 3FAXA 1E71M 5C70A 3EYPA 3PTKA 1LWHA 4AD4A 1JZ6A 2VUYA 1TR1A 4H8UA 5IHSA 4ATLA 1W9PA 1HT6A 5JBFA 1C8YA 1OT2A 1LG1A 5A8PA 3O2LA 2GUYA 5I3DA 2QMKA 1HNYA 2WC7A 1W2PA 1FH8A 3SCRA 3VIGA 5DT5A 1CIUA 2OWWA 2PF0A 2PWDA 5A3HA 3S6TA 1LJYA 4HMDA 3QGVA 2GJXB 4YHEA 3CTTA 4LGXA 4WKHA 4FLSA 2BY2A 1MFVA 3AISA 1GHRA 1XCXA 4LQ1A 3AICA 2VQTA 3W38A 4CU7A 4W8AA 3W29A 2UY4A 3EDDA 4PCTA 1CEOA 4W8BA 4GI9A 4HOXA 4EK7A 1MW2A 4E8CA 3NJ3A 2EEXA 2GK1B 3A4AA 3BAYA 3RM9A 1QNSA 4F8XA 2CETA 1JI2A 1B3ZA 4WSJA 2E3ZA 2UY5A 2W91A 3IK2A 3PZQA 1GUVA 3AIRA 1QW8A 4CCDA 3VD7A 3VD9A 1FOBA 3AZSA 3W6MA 1WZLA 4QLKA 1KXQA 1KFWA 2DH3A 4XB3A 3WQWA 1V02E 4IUGA 1V02A 4J3WA 3GH4A 3ARWA 2ZXDA 2OYKA 4KH2A 4NSBA 2YBTA 1CGUA 4PMDA 4JFUA 1SYTA 1JZ7A 3LPOA 4LPCA 4HTYA 3ARZA 1FFRA 4HA3A 1KQYA 2D23A 3MANA 1AQMA 1JAKA 3OLGA 4S3JA 3IAQA 5A8NA 4Z2LA 1WZAA 1H49A 1V6YA 4CGTA 2G4FA 3VTRA 3I3BA 4BF7A 3AQUA 1UD5A 1VF8A 1E56A 2JF6A 4V2XA 3AS1A 3ZT7A 4CCEA 3PZIA 4DWSA 3CLWA 2G41A 4PEEA 2O9PA 1E73M 1EO5A 1FHLA 1SFSA 5BROA 4R5EA 3U5UA 2ZICA 2XIBA 2YIHA 1J9YA 1E1EA 4AEEA 3WDPP 3OZOA 1E4MM 5D8WA 5IFPA 1CECA 3CMGA 3WF4A 2D2OA 4U31A 1V0LA 5AYIA 1J0IA 3A6OA 3QOMA 2FGZA 2BFGA 1W3HA 1XV8A 1SMAA 3WMSA 3CZGA 4C7GA 4A3HA 1CWYA 4FF5A 4AZGA 1OD0A 1H3GA 1OGBA 3WDHA 3K4AA 1P6WA 5BXSA 1U33A 2WWCA 4OKDA 4W93A 3VNYA 1QI4A 1U2YA 3WEMA 1KR1A 2ZX9A 4PMRA 2O92A 1TZ7A 4CCCA 3POHA 5BRQA 1RP9A 2YL6A 1V6XA 5DF0A 1E6ZA 3VIMA 3MUY1 1TUXA 4U3AA 1UH2A 2J8GA 2E40A 3KL0A 4MNKA 1LL7A 5KEZA 3NUKA 4CU8A 4PSRA 1B30A 5AC5A 4JHZA 1CDGA 3VD4A 3FHQA 4QDMA 4X9YA 1EGZA 1XH0A 1H1NA 4NRSA 4UFIA 3L4WA 4F79A 1AVAA 2D3LA 3AYRA 3OIHA 1V3MA 3NSNA 2BV9A 3SUWA 5LA2A 1R85A 2Z1SA 1J0HA 2ZX5A 4B16A 5LA0A 2W92A 3WFLA 3RMEA 3N04A 1JYVA 1BVZA 2WMGA 1BTCA 5ABFA 3AIUA 4V27A 5CG0A 1CGTA 3U57A 2WNWA 1TA3B 3UG3A 1OCQA 1UH4A 4B3KA 3N15A 2UWFA 3T09A 4YHGA 1PJ9A 1A3HA 3UR8A 5D9OA 2OWXA 4M24A 4M8UA 4WK9A 1UKSA 3MUZ1 4FLQA 4JAWA 3GBDA 3SCPA 3FN9A 1UR0A 1KQZA 4HZ7A 4H8HA 2VVNA 3CZ8A 2HVMA 3D3AA 3VUPA 3U7BA 2WVVA 3ARPA 5A6MA 2WB5A 3CHCA 1AQHA 4QFUA 1Q4NX 2DT1A 3TOPA 3WNLA 2A3HA 2CCRA 4PTMA 3CMJA 4UNIA 4AW7A 2GFTA 1JZ4A 1E40A 3W53A 1W9DM 4JZ5A 5I5RA 4DWSC 3L4TA 3ARTA 3WUBA 2J4GA 1W1VA 1W9VA 3AS0A 3AXIA 3W4RA 3N17A 4ACZA 3WNPA 1C7TA 4W7VA 3VGEA 3AXHA 3TTSA 2VC9A 3ZR5A 1HL9A 1PBGA 1NM9A 1VJSA 4JFTA 4D6IA 4BA0A 2BY3A 5DO8A 1E0VA 4NZCA 3VIJA 4UQ9A 4M80A 3ARVA 5A1AA 2JALA 2EPKX 1JYXA 2DIJA 1UWSA 2VQUA 2OSYA 2MANA 1BYCA 1PEZA 2VVSA 1EIBA 1WAWA 3E1F1 4PMYA 3WH8A 3ZQ9A 1EQPA 4NI3A 2D1ZA 1GONA 1BG4A 4AZ5A 3WDIA 3K4DA 2CKSA 3HU7A 5E0CA 1UA7A 3VO0A 3D5HA 2RGLA 1V3KA 1GQLA 5LYRA 4W5UA 5JIWA 4TVDA 4AZ7A 3THDA 2C7FA 3AIBA 2WBKA 2DSUA 3UESA 5FKYA 4AD0A 2VRQA 3FNDA 1QHZA 1K9TA 4U3CA 1KXTA 1R87A 4GQQA 1JIBA 3ZOAA 1NOUA 2WYSA 8A3HA 3AJ7A 4F9DA 1V0NA 1GVYA 3MV11 2FGLA 4QCFA 2YA2A 3VIOA 1EH9A 5A2CA 2ZUVA 4CN6A 3AS3A 1HP5A 3CUFA 4PTVA 1GVIA 4GIAA 2WLZA 4MADA 1VBRA 1ZBCA 3WKZA 2VOTA 4JIEA 1PX4A 1W32A 4W84A 4JL2A 4D6JA 4AZBA 1OGSA 2YKKA 2G3JA 2J75A 3W25A 1HKJA 1LF1A 3I3EA 4TVUA 3VINA 4OOUA 1RPKA 3VM7A 1ISWA 2ZXBA 3SCUA 1BYBA 4AZHA 3BAJA 2XPKA 4Z2HA 4AC1X 4UR9A 1UA3A 2VRKA 1VENA 1W1TA 3WNNA 4E4PA 2DT2A 2ZOXA 5ABEA 4GPNA 1QNQA 5A2BA 2J79A 2ZUWA 1UUQA 1E1FA 3DHUA 2JIWA 3MV01 3DHPA 3BSGA 4ZXOA 4X0NA 3M6DA 1ZS2A 2XJ7A 2C8NA 1E3ZA 2CBVA 4PSPA 3ARRA 1UR9A 1W9UA 1B1YA 1E0XA 4ATDA 3EMCA 2YDSA 1S46A 1XYZA 3POCA 3GBEA 1OBAA 1W2VA 2XIIA 1KB3A 3UG4A 4J7RA 4ZEPA 3ARYA 4QP0A 3IJ7A 2J8FA 2A3CA 3NDZA 4M56A 2PWHA 2QLYA 4ZFMA 1V3JA 2E9MA 2VCAA 1V3HA 1HF6A 2OWCA 3SEPA 3BSHA 1TA3A 3OBAA 4UZUA 3AHVA 5BXRA 5E9AA 4V28A 5CPSA 5A8MA 4FMVA 1D3CA 5IDIA 4AD3A 1DEDA 1JZ5A 1NWRA 1B3XA 2VX7A 4D6FA 1B3WA 1QBAA 3ZMRA 1VRXA 1V0MA 1US3A 3RM4A 1PPIA 5A6BD 4UOJA 2W67A 2X1IA 3WH6A 2YBUA 4ML4A 4AZ6A 2DGAA 1F4HA 1HVQA 1BFNA 4P7RA 2E4TA 4RE2A 4TX6A 4YPJA 3VGHA 2B31A 2WVVB 1UR1A 2E8ZA 1LWJA 3ZSSA 4MNMA 3U7VA 4AZCA 3ZO9A 5JH8A 4JHOA 4TOQA 3AMLA 1UD3A 4E2OA 1MYRA 3TA9A 3L2LA 1J12A 1XGZA 3BMVA 1HN1A 1UR2A 1KWKA 2G3MA 3WSUA 1V08A 4BZYA 4CVWA 3NCOA 2VZSA 1TVPA 3CUGA 2WMFA 1CYGA 2D20A 1JZ8A 1C93A 3GXDA 3FY1A 3WFZA 5FIPA 2WSPA 1GOQA 5HPCA 3VIHA 2WKLA 1UWUA 4Z2GA 1DWAM 4PMOA 4HU0A 3BC9A 4XV0A 3GNOA 3BMWA 1PX3A 1OINA 4D6GA 1NOFA 2BHZA 4JL1A 3VGFA 5BYWA 1G9HA 1J18A 1JDDA 1PIFA 4OIFA 3L4VA 2AAAA 4W7WA 4UFJA 1UWQA 3EMZA 2PI6A 1WDRA 2V3EA 4CD8A 1W1PA 4LX4A 3W26A 4OJYA 5A94A 1FFQA 3RCNA 4ACZB 1NOWA 3OLEA 4LYRA 2VX6A 5F7UA 1QBBA 1CXLA 2YA1A 4IM4A 1H0IA 1GOOA 4MPKA 2VZTA 3QOKA 1WPCA 1JG9A 1JZ3A 1UWRA 1JYNA 1V6WA 4J3TA 1JDCA 2DSVA 1H2JA 5FOOA 3MMWA 1YHTA 2DSWA 2WM0A 1HX0A 1UD6A 2W4XA 3O9NA 5A6JA 4JFSA 1VAHA 1PIGA 1LL4A 5ABFB 3IJ8A 4MDOA 2CKRA 1XH2A 3PHAA 3VNZA 3WL0A 3VGBA 1WZKA 1OGGA 2WMIB 1MFUA 4PMQA 2CEQA 3W0KA 4HA4A 3VKKA 2QMJA 2WMHA 4W8LA 3SCWA 3WF1A 1E6PA 1HJVA 3TTYA 2XVNA 2BVYA 4EKJA 1QW9A 2E9LA 2A3AA 3WD3A 6TAAA 1ITCA 3ZJ6A 1PZ2A 5DFAA 2WZEA 1WDPA 1CLVA 4L4OA 1C3FA 4AD2A 1HJWA 5LA1A 1CGVA 1JD9A 3WQ8A 3WEZA 1IZJA 3B8SA 4GZIA 2W61A 2W66A 4DM2A 4OBRA 4GO8A 4L4PA 4J3XA 3N1AA 4BCEA 1GNXA 1D7FA 5HPOA 2GDVA 2JIEA 4AMCA 1M03A 1UKTA 3CHDA 4GZJA 4HMEA 1KXHA 4DM1A 1TFVA 3WH9A 3I3DA 4MNLA 1XCWA 2G8ZA 2J25A 5AY7A 3CUHA 1JGIA 4P8UA 3AIWA 7TAAA 2VJXA 3RM8A 1JF6A 2WZHA 3WDJA 4GKLA 1HJXA 4JKMA 5DEZA 3LMYA 2XYLA 3L4YA 3RJXA 4N0RA 3SUTA 1QHOA 3SCSA 5A6BA 2EPOA 1WO2A 5CXPA 1NWUA 2WCSA 1HJSA 3PZ9A 1IV8A 1EOMA 1E6NA 4CD4A 3ARSA 3K8KA 4AZIA 1MWOA 2X8RA 1N82A 1E5NA 2WWDA 2Y24A 2YOCA 4AD1A 3T0AA 2D0GA 5E70A 4D6HA 1RD6A 2OSWA 2BNJA 1BHGA 1NWSA 1V3LA 3CBWA 5CGTA 1LQ0A 1BGGA 4RL3A 1JZ2A 2J47A 3UCQA 4A3YA 4HA1A 5CPQA 4BQ5A 1DHKA 3WNMA 1RP8A 2CNCA 3WDRA 2J62A 2FHBA 3OG2A 3EDJA 2CYGA 3KL3A 3N13A 2CERA 3ZT6A 4OBSA 2WK2A 1C91A 4BS0A 3RILA 2A3EA 3CIVA 2EPMX 3BAIA 1M7XA 2VR4A 3VX0A 3W81A 3CZJA 2Q8XA 5EMYA 2E0PA 1OIMA 2Y8KA 1RH9A 2J7DA 3WL1A 2XTKA 1R7OA 4UQDA 2XVGA 3L2MA 4ZXLA 1BLIA 3MMUA 4A4AA 2ZX6A 1QHPA 1EDGA 3CHEA 4GI6A 4W86A 5GNXA 1UD8A 3DYPA 2FH8A 2PWEA 3EBVA 3KE0A 3AZTA 1DWJM 3ALFA 1XSIA 4AD5A 3WD4A 4HZ8A 1JDAA 1CPUA 5JBEA 1TE1A 3VDHA 5AC4A 2W63A 1ESWA 1MW0A 1GOMA 1MXDA 5BWFA 5EBAA 4GZEA 3EDFA 4P7QA 1F4AA 1CXKA 3GH5A 1DTUA 1X1NA 1V6UA 1NQ6A 5M5DA 1HP4A 3NSXA 3WD0A 3QHNA 4JFWA 4KMQA 2YA0A 2Y5EA 3PTMA 1ECEA 5BXPA 1WZMA 3M7SA 5ECUA 1ZL1A 1VIWA 2XGBA 2D0HA 5A69A 2W62A 1H5VA 3WQ4A 1VFFA 1C8XA 5D8ZA 1GCYA 3PZNA 4AY1A 4HMCA 2J7CA 3BLKA 4AIEA 1DP0A 3ZSTA 3CUJA 1ISZA 4HPHA 5CSUA 3T2QA 1LG2A 2ZX7A 2D0FA 5D9NA 3HN3A 1EQCA 1MW3A 1E5JA 5A8OA 5I79A 1U30A 1VEOA 1QI0A 3AMDA 4Y7EA 2VZOA 3VPLA 4MB1A 5DT7A 2EXOA 1VB9A 1ZJBA 3IJ9A 3WUEA 3UEQA 3VIKA 3GM8A 3CH9A 3WH5A 3II1A 2WAGA 2X2YA 3WMCA 3AIVA 4DUXA 4B3LA 5JUVA 1ZB5A 2WCGA 1UQZA 2ZWYA 4DWSD 2XSBA 2CBIA 1EOKA 3NIYA 4AZCB 2WXDM 1EO7A 1UYQA 3A4XA 2Y8VA 1G01A 4W88A 2XWDA 1WKYA 4Z2IA 2YJQA 1MQRA 3PZVA 4URIA 4EANA 2BVTA 3WF3A 1UOKA 1KCKA 1CTNA 2DQXA 1QNPA 1JD7A 1ZBKA 2QPUA 1UKPA 3WBAA 2BVDA 2J77A 5TD4A 3VVGA 1UD2A 1KGWA 3GNRA 4B9YA 1UG6A 2DSZA 3OGSA 1UQYA 3A3HA 1O6IA 1G1YA 2QPSA 2X05A 5GPRA 5BRPA 3MMDA 2DPEA 4FLOA 3WUFA 4P7NA 1M53A 2OLHA 5M17A 2NSXA 2HISA 4CD6A 2VURA 1WB0A 1D2KA 1XSJA 1E72M 3VGGA 2DDXA 3VMNA 2XHYA 3T0DA 5D9PA 5I78A 5CPTA 1B90A 2PWGA 3WF2A 1IT0A 2BY0A 2WVSA 2DEPA 2J74A 3CZLA 2XFRA 4D1IA 2VZUA 2VX4A 4QLJA 1BYDA 1BF2A 2WHMA 4D71A 3J7HA 3OLIA 1G94A 1W3LA 1AMYA 2E9BA 1CBGA 1J0YA 3UETA 2WC4A 2XGIA 3K8LA 4IISA 3AFBA 5I0DA 2G3IA 3WNOA 3BCFA 3BH4A 2ZUNA 1HXJA 1CNVA 1BAGA 3B9EA 2WMIA 4Z2KA 3AZRA 1M04A 1K9FA 4F66A 2OSXA 4J27A 4ZE5A 2BHYA 5A6AA 4MB3A 3KWXA 6A3HA 3L4XA 3MS8A 1B2YA 3FXYA 2EPNA 4U2ZA 1CGWA 4P8WA 4TVCA 1NP2A 1UH3A 5EFDA 5I2UA 2PB1A 2WMJA 5FL1A 3LPFA 7CGTA 4UFKA 1ZU8A 4MJ4A 3VU2A 3BAKA 3UERA 4QAWA 1WE5A 2XFYA 1GZJA 1JF5A 4R27A 4WIWA 2VNCA 3AIEA 6CGTA 3EDKA 4UQCA 3N18A 4HOZA 4AIUA 1US2A 5EFFA 1BPLB 3AYSA 3GXIA 3MUAA 2YLLA 1ISYA 1G0CA 1XRVA 3BXWA 1WDSA 4M29A 2EQDA 1CXFA 3ZT5A 4AXNA 1KGUA 3ZJKA 3SCVA 4UCFA 1DWIM 3OA5A 1ODZA 4Q7NA 4D6EA 1MQPA 1VFUA 3WELA 1B9ZA 1IZKA 1EXPA 2CBUA 3VDBA 2WZIA 2XG9A 1E4NA 1K9DA 3AMKA 1CZ1A 1Q6CA 1H4PA 1V0KA 4HPGA 5A6SA 5A6KA 3ZJ8A 1FHDA 3HMCA 1W9XA 4PMNA 1MVYA 4JKKA 2BS9A 3GXFA 1C7SA 1E9LA 4P8XA 2V3DA 2C0HA 2O9RA 1GW1A 2YLAA 1KBKA 4W85A 2WHLA 4J3VA 1GJWA 4WF7A 3CZEA 3SCNA 2XUCA 2Y2WA 2D3NA 4H2CA 1AQ0A 2V5CA 4LXFA 3WF0A 1XD1A 1UWIA 5JIPA 2BHUA 4PTWA 4DWSB 2GJRA 2GVYA 3OGVA 3FW6A 4CD5A 3AI0A 1OT1A 1QNOA 1CENA 4GXPA 4J28A 3APGA 3WD2A 2XWEA 3GYCA 3L4UA 1KWGA 4QCEA 2PBGA 4PUEA 5CLTA 1HL8A 1JFHA 3NDYA 1B3VA 3RDKA 4C7FA 3MUIA 2YL5A 2VX5A 4UOQA 4H04A 5C8BB 2O9OA 3GZAA 1UZ1A 4XZWA 5BXTA 4W89A 1HIZA 3WEOA 1HKIA 3ARUA 3O6AA 4WKAA 3VIFA 1L0PA 4UFMA 3SCTA 2AOSA 4AEFA 4MB5A 1ISXA 2AMGA 2ZUUA 1VEPA 4CN4A 2WPGA 2RGMA 4N42A 2YDQA 3W27A 2A3BA 4KGJA 4AIOA 4W5ZA 1LLOA 4MAZA 5AYBA 3VIIA 1CXHA 2VI0A 3GNPA 2TAAA 1GQJA 4IPNB 4UTFA 4W87A 1E6SM 2WSKA 4GO9A 4NRRA 4HU8A 1E4IA 1C8QA 2WC3A 4CU6A 1NP0A 5D4YA 1UR8A 2ZUMA 2BY1A 2J7BA 2WKGA 4ZENA 4CN1A 1WCGA 1PX8A 3SUUA 2CHNA 5I6SA 4W7UA 4RE3A 3GH7A 1NH6A 2NT0A 1Z32X 2DH2A 1ZJAA 4JCMA 2GSJA 2OYLA 4PMZA 4D72A 1TVNA 3AHTA 3K46A 1UWTA 2WBGA 4UQBA 2JE8A 4UFHA 3MKKA 1G5AA 3AMCA 3W82A 1ODUA 3VD3A 1NWTA 4Z2JA 1W9BM 1E70M 1XH1A 2WW5A 3VDAA 2VCBA 2CIPA 1CGXA 1JYWA 1QNRA 1FP9A 3QR3A 1JNEA 3JUGA 1K6AA 2XFFA 3SIMA 2WCAA 1E15A 2XSAA 2WVUA 1WDQA 2EO7A 2CHOA 1Q6GA 2VRJA 1KBBA 4JFVA 1MW1A 3VDCA 5GQBA 4GINA 1KGXA 4MJ2A 5CGMA 4HP5A 2VL4A 4M81A 4TUFA 3WBEA 2WHJA 3CO4A 2E8YA 1HKMA 3VIPA 3VM5A 2DT0A 2ZWZA 3EDEA 2V3GA 4D1JA 1BVNP 3ZJ7A 3W28A 4WSKA 2ZXAA 4MB4A 2YDRA 2CITA 5FD0A 3F4VA 5CLWA 3SURA 1HJUA 5EB8A 1B31A 1E4LA 5ABGA 2Z1KA 3TP4A 4KGLA 3F5KA 4RE4A 4PUDA 2F61A 3BGAA 5I23A 4PTXA 4TX8A 1VBUA 3F5JA 4TTUA 3THCA 4NF7A 3CZKA 3PBGA 4ATWA 1UKOA 3ALGA 5E0FA 2YL9A 3AHYA 3DYOA 1W1YA 3FAWA 4M82A 3RJYA 2F8QA 3AS2A 5HOSA 1EDTA 1BGAA 1DWGM 4UQEA 1J0ZA 5FL0A 1VFOA 4CKQA 4LYPA 3TTOA 4JCLA 4J3UA 4WKFA 3VILA 4U33A 2XVPA 3ZIZA 2J7HA 2VT0A 3CGTA 3DC0A 3WQ5A 1X6LA 3ZR6A 2VTFA 3IANA 2GK1A 1OWQA 4AWEA 4UQAA 1C92A 4TTGA 2UY3A 1Q6FA 1J0JA 1QOXA 5IXEA 3T0BA 3ZM8A 3AROA 2ZX8A 3PZUA 2CXGA 1CLXA 4YN5A 3RO8A 2GJXA 3N12A 1LL6A 4EAMA 1H09A 3AMGA 5CJ5A 2WVTA 3UG5A 3PN8A 2D24A 4LYQA 2EJ1A 3K1DA 3WUGA 3AOFA 4CD7A 3N11A 4UOZA 2ZUTA 4U2YA 2VCCA 4C7DA 3BCDA 4KRTA 3N9KA 3PZTA 3PTQA 1R7AA 3SUSA 1EDQA 3S2CA 1E6XM 3M07A 1CXEA 2JEQA 4EE9A 1ZBVA 1C90A 5HBFA 4MDPA 1QI2A 2CPUA 5CSYA 4PCSA 5A95A 5GNZA 3A47A 1XC6A 4JKLA 3DYMA 1V03A 2J7EA 2DIEA 4PBGA 3WD1A 1GQKA 2X0YA 3IAPA 3UR7A 3RPMA 4H8VA 2XM2A 1E6QM 3GDBA 4Q22A 1GOKA 1SMDA 4AISA 5KZ6A 5I24A 2EPLX 5I77A 2QF8A 2ZE0A 1GOWA 1GORA 1BQCA 4J3SA 3B9DA 4D6CA 4BQ4A 1KCLA 4FK9A 3BAXA 4MNJA 4M1RA 2DSKA 4OZOA 2J78A 3AIQA 2VMFA 4DUWA 3GXMA 3DECA 3NSMA 1W3KA 4U5IA 5HNNA 4S3KA 3MO4A 5GNYA 1KR0A 4CUCA 3OZPA 3VX1A 5HDRA 1JL8A 2FDMA 1OM0A 3WIJA 1VFMA 3QHMA 3M46A 4H7VA 3WMBA 2V5DA 2FH6A 1H0GA 3W24A 5BCAA 5CZKA 4PMUA 3WDQA 2WLYA 1BYAA 4XZBA 1OD8A 1ITXA 2CESA 2VZVA 2J7FA 2V38A 1I1XA 1WNOA 1QI3A 4HZ6A 2QV4A 3RIKA 2VO5A 2QHAA 3CHFA 4P8VA 2ESCA 1FP8A 3WQ6A 4P7LA 1M01A 1XSKA 3VMPA 3KEHA 1B0IA 1TG7A 1FH7A 2ZUSA 3MSGA 1ISVA 3OB8A 3T2OA 1JXJA 4P7OA 3FHAA 3T08A 5CQ1A 1W91A 5ABHA 4UZSA 1PAMA 1DWFM 2D22A 1J0KA 3ARQA 1MXGA 1WP6A 3WY1A 5A2AA 1OIFA 2FHCA 1E0WA 2WMKA 4MTVA 1SR0A 2JF7A 2XVKA 4K68A 4DUVA 4PMVA 1MQQA 2G3NA 1HKKA 4AYSA 1NARA 2YL8A 1E55A 1UR4A 7A3HA 3WQVA 1YQ2A 3K8MA 1ZBWA 1E6RA 4GQRA 1X6NA 1VJZA 3NYDA 3KL5A 3SCOA 1CXIA 1W3JA 1BG9A 1VEMA 2NT1A 3HJEA 5HXMA 2XM1A 4IPLA 2PBOA 2ZXQA 2PC8A 3KZSA 4ACYA 3WH7A 4B9ZA 5E6YA 1CGYA 5JBDA 2XVLA 2FHFA 4PN2A 2X09A 4XUYA 3U5YA 2JEPA 1I1WA 3W6LA 2OYMA 2W5FA 1H11A 4KRUA 2BXYA 2JFEX 4BQ3A 9CGTA 2PWFA 2NW0A 3CUIA 3EMQA 4PMXA 1DWHM 2O9TA 4OOZA 3L4ZA 1OSEA 5D9MA 1TMQA 3A4WA 4D6DA 1JFXA 1JNDA 4MAVA 2J7GA 1EHNA 1XYFA 3OGRA 2GDUA 3G6MA
chains in the Genus database with same CATH superfamily
1GJUA 1K9EA 3MJYA 3GW3A 3FJLA 2RQSA 3PJTA 1ROTA 3ECQA 1S2AA 3ORWA 2CLLA 4FNRA 2Y0FA 3VOFA 2DZXA 1UHVA 1FA2A 4B5XA 4Z17A 1OB0A 1GYNA 3AXXA 3FA3A 4B5NA 1QI5A 4UXDA 1QFEA 3DFYA 4R34A 4CNTA 1Z89A 2WO5A 2J6VA 2BVWA 1AJ0A 4GRSA 3S2NA 1OYAA 3F5LA 2OKTA 1L6GA 5IHRA 3SADA 4O19A 2VD8A 4OVXA 1QPRA 3N4FA 3M5VA 4H41A 3ME3A 3MSDA 2EG7A 3ONBA 4KBXA 2IXUA 3TLQA 4DZ3A 3C3NA 3TTQA 1UKQA 3W7HA 2VGIA 3VFCA 1Y7VA 3UQNA 1JXKA 1VBGA 3JRKA 2R14A 4DJFD 3G22A 3SAZA 5DRIA 4AWUA 3LLXA 4HU4A 3AHXA 1A47A 4E4FA 4ODRA 3O6DA 4UFLA 3LPGA 1L8NA 2WSQA 3P60A 4DZAA 1KXVA 4MY9A 1I9CB 3W01A 4C1KA 1SPQA 4Y2WA 4DUOA 4DT4A 1VH7A 3PZGA 3PZMA 3WK2A 4WY0B 1W26A 3EX2A 4K7YA 3TONA 3NPVA 4C6CA 4HCDA 4GYPC 1LWHA 3LB0A 4AD4A 2NQ9A 1W9PA 5CPLA 3QQ1A 1DIOA 2QMKA 3IUIA 1W2PA 4LH8A 1FH8A 1J6OA 2OX1A 3PUGA 3VIGA 2XN2A 1XS2A 2VDGA 1A49A 1X8CA 1LJYA 4HMDA 4AY7A 2AGKA 2GJXB 2DZAA 1FKKA 1PKYA 1TJ0A 3RK8A 4ZR8A 3QH2A 4FLSA 2BY2A 1XCXA 4XO7A 4QROA 2NQLA 3K2GA 3EDDA 4C90A 3KTXA 1PSCA 5I3JA 5FF4A 3A4AA 2Z4GA 2PFHA 1TCOC 1WKFA 3N2MA 3GZ3A 4JFJA 1B3ZA 1XIIA 2Z6JA 3IK2A 2I7GA 3PZQA 3I6CA 3M47A 2ASHA 3V4BA 5J5DA 4HHLA 2Y7GA 3FVDA 1FOBA 3BG9A 1WZLA 3IKDA 3BG5A 4QLKA 1KXQA 3B0VC 1KFWA 3RG6A 3WQWA 1UC5A 1JGMA 4QT3A 3GH4A 3OBEA 1W6TA 1RQEA 3BOLA 5TNVA 4S3AA 1P1XA 4KH2A 4ZTXA 2YBTA 2QULA 4LPCA 4XO6A 4HTYA 3R8HA 3B06A 4GNJA 2JQXA 4HYRA 1DQXA 1BVWA 4Z2LA 1WZAA 3G8EA 1O1ZA 2G4FA 1MZHA 1MNSA 1K70A 1UBSA 3UR2A 1E56A 4BR1A 2OB3A 3T7VA 2NXGA 4L72B 2EG8A 2G41A 3EOUA 1U1JA 3H2NA 1O95A 4O11A 5FESA 2X7VA 3MP4A 4ADUA 4R5EA 2XFWA 3QLLA 4EPBC 4I8YA 1E4MM 5D8WA 1LCOA 3P2VA 2D2OA 2NX3A 1LUCA 3G1SA 2X30A 3MSRA 1V0LA 3CYJA 1J0IA 4DJFA 4WGXA 3URNA 2FGZA 1SMAA 2RDTA 3WMSA 1FWRA 3QJAA 1XUUA 4AZGA 3WDHA 5BXSA 1U33A 4AFYA 2WWCA 3HF3A 4OKDA 5EU9A 4H2HA 1KR1A 2O92A 1TZ7A 4CCCA 1IGWA 4U86A 3POHA 4CQ9A 3PNUA 3UNDA 5BRQA 1RP9A 2RH9A 2YL6A 3KP0A 2MNTA 4J2MA 1E6ZA 3QC0A 5AC8A 4U3AA 2J8GA 4MNKA 1TV5A 3GNNA 4HTBA 1J2WA 2PU0A 1BWVA 1ITQA 4PSRA 1B30A 2IKJA 3NTYA 3JS3A 4UFIA 3L4WA 3DBNA 1AVAA 4GD0A 1FDZA 4ZODA 2R1NA 4W9QA 1W5QA 3HPAA 1F3XA 5I09A 3NVTA 3SUWA 7PTDA 1XGDA 2Z1SA 3EWUA 5D33A 4FALA 4ODKA 2PPOA 1OFEA 5D05A 2ZBTA 2WMGA 1BTCA 1KM0A 4XZLX 3JZUA 4H7CA 5CG0A 5FEPA 4LAOA 1LBMA 2WNWA 2F84A 3FLUA 4B3KA 2I1OA 4Q4RA 3MVTA 2UWFA 3GSMA 3WO8A 5HMSA 1O94A 2VUNA 3IGUA 3W7EA 3S2MA 3EB3A 3EX1A 4ITZA 3GBDA 4UTIA 4DRSA 4H8HA 2KE0A 4I9AA 3BLOA 3U7BA 4H4IA 3UF8A 2WVVA 3SDOA 2WB5A 2ZDSA 4QFUA 1Q4NX 2V2HA 3TOPA 3WNLA 4LAWA 2CCRA 4UNIA 1MRAA 2GFTA 2XH0A 1E40A 3W53A 2PCQA 1LM1A 2YR1A 4JZ5A 5I5RA 3CWOX 4DWSC 4UWMA 1XIJA 4NX5A 3AS0A 4EPEC 3N17A 4ACZA 1RVGA 4QNEA 4ICMA 3OO2A 1XIEA 3C52A 3KVLA 1VJSA 4JFTA 3ATZA 1YDNA 4UQ9A 2PDGA 4DBWA 3F1QA 4GUIA 1R3QA 1L2QA 3CXOA 1UWSA 3W70A 2VQUA 1BYCA 1PKMA 3LRLA 3GTFA 1WAWA 3G1RA 4AZ5A 2RURA 4Q8UA 3BTNA 3G1FA 3HU7A 4S1FA 5E0CA 3HQOA 5PTDA 1C8VA 1V3KA 4OHQA 4TVDA 4KEMA 4JTJA 3IHZA 3VAWA 2ZE3A 3THDA 2PU1A 2WBKA 3UESA 5FKYA 2MLZA 1QHZA 4GGQA 1T40A 4G8TA 1OX4A 2VXNA 1R87A 3LLFA 1NOUA 3AJ7A 1AA1B 4IOTA 3V3WA 1GVYA 1Q85A 3UNTA 4B2DD 2JZVA 2WJDA 3VIOA 3LLDA 4GC3A 2DQWA 1EH9A 5A2CA 2KZHA 2ZUVA 1HP5A 1XQLA 5AKQA 4PBEA 4HIBA 3H2AA 4WDWA 1PX4A 1W32A 2JK2A 4JL2A 4D6JA 4AZBA 4BHYA 2YKKA 3ITXA 3W2LA 2J75A 1LF1A 1A5KC 2VWTA 1T11A 4OOUA 3H7RA 3MTWA 3VM7A 4C6JA 3R43A 4PCNA 3IV3A 4GY0A 4AZHA 3BAJA 4Z2HA 4YVXA 1IR2A 1OF8A 4UR9A 1UA3A 2VRKA 3WNNA 2FZBA 4E4PA 2V0TA 2P3EA 3CV1A 2IKGA 4EPDC 4A3QA 1FJDA 4H1ZA 4ZXOA 5CC7A 4DNMA 4XISA 2V63A 4DX3A 4IPXA 1ME9A 1HG3A 1QPQA 4PSPA 3ARRA 1W9UA 3FYPA 3KRBA 5LNRA 3QXBA 3A9BA 1PWMA 1XYZA 1GEHA 3GBEA 1OBAA 1W2VA 3T8LA 1PL9A 4PL1A 2XIIA 1X39A 5CPNA 1XGEA 4B4HA 4NX0A 4HNVA 4QP0A 4XBJA 3T55A 3IJ7A 2QJNA 3RRAA 5LXEA 3W84A 4S3GA 2A3CA 2AQVA 3NDZA 4JQ3A 4M56A 3XIMA 3G24A 4JIHA 1V3JA 1ZTVA 4LBUA 1HF6A 2ISVA 9XIAA 3FIGA 4DNHA 1EQ3A 4J4KA 3KOXA 4UZUA 5CPSA 1PYFA 1AMKA 4IT6A 3PFRA 1X6UA 4MPQA 4Z0JA 3UW6A 3WJWA 1B3XA 4QR6A 1VRXA 4YTQA 3KHDA 3RM4A 4DQWA 3SSJA 1TZ9A 3W1TA 1XLKA 1XLAA 3WH6A 4F0LA 5FAJA 3W7GA 2J88A 5B7YA 3WLKX 1CX9A 4RE2A 2OELA 4HPJA 2DUZA 2VEGA 3FK4A 2VDHA 5D2YA 5HW7A 1LWJA 3L5MA 4IIEA 3O5LA 3QMSA 2WKJA 4N7QA 4JYEA 3RGCA 1J4EA 4TOQA 3AMLA 2ZVRA 1OZQA 2QPXA 3BMVA 3GUGA 4BWLA 4XZHA 2GQ8A 3DFSA 2NVCA 3W00A 5HWNA 5HJYA 2I5IA 2P8CA 2XIOA 4HN4A 1A53A 2F23A 3NCOA 1TVPA 2XP3A 1VFHA 2D20A 2DZTA 1TWSA 3CB8A 4C6EA 3F4NA 4ODPA 2GUUA 3UWUA 3PWIA 5HPCA 2X1TA 3ITYA 4OFCA 1UWUA 2O0TA 1HUVA 2QW5A 5HNRA 3UQBA 3O7UA 1DWAM 4PMOA 2VFIA 1KM3A 3BC9A 3QEZA 3NQMA 4LUSB 4LC8A 4XV0A 5HATA 1PX3A 1BWLA 3WQEA 3KTCA 3VFLA 5C54A 2BHZA 3L2IA 1NAL1 3KBMA 4GBDA 1K7EA 5FA5A 1JDDA 2HDJA 2RHGA 2A79A 1GT8A 2PI6A 3S9YA 3CMFA 1EJSC 2VHLA 1WDRA 3STCA 2JKAA 3TU9A 3PJUA 3NRKA 3TNOA 2HS6A 3LGDA 5SWUA 3M0IA 5H8UA 3SFWA 8RUCA 4B4FA 1ELSA 3OLEA 3TQVA 4E3TA 1HKWA 1QBBA 2PDJA 5H2ZA 4IM4A 2VZTA 3U8GA 1IHIA 1UWRA 1V6WA 4J3TA 1JDCA 1QJWA 4FF7A 1KRMA 1DXEA 4PUNA 5HR7A 2HPIA 3OYXA 1WXYA 3W7MA 3WJXA 5DN1A 5CZTA 3C2VA 4JFSA 3UJEA 3MHGA 3IJ8A 1VFLA 2YFOA 5DITA 5A8GA 3DFHA 3R79A 1IGSA 2WMIB 1MFUA 2CEQA 3JU2A 4R7JA 2F6XA 3IPWA 1HJVA 1ZP3A 2BVYA 1KV5A 1YYAA 2Z1WA 4RX0A 5I98A 1TKKA 1ZZMA 1PZ2A 3FA5A 3W7CA 1FKTA 4L4MA 4GA8A 4C6BA 4L4OA 3PR9A 1C3FA 2ZR4A 4GZIA 4YL2A 1F9CA 4I6VA 4OBRA 2QJIA 1T99A 4JQAA 2CLKA 2Z2AA 3HB9A 2V67A 2RUCA 3PSVA 3OTRA 1XIBA 1D7FA 4Y9MA 3VYLA 2JIEA 4AX6A 3IS4A 1UKTA 3F2CA 3AUJA 3LCLA 4K8GA 3UJ2A 3H22A 4G56A 3SGGA 1KO0A 3NOYA 2G8ZA 1AZ1A 3MI2A 1MO0A 5AY7A 3LMZA 3ATYA 2NXIA 3MPGA 3ITOA 2VJXA 1JF6A 1QPOA 2REQA 3WDJA 4GKLA 3DAQA 5DEZA 1DPMA 2XYLA 2ABBA 5EMKA 3G1HA 2QAFA 3IKGA 5A6BA 2V2CA 2Y63A 1NWUA 3PZ9A 3TCZA 2GQ3A 1E6NA 3AAMA 3ARSA 7ENLA 3BLEA 5IBXC 4G2DA 4Q8MA 1BKHA 4IXXA 1E1CA 2ZDRA 4XAGA 5HNTA 2Z0IA 3KXQA 3T0AA 1RD6A 1U5VA 3B0PA 1NWSA 3CBWA 1G7VA 4BQ5A 5CPQA 1DHKA 2CLEA 1RP8A 3OG2A 1PTAA 3N13A 3KL3A 2CERA 2WK2A 4BS0A 2BODX 1QMLA 3CIVA 1VYPX 3T81A 2CWXA 3FSTA 2TODA 3VX0A 5K3VA 4UBPC 3LUOA 3ZZ1A 1G4TA 5KMYA 3W1RA 2HCVA 3N25A 4KFPA 3OVQA 4CNUA 4H7ZA 4NY2A 3C5QA 2AMXA 1FCUA 4LRTA 2NX1A 1R7OA 3EXTA 2WZTA 1TMLA 3L2MA 1KCXA 1H1YA 2QCLA 3UI5A 3B8WA 1BLIA 3CHEA 4MYXA 4S3BA 4GI6A 4W86A 3FX4A 4LAMA 1O12A 5LHFA 1RLDA 3AJXA 4S23A 3AZTA 1TJ1A 2IS7A 2YCLB 4Y90A 1CPUA 3UY7A 4CNSA 2NV2A 4JQ4A 4NQ1A 3LZ3A 2W63A 2QUMA 1MXDA 5BWFA 5DQPA 3V1PA 3ZVHB 1V93A 4A8LA 1VPYA 1F4AA 1CXKA 3BLLA 1GKRA 5C9ZA 1X1ZA 1HP4A 2FVMA 3VCCA 3QHNA 2Y85A 3N2BA 3UXDA 3PTMA 1NFPA 3M7SA 1J96A 2PDWA 3C86A 2XGBA 2GGGA 4FXSA 2RSEA 3PULA 2W62A 4K3ZA 3TC7A 3WQ4A 4R9OA 3K5XA 3AYTA 4HMCA 3TC5A 4WCJA 2J7CA 3MBFA 4AIEA 5HJXA 3M64A 3VKAA 4A3RA 4MYAA 2C15A 4M51A 1Z3NA 2ZX7A 2D0FA 2DVUA 1EQCA 2P76A 1E5JA 3C0JA 3AMDA 3BO9A 3KAGA 5ENLA 2HQAA 1Z8AA 5DT7A 1KRAC 4KF1A 3W7KA 1TPB1 1AFSA 3UEQA 1X96A 3II1A 3OIXA 2ZTKA 1RPXA 1BKSA 5JUVA 1ZB5A 1UQZA 5LNUA 2ZWYA 2FLIA 5LKYA 3G8RA 3W9ZA 2X2GA 3NIYA 3CYVA 2WXDM 1YDOA 1G01A 4TIMA 4M7SA 4KETA 4HQVA 3TA6A 1JVWA 1MUCA 7TIMA 1YW5A 1UOKA 2Q5AA 1QNPA 3G1AA 4RZ6A 1ZBKA 2QPUA 2J77A 5TD4A 1FWFC 3LI1A 2VGGA 3MWCA 1VPXA 8TIMA 1A3WA 3A3HA 1KKRA 1G69A 3H8AA 5BRPA 3DXIA 2PDNA 3QYQA 1M53A 1Z48A 1N1AA 2NSXA 3W1NA 1VKFA 1XSJA 3VGGA 2C71A 3E12A 5AVHA 3VMNA 4UTTA 4WOQA 5CPTA 2PWGA 2OO6A 5EMUA 1IT0A 2DEPA 1GG1A 2VX4A 3NQVA 4LUJA 3FSUA 1UASA 4AUBA 4KR0B 2E9BA 1CBGA 1J0YA 4JFLA 3LN3A 2FFCA 3K8LA 1SZEA 3AFBA 1S2WA 3VNLA 4TYOA 4TQTA 2BX7A 4NXKA 2WMIA 1XLBA 3H4WA 1F6YA 4Z2KA 4ZE5A 3GR8A 3PWGA 3STGA 1ZCOA 4Q4MA 2R1LA 1G4EA 3L4XA 4TVCA 2EPNA 2YXOA 5BZAA 1CGWA 1UH3A 4UR8A 5I2UA 3BVJA 4AMAA 1DXIA 5FL1A 4KFOA 3AWOA 3KOZA 3W2MA 3VU2A 2RUQA 3P8IA 3E74A 1UMYA 2B4GA 1V51A 3BAKA 4LAXA 1QO2A 2VNCA 3MKCA 1JUBA 4HOZA 4LCSA 2CZDA 3SN1A 1BPLB 4Z1YA 3BLFA 2YLLA 2NLIA 1G0CA 4M29A 4QAIA 1KGUA 3CIWA 4LVBA 1ADSA 3LCIA 1FCVA 2BB0A 5LIWX 1IWBA 1ZHAA 1VFUA 2ANUA 2OMAA 3L21A 5C7VA 1B9ZA 3WQCA 1OY0A 3M0MA 2BGSA 1B3OA 2UV8G 5GJMA 1EXPA 3OP2A 3VDBA 3R8RA 2VGBA 3AMKA 1XFBA 1FD9A 1H4PA 3RR4A 4HPGA 5A6SA 3ZJ8A 4JTDA 1FHDA 2KFWA 2HBXA 1L8PA 4IGNA 4PMNA 8XIAA 1MVYA 5JMUA 3BG3A 4LT9A 3H4XA 3GXFA 1C7SA 2Z6IA 4HNNA 4RDZA 1V7YA 3R10A 2Z7GA 4J3VA 1F8MA 1GJWA 1FVPA 3SCNA 2Y2WA 2FTPA 1OYCA 2RAGA 3M0LA 4H2CA 1AQ0A 1OFPA 4G1KA 4DY1A 3ZWSA 1DKWA 3T6CA 4L4LA 3RX4A 1BKFA 1QNOA 1T8XA 4J28A 3APGA 2SFPA 4IQCA 1HZYA 3CL7A 1W3IA 1X7FA 3FA4A 3KBJA 3L4UA 5CLTA 4PUEA 1NQKA 1PZ1A 4Q6XA 3RDKA 3DCPA 2PDXA 1AK5A 4ODQA 1B6CA 2YL5A 1FXQA 5C8BB 5D03A 1YEYA 1WUFA 2ZA1A 4ADTA 3VAVA 1REQA 1K1DA 4XZWA 2D2JA 3Q4DA 3O6AA 3THUA 4JIPA 2P53A 4EWJA 5HWJA 4MB5A 3M4HA 1VEPA 3IGSA 4CN4A 3ZXWA 4HHMA 2ZZ5A 3SIZA 4BF8A 4AIOA 3DESA 5CPOA 3PB2A 5AYBA 4V15A 4US5D 1EKOA 1R46A 3NPXA 4KEZA 4AYGA 3CGMA 2X1RA 4JTRA 3TQ0A 4M6UA 1EJTC 1C8QA 2WC3A 7REQB 3E3HA 3NQ2A 4DHGA 3SECA 4K1WA 5D4YA 4A6GA 2OZ3A 2DFAA 2ZUMA 2J7BA 3UCCA 3CQIA 3TJLA 2P50A 4ZENA 1P0BA 3C2OA 1PX8A 3OJGA 2GZXA 2ZQUA 4RE3A 3C56A 3V5CA 2NT0A 2FKPA 2DH2A 3H55A 1W5NA 2GSJA 3P62A 3QV9A 5E93A 4KQNA 3QFEA 3CC1A 3FAPA 3AHTA 5F2MA 2VN1A 4F2BA 1UWTA 2WBGA 4LS1A 3UFYA 4KWSA 4PBFA 3MB9A 1EJUC 3HPFA 1UZHA 1ODUA 5DY2A 1NWTA 3VD3A 4Z2JA 1W9BM 1E70M 1XJBA 2BOEX 3R11A 2CIPA 1FP9A 1NFBA 1ZPTA 1JNEA 5C9UA 3RO6A 5XINA 2XFFA 1VFSA 3SIMA 4CCZA 2ISFA 2XSAA 2CHOA 5F4SA 4GNKB 1Q6GA 4JFVA 1EF2A 4GFIA 4GINA 3O6YX 1PTDA 2VL4A 3HPZA 2P4VA 4HGXA 3OODA 4IGMA 4XAZA 3CO4A 4FA3A 3T4CA 3ABOA 1A5CA 2BSLA 3VIPA 3AO0A 1JPKA 3EDEA 4Q32A 1SSGA 3U9IA 4D1JA 3CT7A 4WSKA 2ZXAA 5FD0A 3F4VA 1HJUA 5EB8A 4C91A 1E4LA 2QJJA 5ABGA 4GXMA 4RE4A 3LCGA 3HJZA 5FJOA 5XIAA 3BGAA 1A5OC 1W3NA 2BG5A 2YPIA 4PTXA 1VBUA 4TTUA 3THCA 4BI6A 4LUYA 4DYKA 4JICA 1L6YA 1UKOA 4Z1CA 3AU6A 3BPWA 5E0FA 5HNUA 2FYMA 3UZJA 1WBHA 3AHYA 4Q4OA 3RJYA 3AS2A 3G3DA 1YTDA 4LUIA 2H3BA 4UQEA 1EYEA 3AUOA 5FL0A 1KFBA 4H9UA 5EMLA 2GUBA 3UP8A 2PDYA 2ACSA 4WKFA 3VILA 1MEIA 2XVPA 1SFLA 2J7HA 5FI8A 3GU1A 3WQ5A 2R91A 1SVDA 2Y6ZA 4AWEA 1Q45A 4UQAA 1C92A 4TTGA 1WXJA 4DO6A 1M3UA 2ZX8A 1FKLA 3W75A 2I16A 4XBSA 2O55A 4NAEB 1CLXA 3ES8A 3BK0A 3AALA 2D73A 2GJXA 2Z1BA 3PC0A 3MI6A 5G2IA 5CJ5A 1TPUA 2WVTA 4FNTA 1ZFJA 4JN8A 3CQ0A 3PN8A 3G1VA 4NJJA 1XF0A 1LQAA 4PL2A 3O06A 1DE5A 4WDUA 4RDVA 4MJZA 5H1WA 2VCCA 2CU0A 4C7DA 3TSDA 4E2VA 3WZ0E 1NDYA 3BCDA 3BUVA 3QBUA 3N9KA 3PZTA 3PTQA 1R7AA 4Q33A 3SUSA 2E6DA 3LV5A 5CSYA 5D09A 4FNPA 1XC6A 4GUFA 3DYMA 1AW1A 1EP2A 2XM2A 1BL4A 1GOKA 2D9FA 5KZ6A 1SJBA 4HNTA 2EPLX 5I77A 1GOWA 2PTZA 3WLIA 1BQCA 3RFWA 3EPOA 1AH3A 1XDJA 1KCLA 5G4EA 3BAXA 2J78A 3ABXA 3GVWA 3WYZA 4C6QA 3DFTA 1WX0A 3RUBL 5HNNA 5GNYA 4CUCA 3O5EA 3TR2A 3TTEA 3P0XA 1TIWA 1XYLA 1JL8A 3NL2A 1MDRA 1OM0A 3QHMA 4GVGA 1EL3A 2V5DA 3ELFA 2Q02A 5BCAA 3A12A 4UTLA 5CZKA 1DXFA 4EF8A 4RE0A 2WLYA 1BYAA 4AU0A 4XZBA 1KFCA 4QE4A 5IOBA 2VZVA 1XCFA 4UTJA 1I1XA 3NDOA 3ZR4A 4Z1AA 2PPNA 2F7FA 3K1GA 4HZ6A 2C16A 1Q3NA 2VO5A 3QV8A 1EX5A 3WLOA 3QTPA 1ADOA 1S39A 3EZ4A 2ESCA 4JDBA 1M01A 1XSKA 4LW7A 1TG7A 3NQCA 1FH7A 3IVTA 4QIUA 3UF9A 1ISVA 4F0HA 3T2OA 1XLGA 1B57A 5CKSA 5CQ1A 4PEKA 4FIRA 4RV8A 2DZBA 4GY1A 3SM0A 5G2WA 2FHCA 2WMKA 1XLDA 2XVKA 2JF7A 3QZ6A 4DUVA 4PMVA 3P7YA 4JIQA 2EULA 1M7JA 1HKKA 2YL8A 1UR4A 1IIHA 7A3HA 4GWEA 2A3LA 3GDTA 3WQVA 1YQ2A 4NJHA 4PRTA 4RW5A 3I7RA 2BXVA 1VJZA 2ZRWA 3KL5A 1R2RA 3TSMA 3L12A 4ACYA 3OYZA 3OVRA 1B4EA 2W0UA 5JBDA 2XVLA 4PN2A 3S0CA 4A8NA 4A8IA 2QUTA 3U5YA 4K37A 2OYMA 2W5FA 2ZC1A 4JTUA 2BXYA 2JFEX 9CGTA 3DGBA 2PRHA 4PMXA 4GQGA 4A3UA 4LS2A 4MAVA 3GC5A 3MKVA 4FS9A 1XYFA 2A7PA 3HGOA 4UNKA 5E5CA 3P5YA 1U5JA 4K1GA 1BF2A 4FOUA 3VGDA 1GHSA 3BQ6A 4GI8A 1H41A 1TCMA 8CGTA 3ITCA 3WNKA 2BGQA 1J01A 2GWGA 3B9OA 2XN1A 2PGRA 2EBNA 1GQIA 1GOIA 3QHOA 4X0VA 1B3YA 1E3XA 4H19A 4V33A 5M3WA 1FY6A 1WKEA 2XP8A 3S1WA 1XIDA 3F4WA 3T2PA 1G7UA 5KZDA 1S5MA 3O5RA 2DT3A 1LUCB 2GVLA 3PZOA 1C9WA 1PKLA 1J10A 4ECLA 3G6LA 4WLCA 4HOWA 2D69A 4IMGA 5IFTA 5C9WA 3RGTA 4XSMA 1GPFA 4QSHA 4HN8A 4YVPA 4OUEA 4AWSA 4FEZA 1PWLA 2LPVA 3HFTA 4A22A 4XX6A 4A05A 2AL2A 1EHAA 2CBJA 2VR5A 3W37A 1HFBA 3A23A 3W7RA 3PR2A 2NQ5A 4ODLA 4E8DA 1V3IA 1H7OA 4X60A 3OLDA 3A3XA 4U5KA 4PRWA 4CEUC 3L67A 3E9AA 1CB2A 2FJKA 4GIYA 3B9AA 4XAFA 1JJKA 1XD0A 3TYUA 1EA9C 2I5QA 5LIKX 1E71M 5BMWA 3TAOA 4IUOA 3QPZA 4H8UA 1HT6A 3NQEA 5B80A 1A7XA 1OT2A 1WDDA 5D32A 3P67A 3SGZA 5A8PA 3O2LA 2PTXA 2R6OA 2QCGA 1HNYA 2WC7A 2FVKA 2G37A 4YYFA 2DZVA 5DT5A 4DXVA 3DN5A 2OWWA 2PWDA 5K4ZA 2V82A 4DPQA 4YHEA 3RAOA 3LHWA 3H54A 4WKHA 3AISA 3GIPA 4ML9A 1EZWA 1KTNA 4W8AA 3W29A 4LYKA 1CEOA 4GI9A 4HOXA 4EK7A 3NJ3A 5BMXA 1JR1A 1DQUA 5BU9A 4LS0A 2BTMA 3O3RA 2CETA 2E6FA 4DH0A 4WSJA 1FKBA 2UY5A 2W91A 3LCFA 4LY8A 1PS9A 4NAEA 2XINA 3VD7A 3RMJA 2PDMA 4GK8A 3VD9A 3W6MA 4A8RA 5CC6A 4DJDA 1A0EA 4XIAA 3TVAA 2DH3A 4XB3A 1ZAHA 4O8RA 1LDCA 1V02E 2JBMA 4IUGA 4J3WA 4MG4A 2Q01A 3ARWA 1IEIA 3ZVHA 1F73A 4PUWA 1AH0A 4K8EA 2OYKA 2VGFA 4NSBA 4XBKA 3MYPA 4PMDA 3SO7A 4J4OA 1X97A 4JFUA 3LPOA 3E5BA 1J5TA 3NQGA 1U83A 2D23A 4D2JA 4JR5A 3CH0A 1AQMA 2H6RA 3BJFA 1WBJA 5TBOA 5D02A 1TPWA 2K8IA 5A8NA 3E0WA 3WFAA 1H49A 3T42A 1PZ0A 3EXRA 1HGYA 3AQUA 3O5KA 1UD5A 2JGYA 2JF6A 4V2XA 3S5OA 4PUUA 2UBPC 1ZY9A 3AS1A 4RUBA 4I3GA 4DWSA 1J8VA 1SW7A 2NV9A 3CLWA 1FKSA 4PEEA 1OYBA 2O9PA 2PPGA 4FR1A 3GR4A 3HOJA 2OZ0A 3OEXA 3P6LA 2XIJA 3MQTA 2OXNA 4DO7A 1PYMA 3TXZA 3U5UA 2HJPA 1E1EA 4DYEA 1RUSA 2VC5A 6PTDA 3CMGA 3WF4A 2YZ5A 1DJNA 1R9HA 2VWSA 3E2QA 5L9FA 3V35A 4MZYA 4A2SA 3QOMA 1DORA 4R9XA 1W3HA 3QVQA 4DO4A 1G67A 4J35A 2G95A 1QATA 3GRIA 2ZZ7A 1CWYA 4MIMA 4WY0F 4HJFA 4XSLA 2PDUA 1U2YA 3WEMA 4YVVA 3AXKA 3C2RA 3TC6A 4PUJA 3BCJA 3MZ2A 4MY1A 3DH7A 1UJQA 4IIHA 1XG3A 1V6XA 5DF0A 4O16A 3MUY1 3BMXA 3LD5A 3GHUA 4IIGA 1ICSA 3VUSA 3KL0A 4GH3A 5DCDA 4XUGA 1PINA 5AC5A 4LAVA 4JIIX 4KCVA 4QDMA 4UTKA 1XISA 4MUZA 4F79A 3IARA 2XDFA 3VKJA 1TTIA 1V3MA 1XC4A 3NO5A 4KCUA 3NSNA 3WQFA 1YPFA 4R53A 1R85A 1J0HA 2ZQTA 2ZX5A 4ZTYA 4B16A 4FNUA 1WOBA 1YBQB 3GU0A 2W92A 1JYVA 3CWNA 4S2CA 5BOOA 4DJFC 2WQPA 1CGTA 3VZXA 3KACA 2XP4A 3U6WA 2B7NA 1RCQA 1LWIA 2W79A 1QOQA 3NURA 3N15A 3FKRA 4IFRA 2Y78A 1OVDA 1OCNA 4YHGA 4H3DA 1PJ9A 1A3HA 3CEUA 1K7FA 4M24A 2EKCA 1R3RA 2WJEA 1VBJA 1VS1A 2VEKA 1UKSA 3HV8A 5GJNA 3CZ8A 1VZWA 3ARPA 3CHCA 1MXSA 5GPGA 3MW7A 3TYBA 2ZRXA 2A3HA 2VEIA 3T4WA 1Q13A 3CMJA 1DJXA 1W9DM 1U79A 3A3WA 5BU6A 1W1VA 3V18A 3W4RA 5KITA 3VGEA 3TTSA 4MGVA 2C1GA 2BZNA 4P2VA 1QWKA 1J93A 5DLCA 1E0VA 4NZCA 2A6NA 2JALA 2VD9A 1TRDA 1JYXA 1DJGA 4XAKA 1QPNA 3AWNA 2ZCGA 3RLUA 3BW3A 1T96A 4KFNA 3LSCA 2OSYA 5EPDA 3VXGA 4J3ZA 2MANA 4QE5A 2FZNA 2VVSA 4BF5A 2J24A 2ZRVA 3M0KA 3IWPA 3E1F1 3ZQ9A 3W02A 2MLYA 4NI3A 4RKAA 2PGFA 2PP3A 4LUSA 1L2UA 4IQLA 2QCNA 4C6DA 3GB6A 3DIPA 2BMBA 4W5UA 5JIWA 4ZFCA 5I03A 4X61A 2B7QA 1P4CA 4LAZA 1YATA 1M9HA 1ONRA 4F3HA 2C7FA 2DSUA 2REQB 1C9DA 4AD0A 2VRQA 4XD6A 3DERA 3ABSA 3PJWA 1KXTA 2PLMA 1JIBA 1GGOA 4EOUA 4F9DA 3NQFA 1V0NA 1QDSA 4MJMA 4QCFA 3TWBA 1RQBA 4JTSA 2YA2A 4HNUA 4C6PA 3AS3A 4UTWC 3CUFA 5HINA 2BLEA 3CJPA 4HHPA 4MADA 4GIEA 3WKZA 1VYRA 1RVKA 3PPCA 4W84A 4JIRA 1GRJA 3KRSA 4WY0A 1HKJA 1XBYA 1IXOA 3KS6A 3TYDA 1JQVA 1IR1A 2V5JA 3VINA 1T6MA 1F40A 2YCJA 1Q5MA 1ISWA 2QS8A 4EX4A 3SCUA 1L6FA 1U1HA 4O18A 3GO2A 1IT8A 2YCLA 4GIRA 4AC1X 1VENA 2DT2A 2ZOXA 4GPNA 3LGGA 1H51A 1E1FA 3U4AA 3DHUA 1S2UA 4ZSTA 3DHPA 3UZWA 2XJ7A 5CGQA 1E3ZA 1ZALA 3B8IA 2IW0A 3DFNA 1B1YA 2V5KA 3TDBA 3GXPA 3VOHA 3TV8A 1EWEA 2XISA 1JDEA 3DFQA 1EF3A 4ZEPA 4ZO7A 3OHMB 4B5UA 5HULA 2QLYA 3SW6A 2VCAA 3CM4A 1XIHA 2OWCA 4EVZA 3SEPA 3W74A 1TIMA 9RUBA 2PV1A 3TW7A 1PHWA 4V28A 5A8MA 1QO5A 4QQ3A 4FMVA 5IDIA 2B81A 4LJ3A 3TSBA 3B0YA 4FOJA 2VX7A 5HWBA 1A5NC 1US3A 2OZTA 3V1HA 1SO6A 5CAKA 4AZ6A 4P7RA 1HVQA 1P0NA 4ZMGA 2ADAA 4YPJA 3FXGA 3S1UA 2B31A 4C6LA 4PB3A 4QISA 3KW3A 3TXVA 3DUGA 5C9RA 2CW6A 3NQBA 4MMWA 1ZGDA 3CWHA 4RCXA 6REQB 2H8ZA 1P0EA 3MI3A 4JTQA 4YWIA 1XYCA 4E2OA 1ZQ5A 3TA9A 3NQDA 2NZLA 3CAQA 2H3DA 1UR2A 3HFYA 4HK6A 1KWKA 1SJCA 3EWCA 2DZPA 1V08A 4CVWA 2VZSA 2FPTA 2WMFA 4UCGA 1C93A 4Y8EA 4CEXC 3GXDA 2CZ5A 4DF0A 3VIHA 3WLQA 1DHPA 4PCPA 2QGHA 1ROUA 3E02A 2WNNA 1YNQA 4PTDA 2GVEA 3W71A 4Z42C 4D6GA 2F2DA 4GMEA 4JL1A 4PULA 1G9HA 1J18A 3MCNA 1H7NA 3F2DA 4MKVA 4W7WA 4C6MA 1OC5A 4E6MA 1DE6A 5TF0A 3TMLA 1T7LA 1EBHA 4C5YA 3R94A 3R0UA 4CD8A 2VCDA 2PTWA 3O07A 4E2BA 4XKYB 2W3ZA 2P1FA 4DAFA 1GVEA 1FFQA 2YZRA 3URBA 4JX6A 1NOWA 2Y61A 3BL3A 5JXQA 2VX6A 3HPSA 1CXLA 3O5MA 2YA1A 2ZTJA 4IFOA 1GOOA 4MPKA 1V5XA 1JULA 2WJZA 4HCHA 3GE7A 2A21A 4X22A 1W1B1 2FKEA 4TMCA 1VIZA 3UI6A 4MDOA 3LG3A 1FXPA 1WZKA 1OGGA 1FKRA 1PTGA 3W0KA 4GVHA 4W8LA 3SCWA 3WF1A 5AYXA 1E6PA 2E77A 3I6TA 3U3HA 4LF2A 3WQGA 3BJSA 3NEVA 4NZFA 1TWDA 3EWBX 4XAYA 1JPDX 2E9LA 2J9ZA 3RX2A 1OC6A 1CLVA 4LNCA 3K30A 3V75A 3NTPA 3PK7A 5A5WA 5LA1A 1JD9A 3WQ8A 1A5LC 3B8SA 1I2RA 2W66A 2X16A 3S1VA 3B0UX 3S47A 4GO8A 3PUEA 4GCXA 4BCEA 3N1AA 5KINA 3R2GA 3UZZA 3UYIA 1AJZA 3GTXA 2GDVA 3QSRA 1XBVA 5LXXA 1FDJA 3CHDA 4QITA 4JNZA 5M1TA 3DC8A 2YYTA 3OVPA 1XCWA 2GVJA 4G7EB 3TIMA 1O60A 1JCLA 1JGIA 2HRWA 3AIWA 2A0NA 4MLJA 1V77A 1R3SA 2WZHA 4DJDC 2YB1A 3Q58A 5FJJA 4R7OA 5EA9A 3SUTA 2PP1A 1H5YA 1WO2A 3CQKA 3GKFA 4K6AA 2QCDB 3W7NA 5BNKA 3LDVA 4Q8NA 1EOMA 1XM3A 3B4UA 3GVGA 4CD4A 4YTTA 4JTTA 3B8DA 3UI4A 1E5NA 2WWDA 1REQB 4L3NA 4MWAC 1TJ2A 2YOCA 2D0GA 4D6HA 1XPGA 2OSWA 1LRQA 4I7UA 1W0MA 2J47A 1YPIA 3RRXA 4A3YA 4HA1A 3WNMA 1FKHA 2CNCA 3WDRA 4W9OA 1ZK6A 3R4IA 3TC3A 3LU2A 3C4UA 5TQLA 2A3EA 3CTLA 2QDHA 4MZ1A 1QPLA 1RJPA 2VDIA 4IMCA 4XIMA 2Q8XA 2E0PA 2JGQA 1GPWA 3R5EA 1J4IA 2C79A 3I7QA 4NL1A 4Q8PA 1O4UA 2J7DA 3A5VA 3SBFA 1EXBA 2XTKA 3DG6A 4NNCA 2J13A 2XVGA 2CHRA 2FQIA 1EDGA 5H6HA 3V7PA 4AF0B 3VOJA 1F3TA 3O1NA 2PCEA 2FH8A 1XBXA 4G2PA 3ALFA 3PPFA 1I2PA 3WD4A 1FWGC 4HZ8A 5JBEA 1BWKA 2VFDA 3UWYA 1MW0A 3CNYA 3GHSA 5EBAA 3EDFA 4JN6A 4R85A 3W7IA 2ACUA 3L7RA 5K9CA 3PVFA 1UC4A 1X1NA 3PWAA 4NZ4A 1NQ6A 2FB3A 4GJJA 3NSXA 3CPGA 1UJPA 3KOFA 1TYGA 4JXCA 1FKDA 1L1PA 1MSSA 2ZQSA 4TV6A 2PDKA 1ZL1A 2Y70A 3PUDA 4R7WA 2F9RA 5D8ZA 1XLMA 4AY1A 3GXTA 2ZZ1A 3BLKA 3BGJA 3KWSA 4PUMA 3UWEA 4DI8A 1V8EA 1W37A 1YADA 4NASA 3B0XA 5MHBA 3LENA 3LXAA 3IIOA 2QNEA 1UCWA 1O66A 1IXPA 3VPLA 1PCKA 1OFRA 5JU6A 1E0UA 1WOAA 1ZAIA 1VHNA 3FYYA 2L5HA 3N2TA 1ZJBA 4V1XA 1G6CA 3IJ9A 2INEA 3LZ5A 1QZ2A 1TX0A 3GM8A 1AQFA 2WAGA 3WMCA 3O05A 4H6RA 1BF6A 1EGVA 2WCGA 5LGXA 4DWSD 3LV6A 3V0UA 2OLSA 2CBIA 5T9BG 2QXWA 1EO7A 1DJQA 3EWWA 3A4XA 1YW1A 1EGMA 1AW2A 4GFSA 4CQ8A 2BOFX 2YX0A 3UVIA 3NYZA 1WKYA 4Z2IA 1Q63A 1EWDA 3PZVA 3W1PA 3KAHA 3LRMA 4EANA 5C55A 2QCEA 4RNFA 1SJAA 3TKFA 5EL1A 5TIMA 1EUAA 1UKPA 3H70A 1UD2A 1TWWA 5JH2A 4UB9A 1UG6A 2DSZA 3OGSA 1UQYA 1O6IA 1G1YA 2XIMA 3HG2A 3U4FA 5GPRA 2ZZ3A 3KZ7A 3WBWA 4KIRA 4EP8C 1SU5A 3WUFA 1YLVA 3TN3A 2PTYA 4XKMA 4XKYA 4CD6A 4IFKA 4Y6GA 2VURA 4IJRA 4JFIA 1SZFA 3BV7A 3UXLA 2Z24A 5L6UA 3T0DA 2XHYA 4H9MA 3U2OA 5I78A 1TMHA 2WVSA 2J74A 4RNHA 4NZ3A 3W7DA 1O1HA 3CEPA 3GY1A 4F0KA 5J6EA 4TW7A 1V4YA 2WHMA 3YPIA 4DRNA 4D71A 3OLIA 2FAPA 1G94A 1W3LA 2WC4A 1J79A 4LVAA 4I5RA 2AKMA 2I14A 1UB3A 5I0DA 4FNSA 4QEHA 3BH4A 3VNMA 2ZUNA 1HXJA 2IQDA 4FI4A 2NV1A 3ITLA 4XZMX 2YCEA 4GGBA 1VYSX 4H01A 1RD5A 1YXCA 1P7TA 2VFGA 1KFJA 4OECA 1I2OA 6A3HA 1OCBA 3REQA 1EJWC 3LPFA 4US5A 4ERAA 3O5FA 1IWPA 4WDTA 5AOUA 3E2SA 1Q8JA 3VABA 4GISA 5D30A 3VKDA 2XFYA 3D3FA 4WVXA 1JF5A 3AIEA 3EDKA 3H21A 5HTGA 4WSHA 4KT2A 1US2A 1IEWA 3GXIA 3MUAA 1YNYA 1ISYA 3C0SA 1TCDA 2DZSA 3A9IA 1XRVA 3BXWA 4POCA 3I4KA 2XN0A 2EQDA 1CXFA 4AXNA 4IG2B 3VDGA 4Q7NA 5DXXA 3WELA 4LOCA 2CBUA 1RALA 3SRFA 3EX6A 1Q6QA 3UPWA 4TX9A 3HMCA 2ABAA 3ENLA 1VP5A 3LCXA 6ENLA 1TELA 1KW1A 1YNPA 4W85A 3TZFA 3RYSA 3HQNA 3CZEA 3NQ6A 4WF7A 3EIPA 2V5CA 1XD1A 5HUOA 1LQ2A 5BOEA 5G2HA 4I5XA 4YTUA 4DWSB 4PODA 1ZAJA 2GVYA 3OGVA 2EJAA 3LXCA 3FW6A 3AI0A 1OT1A 3LS9A 3L9CA 3TW9A 3FGCA 1JFHA 1JCNA 1B3VA 2PMQA 2X41A 4JFKA 3RNDA 4I7WA 4QTGA 1TREA 2W27A 1HIZA 3ARUA 3WQOA 2ETNA 2H90A 4Y8FA 4WKAA 3SCTA 4G9PA 2CXEA 3IVSA 4NUWA 2QIWA 3LTSA 4IT4A 4CLMA 4JTHA 4N42A 2YDQA 4KGJA 5F2GA 2ZRYA 3O8AA 4J1OA 4UTMA 1CXHA 2VI0A 3PBMA 3W1UA 4IPNB 4UTFA 3GVQA 4LB3A 4W87A 1E6SM 4GO9A 4LUTB 1FWHC 1TTQA 1E4IA 4HU3A 2G97A 3TNBA 2BY1A 4ORMA 4FN2A 2HPMA 2OKOA 1EBGA 4CN1A 3P74A 1K8ZA 5LIYX 4K7VA 2KI3A 3U2ZA 6TIMA 4W7UA 4DAIA 2YGYA 3GH7A 4LY4A 1NH6A 2P3ZA 1ZJAA 2P0OA 3W72A 1Q6RA 3N14A 2OYLA 3STEA 4PMZA 4D72A 2ITKA 1TVNA 4EXAA 3MYOA 1KTCA 3K46A 3EXSA 1KRCC 3W07A 2OX4A 4AHPA 1UOZA 2VCBA 3V36A 3VI2A 1M5YA 1S2VA 4RPPA 4IXHA 3S5SA 3C6CA 2WCAA 2Y7DA 2GQAA 2WVUA 1R3WA 2GOUA 1KCZA 5GVJA 1CCWB 4ERGA 1Z9AA 4GYJA 1IXNA 4H9VA 3A22A 4L80A 1K6WA 1L6SA 3KABA 2PDQA 3WBEA 5LIUX 2E8YA 5JQ9A 1HKMA 2HZGA 3JW7A 5G4WA 2ZWZA 1KFEA 2V3GA 3LCWA 2FFIA 3KRZA 3R1ZA 2QCHA 1DYSA 4MB4A 1EJ7L 2YDRA 1GOXA 5CLWA 3IK4A 1IT7A 1QNVA 4KGLA 3IJIA 3L0KA 5I23A 4Z1BA 3LTPA 2AKZA 4NXSA 3CZKA 1NTHA 4YJ5A 3UA3A 3ALGA 3S2LA 4IHCA 3ZS4A 3WCZA 3FAWA 4M82A 1BGAA 2OGYA 5F4XA 1J0ZA 3GDLA 3LA4A 4LYPA 3QSTA 4O53A 4NZJA 3TTOA 4JCLA 3G0UA 4LAYA 4GLEA 3VE7A 2VT0A 3CGTA 3DC0A 3I6EA 3ZR6A 1J4RA 3UPMA 5LGZA 5EMJA 3S83A 2VM8A 3LM3A 4S39A 2Y5JA 1QOXA 2OR2A 3T0BA 3ZM8A 4QT2A 3PZUA 2CXGA 3I68A 1OABA 3UGRA 3RO8A 2QCDA 1LL6A 4EAMA 3EKZA 3FEMA 3G1XA 3W22A 2AL1A 1Q4WA 1P0DA 2XIQA 2D24A 2GJNA 2EJ1A 3K1DA 5K9XA 3WUGA 4CD7A 1G4SA 2ZUTA 4DJEA 3HURA 1TE6A 2ONEA 1NJJA 2QJHA 3KX6A 3ABZA 3M5YA 4N9CA 3R89A 4L9ZA 3UT0A 2Z00A 3O0KA 1CI1A 1C90A 2CPUA 3B40A 5A95A 5GNZA 1DQWA 5G5IA 3TROA 6ALDA 5HWCA 2NWRA 1PDYA 2FB2A 2GGJA 3UR7A 2ZADA 3A21A 3NL5A 3OOBA 2NX9A 4YLWA 1RCXB 1SMDA 3V0TA 4RDWA 2QF8A 1GORA 4Q4SA 5C7HA 1ZNNA 4J3SA 4JYDA 1GK8A 4M1RA 4MNJA 2PTDA 1C29A 2Z29A 3FFSA 1XFCA 3EWXA 2VMFA 3MDWA 2ZRZA 4WD0A 4GE8A 4EXBA 4U5IA 4S3KA 3S8HA 4CNPA 5HDRA 2Y88A 3ITTA 4Q8QA 1ZENA 3WIJA 3M46A 4H7VA 3NL3A 1RY8A 3WMBA 3PAJA 2G4JA 2FH6A 1H0GA 3NM1A 4M6QA 4DRHA 4BJHA 1EEPA 4N6EA 4ZQCA 1OD8A 2JKPA 1AODA 5I06A 4ZS6A 2KO7A 3BARA 8XIMA 1R38A 3KBSA 2QV4A 3UU0A 3RIKA 4DZ5A 3N3TA 5FF7A 3W85A 1QAPA 2Q6ZA 1SO4A 3B9NA 3VMPA 3KEHA 2XH4A 1D7IA 4XZNX 1JXJA 3R7MA 4Q3MA 1MNZA 1K8XA 4M0XA 1ZSXA 1DWFM 2YB4A 3VNKA 3ARQA 1MXGA 1WP6A 5C2XA 1OIFA 1A0DA 4MTVA 1A3XA 1BQGA 4AF0A 1S2TA 1MQQA 3JZEA 3PB0A 4HYWA 2J8TA 1F2JA 4GUJA 3FYOA 4ORIA 1E55A 4ZBCA 1ZBWA 1E6RA 4S3FA 4GQRA 2V81A 3NYDA 2QEZA 5HJLA 3SCOA 1CXIA 4O57A 4ZOEA 3TJ4A 1BG9A 1SW0A 1VEMA 3SZ8A 4MLRA 3KS5A 3MWAA 1SUXA 4B9ZA 4I7VA 2FHFA 1TV7A 3ZVIA 2P88A 1I1WA 1W56A 2VP8A 2NXHA 2ICSA 4LALA 2GVGA 3CUIA 1NELA 3EMQA 3W88A 4A35A 1FQ0A 4OOZA 1YIXA 3DI1A 3C3UA 3SI9A 3L4ZA 2GJLA 3A4WA 4D6DA 1JFXA 2HEJA 2J7GA 2WNZA 4PA8A 2J6XA 2XU2A 3IGHX 5CZJA 3VKCA 5DRCA 3EB2A 2GDUA 3O5GA 3QKEA 4HSNA 2PS2A 4N19A 1OCJA 3N19B 4ZVJA 3TJIA 1FH9A 3EOOA 4NP7A 4O1DA 3M1ZA 2BXZA 3ANUA 5DMYA 4ZB0A 1KNWA 4ILSA 1GVFA 1KBIA 3SCQA 3CAWA 4AG0A 1R3TA 3GAKA 3GR7A 2X40A 2B7PA 3OW1A 4PR4A 3UJFA 1BSIA 2E5CA 4BQ2A 1HVXA 1IE7C 4ZL1A 4KERA 2Q09A 1W5PA 5J5RA 4JBRA 5A6LA 2D2GA 4TXEA 4WOZA 1P6BA 1YTEA 3KVJA 3KOYA 3EAUA 2IXVA 3VZZA 1FCBA 2YCIX 3CLMA 4E0CA 1EA0A 3SUVA 5E09A 4HD5A 2WHKA 3P80A 3MBDA 2OODA 1D6OA 4CVUA 1M65A 3GHTA 3I4EA 1DIKA 4HPXA 1BEUA 4X2PA 1GKPA 2X0HA 5FJIA 5E6ZA 2UY2A 4DZHA 1RBAA 3MU7A 3QPEA 4IMEA 2F2HA 4YIWA 4O0ZA 1GTHA 3JXVA 3BAWA 3LPPA 3SRHA 3W7LA 2ON3A 4Q8OA 4BFAA 3GTNA 1LBLA 4PYSA 5C71A 4QQUA 5HR6A 1EB3A 2V3FA 1J11A 4B5TA 3CIXA 4X3ZA 1R86A 3LBOA 1AJ2A 4IX0A 1O7AA 3NA8A 4IG2A 5AB3A 1V6VA 2OJPA 2V6AA 2CWNA 4G6CA 4JQ1A 4S3DA 1F8AB 4C5ZA 1NMWA 3FAXA 1A4MA 1V7AA 2X42A 5C70A 2I17A 1NEYA 4AQLA 2VUYA 1TR1A 2VELA 5IHSA 5JBFA 4DRKA 5JVLA 1C8YA 1F7BA 5F4WA 5D38A 1OADA 4TV5A 1LG1A 3TCSA 4NG3A 2GUYA 5I3DA 3RF9A 3HG5A 3N6JA 3NFUA 1F6PA 1S5TA 1CIUA 1JCMP 3S6TA 3QGVA 4O0QA 4LGXA 4IP4A 1K4HA 1RLCL 4LQ1A 3QM3A 9XIMA 4PCTA 4W8BA 1E9ZB 4E8CA 5M2FX 2EEXA 3GG7A 4FPSA 4MWAB 2GK1B 5T9CE 3BAYA 3W1AA 2DIKA 4F8XA 4KQZA 1B5TA 1JI2A 3M0HA 4FHAA 1XDMA 3K13A 3AIRA 1QW8A 3PPGA 5C9XA 2ISSA 3QF0A 3GIQA 2E1WA 4BI5A 5AHLA 4C6NA 1QT1A 3EEZA 4EF9A 1VR6A 3RN6A 2TMDA 5AN7A 1V02A 1F61A 4FX6M 2A2IA 3ZLFA 3ITGA 2ZXDA 1LOSA 4NNBA 4O1FA 3XINA 2KX9A 2XH2A 1CGUA 4EPKA 1SYTA 1JZ7A 4XZ9A 5D04C 1EC9A 1S5WA 4IZGA 1A4LA 1XPYA 4HA3A 3NQAA 3MANA 4H9XA 5T26A 2Z1VA 4XD3A 3HM7A 3N6HA 4S3JA 1OG0A 3UXIA 2DZUA 4UTTC 4CGTA 2NSOA 4V1YA 4AEOA 3I3BA 4E3VA 3T0TA 1NIUA 1FKJA 3S4TA 3IEBA 3ZT7A 5EGRA 1R2TA 1GW9A 5EY5A 1FWTA 1R3VA 3GKAA 1OX6A 3SY1A 1E73M 2QDGA 1XIGA 3E6EA 1OFAA 1VC4A 3GC4A 1E9IA 4IH3A 4GNVA 1G4PA 2ZICA 1J9YA 3BURA 3WDPP 4NILA 3JVAA 1P5QA 1XIMA 2Z28A 5IFPA 3ONCA 2UZ9A 3HIJA 4U31A 4H9YA 3H53A 5AYIA 1GZGA 2E6AA 3TMQA 3CZGA 3NZPA 4C7GA 3FDKA 4FF5A 1OD0A 1H3GA 1OGBA 3K4AA 2POTA 5HQMA 2ACQA 1EZ2A 3P61A 3TYZA 3ID7A 5HMFA 2ZX9A 2Y5SA 1IEQA 2FGBA 5I3FA 1ONXA 5EYWA 1VFTA 3TWAA 3DHFA 3HZ3A 3BZJA 4JD4A 2F6UA 4J5NA 1QUMA 1UH2A 3ZFHA 3SR7A 3QMTA 3UR5A 2ZR6A 3NUKA 5KEZA 1D9EA 1AL7A 1AW5A 4H9ZA 4DN1A 4JHZA 1CDGA 3NNTA 3FHQA 4C1NB 4FX8A 1M7OA 1EGZA 1XH0A 1DJYA 5BOFA 4NRSA 1FWSA 2D3LA 3AYRA 1OX5A 3OIHA 4JY8A 1S1RA 4WHBA 1XLFA 1YDYA 3OU8A 3B03A 1U22A 3EA2A 5LA0A 2C3ZA 2B0MA 3FDGA 4GY7A 3RMEA 3N04A 2Y89A 1J6PA 5ABFA 3AIUA 4V27A 3IJDA 4RJEA 2R94A 1TA3B 1GJPA 1EYMA 2ZZ4A 1OCQA 1DOSA 1LZOA 1HQTA 3T09A 1FKIA 5AZ1A 3UR8A 5D9OA 1RQHA 2DW7A 3TFCA 3TEVA 3UGVA 4I5UA 3MUZ1 1UUMA 4FLQA 3WBXA 4AX7A 4D8ZA 1TPH1 4IMAA 1UR0A 4ALDA 1KQZA 2EF9A 4HZ7A 2VVNA 3D3AA 4MGGA 1AQHA 1GZ1A 1F05A 2DT1A 2I57A 3A5FA 3L5AA 3O5OA 3MDUA 4AW7A 1W1A1 1JZ4A 1X1OA 3GLCA 3RPTA 4DB7A 1GVOA 3NVDA 3ARTA 1RK6A 2J4GA 3AXIA 3HGJA 4QG6A 1C7TA 4QS6A 1Q66A 1RJQA 2XP9A 4FX7A 3ZR5A 4LWWA 2G5WA 1NM9A 3PPHA 1OG6A 2RUSA 3FVMA 1POJA 3OZMA 1RA0A 2BY3A 3XISA 4Q6JA 3QC3A 2EPKX 1JVNA 1PBKA 3BW2A 3O0FA 4JYSA 3WLHA 4N9EA 1U5HA 4ZQNA 1HW6A 1M6JA 1PEZA 3TQPA 2PSNA 3OVGA 4S3EA 4PMYA 1GONA 4LCQA 1BG4A 3PRDA 3K4DA 3WDIA 2CKSA 3QY8A 1UA7A 1OZMA 2Y7EA 2QCMA 3D5HA 5LYRA 3QV7A 3LYEA 4AZ7A 1IQ8A 3QMRA 3W73A 1N8IA 3DI0A 4A2RA 3FNDA 3TK7A 4S38A 5I3GA 1RJRA 3N2CA 2E09A 4GQQA 2A4AA 8A3HA 1FKGA 4HBEA 1VLIA 3MV11 4K39A 2NVAA 1PE1A 1XKYA 1PVNA 4GVIA 4CN6A 2HMCA 4WX2A 4GIAA 1TWIA 2WLZA 1XXXA 3KHJA 1ZBCA 1KBLA 4JIEA 3TE9A 1UP0A 5I3KA 4PZVA 3W25A 2OTDA 4W4QA 3GFYA 3I3EA 4H6QA 5REQB 4C02B 3R0DA 3W2NA 4EWND 4TW8A 5KSWA 2ZXBA 4MOZA 4W9PA 1EJRC 1MI3A 4L6DA 1W1TA 3T9PA 2AGTA 5ABEA 1EC7A 3WLNA 1OFOA 3HO8A 5A2BA 4B91A 3E2RA 1UUQA 3M44A 1PO9A 3DX5A 2JIWA 3MV01 3BSGA 1W8SA 4IPIA 4AVNA 2PV3A 4X2RA 3QYSA 2NQHA 2CBVA 2PWVA 1Q1CA 3UQAA 4ATDA 3EMCA 4RK8A 3QZAA 5CZ0A 2QZRA 1S46A 3POCA 4DRQA 1H1ZA 1BRLB 4UNLA 5K7JA 1C9HA 3UG4A 2V68A 5K2ZA 5EKYA 2NUYA 1Q65A 2J8FA 2X0SA 4I9JA 2DV0A 5FF0A 2PD9A 4M19A 3EY6A 2ZRUA 3BSHA 4LTSA 4S2BA 1TA3A 3OBAA 4KESA 1OJXA 2PWUA 1TPC1 3RHGA 1DEDA 3PG9A 1QPFA 1JZ5A 2PD5A 3CHVA 2PRLA 4D6FA 1H7PA 1QBAA 4Z0SA 3ZMRA 1V0MA 3M5XA 5AFDA 4UOJA 2YBUA 3LM7A 1F4HA 1BFNA 4XVDA 4TX6A 3QY7A 2DUAA 3DKJA 2TSYA 1CW2A 2WVVB 1TR9A 2XH7A 3B3DA 4QXIA 4O50A 3ZSSA 4INFA 3U7VA 4AZCA 3ZO9A 5JH8A 4JHOA 3QTGA 1AG1O 4JS3A 2AAMA 4B3ZA 1S5VA 4NZ5A 4MUPA 3GD6A 4L7ZA 1L6WA 2GPTA 3CAVA 4BF9A 4F0MA 2B7OA 2CC0A 1J12A 3P5ZA 3W2UA 1XGZA 4UTUA 1HN1A 4JEJA 3W2KA 3WX7A 2G3MA 3DHDA 3D47A 4BZYA 4FSAA 4B92A 3Q65A 1CYGA 2AQWA 3GG8A 2YDAA 3FY1A 2QV5A 1QOPA 3LOTA 3WFZA 2ZZ6A 2O4QA 5FIPA 1ECQA 2PLJA 2WKLA 2BOGX 2C1IA 4PRRA 1RR2A 4Z2GA 5KETA 4NIRA 1KFLA 4QX4A 4M5PA 3GNOA 1OINA 4QSFA 3CO8A 3G1YA 3H12A 1NOFA 4L5ZA 3TYEA 4IJBA 3V5OA 1N8FA 3GS6A 5H8PA 4JNMA 4F48A 3O5DA 2AAAA 3H2EA 4E5TA 3EMZA 4HSHA 5C2GA 4ZOCA 1JRBA 1FWIC 2OT0A 4LX4A 1N2VA 1VQTA 5DY3A 4DBUA 5DBTA 4J9JA 4ZQRA 4OJYA 1KV8A 5A94A 3M9YA 3P93A 4I9TA 4ACZB 4LYRA 5F7UA 3S42A 3C8FA 2NLYA 4DBSA 1XINA 1YRRA 3M7WA 4NJKA 4FO4A 4FXJA 4GI4A 1H0IA 3M0YA 3RXZA 3QOKA 3WJSA 1WPCA 1JG9A 1AH4A 1JZ3A 3QGKC 4QJ1A 2DSVA 1H2JA 2ZQ0A 5FOOA 1SFJA 1OFBA 2WM0A 1HX0A 1UD6A 1BSLA 2Y7FA 1SJDA 3O9NA 4QM1A 2YBVA 3VC6A 2Z2BA 1HXVA 1PIGA 3LHVA 5ABFB 4B5WA 2IPGA 3BSMA 3PHAA 3VNZA 3KVMA 2G96A 3VGBA 4EXQA 1LLZA 5CBJA 5F1VA 5G1TA 4HA4A 2INFA 2WMHA 3TN4A 1HO4A 4DLFA 1Q2SA 4QJ5B 1DJW