2DPEA

Crystal structure of a secretory 40kda glycoprotein from sheep at 2.0a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of a secretory signalling glycoprotein from sheep at 2.0A resolution
pubmed doi rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dpeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dpeA01
4JFTA 3FAXA 1JZ2A 1OIFA 2EPKX 2WHKA 4AWEA 3AS1A 5IFPA 1V6XA 3VD9A 1CENA 2WSKA 2VX5A 5A8NA 2PI6A 1TR1A 4ZE4A 3GNPA 2FH8A 4RL3A 4KH2A 1JZ7A 5IXEA 3WQ5A 1UHVA 5AC4A 3BCFA 3DYOA 1FH8A 2F2HA 3CHEA 5D9OA 3POHA 4N0RA 4WKFA 1HJQA 3OLDA 2ZXQA 1LWJA 1WCGA 1HKMA 1ZJAA 3WEZA 4UFKA 3MV11 4WSJA 4FLRA 1HT6A 3SURA 1GQJA 1W1TA 3WFZA 2J62A 4AZGA 5LA1A 4B9ZA 2VZTA 2D24A 5A94A 1H09A 2J7GA 4D6FA 1DWIM 1QI5A 1H0IA 2YA2A 3MO4A 1DHKA 1PZ2A 4UOQA 2GJXA 9CGTA 4OZOA 3WDRA 4QLLA 2VNCA 5BXPA 4W7WA 3L4ZA 1C91A 3VIMA 4J28A 1S46A 1XYZA 1TA3A 1J9YA 4W87A 4V28A 1BTCA 1JF6A 5BWFA 4UOZA 4BQ4A 4P8WA 1O6IA 3ARZA 3GH7A 2DQXA 1GVIA 1CLVA 3AMDA 1E73M 3WH9A 2E9LA 3GDBA 3W24A 2BNJA 3ZT5A 1V3MA 1XH2A 1JNDA 1J01A 2GSJA 1MXGA 2ZX5A 1JYWA 3AZSA 2XGIA 4ATLA 5FL0A 3SCQA 4CU6A 3MMUA 1B9ZA 2BV9A 4J3TA 3WH7A 1KXQA 4H2CA 4HPGA 4U33A 1WAWA 1UD5A 1EHNA 1J11A 4JFSA 3WD0A 1BF2A 4HOWA 4WJXA 4HZ7A 4AIUA 4AIOA 2J25A 1Y7VA 2YJQA 1PJ9A 3ZOAA 1FH9A 4ACYA 1I1WA 4DWSA 1BYAA 2O92A 5IHSA 3VTRA 2YDQA 3RM9A 4BS0A 5JBEA 1NWUA 1UH3A 4BZYA 2PWHA 1OT1A 1Q4NX 2VR5A 2WMIA 2V5DA 3QR3A 4A3HA 2RGMA 4MDOA 3AIUA 4Z2GA 4UZSA 1EXPA 4CU7A 2DSZA 3VO0A 1MQPA 3N11A 3VIJA 1UWSA 1OIMA 2X0HA 4V2XA 2XM2A 4PBGA 1NARA 7A3HA 2FHFA 4AMCA 3CZGA 1E4NA 4HP5A 2D22A 1J0KA 1KCLA 4NI3A 2W4XA 3CZKA 1HVQA 4AZHA 3FN9A 1UA3A 3VX0A 3VIOA 4F66A 4E2OA 2XIIA 3BAYA 4OKDA 2Y5EA 1AQ0A 1PX4A 5CSUA 5ABFB 2E8YA 1LG1A 4K68A 1E43A 3IANA 1QI0A 4B15A 3VDCA 3WQ8A 1UD6A 2WC7A 3NSMA 4AZ5A 1TVPA 4HA3A 4J27A 2VT0A 3IAPA 1J10A 3T2PA 2O9RA 2J79A 2XFRA 3ZIZA 4JFVA 3N15A 1JD7A 2JIWA 3KL0A 2XVLA 3DC0A 3ZJKA 3KWXA 3CBWA 2X09A 2E9BA 2W5FA 2WBKA 5IHRA 1E72M 5E0FA 1V3LA 5ECUA 2PWDA 2BY0A 3GBDA 4MAVA 3SCNA 1C8QA 2WHJA 1QI2A 5CPQA 2CBVA 1G1YA 3A4AA 1UUQA 3O2LA 2GUYA 3E1F1 3ARSA 3FHQA 3WENA 6CGTA 2CHNA 1KBKA 1BQCA 4H7VA 1VENA 2JF7A 3K1DA 3AIWA 2O9OA 4MADA 1U33A 2WCAA 3UEQA 1QBBA 4B3LA 3OA5A 4RE3A 3AS3A 3GXFA 5E70A 1UWTA 1V6UA 1BSIA 3FHAA 3D3AA 5F7UA 3WUGA 4FF5A 5LYRA 1EH9A 1PBGA 2XVPA 5DFAA 3VNZA 1EDGA 4ZXOA 4M82A 4BQ2A 3T08A 2JF6A 2OWWA 4JHOA 3W28A 1MQRA 5ABEA 2CEQA 3AQUA 2HVMA 3KL5A 2ZX8A 1HJVA 2VX7A 1HL8A 1A47A 3AOFA 4AEEA 3HU7A 1WB0A 2VL4A 3ZO9A 2J8FA 1TMQA 5JH8A 2O9PA 4WLCA 5EB8A 2E0PA 3K4DA 1VBUA 3HN3A 3CMJA 2WB5A 3W6MA 2QF8A 2ZX6A 2X8RA 3PZ9A 3VUPA 3ARTA 2WCSA 1AQMA 1J18A 3WFLA 4KWUA 3GXMA 5M5DA 1I1XA 3FXYA 2JFEX 1VEPA 5A6SA 1E5JA 1Q6CA 3EMZA 1Z32X 1CPUA 4H8UA 2D3LA 4QP0A 1R8LA 2ZUVA 2CPUA 4GQQA 4AD4A 3DYPA 3WDPP 1GQLA 1QI4A 3RDKA 4NSBA 4OOUA 2WYSA 4TXEA 2WVVB 2XSAA 2J4GA 1IV8A 1CXIA 2EPLX 3BAIA 1X1NA 4LYPA 1B3YA 4WIWA 1E40A 3ZMRA 4Q7NA 1V6YA 4DM1A 2VR4A 4GO9A 1B31A 3DHUA 2VMFA 5E6ZA 1TFVA 4MB1A 1ISWA 1E6XM 3SUUA 5A6BA 5CPSA 4TTUA 1UR4A 2J7HA 1DWHM 1RPKA 2V3EA 2C7FA 3PTMA 1GOQA 3AISA 1E0WA 4NRSA 1NOFA 5A1AA 3OGSA 3ARYA 5FOOA 5I79A 1VBRA 3WSUA 1ZB5A 3BAWA 4Q22A 1GZJA 3N04A 1DWGM 2C8NA 1US3A 3K8KA 1HX0A 3VMPA 1W9VA 3W25A 1JF5A 4GI9A 1V02E 2DH2A 3VD7A 5A6KA 4P7NA 1WZMA 5JUVA 4QLKA 1W91A 1DWJM 1UKPA 5CXPA 3NIYA 2WBGA 1HVXA 2X05A 3WNMA 1UOKA 1GOKA 1CGYA 1K9TA 2ZUMA 4FK9A 1JXKA 1M53A 3THDA 1XV8A 2YOCA 1L0PA 3SUVA 3EDJA 2VRKA 4AISA 4CUCA 2XHYA 1K9EA 5CG0A 3N17A 3AIQA 3B9AA 2VX4A 2WNWA 3CZEA 4X0NA 3JUGA 2VX6A 3F4VA 1XSJA 5A2BA 4ACZA 3WH5A 1H41A 3OB8A 1W9BM 2CESA 3M07A 5A8OA 4HMEA 4Z2LA 2ZXDA 1CEOA 2EQDA 2RGLA 3T2OA 4PRWA 2W66A 5BRPA 3ARXA 1J0HA 1CECA 1W3LA 2VCCA 5JIWA 4P7OA 1R7AA 4PTXA 1UKSA 1EHAA 4A4AA 3THCA 3DYMA 2ZUUA 1K9DA 4BA0A 3S2CA 1KWKA 4AY1A 4PMQA 1MW0A 1DEDA 3W81A 3B9DA 5A6MA 1V3IA 2BHYA 2W92A 3SCOA 4EE9A 3AIRA 1FA2A 2XM1A 3VGEA 3IK2A 4TX6A 1GW1A 3WNOA 2QMJA 4DUVA 4IUGA 2GK1A 3CO4A 4HMDA 3FW6A 2VQUA 3VIPA 1KXTA 4TVUA 1OSEA 4CD5A 3WIJA 1QI3A 4M29A 3U57A 5D8ZA 3WNPA 1OGBA 1VFOA 1BGGA 4LX4A 4GXPA 2VRQA 4DUXA 5JBFA 1U30A 2D0HA 4AD1A 4MDPA 3LMYA 3TTQA 5M17A 1BGAA 1E4MM 4AZCA 3WD4A 4P7QA 4W7UA 3SCVA 2YL5A 3CUFA 3PZNA 2WLZA 3NDZA 2CBIA 4KRUA 4PN2A 4GZJA 4D6DA 4B16A 4ZFMA 2QPSA 3UCQA 2YBTA 2VTFA 1FP9A 1V0MA 3ZM8A 2B31A 1JZ3A 3KZSA 4AZIA 2VCAA 1JI1A 4HU8A 2VZSA 1BLIA 2WMKA 4YHEA 3UR8A 2A3AA 3EBVA 1E15A 1GORA 5D9NA 3AS0A 5A8MA 3NYDA 2WVSA 3FNDA 1HKJA 1VFFA 1OD0A 1UH2A 5BYWA 4JFUA 1SMAA 3EMQA 5ABFA 4MB4A 4CU8A 3L4WA 1QHPA 5D4YA 1B1YA 1JD9A 1FOBA 2J7EA 1W1YA 4MNKA 3K8LA 2OYKA 1UZ4A 3WQ6A 2Y4SA 1JL8A 3AIVA 1JAKA 5AYIA 2XIBA 4IPNB 4MNJA 2PWGA 3WNKA 1E3XA 4B9YA 3IJ8A 5CQ1A 4UTFA 1Q6EA 1PPIA 4BQ3A 3BMWA 3AICA 3CLWA 1YQ2A 3WDJA 1Q6DA 4OJYA 2XPKA 1M7XA 3AMKA 1UWQA 4R27A 2WHLA 3EMCA 1WZLA 4CD7A 1JAEA 3B8SA 4U2YA 1NWRA 4EANA 3WUEA 5A6AA 2VURA 1ZU8A 3APGA 2ZWYA 3VGHA 2DIEA 4QCFA 3PBGA 5I2UA 1V02A 3VIGA 4PMUA 1VIWA 3VOCA 1B30A 1AVAA 1DTUA 4XZWA 1MFUA 1KCKA 4GI8A 5DMYA 5I5RA 4UQDA 1UD4A 1B2YA 2EPOA 4X0VA 3O9NA 3L4YA 3GYCA 1FFQA 1C90A 4X9YA 3WELA 1U2YA 1RP9A 3AIBA 3SCSA 2A3CA 3ZT7A 1MW2A 4YPJA 3WL0A 4UFJA 1UWRA 2ESCA 1JDAA 4UQBA 2ZWZA 3ARRA 2G3NA 1CXFA 1EGZA 1R87A 3ARPA 1E6ZA 5DEZA 1ZBVA 1UWUA 3WF0A 3A6OA 1PIFA 1E0XA 4CN1A 4H8HA 2DGAA 1BHGA 1JDDA 1OT2A 5DT7A 2WMFA 1XC6A 1DWAM 5KZ6A 5HXMA 1ODZA 2J7FA 2CKRA 3A3HA 3VGGA 1C8YA 5A3HA 5CZKA 4FMVA 3VIKA 2HISA 4HA4A 2J7DA 1VF8A 2XVGA 4W8AA 3MV01 1W1PA 1F4AA 1ZJBA 1K6AA 2TAAA 1IT0A 3N9KA 3UG4A 3NJ3A 4WK9A 1QNOA 4W89A 2NT0A 5E09A 4AW7A 3VDHA 1X6NA 4W7VA 1HNYA 1GOMA 2VJXA 1E1EA 3SUSA 4ZENA 2BS9A 4QCEA 3OLEA 3SEPA 3VILA 2YKKA 3AS2A 5EFFA 3ECQA 3VIIA 2WVVA 2WMHA 3OZOA 2WCGA 1OGSA 1V3KA 3U5UA 3NCOA 4PYSA 3F5KA 3WMSA 1PEZA 1XH0A 3PTQA 2G3JA 2WANA 1XHGA 3N1AA 1C93A 2QV4A 1K9FA 1G5AA 3WUFA 4AEFA 4D71A 1N82A 2CIPA 2JE8A 1QOXA 2PF0A 2YL6A 4OBSA 3ZR5A 2J8GA 4TVCA 1UD2A 2VZUA 4HOXA 4C7GA 3SCTA 4AZ7A 3VU2A 1JI2A 4DWSD 2WKLA 4W5UA 2UWFA 4CCCA 1XCWA 1D7FA 2YDRA 1JYNA 1HKIA 1UA7A 2XG9A 4ZXLA 2W61A 3AZRA 1V3HA 1CGVA 3KE0A 1LL6A 4JCMA 1ESWA 3T0AA 3OBAA 4CCEA 1G01A 3UG5A 3AHXA 2J77A 2WVTA 4GO8A 1HJUA 4CGTA 3VM5A 4JHZA 2XWDA 3WNNA 3WD2A 3T09A 3K46A 3RJXA 5FL1A 2ZUWA 1QHOA 1ISXA 3POCA 3TOPA 1QHZA 3WDQA 1J0JA 3WNLA 2YA1A 4WSKA 2GJXB 4S3JA 1W3HA 2CKSA 2XWEA 1BFNA 4LXFA 1JNEA 3RM8A 5D8WA 4HU0A 3VPLA 3NUKA 2BXYA 3WEOA 3D5HA 2VO5A 1GJWA 3AMGA 3CIVA 4JKLA 4M1RA 5A95A 1MYRA 1CXKA 4AD3A 1KXHA 1W3JA 1QNRA 2VZOA 1KFWA 4WKHA 1H3GA 4NF7A 3AYSA 1CLXA 2F8QA 1VJSA 1GHRA 2CBUA 2Z1KA 3F5JA 5LA0A 2CCRA 2WC3A 3HJEA 2NW0A 1KGUA 3M46A 3AZTA 3WQVA 4DM2A 3MUY1 1E5NA 5ABGA 1XGZA 3CUGA 2DPEA 4MJ4A 2E4TA 1B0IA 3O6AA 1GUVA 4E8DA 2WWDA 1L8NA 4QLJA 1ITCA 2YL9A 4J3UA 3WF3A 4Z2IA 4F79A 2YDSA 1E6PA 2XFYA 4TTGA 4EK7A 1H0GA 5CJ5A 1QNPA 3KL3A 4M56A 3MKKA 1KR1A 3A4WA 4MNLA 1E70M 2FH6A 1QW8A 1JGIA 1G0CA 1RH9A 1H2JA 4XZBA 4IPLA 3WL1A 1AMYA 3N12A 3W29A 2D1ZA 4LPCA 2Y8VA 3WH8A 4JCLA 5M03A 3VDAA 3CUHA 1EA9C 4MPKA 5FD0A 2GJRA 4IISA 1IZJA 4HTYA 3ARVA 3WD3A 3SCPA 1G9HA 2WMIB 4AD2A 1O7AA 2CERA 2Z1SA 4W88A 3CZ8A 4J7RA 2BHUA 4GPNA 3CHFA 2D0FA 4MB3A 4PUEA 2V3DA 1JZ5A 1H5VA 5I6SA 3L2MA 4M8UA 2C0HA 4Z2HA 1IZKA 1HJXA 2AMGA 1OM0A 1X6LA 1KWGA 2DT0A 2D2OA 4GINA 1NWTA 2WW5A 4Z2JA 2Y2WA 1BYDA 4S3KA 5IFTA 1NM9A 3K8MA 2FHCA 4UR9A 4H8VA 4L4PA 3LPPA 1QNQA 5HOSA 3OZPA 2EO7A 5GNYA 3ALGA 3QGVA 4AZ6A 1SMDA 2W63A 3RIKA 2VC9A 3CPUA 2WKGA 3SCRA 1CDGA 2W67A 1HJWA 4JL1A 2MANA 4XX6A 4YHGA 4HA1A 2CXGA 2ZUTA 1G94A 2CBJA 1H49A 1BG4A 1CTNA 3AIEA 5HPOA 1EIBA 5JIPA 1TG7A 2WC4A 4H04A 3MMWA 2BVYA 1E6QM 8CGTA 1V0LA 4W5ZA 1EOMA 1KB3A 1JYXA 3AXHA 4HMCA 2YIHA 4AD0A 1B3WA 2XGBA 4F9DA 3QHOA 5A8PA 1NOUA 2XFFA 5HPCA 2WK2A 1CGXA 2DSWA 5A6BD 1E6RA 4MNMA 2EXOA 5DF0A 3FAWA 3BMVA 3WQWA 1V3JA 3RO8A 5D9PA 2VRJA 1DP0A 5CLTA 1NH6A 1XH1A 1M01A 3RPMA 1H4PA 2XVNA 2QHAA 3BSHA 2ZIDA 5ABHA 1CZ1A 4JKMA 4BQ5A 4J3XA 4UNIA 3BLKA 2VVNA 4CD8A 1HP4A 1R7OA 1EO7A 3T2QA 5FKYA 4GI6A 3QHNA 2D3NA 4D1IA 1GHSA 5A8QA 1E4LA 4TUFA 2EPNA 2Q8XA 3SIMA 1KBBA 5I77A 2BY2A 3VD4A 1VFUA 1JDCA 1WP6A 4CD6A 2CHOA 1UQZA 1ISYA 1UKTA 3U7VA 3BH4A 2FGLA 3LPOA 3PHAA 3AI0A 3UESA 2VUYA 1UR0A 1R85A 4TOQA 1XYFA 2EJ1A 3WH6A 1V0NA 4FLQA 3SUTA 4W86A 3IJ9A 2GVYA 1KQZA 4XUYA 1BPLB 1H1NA 4LGXA 1KGWA 2X0YA 2WMGA 3B9EA 1GVYA 2BVDA 3L4VA 3RILA 1M03A 5A2CA 4HZ6A 1EDTA 1ITXA 1VJZA 4E4PA 4BF7A 3G6LA 5BROA 1LWHA 3A4XA 4MJ2A 1JYVA 1WPCA 1MFVA 4U5IA 3GH5A 4PCSA 1RD6A 3QHMA 1QBAA 2BY1A 2W91A 3WQ4A 3WF2A 1W9PA 4AIEA 4PTMA 1UWIA 1CWYA 1UYQA 3ZR6A 1V08A 5LA2A 3MMDA 3AXIA 4DWSC 1GOIA 2OYMA 4UCFA 1XCXA 3WKZA 5CGTA 1R86A 2V5CA 4TVDA 1ECEA 1C7SA 1NQ6A 5C71A 4CD4A 4EKJA 2PWFA 1OB0A 3BAJA 4W85A 4P7LA 2ZE0A 1EQPA 2G4FA 3CUIA 4F8XA 3CHCA 3WEMA 3EDKA 3WN6A 1QVBA 3M6DA 5CPTA 3VGBA 1GCYA 5FIPA 2V3GA 1EO5A 4QAWA 3TTOA 2GDUA 4KGLA 2BXZA 1W9DM 2DH3A 2AAAA 2DEPA 4CVWA 3W38A 1WNOA 4BCEA 2QPUA 3LPGA 2CNCA 1BYBA 3UG3A 3VIHA 1OINA 1UKQA 3OG2A 1CGWA 2XTKA 3VM7A 2E3ZA 4QDMA 3VKKA 3EDEA 4LYQA 2UY2A 1JG9A 2EEXA 1EDQA 2NSXA 1BVZA 4N42A 2ZUNA 2J75A 3MSGA 1GQKA 5A2AA 1BVNP 3BLPX 4IM4A 4M24A 2WMJA 2WZHA 1W3KA 1M04A 4MTVA 3II1A 1ZBCA 1EQCA 4E8CA 4U5KA 2VVSA 2A3EA 2J7BA 4Z2KA 2X1IA 2WWCA 4AC1X 2DSVA 2VI0A 1VFMA 2WSPA 6A3HA 3WBEA 1OWQA 1GONA 4JFWA 1W9XA 1UD3A 4U31A 2EPMX 3CZLA 3ALFA 1JXJA 5BRQA 1XRVA 6TAAA 5I23A 4CCDA 1XSIA 3CUJA 4ACZB 4GZEA 3I3DA 3PZOA 2VCBA 3VNYA 3MSDA 3OLGA 4HOZA 4PSPA 7TAAA 2BY3A 2OSYA 3IAQA 4UOJA 3WF4A 5DT5A 2OSWA 1VEMA 3HMCA 5BXTA 3CH9A 1MXDA 1LQ0A 3GXIA 3W37A 2YL8A 3K4AA 2ZXBA 3DECA 4UFMA 1NWSA 1D3CA 4R5EA 4JAWA 1GOOA 1E71M 1UR9A 1BAGA 3I3EA 3ARQA 4U3AA 1A3HA 1CNVA 1J12A 2OWCA 5BXRA 4LQ1A 4U2ZA 1P6WA 4AYSA 3MUIA 3ARWA 1LF1A 2G41A 1HF6A 3W26A 3GBEA 1W32A 2GK1B 3T0DA 3AHZA 1SR0A 1GOWA 2BHZA 4OUEA 1MW3A 5A69A 2A3HA 1VAHA 2OLHA 1CXLA 1RP8A 5E0CA 4PUDA 1JIBA 1E3ZA 3VX1A 2ZOXA 2BFGA 5GPRA 1V03A 2WLYA 1Q6FA 1H11A 1VB9A 5HDRA 4AZCB 4H41A 3EDFA 3MUAA 3GZAA 1WDSA 2UY4A 1J0IA 2PC8A 2BVTA 3BSGA 1UR8A 1JZ8A 3L2LA 1UG6A 1OGGA 1FHLA 1F4HA 1JFXA 1UR2A 3FY1A 2D20A 1E56A 4FLOA 4OBRA 3BAKA 5A6LA 5HNNA 2VQTA 2G3IA 4PMYA 4KMQA 4J3WA 4D6CA 4PMZA 4Y7EA 5AY7A 4JZ5A 4D6EA 1CGUA 1UQYA 2OYLA 3ZJ7A 3WMCA 3DHPA 3TA9A 3AROA 4ZE5A 2YLAA 4D6IA 2D0GA 1VEOA 4GIAA 1I75A 2PBGA 2ZUSA 5KEZA 4U3CA 2CYGA 3PZIA 3BCDA 4CVUA 3GXDA 4AD5A 2A3BA 1WDQA 1W1VA 4B3KA 4D6HA 1CXHA 5E9AA 2W62A 3LPFA 2X2YA 1MW1A 2J78A 3AHTA 5FCZA 4D6JA 3VMOA 1C8XA 4PMNA 2DT2A 4AZBA 1Q6GA 1V6VA 3RM4A 1LL7A 3GH4A 2G3MA 1J0ZA 7CGTA 2JIEA 2J74A 2YBUA 3NSXA 4V27A 1KQYA 3PZGA 3MU7A 3TTYA 3TTSA 3KEHA 4M80A 1WKYA 3W53A 4ATDA 1JFHA 1QW9A 3QOKA 2F61A 1HL9A 3PZMA 4UFIA 3BXWA 1ZBKA 3BAXA 4F9JA 1TA3B 2WHMA 3VGFA 1D2KA 1B3ZA 2CETA 1V0KA 1W2PA 1YHTA 1GQIA 3I3BA 1OCQA 5BXSA 1E6NA 4P8UA 4UZUA 2UY5A 4P7RA 4PMRA 1B3XA 4TX8A 1CIUA 1PX3A 3UR7A 2IUZA 2QLYA 1UD8A 1GNXA 3L4TA 3CHDA 2XSBA 5EFDA 4GKLA 4GQRA 1OBAA 3VVGA 4QFUA 4OOZA 2YLLA 3GNOA 3PN8A 4RE4A 5CGMA 5EBAA 1LL4A 2DT1A 1E9LA 2NT1A 2JEPA 5IDIA 1MWOA 1XSKA 2QMKA 1PAMA 1JZ6A 1HN1A 2G8ZA 3MANA 1KGXA 4GZIA 3BC9A 5TD4A 3OGRA 4HZ8A 3ZSTA 3GM8A 3PZTA 3TONA 3AHYA 3U7BA 5DO8A 4DWSB 4CKQA 4DUWA 1AQHA 3VIFA 1ISZA 1V6WA 1QNSA 3ZT6A 1CYGA 2DT3A 2EBNA 1B90A 1E0VA 2V3FA 2XYLA 4P8VA 2D23A 4W8LA 4XV0A 3A47A 1C92A 4W93A 1HXJA 4PMXA 1E1FA 2YA0A 4L4OA 4URIA 4W8BA 3W82A 2DSKA 3WD1A 3RMEA 2WAGA 1C7TA 2V38A 4CN4A 1WO2A 5HBFA 2VOTA 5AC5A 1SYTA 3AJ7A 4D72A 4C7FA 3L4XA 3W27A 3BGAA 1TCMA 3NSNA 4NZCA 2PB1A 4XB3A 2GDVA 1PX8A 1WZAA 4PMVA 1GPFA 3AMCA 1OD8A 3M7SA 3OLIA 5BCAA 3VMNA 3IJ7A 3AHVA 5D9MA 1KXVA 2WZEA 4PSRA 5A6JA 1MQQA 5GNZA 2IXUA 1CBGA 1E4IA 2E9MA 3F5LA 4WF7A 1DWFM 4J3SA 2ZX9A 5I24A 4PTVA 2WPGA 1B3VA 2AOSA 2DIJA 3N18A 1ZL1A 2CITA 1TE1A 3VDBA 4UQAA 4PMOA 3WY1A 2XUCA 1FFRA 1W2VA 4AXNA 3VD3A 3NDYA 4LYRA 1LG2A 1UR1A 3MS8A 3WDHA 3VGDA 2JALA 4EAMA 2FDMA 3ZJ6A 2FGZA 4D1JA 3UERA 1WZKA 3G6MA 3WF1A 2JEQA 4WKAA 4C7DA 3W0KA 4KRTA 5I3DA 5I0DA 1GJUA 5I78A 1UH4A 2PBOA 1HJSA 4M81A 2GJPA 3EDDA 5C70A 4YN5A 3L4UA 2OWXA 5C8BB 3VD5A 3U5YA 3ZSSA 1E55A 1FH7A 1HP5A 3MUZ1 1TZ7A 5CSYA 3EYPA 3SUWA 4UFHA 4OIFA 3WUBA 3AXXA 2E8ZA 4W84A 2ZXAA 3PZVA 3CMGA 3QOMA 1ZBWA 2E40A 2ZX7A 5EMYA 1PIGA 3GTNA 3SCWA 3ZJ8A 2UY3A 5JBDA 1ODUA 2WZIA 5E6YA 3W6LA 3CTTA 3OIHA 1FP8A 1PZ3A 2WM0A 4PTWA 3OGVA 4MB5A 4PEEA 1US2A 5GQBA 3WBAA 4PCTA 4CN6A 8A3HA 3N13A 1C3FA 1CXEA 2Y24A 4FLSA 1HKKA 1UZ1A 1WDRA 1TUXA 3AMLA 3AFBA 3WDIA 1BG9A 3CGTA 5CLWA 1EOKA 2IXVA 1E6SM 3GNRA 1VRXA 4RE2A 4P8XA 3VINA 1FHDA 3PZQA 3J7HA 3PZUA 1WE5A 2GFTA 2FHBA 1LJYA 1ISVA 3WMBA 1ZS2A 4KGJA 1SFSA 4HPHA 1LLOA 3SCUA 1CGTA 4UQ9A 2VZVA 3S6TA 1NP0A 3ARUA 1JZ4A 2O9TA 2XVKA 4D6GA 1NOWA 4ML4A 5GNXA 2WXDM 3PTKA 1QPKA 1XD0A 4JL2A 1XD1A 2WVUA 4ZEPA 2XJ7A 5M3WA 5AYBA 3AYRA 1UKOA 2ZICA 4J3VA 3RCNA 2J47A 1J0YA 2Y8KA 4JKKA 1TVNA 4UFLA 4JIEA 3T0BA 2OSXA 2J7CA 2DSUA 3RJYA 3TP4A 1MVYA 3UETA 1KR0A 4NRRA 2DDXA 1WDPA 4UQCA 4A3YA 4ATWA 3CZJA 3W4RA 1W9UA 1BYCA 1NP2A 4MAZA 4UQEA 4PMDA 1HIZA 2PWEA 3ZQ9A
chains in the Genus database with same CATH superfamily
3IIPA 2DQWA 2RUQA 1JZ2A 1AJ0A 3MO7A 3AS1A 1V6XA 3VD9A 1TV5A 1K7FA 3TH6A 2FTPA 3GNPA 4RL3A 2XH7A 1UHVA 3UYCA 3IPWA 4WKFA 3GUWA 1TYGA 2PCEA 1LWJA 1HG3A 1ZJAA 3WEZA 1L1PA 1SZRA 1EXBA 1GQJA 4O19A 4B9ZA 3SQLA 3TJIA 1A4LA 2Z6JA 2D24A 1H09A 4O1AA 1EZWA 1PCKA 4F4RA 1QI5A 1H0IA 2YA2A 4ZQRA 2QUNA 2TSYA 2WSRA 3T6CA 1RVGA 3M5XA 1S5WA 3O5QA 1CW2A 3H26A 3UP8A 5BXPA 4W7WA 3L4ZA 1C91A 4XD3A 5EMMA 1VR6A 3GZ3A 3L2IA 2DV0A 1BTCA 4QZVB 4UOZA 2G3FA 1NMVA 2HCVA 4PL2A 3WLMA 2M2AA 1GVIA 4LB4A 3BICA 3IVTA 2CW6A 3ZT5A 3LSBA 1JNDA 4AC7C 2Q8ZA 4HU4A 2TMDA 3GC5A 3MWCA 3AZSA 5FL0A 1EWDA 5EGRA 3WLRA 1A49A 2GWGA 2KE0A 3QFWA 1B9ZA 4JTRA 3RCMA 4CNTA 3PJXA 2QJHA 4L3NA 1EJ7L 2IQTA 4W9QA 1JJKA 5IOBA 4J3TA 3MDYB 1EEPA 3K13A 2C19A 5HA7A 4QE1A 4QX4A 1WAWA 1F07A 4I5UA 1UD5A 5D30A 1OK4A 4LUSA 3UBPC 1EHNA 4KQZA 1J11A 4RW3A 3WD0A 4RV3A 3BURA 4HZ7A 4WJ8A 4A2SA 1T96A 3BSMA 1W5OA 1Y7VA 2I57A 4FNSA 3I4KA 3ZOAA 1NF7A 2PAJA 4DWSA 4QSHA 2O92A 4NP7A 1JCHB 1AODA 3OOQA 4QISA 5JBEA 2VR5A 3B8WA 3F03K 3QR3A 3PR9A 2J6VA 4A3HA 3GG8A 4UUIA 1XIJA 4UZSA 4TU1A 3C5QA 3T05A 2RSEA 2X0HA 1SQ7A 3EX4A 2XH4A 4PBGA 1NARA 7A3HA 3S0CA 2FHFA 3P7YA 4AMCA 4JXCA 3DFYA 1HO1A 4BF5A 1EYMA 1J0KA 3FIGA 3DCPA 3VNKA 2W4XA 1XIFA 1H51A 3PPHA 3QV8A 2D9FA 2A3LA 4FZIA 2IS7A 1AQ0A 4NZ1A 5CSUA 2OFJA 1LG1A 3CEPA 3RYSA 4IPIA 5J5RA 5MHBA 3TYDA 5T9BG 3NFUA 3G77A 2PDJA 4QIUA 3WQ8A 2WC7A 4AZ5A 2NQJA 5E93A 2PEVA 4HA3A 3W6YA 1NU5A 1HUVA 3CAQA 2XFRA 3ZIZA 4JFVA 3ABXA 1E44A 3NEHA 4M51A 2QCNA 1TMLA 3KWXA 3KZPA 2E9BA 4CEXC 1ZAIA 1BD0A 3G1SA 4LEFA 4FO4A 4IMDA 3SCNA 3V0SA 5CPQA 2CBVA 3A4AA 3GUGA 1FKBA 1TPH1 1OFRA 5A5WA 1KFKA 3BOLA 1KBKA 3PWGA 3DAQA 3WJZA 2YW4A 4AG0A 2NQ9A 2AGTA 4MPQA 4H7VA 1VENA 2XINA 2NUXA 4NNCA 1U33A 3AAMA 3UEQA 4UIOA 3GXFA 4JNMA 3OTRA 1T40A 1UWTA 2ZR5A 4AY8A 3FHAA 3ABQA 3WUGA 4FF5A 5LYRA 5A6TC 1PBGA 1WXZA 1EDGA 5HWJA 1LUCA 4F0LA 3SGZA 3T08A 5F4XA 2OWWA 3W28A 5K4XA 2FFCA 1MQRA 5ABEA 3TROA 1EQ3A 2HVMA 4ADUA 4DAFA 1P1XA 2ZX8A 2CLMA 1QOPA 4AEEA 1TMHA 2VL4A 9RUBA 5BXJA 3KOZA 1VH7A 1S38A 4B5NA 5JH8A 2O9PA 3FDGA 2E0PA 1XLIA 4C6JA 1XYBA 1VBUA 2UZ9A 4X3ZA 1JNTA 2Y63A 4B5SA 2NLYA 1LBLA 2PGFA 3QXBA 3HGRA 2X8RA 4G7FA 1Z89A 3PF3A 3NI6A 2GGJA 4JN7A 4CQDA 3IJIA 4PB5A 4HBEA 1SM9A 4C65A 3KLLA 3FXYA 1VEPA 3C52A 5A6SA 1ZJHA 1QPQA 4C02B 1Z32X 3TSDA 4H8UA 3N2MA 4ZR8A 2ZUVA 1YE4A 2INZA 2OOGA 2ZFAA 4RDYA 2P10A 3BAIA 2EPLX 3C0JA 1E0UA 4WIWA 4DM1A 2VR4A 2VMFA 3Q94A 4MB1A 1PB0A 5KTLA 5A6BA 2QCLA 1VFHA 1UR3M 1RPKA 1F6PA 1P5BA 3ERPA 1MI3A 4LAOA 3BE7A 3TW6A 4YVVA 3CGMA 2PMQA 3O5RA 4N6FA 3I65A 3N04A 1DWGM 2C8NA 3NXFA 1US3A 1W9VA 3W25A 3VOHA 4L9ZA 1GKQA 3QMSA 4XKYA 5HW8A 4U28A 4PA8A 3EXTA 4DRPA 4B92A 2GWNA 5CXPA 2X05A 1HVXA 4OV4A 3WNMA 1WQ5A 2MLXA 3C0QA 1UOKA 3H7UA 2ZUMA 3E2QA 1XV8A 3ZLHA 2Q01A 3W1AA 1XI3A 3W7RA 4PRRA 1AW1A 1SPQA 3AIQA 3B9AA 1ZAJA 2WNWA 1M6JA 3IVSA 3ZR4A 4DJDA 1XDJA 2VX6A 4GUHA 1YEYA 1YE6A 1H41A 5DO2A 3R4IA 2OFNA 4HMEA 5BOOA 1ICSA 5D37A 3CV2A 5BRPA 4A8IA 4P7OA 3W22A 4M1BA 3PK7A 4M19A 1BKHA 4HHHA 3S2CA 1KWKA 3UQNA 3TR9A 4PMQA 3DG6A 1DEDA 3SCOA 4F0MA 5FF3A 3AIRA 3VGEA 3IK2A 1FKIA 2QMJA 3BGGA 5C9WA 2GK1A 4DJEC 3C2RA 2VQUA 2JGYA 3PJUA 4C6NA 4Q6XA 2QJMA 4MWAC 3LCGA 1SW3A 4M29A 3JYMA 3ANUA 1OGBA 8TIMA 3UFYA 5HWBA 1F40A 1YPXA 4DUXA 3G1VA 2YYUA 2EG6A 3QY6A 4QAIA 3E0WA 1YPFA 3WD4A 4RPPA 2N87A 4G2DA 1ZAHA 2WLZA 2CBIA 2G97A 1PKNA 3BL3A 1J4IA 4KFNA 1OF6A 4ZFMA 2QPSA 3MQTA 3BLIA 3B04A 2C91A 2C15A 2VTFA 1V0MA 3ZM8A 2B31A 5M2FX 1JZ3A 3PSVA 3PULA 1L6YA 2VZSA 3O05A 1O95A 1DIOA 1BLIA 4GIVA 4QNWA 2HTMA 1RALA 4QG6A 2BGQA 1VS1A 2DZBA 3GVQA 1H1YA 1SMAA 5D4YA 5I98A 2FPYA 4AB4A 1K8XA 1F3XA 3L23A 2R1LA 2PDCA 4UTJA 1KM2A 2YPIA 1UZ4A 2V8ZA 2Y4SA 3HM7A 3N2CA 3AIVA 5AYIA 3HPXA 5GVJA 3ENLA 1E3XA 4IPJA 3SN4A 1QDSA 1GT8A 3U3HA 5D2VA 3M1ZA 2P3EA 4WRHA 3BMWA 3CLWA 4JYEA 3SBFA 3I7RA 3VFCA 1S5VA 2BVWA 1TTQA 1UWQA 4HNTA 2WHLA 5CKSA 2YX0A 4HCDA 1IQ8A 4GUFA 4CD7A 1JAEA 3CWHA 1Q7MA 3C0SA 2B7PA 3B9NA 5GJNA 3TN4A 2M1IA 4ZB5A 3CXOA 3UA3A 3B05A 3QTGA 2ZWYA 3A9IA 1SSGA 3PBGA 4GUGA 3VIGA 4PMUA 1HQTA 1VIWA 2ISFA 1B30A 1AVAA 1GOXA 1QTWA 4GFSA 4N6EA 1QFEA 2VN1A 2VFDA 2EPOA 3KX6A 4X9YA 1UJPA 2A3CA 2C1HA 3ZT7A 2O4QA 4YPJA 2BX7A 3FSTA 3WL0A 4LV4A 5C9RA 3QZEA 3CL6A 4ENLA 4UQBA 3NXLA 1M5WA 1E6ZA 1GYLA 3ZXWA 1PIFA 3O6CA 4H8HA 3P0WA 3WG6A 4AFYA 8XIMA 2J7FA 3UCCA 1FX6A 1ADOA 3KBNA 3FDKA 3VGGA 4FXSA 5REQA 2X1RA 3ABZA 2GSHA 1DJNA 3VIKA 4JTAA 1VF8A 1K6AA 2R14A 1IT0A 4WK9A 3TC3A 2VFFA 2RURA 2PDIA 3I68A 2I7GA 3GY1A 3N14A 1FKRA 1GOMA 2VJXA 1DOSA 1F3EA 4ZVJA 3RR1A 4H9MA 4QCEA 1TJ2A 3SEPA 2E67A 4LVAA 2YKKA 4LBRA 3ECQA 1XLEA 3L5AA 3L0KA 1V3KA 4AY7A 3F5KA 4NJJA 1OEPA 2A6LA 3PTQA 3UZXA 3URBA 1VGAA 1BSLA 4IQEA 4IMCA 2F21A 4L4LA 4KEVA 3A21A 2CIPA 1QOXA 2F6KA 3WLTA 4TVCA 3GTYX 2PODA 4HJFA 2IKHA 1IEQA 4JFKA 5JQ9A 1R6WA 2PDPA 4DLFA 1W3NA 2YDRA 1HKIA 2ZCGA 5CC6A 3AZRA 5FJIA 1CGVA 1LL6A 1FHUA 2J66A 2J77A 1AH0A 2WVTA 5LNWA 4NY2A 4CGTA 2RUSA 3VM5A 3M47A 3LENA 3UF9A 5FL1A 1QHOA 1SW0A 4DF1A 4F3HA 1Z48A 3S42A 1RZMA 1LRTA 4S3JA 2ZZ5A 3LXBA 3ZZ1A 5D8WA 4LFYA 3NUKA 3S83A 2AKZA 2VO5A 1KRBC 3PM6A 1K8ZA 4MLRA 3C0LA 4JKLA 4M1RA 4LUTB 1MYRA 4DNHA 2OZ0A 4YTRA 1CXKA 3E96A 2IPFA 3T8LA 1KXHA 1ONEA 4WKHA 3GDRA 1JVWA 4O52A 3KHJA 1CLXA 1L6SA 4RR4A 3UWZA 2F8QA 1VJSA 4JEQA 2RKXA 3PNZA 5LA0A 2WC3A 3GHRA 1YBQB 3WQVA 4DM2A 3MUY1 5E5CA 3DZ1A 2E5DA 4LY8A 3CUGA 1XPYA 2E4TA 1ZK6A 1B0IA 2DW7A 4E8DA 4QLJA 1A5SA 1ITCA 2C71A 1H0GA 7REQA 3GG7A 4I5XA 4NJHA 4NXKA 3A4WA 1E1CA 2ZE3A 3KLKA 1E70M 5HTGA 2FH6A 5HQLA 1QW8A 2MNRA 3DFOA 1RH9A 4PZVA 4EPKA 2XP6A 1H50A 2YB1A 2CZFA 8RUCA 1AMYA 1VLIA 3K1GA 4LPCA 2Y8VA 4XISA 3CUHA 2FVKA 1IWPA 3WD3A 1G9HA 1P4CA 2ZC8A 4AD2A 2CERA 1SGJA 3CZ8A 2FJUB 4L4MA 1JGMA 4YCOA 4M0XA 2CZVA 4XD6A 4E0CA 4MB3A 4MGVA 4PUEA 3A22A 2NXIA 4O50A 4A6GA 1JZ5A 3JR2A 3HG5A 1F3WA 3JRKA 4LEQA 4R9OA 1HJXA 4LBSA 3ME3A 2BB0A 1KWGA 3PG8A 3JXVA 4IIFA 2I9UA 3GXNA 1J4EA 1WBHA 2WW5A 4Z2JA 3Q4DA 3G3MA 4G56A 5LKYA 1NM9A 3M6YA 3LPPA 3GR8A 3OZPA 3W1QA 4B4FA 2FPVA 2J27A 3QV9A 2INFA 2TRSA 4KWSA 4LB3A 3KADA 3CPUA 2Z25A 3IS4A 5DN1A 1HJWA 4JL1A 4XX6A 4IF2A 2P4VA 4HA1A 5B8IC 4UMCA 1G94A 2ZUTA 2CBJA 3ZLFA 1ADSA 2QIIA 1EIBA 3AYVA 5JIPA 3DDMA 4WR3A 4UTUA 1ROUA 4YTSA 4W5ZA 1S2WA 2C18A 2NXHA 3SFKA 4AD0A 1CB7B 2PPOA 4F9DA 5LSMA 1NOUA 3H4WA 2YR1A 4C6FA 2XFFA 3G0UA 5HPCA 2WK2A 3W1PA 4MNMA 1H60A 3BMXA 3VZYA 3BMVA 3PPGA 3WQWA 3GFYA 3PWAA 4J4NA 4B5VA 3W2NA 3WLNA 2VCDA 4HPJA 4XTDA 5ABHA 3V36A 3SRFA 4JKMA 3FS2A 4UNIA 1XYCA 3BLKA 2VVNA 4JOMA 4I5RA 5FKYA 2G0WA 1ZFJA 4BF9A 5A8QA 4LH8A 3QW4B 1PINA 3SIMA 3UWEA 2VDIA 5I77A 4GOAA 1JDCA 1CCWB 1QJWA 5FJJA 3KWSA 4AX7A 2CHOA 1ISYA 1UKTA 4LAWA 3LLFA 3G0XA 3BMBA 1P43A 3AI0A 4TOQA 2GUBA 1W5MA 2XIMA 5AYZA 3P5YA 4W86A 2Z4GA 1W5QA 5ENLA 5LXEA 4LF1A 3BW4A 1BPLB 1H1NA 2QV5A 2X0YA 3KRBA 4US5A 3GTFA 1TKKA 4DO5A 3VNJA 1VZWA 3AU2A 1LT7A 5A2CA 1XFCA 4Z0JA 1VJZA 4X60A 6PTDA 4BF7A 3G6LA 5BROA 3A4XA 4MJ2A 4U5IA 4BFAA 4PCSA 1R2RA 4JYDA 2BY1A 2BOGX 2HE8A 3WQ4A 1W9PA 1UWIA 2E25A 3IV8A 5EMJA 3OHIA 4M5PA 4AH7A 3PANA 4DWSC 1GOIA 4ZL1A 2FMNA 4UCFA 3WKZA 2C0AA 1R86A 3S9IA 3H9RB 3OODA 3M9YA 4WY0F 5C71A 2VEPA 4CD4A 4EKJA 4Q3MA 1J6PA 3CHCA 4U4MA 1F6KA 2WQPA 3G24A 1QVBA 5CPTA 1VJIA 4ZOBA 5FIPA 4DXXA 2A6NA 4WDWA 2GDUA 4KGLA 1W9DM 2I1OA 5DY2A 5CPOA 3BDKA 2ZZ3A 1I2QA 3LPGA 3BQ6A 3TSBA 2ZQUA 4JTSA 5G2WA 3OQEA 1OINA 3R79A 2O0TA 3OG2A 2XTKA 2DVXA 4ILSA 3ZLGA 1FKHA 4QDMA 2UY2A 1UBSA 4FIQA 4N42A 2NSXA 1GVSA 3QQ1A 4QR6A 4JYFA 1LBFA 4S23A 1IYXA 3B8IA 1G7VA 3TNOA 1OX4A 2WMJA 4WOZA 3TDFA 2WZHA 3E49A 4HPNA 1BXCA 1M9HA 2R1PA 1W1B1 1T7LA 1BWVA 2PURA 1OJXA 2HZGA 3MP4A 4F0KA 3QZAA 2F38A 1SFLA 2OB3A 4GIEA 4HZMA 4MKVA 4XAYA 1GONA 4L1GA 1W9XA 1B57A 3WQEA 4GJIA 3SI9A 2EPMX 4FALA 3A12A 1JXJA 3W1TA 1ZP3A 4NAEA 4HNNA 1AW5A 4CCDA 1XSIA 3CUJA 4I9TA 4XAFA 5J5DA 2OT0A 3MT1A 2DUZA 5G4HC 4U84A 2BY3A 2OSYA 4LUTA 4M7TA 3WF4A 2ZZ1A 3ITGA 3R43A 5DT5A 3NQBA 2OSWA 2OJPA 3WJWA 3GXIA 2YL8A 4ICNA 4D8LA 4ORIA 4DX3A 5C0QA 5HINA 3PVFA 1UR9A 1BAGA 2PZ0A 5AYXA 3EX2A 1A3HA 4RDZA 2KX9A 3UPMA 4U2ZA 2PWVA 4Q4KA 2ICSA 1LF1A 2PTXA 2IF4A 3W26A 3DFQA 3UWQA 3CH0A 3NQGA 3H23A 3EOSA 3AHZA 4D2JA 3I6EA 1JUKA 1MW3A 5A69A 1Z3NA 1BRLB 1YYAA 3T78A 3UWVA 2OX1A 1KTNA 4JPGA 1XIEA 4FF7A 3TQPA 3R8HA 3VX1A 4MSSA 3NQ8A 4NYUA 3IJLA 5HNRA 5GPRA 1V03A 2OZTA 3EOUA 1Q6FA 3PUGA 4HHPA 4E2DA 3IRDA 3IUDA 2P0IA 4F0SA 1DIEA 4DRJA 3EDFA 3IIXA 3NURA 3GZAA 2PC8A 1AA1B 1XM3A 2BVTA 3H2OA 1UR8A 1R3RA 4LC8A 1YXDA 1UG6A 2Q09A 2PTDA 3GNDA 1W0MA 4L65A 1R2SA 2XH2A 2DJXA 4OBRA 3E2RA 3KTCA 2PDLA 3O6YX 4KMQA 4DBEA 4Y7EA 4PUKA 1H7OA 1UQYA 4IMAA 2YZRA 2WSYA 4O4VA 1RBOB 5SWUA 1T99A 3WMCA 3DHPA 3TA9A 5AHEA 4PFMA 3OBEA 2EULA 3P2VA 2EJAA 4IIGA 2D0GA 3GD6A 3NWRA 1I75A 1SZNA 5GJMA 2GDQA 5D05A 4DRKA 1RXOB 3GXDA 4O4WA 4AD5A 1W1VA 4B3KA 3GFZA 2E6DA 1CXHA 1EJSC 5K4ZA 2X2YA 4RNFA 4D6JA 4LAYA 1OFOA 2AQWA 2V63A 3H55A 4LNCA 3W86A 3W2LA 3FKKA 1FJDA 1TO3A 3CC1A 2JIEA 2YBUA 1NDWA 1Q6QA 2HBXA 4IX0A 3PZGA 3TTYA 4KERA 4DT4A 3TTSA 4JS3A 4ATDA 5IBXA 4GBDA 1XP3A 1GRJA 1R46A 1TREA 4FAPA 4AAJA 1M7OA 4LCRA 7ODCA 1ZRQA 3EB4A 2DZAA 5MF5A 4PUNA 3O5KA 3I3BA 2I17A 3QZ6A 2TPSA 3KS5A 4O0ZA 1LRNA 4A22A 3EEGA 2IUZA 4Q4RA 1UD8A 3EWXA 1R3VA 4LOCA 3CHDA 3PB0A 4AWSA 3S5SA 2XSBA 5EFDA 3UW6A 4GQRA 2Z7KA 4OGZA 2PP3A 6XIMA 4Q32A 1LL4A 4MMWA 1HKWA 2JEPA 4PTDA 2RUDA 2VWTA 3LU2A 5CSRA 1PAMA 1VPQA 1JZ6A 1HN1A 1FRBA 3PUOA 3U2CA 3USZA 3ZWTA 1VYPX 2FKPA 3GVGA 4HZ8A 1Q2RA 2OZ3A 1XGDA 3AO0A 1Q6UA 4K1WA 5DIVA 4NHVA 4C90A 3EWWA 3L66A 5AB3A 1I6NA 1ISZA 3G1FA 2VEMA 3CUXA 1CYGA 2DT3A 2DY3A 4G9PA 1SR9A 5C2GA 2CLOA 2XYLA 2D23A 4XV0A 1J79A 4W93A 1HXJA 1LROA 3W1XA 1AH4A 3H2FA 1OABA 2RDXA 4URIA 3T4WA 3WQPA 2K8IA 2WJDA 3RMEA 4JY9A 3AWNA 4NG3A 1C7TA 3MJYA 2UV8G 4CN4A 4GE8A 5HK4A 2VOTA 4GYPA 5AC5A 4PE8A 1R3TA 3L4XA 4IT6A 3BGAA 2FIQA 2ISVA 2YXOA 2PB1A 2GDVA 4PMVA 1GPFA 2CLKA 3RF9A 1WA3A 4HK5A 2QQ6A 4DRSA 3S2LA 3K4WA 3M7SA 3OLIA 4KT2A 4R88A 4HCHA 1KCZA 4PL1A 2WZEA 3VCRA 3I4EA 5GNZA 1CBGA 3NPXA 3VOFA 1GQNA 4HD5A 2YCEA 2CLPA 4A35A 2CITA 1EJUC 3T07A 2VEGA 3H2CA 2VM8A 4AXNA 3NDYA 1LG2A 3MS8A 4WVXA 2FDMA 2FGZA 1M5YA 4D1JA 1KRCC 1GEQA 5T26A 3CUZA 4ERGA 1OCJA 4RK8A 1R3YA 2JEQA 4WKAA 1OZMA 3W0KA 2RJGA 1Q7QA 2PC4A 2QXWA 1GJUA 1UH4A 1UROA 2E7FA 1NEYA 4O11A 4M81A 4ODMA 3O3RA 5C70A 2ZA3A 4G50A 1HTIA 1YTEA 5C8BB 2XN0A 1KA9F 4ZCWA 1P6BA 3GC4A 1PHWA 1VCVA 4OIFA 4UFHA 2XGZA 3DI1A 3QOMA 2PFHA 1ZBWA 1TPC1 2BLEA 2E5CA 2XH0A 2UY3A 5L6UA 1ODUA 4OU1A 3W6LA 5CZJA 3GE7A 3O5PA 1PBKA 1ONWA 4GISA 4IGSA 3MTWA 4X22A 4QIBA 3WBAA 1TX2A 3K30A 5CJMA 2QGHA 1VC4A 1C3FA 1CXEA 3QJAA 2Y24A 4QROA 3QBUA 1TUXA 3AMLA 5H91A 3AFBA 2HJPA 5G1MA 1BG9A 5CBJA 3QY7A 3AXKA 1YKWA 5CPMA 3S5OA 1E6SM 4QHRA 5F1VA 5XIAA 1NSJA 3AJXA 1FHDA 3PZUA 1AL7A 2FHBA 3ZYZA 1LJYA 1ISVA 3ONBA 4K8GA 2A79A 1ZS2A 1TJ0A 3VCCA 1XLCA 4HPHA 1LLOA 1BRLA 1LOLA 1CGTA 3M0HA 1NP0A 4A3RA 3GYEA 3SN0A 4ZS6A 1F2JA 4Y2WA 1Z9AA 3E74A 4JL2A 1MNZA 1XD1A 3N6QA 4ZEPA 5AYBA 2FVMA 2QEZA 3E2VA 1J0YA 5G5IA 5LGXA 5BRBA 3LLXA 3NO5A 2DSUA 3UYIA 1KR0A 2PV2A 4JTUA 3S47A 3TQKA 3W4RA 1FWDC 1BYCA 4GCXA 1FDJA 4UQEA 3H54A 4PMDA 1KKOA 1LYXA 2ISDA 4O57A 2E1DA 2CZDA 3ITOA 2FLIA 3OEXA 2EPKX 4POCA 2WHKA 4UDMA 3DIPA 3OU8A 1TR1A 4ZE4A 4FNRA 4KH2A 2V6AA 5IXEA 5AC4A 1S3TC 3POHA 1KV5A 3ID7A 1ADDA 4YXGA 2ZXQA 3KOYA 1WCGA 4C6EA 3XINA 3MV11 8XIAA 3NVTA 3EGJA 1XC4A 1HT6A 3SURA 1W1TA 3EPNA 1DIKA 2VZTA 3GB6A 5A94A 5HKGA 2J7GA 3EWDA 5G4EA 3T1GA 4MZYA 3MO4A 9CGTA 2ADAA 1ZLPA 3WDRA 2I56A 3VC6A 3ANYA 2YSWA 3VIMA 4MY1A 5FEXA 2IPGA 1FWJC 4V28A 4PB4A 4GQGA 4P8WA 5IDZA 5KITA 5DANA 3S3GA 4IL2A 4WXZA 1POJA 1A7XA 1SW7A 2E9LA 4ZFCA 3GU9A 1KD0A 1RHCA 1J01A 4O15A 1MXGA 1O94A 4ATLA 1FWSA 4JY8A 3MHFA 3NO1A 4CU6A 3OQ8A 3MMUA 1K70A 5HMEA 5H8PA 2V82A 1M1BA 3UJSA 3GDKA 1CT5A 2OGJA 5M1TA 3WH7A 4GBUA 4H2CA 4HPGA 4U33A 4RV8A 1L6GA 4FXRA 1BF2A 1BKSA 1OFEA 4WJXA 1DXEA 1YMYA 3M0YA 3DG3A 3EB2A 5HQMA 2E28A 1EGVA 1S3HA 1PTDA 1PJ9A 2RJHA 5DXXA 4ACYA 1FWFC 3RRAA 1V77A 2PSNA 3HPAA 3KS6A 3E02A 3RM9A 4AYGA 4BZYA 4Y96A 3A4JA 1Q4NX 2WMIA 2V5DA 1JCMP 2RGMA 4RW5A 1EXPA 4NJKA 3VO0A 3P61A 1KNWA 3QW3A 1OIMA 2XIOA 2XM2A 5LNUA 4DZAA 4ZMGA 5U4NA 2OQHA 3LHVA 4HP5A 4G1NA 3W7LA 4NU7A 3EIPA 3SZ8A 2VGIA 1KCLA 3HBLA 1NFGA 3CZKA 4MGGA 4TR9A 3CPGA 3OHMB 3QPZA 4F66A 3A5FA 4E2OA 1FWHC 4LAMA 5ABFB 2E8YA 3UI4A 1D9EA 4OE7A 4LAKA 2C1GA 2HS6A 2PA6A 5IRPA 3VDCA 1JCNA 2KI3A 1MDLA 1UD6A 3NSMA 2XP4A 3IAPA 3T42A 1ML1A 4E3TA 1EUNA 2OGYA 4AF0B 3DC0A 3KVJA 2X09A 3GRIA 2Y5JA 5IHRA 1UOZA 2FZBA 1V3LA 5ECUA 2PWDA 1DJIA 4JFLA 2BY0A 3BLLA 4I9JA 4H9VA 3GSMA 1PVNA 4W9OA 4DXVA 2WHJA 1G1YA 3OW1A 4XK2A 3W88A 1UUQA 2O56A 3PJWA 3ARSA 6CGTA 5C9ZA 3HPZA 1BQCA 3F4CA 2B7NA 3PR2A 3WLOA 3UI5A 3K1DA 3WLKX 3BOXA 1X1OA 3KBVA 1QBBA 4RE3A 5D38A 3IHZA 5BZAA 5F7UA 1EH9A 2GQ8A 1H62A 4PCNA 5DFAA 4M82A 3ORWA 1FWIC 4LT9A 4UTWA 1W56A 4JHOA 3P74A 3O5FA 4YIWA 1KFCA 5AC7A 4RDWA 2O7SA 3WQOA 5GPGA 2R1KA 1B5TA 4A8RA 9XIAA 4RZ5A 1ZSXA 4MKNA 3W1UA 2GOUA 4IG2B 3STEA 4R33A 5PTDA 4TQTA 2NX3A 1WB0A 4BI6A 4CNUA 3LK6A 3V5CA 2J8FA 3R10A 4MWAB 3RAOA 2FZ9A 5EKYA 1TMQA 4MSPA 2YDAA 2XISA 3W7PA 1WKEA 3K4DA 4LV9A 2BMBA 1O68A 1KM3A 1DKWA 3LGEA 2WB5A 1KM6A 3PZ9A 3VUPA 4YS1A 4R53A 2WCSA 3FJLA 4WQ6A 4KWUA 4YMZA 2JFEX 3GDMA 1XX1A 5MKGB 1Q6CA 1FWAC 4CLMA 4V1XA 1R8LA 5C7HA 4F40A 3TFXA 4HA0A 1TPUA 1XRFA 3UQBA 1XXXA 3DYPA 3RU8X 1EJWC 4LAZA 1ZGDA 1IIHA 4NSBA 3HJZA 4OOUA 1Q63A 3VA8A 2DZPA 3EOOA 2XSAA 4HN4A 1RPXA 2CZEA 2ZTJA 2Y8UA 1B3YA 3ZMRA 1K02A 3TW9A 4GO9A 5TIMA 1VBJA 1ISWA 3QV7A 3GXTA 3V35A 1FCUA 3V5OA 3PTMA 3LRMA 1GOQA 3AISA 3V75A 1NOFA 4PTNA 4UB9A 3A9BA 1RJRA 2GL5A 3ARYA 4AU0A 4WUIA 5I79A 1VBRA 3P81A 3CQ0A 1C8VA 4KIRA 5AFDA 3OVPA 4JDBA 1K4GA 1P1MA 3BLOA 3WSUA 1ZB5A 3BAWA 2ALRA 1GZJA 1YRRA 4AHQA 3NDOA 4R7OA 4BK9A 4XVDA 4GI9A 5K7JA 3U2EA 2DH2A 3VD7A 2ZC1A 3CQKA 4GUIA 2PDUA 4P7NA 4FNTA 3H4XA 4H6KA 3B9OA 5LGZA 4RKAA 1UKPA 1EF2A 1R9ZA 3INPA 4NNRA 1PDZA 2EGZA 3KP0A 1K9TA 1JXKA 3THDA 3TV8A 3NZPA 3AWOA 3MHGA 4FX7A 2YOCA 3STPA 3LLDA 3SUVA 3EDJA 3TR2A 1GVRA 3KZ7A 1XQLA 2VGFA 2MLZA 3S6OA 3CZEA 4MVAA 4HQVA 3IVUA 4K36A 4J40A 1EJTC 1F7BA 4NZ3A 4ACZA 5A2BA 3PTDA 2CESA 3NA8A 3IUIA 5DRCA 2BTMA 2ZXDA 2EQDA 3XISA 2RGLA 1A0EA 4Y6GA 1ICQA 1KM4A 1MZHA 4F0HA 3S1GA 5FA5A 5D75A 5I09A 2PLKA 3GIQA 1OF8A 2VCCA 2QDDA 1EHAA 4A4AA 4PRTA 2ZUUA 4TO8A 1MW0A 2W92A 2ABAA 4BI7A 4EE9A 4YNGA 2HXTA 4G7EA 3FEMA 3SN1A 3GVWA 3LA4A 3WNOA 1UWAA 2H9AA 3NL5A 3TMLA 2WSQA 4JX5A 3HGJA 4A21A 4Z42C 2Q8LA 1KXTA 3DOPA 4TVUA 2CC0A 3LCWA 3THQA 2BZNA 3PA7A 5D8ZA 3FJNA 3FXGA 4JQ1A 2PU0A 4H8NA 4LUYA 4X9SA 1BGGA 4XSLA 1EFZA 1J8VA 4FX6M 5AYYA 2E68A 1RR2A 3WQCA 1E4MM 3B7XA 3G1DA 1N1AA 1DQXA 4W7UA 3PAOA 3SCVA 4NZ4A 3NDZA 4KRUA 3WQGA 2GVJA 4PN2A 1QPLA 4GZJA 2H6RA 1W8SA 4P5UA 4HK6A 2VHLA 3BW2A 4IPXA 4QRNA 1JI1A 4DF0A 3HFYA 4LF2A 3WO8A 2WMKA 3W2KA 3GIPA 2A3AA 1GORA 2DJLA 3AS0A 3GU1A 5A8MA 3VFLA 1IR1A 4GJJA 5ABFA 1JD9A 1ZCOA 2BOFX 1EIXA 1TWSA 4ECLA 2XIJA 3ITLA 3WQ6A 2PD5A 1XL9A 1JAKA 4GWEA 4IPNB 1GKPA 2Z29A 1NELA 4Q8WA 5FEZA 1VQTA 3BPWA 5CQ1A 2D69A 1JPIA 1PPIA 4D8AA 2PRMA 3N4EA 4AF0A 1JEZA 3KCJA 3WDJA 1Q6DA 4OJYA 5AHMA 1NIUA 2XPKA 4FOJA 1M7XA 1QATA 4ZTYA 6REQB 1WYIA 2Q3RA 3G18A 5D2TA 4R27A 3UJ2A 2WNZA 3OYZA 1P0EA 2VD8A 3BK0A 3RX3A 3MY9A 2YCLA 4U2YA 2DFAA 4PUUA 5LNSA 5DCDA 3TN3A 2PDMA 1KFLA 1IE7C 3DFTA 5H2ZA 4EANA 1ME9A 3F7JA 5A6AA 3OIXA 4A8NA 5IBXC 1G4PA 1W1IE 1ZP4A 5I2UA 4C5ZA 2I5GA 4XZWA 4GI8A 4HNVA 5I5RA 4UQDA 4BI5A 4EF8A 3O9NA 3L4YA 3GYCA 1WOBA 5AC8A 4JIPA 5KZEA 2C3ZA 1EB3A 3GWQA 3R8GA 1U2YA 1XKYA 1RJQA 4UTMA 2TYSA 5HQEA 4L1WA 2AL2B 4CQAA 1JDAA 1XIGA 2QJJA 3RGTA 2ZWZA 3ARRA 2G3NA 1CXFA 1EGZA 2VEIA 2C79A 3ARPA 4OT7A 4PEKA 1E0XA 2WM1A 3LHZA 4CN1A 5F2MA 4DJFC 1BHGA 3WBWA 4ES4A 1Z42A 3LGGA 2WMFA 1XC6A 3H12A 5HXMA 2CKRA 5A3HA 4N9EA 1S2CA 2ZYFA 2DVTA 2HPIA 2HISA 4HA4A 2J7DA 1D7HA 3W7HA 1RK5A 2QCHA 1F4AA 3NM3A 3IJ6A 2C14A 2WJZA 1DV7A 1O66A 5MKGA 1U22A 3GAYA 3QLLA 4W89A 5AHNA 5E09A 4AW7A 3TFCA 4WEVX 4W7VA 1HNYA 4JFIA 3SJNA 1FKGA 1H7WA 1TRDA 3IWPA 2BS9A 3OLEA 1S2TA 4Y9AA 3I6TA 2OX4A 5FF7A 2VDHA 1Q45A 3VIIA 3OZOA 2WCGA 1OGSA 1NFBA 4Q8VA 1IXOA 3EX3A 3U5UA 3WMSA 1K77A 4C91A 2G3JA 4DRHA 4GYPC 3R12A 1QCWA 4XSMA 1K9FA 3UQAA 3C2FA 3CEUA 4AEFA 4HBOA 4GGQA 1TX0A 2YL6A 1IZCA 3ZR5A 2J8GA 3B4YA 4UMBA 3DN5A 4GYKA 3GDTA 4QT2A 3VKCA 4W5UA 4K7YA 2UWFA 1XCWA 3MW7A 2W61A 2NLIA 3KE0A 4JCMA 1N2VA 4CCEA 1I2RA 1G01A 3MA8A 3UG5A 2PDQA 2XWDA 3W7MA 3R2GA 4IQLA 3WNNA 4U85A 3WD2A 3K46A 3CASA 3RJXA 3FJ4A 3W85A 3S1UA 5HUAA 1ISXA 5DBTA 3WNLA 3P82A 1O4UA 1V79A 4HU0A 3VPLA 2JKAA 3PRDA 1YTKA 3D5HA 4S2CA 3RXZA 4XO7A 3QTPA 2DZTA 4YTQA 3TU9A 2MNTA 1BWLA 3LN3A 1Z69A 2X41A 3AYSA 1QRQA 2DG3A 4LRTA 1L6FA 3HA1A 4IOTA 3MHUA 4GC4A 2Z1KA 4ONVA 3F5JA 1XIMA 2CCRA 3EWBX 3M46A 4N7QA 3F2DA 3LHYA 3LD5A 3H2AA 1XGZA 4NKCA 5ABGA 2DPEA 1ZJIA 4CQCA 4IFKA 1T8QA 5DQPA 4P61A 1XBYA 1GUVA 4O0KA 5FJUA 3N4FA 3MBFA 3V18A 4O1BA 4UMAA 4Z2IA 4TTGA 1E6PA 2OT1A 3TOYA 5D03A 3S6DA 4M56A 2H8XA 1MO0A 1KR1A 3VABA 4MNLA 4GJ1A 5I3KA 1EBHA 4QDWA 1BKFA 2D1ZA 4W4QA 5M03A 1IGSA 3TEVA 5FD0A 1IZJA 1KT1A 1TPEA 1UP3A 1NF0A 2J8TA 5JMUA 1O7AA 1HGWA 1FBAA 4W88A 1I0BA 1OY0A 2JK2A 2BHUA 2P8BA 3C86A 3W83A 2V3DA 3TVAA 1JQXA 3LI0A 3PFMA 4GY1A 2C0HA 4M8UA 4Z2HA 1KM1A 1VRDA 2WO5A 2DT0A 2DZXA 2D2OA 1DXIA 4LUIA 3I10A 3WLQA 3KOXA 5IFTA 5XIMA 1S2AA 4H8VA 2ZVRA 5I00A 3N6JA 5HOSA 2OZ8A 3SECA 3W75A 4AZ6A 2AQOA 1XYAA 4HKPA 4L6OA 4QBXA 3BG5A 3EZ4A 1SMDA 3TAKA 3P0XA 5HULA 3ES8A 1CDGA 3KXQA 5D32A 4YHGA 2CXGA 3WMLA 1CTNA 4RJEA 4NI8A 3AIEA 5HPOA 3BZGA 2ZZ2A 1JCLA 2ISSA 3LYEA 1D7KA 2R91A 2H90A 3MMWA 5U7SA 1SUXA 8CGTA 2KO7A 3NQAA 1JYXA 3F4WA 3FX4A 4IFOA 3O0FA 2YIHA 2QUTA 4AXKA 4XZLX 2XGBA 5KSWA 2GPTA 2ETNA 3LOTA 3HQ1A 3G1AA 1CGXA 1ZY9A 4QE4A 3FAWA 1U83A 2ZA1A 5D9PA 4O54A 4XIMA 3BJSA 2VENA 3QEZA 5XINA 4YVXA 1XH1A 4ROQA 4JNZA 1M01A 4DO7A 2FYMA 1FKLA 1T8XA 1IHIA 2QHAA 2XVNA 2AL1A 2Z7GA 1J5TA 4NNBA 1HP4A 4B5TA 1FD9A 1LUCB 3ODKA 3RUBL 4GACA 3MP5A 2Q8XA 4IP5A 5KINA 4Q6JA 3A23A 1KBBA 3O7UA 4Z1YA 1IEVA 3LXAA 1WP6A 1XPGA 1QZ2A 5AHLA 3GU0A 3IGUA 1B4KA 1FWNA 2V2DA 3LSCA 3U7VA 3PWIA 1IT8A 3QYSA 3BH4A 3LPOA 2EJ1A 1Q1CA 3BTNA 3MDWA 2PPNA 3UI6A 2GVYA 4XUYA 1O1HA 4LGXA 2PGWA 1UBPC 1EZ2A 3B9EA 3IKGA 3UY7A 3L4VA 4EVZA 2PP1A 1KFEA 3C8NA 1KV8A 2RH9A 1OG0A 3GNNA 1ITXA 5HR7A 1GZ1A 1LWHA 3CGNA 1WPCA 3SADA 3P60A 3GVRA 3NPVA 3GH5A 3QHMA 2OKOA 1K8CA 3WF2A 4AIEA 1EX5A 1QPRA 5LA2A 2G5WA 2PDHA 3Q58A 1XCXA 1A4MA 4NX0A 3VZZA 4NIRA 3BO9A 1ECEA 1C7SA 3C2YA 1YDYA 3WLIA 4JTQA 2PWFA 1OB0A 1WXJA 1FKXA 3BAJA 4UTLA 2ZE0A 2G4FA 4GXMA 4JDYA 2V3GA 2PDYA 4QAWA 2H3BA 2DH3A 2AAAA 3I7QA 3W38A 5KZMA 1WNOA 1J2BA 4BCEA 2IKIA 2ALDA 5ABTA 3MBDA 3UG3A 1WBJA 1QMLA 1UIPA 1CGWA 1IXQA 1RCXB 4KS0A 3DKLA 1JG9A 5FSEC 1G4TA 1EDQA 4FB7A 1TSIA 2DORA 4KW2A 4I7VA 5T8GA 3DESA 1Q8JA 5KMYA 4BJHA 4Y9MA 1X1ZA 4XKYB 4UNLA 1YDVA 2V2CA 3B0VC 4M24A 3H7RA 1W3KA 1M04A 3R0DA 1IGWA 3QV6A 4A8LA 1T0OA 1XS2A 3WLLA 4QG9A 4QEEA 2PU1A 2VVSA 2J7BA 2X1IA 4KEMA 2RQSA 2ZADA 3G1YA 3THUA 5AKQA 1OWQA 1R3QA 2FDSA 2QPXA 4C6DA 5C55A 5DMLA 4U31A 4IJRA 6TAAA 4L56A 4AMAA 3TA6A 2VCBA 3MSDA 3OLGA 2HV5A 4PSPA 7TAAA 4KKXA 3IAQA 3RPDA 3N3TA 3IJDA 1E51A 1VEMA 4KEUA 4WSHA 3CH9A 1MXDA 1LQ0A 1N8WA 4XZ9A 3W37A 4GUJA 5EBUA 5CBBA 2BSLA 3LZ3A 4IGHA 4KBXA 1GOOA 4UTWC 3LMZA 3I3EA 2DUAA 5D02A 4LUJA 4U3AA 4XZIA 4Y90A 3BG9A 1ZNNA 1J12A 2OWCA 5L9FA 4GRSA 1P6WA 4AYSA 2X0SA 3P6LA 2G41A 4FP1A 2GK1B 4QJ1A 1SU5A 2PBCA 2J9XA 1XLLA 1YDNA 3CT7A 3W9ZA 4EX4A 2VP8A 2BHZA 4TV5A 3H70A 2OLHA 2DZVA 1RSCA 4PUDA 5BMWA 2CWXA 1R0MA 4BR1A 2PDGA 1TPDA 2BFGA 2WLYA 1H11A 5HDRA 3OA3A 3JYJA 1FWCC 3NYZA 4NZJA 4YYFA 4H41A 4HSOA 3WLJA 4K37A 3M0LA 1MEWA 4MLJA 1J0IA 3BLDA 2GLKA 1OX6A 2PLCA 3S2JA 3WFAA 1EBGA 4K8HA 1DQUA 4XVEA 4PR4A 1FHLA 1Y0OA 2VGGA 4M3PA 1E56A 5DIUA 1MNSA 3UR2A 4BWLC 3BAKA 5A6LA 5HNNA 2VQTA 4PMYA 1DIDA 3EY6A 3N73A 3PBMA 5HWCA 4D6CA 1EC8A 1SZEA 2Y88A 3SO7A 1B54A 5BU6A 1TTPA 3ZJ7A 2Y62A 4ZE5A 2B7QA 4D6IA 2EG8A 3DX5A 3BV4A 2PBGA 2ZUSA 2X1UA 4GA8A 5KEZA 4U3CA 5AOUA 2CYGA 3PZIA 3BCDA 1TB3A 1Q4WA 2A3BA 1WDQA 4QQUA 4DAIA 3WK3A 2R94A 5E9AA 2W62A 3LPFA 4RXGA 9XIMA 1MW1A 3VKJA 1C8XA 3QR1A 2DT2A 1SJBA 2Y78A 4AZBA 1V6VA 3SM0A 3GH4A 1LOSA 3HG3A 3KOWA 4A05A 7CGTA 3W7NA 1JR1A 4GIRA 1XICA 4MKSA 1ALDA 3PJTA 3B0XA 4ZA0A 4M80A 1WKYA 3FA3A 2KGJA 1QW9A 4E2BA 1G6CA 3PZMA 4WHBA 3CL7A 4H3DA 4UFIA 4F9JA 3IV3A 3U8GA 4RUBA 2WHMA 4J4OA 1V0KA 4ZGYA 3XIMA 4RZ6A 2PRHA 1OCQA 5BXSA 2QGYA 4RNIA 4UZUA 3LUOA 4P7RA 4TX8A 1YNQA 2WV8A 4NT0A 3UR7A 1PWMA 1VIZA 2QLYA 3EEZA 1GNXA 1U5VA 3VVGA 4QJ4B 4QFUA 4LVDA 4LS1A 3CK5A 4EWND 2Q02A 1Y0EA 2NQ5A 4I7WA 5EBAA 3KW3A 3L68A 4L80A 3G0SA 5LHEA 1MWOA 3DU0A 4H7ZA 5G1YA 1XSKA 3BLEA 4K1GA 1NQKA 3EOLA 2IW0A 3C4UA 2PTYA 1TCOC 4MG4A 4S3AA 4LNYA 5TD4A 4KCWA 5REQB 4L9XA 3R7MA 3TCSA 3P84A 4TW8A 1VFSA 1K7XA 5ECVA 2CZ5A 2QZRA 2XDFA 1UC5A 3SQMA 3MP3A 3CMFA 4UTHA 1B90A 4XD4A 3GTIA 3IIZA 5BMXA 4L4OA 4RZBA 1QU4A 4W8BA 3W82A 1ZZMA 4GI4A 3UZ5A 1Q85A 1RAKA 4Z0SA 1TV7A 2V38A 1US0A 1WO2A 2F4EA 1X39A 4C7FA 4JTIA 4KETA 4FOKA 3O5JA 3NSNA 4XB3A 4O18A 1RCOB 1PX8A 1WZAA 3AMCA 1G4SA 3R5EA 2HRWA 4JTLA 1VYSX 1KXVA 5AZ0A 4PSRA 5A6JA 1W3IA 1HKVA 1JVNA 4J3SA 2ACQA 3CT2A 1Z8AA 1B3VA 3GX9A 1S5MA 3GFXA 2DIJA 3N18A 3OO2A 3VDBA 3RLVA 4UQAA 1TV8A 5BNKA 2XUCA 2V5BA 3WDHA 3CAWA 3E6EA 3QYQA 2OELA 4EAMA 1OFDA 4MJZA 4L5ZA 3WBXA 3UERA 3A3XA 4Q8TA 1Q5MA 3IJQA 4REQA 3O5GA 3S9YA 4A3UA 3PNUA 4MJMA 4KRTA 3TWAA 5DX7A 3N9SA 5I0DA 5LIWX 2VFEA 1CI1A 2LKNA 1HJSA 2GJPA 3EDDA 3I6RA 2BGNE 2P53A 3TCZA 3W7QA 5C2XA 2OWXA 1F8MA 1ME8A 5DY3A 4AVOA 1KLYA 3U5YA 3TKFA 3ZSSA 3MUZ1 4H1ZA 1KTCA 4KFPA 4H6EA 4J3ZA 1TZ7A 4CQBA 4ADTA 1HFBA 1Q7ZA 1H5YA 2ACRA 2E8ZA 1H63A 1N55A 4RX0A 3UXKA 4X2PA 3W71A 3QR0A 2X1SA 1XQKA 3PZVA 2OG9A 2V5KA 1VFTA 2ZX7A 2ONEA 3O8AA 3ZJ8A 2AAMA 5JBDA 3M44A 2WZIA 5E6YA 1Y8BA 4PMJA 3IGSA 3CTTA 3RFAA 3URAA 3EKZA 4KRZA 3SRHA 2DG4A 4LJ3A 4PEEA 2QDHA 3Q2DA 3RK8A 3ZWSA 1B3OA 8A3HA 3N13A 1XDMA 3CIWA 3UT0A 4YWSA 4FLSA 2H8ZA 3O63A 1WDRA 4ODQA 4G8TA 4LSBA 4DRNA 2IKGA 1EOKA 1W5PA 2IXVA 5CLWA 1FWTA 3DHDA 2HPMA 4CNNA 7REQB 3EB3A 2GUUA 4WY0A 1N8FA 4GLEA 3G8EA 2QVHA 1E1CB 3H4GA 3WMBA 3LTPA 4DUOA 1SFSA 1E9YB 3NZQA 4MZ1A 4B2DD 4GG9A 3VE7A 2PRLA 2VWSA 3S4TA 1JZ4A 4C6LA 4ALDA 3TSMA 1OFQA 3UZJA 5GNXA 4NNAA 3TXVA 3KHDA 4DYEA 2ZZ7A 1XUUA 2XJ7A 3R8RA 3JZEA 4HSHA 1B9BA 3AYRA 1UKOA 2ZICA 1NY1A 1TIMA 3RCNA 3T0BA 3KRUA 5CEWA 1GTHA 2J7CA 3RJYA 4ZO9A 4ZOAA 4UQCA 4A3YA 4OECA 1ZHAA 4MAZA 4TW6A 4AWUA 3E0FA 1MUMA 2QAPA 4OVXA 3TQVA 5I3FA 3F4NA 1TQXA 1KLZA 3FYPA 2XP7A 4JFTA 1WXYA 3QC3A 4DRQA 4AWEA 3ZVHA 3KCLA 2PI6A 1FDYA 3VDGA 3TLLA 3KTSA 4Z17A 3WQ5A 4HYVA 3BCFA 3DYOA 1FH8A 1LQ2A 3LXCA 4N0RA 4HNUA 3OLDA 2Y7GA 2FFIA 4F0RA 3BQ5A 1J93A 1XBXA 4W9TA 4WGHA 3DG7A 4UFKA 1LCOA 2EG7A 1YDOA 3T55A 3AUOA 4HHMA 2YB4A 1CLKA 2J62A 4AZGA 5LA1A 3W76A 1F8IA 1NMWA 1TJPA 1OZQA 4D6FA 1DWIM 4QTGA 3TC7A 2YCIX 4GYJA 3VNDA 1DHKA 5CJNA 4UOQA 3TLQA 5CPLA 4HNLA 2GJXA 3HG2A 4UR7A 1P0DA 4N9BA 4OZOA 3W2MA 4QLLA 3MCNA 2VNCA 4DZHA 2NZLA 5I06A 4JN6A 4J28A 3V0UA 1A5KC 1XYZA 4QS5A 1IEWA 3L0GA 3LTSA 1Z7AA 1XF0A 4DB7A 5I02A 3W70A 4TMBA 4Q4SA 3GH7A 4UNKA 3S9ZA 2DQXA 4GNJA 4F48A 1OFAA 3W24A 2BNJA 2B81A 1V3MA 2NQHA 2GSJA 1GPWA 3LBOA 2XGIA 2IKJA 2GVGA 4P2VA 2J13A 2BV9A 3AUJA 3BZJA 3LHUA 1Q66A 2FB2A 1LP6A 5CZTA 3V7PA 4MM1A 1UB3A 2QCCA 4C6KA 4DZ3A 1AJZA 4HOWA 1UUOA 2J9YA 4AIOA 2J25A 2YJQA 5EA9A 1O60A 1IEIA 3SGGA 1FH9A 1I1WA 1P0BA 1DORA 3MZNA 3VTRA 2ZVIA 2F2DA 1OT1A 3EX1A 2A7NA 1DBTA 3P93A 1FWWA 1A3WA 3LV6A 4Z2GA 3CAKA 3TWBA 1MQPA 3N11A 1UWSA 1ZCCA 3W7KA 1KFJA 4JX4A 3S8HA 1E4NA 3O5OA 4ODLA 2PE4A 2E09A 1HVQA 3CV7A 3FN9A 5E0KA 1YX1A 3VX0A 3VIOA 1GWJA 3BAYA 4GHRA 4OKDA 2Y5EA 1I2OA 4NJIA 5B7YA 1I2PA 5H6HA 3BJTA 4M7SA 5LXXA 3B3DA 3F4DA 1E43A 1QI0A 3UJRA 4B15A 3WK2A 4GZ7A 4JEJA 5EYWA 5FACA 1X6UA 5EPDA 5I3IA 1NJJA 1LTDA 3M5ZA 4OTKA 1TVPA 3KRSA 4J27A 4BKNA 2VT0A 2VEKA 1X97A 2O9RA 5LIKX 2NX9A 4AVNA 2JIWA 3KL0A 3W7EA 3ZJKA 4A3QA 3CBWA 1AW2A 3T0TA 1E72M 3DGBA 1OX4B 2AKMA 3W2JA 1K1DA 1C8QA 4EXAA 1AL8A 4ZBCA 3LTYA 3NPUA 2GUYA 5G1TA 3WENA 2CXEA 2HSAA 4O17A 2CHNA 2ZR6A 1EC9A 2JF7A 2O9OA 4MADA 3R58A 3RU6A 4LAUA 3B0PA 1J96A 4B3LA 3OA5A 3AS3A 5E70A 1V6UA 4NAEB 3B4UA 4RPQA 2VOMA 3D3AA 2HVNA 1R38A 3MDUA 2XVPA 4HVXA 3GDLA 3IKDA 1U1JA 3STFA 3JS3A 1EGMA 1DJQA 4K38A 2JF6A 2Y70A 2CEQA 3QKZA 5TQLA 4AQLA 2BBFA 1R5YA 4JX6A 1H61A 2VX7A 1A47A 2UBPC 1L2UA 3HU7A 3ZO9A 1XRSA 3QSRA 3URNA 2QDGA 4WLCA 5EB8A 3OPSA 3TJLA 3HN3A 3CMJA 1DTNA 3GO2A 4NAFA 4YCPA 4QQ3A 3W6MA 2QF8A 5HW6A 2ZX6A 3O5IA 4ERIA 1KC7A 3TIMA 1X96A 4L61A 4IPPA 2WNQA 2I5IA 1UUMA 2EAWA 3TCEA 1AQMA 3V5FA 3GXMA 5CSSA 5M5DA 4Q8PA 3W73A 2GJLA 1E5JA 3VUSA 4IJCA 5CC5A 2REQB 4RDVA 1OYAA 2F9RA 4QP0A 4Z1AA 2FZ8A 1SSDA 3AC0A 2CPUA 1BXBA 4R34A 4QGCA 1AG1O 3FVMA 4GQQA 4AD4A 3WDPP 2ZRZA 5DRIA 2WYSA 4TV6A 1GVOA 4TXEA 1SO4A 3RLGA 4Q4OA 3GG1A 1IV8A 4LYPA 4JTDA 3O5EA 2G4JA 3UA4A 3O07A 4GX9A 3IACA 5E6ZA 1TFVA 1PKMA 3P8JA 3W72A 4V15A 1UR4A 4O8RA 2J7HA 1DWHM 1KW1A 2C7FA 4ZPWR 2G96A 5A1AA 3OGSA 1NFPA 1M3UA 2BOEX 4PULA 1DXFA 1OC7A 5BW6A 1GYMA 3FGCA 4Q22A 4M6VA 2OODA 2HROA 3K8KA 1XWYA 1HX0A 3VMPA 1JF5A 1F3TA 1V02E 1XLFA 1F9CA 2B0MA 4US6A 1M41A 4IJBA 4XZNX 3NZGA 1AUSL 2VXNA 1XLGA 4U10A 3EA2A 2LGOA 3NIYA 2WBGA 1VBHA 3VNMA 5DELA 4KCTA 3W01A 2NV2A 5J6EA 1A50A 1L0PA 4QJ3B 2D2HA 3NPWA 2VRKA 3LZ5A 4AISA 4EXBA 4MOZA 2HNHA 2XHYA 1K9EA 3HF3A 2A1YA 5CG0A 3N17A 2QKFA 1QO5A 3NG3A 4OUIA 3EKGA 2FZDA 3JW7A 3FV9A 3W7OA 4QXIA 2B5UB 1XSJA 3U48A 1Y5VA 3OB8A 1W9BM 2BG5A 5A8OA 2EKCA 4Z2LA 1CEOA 1MXSA 4HARA 4HJWA 4Q8OA 5FF4A 3T2OA 2W66A 1WOAA 7PTDA 3LB0A 4HT3A 1J0HA 3MJMA 3EWUA 4D8ZA 5JIWA 4PTXA 3V1PA 3THCA 4MFDA 1K9DA 3CQJA 5I07A 1TELA 3W81A 5A6MA 3USBA 4HNOA 1FA2A 1RBAA 1RQEA 1UCWA 4DELA 4TX6A 1GW1A 3UGRA 3CO4A 4HMDA 4JFJA 2RDWA 1IWAA 4IGMA 1V5XA 3N34A 5HMDA 1EP1A 1UMYA 2A5HA 4N9DA 2PP0A 3C56A 5HJLA 3WNPA 3GTHA 4H9YA 1VFOA 1WKDA 2AWGA 4LX4A 4GXPA 2VRQA 1FQ0A 3O5LA 4MDPA 2NQZA 3LMYA 3TTQA 4AZCA 4N02A 4P7QA 1QNVA 3VC5A 2YL5A 1FKFA 2E77A 4Q8QA 3PZNA 1W3TA 2HEJA 3UCQA 3W1RA 3WH0A 1FWRA 4IH3A 4S3EA 4AZIA 4DF2A 3U2ZA 3G1HA 4HU8A 4Y8EA 1XLJA 3TN5A 1CB2A 3UR8A 2Y61A 1QK0A 4I3GA 5D9NA 3TK7A 4XIAA 1NAL1 1W17A 3NYDA 4I9MA 3T4CA 4HN8A 4OQVA 3S5NA 1UH2A 4PUWA 3T44A 4MB4A 4CU8A 3L4WA 5I7GA 1FOBA 4PBEA 5C7VA 3TC6A 1EX1A 3L0NA 1OADA 1MMFA 1W1YA 4MNKA 3K8LA 1MDRA 3HFTA 3VOJA 2OQYA 1NDZA 3PFRA 2PDNA 2XIBA 4ZO8A 3I7SA 1O1ZA 3B0UX 2ANUA 4E4FA 4UTFA 1Q6EA 3LCLA 3U9IA 3LRKA 2V9DA 4XBJA 2WOQA 1D8WA 3AICA 1YQ2A 2HK0A 5HAOA 2VELA 4DLMA 3AMKA 3EMCA 3R11A 3UNDA 2B4GA 2HMCA 3B8SA 3KVMA 1NWRA 2XZ7A 1AMKA 3WUEA 2VURA 3D46A 1ZU8A 1RY0A 1L8PA 3APGA 4LW7A 2XPAA 2DIEA 3B8TA 3TJXA 2HS8A 2Y89A 3VOCA 1A5CA 1DTUA 1KCKA 3EXRA 4GQBA 5DMYA 4AWTA 1XIIA 4X0VA 2POZA 4DIAA 1FFQA 1C90A 5CCZA 3WELA 3P8IA 2JQXA 3SCSA 1MW2A 3R25A 4XZMX 2DUXA 3LQLA 4Q8MA 1NTHA 2ESCA 2L2SA 1MUCA 1IXNA 1R87A 2QYGA 3W7JA 3JVAA 3A6OA 3CB8A 1Y5XA 1H7RA 4XG1A 1B6CA 1A53A 1M68A 3GC2A 3NRKA 5FJPA 5B7ZA 1X8FA 4W9PA 5KZ6A 3A3HA 4IP7A 4M6UA 5CZKA 5I03A 3QC0A 1R2TA 4FMVA 1P5QA 1IT7A 2XVGA 1SO5A 2GSEA 1W1PA 1XBZA 2PPPA 1ENUA 4LVFA 4UBPC 1ZJBA 2ATMA 2VUNA 2R1NA 1L2QA 2REQA 3VDHA 1X6NA 2X42A 2P1FA 3RNDA 3SUSA 3ATYA 1VLWA 3U2OA 4YTTA 4X2RA 3QN3A 1LLZA 4DRMA 4AHOA 5EFFA 3STCA 3ISIX 4YU1A 4XKMA 1ZALA 1VPXA 3KVKA 4PYSA 2XPBA 4FNPA 2WANA 3RMJA 3KUMA 3Q37A 2NVDA 1XHGA 3N1AA 4MIMA 2QV4A 3ANVA 3H2MA 4DPPA 3U0HA 3M0MA 3WUFA 1QPOA 4D71A 1N82A 2JE8A 2PF0A 1QW7A 3COTA 3QMRA 4GD0A 2VZUA 4HOXA 2X30A 4MY9A 4O12A 1J2WA 3VU2A 1JI2A 1JUEA 4K2SA 1OC5A 2WKLA 2X40A 6ENLA 4MUPA 3WBYA 4XQ6A 4TIMA 5FAGA 1Q6HA 3M0ZA 1UA7A 4NZFA 2ODOA 3E5PA 4ZXLA 4LBUA 2W0UA 1WUEA 1V3HA 3PAJA 5D04C 1E9ZB 4JHMA 3T0AA 2YBVA 3DBNA 3AHXA 1Q8AA 3PBVA 5FJRA 1YW5A