2DPEA

Crystal structure of a secretory 40kda glycoprotein from sheep at 2.0a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a secretory signalling glycoprotein from sheep at 2.0A resolution
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dpeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dpeA01
4H2CA 3SIMA 5A2AA 1GHRA 1MXDA 1VFFA 2BHUA 2WCSA 5JIPA 1UD2A 3PZUA 3K8LA 1VEPA 1FHDA 1HKKA 1XH2A 2WMIB 3ZR6A 3L2MA 1J01A 3SCRA 3GDBA 2XFFA 1KBBA 4RE3A 4JKKA 1E70M 4M80A 2J78A 4DWSB 2V3FA 1J11A 1OIFA 3K8MA 5CSUA 3GXIA 4H8UA 1MW3A 4AIOA 4N0RA 1BLIA 4JCLA 3VD5A 4BA0A 3BAYA 3HJEA 2WMHA 1VIWA 3DC0A 2ZUUA 1GPFA 3RM9A 4TUFA 3LPPA 1EDQA 3CHFA 3MMWA 1KR0A 3VGEA 3AHTA 1C90A 4CD6A 3AS1A 2YL6A 4UQEA 5CPTA 3BLKA 3ARQA 1BVNP 1WAWA 1JDDA 4P7RA 4A3HA 1UWRA 4W7WA 1CBGA 1E40A 5JBEA 3AMLA 1E55A 4F79A 4JFUA 5E0FA 1TMQA 3UR7A 2YDSA 1OBAA 1EXPA 3WL0A 1BYAA 2J79A 2PWDA 4EAMA 1DTUA 1C8YA 2ZUWA 3QHNA 4DUWA 5CXPA 2ZUVA 3VD9A 1DP0A 2D24A 1UWUA 1E6XM 1ZL1A 1SR0A 3N17A 7CGTA 1EHNA 1E15A 3MUIA 3CHEA 5E6YA 5CSYA 5I2UA 1E4IA 3MUZ1 4KRUA 1GOQA 3UERA 4R5EA 1F4HA 3WF2A 5DT5A 5I3DA 3AXIA 4J7RA 3GM8A 1X1NA 2E9MA 2YBTA 5A8OA 1W1PA 1BYBA 2BVYA 1U2YA 2WK2A 2FGZA 4HZ8A 3NSXA 4AD4A 5CQ1A 2VX6A 3UG3A 4E8CA 4GZEA 4PTXA 1JZ5A 1KWKA 4IM4A 3CUHA 1MXGA 1V6WA 3W6LA 4B3LA 1EO5A 1UH4A 3EDDA 3PHAA 1H41A 3B9AA 2IUZA 3GTNA 1TR1A 2Y24A 3JUGA 2YDQA 4FLRA 4L4PA 1UKSA 2ZXAA 2XVNA 2ZUTA 2OWXA 1WCGA 1XH1A 1XYZA 2E8ZA 5HBFA 4PUDA 1E5JA 2NT0A 3AIEA 3OGSA 1JXJA 1PX3A 1QNSA 3AHXA 2OYKA 4UNIA 2DGAA 1HKIA 4M29A 2VQUA 3WQWA 4MAZA 3WMBA 3WEZA 2V3GA 3WEMA 1W2VA 3UETA 4PBGA 1V6YA 2RGMA 2CBJA 3AIWA 4WSKA 4WSJA 1J10A 3ARWA 2VRJA 3KZSA 1B9ZA 1FH8A 3OGVA 4AZHA 2VT0A 4X0VA 2WVVB 1HVQA 4FK9A 4TVDA 4J3XA 5D9MA 2WVTA 3MKKA 1UD3A 4TX6A 2QV4A 4CVUA 3WY1A 3GH4A 1GQLA 4J3VA 1Q6CA 3MU7A 3PZVA 1JXKA 3ALFA 3NDYA 1UZ4A 2VO5A 3BAWA 2BY1A 1OIMA 3W6MA 2WLZA 5HNNA 3FNDA 2WVSA 3F5JA 5BCAA 4P8XA 2W92A 2BXZA 2J7EA 2ESCA 3NIYA 3CIVA 3KL0A 2IXVA 1HKMA 4M56A 1CXKA 5CGMA 1OGSA 3ZT6A 4EK7A 3ZM8A 1H1NA 3OLDA 2F2HA 1OWQA 3WDQA 1W1TA 5JIWA 2J8GA 5AYIA 1E0WA 2DPEA 1GNXA 3VNYA 2EXOA 2QPUA 1E4MM 4E4PA 4AZGA 3CUJA 5A6MA 2ZXDA 1AQHA 3POCA 2V3DA 2YLLA 4D6GA 2CHNA 6A3HA 3BLPX 2D0HA 2GJRA 1GZJA 5BRPA 1V3HA 1HX0A 3VD4A 5CG0A 3N9KA 1GOOA 2VX4A 1PZ3A 1BG4A 3VU2A 1EQPA 4AD5A 1Q6EA 3WDIA 1O7AA 3NJ3A 1E9LA 1CGUA 2J7FA 3VM5A 4BQ3A 4AEEA 2VX7A 2D3LA 3VOCA 3OIHA 3AQUA 1VRXA 4C7DA 1TZ7A 2J7HA 4AWEA 1BGAA 2GDUA 3FN9A 1CIUA 2A3HA 3WDHA 3AMGA 1M7XA 4AY1A 5A8NA 2VQTA 1AQ0A 2J7DA 3PZQA 1K9DA 2FHFA 1A3HA 2BVTA 4PMZA 3VD3A 1NWTA 3WNPA 1GQJA 3VPLA 3RPMA 4UCFA 4P7LA 3B8SA 1W3HA 3WD0A 3DECA 3CBWA 5IHSA 3SCSA 2J7BA 1L8NA 2OWWA 2ZX6A 5BRQA 1NOWA 3KE0A 2YDRA 1WP6A 1JZ2A 3MSDA 5A6JA 3GNOA 2ZXBA 5ABFB 5FD0A 3ECQA 3TTOA 2XYLA 4FLSA 3VDHA 3DYPA 2OSYA 3B9EA 1CLXA 4URIA 4UQDA 3MSGA 1QPKA 2PBGA 3D5HA 4DM1A 1V6VA 1HT6A 3BMVA 2XJ7A 1MQPA 3VIIA 1E5NA 2GJXB 3WD1A 2XVGA 4MDOA 2VCBA 3CO4A 4A3YA 2VRKA 4ATDA 2WVVA 1OT2A 2WNWA 4JIEA 1NQ6A 1HP4A 4QFUA 4UR9A 1A47A 4D1IA 1R7AA 5LA2A 3BH4A 1ODUA 3W82A 2VZVA 4BQ2A 2ZUSA 2DDXA 3FAWA 1GOWA 5CZKA 1ZB5A 1JZ6A 5EFDA 2PI6A 1QI2A 2Y8VA 3VMOA 1BAGA 2UWFA 1CYGA 2ZUNA 2EPLX 3PZ9A 2F8QA 2ZIDA 3CZEA 3WUFA 4WKFA 3WIJA 2WKGA 3QGVA 2G3NA 3QOMA 2FGLA 2VCAA 2UY2A 4IISA 1NWUA 5CLTA 1MQRA 2BXYA 4XZWA 3TP4A 2WWCA 3L4ZA 1SYTA 1OD0A 3RDKA 4MDPA 1OCQA 1UQZA 1RD6A 3POHA 5M17A 1VAHA 1BYCA 5E6ZA 4WIWA 2YLAA 3RO8A 1FFRA 3W81A 3ZJKA 3O9NA 1XSKA 4U31A 3FW6A 5GNZA 1HF6A 1OB0A 2OWCA 1CDGA 1UD5A 2ZWZA 5E0CA 2WZEA 1GHSA 3SUUA 5DMYA 4GO8A 4F8XA 3WNMA 4IPNB 1JG9A 1UYQA 2D0FA 5GPRA 1W9PA 1GJUA 4BF7A 1RP8A 3ZT5A 2J25A 3W24A 1TFVA 2WMGA 3THCA 1TVNA 4AMCA 2D3NA 2PB1A 1KXQA 4JHOA 4RE4A 4UTFA 1B31A 3CHDA 1PPIA 3BAXA 1JD7A 4W8AA 1QI0A 3CMGA 4Z2KA 3RILA 4B16A 1CWYA 1V3JA 4RL3A 2ZWYA 4B9ZA 3WQ4A 4JCMA 1QI3A 5E09A 3WFZA 2WC7A 2CEQA 1B30A 4S3JA 1HN1A 2DH2A 5BXPA 3GYCA 5C8BB 1BPLB 1P6WA 3J7HA 5D8ZA 2BHZA 4ZEPA 1C7SA 5BROA 1CNVA 1UA7A 1W3LA 1GOIA 3L2LA 1KXTA 4W7VA 4J3UA 4CN1A 3T0DA 5C70A 3PN8A 4AIEA 2J4GA 3WF4A 4UFKA 2WBKA 3WNKA 2CHOA 1B3YA 5CPQA 3WD3A 4W5ZA 4N42A 4PMYA 2YA2A 1QNOA 2PWFA 2A3CA 3AS3A 3IJ7A 3ZSTA 1J9YA 3NYDA 3W53A 5F7UA 4BQ4A 5CGTA 2YL9A 1G94A 1QBBA 3TOPA 3WUBA 1MW1A 3ARXA 3PTQA 1W9VA 3I3EA 4AD0A 5A6BA 1RH9A 5IHRA 2XSBA 8CGTA 1O6IA 4CN4A 1F4AA 2X09A 1ITCA 1LL7A 4XUYA 1BTCA 1V3KA 3ZOAA 1FH7A 1BSIA 2IXUA 3W4RA 3AHYA 4OBRA 3N11A 4BS0A 3AZSA 3BAKA 1V0LA 4AIUA 1XCXA 3CMJA 4L4OA 2EO7A 1XV8A 1J0JA 2D2OA 2E8YA 3VIPA 1EOMA 2XSAA 1X6LA 3CH9A 2VRQA 1NP0A 4MPKA 5A6AA 1XSIA 2XVKA 3D3AA 2W5FA 3BSHA 1GCYA 1QHOA 4UZUA 1FP8A 1HJSA 2C0HA 1W1VA 1JGIA 2O9PA 2GDVA 3TTQA 1E3XA 3IAQA 3I3DA 2FH8A 4HOWA 2D23A 2CNCA 2WVUA 4UFIA 1E71M 2E40A 1UOKA 1GJWA 5KZ6A 1MWOA 3N15A 1NWSA 3QOKA 2ZICA 5A6SA 1HIZA 2X0HA 3PTKA 3WBAA 5AC5A 4ZXLA 5BYWA 2O92A 1WKYA 3AXHA 3SCQA 3CUGA 1EQCA 1PBGA 4RE2A 1GOMA 1JNEA 3AIVA 3RM4A 1PIGA 3SCUA 3QHOA 1KR1A 2V5CA 4TOQA 1CXLA 1H2JA 1WZMA 3ARVA 3WELA 2EQDA 2XUCA 1NP2A 4MADA 1U30A 4UFJA 1G5AA 1C91A 4DM2A 3GBEA 1R87A 3ZIZA 4CVWA 4AC1X 5LA0A 2GSJA 2WSPA 4V2XA 4J3SA 1K6AA 4QLKA 5GNYA 1BYDA 4CU7A 5ABGA 4MJ4A 1ZBKA 1NWRA 3SUTA 5LA1A 5DF0A 8A3HA 1H3GA 4PSRA 4D71A 3SUVA 3OZPA 1JDAA 4DWSD 3GH5A 3OLGA 4M1RA 1PAMA 3E1F1 4WF7A 5M03A 1WDPA 5FIPA 2WWDA 1BQCA 5CLWA 1W9DM 1Q6GA 4ACZB 3ZJ8A 3GXMA 1D3CA 3LPFA 1EGZA 1XYFA 1E3ZA 1W1YA 1PX8A 4PYSA 5EMYA 5BXSA 3MS8A 1N82A 4AZ5A 2XWEA 5E9AA 3VTRA 3OG2A 4FLQA 2BFGA 2OSXA 4CD7A 3AIUA 1QI5A 4GZIA 3L4VA 4BQ5A 1KCLA 3WDJA 1OM0A 2JEPA 2WBGA 2DSVA 2FDMA 3AYSA 4JL1A 4D6EA 2ZX5A 3OLEA 3T2QA 3FHAA 1QI4A 3BXWA 4PCSA 4KGJA 4U3CA 5D8WA 1XRVA 4W93A 1JAEA 3WNNA 5IFTA 1MFVA 2DQXA 2NT1A 1JFHA 4HMDA 3MANA 1XHGA 4Q7NA 1Q6FA 4D6FA 3MV11 3AIBA 4ATLA 1JI2A 1E1EA 2QHAA 1VB9A 2DEPA 3ZT7A 4JZ5A 4W8LA 3VUPA 1UKOA 4PMVA 5I79A 3VGBA 3EMZA 2EEXA 2OYMA 3AJ7A 4M24A 4JAWA 1LG1A 1B90A 1HL9A 1XC6A 2VZUA 4HA3A 3WBEA 4NI3A 5A8PA 1US2A 4OOUA 1JF6A 1FHLA 4UOJA 1EDTA 2BHYA 5A1AA 1G0CA 2J7GA 4LYQA 2VC9A 1SMAA 4XZBA 5JUVA 1W32A 4BZYA 4TTGA 1LG2A 2WZHA 2Y4SA 3WFLA 4QDMA 1E6ZA 2JE8A 3RIKA 4ATWA 1JZ8A 3WH6A 3PBGA 4PMXA 4LQ1A 5IDIA 5A69A 5BWFA 3LMYA 2DT3A 3AIQA 2EPMX 3WNOA 4F66A 3VIHA 9CGTA 2RGLA 2XPKA 4Z2GA 2VTFA 5HPOA 3L4YA 4P7OA 3NCOA 3SCPA 1MW0A 2GUYA 4W87A 3OB8A 1IZJA 2O9OA 1V0MA 5GNXA 1XD1A 1C8QA 3ZR5A 2CBVA 3AXXA 1VJZA 1J0HA 3SCOA 4EANA 2F61A 2VCCA 1OT1A 3EDJA 4P7NA 4MNLA 4S3KA 4M8UA 2PWGA 1LWJA 1D7FA 4R27A 1CZ1A 2O9RA 4MB1A 2EJ1A 4GQQA 1X6NA 3OBAA 1WPCA 1WDSA 4PMOA 1WNOA 2DSKA 3N13A 1DWIM 1ZJAA 3UG4A 5D9OA 2YL5A 4E8DA 3VNZA 3N18A 2Q8XA 3WF3A 3K46A 2JF7A 5FL0A 1KXVA 2XVPA 1TG7A 4M82A 3WDRA 4W85A 2E0PA 3DYOA 4XB3A 5ECUA 3NSNA 1HNYA 4W84A 4MTVA 3M07A 1QBAA 1MVYA 5A8MA 2XG9A 2D22A 1ZJBA 4HMEA 1KGWA 2WANA 4UQAA 4CUCA 4U3AA 2WZIA 4NZCA 2V3EA 3SCNA 4AYSA 1VFOA 1C8XA 1LWHA 2C7FA 1V0NA 5DFAA 1DWJM 4FF5A 2ZXQA 1GOKA 3FHQA 3ALGA 3BAIA 3VVGA 2YIHA 1B3WA 3L4WA 5AY7A 2CETA 6CGTA 1V08A 1R86A 4PMUA 3GBDA 3VINA 4OKDA 1B2YA 4OUEA 1UWTA 1HVXA 4DUXA 5JBFA 5ABFA 2VMFA 3WH7A 4MAVA 1FH9A 1W2PA 1CXHA 1S46A 1OGBA 1QNRA 3TTSA 2J7CA 3AHVA 2VZTA 3AMCA 2V38A 3A47A 3HN3A 1JI1A 2AOSA 3FY1A 4TVUA 4UZSA 4AZ7A 1WZKA 1YQ2A 1XCWA 1BF2A 2J74A 3CZKA 3MUY1 3W26A 1DEDA 4ZE4A 2CERA 1AMYA 2DSZA 3G6MA 1QHZA 3DHUA 1E0VA 4JL2A 4TXEA 4C7FA 1NOUA 1BG9A 1AQMA 2MANA 4MB4A 1FP9A 4HZ7A 4D72A 2W4XA 1GUVA 4JFSA 3MO4A 2WXDM 3PZGA 3RCNA 4GPNA 3AS2A 1IV8A 3AICA 1Q6DA 4PMDA 4C7GA 1EA9C 3QHMA 3AMKA 4XV0A 1CXFA 3U7VA 2VZOA 2GK1A 1WO2A 2G41A 1UUQA 3T2OA 2D20A 5ABHA 2WLYA 1MQQA 2JIWA 4CCDA 1UR4A 4BCEA 3PZOA 4W86A 2QMJA 1DWHM 2A3EA 1V6UA 4AXNA 3APGA 1HXJA 2ZE0A 1DWFM 4JFTA 2WW5A 3VGFA 1Q4NX 1G1YA 3ARSA 2OYLA 4HPHA 4MJ2A 4HTYA 1UHVA 5I6SA 3N1AA 3UR8A 4TVCA 5A2BA 1HKJA 2X1IA 5I0DA 1JL8A 1FFQA 3OA5A 1E73M 2BS9A 4UFHA 3PZMA 1HP5A 3GXFA 2YA1A 5ABEA 4PRWA 2ZX9A 3VIGA 3HMCA 3VMPA 4U5KA 4W7UA 3GNPA 4JKLA 4U33A 2PWHA 1LL6A 3GZAA 4HU0A 1DWAM 1V02E 2X0YA 2VL4A 2WHKA 3T2PA 4E2OA 2XWDA 2G8ZA 1KQYA 3UG5A 5IXEA 3EDKA 3GNRA 4CD8A 2CKSA 4D6DA 3VIMA 2WC3A 1JF5A 1VFUA 1GW1A 3ARUA 4PEEA 1B0IA 3KWXA 4AZ6A 4JFVA 4NRSA 2WPGA 4OIFA 3VKKA 3T0AA 3QR3A 2D0GA 3SCWA 5FKYA 4B9YA 5IFPA 1WDRA 1UWIA 2JALA 1PEZA 4HZ6A 2CXGA 1VBRA 3T08A 2QF8A 1CGXA 1M04A 1WE5A 1GQIA 3BMWA 5M5DA 2VUYA 1JYWA 3W25A 4CN6A 3ARRA 2YA0A 2W62A 4GXPA 4ZXOA 1K9TA 4LYRA 1CEOA 3NDZA 3SURA 1PIFA 4B3KA 1E4NA 3K1DA 3IANA 1VJSA 4HMCA 3MMDA 2ZOXA 4ACYA 5A6LA 3WQ6A 3SEPA 3WL1A 1Y7VA 2WMFA 3UESA 1KFWA 4KMQA 1C7TA 2GK1B 1PJ9A 5M3WA 1IT0A 2VOTA 1ZBVA 3DYMA 1KGXA 3MUAA 1E56A 2X05A 5A6BD 1G9HA 1SMDA 3S6TA 2UY4A 3L4UA 1GONA 2Z1KA 4DUVA 3EYPA 1KXHA 2PF0A 4HA4A 3VILA 4UQCA 4AEFA 4CU8A 1E6SM 3II1A 4H8VA 5A3HA 2Z1SA 3EMCA 1E6NA 3CZJA 5FCZA 1FA2A 2CBIA 1E6PA 1K9EA 4WKHA 2XIIA 3CUIA 1E1FA 3CHCA 2ZX7A 2W67A 3WMCA 3ZJ6A 4CGTA 2DH3A 3IAPA 2VNCA 2YL8A 3EMQA 1OD8A 1UH2A 3K4DA 4P8UA 2FHCA 2XHYA 2WKLA 1KBKA 3F5KA 3PZTA 4M81A 4OJYA 4AZCA 1J0YA 4K68A 3KEHA 4PCTA 3A4WA 1CENA 3WF1A 1H4PA 2G3IA 3W0KA 3T09A 1TCMA 1J18A 2CIPA 4NRRA 2A3BA 2QLYA 3VDCA 4UOQA 4Q22A 1EH9A 2JIEA 1RPKA 3FAXA 4UOZA 4DWSC 1E6QM 4ZENA 2J8FA 2JEQA 1CXEA 2ZX8A 2GJPA 1KWGA 1TVPA 2W61A 4Z2JA 1XH0A 2J77A 1J0KA 1LF1A 4Z2LA 4AD1A 1H49A 2BVDA 1UKPA 3IJ9A 1M03A 4U2ZA 4ACZA 1OSEA 3ARTA 3DHPA 3L4TA 2O9TA 4JFWA 2BY3A 1ZBWA 1J12A 3WH5A 1JAKA 2YJQA 3VX0A 4PTWA 3ZMRA 1DWGM 1JNDA 2WB5A 1C93A 4LGXA 3ARYA 2G4FA 5BXRA 1W9XA 2VI0A 3IK2A 2XGBA 4UQBA 4W8BA 1ZS2A 3WQ8A 3WKZA 2W66A 3VGHA 3W37A 3THDA 3TTYA 4GI9A 1UR8A 1B3XA 4PUEA 2PBOA 3VIJA 3VGGA 1PZ2A 1QW9A 3BC9A 4V28A 4QCEA 1VBUA 3LPGA 2XFRA 4TX8A 4U5IA 2DT1A 3M46A 2A3AA 1CGWA 4D6IA 2WMJA 4AISA 4GI8A 2VR5A 1W3KA 2HISA 2E9LA 4MNJA 4P8VA 3CZLA 4F9JA 2CBUA 1EOKA 5C71A 5D4YA 5I24A 4QCFA 3RJYA 4X0NA 5CJ5A 5FOOA 4GI6A 1UKQA 4H7VA 3NSMA 5BXTA 3TA9A 3B9DA 2QMKA 4QLLA 4OOZA 3ZJ7A 1WB0A 1CXIA 3UEQA 1QW8A 3AI0A 3VIKA 1B1YA 3BGAA 1XSJA 1B3ZA 2W91A 5I23A 4ZE5A 2NSXA 1BVZA 3RMEA 3N04A 4ML4A 5TD4A 1H5VA 5HOSA 1EDGA 1JDCA 5DT7A 1JYNA 3AIRA 3WN6A 1M53A 1QVBA 2CITA 1V3LA 3PTMA 2C8NA 3VDBA 3OLIA 3VDAA 3WENA 4Y7EA 5AYBA 4PN2A 4UFLA 3AS0A 4GINA 1CGTA 4PMNA 3ARPA 1UKTA 1ISYA 4PSPA 3ZSSA 4WK9A 1CLVA 2XGIA 2VZSA 2DSWA 5HXMA 1I1WA 3U7BA 4J27A 4A4AA 3WNLA 1HJVA 4WJXA 1ISWA 3ZQ9A 2UY3A 2HVMA 1UWSA 3OZOA 5A95A 1HJUA 5I77A 2BY2A 5FL1A 1KCKA 4D6HA 1ITXA 1UR1A 4MNKA 1OINA 4OZOA 1ISXA 1ESWA 2FHBA 1LLOA 2XVLA 3GH7A 4TTUA 3WD2A 1GVIA 3BCFA 1VF8A 4GKLA 1TUXA 3KL5A 1FOBA 3EBVA 5LYRA 2BNJA 2CCRA 4DWSA 4KGLA 1KB3A 4JHZA 1CECA 1R8LA 1E43A 3WUGA 3EDEA 1H0IA 2G3MA 4D1JA 1PX4A 2D1ZA 4CD5A 3ZO9A 2CESA 2YOCA 2DIJA 1H09A 2AAAA 1YHTA 4W5UA 1EIBA 1JYVA 4LPCA 1V02A 4GZJA 5HPCA 5D9NA 1VEOA 1H0GA 4W89A 1KQZA 2BV9A 1E0XA 4AD3A 1QNQA 4UQ9A 3W27A 1W9UA 2UY5A 4AZCB 1UZ1A 4LYPA 3FXYA 4FLOA 4LX4A 1LQ0A 3K4AA 4H04A 3PZNA 4U2YA 1K9FA 4MB5A 4YHGA 1TE1A 1CGYA 3UCQA 1R85A 2WMIA 4MB3A 1ISVA 4HOZA 2B31A 1JZ7A 2WCAA 3WSUA 2DT0A 4CD4A 1BGGA 2J75A 4CKQA 4J3TA 1DHKA 2FH6A 3WMSA 4H41A 3VIFA 3WD4A 1C92A 1UH3A 1GORA 4H8HA 2VR4A 1B3VA 1UQYA 2WC4A 2VJXA 4NSBA 3O2LA 3VIOA 3CLWA 2WM0A 3A3HA 5A2CA 3L4XA 2JF6A 1QNPA 3W28A 3AMDA 1HJQA 1CGVA 5I5RA 4YN5A 1L0PA 3TONA 1UR0A 1KGUA 3SCVA 4AW7A 2OLHA 3CPUA 1JFXA 4J28A 3A4XA 4KWUA 3W29A 2VVNA 1H11A 2XFYA 5A94A 4CCEA 1UA3A 3F4VA 4IPLA 4D6CA 1JD9A 2TAAA 4PMQA 1JZ3A 1E4LA 3WH8A 4D6JA 4P7QA 3AYRA 3HU7A 4GQRA 1U33A 4XX6A 4PTMA 1MW2A 2Y2WA 3N12A 2DIEA 1AVAA 3WQVA 3BCDA 3MMUA 3WDPP 4HOXA 1E72M 3U5UA 1BHGA 4PMRA 4P8WA 5I78A 1LJYA 1UWQA 5DEZA 2VURA 2GFTA 4UFMA 3A4AA 3VM7A 4JKMA 1V0KA 5E70A 1W9BM 2ZUMA 2WMKA 4AZIA 1ECEA 3SUWA 4YHEA 4KH2A 3KL3A 4PTVA 1E6RA 1V03A 3LPOA 7A3HA 3WQ5A 2E4TA 3WEOA 4HU8A 1NM9A 5GQBA 3CZGA 1ZBCA 1SFSA 3M6DA 5JBDA 2NW0A 4J3WA 1HJXA 2WHJA 4HP5A 1VFMA 7TAAA 1V3MA 1EO7A 4OBSA 1I1XA 4Z2HA 5EB8A 2PWEA 3SCTA 2J62A 1V3IA 1QHPA 5CPSA 2PC8A 2E9BA 1EHAA 1UG6A 3PZIA 3G6LA 3OGRA 4NF7A 2X2YA 1JIBA 2EPKX 1IZKA 2J47A 5A8QA 1GVYA 1CPUA 2AMGA 5EFFA 2W63A 2QPSA 5HDRA 2XM1A 4HPGA 5D9PA 4V27A 1VENA 2V5DA 1G01A 3CGTA 3ARZA 2GJXA 3SUSA 1R7OA 3VMNA 1UR2A 2CPUA 4YPJA 2DT2A 3K8KA 3AISA 4QLJA 2G3JA 3WH9A 1W3JA 3CZ8A 1V6XA 1NOFA 2XTKA 3WUEA 4QAWA 2WSKA 3RJXA 3I3BA 6TAAA 3BSGA 5A6KA 2JFEX 1XGZA 3RM8A 4AD2A 3T0BA 2WCGA 2WHMA 2Y8KA 4MNMA 2EPOA 3W38A 4WLCA 1WZLA 1TA3B 1UD4A 2WAGA 3U57A 1ISZA 1WZAA 1J0ZA 1LL4A 4Z2IA 1GQKA 3AZRA 4F9DA 2CYGA 1UD8A 1MYRA 3AFBA 2VVSA 1Z32X 4KRTA 1D2KA 1XD0A 4HA1A 1HL8A 3EDFA 1TA3A 3GXDA 3U5YA 3CTTA 4EKJA 3VD7A 3CUFA 1UD6A 1ZU8A 2EPNA 2GVYA 1JYXA 4AZBA 3NUKA 1OGGA 2EBNA 1W91A 3VO0A 4CCCA 1HJWA 1MFUA 3AZTA 5DO8A 1US3A 2YBUA 3M7SA 1VEMA 3A6OA 4LXFA 1BFNA 5KEZA 3VGDA 3O6AA 2WHLA 3AOFA 4QP0A 4IUGA 2CKRA 1RP9A 4X9YA 1JZ4A 4FMVA 2X8RA 1M01A 3S2CA 1CTNA 3AHZA 3IJ8A 2BY0A 4GO9A 3VX1A 2OSWA 1J0IA 2XIBA 2VX5A 5AC4A 3AROA 2XM2A 5EBAA 2Y5EA 2WYSA 4W88A 1UR9A 3WF0A 3MV01 1ODZA 2E3ZA 1I75A 1QOXA 4CU6A 1NARA 4ZFMA 3F5LA 4B15A 1C3FA 5JH8A 1NH6A 2DSUA 2YKKA 4EE9A 3BAJA 4GIAA 1WDQA 4WKAA
chains in the Genus database with same CATH superfamily
3W73A 4AIBA 5LXXA 2Y89A 1BQGA 5CBJA 1UD2A 4Z0JA 3EWUA 1XH2A 4L64A 3SCRA 2H6RA 2XFFA 4RE3A 3ONCA 3QVQA 6TIMA 3OJGA 1ZK6A 4JN8A 4DWSB 2R1LA 1OIFA 3BICA 3GXIA 1ME7A 4AIOA 3N9RA 4N0RA 1BLIA 4BA0A 3MCMA 4Q8OA 4U4MA 4YLWA 3C86A 2QIWA 1G4TA 2ZQSA 3RM9A 4TUFA 3LPPA 3BGJA 4IPPA 2GGEA 2ZE3A 1IIHA 4CQ9A 4GWEA 4CD6A 5E5CA 2YL6A 3F2BA 3PULA 4B5TA 2A79A 5CPTA 3KBMA 1BVNP 3ODKA 1TWSA 4DF0A 1MRAA 1ZJIA 5BXJA 3R0KA 2OLSA 1E40A 3HG3A 3AMLA 4K7YA 1E55A 1XQKA 1NQKA 1C29A 5E0FA 1AL8A 1Y5XA 3UR7A 3BW3A 1EXPA 3S2MA 4O4VA 1BYAA 4CNSA 1I2RA 5AC8A 4Z08A 1GZGA 3B9NA 3HGRA 2ZUVA 1XIFA 2D24A 4XZIA 1SR0A 7CGTA 4OWGA 3MUIA 2F2DA 2E6YA 1EJWC 4O17A 5T8GA 3MUZ1 2CLHA 4R5EA 1JVNA 3AXIA 3VZXA 2PTDA 4LVDA 3GM8A 3P67A 1M5WA 2W27A 2YBTA 2VDHA 1B57A 3PAJA 4HBEA 3FCPA 4H6KA 2DUAA 3GDLA 3UG3A 1UP2A 3W2KA 4L1WA 4PTXA 3CUHA 1U5JA 3CU2A 4B3LA 1EO5A 1UH4A 3EDDA 3WZ0E 2B4GA 3B9AA 2IUZA 4Q4KA 3V7PA 3WLMA 1ME8A 1TR1A 1W37A 4DRPA 3UPMA 1JPDX 1EPXA 2YDQA 1SJBA 4DJFD 1UKSA 4LVBA 4PUDA 2XPAA 2VEFA 4AG0A 3AHXA 3W1TA 3BZGA 3VNDA 1HKIA 4AHQA 4XO6A 2VQUA 4MZYA 3G3MA 1RSCA 3WMBA 4MF4A 3WEZA 2REQA 3FA4A 3WEMA 1W2VA 5CC5A 1RBAA 1V6YA 2RJHA 2CBJA 2Q02A 4US6A 4OTKA 5J5RA 4XO7A 3NQ2A 4Q3MA 3HO8A 4X60A 3UNTA 3R11A 2OZTA 3OGVA 4X0VA 3QMTA 2WVVB 2ZDSA 1HVQA 5DCEA 4KIEA 4AU0A 4J3XA 1ONXA 3MKKA 2TYSA 3BSMA 3O0FA 3N34A 2QV4A 3CS2A 4EAYA 1W56A 1UR3M 2CLOA 3MU7A 3ES7A 1XIHA 2F38A 2Q09A 2REQB 3PRDA 2WLZA 1ADOA 3NR0A 2EKCA 4IMAA 2ZZ4A 3SGZA 3GG8A 2CFFA 2J7EA 4E8GA 1U1UA 1ROUA 2RAGA 3KAHA 1OGSA 4MKNA 4WCJA 5DY2A 1W1TA 2OEJA 2YFNA 1ZCOA 4L9YA 2QNEA 2XH0A 2DPEA 1GNXA 2FFCA 2PDIA 2CLFA 3R2GA 1B4EA 3RCMA 5A6MA 4KEZA 5FACA 3POCA 3OPSA 4D6GA 1SO5A 4G6CA 4H1ZA 3BLPX 2VEPA 2GJRA 4JYFA 1GZJA 3MHUA 3GDRA 3UQNA 1K1DA 4N2YA 5CG0A 4MM1A 3PNZA 4OQVA 2YDAA 5C55A 3PANA 1LT8A 4DRSA 1AQFA 2A6NA 4YTRA 3IGHX 4LAWA 2V81A 2PDCA 3T07A 2F6UA 1E9LA 1M7OA 4QS6A 1FWBC 2VX7A 5REQB 1R47A 3EGJA 3OIHA 1BRLA 3F4NA 2FZ9A 1GYNA 1TZ7A 3W2JA 2J7HA 3PBVA 2GDUA 2QAFA 1RCXB 4B5NA 3WDHA 3AMGA 1M7XA 3I10A 3UA3A 3TW7A 2VQTA 5C5YA 3WNPA 2OXNA 1I6NA 1YNPA 4DJFA 1BTMA 2R9RA 3TYBA 1OK4A 3H7VA 4P7LA 3W2MA 1XX1A 3G0XA 5JMUA 5BOEA 3WD0A 4AWUA 2PDKA 5DMNA 2I9EA 3FX4A 1L8NA 1NDVA 5HQEA 1YE4A 3KE0A 1VYPX 4K39A 1A0EA 1RQBA 3MSDA 3H70A 1XL9A 4OGZA 4F0MA 1E0UA 2NV9A 3ECQA 1P43A 4YTUA 1JPMA 3WLKX 2PDUA 3NGJA 1QPKA 1BSLA 4N4QA 3R8GA 1GVRA 2QXWA 4S2CA 4DM1A 4M51A 1V6VA 3AUOA 5DRCA 3VC5A 1E5NA 1SO6A 2ADAA 2PWVA 4YYFA 1KV5A 4LJ3A 2VRKA 3GNDA 2WVVA 4F2UA 5FSEC 2AAMA 4FXSA 1FKFA 1W5MA 3E38A 4IJBA 1HP4A 1A47A 3M0YA 3HV8A 4YVXA 3BH4A 3LHVA 1KA9F 3H55A 3RPTA 4L9XA 3BLLA 1H50A 3NYZA 1IT8A 4A3RA 2QULA 4RV3A 3CPRA 3LGDA 1Y8BA 2O7SA 2XP5A 3D6NA 1GOWA 3HOJA 3KUMA 3CTLA 4RXFA 5EFDA 1QI2A 2C1IA 2V5JA 3C6CA 4L80A 2VKZG 1OFOA 1LRNA 4ODLA 3WIJA 4BR1A 2MUCA 1EP2A 4AWTA 3EXSA 3QOMA 4GBUA 2FGLA 4DZ2A 4IISA 3R8HA 1MQRA 3TP4A 3W7HA 1B5TA 1XIBA 4MDPA 1REQA 1TV8A 1WKEA 1B4KA 3EPOA 4I7UA 3UWVA 4A3QA 4FX7A 1VAHA 1BYCA 4REQB 2OLAA 5FESA 2YYTA 3QJAA 1FFRA 3RO8A 3W81A 3ZJKA 1A0DA 4C60A 4U31A 1VLIA 4ERGA 1TTQA 2OWCA 5XINA 5E0CA 2WZEA 5DMYA 1VHNA 2Q8ZA 3WNMA 2QJNA 2D0FA 4BF7A 1RP8A 4Q8UA 4LAZA 3T81A 5FJRA 1KXQA 3WLQA 1V7AA 1FDJA 4UTFA 1FKJA 1S5WA 2G37A 1JD7A 1N8FA 3CMGA 4AYGA 3RILA 3CQKA 5HW6A 3UI5A 3TFXA 1YNYA 4YTTA 2FQIA 4B9ZA 4WGXA 4QJ4B 1QI3A 5E09A 2PDBA 1ALDA 2H9AB 3B0YA 2QR6A 4IPJA 2PGEA 4BHYA 4S3GA 2Y63A 5BXPA 1BPLB 4UTIA 3G2GA 3J7HA 5D8ZA 4ZEPA 4L4MA 1GVOA 4XBJA 2PTXA 1GOIA 3DENA 1Z9AA 4NJIA 3L2LA 4LC8A 5I3JA 4JYDA 1VR6A 4CN1A 4KFPA 3UXLA 3W7MA 1UPPA 3Q45A 4W9OA 2X40A 4UFKA 2V5KA 1G6CA 1B3YA 4Q8PA 3WD3A 4W5ZA 3LXAA 2YA2A 4M7TA 1A5KC 4LRSA 4US5D 5F1UA 1E9IA 2VXNA 4L6HA 5F7UA 4FR6A 4UIOA 2YL9A 3CGMA 1G94A 3PBYA 2G97A 1OFRA 4X2RA 1K7EA 1TPB1 1Q4WA 3MBFA 3I3EA 4AD0A 5CBIA 2NUWA 3H2OA 1TRDA 3NFUA 8CGTA 2IKIA 1TJ0A 4ENLA 4PRTA 1EQ3A 3TYUA 1HGWA 4XUYA 3LEPA 2IXUA 4WJEA 3AHYA 4BS0A 3DI0A 5G4EA 3BAKA 1LBLA 1TYGA 1V0LA 3CMJA 1PKLA 4H8NA 2D2OA 4G2DA 2R1KA 1Q13A 2YCEA 2ZRWA 5AYYA 1W31A 5HANA 4RR4A 2R1PA 4MPKA 2V30A 1TWWA 1XSIA 3D3AA 2W5FA 4KCVA 3M0HA 4FNSA 4F0LA 1J2WA 4WQ6A 2DZWA 4UZUA 4JTGA 4QE1A 4Z0SA 3BG5A 1JGIA 2PLCA 2O9PA 3ITGA 2GDVA 3EWZA 2VFHA 3OZMA 2D23A 2CNCA 2HMCA 4UFIA 1FX6A 3CQHA 4BY3A 4IZGA 1KFEA 3WFAA 3N3MA 1MEHA 3UGRA 5FJUA 3SCQA 3AXHA 2J88A 2QZRA 2NV1A 1Y65A 4RE2A 4H9VA 1J4IA 3SCUA 4G1NA 3S6DA 4DBWA 1H2JA 1WZMA 3WELA 2O4MA 2EG8A 3O16A 3AWOA 2JGQA 5H91A 2WSRA 3CIWA 3IGUA 2O7QA 2X1RA 5AHEA 1XKJA 4KPLA 2GSJA 2WSPA 4V2XA 4J3SA 1K6AA 4QLKA 4MJ4A 5AC6A 1ZBKA 5LA1A 3SUTA 3TCZA 3BANA 4BK9A 1QASA 3H54A 3TJIA 4TIMA 4RKAA 1PAMA 2P50A 2PDHA 4DRMA 1WDPA 5FIPA 2WWDA 5I02A 1TJRA 5CLWA 4MSPA 2PE4A 1Q6GA 4JTCA 3PG8A 1XLGA 4ACZB 1T8XA 4HPNA 4O18A 3GXMA 3LPFA 1E3ZA 3RN6A 4RNIA 1MSSA 5L9FA 5DCBA 5IDZA 1T8QA 2G95A 1XYAA 2XWEA 4XIMA 4JFKA 3UQAA 1VFSA 4FX6M 3L4VA 3G3DA 3G8RA 3LLDA 3SFKA 1RK6A 3ZZ1A 2I16A 4D6EA 2B0MA 1PZ0A 1SFTA 1YIXA 3EEZA 2P53A 5D8WA 4ONVA 3EWYA 2NSOA 2A7RA 2BGQA 4H00A 2DQXA 1WKDA 2NT1A 4L1GA 4HMDA 2ZRZA 4D6FA 1Q6FA 2PDYA 1V4YA 4ATLA 1JRCA 1JI2A 2QHAA 1VB9A 3NO3A 3W1MA 3ZT7A 3VUPA 1UKOA 5I79A 3H2NA 1FWNA 3AJ7A 1LG1A 3ENLA 1XC6A 4O0KA 4QISA 5G2WA 3RK8A 2VZUA 3RLGA 4YCOA 3TYDA 1FWGC 4OOUA 1YKWA 1G4EA 1FHLA 1MXSA 2A5HA 3CB8A 3TNOA 1G7UA 4HSOA 1WDWA 3GKFA 1UMYA 4LYQA 4JBRA 3QV8A 1W32A 1PYMA 1A5MC 4H9YA 4QDMA 1ELSA 5CC6A 3RIKA 3CWNA 4LQ1A 2I5GA 4DJDC 2DT3A 1XFBA 2GZXA 2EPMX 3PWIA 3WNOA 4MFEA 4F66A 3K2GA 1NDYA 1JCTA 3VIHA 2XPKA 1D7JA 4Z2GA 5F2IA 3L4YA 4P7OA 2OGYA 1IT7A 5EMJA 2E6DA 4JY9A 4FOKA 1D8CA 3OB8A 1IZJA 2IW0A 3L67A 2X7WA 1F6KA 2P3ZA 5GNXA 1KFJA 3L23A 4XG1A 1J0HA 3WBWA 4IQLA 4EANA 4LAYA 4DJDA 2GJLA 4P7NA 4MNLA 5IBXC 2C0AA 3URAA 3WX7A 2R82A 1QZ2A 3MYOA 2EJ1A 5E93A 6XIMA 2WPBA 1X6NA 3P5YA 4Y8FA 2Y70A 1X96A 4PMOA 5TBOA 3N13A 1GQNA 2CHRA 5HMEA 1FWFC 1O95A 3VNZA 1Z44A 3N18A 2ZZ6A 1OC7A 2JF7A 3ITTA 3H21A 4KF1A 3B04A 1BVWA 3DYOA 3B05A 1HNYA 3DFTA 4W84A 4J2MA 5FF4A 1QBAA 1LROA 5D33A 5JVLA 5A8MA 4F48A 1OFAA 1F76A 2XG9A 2A6LA 4NZ3A 1K77A 4HMEA 1KGWA 4CUCA 5K7JA 2PGRA 1KD0A 2OT0A 4QNEA 3UU0A 4AYSA 1XLLA 5DFAA 2VR2A 2ZXQA 1GOKA 3FHQA 2JQXA 1B3WA 1AFSA 3L4WA 4K3ZA 1FWRA 4PMUA 3GBDA 2ACSA 2PDJA 1B2YA 1UWTA 1HVXA 1EWEA 4XAYA 1TTIA 4HBOA 1UW9A 3A5FA 5ABFA 4JTHA 2EG6A 1QNRA 2Z7GA 3S2JA 2YCIX 3LGEA 2J7CA 3TTSA 2GWGA 1TRIA 2B5UB 1HTIA 4IP4A 2DZPA 2AOSA 1VD6A 4UZSA 1XYBA 3OYZA 3DHFA 3E12A 4AZ7A 1YQ2A 2PD9A 1KFCA 1VPYA 1GTEA 5HULA 2K8IA 1LDCA 4HNCA 1RR2A 4IJCA 5EKYA 1DIDA 2DFAA 3L0KA 3VAWA 1Z3NA 4C02B 2J8TA 1BG9A 4MB4A 4HZ7A 4D72A 4ZODA 5AC7A 1RJRA 3C3NA 1IV8A 3AICA 1FKSA 1Q6DA 4RCXA 2QCHA 3AMKA 4L6OA 4Q8NA 3SSJA 4R53A 4XZNX 2GK1A 5ABHA 2WLYA 3O1NA 4FX8A 5PTDA 3B97A 1UR4A 2NX3A 4B5WA 1OCNA 4J35A 3QQWA 5DRIA 1MZHA 1WXZA 1AODA 1ZCCA 2IKJA 2QMJA 4W86A 3FFSA 3FEMA 4OHQA 5FJTA 1Q7MA 1HXJA 4JFTA 1B9BA 1Q7ZA 2WW5A 1Q4NX 1G1YA 3NXFA 2PP1A 1L6SA 4QXIA 1GZ1A 1R9ZA 3S5NA 2OTDA 1LLWA 3N1AA 1VJIA 4TVCA 2QDDA 1JL8A 1FFQA 3VCRA 3PZMA 4HA0A 1S39A 4MHBA 4PB4A 3RXZA 5ABEA 4G7EB 3QEZA 3VMPA 4W7UA 3BDKA 4FALA 3GNPA 2KI3A 4U33A 1BKSA 4YXGA 1FRBA 4Q4OA 3GZAA 3O15A 3QBUA 3EX1A 4D8LA 3DGBA 1MDLA 3TYZA 2Z25A 4QSHA 3C56A 1KQYA 3BK0A 1Q8AA 1QTWA 1O1HA 1X8CA 3EDKA 3W71A 4DB7A 4D6DA 3W9ZA 1JF5A 3P0WA 3KAFA 3KABA 4PEEA 3BMBA 3IIVA 4WRHA 3DKJA 1ME9A 3KWXA 4R34A 4AZ6A 1EUAA 4JFVA 1WXYA 1XIEA 4C6BA 3VKKA 4R88A 3T0AA 2P3EA 2G96A 3SCWA 5FKYA 1WDRA 1Z69A 4IQEA 3KOZA 4O15A 3XINA 3QPYA 3ARRA 1AUSL 2OB3A 3L5LA 3IPWA 4WDUA 4CQDA 3BG3A 3ANUA 3GC2A 4KEVA 4ZS6A 2FVLA 3CEPA 3NL2A 7TIMA 1WV2A 3UESA 2IPFA 3AXMA 1KFWA 1C7TA 3KP1A 1PJ9A 1ZALA 3LHZA 2XZ7A 3A64A 1DJNA 3S6TA 3EOLA 3EB3A 2Z1KA 3EYPA 3FGCA 3AC0A 3LY0A 4UQCA 1QPOA 4CU8A 3H7UA 2Z1SA 1FA2A 3W87A 2CXEA 2GDQA 4KERA 3WMCA 4KWOA 2NLIA 3P61A 3NO1A 1V51A 2YL8A 1EX5A 3QC0A 4P8UA 2FLIA 2I57A 2PUZA 1R6WA 3B7XA 4DNHA 4K68A 4OECA 3KEHA 4N9EA 3A4WA 2IKGA 3WF1A 3W1XA 1XPYA 4LAOA 1M7PA 3B4YA 4PCNA 2OFNA 2CZFA 3VDCA 4UOQA 1QRQA 2JIEA 3S1VA 1YPXA 3FAXA 4UOZA 4GNKB 5BNKA 4NXKA 2JEQA 1CXEA 2ZX8A 4XKMA 4BFAA 2W61A 2O55A 1XH0A 1D8WA 3DH7A 3LHTA 3QV6A 4ACZA 2PLKA 3PUDA 4HBKA 5D38A 4NG3A 1ZBWA 1J12A 5CPNA 3BQ5A 3RX4A 1DWGM 1XBXA 3C0JA 3WK0A 1EJRC 3VNKA 1W9XA 3GRIA 3P81A 4C6OA 4MY1A 2W66A 3W37A 3TTYA 4GI9A 3MBDA 2E77A 3QFEA 3V35A 1PZ2A 3BC9A 2HPIA 2X7VA 1LT7A 1W1A1 3IK8A 3E96A 2WMJA 4AISA 4GG9A 3O07A 1VPXA 4MNJA 2HE5A 3O6DA 1S2AA 2X41A 5D4YA 3YPIA 3CL7A 2HS6A 4X0NA 4MLRA 4K8HA 4H7VA 4A35A 2POZA 3NSMA 1DTNA 1JRBA 2QMKA 4QLLA 3E74A 4B91A 4C91A 3UEQA 1XLKA 2WSQA 4DBSA 4LC6A 4MPQA 1B3ZA 5I23A 4LNYA 2H3BA 2PP0A 3RMEA 5LNUA 1UZDA 2Z2AA 1H5VA 5ECVA 1EDGA 2Q8LA 3AIRA 1RV8A 1AW2A 3ZWSA 3T42A 3CO8A 4CEXC 2C8NA 3VDAA 2WZMA 5AYBA 4O4WA 1MUMA 4UFLA 3GVGA 3GIQA 4ZB0A 4I6KA 3LI1A 5GVJA 4ZSUA 1XUZA 3LCHA 4KIRA 3ZSSA 4Y9PA 5HTGA 4FR1A 3Q94A 4ES4A 3RG6A 2ASHA 2XGIA 1DQUA 5HXMA 1I1WA 5FEXA 4JQ2A 4YYCA 5HATA 2XP7A 1TPVA 4PB3A 1U83A 3OZOA 1YDVA 5A95A 3MB9A 3MP3A 4TNSA 5I77A 2INZA 4AEOA 3O5IA 4GVHA 5FL1A 3NPUA 2JK2A 3PBWA 4GA8A 3UJEA 3PUOA 1Q1CA 1I2QA 4D6HA 1R46A 4MNKA 1P6CA 2ETNA 3ZVHB 3V1HA 4QDPA 4FOUA 3MDYB 2NX9A 3K13A 3KL5A 1FOBA 1QNVA 3GLCA 4O50A 3H2FA 4NNBA 2YW3A 3CUZA 1XDMA 2PF8A 3V36A 3LK6A 1C9HA 1OG0A 3E9AA 2CESA 3ITVA 2POTA 4XUGA 3RU6A 1KM1A 4HK6A 3SGGA 2PU0A 4IQDA 1UUOA 3NZPA 4P2VA 5HPCA 1VEOA 1LBFA 4GOAA 3DAQA 3UPWA 3MI2A 1DXFA 1KQZA 2BV9A 1A3XA 4GK8A 1TPC1 3W00A 1TO3A 4LX4A 2PDLA 1DJIA 1P0EA 4U2YA 4LALA 2IS7A 1FTXA 1TE1A 1R85A 1ISVA 1FCQA 5FF7A 1O60A 2F7FA 3W01A 1OG6A 2DT0A 2JZVA 1Q6HA 3PBMA 3QTGA 3EB4A 3NQCA 4CKQA 5FI8A 4J3TA 1EJUC 5E9XA 3CV6A 3AUJA 4UXDA 2C6QA 2YX0A 4MY9A 1UH3A 3IWPA 1L8PA 1S3HA 4H8HA 2EGZA 2WC4A 2VJXA 4PODA 2C91A 5CAKA 4WD0A 2WM0A 5A2CA 3IEBA 1FXQA 1QNPA 3KVJA 1HJQA 1CGVA 1CT5A 1W3TA 4F2BA 1I2NA 3A22A 5I5RA 4H2HA 4IF2A 4AW7A 4ZOEA 2PFHA 2DW7A 3WYZA 3W29A 3W23A 2XFYA 5A94A 3F4VA 4WY0A 4IPLA 4D6CA 4I8DA 1XG4A 4D9PA 1Q2SA 1FKLA 5TAOA 3VKJA 4PMQA 2RUQA 1JZ3A 3P0XA 1G67A 4K1WA 3HU7A 5CJMA 1XW8A 5H2ZA 3VOJA 3WDPP 4DRNA 2YPIA 3LD5A 3MMUA 1KM0A 4HOXA 5HNRA 1E72M 4PMRA 4DXXA 1UWQA 2VURA 4GJ1A 4JKMA 3H4XA 5E70A 1Q63A 1NMWA 1IXNA 3LV5A 2Q01A 3F4WA 1W9BM 1FKTA 2QCDA 1ZLPA 5K3VA 2ZUMA 2WMKA 4AZIA 4YHEA 4KH2A 1V03A 3LPOA 5EMKA 6ALDA 3T4CA 3WQ5A 5JH1A 1JJKA 4HU8A 1OX4A 1HG3A 3V0TA 1NM9A 2RH9A 5HJYA 5JH2A 1SFSA 2XSXA 3LXBA 1YPIA 1SW3A 1K02A 4F3HA 2WHJA 4HP5A 1ZRQA 3TX9A 1YADA 2NVCA 1I1XA 5EB8A 3N14A 1I2PA 1S5VA 3L2IA 2PV3A 3W1AA 3MI6A 3H26A 2DY3A 2PC8A 1OEPA 1MEWA 1R9XA 5LKYA 2J47A 4I8YA 1LORA 2DP3A 4JIIX 5EFFA 5HDRA 2ABBA 4HPGA 1AL7A 2QGHA 3LDVA 5D9PA 3SUSA 2GJXA 4PTNA 2CPUA 3WCZA 1TSIA 3GIPA 4DI8A 3GNNA 4QLJA 4IP5A 1RJQA 3PJTA 3JU2A 3GDTA 3S2NA 3T8LA 2NQJA 2XTKA 1NOFA 4MKSA 3GXNA 2GVJA 3I3BA 2JFEX 4FNRA 4AD2A 4G2PA 2WCGA 1UP3A 4M7SA 7PTDA 1EYMA 1TA3B 5LGXA 3OODA 2Z6IA 3RCYA 4XKYA 1BXNA 4NYUA 5K2ZA 4F9DA 1UD8A 3NVDA 2VVSA 1W5OA 3EKGA 4N9DA 4KRTA 3S2LA 1BXBA 4GXWA 4J3ZA 1EBHA 3GXDA 4UTHA 3CTTA 3VD7A 2EPNA 2GVYA 2WM1A 2NWRA 3MDUA 1OGGA 2SFPA 3GTYX 2B7OA 5EPDA 2Y62A 4A6GA 4CCCA 2Y7FA 2DVTA 4LCSA 1GKRA 4XIAA 2F2KA 5DO8A 1US3A 3M7SA 4A3UA 3DU0A 1VKFA 4LXFA 1BFNA 1XLDA 1LTDA 3VNJA 1EKOA 4Y9MA 4GVGA 2WHLA 4IUGA 1PCWA 3KVMA 2RDXA 3QZ6A 4ZQPA 4CNTA 4X9YA 1JZ4A 2X8RA 3FYPA 1M01A 4NILA 4KETA 1QWKA 1CTNA 1PTAA 1TIMA 4MMWA 3O5JA 5D37A 1I0DA 1J0IA 3UA4A 1UR9A 4GFSA 1YDNA 1F8IA 5CPMA 1NARA 4B15A 4GYKA 2PGFA 1YEYA 2FZDA 2YKKA 3P8IA 4GISA 3JRKA 4ZO7A 1I8JA 5A2AA 2BHUA 3VE7A 3K8LA 1HKKA 1NSGA 2WMIB 1K3UA 3WLLA 4L3NA 3P5ZA 1AZ1A 4ADSA 4ZQCA 4DVOA 3IJLA 2QCNA 4JKKA 1KCZA 1S1PA 4M80A 3W1QA 4GNVA 4NASA 3M5VA 3EX6A 1J11A 3LHYA 3K8MA 4PULA 4NZJA 1KTBA 5E1QA 5HWCA 4K37A 4JCLA 3VD5A 3BAYA 3HJEA 4Q6JA 2C3ZA 1J6YA 1Y5WA 4LCQA 1NU5A 3I68A 1GPFA 1NVMA 5I3IA 1GJPA 1EDQA 4H3DA 1KR0A 2VUNA 2ATSA 4HQVA 1H63A 1VZWA 4A3HA 1UWRA 5J5DA 2ZKMX 4V1XA 3QR1A 4L56A 4B3ZA 4JFUA 1EXBA 1TMQA 2TRSA 3PB2A 1OBAA 4C1KA 2X2GA 1FWCC 2HXTA 4RZ5A 2J79A 4F0KA 3UWYA 2PWDA 3W1RA 2ON3A 3DESA 1DTUA 1DORA 3HPSA 1C8YA 5FEPA 4DUWA 3TC6A 4EWND 1AH4A 3ITCA 1ZL1A 4RE0A 2YZRA 4N19A 4ODMA 5FSDC 3CHEA 5I2UA 3HGJA 5AVHA 1E4IA 1UWAA 4XAFA 4POCA 1RUSA 4LY8A 3IV3A 4DQWA 3PTDA 1F4HA 3USBA 4RPPA 4ZO8A 2ICSA 3NQ7A 5A8OA 3GFYA 2BVYA 3ELFA 2WK2A 2FGZA 3P8JA 3TK7A 4KBXA 4RDZA 2HTMA 5CQ1A 4GZEA 3JW7A 1KWKA 4IM4A 1MXGA 3W6LA 3QR0A 1GRJA 1TUFA 1XRTA 1H41A 4LV9A 4LUYA 2Y24A 1VPQA 2RDUA 4PTDA 2BASA 4FLRA 1TE6A 3VOGA 2ZXAA 2XVNA 4O16A 1EF3A 1WCGA 1XH1A 3JR2A 2NT0A 3AIEA 3W7DA 3H24A 4UNIA 4H01A 1OQFA 4WR3A 4MAZA 7XIMA 2NQZA 1XISA 3BE7A 4PBGA 4HYVA 5FAJA 3C3UA 3W84A 3AIWA 2Z0IA 4Y6GA 1DXEA 1RJPA 1J10A 3ARWA 2VRJA 3DERA 4IPIA 4LUIA 3B9OA 3FXGA 1RVGA 4I7VA 5G5IA 5I09A 4FK9A 4TVDA 1ADDA 3B8TA 4O2TA 5BU6A 4C6EA 3A9IA 4X22A 1XGEA 4J3VA 1Q6CA 1J6OA 3PZVA 1JXKA 2OZ8A 3ALFA 1UZ4A 1M7JA 3M5ZA 3O8AA 3BAWA 3DXIA 2XP6A 2J13A 2KAUC 4UCGA 2BXZA 2ESCA 4NAEB 3N73A 3EPMA 1CXKA 4EK7A 3ZM8A 3OLDA 2PDNA 3CUXA 3OVRA 1OWQA 1YLVA 1H1ZA 3I6EA 3NL6A 5A5WA 2VHLA 1FKDA 2EXOA 3V16A 3HB9A 1EUNA 1SU5A 4ADTA 2PAJA 1OFPA 3MCNA 3WLPA 2CHNA 4GBDA 3QZAA 1OZMA 1TJ2A 1UZHA 3VD4A 1LRQA 2G3FA 2NV2A 3QQ1A 3Q37A 3TSDA 1R5YA 5C9ZA 1VQTA 4MWAE 4AD5A 3BLOA 2WV8A 2QDHA 3U2EA 2WKJA 3LCFA 3GHSA 3VM5A 4IMDA 4AEEA 1N7KA 4L65A 1VRXA 4M0XA 4C7DA 3W6YA 2HJPA 5HMSA 1LZOA 1CIUA 1EYEA 4XD5A 5A8NA 3PZQA 2FHFA 4XBKA 1A3HA 2YCLA 2NXHA 2BVTA 4CLMA 1FAPA 1GQJA 4M1BA 3EKZA 2BVWA 1RA5A 3B8WA 1P0DA 3LN3A 4LSBA 1XYLA 3DECA 1Q3NA 3TSMA 5IHSA 3PUGA 3UF8A 2OWWA 1SZFA 1NOWA 4R7OA 1AK5A 1WP6A 4AVOA 4DZIA 5A6JA 1DIOA 1D7HA 2PODA 2YCKX 3UZ5A 1ZUAX 3KVKA 3FA3A 3UW6A 3W22A 2ZXBA 5ABFB 5D05A 3TTOA 1ZAIA 3VDHA 3QH2A 3DYPA 2OSYA 3B9EA 4NAFB 4UQDA 2AQWA 1TB3A 1F2JA 1RY0A 3TN4A 3D5HA 4EPEC 1HT6A 3BMVA 4GX9A 1E9ZB 2GQ3A 3VIIA 1VBGA 3WD1A 3PJWA 3EXTA 4MDOA 3SRHA 1XUUA 4A8IA 2VCBA 4CNOA 1EC8A 4GCAA 4JIEA 2QIIA 1NQ6A 5I00A 4ECLA 3G1AA 1RLDA 2BBFA 3B8UA 5LA2A 4CQBA 3ABXA 1ODUA 1RAKA 3V75A 2VZVA 4NT0A 2DDXA 3FAWA 2VYOA 1F8AB 3RF9A 3G77A 2I9UA 1QU4A 3QRHA 3EB2A 2PI6A 3VMOA 1PCKA 1BAGA 2ZUNA 4OVXA 3PZ9A 2F8QA 3CAQA 4QE5A 3WUFA 4DX3A 2G3NA 3T9PA 2VDIA 4X3ZA 1Y5VA 4NZ4A 3B0PA 2UY2A 1VH7A 5T9BG 4C6KA 3QY7A 1XP3A 5CLTA 2BXYA 4WGHA 5DELA 4XZWA 3L4ZA 1TQXA 2D73A 3C0LA 3OP2A 3GW3A 3R13A 4I9TA 3OHMB 2MF9A 2PURA 4JR5A 4RW3A 1TV5A 3BURA 2H8ZA 5E6ZA 2YLAA 3OU8A 3TROA 3O9NA 1QPNA 4CCZA 3FW6A 5CH9A 2QJGA 3LERA 5HWMA 1TPFA 1UD5A 4MIMA 1NELA 1VIZA 1KFLA 3SUUA 1S5TA 3VNMA 4IPNB 1JG9A 1UYQA 1GW9A 5J8LA 1GJUA 4DLFA 4XK2A 2J25A 3W24A 1YBQB 3EX4A 3R8RA 3CIXA 1W1IE 1TVNA 1T99A 3NQDA 3GTIA 2D3NA 4HYWA 4IFOA 4IMEA 1X1ZA 2E68A 1OY0A 4IL0A 1B31A 3W7JA 3BAXA 5EL1A 4FN2A 4W8AA 1QI0A 5EYWA 2MLZA 2ZWYA 3E49A 3ITOA 4ZB2A 1IEQA 4IP7A 1FVPA 3WQ4A 2A2IA 3NQMA 3NL5A 4DYJA 3TJXA 3BO9A 3VKAA 2WC7A 4LTSA 4S3JA 1HN1A 2NQ9A 2FPVA 3GYCA 5C8BB 4NX5A 2VENA 3MHFA 5DN1A 1NDWA 1OFDA 3GUWA 1UASA 1C7SA 2HRWA 2AL2A 3GQYA 1P5BA 3TDFA 1CNVA 1KXTA 4W7VA 1DPMA 2QQ6A 5I3KA 4O1CA 1P0NA 4AB4A 3KHJA 2HWGA 4Y9OA 2WBKA 3WNKA 3M44A 1ROTA 2PA6A 1XIGA 3MQTA 1TJ1A 5D03A 4C6PA 4WXZA 3NYDA 3SGUA 4FXFA 1JUEA 2ZZ7A 3ARXA 3PTQA 1UC4A 2A0NA 1PUDA 5A6BA 3RYSA 3C4UA 2XSBA 4UWMA 2XP4A 1O6IA 4KFOA 3IIPA 5HA7A 2CWXA 3GYEA 4CN4A 2X09A 3AYTA 3G1XA 3NTPA 1LL7A 3LM7A 4KFNA 1BTCA 5HAOA 4OBRA 4XD3A 3V0UA 4C6MA 2NLYA 1DYSA 1XCXA 3QKEA 4L4OA 3WLJA 1XV8A 1J0JA 2D2HA 3S47A 1ZAJA 1L9WA 4AXKA 3WQCA 3KOWA 1GKQA 3CH9A 3H12A 2Q71A 3CL8A 2XVKA 4TU1A 3BSHA 3TJLA 1GCYA 1FWSA 3UXIA 4AWSA 5F2LA 1E3XA 3I3DA 4NNRA 3FEQA 2FH8A 4BI7A 5FJJA 1HUVA 2D69A 2E40A 1KFBA 4ZOBA 3GW0A 2PCQA 2NQ5A 2QUMA 3P62A 2X0HA 3WBAA 1YDYA 3E2VA 3ICJA 4ROQA 2PLMA 1PBGA 1DJZA 4UTKA 1JCXA 1GOMA 2YBVA 4EP8C 3RM4A 3USZA 3WQOA 3QHOA 2X0SA 1PL9A 4GUJA 2GGGA 2EQDA 1NP2A 4MADA 3QM3A 3ERPA 4UNKA 1U30A 4UFJA 3E0WA 1G5AA 5LHEA 2PRLA 4DM2A 2OQYA 3V4BA 1R87A 4HK5A 4AX6A 3R43A 3KS5A 3BV4A 1FQ0A 3KAOA 2PCEA 4S1FA 5CSSA 1P5QA 3F2CA 5GNYA 2M08A 1FKKA 4Q33A 1NWRA 3LI0A 1JVWA 8A3HA 1X98A 1O1ZA 4PSRA 3SUVA 4O54A 4XWUA 4HNLA 3OLGA 4Q32A 5MF5A 3E1F1 5LNWA 1JQVA 3O5RA 3BJTA 3I7SA 2QCGA 4QT3A 1GEHA 3FVMA 3G0UA 1LOSA 3E0LA 3A3XA 1D3CA 1EGZA 4TQTA 4QDWA 4O14A 4PYSA 5EMYA 5BXSA 3DKLA 1O5KA 4BEUA 1EYWA 4JOMA 4ZR8A 5E9AA 3LUOA 4H7CA 2BFGA 2ZTJA 4CD7A 1WOAA 3AIUA 1QI5A 4GZIA 3M0XA 4BQ5A 1KCLA 1FD9A 1OCJA 3KBJA 2JEPA 1M3UA 2FDMA 5HJXA 3A12A 4KT2A 5C2CA 3EOUA 1EJTC 3AYSA 2ZX5A 1EBGA 3IJQA 3NTYA 1SM9A 4EWJA 4U10A 3L0GA 3REQA 1XRVA 2BWGA 2GYIA 1TV7A 1R2TA 1MFVA 3U6WA 4LS0A 4PE8A 4IJRA 4W8LA 4AY7A 4PMVA 3TYEA 4M24A 3UG8A 2OX1A 4QR6A 4LUTA 5CSRA 4ODKA 1IXOA 3OQ8A 3ZS4A 5A8PA 4EF8A 1US2A 1JF6A 4UOJA 2A1YA 5F4WA 3SR7A 3TKFA 1B6CA 1G0CA 4UTWC 2Z2UA 2VC9A 4MY8A 1SMAA 3UCCA 1LG2A 3WFLA 2FYMA 1LM1A 1A5AA 1UC5A 4ATWA 1JZ8A 4IMFA 4PMXA 3G1SA 3PBGA 4MLJA 1LBMA 5A69A 2FTWA 3AIQA 2JKEA 1TWZA 3NCOA 2YYUA 5KZMA 1MW0A 4HHLA 3RLUA 1V0MA 5TQLA 2CZVA 1W3IA 3GHRA 3SCOA 1A5SA 7ODCA 2VCCA 4BI6A 3FOKA 4M6PA 4HZMA 1OT1A 4J4OA 3EDJA 4S3KA 4M8UA 2PWGA 1LWJA 5HUOA 3S1GA 3IGSA 2AWGA 1UJQA 3EA2A 3TN6A 5I3FA 5I07A 2BG5A 4O1DA 2C16A 3VDGA 3OTRA 3G1RA 2DSKA 1KW1A 1ZJAA 1LYXA 4EXAA 2Q8XA 4LCRA 3PC0A 2J9XA 1GGOA 1C9DA 5FL0A 5LHFA 2HE8A 5AZ0A 2E0PA 3TSBA 4DPPA 1QJWA 1EP1A 2FPTA 4MTVA 3M07A 2OO0A 3OBKA 4M19A 1WAUA 1LUCB 2D22A 2DZAA 4NZCA 3NEHA 3EWDA 2Y88A 2VDGA 2RJGA 2Z29A 1XBZA 1MDRA 2C7FA 1XC4A 3NA8A 2R24A 1F7BA 1DWJM 3I65A 4FF5A 3ITYA 2PLJA 3ALGA 1P6BA 2X42A 2E67A 4NZ1A 1V08A 4ITZA 2Z4GA 4EXQA 1WYIA 4OUEA 4NAFA 3LCWA 2OQLA 5DBUA 3KW3A 4DUXA 1B3OA 1FWIC 4F0HA 1FH9A 1OF6A 4HSNA 3SY5A 3BJFA 1WDDA 3VFLA 2FB3A 3CT7A 3EY6A 1E51A 5K4XA 1WZKA 1TIWA 4W9QA 3KVLA 2QUVA 1XGDA 2PGWA 3TLLA 2J27A 3K4WA 3MUY1 4ZE4A 4GRSA 3TZNA 1C8VA 2DSZA 1QHZA 1GVSA 1YXDA 5TIMA 3EWCA 2H8XA 1R3RA 3OA3A 4TXEA 4ZPWR 3B8IA 1PYFA 1JPIA 3W7QA 5D2XA 1AW5A 1VS1A 2ACUA 3FDGA 2HDJA 3RCNA 3LG3A 3AS2A 3PFRA 4PMDA 4C7GA 1IYXA 5D2WA 4JFLA 1EA9C 1XR2A 2GOUA 2XN1A 1ZAHA 3U7VA 2HK1A 1K8ZA 3LRMA 2VZOA 3IV8A 3VYLA 1I4NA 3T2OA 4J40A 4F0SA 1ZZMA 1PXGA 3I6RA 3F2DA 4H9UA 3ID7A 1A0CA 3QLDA 1U1HA 3LSBA 2PMQA 1EGVA 3PB0A 3L5AA 3PZOA 2PPOA 2DZUA 4FNQA 4GH3A 3PWGA 2GLKA 3APGA 4HSHA 2ZE0A 3VI2A 3ARSA 3N2TA 1MO0A 2ZQUA 1XLAA 5A2BA 4LUJA 3CYJA 3H6OA 5I0DA 4HT3A 1DQXA 3ITLA 1HO1A 2RDWA 4R33A 1JCNA 3GXFA 2YA1A 4PRWA 3P2VA 3M64A 5J04A 1EWDA 3HMCA 1YW1A 4JKLA 5EY5A 5LGZA 3R94A 1H51A 2PWHA 5I06A 4QE4A 1DWAM 4H19A 2E5BA 2CZEA 3TC3A 4ZFCA 2H90A 1US0A 2XWDA 4PGLA 4B2DA 2PZNA 3UJFA 1H7WA 3UG5A 3GNRA 4CD8A 1F6YA 3VIMA 1VFUA 4ZB5A 2ANUA 1TPWA 3E2QA 3KBVA 3LA4A 4C6CA 2A21A 1S38A 2Z28A 4NRSA 4MSSA 3WBYA 1KM6A 1JCLA 3DZ1A 4FXJA 2GWNA 1A5CA 4HZ6A 1PEZA 3T08A 2CLLA 4JXCA 1WE5A 3G1FA 4R85A 2IPGA 2NZLA 3BMWA 5M5DA 4JNYA 2YA0A 3EAUA 1NF7A 4RNHA 3M5YA 4ZXOA 1K9TA 3IKGA 4PC8A 3KP0A 3MP4A 1CEOA 4HB7A 2WJZA 1E4NA 3K1DA 2QCDB 1OZQA 4ACYA 1K03A 3HFYA 3BW4A 1VFHA 5A6LA 3WQ6A 3SEPA 4IX2A 2FZNA 4KMQA 2Y6ZA 2VOTA 1ZBVA 2PV2A 1KGXA 2QJIA 1TV2A 1XIIA 4KW2A 4GJJA 4TW8A 1KXHA 3B3DA 4HA4A 4AEFA 3MHGA 3T6CA 3UWQA 3WO8A 3II1A 4BEQA 5FCZA 2CBIA 4HNTA 1E6PA 4KKXA 1MZRA 1X97A 4D8ZA 4TW6A 3M7WA 4TO8A 4GYPC 3S5YA 4YWIA 5KITA 4XTIA 1RBLA 5ABTA 1OD8A 4FXRA 5C9XA 3K4DA 3UZWA 2FHCA 4QTGA 3F5KA 4OJYA 4IIGA 2Q3RA 3M0KA 3SADA 3UWWA 3T09A 1TCMA 3GC4A 3URBA 1J18A 2CIPA 4NRRA 2A3BA 4LF2A 5DMLA 4OBTA 1X7FA 1EH9A 1RVKA 3N6JA 4AVFA 3WLTA 3S1UA 1E6QM 4JY8A 4NNAA 3TZFA 4FIRA 1TVPA 4O28A 8XIMA 2J77A 1J0KA 1LF1A 4Z2LA 1H49A 4U2ZA 5KTLA 2OZ3A 3GWQA 4YL2A 1PWLA 4WDXA 4KCTA 2BY3A 4QG8A 2FMNA 1DE5A 3OOBA 2FMOA 3L12A 2ZRUA 2WZTA 5FAGA 1JAKA 4O1AA 3BARA 1IQ8A 4PTWA 3HV9A 3ZMRA 1TX0A 4GVIA 2WB5A 5T9CE 1KM3A 3GVWA 3UJRA 1GEQA 2VI0A 3IK2A 2XGBA 4UQBA 4DBUA 3WQ8A 3VOFA 3LTSA 2QT3A 4AQLA 3VGHA 2DZSA 4OU1A 3VIJA 3VGGA 1QW9A 1SZNA 1GVQA 4QCEA 1VBUA 3WLSA 3W88A 4U5IA 3FJNA 1CGWA 1NEYA 3WLOA 3IIZA 3L9CA 2R6OA 2E9LA 4P8VA 3WK2A 4F9JA 1R2SA 5D02A 2CBUA 1EOKA 5C71A 1MNZA 1XIMA 4QCFA 3P60A 4Z1DA 1NY1A 5FOOA 1NSJA 5C9UA 5C7HA 1UKQA 1POJA 3TFCA 1XLFA 3NXLA 5BXTA 3TA9A 2NX1A 4OOZA 3ZJ7A 4DF2A 3BGAA 1XSJA 1F9CA 2W91A 2E1DA 4HHHA 1BVZA 3LLFA 5C2XA 5TD4A 3PF3A 1L1PA 1PBKA 1JDCA 5DT7A 4AF0B 3QGAC 1LQAA 3WN6A 1M53A 3P82A 1QVBA 1DJGA 2OT1A 1L6YA 2DORA 4MWAD 1VHCA 1WBHA 3OLIA 3WENA 3GTXA 2YCLB 4LVGA 1CGTA 4H6EA 4LANA 3S5OA 1F3XA 3ARPA 1ISYA 1XDJA 4OFCA 4WK9A 4KEMA 3LRLA 4WOQA 1IGWA 1A5BA 4J27A 4KS0A 3F4DA 3GG1A 1ONWA 3O5KA 3C8FA 3AALA 2OODA 3ZQ9A 4OT7A 1O66A 1DJXA 3R5EA 2DVUA 2C79A 4OZOA 3F4CA 1ISXA 3FLUA 4I5XA 1W1B1 3MCOA 4JIHA 1LLOA 4TTUA 4R7WA 3WD2A 1GVIA 3UR5A 1VF8A 4K38A 3MVIA 4I5RA 5LYRA 2BNJA 3GZ3A 1TKKA 2CCRA 3L0NA 1KB3A 1CECA 2UZ9A 2QF7A 1TX2A 4PUWA 3EDEA 4ODRA 2DJXA 1LLZA 4D1JA 3BGGA 1CX9A 1FWDC 3VKDA 1O12A 4GI4A 4LUTB 2QW5A 3M9YA 2DIJA 3QYQA 4DJDD 1O68A 1YHTA 4QG9A 1JYVA 1HL2A 3LS9A 4DO4A 4ROPA 1JPKA 1JCMP 3DX5A 1V02A 2N87A 3DBNA 1QCWA 1H0GA 2P8CA 1AJ2A 3UBPC 2P1FA 2VC6A 4W89A 4XBSA 2BSLA 2X16A 1QNQA 1AW1A 2UY5A 3FXYA 4CNNA 3N3TA 3GTFA 3PZNA 4NJKA 1K9FA 4YHGA 4UTMA 3B06A 2HV5A 3MA8A 1FKBA 1JZ7A 4UTTA 2WCAA 3U2ZA 4CD4A 4AX7A 2BODX 3DCPA 4UTJA 1DHKA 5REQA 3QFWA 2FH6A 4MWAA 4DT4A 1DIEA 1UP0A 2GUBA 3VKBA 1UMLA 3E0IA 3M16A 4Y2WA 4Q4SA 4LOCA 3A3HA 4A21A 3W28A 3AMDA 1NJJA 4YN5A 1UR0A 2JKAA 2OLHA 3CPUA 3KCJA 1S1RA 4DHGA 3A4XA 4JQAA 4M6VA 1XJBA 4J1OA 2VVNA 1H11A 4CCEA 4ICCX 1YNQA 3TXVA 2QCMA 3O5LA 1E4LA 3WH8A 4P7QA 3QXBA 2KGJA 1U33A 1PWMA 2OQHA 4LUSB 3N12A 2DIEA 3KOYA 1JR1A 3WQVA 3RHGA 3EZ4A 3G22A 3CNYA 3U5UA 5I78A 5J6EA 3KCLA 1ZENA 1RPXA 3KBNA 4MWAC 1IEWA 1ECEA 4C65A 4PTVA 1E6RA 3N2MA 3QV9A 3CZGA 3PSWA 2VFDA 1ZBCA 4Q8WA 5K4ZA 3M6DA 3D0CA 1V79A 3S0CA 3L21A 2NW0A 4J3WA 1HJXA 1F3WA 2ISWA 1VFMA 1PHWA 7TAAA 3QN3A 3F7JA 3WQPA 4LEFA 6REQA 4Z2HA 4OUIA 2FZBA 3SCTA 3CGNA 1BWVA 2NXIA 1QHPA 2ZFAA 3WQDA 3LLXA 5CPSA 2E9BA 1EHAA 1UG6A 3G6LA 4UR8A 1IZKA 3BW2A 4QT2A 4WY0F 3T4WA 3C8NA 1CPUA 3QKZA 1IWPA 2ZDRA 4QIUA 4IFKB 2VWSA 5CC7A 4NQ1A 3IJIA 3VNIA 1N1AA 1UIPA 1UR2A 3DFYA 3AISA 3S4TA 2RHGA 3RMJA 4WEVX 3UYIA 2OFJA 3R1ZA 3EIPA 3O5FA 1EJVC 3MSYA 4Y96A 2A7PA 3KDNA 4IQ2A 2WSKA 1IIGA 2V68A 3BSGA 5A6KA 4DWDA 1XGZA 3RM8A 4CNPA 1RCOB 5GJPA 2WHMA 2Y8KA 4MNMA 1R9HA 3NZQA 3KOXA 2WAGA 1FKRA 2OKTA 3U57A 1ISZA 1WZAA 3QW4B 3LXCA 4JTLA 4Z2IA 1UPMB 1GQKA 1XI3A 3AZRA 4MFDA 1MRQA 3AFBA 4A8RA 5HUAA 1Z32X 3CQ0A 4XZMX 3WJSA 3EWXA 3LB0A 4YVVA 4HA1A 1HL8A 4IOTA 1E1CB 3EDFA 1TA3A 3U5YA 1JGMA 4O0QA 5BMXA 2J66A 2VC7A 3DHDA 1UD6A 1ZU8A 3TLQA 3H2MA 3C52A 1Q6LA 3ES8A 1LCOA 3NUKA 3A5VA 2DZVA 2Q3OA 4LT9A 1HJWA 3UZXA 1SO4A 7REQB 4S2BA 1H62A 3A6OA 3M4HA 1H7NA 5TF0A 1ONEA 4FB7A 4QP0A 4QJ3B 1RP9A 3QSRA 4FMVA 2ZADA 1P4CA 3PAOA 1CB7B 4GUGA 4XAZA 3TW6A 4IQCA 3S2CA 2OSWA 3NOYA 4R3UA 3W7IA 5EBAA 5LXEA 3TV8A 1R2RA 2IPJA 2YW4A 2ZQTA 2QV5A 1TQJA 3WF0A 2QCEA 1XDLA 3GVRA 1I75A 1QOXA 3DG7A 4ZFMA 5K9XA 1C3FA 3KCEA 4DJFC 3RFAA 3DG3A 2DSUA 5KZDA 1I2OA 2DUZA 3QYSA 4GIAA 4MGVA 1FWTA 1WBJA 4H2CA 3SIMA 1MXDA 1VFFA 2WCSA 4NY2A 5JIPA 3TCEA 1FHDA 3CH0A 3ZR6A 2ZRVA 4J5NA 5MKGA 1KBBA 1OX4B 3WMLA 4IPXA 5E0KA 4IL2A 2P8BA 1RLCL 2V3FA 1ICSA 5CSUA 1MW3A 1K8CA 1T96A 3ZLHA 2WMHA 3H4WA 2ZUUA 1JCYA 5LZLA 3TWAA 4C1LA 2HEJA 3MSRA 3S46A 3F03K 3VGEA 3AHTA 5F1VA 3N2OA 3LZ3A 3S9YA 5AN7A 2PTZA 4JTTA 3ARQA 1WAWA 1JDDA 3MW7A 4P7RA 5DXYA 4IFRA 5JBEA 3G1HA 1UBSA 4F79A 3MO7A 4B2DD 4LS1A 4DI9A 1PHQA 3B8VA 4J4NA 1AJ0A 4HIBA 4NKCA 3QHNA 1DKWA 3A13A 4IGHA 2LLEA 3DC8A 3PRAA 3VD9A 1DP0A 2OMAA 3TVAA 2Z1WA 1Y0EA 5DXXA 4QS5A 1EHNA 1E15A 1J6PA 1FDZA 3QGKC 1TPH1 4KRUA 3M0LA 1NTHA 3GK0A 3UERA 2BDQA 3DFNA 4V1YA 2EHHA 4J7RA 3U48A 2E9MA 1W1PA 1BYBA 3P93A 3O3RA 2BB0A 1KC7A 3NSXA 4AD4A 4LF1A 4GC3A 4XD6A 2VX6A 1R3VA 3W7LA 1JZ5A 4Y8EA 3GDMA 4JN6A 3PHAA 3NPXA 1F61A 1IF2A 3HA1A 3JUGA 4GGQA 3UPBA 1W6TA 2YSWA 4AF0A 2OWXA 1XYZA 1KBJA 2E8ZA 5HBFA 1E5JA 1ADSA 1JXJA 3MWCA 1XLBA 2OYKA 1XYMA 4M29A 3V3WA 4EPBC 5C7VA 2V3GA 4KWWA 2RGMA 1ECQA 3W74A 4WSKA 1VCFA 3I4KA 3KZSA 1B9ZA 3D46A 3NZGA 4FPSA 1VGAA 1FKXA 1JNTA 2EF9A 5D9MA 4C5ZA 3GHUA 4TX6A 4GD0A 3GH4A 1XFCA 4LRTA 3G1VA 3SM0A 1TWIA 3W6MA 3SJNA 5HNNA 2V6AA 3FNDA 3R7MA 2WVSA 3F5JA 5CBBA 3QTPA 5BCAA 2W92A 2XN0A 3NIYA 1TMLA 4W9PA 3CIVA 4J2PA 3KL0A 1K7FA 4M56A 3ZT6A 3IACA 1H1NA 3TAKA 1X39A 1TV4A 3TA6A 3WDQA 5JIWA 4JTRA 4EOUA 2WQDA 4JN7A 3VNLA 4GNJA 3PS7A 4AC7C 2ACQA 2WJDA 1E0WA 1T7LA 4A8NA 3TU9A 2QPUA 1E4MM 4E4PA 3BOXA 3CUJA 3QY8A 3SJ3A 2V3DA 3U4FA 2D0HA 2VM8A 5BRPA 1PB0A 3LBCA 3LZ5A 5JU6A 3HPAA 1GOOA 1PZ3A 1BG4A 3IRDA 1CI1A 3DDMA 2YZ5A 1Q6EA 3W2NA 1AA1B 4D8AA 4BQ3A 5U4NA 3R58A 5CAHA 2D3LA 4NI8A 4AWEA 2C19A 1BGAA 3FN9A 1W54A 1X38A 1ZSXA 1PTDA 1MEIA 1MMFA 4DIAA 3CL6A 4LU0A 2F84A 4UTUA 2OEKA 3T1GA 1AQ0A 2J7DA 3C5QA 1KCXA 3TEVA 4PMZA 3LNPA 4L7ZA 3VPLA 3RPMA 5HQLA 2ZZ1A 3NQ6A 3UVAA 3B8SA 3PK7A 1W3HA 2PS2A 4IGNA 3CBWA 3BTNA 4DAIA 4U86A 2YB1A 5BRQA 3OVGA 2YDRA 3W7PA 4RZBA 1YX1A 5KSWA 4QQUA 5C9RA 2PDGA 1PKNA 4FLSA 4R7JA 3Q58A 1UB3A 4URIA 4K2SA 3TC7A 3C2VA 3PR9A 3H22A 4C5YA 5FJIA 2C18A 4DZHA 3G18A 2WSYA 1EZWA 4YWSA 2GJXB 2XVGA 4GIVA 1J79A 3CO4A 4A3YA 3M47A 1CW2A 3ATYA 1KO0A 4DO6A 1OT2A 2CW6A 2WNWA 4GY0A 4GVFA 4UR9A 4D1IA 3NQGA 2JKPA 5G4HC 2CLPA 3HM7A 4AFYA 4S3CA 1F07A 1JPHA 4FHAA 5EMLA 3O6CA 3GO2A 3CV7A 2R91A 4BQ2A 2ZUSA 3QQ0A 1E44A 3C2OA 4LY4A 1ZB5A 1JZ6A 1P1XA 3W85A 2PD5A 1YTDA 2QCLA 1GG1A 3SW6A 2ZIDA 3PP7A 4WKFA 4DO5A 2WKGA 4XAGA 2NVAA 5IRPA 3WQEA 3P74A 3KRZA 4O11A 3WLNA 3RX2A 5BWAA 1NWUA 4CNUA 3W7CA 2WWCA 3AO0A 3M6YA 3RDKA 1OCQA 1UQZA 3BPWA 1QPQA 3GG7A 1RD6A 3KWSA 3POHA 1ZQ5A 1HO4A 1OFQA 2OEMA 3PNUA 4WIWA 5GNZA 1V7YA 5CKSA 2ZWZA 3M0ZA 3RITA 1GHSA 5M2FX 3ATZA 4F8XA 4QZVB 2X1UA 3VABA 2ALDA 1KLZA 3IHZA 5G4WA 2OZ0A 2WMGA 1POKA 3THCA 4AMCA 1OF8A 2P4VA 4S3AA 2D2JA 4O8AA 4JHOA 4RE4A 5HUPA 3N4FA 1K4HA 1K8XA 3C2EA 1IR1A 1M68A 3W83A 3DI1A 4HPXA 1YTEA 4QNWA 1V3JA 4RL3A 3TDBA 3GG0A 2RURA 5KMYA 1U5HA 1XCFA 1DJYA 2V63A 4I9AA 2VEGA 4NZ5A 3WFZA 2CEQA 2FTYA 4FAPA 1B30A 3HQ1A 2HCVA 5G2IA 2DH2A 2F4EA 4DZAA 1P6WA 3M0IA 1L6FA 1Z42A 1Q2RA 1D9EA 2YFOA 1Q6IA 1R38A 3GFZA 3KOFA 5DANA 1H7PA 1AD4A 4QBXA 4J3UA 2ISDA 3I6CA 4RUBA 1Z8AA 3PN8A 4PFHA 1KFKA 2J4GA 3VFCA 4I7WA 3WF4A 5CPQA 4IIDA 4N42A 2QJJA 4PMYA 2A3CA 3IJ7A 3ZSTA 3ZYZA 3GUGA 1W26A 2Q6ZA 3NOEA 4BQ4A 5CGTA 1XINA 3TOPA 2FKEA 1A5OC 5F2MA 1W9VA 2HBVA 1QUMA 1PTGA 2XINA 5IHRA 3BVJA 3OVPA 4GIYA 4HN4A 4HKPA 4KCWA 2PZ0A 4DNMA 1ITCA 4LBUA 1UOZA 4GX8A 5F4XA 6XIAA 3HJZA 1V3KA 3S42A 3ZOAA 1FH7A 1BSIA 3W4RA 2KO7A 1OHLA 4MZ8A 3TR2A 4AH7A 1Q65A 3A3WA 4U84A 1FY6A 4DBDA 3THQA 1KRAC 1IGSA 4WDWA 1TREA 2E8YA 2V5LA 3VIPA 1EOMA 4MUZA 2XSAA 1NP0A 1FDYA 4JTUA 1QHOA 3CYVA 3XIMA 4RX0A 1OVDA 3OO2A 1QWGA 1BRLB 4RW5A 1SSGA 1FP8A 2GSEA 2C0HA 3IAQA 3PWAA 1W5PA 3E0VA 1NAL1 2DZTA 4R9OA 5KZ6A 3MZNA 1NWSA 3QOKA 2ZICA 3MJYA 1HIZA 3GX9A 1IEVA 4XKYB 3OEXA 1G7VA 3LGGA 4JQ4A 2GGIA 3CUGA 3IS4A 3MY9A 3AIVA 2OCZA 1PIGA 1KR1A 4TOQA 3W1NA 1FCUA 5D09A 3DFSA 1Q66A 2XUCA 1ZY9A 2BGSA 1HGYA 3FV9A 4KRZA 3GBEA 2F6XA 1UROA 3SY8A 4HJWA 4E3VA 3OQEA 1EEXA 3ZIZA 4CVWA 4AC1X 2BGNE 3V5CA 4YS1A 4GACA 1BYDA 5ABGA 2GVEA 1LOLA 5DF0A 1SPQA 4D71A 1V93A 3OZPA 4FI4A 1KT1A 4DWSD 4NJGA 1OADA 4M1RA 2WOQA 4FS9A 3Q65A 3STCA 2ZQVA 1BQCA 3GTHA 1GKPA 1SZRA 5LIKX 4DJED 5XIMA 1W9DM 4ZPTR 4JX4A 2X1TA 2INEA 1RK5A 2FDSA 1SJCA 1D7IA 2EPHA 5CCZA 1XYFA 2FKPA 5BRBA 3GU9A 3H7RA 1PX8A 2IQTA 4JHMA 3TUUA 3ITXA 1PZ1A 3MS8A 1N82A 3NDOA 2E6FA 3OG2A 4FLQA 4XAKA 2OSXA 3GU2A 3SDOA 2XH4A 1IXPA 4ODNA 2OKOA 2Z6JA 2DZXA 1OM0A 3WDJA 2DSVA 5BW6A 4LVFA 4NYYA 4JL1A 2YCJA 1PIIA 3RR1A 4EPKA 1J96A 2GGJA 3OLEA 3T2QA 1QI4A 1XRSA 3CJPA 3BXWA 4PCSA 4KGJA 2YXGA 4TMBA 4U3CA 4ORIA 1JAEA 2J9YA 2R94A 1YXCA 5IFTA 3LTPA 5HKGA 1N55A 2TPSA 1LUCA 4Q7NA 3HG4A 3MV11 2XGZA 3AIBA 4NL1A 2DEPA 4MJMA 4QEHA 3EMZA 2OYMA 1IHIA 1HL9A 2Y1HA 2KZHA 3G0SA 4Q4RA 4E0CA 4HNOA 4FZIA 1EJXC 2BXVA 3WBEA 4NI3A 4ZCWA 4WVXA 3WJWA 1KM4A 1EDTA 2BHYA 2QCFA 1IXQ