2DPEA

Crystal structure of a secretory 40kda glycoprotein from sheep at 2.0a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of a secretory signalling glycoprotein from sheep at 2.0A resolution
pubmed doi rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dpeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dpeA01
2PWDA 2WSPA 2WLYA 1WDSA 3AIQA 4NF7A 4P7OA 2VOTA 5CQ1A 3AS3A 3KL0A 5BROA 4TTGA 2CKSA 1GQKA 2WVVB 2XFYA 3AIUA 1C91A 3EDFA 3W25A 3ZMRA 4PMNA 2XUCA 1XYFA 2XFRA 5DMYA 1EHNA 2WMIB 4PMDA 2WVVA 2BY2A 3ARTA 3VIMA 4WKHA 3HMCA 1OIMA 2W63A 4TXEA 3WN6A 3B8SA 3L4TA 2WMIA 4AD3A 3I3DA 3VMNA 4UQ9A 2Y8VA 4GQQA 3VIJA 3WF3A 2X1IA 4TVCA 5GQBA 2D0HA 4UFLA 1E5NA 1UG6A 4UR9A 3T0DA 4WKFA 1IT0A 2J7DA 4UQCA 5C70A 3K8LA 1EDGA 1QBBA 1QBAA 4AZ5A 2CBIA 4OBSA 3AROA 2VCBA 2WKLA 1LG1A 1OB0A 2G3IA 1CPUA 3FW6A 3K1DA 4IM4A 1ESWA 2ZIDA 1WCGA 3QOKA 3ZSSA 2VQTA 3CH9A 1VENA 1L8NA 4TOQA 2ZWYA 4JHZA 3AXXA 2BVDA 3T2QA 5E6YA 3W4RA 2JALA 2CYGA 4AYSA 4J3VA 3D5HA 3EYPA 5HBFA 1G94A 1E72M 3THCA 1HXJA 1GQIA 2G3MA 3PZQA 2WC7A 3RPMA 3MSGA 4ZE5A 4LXFA 1H3GA 3HN3A 4U5IA 3CZEA 3GDBA 5A6AA 3MMDA 4ZXOA 3GNRA 4RE4A 2VX6A 2W67A 4D6FA 1H0IA 3PHAA 3QOMA 4L4OA 1PZ3A 4D6HA 1H4PA 1UR9A 1JAKA 4KMQA 2WPGA 8CGTA 3RM9A 4XUYA 1NOWA 2VRQA 4DM1A 4BS0A 1DP0A 2VZTA 1DWAM 3MS8A 1V3HA 2D24A 1KFWA 1WZAA 2J78A 5JIPA 1XHGA 1HKKA 3AS1A 1RH9A 3OIHA 3CUGA 5GNYA 3L4YA 5A8MA 2J75A 1L0PA 2CHOA 1OGSA 3RDKA 3WDJA 3UR8A 2C7FA 2CERA 2WHLA 2UY2A 4KWUA 4AISA 4W87A 1C8XA 3PTQA 3VD3A 3BC9A 1JI1A 3UG4A 3LMYA 1A47A 3DC0A 1ZBKA 1HKMA 4PCTA 3F5LA 4C7GA 5CSUA 3AHZA 1BYBA 1YHTA 4HZ6A 5E70A 2E8YA 3JUGA 1BSIA 2JIWA 4FF5A 2C8NA 3D3AA 3CIVA 2HISA 4D6DA 1UYQA 2UY3A 2J7EA 3TTYA 4CN6A 1MW1A 1CXHA 4HU8A 3VDBA 4J7RA 1RP9A 3ZQ9A 3WBAA 3CO4A 2V3FA 4MAVA 1LJYA 4MB1A 1XH2A 4W7VA 2A3CA 3PZNA 4CD5A 1JIBA 2CEQA 1NM9A 2DSKA 4HZ8A 1B9ZA 1R7AA 3PZMA 1JL8A 5CG0A 1CDGA 1ZU8A 3SIMA 3OLIA 1KXHA 4UQAA 1YQ2A 3GNPA 4XV0A 1X1NA 4LX4A 4JIEA 4OKDA 5EB8A 5HNNA 1EIBA 3B9DA 1OSEA 4V27A 3WF2A 2D2OA 4TVDA 2GUYA 1PAMA 2NW0A 1DEDA 2G3JA 2XGIA 1D3CA 1ITCA 3SCWA 3WQ5A 1HKIA 3MMUA 4H7VA 4HP5A 2XJ7A 1PIGA 1ISZA 2WVTA 2WANA 2E9BA 4HU0A 4V2XA 3WF4A 1BF2A 3W29A 4U33A 3GBEA 1ITXA 1V6VA 1K9TA 3DHUA 3S2CA 5I0DA 4CU7A 1BYDA 2JFEX 3ZT7A 1AMYA 2PBOA 2X0YA 4AZCB 4S3KA 1WDRA 1G9HA 2O92A 4JFTA 5D9NA 4W85A 3W82A 1F4AA 2XVNA 4HA1A 1Q6DA 1XYZA 3VPLA 3W53A 1UKPA 1ZS2A 5A6JA 4P8WA 2Z1SA 3OZOA 2EEXA 2GK1B 1JXJA 2PF0A 2V38A 3MO4A 1OGGA 4R27A 3MU7A 4QLKA 3K8MA 3ZR5A 1J9YA 4JHOA 4EKJA 2YBTA 1JYVA 1XSIA 2J7HA 2GK1A 4CN4A 2DH2A 3AHYA 4CVWA 4L4PA 2VQUA 3CHCA 2ZE0A 2C0HA 3GXFA 1BG9A 1CNVA 4AD1A 1ISYA 4TVUA 1WE5A 1KGUA 7TAAA 4LYQA 1QI5A 1OD0A 3WFZA 1MQPA 5AC5A 3WDPP 4BCEA 1UKOA 2OSWA 1UOKA 2DIJA 1BQCA 3A4XA 1CXEA 3PBGA 2X2YA 2Y2WA 4U3CA 2DSWA 2VZSA 2WVUA 3OGSA 3RJXA 1TG7A 3EBVA 1J0IA 3AMCA 3PZOA 1FP8A 2DH3A 1BGAA 1B2YA 3ZO9A 1MFVA 3KZSA 3N18A 3VNYA 1MQRA 1W1TA 3TA9A 3HJEA 1BPLB 1TVNA 3RIKA 3MSDA 1QNRA 4GZIA 1J11A 3SUWA 4CD6A 3VGGA 3FY1A 1TZ7A 3G6LA 2V3GA 1JZ8A 1V02A 2YA2A 1E0XA 2V5DA 1KBBA 3MUY1 3GYCA 2DGAA 2XSAA 4B15A 4K68A 4DUVA 4W88A 3MANA 3QHOA 3ARYA 4GINA 5BCAA 4OJYA 2DEPA 4HMEA 4JFUA 2FH8A 4D6IA 4B9YA 3BAYA 3IJ9A 3AXHA 3PTMA 2D20A 4J3TA 3W27A 4WIWA 4UCFA 1E55A 3CMGA 4D6EA 4M56A 3UETA 2WXDM 1UR0A 5A8OA 1JZ5A 1C92A 1GPFA 3WQWA 2VX5A 1E15A 3AS2A 1R85A 3WD2A 5A2CA 1B31A 3WH7A 4PUEA 1NP2A 3TTSA 2A3EA 1KXQA 3WD3A 4D6GA 2W61A 1H1NA 1TFVA 1C3FA 4Z2HA 3VIGA 2VO5A 1HL8A 1KWKA 2D3NA 3BH4A 4MJ4A 2Y5EA 4OZOA 1H11A 3WNNA 4N42A 5ECUA 4BZYA 4UOQA 1HL9A 1J10A 4GO8A 1GW1A 5DF0A 1B90A 2ZXQA 4YHGA 2XM2A 2FGZA 1CIUA 3WQVA 1K9DA 1GHRA 4BQ3A 3KE0A 2E9LA 5ABHA 1BFNA 3WNOA 1UR4A 3KWXA 4CD8A 1U2YA 4ATDA 2CPUA 4ZFMA 1ZBWA 3ARZA 4QDMA 4R5EA 5CPTA 3II1A 3QR3A 1LG2A 1HJQA 3OZPA 3K46A 3WBEA 5DT5A 2BY0A 3WY1A 1R7OA 2GSJA 1W9XA 2GJPA 4A3HA 2J7GA 1EGZA 1JZ4A 1WZKA 3N12A 2WCAA 2WMHA 4PSPA 2VZVA 4CCDA 2JEQA 4QCFA 4W89A 1FHLA 4DWSB 4H41A 1UQYA 1C8YA 1Q6CA 1UKTA 2CXGA 3UEQA 3WUBA 5C71A 2WWCA 1NWUA 1JZ7A 3VD7A 4PCSA 2PWFA 3VIKA 3SCSA 4M8UA 1FH9A 3J7HA 4NI3A 4DWSA 1VAHA 3S6TA 2WMFA 3WQ8A 1UWUA 3ZJ8A 3WMCA 1CTNA 3ZR6A 3EMCA 2FDMA 1E0WA 4Q7NA 3CZ8A 4U31A 2G3NA 4D1JA 1MFUA 2DQXA 4U2ZA 2EJ1A 1G01A 2WBGA 4S3JA 1G1YA 3BMVA 2O9PA 4A4AA 1VBRA 3AJ7A 3VIOA 1QHPA 1ISWA 1GORA 2ZX5A 4W7WA 5I3DA 1JI2A 3WQ6A 1UR8A 4CD7A 1CLVA 2WMKA 3KL5A 3SCVA 2ZX7A 1WB0A 1UKSA 1JYXA 4RL3A 4UFIA 3ARQA 2WYSA 2W5FA 1VB9A 1B1YA 2XIBA 4AD2A 1W3JA 5A6BD 2ZUNA 4GZJA 1UR1A 5E6ZA 4MB5A 3AHVA 2VI0A 3KL3A 1JFHA 1WO2A 3L4XA 1E40A 5HDRA 3DYMA 1H49A 2CNCA 4W93A 1TVPA 1UA3A 1UD5A 4GXPA 1E6QM 3DYOA 3WH8A 3BAKA 2E0PA 2ZXBA 4JKKA 2MANA 1FH8A 3AMKA 5F7UA 3APGA 3QHMA 3WENA 4E4PA 3CHFA 3GXIA 2DT3A 1JD7A 1E3ZA 3CUJA 2BV9A 3ARXA 4YHEA 5M17A 5A8NA 3I3BA 3U57A 1UH2A 2PWEA 3NUKA 4DUXA 4UOZA 2XM1A 3VIHA 1QHOA 3AI0A 4QLJA 1W2PA 1K6AA 3EMZA 5IFTA 1SMAA 4URIA 3L2LA 4QAWA 3ZJKA 5BXTA 1DWFM 1QHZA 5DO8A 2F2HA 2ZOXA 4GIAA 1KQYA 3W0KA 4CU6A 9CGTA 4JKMA 1NOFA 3WDRA 2WHKA 4TX6A 1BHGA 1D2KA 5JBFA 2PC8A 3AZRA 1CBGA 3IANA 4PMZA 3SCPA 3AQUA 2FGLA 2VZOA 4FLQA 2QMJA 2XGBA 3WH9A 5FCZA 4UOJA 1W3KA 3FNDA 1XRVA 4DWSC 4MDPA 2GDUA 4MAZA 2WVSA 5M5DA 3B9AA 2VRKA 2FHFA 4AEFA 5LA2A 4AC1X 2FHCA 1FFRA 1JAEA 3AMGA 1LL6A 1SMDA 5BRQA 4OUEA 1WKYA 3LPPA 3PZGA 5I78A 4W84A 3BCFA 3BLKA 5E0FA 2XFFA 1GCYA 2RGLA 2V5CA 4JFWA 2J8FA 1QI2A 1MXDA 3ARVA 1M53A 1MWOA 2WC4A 2E9MA 2WZIA 3VIPA 1CWYA 1JD9A 1WDPA 2ZICA 1OINA 1CGTA 2NT0A 5FD0A 3IAPA 3SCNA 3PZIA 4GZEA 3WD4A 4CCCA 3W24A 2WZHA 1GVYA 4OBRA 1UZ4A 1VFMA 4UQDA 2D3LA 5I5RA 1BG4A 1B3VA 3MV11 1JF5A 3N11A 1CXLA 3VX0A 1H2JA 3O9NA 4M81A 2ZX6A 1CYGA 2VCCA 4CU8A 1MYRA 4GO9A 3W6LA 1QI3A 5A6MA 5CXPA 3BGAA 1K9FA 1FA2A 3W28A 3ZOAA 4XZWA 2HVMA 4ACYA 2GJRA 2XVLA 5HXMA 2WWDA 4ZEPA 1C7TA 1M7XA 1QW9A 2YDSA 2WLZA 4UZUA 5EFDA 4FLSA 1NARA 1Q6FA 1JDCA 5A6BA 3AHXA 1AQMA 5AYIA 2VR4A 3VO0A 1JGIA 4P7LA 3F5JA 3GBDA 1EXPA 2OWXA 1UD3A 2VJXA 2VTFA 1CXIA 1HF6A 4D72A 2X05A 1V3LA 1E5JA 1B3WA 4BF7A 2Y24A 3CMJA 5I79A 2ZUVA 1X6LA 1UD2A 3GXDA 2UY4A 1GUVA 1UD4A 1UWTA 1Y7VA 3NDYA 2UY5A 2XVPA 1A3HA 2XPKA 3WUFA 4ZENA 6CGTA 3CUIA 3DHPA 2BHZA 5JBEA 4J28A 1DWHM 2VT0A 3KEHA 3PZUA 2OYMA 1FP9A 3BCDA 3N04A 3T0AA 2WBKA 5AC4A 1VFUA 2XSBA 3CUHA 4WK9A 2YA1A 1E6NA 1H41A 1VEMA 4J27A 4MADA 3W37A 1HJVA 5LYRA 1TA3B 3TTQA 1GNXA 2IXUA 1KQZA 4WLCA 3VMOA 4AZHA 1B3ZA 3CGTA 1DTUA 1PEZA 2VMFA 4X0VA 1TA3A 1LWHA 4B9ZA 3AICA 4MNMA 4BA0A 2JIEA 3OG2A 5A6LA 5BXPA 4NRRA 4M1RA 1HJUA 3SCUA 4JL2A 3L4VA 5D8WA 2ZX8A 4CVUA 3AIWA 4P8VA 2YL8A 2DDXA 4PTVA 3WDQA 3RO8A 1UWSA 2W4XA 2VL4A 4X9YA 4FMVA 3WEMA 3VILA 4GPNA 4F79A 1V08A 1GJWA 1LQ0A 4A3YA 2YJQA 1XGZA 1W1YA 3N9KA 3WDHA 1W3LA 3WD1A 4GI9A 1S46A 3VGBA 3VD4A 1G0CA 2JF7A 1GJUA 1V02E 1TR1A 3NCOA 3WFLA 1W3HA 3CUFA 5AY7A 3TOPA 4V28A 1NP0A 1PJ9A 3ZJ6A 3EDJA 4XX6A 1JXKA 1UWQA 4DWSD 4P8XA 1ECEA 2VR5A 2J7FA 1DWJM 4UQBA 4PYSA 1LL7A 1EQCA 1RP8A 3B9EA 2BHUA 4NSBA 1CXKA 6TAAA 1W9VA 3BSGA 3PZTA 2W92A 1QNOA 3WNKA 1VEPA 2EPLX 1J0ZA 1TMQA 3VD9A 3SUTA 2ESCA 2WC3A 3A4WA 2PI6A 1RPKA 3POHA 3WMSA 1LL4A 3POCA 3VU2A 3WSUA 3VM5A 3LPFA 3ZIZA 1EDTA 2BVTA 2YL5A 4F9JA 3W81A 1NQ6A 3AYRA 1JF6A 4Y7EA 1I1WA 5BRPA 2IUZA 1WZMA 2E3ZA 3T09A 1E3XA 2WMGA 3RCNA 1EOKA 5M3WA 5FL1A 2OLHA 1OGBA 1JZ3A 3VOCA 3AIBA 1ISXA 4HZ7A 1XCWA 3THDA 1HJXA 3TP4A 3GXMA 1VEOA 4M80A 3MMWA 3IJ8A 1E43A 1XC6A 1OT2A 2G4FA 4EK7A 2YDQA 4H8UA 4TX8A 3VD5A 4HMCA 2XIIA 1JYWA 2GJXB 3N15A 4IPNB 3BAWA 3M46A 1QI0A 3VGEA 2Y4SA 1GOWA 3F5KA 4M29A 3NJ3A 1JYNA 5ABFB 1HIZA 1B30A 1IV8A 1PX8A 2FHBA 2UWFA 2GDVA 1UH3A 2GJXA 3SUUA 2A3HA 4HOXA 3UG3A 1CGYA 2ZX9A 2WW5A 5ABFA 1NH6A 2EO7A 3WUEA 1MXGA 2VZUA 3QGVA 1HNYA 3U7BA 3O2LA 1BYCA 1HVXA 3MUAA 3VGDA 1JZ2A 5GNZA 4PUDA 3NSXA 3WELA 4CUCA 5FOOA 4PTMA 2AAAA 2QF8A 2WM0A 2BS9A 4Z2GA 4LQ1A 2J47A 1GHSA 3CTTA 2ZUUA 2PWGA 4AW7A 2DT2A 2CETA 1UZ1A 4IPLA 1CGVA 4HA3A 4OOZA 4D6CA 2YLLA 3NDZA 1OM0A 3OGVA 4J3UA 1E4IA 2XWEA 2YIHA 5CLTA 1BGGA 4AWEA 2WSKA 5E9AA 4Q22A 2BHYA 4W5ZA 4AZ6A 3ARWA 5A6KA 3BAJA 1V3MA 4Z2IA 1ISVA 3ZJ7A 5CGTA 2EBNA 2D22A 5CSYA 2TAAA 1PIFA 5ABGA 1US3A 3CZKA 3ARPA 3AOFA 2B31A 2VX7A 3L4UA 3ARUA 1E6XM 2D1ZA 5CPSA 1CGXA 3L4ZA 4W8LA 3IJ7A 1E0VA 2QHAA 3K4AA 1GQLA 1DHKA 3AXIA 3LPOA 4MPKA 2V3EA 2VC9A 3PZ9A 2QPUA 1QW8A 3WUGA 1HJWA 1F4HA 2CBVA 1E1FA 5LA0A 1EQPA 2YLAA 4HMDA 4W5UA 1FOBA 3WH6A 1FHDA 1NWRA 1IZKA 2IXVA 2Z1KA 1ODUA 4AY1A 1JNEA 2CCRA 3WNPA 2A3BA 2Y8KA 3GM8A 1C90A 2OWWA 4UZSA 1K9EA 3AIRA 1QNQA 3WNLA 2AMGA 2J62A 1ZJBA 4GI6A 4QLLA 1E1EA 1EO7A 3ZT6A 4JZ5A 5I2UA 3LPGA 3GH5A 1NOUA 4UFKA 2VURA 2EPKX 1KXTA 4AEEA 5BXSA 4ACZA 4IUGA 1HN1A 1E4NA 3VDHA 4AD4A 1GZJA 4LYPA 2YA0A 1NWSA 1J0JA 2WK2A 4U3AA 2PWHA 3MUIA 1LWJA 4UFJA 4X0NA 2ZUTA 4M82A 1V3JA 3UR7A 1J18A 5GNXA 1HT6A 1V6YA 2EPMX 5DT7A 1BYAA 5D9MA 1V6UA 1J01A 5EMYA 3CZJA 1E6ZA 2EPOA 5JIWA 3AHTA 1P6WA 3AMDA 1E73M 4AZIA 2WMJA 4JFVA 3GTNA 4DM2A 1WAWA 3VKKA 4PMOA 1MW3A 1DWGM 1VFFA 1KGXA 3A3HA 2GFTA 3WMBA 1XD0A 3SCOA 2O9TA 5IHRA 1HP4A 2J7CA 4HPGA 4KH2A 5JH8A 4GKLA 1QVBA 3BAXA 5CLWA 1GOMA 3DECA 1KGWA 3M7SA 2WKGA 4EAMA 5CZKA 2O9RA 4Z2KA 2ZUSA 2D23A 4N0RA 2OYLA 4EANA 2WCSA 2E4TA 4U5KA 1BTCA 2WHJA 4Z2LA 1E6SM 4AIUA 1Q6EA 4W7UA 1E9LA 5A95A 1BAGA 2YDRA 3ARRA 2VVNA 2ZUWA 5E0CA 3FHQA 1QI4A 4HPHA 3VM7A 5HPCA 2JF6A 4PMXA 1ZB5A 1CZ1A 3SUSA 3MKKA 3TTOA 5JUVA 3FAXA 3ALGA 1WZLA 4KRUA 1UQZA 1V6WA 2QLYA 7CGTA 2X0HA 4GI8A 3AS0A 2YOCA 2EQDA 3AFBA 2NSXA 5A3HA 5A1AA 1EDQA 4MDOA 3M6DA 5A2AA 1VF8A 5A8QA 5I23A 1JDAA 3VIIA 1VFOA 2XWDA 3HU7A 1NWTA 5IFPA 1E6PA 3RMEA 5TD4A 4XZBA 1W9DM 1Q4NX 2E40A 2WZEA 1E4LA 1U33A 1QNPA 3A47A 1KB3A 7A3HA 1KR0A 1XSJA 1UWRA 1KWGA 3MV01 1EHAA 2YKKA 5IHSA 4BQ5A 2J25A 4WKAA 3BMWA 3AISA 3AZSA 3RILA 2F8QA 4UTFA 2J77A 4JAWA 5HPOA 1H5VA 2YBUA 1LF1A 3BLPX 4OOUA 2BNJA 2J8GA 3SEPA 1U30A 2EXOA 3A4AA 3BSHA 5A94A 4H8HA 4MB3A 4UQEA 1N82A 3WDIA 2ZUMA 4BQ4A 2BFGA 2DSVA 1AVAA 3IK2A 4J3XA 1JDDA 3SCQA 5D4YA 5EFFA 4OIFA 1XSKA 5IXEA 3QHNA 3NIYA 5GPRA 4AZGA 2AOSA 1J0KA 4PBGA 1X6NA 3W6MA 4WSJA 3CHEA 4PMRA 2ZWZA 4UNIA 5LA1A 5E09A 3A6OA 4C7FA 2DPEA 4LPCA 1TUXA 3PN8A 1VIWA 3VTRA 4B3LA 1US2A 4E8DA 3PTKA 4W8BA 3T0BA 3WEZA 1VBUA 1E70M 4P7RA 4GQRA 4ATWA 5FL0A 4C7DA 1AQHA 5IDIA 2CESA 4QFUA 4RE2A 3OA5A 4QCEA 4M24A 1KR1A 3EDDA 1UA7A 1WPCA 5AYBA 5CJ5A 3PZVA 2VVSA 3OBAA 4RE3A 3N13A 3F4VA 1C8QA 3AYSA 2XVKA 5FKYA 1MQQA 3SCRA 4HTYA 4UFHA 4AD0A 1MVYA 5CGMA 1PZ2A 4HOWA 4B16A 2BXYA 4KGLA 1XD1A 2FH6A 3VINA 2DT0A 5JBDA 4AD5A 3I3EA 3EDEA 1CGWA 4P7QA 3MUZ1 2A3AA 3AIEA 2XHYA 3CZGA 3VMPA 4WJXA 4JCLA 1UUQA 2OSYA 3N1AA 2XYLA 2E8ZA 3L4WA 2NT1A 1BVZA 3SUVA 4NZCA 3ZT5A 1W9PA 1TE1A 2CHNA 3ZM8A 1ZL1A 4HOZA 5C8BB 2XVGA 4CCEA 2CITA 4EE9A 3CHDA 1EH9A 2G8ZA 5A6SA 3OB8A 4ZXLA 4U2YA 1V3KA 5I77A 5D9PA 3FHAA 1VJSA 2DSUA 1M04A 1FH7A 3W38A 2WCGA 4QP0A 5DFAA 4KRTA 4DUWA 2QV4A 3WIJA 2YL9A 1W9BM 3O6AA 1O6IA 3RM8A 5BXRA 1C7SA 4AZCA 2OSXA 2OWCA 1MW2A 2X09A 3CLWA 1G5AA 2W91A 1RD6A 4FLOA 3U5UA 3VX1A 3T2OA 5DEZA 1V0LA 4J3SA 1KCLA 1W2VA 1SFSA 1CENA 1Z32X 1VRXA 2WHMA 4UFMA 3GNOA 1XCXA 1HKJA 1H09A 4MNJA 2PBGA 1VJZA 4PTXA 3UCQA 2BY1A 4WF7A 1UH4A 4AIOA 1SR0A 4TTUA 5EBAA 2ZXAA 1UWIA 2YL6A 5I24A 3EDKA 3U5YA 1CXFA 3OLEA 4D6JA 2J74A 3NSMA 1PX3A 1M03A 1XH1A 3U7VA 2WNWA 3G6MA 3OLDA 1OBAA 3W26A 1KCKA 3WNMA 1OWQA 1PBGA 3WF0A 4F9DA 4W8AA 1JFXA 2CIPA 3SURA 1V6XA 3IAQA 4Z2JA 1D7FA 3UERA 1TCMA 2BVYA 4D1IA 1R8LA 8A3HA 6A3HA 2OYKA 1GQJA 1UR2A 5D9OA 5BWFA 5A2BA 4WSKA 1JG9A 3GH7A 3VGFA 1HX0A 2VUYA 3VGHA 3CPUA 1V0NA 2W62A 1HVQA 4PMQA 3NYDA 3WQ4A 3GZAA 4FLRA 3ZSTA 3VIFA 3FAWA 2DSZA 4B3KA 3K4DA 1WP6A 2D0GA 3WL0A 2BXZA 2GVYA 1EO5A 2J79A 1ZBVA 5D8ZA 4ML4A 1B0IA 2CKRA 2J4GA 5ABEA 1M01A 3SCTA 1SYTA 2VX4A 1JNDA 3WF1A 1CGUA 1UD6A 1MW0A 4MB4A 4MJ2A 3AMLA 1H0GA 4AIEA 4E2OA 1ODZA 1V03A 1OIFA 3DYPA 5KZ6A 1XV8A 1WDQA 2D0FA 1BVNP 5BYWA 3RM4A 5HOSA 4P8UA 1I1XA 1E56A 1UD8A 4KGJA 5KEZA 3WEOA 3FN9A 1BLIA 3OLGA 3VDAA 1O7AA 2V3DA 4F66A 1ZJAA 3UESA 3VNZA 3WL1A 2WAGA 4H04A 4CKQA 1HJSA 5FIPA 1J0HA 1OT1A 1QOXA 1V3IA 3NSNA 5I6SA 1V0KA 1DWIM 2BY3A 3GH4A 4CN1A 4LYRA 1CEOA 3K8KA 3CBWA 3E1F1 4AZBA 1CECA 2VRJA 4ATLA 2Q8XA 4AMCA 3BXWA 3TONA 4PMVA 3WH5A 1B3YA 4NRSA 3ARSA 1WNOA 1E71M 5A69A 4CGTA 1B3XA 2WB5A 1OD8A 2JEPA 3FXYA 4PRWA 1GVIA 1OCQA 2DT1A 2RGMA 1EOMA 1KBKA 4AXNA 1GOQA 2DIEA 4H2CA 4PTWA 4BQ2A 4W86A 2XG9A 3T08A 1C93A 3M07A 4D71A 4CD4A 4PEEA 2G41A 5A8PA 1W1PA 4JL1A 1GOKA 4TUFA 3RJYA 2EPNA 4PN2A 1W91A 1UKQA 1GOIA 4ZE4A 4PMYA 1J12A 1CLXA 1Q6GA 1I75A 1E4MM 4MNLA 2J7BA 4JCMA 4P7NA 2F61A 1AQ0A 3ECQA 1PPIA 1W32A 4AZ7A 4LGXA 3EMQA 1GOOA 1QNSA 3T2PA 1V0MA 3CZLA 4PMUA 4H8VA 4PSRA 1LLOA 1UHVA 1W9UA 4JFSA 1HP5A 3WKZA 4ACZB 4F8XA 1ZBCA 4MNKA 1GONA 5M03A 3N17A 3AIVA 1FFQA 1JZ6A 2JE8A 1IZJA 2XTKA 2CBJA 4IISA 1W1VA 3OGRA 2PB1A 2O9OA 4HA4A 2CBUA 4MTVA 1PX4A 2QPSA 2VNCA 3VDCA 1XH0A 3ALFA 1J0YA 3AZTA 3BAIA 3VVGA 4FK9A 4XB3A 1R86A 1EA9C 1QPKA 3UG5A 4JKLA 4J3WA 4YPJA 3WD0A 5CPQA 2ZXDA 1KXVA 3VUPA 2X8RA 3L2MA 1R87A 4YN5A 2QMKA 4E8CA 2VCAA 2W66A 1E6RA
chains in the Genus database with same CATH superfamily
3E0VA 2WSPA 3GE7A 3L68A 4NF7A 4DAFA 7REQB 4IJBA 4EIVA 2VOTA 1YPFA 5CQ1A 5F1VA 2IQDA 3AS3A 2Q09A 4HIBA 1S3TC 3KL0A 3MP4A 1ICQA 2NQLA 2VR2A 2YB4A 1A0CA 1I0DA 1XYFA 5DMYA 3QRHA 5FEPA 3HJZA 4PMDA 2WVVA 1H7WA 2BY2A 3ZVIA 3BK0A 3VNDA 3VIMA 1IXNA 3HMCA 1OIMA 1XYAA 3WN6A 3B8SA 4XK2A 1CCWB 4L3NA 2F6KA 3TAKA 1EB3A 5HQLA 1LBLA 1UG6A 1TPFA 4HZMA 4WKFA 1IT0A 4E38A 1TMLA 3EPNA 5C70A 4OBSA 1SFTA 4JR5A 4UB9A 2ZQTA 4C6JA 1OB0A 1OC6A 4N4QA 1W5NA 1XDLA 2P5NA 3KW3A 3T05A 4XZ9A 4ZO7A 1WCGA 2R82A 3ZSSA 3CAKA 2BSLA 3MKCA 4TOQA 4DJDA 4L1WA 3AXXA 2A79A 2JQXA 1P5BA 3T2QA 2OT1A 2G37A 2JALA 2CYGA 4X61A 4ICMA 3UZYA 2PWVA 5HBFA 4B92A 1KM4A 4GQBA 1Z6KA 4JX5A 3ZS4A 2G3MA 3PZQA 2WC7A 1GG1A 1BQGA 4ZE5A 1H3GA 3CZEA 3TSBA 3MMDA 3CH0A 4D6FA 3F1QA 3PHAA 5G1YA 4RZ4A 3RM9A 4XUYA 3O5RA 1NOWA 4REQB 2VRQA 1L2UA 2D24A 4ALDA 1KFWA 4C6BA 4PL1A 3AS1A 1W1IE 4X22A 1F8MA 2PDXA 1YRRA 4IMEA 2J75A 4XD5A 3WJYA 3TAOA 4OE7A 2HK1A 3WDJA 2WZTA 3THQA 1SJDA 2WHLA 2UY2A 3PBYA 1EBGA 4ICCX 1JI1A 3WBXA 4WQ6A 3HGSA 3M0KA 5JH1A 1IEWA 1X96A 3G22A 3F5LA 4PCTA 5CSUA 1LQAA 1BYBA 3OVQA 3ABXA 1YHTA 4QS6A 1YBQB 1WDDA 3GU1A 3SSJA 3UZJA 5E70A 3WQEA 1KTNA 2QV5A 4Q4RA 2UY3A 4C1LA 2ZZ5A 3HPSA 4MPQA 1K8XA 1E9YB 4HU8A 4F40A 3UD6A 3VOIA 4AQLA 3TN6A 4MB1A 3R10A 1G4TA 3E5BA 3MUXA 3P7YA 1O5QA 2CEQA 1NAL1 2DSKA 4HZ8A 3LI0A 3PZMA 4XISA 3S1GA 2HWGA 3EA1A 1KXHA 3ATYA 1V6TA 4KIRA 3UJRA 4XV0A 4LX4A 2PF8A 4OKDA 5EB8A 1QTWA 1FJDA 4HNCA 1PAMA 3ICJA 3PULA 3SCWA 3MMUA 1ISZA 2DIKA 3OOQA 4B91A 4HU0A 1BF2A 1XGDA 2VD9A 4JFLA 3P80A 2I56A 4I9MA 1K9TA 3DHUA 5I0DA 3U2OA 2X0YA 2PBOA 3GXTA 1NMVA 1ADDA 4S3KA 4QE1A 1GVEA 2GUBA 3VXGA 1XR2A 1SUXA 1A5UA 2QEZA 3S5ZA 1Q6DA 4L7ZA 4CQ8A 1XYZA 4IQCA 1UJQA 1FKHA 5A6JA 2QCLA 1IQ8A 4DIPA 5J04A 3B0PA 3ZR5A 4JHOA 4S2BA 2J7HA 4ERIA 1W54A 5EMKA 3JVAA 4IP5A 4RE0A 3M6YA 4DRSA 2ZE0A 2C0HA 2FQIA 4TVUA 4H6QA 1A5BA 1KGUA 2AQOA 5XIMA 3TSMA 3TZFA 3FVMA 4HYRA 1MQPA 1WKFA 1UOKA 4XAKA 2C1IA 2ATMA 5M2FX 3E0WA 3UXDA 4ODQA 1CXEA 1RQBA 3CMFA 2X2YA 3V16A 3LHVA 4TIMA 4RDVA 2OFJA 3FJNA 3CJPA 1B6CA 3RGCA 3BVJA 4ZB5A 2DH3A 3N19B 4OBTA 4LBUA 1ITUA 4TMBA 3UF9A 1MQRA 2PP1A 2ZBTA 3SN0A 1BPLB 3RIKA 3H23A 1A5KC 4IFRA 1FWBC 4IH3A 2PA6A 3P2VA 3SUWA 4CD6A 4M3PA 1TZ7A 1Y0EA 4IMCA 3NGJA 1PL9A 3MUY1 5CJNA 1JCYA 3SBFA 2CLPA 3FIGA 3QHOA 4GINA 3DDMA 2V68A 1MI3A 3UI4A 5LNSA 3NEHA 4DLMA 4QEEA 4D6IA 3U2EA 1OFAA 4C6LA 2Y7DA 3BAYA 5A8GA 3AXHA 3PTMA 4H83A 2D20A 4G50A 5EKYA 1E55A 1UR0A 1MEWA 5A8OA 3H22A 4UTTC 1GPFA 2P8BA 1H7NA 4HMNA 1S3HA 3N2TA 1IF2A 5T26A 1B31A 2Q6ZA 1XJBA 4PUEA 2G50A 3TTSA 3MWAA 4B4HA 3TCSA 3TH6A 4KETA 2A3EA 1EP3A 3CXOA 2YFOA 1Y5WA 1R47A 4A3UA 2GQ9A 3BANA 5U7SA 3KM8A 3PA7A 3WQDA 3QC3A 2ZA3A 1TCDA 2D3NA 1AD4A 2Y5EA 4OZOA 3O15A 4S3DA 4N42A 3UJEA 3JS3A 2FFIA 1UCWA 3H21A 1H63A 4GO8A 4X3ZA 2XM2A 2VEIA 1NTHA 1ZQ5A 3WQVA 2ALRA 3AC0A 3H7RA 5AOUA 9RUBA 3F4NA 1UR4A 4DJDD 2PEVA 4ATDA 2CPUA 4Q8NA 3T4WA 3UZXA 5LIXX 3OZPA 5DT5A 2NV9A 2BY0A 1EF3A 4YTQA 4IJRA 4YXGA 3ONCA 2DU2A 1ZPTA 1CB7B 3N12A 4CCDA 4ROPA 3KTSA 1IGSA 1PWMA 4QCFA 4LS2A 4GNVA 1UQYA 4G8TA 5HQEA 1C8YA 3WUBA 4PCSA 3S47A 2FLIA 4NI3A 1VAHA 3WQ8A 1W1B1 4K8HA 3SY5A 5LNVA 4S3FA 1W37A 3LCXA 1PB0A 4XKYB 1RCXB 3EMCA 4Q7NA 3CZ8A 4ZOBA 2G3NA 4JTDA 4Q7IA 3W00A 1G01A 2WBGA 3EX4A 3AUJA 2CLKA 1QW7A 3S42A 4G7FA 3ITXA 4H9XA 1CLVA 1AZ2A 3KL5A 4A6GA 3IGXA 5I3JA 2PZNA 4GGBA 1GVRA 5FJRA 1TPUA 1FCUA 7ENLA 4GACA 2FZDA 2NLYA 2L2SA 3FAPA 1VB9A 4ZODA 2P3ZA 1B1YA 3I6RA 3DKJA 4AD2A 1F74A 3KL3A 1JFHA 3L4XA 2CNCA 1TVPA 1UD5A 4GXPA 5KZMA 4GIVA 3G18A 4JX6A 4QROA 1HGWA 5KINA 2E0PA 5E9XA 1O5RA 4GNJA 3AMKA 3O5OA 1YDYA 3QHMA 5E1QA 5F7UA 3I6EA 4E4PA 1RBAA 1XLJA 3O6DA 2BV9A 2QCHA 3NQMA 1R3VA 1KKRA 3OBKA 3PAJA 4UOZA 3VIHA 2Y7FA 5HNRA 3SSZA 1YLVA 4DBWA 2V2CA 5IFTA 1PIIA 3VYLA 4XO6A 4IMDA 5DO8A 3V36A 2ZOXA 4GIAA 1TV7A 1NOFA 4H01A 1FWJC 3TJXA 1BHGA 1CBGA 3PJTA 3IANA 2ZZ2A 1RA5A 2Z0IA 4PMZA 3C5QA 3PB0A 2A7NA 3QKZA 2UZ9A 3KRBA 3PNZA 3WH9A 4AVNA 3G1FA 5FCZA 3FNDA 4WDTA 2PDBA 5AC8A 3GHUA 5AYYA 2XIJA 2TMDA 2CC0A 5DY2A 1XP3A 2Y78A 4O1AA 2QGHA 3URBA 6ALDA 1FTXA 4HA0A 1WKYA 1QPOA 3B8TA 4DWDA 3PZGA 3GFZA 1QO5A 2PLMA 3BLKA 1JDEA 3OODA 4JX4A 3GHSA 1EEXA 1MWOA 2OQHA 2WC4A 2NQ9A 2OMAA 4Y9OA 2WZIA 1DVJA 1M68A 4FALA 1H7XA 4JTUA 1CGTA 4WR3A 4GZEA 2NV1A 4CCCA 1LLZA 3V5FA 3RX4A 3LLFA 5K7JA 4OBRA 4K39A 3OOBA 2YPIA 1L6GA 4PMJA 1AG1O 4H6RA 4HVXA 4BK9A 4JIRA 4M1BA 3GNNA 3O9NA 4JTJA 4LYKA 2ZX6A 1CYGA 5K9DA 4GO9A 2VFHA 3G1DA 4PBFA 4B4FA 2FZNA 2NQZA 4RNJA 2Z25A 4C91A 7XIMA 3ZOAA 3W28A 2XDFA 4XZWA 3ME3A 4MYXA 3QW4B 4J1OA 1RY0A 1S39A 4ACYA 1YW5A 4HNNA 2GJRA 4IMAA 3S5OA 3W7JA 3G0UA 4O1EA 4L9ZA 1M7XA 1KFKA 3H2CA 2YDSA 2DVXA 5A6BA 1YXYA 1SW0A 3BLLA 2VR4A 3DG6A 3B0UX 1KM0A 4CQAA 4E0CA 1JGIA 4P7LA 3W2KA 2DUXA 3D3FA 3UZ5A 3GW0A 2VJXA 3UQAA 1ME7A 4BI5A 3C2EA 3A3WA 2X05A 1V3LA 4MM1A 4I90A 3O5IA 2Y24A 2ZFAA 5I79A 1C29A 4GOAA 1N1AA 2UY4A 5I3KA 1UD4A 2V82A 1Y7VA 3SY8A 2OKTA 2UY5A 5FSDC 2XVPA 1A3HA 4O50A 1GYMA 3CUIA 2O56A 1RLCL 2OG9A 3BLOA 4DYJA 4J28A 2VT0A 3KEHA 2FKPA 2YBVA 4QAIA 1XLGA 4DZ5A 2WBKA 5REQA 1XX1A 4JNMA 2Y62A 4DRQA 2PDHA 1DIKA 4WK9A 2XZ9A 4JBRA 1E6NA 4MADA 1Q66A 1BSLA 1TA3B 3LMZA 1GNXA 2C18A 3TTQA 1OX6A 2I5IA 3VMOA 1OF6A 4N19A 4O53A 2J6XA 1PEZA 3HF3A 2VDHA 4B9ZA 4Y8EA 1X6UA 5C55A 3KVLA 5BXPA 2AGKA 4NRRA 3NQEA 2CZFA 3LN3A 2PUZA 3VZYA 5D8WA 1FKSA 2DDXA 3QQWA 4PTVA 3WDQA 3RO8A 1UWSA 2W4XA 4X9YA 4AF0B 3CB3A 4EVZA 2DORA 2REQA 2YFNA 3D47A 3WD1A 2J8TA 3BARA 1S46A 3WX7A 1GQNA 4F48A 3NPXA 1GJUA 1V02E 4GJIA 3NCOA 3WFLA 1W3HA 3KOWA 4CQBA 1F3XA 4NHVA 4V28A 4IUOA 3PSWA 2HZGA 3ZJ6A 4YYCA 2I57A 4QITA 1D6OA 1UWQA 3Q65A 4LF2A 1RA0A 4MF4A 2NLIA 1EQCA 1RP8A 1KFLA 5TIMA 2QW5A 1E1CB 2ZQVA 1HKVA 3BSGA 1SFLA 3PZTA 1A5LC 1BWKA 5F4XA 1IEQA 2HNEA 1A5MC 1RPKA 3POHA 1LL4A 1DKWA 3EKGA 5D33A 1Q1CA 2Y70A 4EXAA 2BMBA 3E5PA 1XLDA 1XGEA 3ZIZA 2P0OA 2NQJA 3OTRA 3BV7A 3W81A 4R34A 4NILA 1GVSA 2NVCA 2OODA 3WLKX 5BRPA 2IUZA 4HNTA 2WM1A 3T09A 3RCNA 2FVMA 4L6HA 2Z6JA 3LM3A 3UW6A 4HK7A 4DF2A 5FL1A 2BZNA 2Q3OA 2QUVA 3AIBA 4Q4QA 2CHRA 3THDA 5FJPA 1AD1A 1VEOA 4FF7A 1O12A 2OLSA 4EAYA 3IJ8A 3ATZA 1XC6A 4YWSA 3M5VA 2OELA 3VA8A 3RPTA 4E3VA 1W3IA 1FBAA 4HMCA 1PCWA 1QI0A 4WDXA 1M41A 1HIZA 2BOGX 1B30A 1PX8A 2GDVA 3N2OA 2PPPA 4HD5A 3HG4A 3UG3A 1CGYA 2C19A 3HGJA 1NH6A 3BLIA 1OYBA 1F6YA 1MXGA 1EEPA 3U7BA 3O2LA 4JEQA 4ZZ9A 4JTKA 1FWWA 1F05A 4PUDA 3NSXA 3WELA 3NQ7A 5FOOA 1GPWA 1N55A 2Q8LA 1YTKA 4LQ1A 2J47A 4JTAA 3DXIA 2WJDA 4S39A 2PWGA 1EXBA 3NURA 3OVPA 3R12A 4OOZA 1S2TA 2E6AA 1E4IA 5CLTA 1QNVA 2O4MA 5A6KA 1SZRA 3BAJA 3OBEA 1V3MA 4NL1A 4F4RA 3W84A 1ISVA 4L4MA 2EBNA 1XLBA 2TAAA 1L6WA 1US3A 3SJ3A 3AOFA 2B31A 3L4UA 1E6XM 4PODA 3UPBA 4GC4A 4NQ1A 4XBSA 5C9ZA 2O7QA 4LV9A 2Z1BA 3QMSA 4W8LA 3IJ7A 1FWAC 3T0CA 2QHAA 3K4AA 4GQ0A 3AXIA 3LPOA 4UR7A 4MPKA 1LORA 3GSMA 5BMWA 3D46A 3UVIA 1HJWA 1F4HA 4QS5A 6XIAA 3ID7A 5MKGB 2WQDA 3CHVA 2NX1A 1I2RA 1FOBA 3TC3A 4IIDA 1FHDA 4C90A 2A6NA 3B7XA 1NWRA 4Q3MA 1IZKA 1JNEA 1SU5A 1Q7ZA 2A3BA 2Y8KA 4IGSA 4R9XA 3O05A 1HG3A 3SJNA 4I9JA 3CPRA 1RR2A 3AIRA 4GFIA 4HJFA 3I68A 3N4FA 3WNLA 2J62A 4GI6A 1P43A 2ZR6A 2I7GA 2XP6A 2VURA 1KXTA 5BXSA 4G7EA 5JVLA 1HN1A 1EP1A 4J9JA 3OHIA 4A05A 1J0JA 2WK2A 3M64A 5TF0A 3PBMA 5LNRA 3LI1A 3E2VA 2A7PA 1V3JA 1AW2A 3UR7A 4ZSUA 4CEXC 5D9MA 1V6UA 1NU5A 1KTBA 2EPOA 1KLZA 4DROA 4JGDA 4HYWA 1V93A 2PDGA 3DGBA 2IKGA 1DWGM 3ITGA 3CV2A 3WMBA 4DJFC 3G1YA 5BXJA 1XD0A 3SCOA 2J7CA 4KH2A 1MUCA 3BAXA 3EA3A 3NR0A 2HSAA 1K3UA 4EAMA 5CZKA 2O9RA 2VEPA 4EANA 2MLYA 2WCSA 1LM1A 4JIIX 3KOYA 2ZQ0A 3BG9A 2RDUA 3LSBA 4Z2LA 3RR4A 1Q6EA 3AO0A 1W5PA 1ROUA 2YDRA 5FF2A 2CZDA 2ZUWA 2ISSA 3LYEA 2XIOA 4O8RA 4HPHA 2I14A 1YPXA 3QJAA 3KBSA 3S6DA 5K4XA 4HK6A 3MKKA 1GTEA 3GR4A 4UR8A 2H8ZA 3STCA 1HXVA 3C56A 3GC5A 2EQDA 4S1FA 2NSXA 3GTHA 4Y96A 3R25A 4MDOA 1ZSXA 5I23A 3VIIA 1YE4A 4LVBA 4KEMA 4G1KA 5KSWA 1JRCA 4XZBA 4R33A 1W9DM 1GYLA 5C9UA 3P8IA 1WXYA 5C2XA 1NDZA 1DJWA 2KE0A 3G0XA 2WZEA 1E4LA 1U33A 4OT7A 2E09A 1KR0A 1ZENA 4WY0F 1KWGA 1EHAA 1K70A 3L65A 2XU2A 3PJWA 4BQ5A 3F4DA 3BMWA 3AZSA 3PBWA 2F8QA 4UTFA 3IV8A 2Y61A 3IK4A 3ES7A 3N6QA 1AJ2A 1A7XA 2BNJA 3MQTA 3B06A 2VEFA 3S6OA 5FEZA 1M9HA 2EJAA 1U30A 3A4AA 5A94A 2DY3A 4UQEA 2DZTA 2YCLB 2DSVA 4QDPA 4J3XA 3PWGA 3UT0A 1QWKA 3B04A 5D4YA 5EFFA 5G2HA 1IR1A 3QHNA 5GPRA 1P4CA 5DIUA 4NAFA 4F0HA 2PV3A 1OG6A 2PLKA 3W6MA 3CHEA 4DZIA 2ZWZA 4IZGA 4NIRA 1A3WA 1P0DA 5TAOA 5LA1A 1ZJIA 4LH8A 2DUAA 3HGOA 3EOEA 4FOUA 4C7FA 2DPEA 3ITYA 1A4LA 4ZTYA 1TUXA 5HW7A 3PN8A 3MP5A 1G67A 1US2A 4QQ3A 3T0BA 3WEZA 4HU4A 1E70M 3EOLA 2RH9A 4C7DA 2R1NA 5IDIA 2CESA 2ACUA 4DXXA 3EDDA 3VCCA 4ZPVR 2AMXA 1WPCA 5EA9A 5CJ5A 4TW6A 4RE3A 3F4VA 2JKAA 2YGYA 2DFAA 1X8FA 3SIZA 3M5ZA 3SCRA 1MVYA 4Z1YA 1Q6OA 1PZ2A 1Q2SA 2GOKA 1ALDA 2BXYA 1DBTA 1XD1A 1FWEC 3VINA 4GXWA 1NDYA 3S5NA 3W07A 1H7PA 3PM6A 4W4QA 1UUMA 3EDEA 2FGBA 2HDJA 1XRFA 3JYJA 3LENA 2Y7GA 3EEZA 3RK8A 4S23A 4FP1A 1BRLB 4Q4SA 3SGGA 3SUVA 4EPDC 4MWAB 1ZL1A 5EMJA 3STFA 1I2PA 2G3FA 2ISFA 2CITA 3N6JA 5A6SA 1JUBA 1M6JA 2PN0A 3P67A 2OOGA 1SQ7A 4DY1A 4G2DA 4KR0B 5CH9A 3WLHA 1FH7A 4R53A 5I3IA 2OFNA 4CQ9A 3MC5A 1EYMA 2I1OA 2YL9A 3M5XA 2VGGA 4AZCA 1DPMA 3CQIA 1L6YA 4YNGA 1H60A 2X09A 2ZZ4A 4MFDA 3R1ZA 3VX1A 3T2OA 1UB3A 3BURA 1HQTA 5K9XA 1OEPA 3HG2A 1VRXA 4UTLA 4NUWA 1XCXA 2OB3A 1HKJA 4MNJA 4CLMA 1YW1A 4PTXA 1SJBA 1YXCA 3UCQA 3GLCA 3MUCA 1V7YA 2YL6A 4GUIA 3U5YA 3P62A 5H8MA 1S38A 4JY8A 3O07A 3CAQA 1PX3A 3RR1A 4FNSA 1FDYA 2WNWA 3RF9A 4AHOA 1FWCC 5JMUA 1KCKA 3WNMA 1OWQA 3TDFA 4F9DA 3W83A 1Q7MA 3BW4A 4XZNX 1JFXA 3TR2A 4LAYA 3I65A 4AHQA 2ODOA 1FKBA 3C2FA 5BW6A 4PUNA 4DJEA 2OYKA 1UR2A 3O5QA 5D9OA 4WSKA 1JG9A 4QT3A 2V8ZA 3ISIX 1HX0A 3TX9A 4L80A 4GWEA 3TN3A 3W88A 3QPYA 3VGHA 2W62A 4JTRA 5LSMA 3NYDA 1XW8A 2H90A 4NP7A 3GZAA 1XQLA 2ABAA 4Y90A 3ZSTA 2Z24A 2F84A 2DSZA 4PTNA 4CQDA 4RK8A 4L6DA 5HWCA 5LIWX 4B3KA 4HPJA 4FNQA 2D0GA 2HBXA 1XQKA 1KT0A 1WYIA 2POZA 2BXZA 2GVYA 4DZHA 2J4GA 1D7IA 5ABEA 2VX4A 1VYSX 3G2GA 1S1PA 3GW3A 1WKEA 9XIMA 4KFPA 1UD6A 3ES8A 4MB4A 3AMLA 1VFSA 1H0GA 1H5YA 4E2OA 2RUSA 2BOFX 1K77A 3TCZA 1V03A 4HNOA 5AYZA 4JYEA 2Q8ZA 4L6OA 4AWSA 1JCMP 2VC5A 2X16A 1QWGA 3SRDA 1WDQA 1EZ2A 4GK8A 5BYWA 5HOSA 1QJWA 4GX9A 4P8UA 1GOXA 2HEJA 3PVFA 3W1RA 3V0UA 1UC4A 1ZP4A 3C3UA 4QJ3B 3REQA 1I1XA 1E56A 3UQIA 2MNTA 4N6EA 4ENLA 3AAMA 3OLGA 5H2ZA 1YE6A 1G7VA 1ZJAA 1OX4B 4FXRA 1R9XA 5I6SA 1DWIM 2BY3A 3QMRA 4UDMA 4AZBA 1JCHB 5AHNA 4AMCA 4PMVA 1B3YA 1XLEA 3ARSA 1UROA 1KTCA 1VLIA 3TK7A 3F4CA 1B3XA 2WB5A 4L1GA 1OD8A 3UXLA 5TQLA 3E2SA 1LROA 2EG8A 4IF2A 2AKMA 1OCQA 1EOMA 3L9CA 1QUMA 4V15A 3PPHA 4HPXA 1I0BA 4PTWA 1IXPA 4BQ2A 3CL7A 3IKDA 1GVOA 3IVUA 4AUBA 5FF7A 3E6EA 1MUWA 4QG9A 4PEEA 2LGOA 1DIEA 3RGTA 3AU6A 1W1PA 4UTWA 1U79A 1GOKA 3RJYA 3HQNA 4B5TA 4ZPWR 1ZCNA 4PMYA 3GO2A 1GG0A 3D6NA 1I75A 2ISVA 4MNLA 3WBWA 2J7BA 4P7NA 3OPSA 2VELA 2E1WA 3TC7A 1W31A 3UCDA 2WKJA 1UHVA 2D2JA 3WK3A 3B97A 3VOFA 3H2AA 4ACZB 1ZBCA 4L56A 3PTDA 3G5EA 4Y8FA 1BWLA 1H50A 1GW9A 7ODCA 1ITQA 3A24A 3I7RA 3V5OA 3IACA 2O9OA 3P93A 3LHTA 2Y63A 4RPQA 3NNTA 1J0YA 1RUSA 3BAIA 4RXFA 3LQGA 4LUSB 5CG7A 1LUCB 2G95A 2ZRUA 1TO3A 4EP8C 4NZ1A 2XIMA 3L2MA 2QMKA 3PWAA 2PWDA 2WLYA 1WDSA 3TR9A 2A2IA 4HCHA 3SQSA 3BCJA 3EWWA 3L5MA 1XBZA 4XQ6A 5CZJA 1R2RA 4B3ZA 4TTGA 3UXIA 3EDFA 3W25A 7REQA 4ODKA 4ZQMA 3QM3A 2XFRA 2QR6A 4PCNA 1YIXA 2PZ0A 3NZRA 4O28A 2W63A 3A21A 1BWVA 2GQ8A 4DF0A 2FDSA 3A23A 1S1RA 3VMNA 4UQ9A 2PDMA 1OK6A 3WF3A 4G2PA 2X1IA 5GQBA 1QOQA 1EJXC 3R89A 3WZ0E 3MWCA 1E5NA 1ENUA 4H6EA 4UQCA 3K8LA 2FZ9A 1TRDA 1OY0A 4YTTA 4BY3A 1OFBA 4XO7A 3FSUA 2C0AA 1F3EA 2VCBA 1LG1A 1YMYA 2G3IA 5CZ0A 1UC5A 1F61A 1NEYA 1VS1A 1VENA 3GKAA 1F07A 4MUZA 4F0MA 3THUA 1OYAA 2BVDA 2OEJA 4KFOA 3OA3A 4AYSA 4J3VA 2ADAA 1E72M 3RCMA 3THCA 1IHIA 2X2GA 1IEXA 1W5OA 2VEGA 3RPMA 3URNA 3MSGA 4MYAA 5CBIA 3LCWA 3HN3A 4EXQA 5FJTA 3JZUA 2Z7KA 3K1GA 2W67A 3LTSA 1TUFA 4GVGA 3QOMA 5LNWA 4KMQA 4J4KA 3UQNA 4YMZA 4BS0A 2HQAA 2VZTA 3GQYA 3APTA 4ICNA 4HBEA 2J78A 3L66A 2OQYA 4RZBA 1XHGA 1HKKA 4J35A 4REQA 5GNYA 1QR7A 2E1DA 3ODKA 3W7EA 1EJWC 3RDKA 3MBDA 1F6PA 1PDZA 1RJPA 1QU4A 5LZLA 4UMBA 2CERA 2XN0A 4KWUA 5LXEA 2HPMA 3QYSA 4XSLA 1TVLA 3VD3A 4DJED 1XBXA 3BC9A 3RXZA 2QCGA 3V0SA 3DC0A 1BF6A 2YX0A 2X30A 5HJYA 1ZBKA 3FXGA 2GWNA 1I60A 3NO3A 5D75A 2E8YA 3JUGA 3IKGA 2A3LA 4FF5A 4XZIA 4HHPA 3CIVA 2HISA 3GFXA 2JZVA 2CZ5A 2GVJA 1W26A 4MWAE 4LEQA 1EYEA 4UXDA 1R3SA 4DXVA 4J7RA 2WNQA 3M0IA 4F0LA 3RRAA 2AL2B 3EGJA 4W7VA 2ZC8A 3P60A 5C9RA 4DJDC 4PBEA 3OU8A 4Q8MA 4GC3A 2YR1A 2HV5A 1B9ZA 3L5LA 4KBXA 1QZ2A 1CDGA 1POKA 1ZU8A 1EJSC 3PUGA 4CNOA 3OLIA 5FSEC 4DRPA 2AL1A 4JIEA 1EIBA 4AXKA 3V0TA 3R7MA 3W73A 3UXAA 2GUYA 2NW0A 3W7CA 1DEDA 1KCXA 4KIEA 1I6NA 2PP3A 3DCPA 2PC4A 1NFBA 4RR4A 1DJYA 1ITCA 2XZ7A 4GUFA 4H7VA 1HKWA 4HP5A 3VKBA 1FXQA 3H8AA 4NNBA 5KETA 2E9BA 3TW6A 4U33A 2ACQA 4NZ5A 3WLMA 1JCXA 5AHLA 1AFSA 3GVWA 4Q4PA 4CU7A 2JFEX 1RQHA 4NZFA 1Y8BA 4JFTA 1R9YA 1KV8A 4Z1CA 1QPRA 1A0EA 3NXFA 4W85A 2XVNA 4DIAA 3VC5A 4DYKA 3OZOA 2PF0A 4JN8A 3A9IA 4E4UA 1OGGA 2VD8A 4O52A 4ZQPA 1OFRA 1J9YA 1VJIA 4KEZA 2YDAA 4YVVA 2DH2A 1VCVA 4CVWA 4L4PA 3GY1A 5F2GA 3CHCA 3BZJA 1BG9A 1UZDA 5DX7A 1DJXA 1FDZA 4AD1A 1U5HA 4S3AA 4PRTA 2WSQA 4EWJA 4GHRA 3WFZA 1VIZA 2V6AA 6ENLA 4R85A 1GYNA 2E5CA 4BCEA 1UKOA 2OSWA 2XN2A 3O7UA 1BQCA 2RUQA 3A4XA 2BODX 3PBGA 2PDLA 4U3CA 3EB2A 2KO7A 3GS6A 2R24A 3G1SA 2X1UA 3AMCA 1NJJA 1FP8A 3QF0A 4HGXA 1MFVA 2VFGA 2K8IA 4AY7A 3RG6A 2W9MA 4C6CA 3U2ZA 1J4HA 3KDOA 1W1TA 3HJEA 1W0MA 5HMFA 2VGIA 4RW3A 3MSDA 3W7HA 4KF1A 1J11A 3TXVA 4JTGA 4JFMA 3VGGA 4KEUA 3G6LA 1V02A 1R3WA 1E0XA 2V5DA 3NL2A 3GYCA 4E3TA 1FWHC 4DUVA 4W88A 3MANA 3ARYA 1A80A 3W86A 3A9BA 2E6YA 5JH2A 2DEPA 4QDWA 4FNUA 4HMEA 5K2ZA 4JFUA 2FH8A 3GDRA 3IJ9A 2INFA 4J3TA 4BKNA 4WIWA 3UYIA 4D6EA 3UETA 5EMUA 4QX4A 4AB4A 4B5VA 3FA5A 4GYPA 3VABA 2VX5A 2D2GA 4WJEA 4LNYA 2HBVA 1FKTA 2QS8A 4IIEA 3QGAC 4GKTA 2IPGA 4OTKA 4M6PA 3CK5A 1TFVA 4Z2HA 1XLHA 2VO5A 1EGVA 1HL8A 1KWKA 3BH4A 1H11A 3WNNA 3QH2A 3H53A 4BZYA 4AWUA 2OJPA 4HSOA 1MDRA 1GW1A 5BNKA 1B90A 3IIZA 2YW3A 4DZ2A 1IEIA 2XP8A 3W6YA 1K9DA 3TYCA 2FJUB 4DT4A 4YWIA 3WNOA 3KWXA 1ZBWA 4QDMA 2O4QA 4E5TA 3II1A 1ZRQA 4FR6A 4MLRA 1LG2A 4IQJA 3K46A 1S2UA 2WSRA 2BWGA 1XLKA 3WY1A 2GSJA 3GWQA 4L1XA 4LTSA 2GJPA 3W7GA 2PPOA 1JZ4A 5J5DA 2WCAA 1G4EA 2WMHA 3CM4A 3P0XA 3KLLA 1FHLA 4E2VA 4DWSB 4P61A 1X7FA 1UKTA 2ASHA 3UEQA 4FA3A 1PKLA 5BOOA 3S6TA 2WMFA 4B5SA 3WMCA 3QTGA 2FDMA 4RCXA 1E0WA 3W2NA 1MEIA 4DELA 3CIXA 3FYOA 3CPGA 4D1JA 5HUOA 4QJ4B 1MFUA 4U2ZA 2QIIA 1UP2A 4S3JA 4XKYA 1ECQA 1QHPA 4M19A 2ZX5A 4W7WA 2Z2UA 4W9OA 2IKHA 1FHVA 3NQFA 1QK2A 3CL8A 3JXVA 3SCVA 1XF0A 2XH0A 3UU0A 1YADA 5AHMA 4JFJA 1RY8A 4OECA 1GKQA 2XH4A 1XRSA 4A8LA 2WYSA 3O16A 2VFEA 1W3JA 3EWZA 4NKCA 3E02A 5E5CA 3IWPA 3KRSA 2VI0A 3ANVA 4IT6A 1WO2A 4DO7A 5AZ1A 4E2BA 3VNJA 4W93A 2Z00A 1UA3A 1E6QM 3C0SA 2DZVA 4A3RA 1N2VA 3DYOA 3TU9A 3ITOA 3AWNA 2SFPA 2VP8A 3CHFA 5DITA 4LAXA 1U1JA 1ROTA 2OPJA 5A8NA 2FKEA 3I3BA 1UH2A 2PWEA 2MPHA 1QHOA 3AI0A 4X2PA 1K6AA 3EMZA 4NYUA 4UUIA 1SMAA 4URIA 3L2LA 3TXZA 4NYYA 3NQ8A 1QHZA 3DZ1A 1J96A 4JKMA 4WZHA 3WDRA 1D2KA 3WLTA 1R3QA 2VUNA 1QFEA 5DXYA 1R5YA 2QMJA 2XP7A 2XGBA 2I9UA 3UG8A 2WPBA 4UOJA 2NZLA 1XRVA 4IPIA 1LRTA 4MAZA 1H1ZA 2B81A 2FHFA 3GVVA 2EKGA 4AC1X 1ZFJA 3UR5A 1FFRA 1JAEA 3AMGA 3W7IA 1SMDA 1V79A 2GDQA 3LPPA 4WOQA 3W1UA 4HSNA 4IP7A 1RJQA 1TJPA 2RGLA 3ANYA 4IX2A 2V5CA 1Z89A 3IIVA 1K7FA 2J8FA 3COTA 4JFWA 1QI2A 4Q6XA 1DE5A 3TQPA 2NUYA 3P81A 3KADA 1JD9A 2H9AB 4U86A 2HE8A 3QMTA 5T91A 2OO0A 3IAPA 5HJXA 1OFDA 2C71A 2YZRA 4IQDA 3S5YA 1CW2A 1GVYA 3CV6A 1UZ4A 1J93A 4RNIA 2D3LA 4DRJA 3MDWA 4IX0A 1L1PA 1PHQA 2Y1HA 4NAEB 3TWBA 4GABA 1XXXA 3OJGA 2F7FA 3DC8A 3W6LA 3T8QA 1P48A 2GYIA 4H8NA 5H1WA 1TWDA 4LAMA 4HU3A 2VCDA 2DG4A 2HVMA 4XD4A 3H4WA 1VFLA 3VUSA 1HUVA 1N7KA 3O6YX 2WLZA 4R7OA 1QPFA 4HKPA 1NARA 1J2WA 1Q6FA 5AYIA 1AQMA 2ON3A 2PV1A 3E0LA 4C65A 1JUKA 3GB6A 2QUMA 3GRIA 1UP3A 2Q71A 4DN1A 1WXJA 3CGNA 2OWXA 4TNSA 4DRMA 1CXIA 4LOCA 1HF6A 1BXNA 2Z2BA 2TSYA 4BF7A 4NZ3A 4GUGA 3G1RA 3QGKC 3E96A 4YIWA 1ZLPA 1UD2A 9XIAA 1UWTA 1Z69A 5C7VA 4LJ3A 3TTEA 3T4CA 3O5JA 2QCDB 3T42A 4N9DA 3WUFA 1SJCA 1TX0A 1XIFA 2C16A 3LCHA 6CGTA 3DHPA 3BQ5A 4LY4A 4GJ1A 2XPAA 2CU0A 1DWHM 1FKKA 5GPGA 3KBNA 3LX9A 2ACRA 5CPNA 1AL7A 3T0AA 1EC8A 3N6HA 4WDWA 1XG3A 3TWAA 1Q8AA 4K37A 1PWLA 3H4XA 5AKQA 1H41A 1VEMA 2GVLA 4HBKA 3IPWA 1HJVA 4YU1A 1XIEA 8XIAA 5LYRA 4EF8A 1M7PA 2IXUA 2IPJA 5BOEA 1B3ZA 4MVAA 1VPXA 1GEHA 2AKZA 3W7OA 2XN1A 1TA3A 1LWHA 3M9YA 3AICA 4MNMA 4H9TA 3OG2A 2PDJA 1Y65A 4M1RA 1HJUA 4I3GA 3T81A 4UTTA 1EIXA 3GU9A 2X1RA 3AIWA 3LB0A 3QPEA 1TMHA 4Z17A 2F9RA 2VL4A 4PULA 4ZB2A 3DFNA 4FMVA 3VILA 2OLAA 3E2RA 4GPNA 1V08A 3H70A 4G5DA 2XSXA 2XP5A 4ZSTA 3TOYA 1W1YA 4QM1A 1W3LA 2AQWA 4AF0A 4GI9A 1TE6A 3TSDA 2JF7A 4HNUA 1OX5A 1TR1A 2DQWA 3L7RA 3CUFA 5AY7A 4KWSA 5FJJA 1PJ9A 4KERA 1VZWA 2ZC1A 3EDJA 4RLIA 1JXKA 1ECEA 2VR5A 2J7FA 1DWJM 1LL7A 3UVAA 3ZZ1A 2BHUA 3DFSA 5HKGA 2PU0A 2QDGA 4NU7A 3BZGA 1QNOA 4GD0A 1VEPA 2EPLX 1J0ZA 1TMQA 4O19A 1E1CA 3WMSA 2OZ8A 3POCA 3VU2A 3EB3A 1FKJA 3VM5A 4A8RA 4GBDA 1OC7A 2YL5A 3PPGA 3GHTA 1AODA 3AYRA 3O0FA 2PGWA 1TQJA 3KCOA 2E77A 3PPFA 1XYBA 3V18A 3IIOA 5FJUA 3KHDA 3PNUA 2ONEA 3W23A 4IMFA 1JZ3A 5G1TA 1DXIA 4Q33A 1ISXA 1HJXA 1UIPA 4PUKA 3TP4A 3GXMA 4JNYA 4O1FA 4M80A 1JPHA 2YXGA 3DHFA 1F40A 3HURA 1GZ1A 1E43A 1SO4A 3LHYA 4WEVX 1OT2A 2G4FA 1RSCA 4K2SA 4DX3A 2YYUA 3WLQA 3EWCA 4IP4A 2E25A 2YDQA 2O7SA 1B9BA 2MUCA 5D2VA 1RVKA 3M41A 3BAWA 4IPNB 3F5KA 2QJJA 1VQTA 1IV8A 2RUDA 2FHBA 3DFYA 3LXCA 3MHUA 3SUUA 2M08A 2A3HA 2HS8A 4PB3A 3W2UA 4PR4A 3W71A 3PUDA 3QGVA 4C02B 2DW7A 2RFGA 4Y2WA 1HVXA 3MUAA 3SQLA 1JZ2A 5GNZA 4RUBA 4CUCA 2C14A 2QF8A 1OADA 1FUYA 4CQCA 3RLUA 2CETA 4IPLA 3B8WA 2QJNA 3NDZA 2MF9A 1OM0A 3OGVA 3GZ3A 2YIHA 1MZRA 3MYPA 2WSKA 2Y88A 5LGXA 3ARWA 2X0SA 4MGVA 4Z2IA 3PK7A 3FLUA 5DRIA 5CSYA 3DU0A 1PIFA 3BPWA 3MTWA 3MSYA 4Q4KA 2W3ZA 3S2LA 3GIPA 1JCJA 1FWFC 5IDZA 4O57A 3T44A 2Q01A 3TN5A 3H2FA 1F7BA 1E0VA 3VFCA 3KFTA 1MNSA 3EPMA 4KWOA 1DQUA 2V3EA 1AW1A 1XIGA 3LA4A 4N7QA 3TYZA 2QPUA 2F23A 2TRSA 2CBVA 5G2WA 5LIKX 5LA0A 4GI4A 5D32A 1EQPA 1FVPA 2E6DA 1SR9A 4I7UA 4WJ8A 3L0GA 2IXVA 5MKGA 5M1TA 3S2JA 1ODUA 4AY1A 2CCRA 3GM8A 1KLYA 3RFWA 3O5LA 3UI5A 4O4WA 4MZ8A 4ZBCA 3UA4A 3FDKA 4KW2A 3KBWA 3S2MA 3TE9A 1OJXA 4IFOA 4IPJA 2Z7GA 1YKWA 1ZJBA 3KRUA 1VPYA 4QLLA 1E1EA 3ZT6A 3ZYZA 4UTUA 2RDWA 5I06A 3W7QA 5G2IA 3LPGA 3GH5A 2QJIA 4UFKA 1S5TA 2EPKX 1Q4WA 2QVHA 3SGZA 1E0UA 1PCKA 3P8JA 3O6CA 3EPOA 5AC6A 3MUIA 3G1HA 2ZUTA 3W1MA 1JPMA 2PPNA 1F76A 6PTDA 5HUPA 4GY1A 5GNXA 1HT6A 5DT7A 1H61A 4FXFA 1BXCA 1BTMA 1X7IA 1FKWA 3UJFA 5FF3A 2VHLA 3GTNA 3MP3A 1OFPA 3A12A 3KTXA 4GYFA 4DM2A 2BDQA 1WAWA 4PMOA 4GMEA 2CW6A 3IJQA 2P4VA 1T40A 5C54A 2O9TA 5IHRA 4HPGA 5JH8A 3QC0A 4GKLA 2YCKX 3B9OA 4UTHA 2GZXA 5CLWA 1GOMA 1XRTA 3M7SA 1P6CA 1TTQA 2WKGA 1XINA 4Z2KA 3AYTA 3EX2A 5T9BG 3KWSA 2E4TA 3FA4A 4A3QA 4U5KA 1E6SM 2QDEA 3QR0A 4MIMA 5FI8A 3S83A 1E9LA 1PKNA 1BAGA 3MYOA 4A29A 3CUXA 2HXTA 2OEKA 3WLSA 3H54A 3RRXA 1Q3NA 2W6RA 4PB5A 3S4TA 5K9CA 1BKSA 5EBUA 1HL2A 1Q45A 1UQZA 1V6WA 1YTEA 2QLYA 1JGMA 4PFMA 3MO7A 2X0HA 4GI8A 3AS0A 3AFBA 3NEVA 4DPPA 3I4EA 4L4LA 1D9EA 4OUIA 4ODNA 4LAUA 2KR7A 2CLHA 5A1AA 3M6DA 4DBEA 3QSRA 5A2AA 1JDAA 2XWDA 3HU7A 2QDHA 4RZ5A 1NWTA 1YPIA 3SZ8A 1O5XA 2X42A 3NWRA 3NQCA 3R8HA 5IRPA 4ZO9A 3A47A 4ZTXA 7A3HA 2J66A 1QPQA 1XIHA 4O14A 1XSJA 4DQWA 2EPHA 4PTDA 2YKKA 3ZXWA 3CGMA 3ABSA 1ONWA 2R1KA 4O1CA 3MJYA 4AFYA 2OEMA 1V77A 4JAWA 3DHDA 3TC5A 4ROQA 3BLPX 4OOUA 5C9XA 3G1AA 1QASA 3KXQA 2J8GA 3W74A 3FJ4A 3F7JA 4H8HA 4MB3A 5DMNA 3Q4DA 1N82A 3WDIA 2ZUMA 2BFGA 3C2YA 1AVAA 1S5VA 3IK2A 3BMXA 1JDDA 3W3OA 3EWYA 3C2RA 4GUHA 1ZUAX 2YCLA 1XSKA 1A49A 2CLMA 2DVUA 4AZGA 3MVTA 4NXKA 2OO6A 1K4GA 2UZ5A 4IGMA 1K6WA 3OYXA 4IOTA 3IRSA 3U4AA 1XM3A 4K36A 4LPCA 3KAHA 3OVGA 4GQGA 5D37A 3PTKA 4GNKB 4HT3A 3SFKA 3W2LA 2FMNA 1VBUA 3W7MA 4P7RA 1LRQA 4ATWA 1PDYA 5FL0A 4JIPA 1GJPA 1WV2A 2CLIA 4O18A 4ECLA 4ADUA 2VVSA 3OBAA 4X60A 3EOSA 2DG3A 3TUUA 1LBMA 3BO9A 1OFEA 2XVKA 4LB3A 1MQQA 3KAIA 4FAPA 4B16A 1OF8A 2FH6A 5I09A 2A6LA 4IG2B 5AC7A 3TYEA 6XIMA 5JBDA 3NPWA 1SVDA 3M44A 2XHYA 2FIQA 3NQBA 3VMPA 3AU2A 3NL6A 1R9ZA 3VNKA 1UUQA 4QSFA 2BBFA 3N1AA 3ABOA 4GIYA 1UZHA 3L4WA 2NT1A 1UMLA 4NZCA 3ZT5A 3GDKA 2P3EA 1J6YA 1BRLA 3ZM8A 5AYXA 5JXQA 4OWGA 1H51A 1EH9A 3OVRA 3TYBA 4MWAA 4ZXLA 3DKLA 3UPMA 4GUJA 4BF5A 5JU6A 1V3KA 5I77A 3PG9A 2B7PA 3C61A 3LOTA 3H4GA 2DSUA 2I5QA 1I2QA 1FCVA 2WCGA 2REQB 4O0QA 4AYGA 2OTDA 5DFAA 4DUWA 3CEUA 2QV4A 3LNMA 3FKRA 3M0VA 3A64A 1LLWA 3IUHA 1W9BM 3O6AA 2OOFA 1O6IA 3EKLA 3LM7A 1ZCCA 3GG7A 4LUYA 3BLEA 3CLWA 2W91A 5HAOA 4LUTB 4LAKA 1RD6A 3U5UA 5DEZA 4J3SA 1KCLA 5C6MA 3CEPA 3V1PA 2QCEA 1SFSA 3GC4A 1P6BA 1Z32X 2WHMA 2CFFA 5E93A 1LWIA 4YTRA 4GG9A 3R58A 1P7TB 7TIMA 2XPBA 3FKKA 1Q6UA 3JR2A 1EC7A 3USBA 4TTUA 5EBAA 2PU1A 4AIBA 5I24A 1Y5VA 3B9NA 1CXFA 4XTIA 3OLEA 4BFAA 4ZQNA 3NSMA 2P8CA 1XH1A 1YXDA 2ISWA 3OLDA 4C1NB 4HHHA 3W26A 3LBCA 1PBGA 1LOSA 4Q8UA 4XSMA 4W8AA 3T8LA 4Z2JA 4NX5A 1D7FA 1TCMA 3ABQA 6A3HA 2PS2A 3VGFA 3BOLA 1XFBA 2JKPA 2VUYA 1RBLA 1WUFA 2WQPA 2ATSA 3WQ4A 2VC7A 1M7JA 2R8WA 3V1HA 4ODMA 3XISA 4FLRA 3VIFA 2PTYA 1Q6LA 3K4DA 1WP6A 4QISA 5U4NA 5BZAA 3M1ZA 4DI8A 4JFIA 3WL0A 5D8ZA 1ZBVA 2C13A 4QZVB 2QF7A 4LW7A 4ML4A 4N9CA 3TFCA 3L12A 4JTSA 4GCAA 3SCTA 1SYTA 2BOEX 2DZUA 4O1BA 1IWPA 3CIWA 2TODA 3Q94A 3WF1A 1CGUA 5AECA 1MW0A 4UCGA 4MJ2A 2ZRVA 3TFXA 3UQBA 3GR8A 4PA8A 4E2DA 5CBBA 3HOJA 4AIEA 3EWUA 5KZ6A 3QFEA 2Y5SA 1O60A 2OR2A 2BX7A 3UI6A 4B90A 3HMJG 2PTWA 5LXXA 1FRBA 3QKEA 4KGJA 3WEOA 5EYWA 2V63A 4JQ3A 4O1DA 2NWRA 1O7AA 1OC5A 1WOAA 3WL1A 2WAGA 1HJSA 5FIPA 1QOXA 1JNSA 4ITZA 2PTXA 1OX4A 2HVNA 3OG3A 5XIAA 4LYRA 3K8KA 4PRRA 1CECA 2X40A 2ZDSA 4FB7A 3TONA 4ZS6A 8TIMA 4JNZA 4JXCA 1EQ3A 4NRSA 1E71M 1PKYA 5D2XA 3SRFA 5F2LA 4A35A 1ONEA 5A69A 4UWMA 3OEXA 1AJZA 1XLMA 4XAYA 3FXYA 4Z08A 4DJEC 2CXEA 4PRWA 3SI9A 4GA8A 5MF5A 1RXOB 3S3GA 3B8DA 4PUJA 5K3VA 1WX0A 1E44A 4W9PA 2PV2A 2RJHA 2VYOA 4FIQA 3T08A 1C93A 2ZZ7A 4PCFA 4D71A 3V5CA 4CD4A 4N6FA 3KOZA 2G41A 5A8PA 3PF3A 3CNYA 4JL1A 4HBOA 1Z42A 1ZGDA 1DJQA 2EPNA 1W91A 1GOIA 4H4IA 5I7GA 4O0KA 1T0OA 4DO6A 3ZVHB 2ZRXA 1KM3A 1J12A 1CLXA 1Q6GA 3VZXA 4DEFA 4DRNA 1XLLA 2F61A 1UOZA 3PR9A 2GJLA 1QNSA 1VLWA 1T8QA 3CB8A 4H8VA 3K30A 1LLOA 3QQ0A 1W9UA 1HP5A 2UBPC 4F8XA 2B7OA 2G96A 4GIRA 3FX4A 1ICPA 2A0NA 4IXHA 1D7KA 3OIXA 3CQKA 3DEQA 3LCIA 4IISA 5PTDA 4HA4A 1CX9A 5FA5A 3H2NA 4Q8WA 1PX4A 3VDCA 1XFCA 4F2TA 1TELA 3DIPA 5HQMA 1V5XA 3CTLA 4WGHA 4WX2A 1T6MA 1U5JA 4IIGA 2R14A 3CYVA 3G8RA 1R86A 3LRLA 4XB3A 1EA9C 4ASTA 3UG5A 1HZYA 4JKLA 3OO2A 4LUSA 3WD0A 2LKNA 2WNNA 3H2MA 2ZXDA 2F6XA 3VUPA 2PDKA 4YN5A 2WZMA 4LFYA 2RUCA 4E8CA 2JKEA 1E6RA 2W66A 2W27A 2XH7A 1EBHA 3TV8A 1EYWA 3FGCB 3TEVA 2PDWA 3TKFA 4HHLA 1TTJA 2CKSA 1GQKA 3ZMRA 1OG0A 1KM5A 1FDJA 3PSVA 1EHNA 2WMIB 4O16A 4WD0A 3LBOA 4TXEA 1NSGA 3L4TA 2QXWA 3U3HA 2CWXA 1V51A 3JZEA 3SADA 3I3DA 4K8EA 4UTWC 2Y8VA 4GQQA 3VIJA 4TVCA 1TJRA 3QVQA 2J27A 2D0HA 2VC6A 4UFLA 4UR9A 2J7DA 1EDGA 1QBBA 1QBAA 3FYYA 3LCLA 3B03A 2QUUA 3E12A 4AZ5A 4N9BA 1FWRA 1SPQA 2CBIA 4MWAD 5DBUA 1LTDA 1TV4A 4WRHA 3FW6A 3K1DA 1FWNA 1ESWA 3EOOA 3AJXA 4H9UA 4D8ZA 1TREA 2ZIDA 3UZWA 2E68A 1F5ZA 3QOKA 1VBHA 1XIMA 3G24A 3DI1A 3KOFA 1L8NA 2F21A 1YDVA 5E6YA 1R0MA 1XLAA 1DORA 3W4RA 3CL6A 1J5TA 3C4UA 1R30A 3D5HA 3VNIA 5G5IA 4PEKA 1DQXA 4J5NA 1HXJA 1M3UA 2JGQA 2A4AA 1GQIA 3NAVA 4UIOA 3PJUA 4K7YA 4LXFA 4U5IA 3GDBA 4D8AA 4TQTA 5A6AA 3GNRA 1F8IA 1H0IA 2JBMA 4Q8PA 4L4OA 1UR9A 1JAKA 2HMCA 1JPKA 4DM1A 1DP0A 3MS8A 1V3HA 1WZAA 3P14A 3BJSA 4XKMA 5JIPA 2ANUA 1IYXA 2I9EA 3OIHA 1K7EA 5A8MA 4PL2A 2GOUA 3W1TA 4G56A 3IK8A 1OGSA 3W7KA 3T6CA 1JCLA 3WH0A 1EX1A 2C7FA 1Q85A 3SB0A 1C8XA 4QSHA 3KUMA 3UG4A 4XAPA 3KVKA 3LMYA 3AYVA 3BTNA 4ORMA 3FEMA 4JIQA 1TTIA 2QCNA 3AHZA 3IJLA 3KRZA 4HZ6A 1BSIA 5EMLA 6REQA 3D3AA 3SRHA 1NVMA 1UYQA 2J7EA 3TTYA 2V2DA 4CN6A 1J2BA 3LQLA 4GVIA 1HFBA 4IQ2A 1MW1A 1CXHA 5FAGA 1UW9A 2EGZA 3VDBA 1G69A 1YNYA 4YCPA 3CO4A 3MDUA 3SN4A 3SQMA 1LJYA 3MSRA 3GG1A 2X41A 1XH2A 2F6UA 4JQ1A 3RX2A 4DNMA 1JIBA 4NG3A 2AL2A 1FQ0A 4GVHA 3W1LA 3R5EA 1R7AA 1JL8A 3SIMA 2AAMA 1XC4A 3E74A 1YQ2A 5A6TC 1RK6A 1X1NA 1X97A 4PH6A 3GTXA 4FPSA 2P1FA 1F8AB 1Q8JA 1R9HA 1DTNA 3WF2A 2D2OA 4TVDA 4YVXA 4WVXA 1O66A 1U1HA 3IIXA 1T8XA 2XGIA 3CUZA 2YXOA 1D3CA 2FVKA 3WQ5A 1HKIA 3LXBA 1PIGA 2QCMA 2WANA 2VFIA 3W2JA 4NVTA 3EX6A 3H7UA 3W22A 1ITXA 4A21A 4LAVA 2IKJA 3S2CA 1BYDA 2GL5A 3ZT7A 1AMYA 1TQXA 4AZCB 3W1NA 4MKNA 2O92A 5D9NA 2OX4A 3U0HA 1K02A 2A1YA 3S9YA 3VC6A 2E7FA 3VPLA 1UKPA 4GISA 2Z1SA 2GK1B 3MO4A 1JXJA 5E0KA 1WAUA 2GQ3A 3MU7A 2CLOA 3K13A 3K8MA 4K7VA 2YBTA 1JYVA 1XSIA 3IUIA 3VOGA 5H8PA 3LTPA 1CNVA 3B05A 3T1GA 3DI0A 2F38A 2J13A 3N9RA 3UWWA 6TIMA 1WE5A 1QK0A 3UBPC 4WDUA 1QPLA 4LYQA 5CBJA 1ZCOA 2NSOA 5AC5A 3UCCA 1DJNA 3WDPP 1A4MA 3P61A 4XZMX 4H9MA 4QG6A 4EACA 1XCFA 1V7AA 2Y2WA 1JUEA 3M0JA 3GNXA 2WJFA 2DSWA 2VZSA 1TKKA 2WVUA 2IS7A 3OGSA 4DO5A 1TG7A 2FTYA 4PB4A 4K1GA 1KM1A 1RV8A 4IMGA 2Z1XA 3PZOA 1YTDA 1B2YA 5L9FA 1YDOA 3KX6A 3KZSA 3VNYA 4WGXA 3A13A 3HG3A 3G8EA 1TVNA 3IVTA 1YEYA 4GZIA 1AZ1A 4LCSA 2J24A 3WJXA 3FY1A 3V35A 1TV2A 2V3GA 1JZ8A 2BP1A 2YA2A 3EX3A 4OVXA 1XLCA 3WFAA 3M43A 2DGAA 4B15A 4NNRA 3W7LA 1L6SA 3W72A 5I07A 2ZQUA 1C8VA 2W0UA 4IT4A 2FAPA 1DHPA 3KAOA 4UCFA 2YSWA 2WXDM 1TIWA 5CC7A 1JZ5A 1C92A 4IJCA 2DJXA 1R3YA 1E15A 1KT1A 2PD5A 3BV4A 1XUUA 3EB4A 3RO6A 1R85A 2MLXA 3DENA 1XIJA 3EX1A 5DELA 3WH7A 1C9DA 2R6OA 1T5AA 3UGRA 3WLRA 3WQOA 4D6GA 4KQZA 2W61A 4JDBA 4I5XA 3WK2A 3VKDA 4AVOA 1C3FA 4NNCA 3VIGA 1TV5A 2X1TA 5D02A 1MUMA 1Q5MA 4LT9A 1J6OA 1Z7AA 4GFSA 4QJ1A 4UOQA 2G97A 3A5VA 3ELFA 1HL9A 4O17A 3LLDA 3QZAA 1J10A 1VP5A 4QQUA 1PYMA 4TO8A 4JYSA 1XLFA 1CIUA 3SGUA 1GHRA 4BQ3A 3KE0A 1R3TA 1TV8A 4XWUA 4MJZA 5D38A 1U2YA 3R13A 1ME8A 4XG1A 3ARZA 3UA3A 2M1IA 4Z1AA 3VAVA 1LP6A 5CPTA 2GGIA 5TNVA 1ZHAA 3WBEA 3ZLGA 1W9XA 3LCGA 1JQXA 4QR6A 5CGQA 2J7GA 1EGZA 1Q6HA 1ZY9A 2IW0A 4PSPA 1IT8A 3KP1A 2JEQA 2WOQA 3ITTA 4KESA 3TN4A 3A3XA 1DXEA 3NZGA 1TIMA 2CXGA 3DFHA 2WWCA 1NWUA 1JZ7A 3VD7A 3VIKA 3SCSA 1O5KA 1PINA 1FH9A 2ZR4A 3J7HA 4DWSA 1AJ0A 4QE5A 4PUMA 4CCZA 1YATA 1UWUA 3AWOA 3GK0A 4DUOA 3ZR6A 4KT2A 5G4WA 3L5AA 4U31A 1NF0A 2PTZA 3GYEA 2DJLA 3S5SA 3NQVA 2O9PA 4LNCA 4A4AA 4L9YA 3AJ7A 4GYPC 3VIOA 5I3DA 1JI2A 3NOEA 3R43A 2OZTA 2WMKA 1I2OA 3CWOX 4KKXA 3RCYA 2VFFA 3DERA 3UXKA 4NNAA 1WB0A 1UKSA 1JYXA 1H7OA 4RL3A 4UFIA 3ARQA 1ICSA 2XIBA 4FHAA 4H9YA 5A6BD 4XIAA 2ZUNA 4GZJA 1UR1A 5E6ZA 3BMBA 4MB5A 4LS1A 5HDRA 1X39A 1ONRA 3DYMA 2V30A 3SECA 1H49A 3WQFA 4R88A 2BGSA 3NRKA 2Y7EA 3W02A 1TWZA 4JKKA 4ZA0A 1FH8A 3WENA 3GXIA 1EJTC 4R7JA 3F4WA 2J88A 4LAOA 5M17A 3W75A 1J6PA 3U57A 1XIDA 3NUKA 3F2BA 2C1HA 3Q2DA 1M1BA 2BGNE 1W3TA 1W2PA 2MLZA 4QAWA 3ZJKA 1ZTVA 5L6UA 5J6EA 5BXTA 2F2HA 4I7WA 3N14A 4RX0A 9CGTA 4I9TA 3R4IA 4ZQRA 4Q8TA 2PC8A 3AZRA 5I3HA 2M2AA 1KKOA 3AQUA 2FGLA 5AN7A 2IQTA 3WMLA 4FI4A 4ZCWA 1QATA 1W3KA 2VKZG 4W9QA 3DFQA 3EY6A 1R3RA 2YXXA 3QY6A 2WVSA 5M5DA 3B9AA 4AEFA 5LA2A 2B7QA 2VENA 3OYZA 4NJKA 5AVNA 1I45A 2FHCA 4Z1BA 1LL6A 5BRQA 2J9XA 4HN4A 4OUEA 1EGMA 3IGHX 1Y0OA 1PXGA 2J9ZA 5I78A 1Q13A 4BWLA 3BCFA 1Q6IA 1GCYA 1TV3A 4KCUA 3P84A 1MXDA 1DJHA 1M53A 2HS6A 1PZ0A 4Q8VA 3Q37A 3VIPA 3GR7A 5HNTA 3CAWA 1WDPA 4UTIA 2NT0A 3SCNA 3GTIA 2Y0FA 4I8DA 3T78A 1TPEA 3IGSA 2H9AA 4H6KA 3TNBA 1VFMA 2NUXA 2DP3A 4UQDA 4JQ4A 3MKVA 3KBJA 4AWTA 1JF5A 4O2TA 1CXLA 1KBJA 3MHGA 4O4VA 3VX0A 2PDNA 1NELA 3GKFA 3TYAA 4NJHA 4M81A 3UY7A 2VCCA 4NAEA 1MYRA 1QI3A 4F0SA 3UNTA 3TZNA 1NY1A 1AL8A 1LYXA 1W8SA 1FX6A 5H6HA 4A2SA 2PE4A 3BL3A 2ZQSA 4K3ZA 1C7TA 1QW9A 2FPTA 4UZUA 2WO5A 5EFDA 1FKGA 3V7PA 3BOXA 2I16A 3GPKA 3C8FA 1MDLA 3VO0A 4RV3A 3F5JA 3CT2A 1P5QA 1EXPA 3IARA 2GSHA 5CKSA 1UP0A 1UD3A 3KCEA