2DPKA

The crystal structure of the primary ca2+ sensor of the na+/ca2+ exchanger
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
136
structure length
124
Chain Sequence
b'HGIPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSESALACLGSPSTATVTIFDDDHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium/calcium exchanger 1
publication title The crystal structure of the primary Ca2+ sensor of the na+/ca2+ exchanger reveals a novel Ca2+ binding motif.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Metal transport
total genus 22
structure length 124
sequence length 136
ec nomenclature
pdb deposition date 2006-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2dpkA01
3GINA 3FQ4A 2FWSA 2QVMA 3RB5A 2KLSA 3EADA 2KLTA 3FSOA 2QVKA 3H6AA 3RB7A 3E9TA 3US9A 2FWUA 2DPKA 2LT9A 3E9UA
chains in the Genus database with same CATH superfamily
1MUJB 3LZOA 4FG0A 4PJDB 3VFTB 2Y5TB 4KUZL 4PJFA 4QGTA 3L4WA 5C08D 1AKJA 2X0UA 4OIAA 3QIBD 4A2MA 1D5BB 5L7XL 5AALA 4PGDA 5K59F 1F3DJ 2CGYA 1P2CB 1CT8B 1UUNA 2XX0A 2YD1A 2X4TA 4GAGH 4JFFE 4L23A 4YIQA 4YBLC 3FRPB 1ACXA 4HV8A 4JFZL 1SVZA 1FSKC 2R1XA 1MQKH 2VLLA 3UYPB 3NRFA 2IXQB 3QC6X 3W5NA 3S4SG 1ROCA 2R4RL 3AVEA 4PREA 2EDDA 3IJSB 4WW2A 1XGTA 3KPNA 4EOWL 3D85B 5E1AA 2JNZA 1Q0XL 5JXAH 3VXUE 3ATBA 4LPTA 5HI5D 3VU1A 4F7CA 4JHBA 5SX4I 1PFOA 1N18A 3R06B 1HT6A 2DM2A 3ZU8A 4X5QA 4O2EB 2DICA 2E4FA 1WT5C 4KX9A 4OGAC 4ALAC 4Z5RA 4YPJA 3FZUD 3IMUA 3X1EA 3SCMD 5KJRH 1XH3B 3A6CH 3H3PH 3PNWA 1CE6A 2NYYC 2PW2B 3MAWA 1WLHA 5HHNA 4JO5A 3CBRA 1K6QH 4GS7C 3L7FA 1EGJH 1LP9E 4XVJH 5JIQA 5EEUA 4H25B 2ZPKH 4MNQB 4OH2A 2PTVA 3BC9A 3BP6B 3UTTE 5KSVB 2E9BA 1GGBL 2E7LC 1A7NL 1SJHA 2JVUA 3LS4L 4PJAE 5I1IL 3MKKA 1AYRA 1EA9C 4FQXD 1CICA 4BBWA 3SE4A 5C0EA 3SQBB 5FUZL 9PCYA 2XYCA 3AS1A 4Y2OA 1B0GA 1C08A 2BFVL 2J8UF 3F5WA 5JW3L 5E5MB 1NFDE 2PCFA 4XTRD 3IGUA 5BO1H 3HOGA 3QIUD 2CA3A 1B4RA 4UDTA 3EDFA 3EYUH 2XV6B 2VW4A 1NQBA 5HGHA 5KAQG 1PD1A 1F0LA 1KUMA 1GS6X 4W9CC 2WQRA 5EUOF 3R8BB 5BVPH 4X50A 5FOJA 1LYQA 1DBAH 1NL0L 2YD7A 2FK9A 1A6AB 2WLZA 1G0XA 4PRHA 1A02N 2PCYA 4UYQA 4M61B 3EDKA 4FKHA 1ORSA 1E67A 3ZHKA 1OCWL 2DMCA 3FB8A 4JO2L 4N2GA 1KB5A 2YS4A 1MOEA 1FAIH 3HAEB 1NPNA 3SKJL 3ZE1F 4W9JC 1LHZA 2NTFB 4QRRD 2O61B 3MRGA 1YN7B 4NNXB 4NQSA 5CU9A 3HPLB 5TH2B 1S9WA 4GW1A 1EHLH 4AT6B 1FG2A 2JQMA 5EZJA 5F7YC 5LGJA 5JW5B 4QXTB 3Q43A 1CDYA 4FI7A 1AGCB 1BYPA 3VXOA 3N9GL 4JDZA 4K7PX 3MLVL 4TXVB 5JHMA 1EJ8A 3TNNB 2W80C 5HYIA 1NAMB 1WD8A 3BVVA 4OTXL 3HI5L 3TF7C 4PTUB 3FUEA 1A7QL 3QQDB 1KDIA 1NC2B 4XP5L 3QWQB 4Q58C 2ATPB 4JEGB 4BE5A 1ZS8B 4M7JH 2HKFH 1NAKL 4N26A 2KC0A 4MD5B 3Q8FA 3L16A 1OAKL 1L9QA 2BLFA 2HMIC 3RJDA 4ZUUB 3ULAB 5JW4R 1E27B 3MYZA 5J6GB 3HNVH 3D4YA 3ARDA 2G2RA 2IPUG 1SM3L 1UZ8A 3EFDL 1HHHA 4GI6A 1IBFA 4LP8A 4C58B 4DO4A 2YQ3A 1OSZA 3Q2WA 4ZFOL 1E9QB 3GNMH 2K4AA 3MN8A 4HWBH 1SEQL 3M45A 4GNKB 2HYMA 3QJQB 1HWHB 1R46A 1K5WA 1XGZA 1D7DA 2R8SH 2QV4A 3ISRA 2IJ0C 2VDKH 5C0CA 4IS6A 3MRIA 1NBQA 4YDLB 1BBDH 1IBBA 4MZRA 5SWQA 2VE6B 3DV6B 4X7CC 2R4SH 4RSYA 1CDGA 4ADJA 3E9TA 3O9WB 4AYDC 4YXLL 1ZS2A 4JGNA 4PI0A 4MA3A 4PBWD 1ZLSH 3WE6B 4AQAB 1AO7D 2Z93B 4HOMA 1YEHH 2EXYD 2E6PA 2JKTM 2TRHA 1CFSA 2YUWA 2B2XH 1FFPA 4NO2A 1OPGH 2EDHA 4LOUC 1UWEL 4Q56A 4YDNA 4G5ZH 4WWKD 1LEIA 1BFVH 1FWXA 3W2DL 3HTLX 1MCJA 3CFTA 3ATFA 4N8PA 1WA1X 3O4OB 5IM7B 1HVXA 4A1RA 1G7LB 4J3OH 2VYRE 3SO5A 3ZDXE 4ETQB 3UACA 4K9EL 5GZOC 5DI8B 2VDNH 2XQ0A 3BZ4A 2OYKA 5I2IA 1H8LA 2PNDA 2EEFA 3MRBB 3LKPA 4BH7B 2GJZB 3LPPA 4HPYL 2F53A 3WD5L 4NO5A 1Z3RA 1JZ7A 1RK7A 3APCA 5JQ6L 2E7DA 4D7PA 4GRWB 1DJYA 3ARSA 4GKZA 4X9BA 1HCFX 1UXWB 3OHMB 3ISWA 4TOYL 5A2IH 4ZG1A 1JZJA 5MENE 2JCWA 4L4TD 1MWAH 1NFAA 1XGQB 4L37A 3HR5B 3RVVC 1N5YH 1F4YL 2QVIA 1IM3B 1X5KA 3TS8A 1LEKB 1G84A 4IIQB 2AJSH 4OAWB 1IGYA 1E90A 3AJ7A 4LAQL 4QOKE 3IF1A 3UG3A 1AD0B 5ABAA 2DKSA 1JGIA 1PJ9A 4Q9BA 4M1GL 3EYSL 4MD4A 5ITFB 1QW8A 1L7TH 3E0GA 3NTCH 4O02B 1F41A 4PP2B 4JFQA 1LO0H 3OMZA 2P8PB 4H7VA 3TO4B 2HFFB 3MXVH 5K39B 4PBVC 1AI1H 3KJ6L 5FXCH 4LQ1A 3ZYIA 2FWOB 3NYKA 3U0PB 1U58B 3DYOA 3QVAA 3C8KB 3AMKA 4IDJL 3WIIH 4YHLL 5E56A 1BCIA 3T0EE 1TQBB 1INDH 1COBA 1T66D 3SDAC 4RZKA 4JPIB 1MELA 2YPVA 5DO2C 4PHXA 4OB5H 5ALBH 1HWWA 3DGGB 1WZ1H 4NX0A 5EOCL 1RZ8A 3W39A 2A38A 2M83A 4NO3A 1RZ7H 1IBHA 1O9WA 3GUTA 1XIWA 2ZXCA 2DJMA 3WXVL 4K2UL 3ECBB 4WEEA 1AP2B 3CHXA 1T1WA 4JCWA 1BQLL 2QFPA 5HBBA 4A2EA 1NCUA 1GC1H 4EUPA 4QRQA 4KJQC 4X4XA 4M7LH 1OE3A 2ZF8A 2JI1A 2VJ0A 1FP5A 4LKCA 1J1PL 3NIFF 4N3UA 3IU4H 1XBDA 4XNZB 1YJDC 4ETYA 3UC0L 2JLPA 5AEAA 25C8H 2EACA 4YFEA 4B0MB 5E00B 2GUOB 2YN5A 3FU5A 1XR9B 3TV3H 2BNUA 3U46A 4HKBA 2QVKA 5E2VH 1YCSA 4UT7L 2J6EH 3EOAB 2H1PL 3R1GL 1MFCH 1PG7H 5SWSA 2R2EB 3QFDB 3BOVA 1EHAA 1JOIA 1VSCA 2BIQA 3MRCB 3OXSB 3VYPA 1KTKE 3CZKA 4HKZB 3CN0A 3U4EB 3GRWA 2F08A 3L3DA 4IU3A 2Y7LA 3A4FA 1B0WA 3VXRD 2YUXA 3WJJC 3QUXC 3X3GH 1UG9A 2E59A 5EU6B 2LU5A 3DUSA 3NZ8B 2A73A 3EZJB 1D3CA 4MJ6B 1QPPA 1CICD 4KI5E 4E5XA 1DJHA 1JZ3A 1X4YA 5GZNC 1FSKB 5T1JA 4HT1L 1F3RB 2V3FA 4PWJA 5DC4B 1RIUL 2ITCA 3P30L 1QFWI 3FOLA 4L8BB 4YE0A 5IWLA 4G6KH 4A37A 4EBQH 1H3UA 3V4LA 1NDGB 4YSPA 4Y5VC 3K6DA 1BJMA 3H85A 3HG0A 3MX0A 5AKSA 1DJGA 2XZAH 3VSTA 1DUZA 5H35A 4XBGA 1PFCA 5DQDH 2LOEA 3GQFA 3BIKA 1OHQA 3ZE0F 5ITBH 1U95A 4NBZB 1Q9LA 3MV11 2R0WL 5E99L 5J6HA 2EUXA 4MZ3A 3SBWC 4CSSA 2FL5B 3OJ2C 1E4KA 4PRHD 3WDHA 2IG2L 5J4MA 2CJUH 2HRPH 1NOLA 2XPGA 3IJEB 4U2YA 3WMSA 3EADA 8FABB 4HJIA 5L2JB 3C2AL 4GS7B 2XG4A 5IBLC 5CEYB 2B59B 3NMEA 3P9MA 4JKLA 5I1GH 5KVEH 4KU1A 3DRTB 4DVRH 2I27N 1CD0A 4NQEB 4Y4HA 4DGYH 2YFOA 1BQUA 2EYSA 2CQVA 7TAAA 2WLMA 3G08B 3QJHA 1Q8MA 3SYQA 4ZUSB 1UVQB 2K0RA 5FECB 2WLLA 4R4FH 3QNFA 2NDGA 2YBRB 5D9SA 2D3VA 4TUJA 3TPUB 4Q0XL 5EBMA 5HHVL 1WIUA 2O5XH 4NGHH 2XX1A 3QR0A 5HYJE 1HJCA 1U8OA 2ZG1A 2EUZA 2BMKB 3OJDB 3PGFL 4GI9A 4LSVH 4PUBH 3BEWB 3QA3A 4OZHA 5ACZA 2HH0H 5DZLA 1ASQA 4Q6YA 1NOAA 3G6JA 3ARDD 2EO9A 3LEYH 1NTDA 1D5ZA 4H13C 3ZDYE 3VTTA 4UTBH 2ZKXA 4N0UE 5D7IE 4QNPF 5IB1A 4XXDB 4LPCA 2HTKC 3E3QE 3MREA 3CFKB 4LLYB 1S7WA 4U3CA 3D05A 2Z65C 1IE5A 1TZ8A 4LARL 4MD0B 3LH8A 3NAAL 3FOMA 4PJEF 2DQDL 4PSPA 1N7MH 1KPRB 1CK0L 3P2BA 5E8EB 3GJFA 3IJYA 3U4KA 3SKOB 5CLXA 3KW8A 2HVKA 4R26H 5KBNC 5HI3C 4KZ0A 4B6ZA 5EBWB 2MQCA 3MRLA 3WOVA 5HJGA 5JOPE 1FC1A 2LGNA 4XP9L 5I0VA 4R0LC 1MHPL 2YBGA 2O5ZH 3IMSA 3FSWA 2Q1EA 4HW6A 4I3SL 2UZIH 5F21B 3SY6A 3TJHC 1QRKA 4G1MA 4H8WH 4W9GC 2F54A 4NZRL 1Q9WB 3MBEA 1IGIH 3VFOA 1GIGH 1V3MA 3B8YA 1M7IA 3MNVA 3GSQA 3RUGB 2GC7C 2OMBA 2YRZA 2FEDD 3QISA 3QXAB 3SE3A 3O2DH 2NY5L 4ZMQA 3FFCE 3UAEA 1FVEA 3INUL 2R56H 1MNUH 3IWVA 4I0KA 4YHKH 3CVCA 2XUWA 4HKXA 2IH9A 1NEZB 2W07A 4HUUB 4NQQA 4XHJD 2W92A 4F7MA 4ZO7A 1NCAL 5GZOA 2IV9A 3S7GA 4J5VA 3AB0C 4DNLA 2UUDK 2R1YA 1N67A 1LO4L 2ICWI 2EZ0D 3VJ6A 2YQBA 1ZHNA 5F9DC 3DARA 3JWNG 4ILDA 3I6SA 1LK2A 2R83A 5ETUB 4PJ5D 1UB5A 2VXVL 4R2GC 4CSPA 1A3LH 4BHUA 1VKXA 1WA0X 2EILB 1YA5A 2X42A 2JCCA 1JF5A 4QTHB 1C5DA 3QNXB 4RLDA 3JV6B 1BZDA 1X4XA 4MDRA 3TZVD 1MJ8L 2DQCL 4WI0A 2O6DA 3VD5A 3GXPA 3WS6A 3ZKXC 4QJ4B 2VXQL 2WTPA 1CTNA 2XN1A 4Y1AE 5E5LA 1Y0LB 4P57A 5F93C 2PPEA 4NKOB 3D25A 1RU9H 4JHWL 4N2NA 3I50L 1G43A 5ILTL 4ZUVA 2X7LA 4PG9B 4Z1PA 1YNLL 2FGZA 1B9ZA 2AZUA 2HJFB 1CGTA 4GT0A 1K8DA 2A1WH 1ML0A 4KHTH 4MHHI 5TF1L 5GQBA 3W9DA 2DKMA 3SOBH 4Z0BH 1R3LA 2QHRL 2AQSA 1EJOL 4UINL 1P5VB 5AYTA 7FABH 1AFVL 4AWJC 1WWAX 1DFBL 4Z7UA 1DVZA 2F5BL 1EO7A 3QPXH 5CU5A 4GKNB 1A6UH 5GS1C 3N1MC 2ITDB 1MHHA 2YJQA 1XIWD 1P7BA 4PJHF 4G8FA 3TTYA 4OZIB 3NPSB 5IBUG 4L8DA 3VFGL 2N7BA 4U4BA 4PLNC 4FQIH 2OYMA 3VSUA 4OFYA 5CILL 4ZK8A 1MFNA 3LKSA 4FZEH 5T1DL 3LN9A 1CYXA 1RUPH 1SBSH 3MGOB 1OW0C 2WNXA 4HPOL 5ERWB 1CE1L 5F1NB 4ZUTA 3TBSA 4UIMB 4I77L 5BUAA 3GPSA 3LX9A 2YXMA 3QJUB 1RJLB 3BQUC 2G3NA 5DR5H 3DHPA 1S9YA 1OAYH 3UDWA 1C5BL 1H3XA 1KXVA 5HY9B 3KEDA 4Y9FA 3QI9C 4KPHL 3WJLA 4N8VB 4HXBL 3OKKA 2JJUA 2AEPL 4HH9A 4PJBF 4DHLA 1NKOA 3IMWA 2CUAA 2UXGA 1UOLA 1AQDB 4FFZH 1HOEA 1I8LC 4P2CG 5H94A 1AGBB 4KJWD 1MFMA 4XMVA 3IVKB 1UACH 4KKCD 3SDAB 4YDIL 5FM5O 5AAWA 4MAUH 1OT2A 2CBOA 3SPVA 4K7PY 5CJQH 4O9HH 5BS0A 5B38A 4PJXE 2IOMA 3WO3B 5GHWH 3LY6A 3WV0A 2D03H 3LEXA 1E5UI 3ROOB 5EF3A 2MNWA 2A77L 2B9AA 5KYWA 2DLTA 2NXYC 2DPKA 4HG4K 4M6AA 1ZHBA 2FSEB 1JD7A 5H4YA 2V17H 4NBYB 4KNSA 2VDRB 3EYQC 3TLRA 1N6VA 2FZ3B 1W72A 2CWRA 3BVNA 2P7TB 2FE0A 1DTUA 1NIDA 3CXHJ 2LFGA 1VFAB 3GEFA 4FFVD 2D3LA 4PVNA 5JOFB 4UQIM 1X5AA 2G3ZA 5B1JC 2PR4L 2N0MA 2WWOA 4ANWA 3NOIA 1M53A 3U2SB 3FQ1A 4Z7OE 4IRZA 2WBXA 1IM9B 1FAKT 2OCJA 4ZPVB 4IJTA 3WJMB 1D5MB 4JFXA 3V52H 5EDXA 1GMEA 1F56A 1QEXA 3HZMA 2Z91A 3RJQB 1EXUA 1F6AA 2NY2C 2BW4A 5F9OL 3MRFB 3WEOA 3RB7A 1Z2KA 5L4MA 3UERA 1G5GA 2X4QB 5E9DE 3ZGIA 1J0IA 4JPKH 1KEML 1KTDA 4RMWA 5D93C 1CD1B 1U8NB 4Q9RL 3BT0A 4K94H 5D2LB 4EIBA 2XJKA 4WFEE 3RWJA 1HESA 4LHUG 3RTQA 1QSFA 1F13A 3EJJX 1JP5A 5CR1A 2RFXA 4ZSOB 3SDCC 2AEOA 2YGNA 1EMTH 3O2VH 2AK4D 2ZAIA 4HKJB 5J1TC 5IESH 3QUGA 3AUVA 4Y5VB 4S11A 5DDHA 4EEEA 2Y2YA 4TUUA 1BJ8A 1NANI 2OMZA 2RMNA 4N0FA 5KANG 1OP5H 4R3SB 2ALWA 1A3RL 2V2WA 5TFSL 3PAVA 1U6AH 4A7SA 3SN6N 1ZOXA 4HVBA 5DJ0B 3UCRA 4UILH 1Q0EA 1NLDL 2H2PD 1R3HA 4FC3E 4KXBA 4XNAA 4GRLB 1OTTD 2R9HD 4ODWB 2PMZA 1BD2D 1NEPA 1RVFL 4U0QB 2EDFA 3F7QA 1DANT 1BSIA 4JFDA 4PJCE 3X17A 2CH8A 3ETBF 2JXMB 5ALCH 2QQKL 3G6AB 3RWEB 5AVVB 4TVSa 3TN0D 1W0YT 2QFRA 1KYUA 2X6CA 1K8IA 2B1OA 3C6EA 2VIRA 4AQZA 5DHVB 1L5GA 3PY9A 3LRKA 2J20A 1EFXD 4QWWD 1Z66A 2X41A 2Z9TA 3GJEA 3L1EA 3LRSA 3UBXA 1L6PA 3C5ZD 4L4VD 4ZQKA 3AS0A 4AVHA 1D7BA 3BCDA 1X7SA 3QXWA 4QHUA 1FL6B 3WI9A 4E9QA 5DYFA 1WTLA 1JV5B 2ADFH 2XCMC 3EYOB 3FT4B 3B9DA 2NR6C 1EXGA 4ZUWA 5LGKA 4U1IB 5CSGA 4MKMA 3VH8B 1ACZA 2DJ4A 1CCZA 4OLZH 3BDXA 1YECL 4Y4FC 2VDPL 3X11A 2B1AL 4R8WH 1KJVA 2C9UA 3EH2A 1KTRL 1P6WA 1QEWA 4K5OA 1EAPA 3BGMB 4R0LA 1WG3A 2FEEL 3EFFB 4U1NB 3MBED 3VWKA 4FQ1L 2WCSA 2R1WA 5LNEA 3LXAA 1JYXA 5C07B 5I6OA 3FMGH 3LQAL 2V8LA 3T8XA 3S98A 1KIRA 5HJDA 1UWYA 3O4LB 3F7VA 2A4ZA 3KPQB 1UWGL 4AE0A 2BY3A 2CDEB 3LQMA 3O8XC 1JZGA 4LLWA 3L5WA 3AXLA 4S1DC 2QGCA 4QRPB 4DK5A 4LSQH 4G8GE 2GI7A 4WNJA 3QDGE 3QQ9C 1UB6A 3STZA 4HJJL 2EDJA 3RLSA 2QPEB 1JTPA 4WSGA 3VG0H 4OGQC 1WAAE 2WWKO 3FAWA 1J0ZA 2YO3A 1CI3M 4JREC 2VR9A 5CBEB 3FYEB 1FNSH 3BQVA 3C60D 3H53A 3V5KA 3Q8EA 5C9JA 3OSVA 5I6PA 4KV5E 3H4HA 2YGQA 4RISL 3SJVB 4LQFL 4K5MA 2VLRE 5AVWB 2Q3AA 1KB9K 1I1AC 1ZE3H 4HZLB 3H0TB 2ARJB 1W16A 3IMTA 4LLDB 4X6CB 3KS0H 2F61A 2BNQE 2CALA 4JJ5B 2FR4A 4XZ4A 4ZFOB 3GD1C 4HPHA 4X6FB 1JXGA 4FLOA 5DD1L 4JNXA 3D6GA 1H9VA 4F9LA 3CZNA 2HPTA 1H0DB 1A4JB 1YEFH 1NIAA 3AB0B 1ID2A 4L9LA 2IWKA 5EWIH 4C83A 1HYSC 1UOVA 3QORC 4URTB 5FHAL 1WBXA 3GHEL 4FNLH 5IBTL 3BPCA 4KBPA 1HFUA 4KKBC 2YJLA 3DSFH 4OFYD 4R2GB 4NUQA 5A2AA 4JG1H 4J8RB 5HDBE 5IW1A 5A2LH 5F1IB 1LEGA 3D5OF 5EFIA 1JWMB 3F62A 4BRJA 1GGIH 3ABMB 1I1RA 3W11C 4IEFB 1YPZB 3ARGC 3VGAB 5J8OA 1BYOA 3EBAA 2CJ3A 3ZKXB 3GC3A 5EOTB 2PCXA 5L4JA 4GIAA 4HLEA 1AR2A 3G5ZA 4YFLI 2B08A 2L7EA 4O00A 4S1SH 3KL5A 3CX5J 4I18C 3CSYB 3EH3B 3VXTA 3QHZL 3BQUA 2XA8H 3MRKA 2G3MA 4R96A 2WVVA 4HUXA 2VDLB 4HF5H 4A6YH 2WOYA 2WINA 3A21A 4PWHA 3VDAA 4L8CA 4HHGA 1XO8A 3JWNE 1SOKA 4XCCH 2YEZB 2NX5E 1HZLA 2EH8H 1EDHA 2B4CH 5E0QA 4P3CL 4TNEA 2KUTA 4G7VH 1H3TA 2YPLA 2YARA 5HJ3B 4QUOA 2XTJC 1R5IB 5GIRA 3G9VA 4P46B 4GXVL 2F68X 3AM8A 2GBTA 1SYVA 1NCJA 5KVGL 5GS1B 4XNYL 1AANA 5ICYA 4GW5A 3LNFA 3RNKB 4Z7VE 5L2KE 4DUXA 1YEKH 1QASA 3TEUA 3SYCA 2IAMA 1SMAA 2NXZB 2WQVA 1SY6L 1HHIB 5IQOA 2GK0A 4UTAA 1AS8A 3OAUL 3FUKA 4XP6L 1TZGL 2DMBA 4BFGA 4Z3JA 3DV4A 3LIZL 3TO2B 4AXWB 1WZLA 4IKJA 5CO1A 5LLIC 1JZ4A 1FPTL 3PWUB 3BKYL 3GLEA 5JLZA 1BQ5A 1JNNH 3QI9B 2DN7A 4WGWB 1GW0A 4LF3B 2UXVA 3PGDB 1KBKA 3LPGA 3AREC 1XXDC 3TBWB 3MOAL 2FJGA 3LEVL 3GKZA 4PR5A 1YY9C 4F57H 4YLCA 4K5NA 2AJXH 3TBYB 3PHOB 2B1HL 2XWCA 5I1EH 2MSPA 4P4KD 2DLEA 5ABZA 1JS4A 4LHQB 1Z5LA 4R90L 5AB2A 4H20H 4GG6A 4LRNH 2GI0A 2VLME 3OLDA 4FZ8L 2NQDA 1S6NA 2GCYB 3QJVB 1FYTE 3GSNH 4ZX5A 1JGVH 3KPSE 5IF0B 2NXYB 3SE8H 1FNGA 4PV9A 3RTQD 1IGFL 3FQXB 1QSFD 3IS1X 2JB5H 3QQ4A 2Y7NA 4W9FC 2C9PA 3IJHB 3JWOH 2G9KA 4W9EC 5JW4Q 2B39A 2PUQT 2EE3A 3ZJAA 4X7SL 5I74C 3WFZA 1ETA1 4H88L 1J9CT 1EZUA 4JO4H 1I7UB 4RMUA 5D70H 5DMYA 4DW2H 1N12A 3SY0B 5C0DB 3VFWB 4MDJA 2IQAA 3M7FB 2N7SA 3H9ZA 2ZONA 4FEIA 5CSZB 5LWYH 2ERJC 3JVGA 4UU9A 2H6PB 2X4PB 3OZ9L 3DPBA 4YDVB 2MQGA 3UTQA 1T03L 2NY2B 3VM7A 4A7UA 3AAZB 5EU7E 1INQA 3WIHH 3CDCA 4YHPA 2IALB 5B8CB 2W65A 3MCG1 5IVXF 5K59E 2LVEA 5D93B 2C34A 4FQLH 1E9OB 4F27A 2K70A 3BH9B 4NUMA 2ZG2A 4EQ2A 4WW1B 1TNNA 2WLIB 4ABVA 5F1OB 3ILPB 1QLFA 1J5HA 1RK1B 1OO2A 1J8HE 2OJ1A 5DUJA 3D2UB 3SDCB 5B39G 5IFAL 4QHMB 2AJVH 1I8IB 3AITA 3EH1A 3IGFA 4ONFH 5LG1A 1ZV2A 2P24A 4HUMB 3I6LD 3NIDF 2Y1ZA 4PS3A 4RFOL 4D9RD 2NR6A 5IB4A 2O26U 3SEPA 5C0RL 1ODAA 3G04B 1CXLA 1S9KC 4OCXH 1M2OA 3RWCA 3OQRA 4I1PA 4JN1H 3WNPA 3BAWA 1R3JA 3PP4L 4KVPA 3SBQA 1ESOA 2EDMA 1XVSA 7PCYA 4WKXA 3SDXF 2Q7NA 4GUPB 4JFED 5FWRA 3H9SE 3FU8A 3BUTA 1A6PA 4HJSA 1Z9PA 2XN2A 4NEHB 3OPZL 3RZCD 1RZGA 5DC9B 5CLTA 5FUOL 4PRNB 7CGTA 3TT1H 3V9CA 4X5XA 1EAJA 4PJIB 4DFHA 4XT1C 1NMCC 2VZTA 3U6RA 3WDJA 3NCYS 1NCBH 5G5DA 3VFRB 4BFNA 4X9HA 4KY1H 2OMUB 4TQHA 1EZLA 2J8UE 4A7QA 3BUPA 4OKVB 2P45B 1JRHH 2CLZA 4WHTA 1FCCA 1ITBB 1MHCA 1NWOA 2XG5B 1XTMA 1ZT7A 4IHBA 1WCBB 5DQ9A 3W37A 4ZXBC 3OWRA 3D0LB 1LE9A 2H2SC 3GSWB 1ZY9A 4NUJB 3RGHA 3TTSA 4NQXA 4BQ6A 3QQ3A 5IB2A 3RI5F 2J7LA 3PAUA 5D1ZI 5EUOE 2XRAH 4ZFGL 2BP0B 2I9LB 3HPJB 4PVLA 1A8JH 3FBKA 2PABA 3JTTA 5CJ8A 4OUUB 1IVTA 1YG9A 5D4IA 2BO0A 5I1LB 3EJZC 3QZWG 4HWNA 4M4RA 4X42A 3T0DA 2AP2A 1WQVT 4YBQC 3AU1A 4HEPG 1PDKB 3KLAB 3F7RA 3ZE1E 4RAUA 1IEBB 4H0GA 4RGNE 4DQAA 5GS0L 2J21A 1E5YA 2FWUA 32C2B 2TSBA 1J87A 1GSMA 1NLBH 2BP8B 4KXDA 1RZQA 3WHXB 3ZPDA 2WJ5A 3O8XB 2WHVA 4L3ED 5IMMB 3RDJA 1R5VB 3ET9F 3VXSB 2NNAA 5D6DA 4M62H 5C6WH 2VDQB 3BUDA 3HI1B 3RGVA 1JNJA 1CDUA 2KYIA 2AERT 5KVGE 4MQXD 4MYPA 2O1AA 3O3DA 3F6IA 4QXUH 2FBJH 2ZE0A 4JREB 2O4EA 5IMLA 4YSRA 2Z3FA 2YD4A 1AXTL 2Z31C 2NUPB 2X9WA 3WO4C 1ETB1 4X6BA 5F9AC 1DZ0A 4XGZB 1FGNL 4UAOC 4J23A 3ARGA 2CR3A 3GI8L 3LOWA 4OLEA 3WKMH 5ISZB 2OXHA 4PW3A 1OOAA 1QBMH 3VQLA 2DWDA 2K4WA 5DRWA 3IJ8A 3MV7B 4Y2NA 2FH6A 2HFGL 3W0WA 1I1AB 1ZSDA 1NC4B 3D3VE 2BVUA 5DU7A 1A6ZB 2D8KA 2KLRA 1QKZL 3NJJA 2IANB 2J2ZA 3ARWA 2V7HA 3QCTL 4NDMA 4N9OB 4OF5A 3L9RA 2EH7H 1DBJH 1U8QA 2EC9U 3CN4A 1LO5B 3MA7B 4LBEB 4F2FA 1XGRB 1QLEB 1NAMH 3LRLA 3PQYA 5A3IC 1TITA 1L3WA 4OZ4B 2DIEA 3FCTA 5I1HH 1EJ6A 2A9NL 3BZFA 1JGEA 4JE0A 5AW9B 2VW7A 1A64A 1HH6A 2ADJB 2HJKA 5CD5C 5CINH 3QORB 2BNRA 1XAKA 4HIEA 4NKMA 2WWMC 3NJGA 3AZUA 3HG1B 4ABUA 2WCGA 4EDWH 1YNTA 1LL1A 2P1YA 4X6DB 2FUTA 2IAMD 3C9NA 1E3FA 4FLQA 5EOCJ 2UZYA 4K23L 5DWPA 3PUUA 2WB1A 4A2GA 2BH0A 1X5XA 5CN3A 3PNRB 4PY7B 3T4AC 4TSBL 3RL1A 5IV2B 1M4KA 3IDGA 2WB7A 1KGXA 2BPBA 2W9DH 5AKRA 2OTWA 2ZOKB 4OU3A 5BRZE 4OLWL 1I7RB 5J9PB 4I18B 1NGXB 2DRUA 4HLZG 4X8XA 3MOBL 2PWEA 1U33A 3M8OL 3QHFL 1B4LA 3UTSE 4YDKL 4IRJA 3MROA 1NMBL 5H37H 3QEQA 1AQ8A 4WHDA 1M2VA 2H8PB 2MMXA 2WV3A 3L2MA 2AJUH 3D69A 2ENSA 3ASNB 2ED9A 4PGCB 3LVEA 2XTJB 3NFPB 3PIQA 3QUMA 4B7IA 1TQCC 4HCFA 3GMOB 2MRYA 3QIWC 1TCRB 3UX9B 4HAFA 4KQ3H 4R9HA 3UGEA 1FDLH 5DJYB 1A3ZA 3KPTA 4MSWB 4B9YA 1FFNA 1DSYA 4L8SC 2ATAA 2WGNB 1RFDL 3REVA 3R7QA 3WL9A 4WHYG 4DT2A 3FJTA 1OAXL 1NCDH 4ELKB 2Y07H 5F7UA 2Q6WB 3GKWL 4Z0XB 3MLPA 4RH4A 3HI6H 1QLRA 5CBAA 4WKZB 3II1A 1JF1B 3VM5A 4XMPL 1X6NA 2G75B 5TGBA 5CWSB 1U91B 3D39E 5EU3B 4MZIA 2V5YA 3UIYA 4P06A 4XCNB 2NDFA 3RILA 4QD2E 4UT9L 3VGGA 3TPKA 4N90E 4UNIA 4F7EB 5E2UH 3X1FA 3FTUA 3AREB 3I84A 3Q2NA 4GRWH 4HXAL 3GSVB 4NJAL 4L3CA 3DUUB 1F18A 4XPAH 3WDIA 4AV4A 3ZK0A 1XCTA 3K4DA 1KNOB 3QG7L 4P23C 1MI5B 3ZHLA 1F45A 4B50A 2H6OA 3ZOAA 4I3RL 4BDVB 5JYLA 2CD0A 4XBPB 1CXFA 4LRIA 4QIRA 4U1LB 5DT1L 2OMTB 5KSBF 2WVUA 2BVQA 1KYOK 4Y9BA 2P47B 1MAMH 3Q5TA 2MPAL 5A2FA 2ALAA 1T7VA 2XQBL 2Z35B 2ZKHH 3W81A 5FLVA 4HHAA 3W57A 4O02H 2K9FB 3CVIH 1KJMA 5C09B 5IQ9B 4CNIB 2OR7A 3MCKA 5ICZB 3B5TA 3P69A 3ILQC 4JX0A 6TAAA 1HSBB 1XCQA 1JNHB 4XOEA 1BX2B 2PWGA 3NIFE 4BUHA 2FQGA 5I1JL 5TD4A 4NQDB 1KIQA 5I74B 3MODH 4LCWB 3T0EC 4CU6A 5JDSA 1M1XB 5I76B 3MRDA 4YXKH 2IVFC 4KRPD 2Q76B 3VXMA 1NBVL 2ERJB 2WXLA 3CPLB 1OE1A 3FH5A 2SODB 1ZGLA 3MJ9A 4FXKC 2PYED 1J8SA 4FYTA 4JFFA 1PAMA 5LGYA 2NTFA 2J57A 2PF6A 1QSVA 1YN7A 3UJIL 4JY5L 4GKSA 2C3HA 1T6BX 3C6SA 4W6XB 2VWEC 3HPLA 3TIDA 2JV6A 3WNJA 1L7IL 4D9LH 4OCRL 1DEEA 3OMNB 5AW0B 4FCAA 3GI9L 2Q8AH 3VXUA 3L3OC 2JB6B 3MV9B 4GT7A 1A3QA 4E0RB 3G5WA 5CZXD 5E2TL 1Q0YL 3QFJB 4APXB 1G1YA 2AANA 2BIPA 5E94B 5KSUA 5EOQL 1JCKA 3NDYE 2YMTA 4JFHD 1ZEAL 3HNTH 3SKUD 2PXYC 3GSRB 5D7LD 2VN4A 3OBAA 4EDXB 4PJ8A 3TA3D 3HZVB 3RA7L 1HZHH 2VXUH 3DXAD 2HSIA 2JKWA 5F7BA 1HSAB 3IFPA 4KNQA 4YXHH 1AH1A 1F90H 3UTTA 5T3XE 3LN5A 3L3KA 1JDDA 3BD4A 3KH4A 1FO0A 4RVBA 4EUPH 5IVNA 4KAQH 2I9TB 4PJAA 4Q6IC 4XBEH 1DQIA 3N44F 4HX1B 3T3PB 3VI4F 1CS6A 1TMCB 2JELL 4UT6L 1RZPA 1Y18A 4QXGL 1O6SA 4DESA 1F2QA 4PRIE 4OLYL 4TUOB 3KCPB 3P4OB 4W1TA 5LO7A 1KFAL 1CIUA 4JRXB 5EN2B 2FJFB 1HHKB 1K2DA 3QSKB 3V0HA 3M6DA 1NFDA 5GGRB 1IBGL 1T21B 2QQLL 3IS0X 2EINB 3M1BB 2E9JA 3L1OH 1S5IL 3OG6B 1FL3A 1GS7A 3QXTA 1XB6A 4LPUA 2EYRB 3GBNH 3RGVD 2FBOJ 5B1BB 3GO1L 4ALAH 2QT6A 3GRWH 3WIFB 4F15B 4HBQA 4ZXBB 1ECZA 1PTZA 5JHLH 5I8EA 4BD4A 1S7QB 3A0OA 3QUYC 4UOW0 4D0CB 2PTTB 1WS8A 4F2ME 1AR1C 4N0CC 3NH7L 3CVDA 3AQZA 3BAKA 5F9JA 4B9FA 1EUTA 1JZEA 1F2XK 3IU3B 5IJCC 3V0GA 3FPXA 2JIXA 3T0XA 4GMSH 2ENJA 1BEYL 3SKMA 3KNBB 1NCHA 4J3TA 1BWMA 1DN0B 1YMHB 2ICWB 3UL4A 4AQOA 2Z4QA 1VGEL 1P4BL 5I1DB 2YA1A 4QNPE 3R7RA 3TCLA 2CIKA 5FO7B 2OK0L 2ZXBA 4Y19B 4YSQA 2ZIDA 1J10A 3KDMB 2GJZA 1XL4A 4JFPA 4X0KB 5BVJB 4M5ZH 3PQYD 3TX4A 2NYKA 4B9ZA 1HNGA 2GJ6E 5D4QA 2IFFH 1S3KH 1MXDA 4WDIA 1YQVH 2BOBA 4OM0L 1UXWA 4B3EA 5GGQL 4PJEE 2BNRD 3KM2A 2Y36L 3P77B 3CZFB 1DO5A 1U8HA 4NUGH 2W95A 1DCLA 1JBJA 5KBLA 3U0WH 2UV3A 3L5XH 5GGTL 5D6CA 2DJSA 4HWEH 1BM3H 3BISA 2CRIA 3FFDA 2EIMB 1DDHB 1CLYL 1I9RL 2R2BB 1UH3A 2Z31B 1IAKB 3BEVA 3QDJB 4XN1A 1MG3C 2ZX7A 5FYLL 4YO0B 1VFMA 3V10A 4UAOB 4O2CB 4JRYB 4QY8B 5T5FH 1KACB 3E3QC 2WNKA 3MRHA 1WBYA 1ES0B 2XFGB 1CDBA 2CO7B 1GZPB 5AG9A 4PLJC 3ARFD 1WICA 1MCPL 4YHZH 4WGVB 3BHBB 3U0PA 2R69H 1HIMH 4HP5A 1KEGL 3CZLA 2I07A 2CIIB 3BWAB 4O58L 2NW3A 1KIUB 3JZYA 3IPEA 3NUKA 2H26B 3ZY7A 4AM0Q 1UT9A 3QNYB 4OD2B 4ZW5A 5KBMA 1H6UA 3O2WL 1BBJB 2DQUL 4GB9A 5CZVH 1RUMH 3BD3A 1S7SB 4LEXH 1JWUA 2OM5A 4XAWH 1XHHA 1DVFA 2ZOWA 5KANI 4KZEL 4XP1L 3H2WA 1BZ9A 2H4EA 2JKIS 1RHHA 5FAAA 2DTSA 1GZHC 3KXFE 3BGFC 3CHPA 2DL9A 4L8SA 3HBQA 4HQQH 4PRPE 3IETA 1BXUA 3WTTA 1LE5B 2QQNH 1ASPA 3QDMB 3T4AB 2OZNA 4Z78A 2D0FA 4FNQA 2RHEA 3FDWA 1QABA 3TA4D 2EIZA 4DOHB 4ES9A 2GW5A 1QP1A 3MR9B 5HGDA 1KCSH 4AMXA 4TL4A 2VABA 1RK0B 3OR6A 3UPRA 1DQLL 1WEJH 2AW2A 5F9WC 4KXZH 1A7OL 1UQSB 2G5BB 4XCYA 2XQYK 3VI3F 4XWGL 3PAZA 4DTGH 1VESA 4JQIA 1DQDL 5JXEC 4MRBA 2XU9A 2VRKA 3GS7A 2CAKA 5IJVB 1SMOA 4ISVA 4MNQD 3CHRA 2VLKB 4XC1H 2FATH 3IJ9A 4FHBD 3LIUA 3IAGC 3PDDA 3W56A 1JFQL 4CVZB 1OGAE 5MENA 1TQCB 1T1ZA 3QIWB 2CU9A 3QWNA 4MJ6A 3U4AA 3UYRL 1FJ1B 4KQ4H 1K72A 4MB4A 3MRNB 4QOKA 1JTTA 1WISA 2V33A 1IU1A 4IW4C 3OXRB 3HMWL 2WQAA 4I4WB 4MX7B 4HCIA 5D7KE 1PVHA 3ZQWA 2VM3A 2KS0A 4Q9CA 3BVXA 2A6KB 4MQ7B 2LR4A 3BZ5A 3N55A 2DIAA 3PJSB 4ONHB 3GSUB 4RCAA 4YAQB 4I87A 1YAZA 1M7DB 1I3VA 2NQCA 3UABA 3V4UL 3CFJA 4EI5A 3M86A 1G9NC 2YAOA 1A14L 1KCWA 4QTIL 4R7DA 5KBDA 1ZJBA 2FNWA 5HHOB 1KJ2B 3SDDC 2YEQA 4PJBE 3VXMD 1AZVA 3AWGA 4PD4K 5HHQA 3U7WL 1CN4A 4D8PB 3KZ8A 1QQDB 3OKOB 1E30A 43CAA 1NUNB 2VR6A 4P9HL 3IGKA 5DEJA 4N1HB 1YEJL 3VGEA 2AI0H 5D7JC 4D7BA 3V4VB 1KIPB 3L45A 4NP4H 3V6FB 3NIGF 4QKTA 1PG7W 1MJUH 1S8DB 4PM1A 5C08E 2WK2A 3VD7A 3QXVA 1BF8A 3RVTC 3CFUA 5DS8B 1PZUB 3QZNA 4NSKA 4UOQA 1PL3A 2ROYA 3TPUA 1MH5B 3MGTB 3N42F 4ZRGA 3VXUD 2EDRA 2OL3L 4R4ND 2XZCL 1Q1JL 5ANMB 5GRZA 1E9PA 3SDYL 1ZXKA 1NGZA 3DOSA 4OBRA 1NC2D 4CA4A 3FQYA 1WWBX 4HGWB 1H8OA 3BJ91 4UB0H 3LZNA 3K72B 3QULB 2AC0A 3MFFB 5BUPA 3O0RH 4WTZG 4XPGL 4AZ8B 4M1CD 1NIFA 1RZKL 1EHNA 5FGCE 4X4YB 1S46A 3B9VA 3G5VB 2AQ3A 4Y2DC 2X89A 5FF6B 3S34L 3UZEC 8CGTA 3V5HA 3AADB 1JWSA 5IZ7A 3QE5A 4OVVA 2XBZA 5JZ7D 2Z0BA 5DVPA 4MCMA 4WFFD 3NVQA 3CFKA 4JJHA 5F7EH 4HIIA 1A6TA 3RWHA 2X4NA 1J5CA 2VDRH 3RWIB 3UJTH 3NCWA 3EIFA 2Q3ZA 2ZWYA 3TM6A 1QFPA 4LIQH 4EJ1C 4JY6B 1NSNL 1YJDH 3L7EB 2AFNA 4DEPC 3CIAA 1KPRA 2J1YA 3WEXB 1BJ1H 1FZJB 2ZKWA 3O9WD 4DERA 5IJKA 3GZPA 1G7HA 5DWUH 5D1ZC 2JKSA 3SKOA 2X38A 3L3OB 4X6EB 1QSEB 2IEPA 4OIBA 5C0GB 1V27A 4PJ7B 3MVSA 4FFYH 1E50A 1WUZA 4TSCH 3GIZH 4XXWA 4ZNEE 2HT2C 2XPYA 1MY7A 1WYJA 2VC2L 4LHJB 1G4RA 3T65A 2B0SH 4BK5C 1TXKA 2J55A 1HL4A 4JKNA 2R0ZH 4Q8BA 3VGBA 1AE6L 1IGMH 1NM9A 2NYZA 4ZS6C 3JUYA 4WO4C 4C59B 5G4OA 2PXYB 3WFHA 3HE7C 1QBBA 1MFAH 5I30H 5F7FA 5HXMA 3QCVH 2OMXB 5DHDA 1A5FL 3OAZH 2MKLC 5KTEL 3S4SA 3ZL2A 1C7SA 1OD9A 2AVFA 2M1KA 4PB9L 1M6OB 4JVWA 1C12A 4GEIA 2MOGA 4WFHD 4D0BB 3WSQH 1E4HA 2FYYB 2BSRA 2DTMH 4FXGA 4HSQA 3UGUA 5AVYB 1C1EH 2A4EA 5E2WL 4Q6IB 5CMAA 3ZRCC 3D51A 2VSMB 4NAQA 1NEZA 2QMJA 4G8IB 2JTDA 3C6LA 3MCLH 1YSOA 4YPGB 3GZKA 5I16A 4QMEA 3NA9L 1N8ZA 4DP6X 2OXGB 1SYSA 1VFBB 2AKRA 4QRRE 4X7TB 4JVUA 2C9XA 1DVYA 4FN0A 1KELL 3PPSA 4MQSB 1XR8A 3FKUS 1U0QA 5HYJA 3SO3C 3GXNA 1EAOA 5B4MC 2G9HA 4GOSA 3HEIB 4KK5D 5F1SA 2CHZA 3V0JA 3HKZA 5D71L 2HLAA 3P0YL 3U6XS 3L3JB 3T1FA 3AFLA 2B20A 1AR1B 3CZSA 4JM2F 1E6OL 4NKOA 4LDOB 3B9EA 4N0UA 5D7IA 1UD5A 1A1OB 2ATKA 3PL6A 1CFVH 1NCCL 3H4FA 1KLUB 2GITA 3ZHNA 5TE6L 3CFIC 4F8NA 4WV1C 2YWYA 1BZ7A 4XNQA 4XCEB 1CUOA 4Y0GA 4IMLA 2V9QA 3DYPA 1ORQA 1S7XA 3ZIYA 4XR8C 3V95A 3OKNB 1OQOA 3ELAT 3M88A 1UCBL 4HZ1A 4QGYA 4Z3HA 4JPVL 3WFEL 3KPPA 4J2XA 2RH0A 5J1AB 1EBPA 2BINA 2P8MA 2VAJA 3ZVVA 1ND0A 3D07A 3HLAB 2NT1A 4J6RL 1KBGH 5LDSA 3EXJA 1TQTA 3IAPA 2Y1YA 1BLNA 1Q72L 2OW6A 1TVBB 4GW4B 4KMTH 4LBAA 1TVDA 5ERWA 4ELMF 2DD8H 2UX7A 4ODXB 2QHLA 4C54A 4CMMB 1F4WL 1UYWL 1U36A 2GJPA 5HDOA 3MMEB 4GRMB 1IAII 4U3XA 3D06A 4LCIH 1AO7E 5F7LB 4AYMC 4AJVA 2WPGA 1V7NL 1VACA 2VH5L 4EIGB 4RIRB 3I3BA 4NBXB 1JXKA 1P4LB 1AZZC 2X4OB 1DO6A 1H3WM 1RUKH 4ZTOH 1G87A 3FFCA 5EUKA 4AUJA 2MCPH 2Z7ZA 1OPOA 1XFPA 2C3VB 1G7MB 3Q06A 1A22B 3CDZB 2ZCLH 4YHOH 5BV7H 2J4WL 3FONA 4FYQA 3DTDA 2R23A 3TNMB 2B15A 5IVOA 4NZDA 5KW9L 1QUNA 5DJ6A 4LCYB 4Z18A 5E6IC 4XPFL 1UXLA 3F85A 5EU6D 3F84A 4Z76A 4GFXA 3ESMA 1RL1A 5FA3B 2Q87A 1WBZA 4QHKI 3WNOA 3WNMA 2EUWA 2WXIA 3S5LG 3JQOB 4KNUA 1QI3A 4P05A 2OJEB 4Z3FA 1XB8A 1NPUA 4ZFQA 3LPWA 1HHGB 1JHTA 2IQ9H 1IIKA 4OZGF 1K4CB 1R47A 1YYLH 3BGFB 5JUEL 2EVJA 3H6JA 4L4TE 4Y1AA 2ENPA 2ITEA 4QJ5B 1REIA 5JOFA 2DWEB 4X98B 5C0BB 3VXNA 5HPMB 1WA2X 2X70B 3U2SA 1RIHH 2WZAA 3NZSA 4XCFH 1D9KC 2DWXA 4ZFZA 4JANA 5FUCE 4OGAD 4RAHA 5JXAL 2EDNA 4ELDA 4MJ5A 5F9WB 4X80H 2HG5A 5E4EC 5I5IA 3VXPA 5TPWH 2OPCA 3MRFA 5DRNA 3EG9B 3P0VH 1M7UA 5HYFA 3WCYA 3AMLA 3D1MC 3H7BB 4M6ML 2AV7B 4PPTA 4FYRA 5HGBB 5E8PA 5F0PB 1BHGA 4KWUA 5KJRL 4UAHA 3T6VA 4NFBA 2BWQA 5FYKD 3B2XA 3JV4B 1HINL 1OCZB 1XL6A 4PJFE 3V8CA 1K6QL 4XVJL 1EGJL 2AJZB 3GF8A 4YZFF 1PZ5A 2ZUQC 3GBLA 4L2LA 2X4SA 2CCWA 2EC9T 2ESVE 3DIFB 3RBGA 1UH4A 1MRCH 2G30A 4POZC 4H26A 4OKDA 5I23A 5E03A 4GSXA 1KWGA 2VDLH 4S1QH 3BWZA 1ZANH 4HS3B 4OF7A 5CJXA 4ZYKB 3JWNC 1B4TA 1KZQA 1DN2A 2ZSWA 4KKQA 5EF1A 2MNJB 4UM8A 4XO8A 1JIBA 5E7FA 3OMIB 1QO3A 3S36L 4PWGA 1WJ3A 2XKSA 1BXVA 2BOCB 4XVTH 3RPIB 1XZ0A 4FQCL 5IB5B 1AZUA 5IROC 1MFDH 4GRLA 3OB0K 3EYUL 3P11H 1U3YA 3L3IB 3FH8A 4JKPH 1P4IH 1ZLVH 1KN2H 1JL8A 4DETA 3P3YA 4NHUB 1NBYB 3U6XA 3QDAA 4PGBA 3GHPA 4PJXA 4A68A 3ATAA 1LD9B 3BZEA 1TKWB 3GSXA 4Y2DA 2H32A 5K9QG 3SZ6A 4BCZA 1BFOB 4KI5D 5D7JB 1PQZB 1S7RB 2YD8A 3VXRE 3QYNA 5A2KH 5DHVA 1U8KA 4N8CH 4TNGA 2VZUA 5JHDE 5E24E 3IDIB 4L0PB 4XPBH 1FAIL 2WBJC 3ZR6A 1AGFB 3O81A 3FT4A 4WENB 1N8OE 1S9VB 4U0RC 1EHLL 4AQ1B 5K1JA 3ZKSD 1I3RA 3OAZK 4JCLA 1YRKA 1A9BB 3VGDA 2CCLA 3F12B 1R3IL 2X09A 4AE1A 5J11C 2A6IA 1UXMA 4PJ9C 2HMID 2QQQA 1AJ7H 3PHSA 3ARBC 5AVZB 5JIHA 3QZBA 3MACH 3LZQA 2D3JA 2H41A 2HKFL 3HE7A 2OP4L 1KMGA 2DI7A 4UTAH 3K2UL 1TVHB 4N1EA 4AITA 2FO1A 1IUZA 3OC5A 2Q20A 5AKVA 5AVUB 5HYQB 3L08A 3GNML 1H9DA 4HWBL 3RIAF 2QBWA 1MG2C 4F7KA 4YHNA 4HOXA 3MLYH 3ZL1A 4DEPB 1EZSA 4IKNA 3L95A 1ZA6B 3Q8BA 4NAJA 3TBBA 1WFUA 2R8SL 1A21A 5D1ZB 2VDKL 4RAVB 4G7RB 3MYJB 2OMYA 3D30A 4YSDA 4KTDL 1BYNA 4PBDA 3NIDE 1E2ZA 1WPCA 5FYJH 4LOUD 5EU7C 1CFNA 4NKIL 1YMMB 3IMVA 5E4IA 1KULA 5E9DB 2C7UB 1KJ3H 5T1LB 3WFCH 1FVCB 2AQ2A 2X0WA 1OWRM 1YEHL 1H15B 3DMMC 4DKEH 2G4GA 4PJCA 4BSVB 2IH8A 4XNUL 1KLFB 5E4OA 1MJJB 3Q6FA 3PPEA 4HWZA 2ORBH 4G5ZL 4NYLA 3DVIA 3D08A 4N5ED 2Z92B 3SDXE 1BFVL 1RLBA 4PYHA 3MLUH 1X7QB 5IMKB 4F7TB 4HC1L 4LDLB 1DQVA 3RIFF 3S9DB 4KOBA 2X6UA 4NFCA 5I66A 1Q9OB 1AGEB 1SDAB 4ANUA 3LRGA 1E28A 4M56A 4GI8A 2MKWA 2IPKB 2VDNL 5GRUH 4OLVH 3WN5C 2AQNA 3RX8A 3RVVD 4TQPA 1FNEA 2WBWB 3SO3B 2F15A 4QHLB 2DLFH 1OARH 5F6HI 2CZNA 2J12B 1YNTF 4JMNA 1GL4B 4WAFA 1AZBA 2HFTA 1MWAL 2L0DA 1N5YL 3JSSA 3VTMA 1RZJL 2DBJA 4KRLB 3UAAA 4UDUA 2CM6A 4TPRH 1FORH 1X5ZA 1M3IA 1RULH 2AJSL 3IB4A 4O2FB 5AVXB 1I7ZB 1NGYB 2VN6A 4TLUA 4PRBB 4YHIA 5TK4A 4U6VH 2CM5A 4N1CA 5KG9B 1SRDA 3HBGA 3UBHA 5CHNA 4G1EA 1C9SA 4WV1B 4KX8A 1MDTA 4XMTA 2P5EA 3PXJA 2FT8A 2JK5B 2NT0A 3J7HA 1LO0L 3OVUB 1G6RA 4OCLC 4UQEA 1ZSHA 4S2SB 3SDAD 3V0VB 4ODVH 4U1SB 5T8IA 3MXVL 1I8MB 3BW9A 4MB1A 1AI1L 4G8GA 1RPUA 5DJXA 3QDGA 5AUMB 2GY5A 4PJDF 3C08H 1C7TA 2FX8H 3NBNA 4TVPD 3WIIL 5C7XL 1WAAA 2WW8A 5I8KL 1VGKB 1NZRA 4LCCA 4YSSA 5E6RB 3GTVA 1QI4A 4OB5L 3FT3A 1WZ1L 4OI9A 4P5MB 1I85A 3IGLA 3PXHA 1MQ8A 5AW4B 2WQSA 4KJQD 2IH3B 3NN8B 4PJ5E 5EU5A 1SEBB 2BM3A 4KDTC 2DV6A 3MXWH 4ZX6A 2VLRA 3FTWA 3O3BA 2H3NB 4QRAA 2FT6A 2X6AA 1TU2B 5ENWA 4NRYA 1ZK5A 5EA0H 1GC1L 4KZCA 2BVOA 2XFXA 5KVFL 3LZFH 1IM9D 1UH2A 3AWFA 2C1PA 3FU3A 4M7LL 5BOZG 2V7NB 5DRZB 2BNQA 4BZ1H 5HVFB 3IU4L 1V3LA 1IC7H 3EXLA 4OFVA 2P5WE 5I1AB 4P5TA 2YKLH 3OF6D 3TV3L 4AK2A 2P42B 3FB5A 4QRTA 5CP7A 2VDQH 1IT9H 5DMKB 4QCIB 2J6EL 1N2RB 2WXNA 1GOGA 1MFCL 1PG7L 1HXYB 2F7OA 1A4KB 2Y6SC 4GPVA 2YXVA 3EO0B 4KMQA 3DK2A 4NAMA 3ABKB 4KDVA 1M7XA 2VXTL 4NP9A 4NNPH 2GCYA 3MUJA 2UXTA 4JFOA 1A6WH 1JHKL 3FHQA 5GZND 5IFHH 3X3GL 3VU2A 3PWJA 3E9UA 4B7LA 5CN1A 1KENH 1QOKA 4FERA 1GMIA 2E46A 4HCRH 1IVLA 5DJDB 5FA4B 3AY4A 1U3HC 4LLMB 4H1LB 2IH1B 2PP9A 5DZ9A 4AI7A 3RX7A 4ZMWA 5CCJA 2VMCA 3S3JA 2EKSB 1ZLVK 1WUNT 4I0PA 3PUCA 1HILA 2ZUYA 5FGBC 2OI9C 4Q7DA 3S37H 1D9KB 1QLEH 4PWKA 1FFQA 2LAAA 4G6KL 1FZKB 3ZZ1A 2OR9L 3JT2A 5CSZA 2ZP8A 2F1AA 1EO8H 4GRLD 3MRMA 5E4EB 1T4WA 2XZAL 4IBWA 1CYGA 3N0AA 3PDOB 1WFIA 2J1ZA 1YC8A 2Z1PA 2YHGA 3MLTA 5IBLD 3V4PB 2HP4A 5AVSB 5EC1A 4Z7VA 3BO8A 5L2KA 2DEXX 4PV8A 2HRPL 3DETD 1XSOA 3K91A 3F83A 4ICXA 4NC1E 1DHKA 1MRFL 4G43A 2QSCH 2HVJB 2J88L 4WF7A 1RERA 2ZUQB 4PB0H 5KVEL 1CXEA 5I1GL 1H19A 4X99B 4DVRL 1CQKA 3NJHA 3X12A 3P0GB 4DGYL 2WZPA 3D2UA 1E4XL 3ZSTA 4QRUA 1T1XA 3CFCH 1JN6A 3IRPX 5DYOB 3VCLB 3RIKA 4GSDH 3G6DH 4OV6F 2NX5B 2BSED 2WLJA 4X8JB 1T7XA 2RCSH 3BKMH 5FFGA 4XPTH 4LLAA 4NRXB 5AW8B 2GSIB 5ICUA 3WU1A 2O5XL 4E36A 1NJ9A 4NGHL 3GLAA 2FNBA 5KYUA 2OR8A 2ZCKL 5GJTH 1BVKA 1LO2L 3S88L 3CLFH 2I5YH 3N1QC 4P5KB 2HTLC 4LSVL 4N20A 1YDPB 3PF2A 2HH0L 5C07D 3HC0A 3LNGA 1C5CH 4JY4B 1CGSH 5TQ0L 3CC5B 3WELA 1YEIH 3O4LD 5LBSH 1ZLWH 3LEYL 3QJRB 4ZT1A 3KPSA 3L3HA 4JAMB 3T2NH 5KSBE 1DVTA 5LCVA 1A1MA 5F88A 3VW3H 4MASA 5KEZA 2FJHB 1OTSD 4W68A 3CIQA 2OZ4H 2ZUSA 3NGBC 4N6QA 2B14A 4ZZKA 3NJMA 4GAYB 3O3EB 5SWZB 2A74C 5F3HB 1BQHG 2WBJB 3BAXA 3NCJH 5FGSA 1FZOB 2WCPA 2XG5A 5KZCB 3A6OA 5IFJB 1N59B 1OM9A 4MMXC 4U0RB 3T3MB 5BXFA 4KO5A 2BHFA 4WWID 3V2AR 4BSWA 5E1HB 2CO1A 2QSTA 2ZUTA 1BXXA 2AK4E 4IRZL 1TEFA 2HWZH 3UH8A 3SJVD 4R26L 4N2AA 5CCGE 4IRSA 2VAAA 4KK9C 4AYID 2IGLA 4PJ9B 4UQ2A 1BVOA 3T6ZA 1AG0A 1QFWH 3BI9X 4JG9A 5F70A 3ARBB 4WI2A 2VISB 3PS6A 2P26A 5J06A 3HFFA 4P2OB 3QUKB 5GRWA 3V9EA 4AYEC 1CFQB 5DSCA 2O5ZL 2YEVB 1FYTB 4WTWA 1I3UA 3O6KH 2H9GB 3DTXA 1UWXH 1BD2E 2A9MH 5E6UB 5GJSH 1IGIL 3KYNA 1GIGL 3FULA 2Q2LA 3HA0A 3VXQB 3WHXA 4U31A 1LWHA 4FNRA 4FFWD 1S7VA 1MVUB 3CVHB 1G4MA 3O2DL 4MAYC 1J8HA 1YN6B 3OMAB 4EPSA 2R56L 4YHKL 4J2QA 4GSQA 4JN2B 2PO6B 4NZFA 4R2GD 4PGJA 4GRWF 3KAAA 5GRJH 1TR7A 4L4VE 2KPNA 2DQGH 3ZKQD 1U2HA 2IV8A 3LTVA 4MA1C 5JIMA 5KVDH 2E7MA 3NESA 3IT8D 4G80A 4DIXA 2FHBA 1W91A 4ZMZA 4BWTA 1A3LL 1EV2E 1ZRUA 4XC3H 2NY4D 4M7ZC 2J5WA 5CGTA 1OL0A 1F11A 3BH4A 1VZIA 5EBLB 4I89A 4H8QA 4LHUA 2X4UB 3DMMB 4B9KC 3EBIA 2FVNA 1IRAY 4UTCA 4DUVA 5KVFE 4AOFA 1B2WH 1MXGA 2BDNH 2ZT9C 1MCNA 2P5ED 4JGJA 3VI4E 4F93B 1GPOH 1RU9L 5E8NB 4HJGB 4PW4A 4PIRF 3H3KA 3RL2A 4P46D 3WUWB 2J8UA 2A1WL 3MV8B 4KHTL 3EYVB 1A7PH 3SOBL 4Z0BL 3H9YA 2AMGA 2NNFA 2YMXH 4DN4H 5SV3A 3P73A 4X6DA 3WN5B 5K9OB 1I4FB 2NXZD 4MWFA 3QPXL 3BUIA 1CG9B 1A6UL 1QFUL 5JHBA 5EIIG 3GLDA 3IFOA 5F3BA 3MJ6A 4AQEA 3F58L 1A7RH 3MJ9H 1E4WL 5EUOA 2BCKB 4P2QB 3UAJC 4YSCA 4GUOA 4OT1H 4FQIL 3V0FA 4AEIH 5C0AB 3T2LA 3KBHE 5DK2B 2B5IC 5CJOH 4RMTA 2WUBL 3MUGA 4FZEL 3US0A 1RUPL 1SBSL 1KN4L 3ESPA 3V6BR 3H9SB 4HAGA 5C0JB 3VD4A 4WCYH 2R7EB 4K7PL 2UY7A 2KZKA 5F0LB 1IC0A 1HHJB 5DR5L 2CDGB 3H9HB 4ORGA 3KLQA 1A0QH 2QADD 5I24A 4P5TD 4FOMA 3GMMA 3NFPA 3D0VA 43C9B 4W4OC 3L5HA 3LQZB 3FUJA 3L5JA 4Y16C 4AH2B 4P4RA 5DA4A 3VGFA 4FFZL 2OCFD 3KWTA 2D0GA 3CN3A 3O6FC 4P2RB 1UACL 1JE6A 4N2MA 3JWDC 4MAUL 3TH3T 2CXGA 3MBWB 4FS0A 5CJQL 2IOOA 4H8VA 1XSIA 1SY6A 1DSFL 4BZ2H 2O93L 5GGRY 3F7YB 5KVEE 5EO1B 4P99A 4MVBC 3LIZA 5C2BL 5CR8A 2Y6TE 3CFEB 1N0XH 5KN5B 4OCWL 5CWSA 4KJPD 1XGYH 2V17L 4I0PD 4KHXL 3D3VA 1KY6A 2LFEA 2HT3D 1SXNA 1G7IB 1U8JB 3IDYC 1NCGA 1P1ZA 3PGCA 4LLVA 4LP4A 1FF5A 5FGBA 5FC9A 2V5RA 1E43A 2NY2D 3EGXA 5FYJD 1MCCA 1UJ3C 4CVUA 4WWPA 5I6NA 5DMJB 1TZHA 1CU4H 3ZKMC 4IOFD 2A6JA 2QR0B 5HGAB 1FH2A 4KKNA 1SDDB 4U2ZA 2D31A 1AG6A 3MNZB 2G0LA 2WYHA 4IGBA 4IMKC 1UOWA 2CRYA 1T7ZA 5C09A 3PV6B 4JPKL 2DMGA 2K6ZA 2PWHA 4RBPK 5H2BA 3O41B 4NN7C 2ADGB 3DJTA 3D2UD 5EO9B 1Z9MA 3SDCD 3HCVB 2GSMB 3ECVA 1UEYA 3PWVA 5BRZA 4WSJA 3T6QC 1U3HB 1G7PA 1BOYA 4TNWK 1DLFH 4RX4D 4S1RH 1CWVA 3UTSA 3T04D 3UZQB 2LTQC 2OI9B 1M05B 1F1GA 4RWYH 1I31A 4LGRB 5IESL 3L4UA 3VI3E 1E4JA 4OF0A 3FU9A 5TE7H 5E1QA 3CX2A 1MJ7H 1OSPL 1ZTXH 3LSOA 4R7VA 3TFKC 3C5SB 1U6AL 2CUHA 1GGYA 3CFBA 4NQCB 4UBDC 2X05A 5AAPA 4UILL 5FCUH 3ZUCA 2OTUB 1AS7A 3A47A 3C5JB 2WMPB 3DIDA 5GSVB 4N2FA 2A9AA 1VCBC 4RDQF 4NENB 1GR7A 1Q9KA 4MCYB 1IL1B 2VZSA 4GQ9H 2UY6A 3OWEA 4Y9EA 2Y06H 4XH2A 3RWDB 3GUFA 3ILDA 5F72S 2WXRA 5DJ2B 1AQHA 1OP3H 3CG8A 3PDGA 5DUMH 1PIFA 1H5BA 3ZDZB 5JPMC 4KKLC 3D39A 5DD6B 2B16A 1QSFE 1A9VA 3FO1B 1XTLA 4U6TA 3DJRA 3CUPA 2GABA 4OLUH 3QG6A 1Z32X 4RQQB 4GO6B 4OCYH 1MPAH 4PCTA 3CSPA 3H2PA 4IRSD 1J9RA 1ZJAA 2X1QA 4AMKH 1UWXK 2FUQA 3FQWA 2DYPB 1BIIA 1HSAA 1TYRA 2RQEA 1FHGA 3I02A 2AXHA 2OMVB 1TUPA 4OZFB 4JQXC 1AZCA 3D7PA 4NRZA 3GMPB 5E95B 2VZ3A 2MQ3A 3MO1A 4R8WL 1JPFB 5C71A 4BFKA 3RUGF 1T0NB 1PKQE 4TUOA 1CZ8L 3NIGE 4MRCA 3FO9A 3OR7B 5F0MB 4IOIB 2GTWA 1KPVB 1BF5A 5GGRA 1T21A 4WNQA 3WS3B 4X5RA 4FULA 3KVPA 3FMGL 4MQTB 4F33B 3ZLQC 3NGBB 3QQ9D 4IQHA 4AGNA 1OK8A 4HOZA 2A74B 4MS6A 3NFSH 3CXHK 2X1OA 4FNPA 4KVNH 1KJ2H 1GYWA 4QHPA 1FFOA 5KSAA 4MMXB 3T4YB 3OV6A 2KPWA 4LSQL 5HYSA 3KVQA 4PG2C 5C3LD 2RTTA 3B9KA 4WHCA 3U83A 3LH2L 3VG0L 1RP8A 5ISZD 3QNZB 5HVWA 3EOTH 5AWNH 1XF2A 2FLMA 3L4YA 4D9RE 3MV7D 1FN4B 2X9YA 4NT6A 5IOPB 4WGKA 1I1AD 3I3DA 3QEHB 1QFOA 3FW6A 2IAND 3CCHA 1BXAA 1NANH 5DMGD 1OGTB 5JNYB 3MLSL 3BP5B 3AACA 4MXWH 4EVNA 3MLRH 1KC5H 2D2OA 4OCMC 3N40F 2XKNA 1PBYA 3IFNH 4JFEE 4ANXA 3INOA 4HS6A 2Y1AA 1HYSD 5IG7B 4WU5A 2OX5A 3EFOA 3H7LA 4MAYB 3QORD 3SGJC 1KBPA 2JH2A 4U3SB 2JTYA 4TTDD 5EO0A 1N5AA 5HI5C 3ARQA 4OZIF 2XC8A 3AS3A 4DGVH 1DR9A 3L54A 2GG1A 5EWIL 3QWOA 1ZVSA 3QQXA 4MA1B 1YAIA 3BDBA 2V5MA 4G9FE 2HJLB 1UASA 3DSFL 2EDYA 4ES8A 5E6ZA 4JG1L 1GGBH 4JUTA 4DP2X 1A7NH 3DBXB 1DL7H 3OKEB 1OSYA 4M7ZB 3TEXA 5EF0A 1CGVA 5HI4D 3VFMB 1JXFA 2ADIA 1KTBA 5DS1A 1Q94B 1L3NA 2EEDA 3FQNA 3ZGHA 3BHBA 2MTAA 1EHXA 3LAFA 4MMZC 3KL3A 4N0YH 4Y4KB 1SHSA 1KIUA 1MIEL 2XACC 3L8QA 4PRIA 4RGND 2PLTA 4E41B 1XF5A 5B39A 3MJ8A 5FB8B 5IGXH 1CC3A 1U41A 1YYCA 4HA1A 3UFIA 5I8CB 2IFGA 4FQXC 4CADB 3PWNB 2XA8L 2F8XC 4AM0B 5KYYA 1GOFA 1QW9A 1U92A 1WHOA 2XTJD 4HF5L 1KYDA 4JLRA 4A6YL 5CXPA 2EVGA 4XCCL 1J8KA 4NNYA 1TQWA 3BPNC 3HE6A 3ISYA 2B4CL 4GQQA 4YK4C 4QO1A 4G7VL 3K6SB 3K71A 4Y16A 4B27A 2VQUA 3P9LB 1WVZA 2GTZA 4QF1B 1NL0H 3FT1A 4L3EE 1L9RA 1RY7B 4U1KA 4A7GF 5GPRA 2Q7YA 4F2MA 1HE7A 4FTDA 4IHOB 3DLQR 15C8L 2HN7B 3EJTA 1ZAGA 3F6LA 3QFGA 1ED3A 3SKJH 5LVEA 1YEKL 2YMOA 3GMNA 5LNDA 3G5YA 4G83A 1JGDB 3QYCA 4JG0H 5AYUH 5A1AA 3FRPG 1RK0A 2YR3A 4LE8A 4L29A 2F19H 1XZWA 3L3GA 1HZKA 3S2CA 2NNCA 4UANA 3GDCA 4V11A 3CH1B 2WQWA 3D18B 2YSSB 4NQVB 4W9IC 2X12A 5CGYD 1PLCA 1G7JB 3N9GH 1YY9D 1MWOA 2GJ6A 2ICEA 3I6GA 1MI5D 1V3JA 4FD0A 4M43L 1UXSA 4CVZA 5DRXB 3SGKC 3NDZE 1XSKA 3LV3B 1VIWA 4XP5H 3X3FH 5MERA 4PJEA 2D9CA 3BD5A 4M3JA 4NZJA 4ODUB 1GW6A 1NAKH 2CBPA 2DQHH 4F57L 5TJWK 2JKJA 1YZZA 4WWOA 4PJGB 3HHRB 2AJXL 4M8QB 3UBGA 3TEZA 3AC0A 5FO8B 4RNRA 4IGBD 2OQJB 5C09D 4XBMA 4H20L 5D2LF 1U8CB 4MX7A 1SM3H 2O5NA 3EFDH 2B7DT 4GSRA 4LRNL 1T0MA 3DURA 3KDPB 4ELME 1F42A 4LL1A 1CFTA 5EORH 1KXTB 4ONHA 5HHMD 5DFWH 3CU1A 5INDA 5BJTB 3GSNL 1M7DA 4NQDD 3SGEI 2PCPB 1JGVL 3GMRB 3SE8L 3BSZH 2A0LC 3CXFA 3NABL 4Z95L 1QSZA 2JB5L 4D9QD 4B9IA 4DO6A 2QLVB 4DN3H 5I17B 5J12C 5C0FB 1HOCA 4UT9A 5C86A 3IDYB 2ARJQ 4DPRA 4XRCB 3RX5A 3L4XA 4CN4A 5I6LA 1IC4H 1RHFA 2H3KA 3HN5A 4WUUB 5D70L 1UJ3B 5D72L 5DK3A 3Q1SH 5FO9B 4YUEH 4GBXB 5IP4A 3V4VA 4JL2A 3E6FB 3QUZC 4N6RB 5LWYL 4V1DA 2GEEA 2Y3NA 3MRPA 4JHUA 4BJLA 1RSYA 1YNKH 1QBLL 3UO1L 3KXFA 1Z9OA 3S36X 5GSRA 5D1XB 3WIHL 4PRPA 3BXNA 3PWPB 2BW5A 4NUPA 1N0LB 4HUVB 4EN2A 3B2DC 3MV9D 3CH8A 3I74A 4KXAA 1NCOA 1S7TA 2KZ1B 3T8VA 3CSBA 1DQKA 4FQLL 3K6NA 4NN7B 2QPSA 1S78D 4WWKC 3QFJD 3VFPB 4HGWA 1G1OA 4GMTL 4YX2H 1HI6A 3I9GL 3KG5A 3D39D 3HAEG 4IU2A 4AL8C 5M7QA 3CDYA 4PLKD 1EDQA 3MFFA 2D2CC 3W82A 2JJWA 4N90D 3CX5K 5JPMA 5AD0B 1RJZA 3UCQA 1PKOA 3WD5H 1OXYA 1LM8V 2LTQB 3HS0B 4RWHA 2V3EA 4ONFL 4J3UA 3UGXA 1EEYB 1T22A 3ZO0A 1OALA 4Z7WB 3VQMA 4FADA 1OGAA 4GO9A 1KG0B 2VN7A 2LU7A 1PSKL 4PJHA 1V5JA 4J1UA 3NPZB 1R3KB 2XIDA 4MCZB 3BPOB 1CBJA 3IK2A 4L4JA 3VNYA 1AHKA 1HEZB 4JN1L 4UMGA 4KRNA 1NCNA 3CC1A 3BAYA 4H0LC 4JRXD 4M1GH 4YZFE 1NDMB 4WI9A 3VE0B 3PWLB 1FZMA 1RP9A 4GAJH 3WEBA 5BZXA 1CLCA 5LJYH 4X6EA 1JHLL 1KLGA 2V2TB 4XB8A 2CLRB 5IMOB 1N10A 2AJ3B 3X13A 4PHZA 4EN3C 4KI1A 4UM9A 5IREA 1P5UA 2B8OT 4UI2A 3TT1L 2R59A 3KWWB 5FYKU 5KSAD 2H2SD 2W60B 1T5XB 4UV7L 1NCBL 1RQ5A 5FDWA 1E4XI 1JUFB 2PKDA 4KY1L 2CJSA 2VNCA 4PJBA 1LNUB 4M1DH 3Q9QA 1CD8A 4FLSA 4UQ3B 3RY6A 5KS9B 4XMLH 4YGAB 4M6NH 3VRJB 1P7KB 1XH2A 1T66C 2JKNA 3HHMA 3QEUA 4K2UH 4HLJA 1IAOB 1HCYA 5J89A 1BQLH 4LASL 4WEMB 4I2XB 5DO8A 4FDWA 1CBVH 1RH8A 4L1TA 2XRAL 4A66A 2QEJA 2VITA 4MA8H 4Y19D 3QIBA 1CVSC 2WC7A 4UT6A 1SOQA 4ERSL 1J1PH 4X6CF 1O7DE 1BAGA 1P7QB 1RAMA 3DWTA 2PYEE 3BP4A 1DE4B 5T1MA 3E6HA 3ML8A 4FQQA 4ZAKB 1G9ML 5FK9A 3IKKA 1KYFA 1HL8A 4UT7H 1TJIH 4FHJA 4PBXA 1PLGL 4JKMA 3R1GH 1CTMA 3DGCR 1G9NH 2DEYX 2W0LA 4HJ0C 2R29H 5EU4B 2CDFB 3NP4A 1KV3A 4A2LA 1IGCH 4C56B 1UA6H 3SOTA 2W0KA 3FU7A 1RPQA 3C8HA 2GUYA 3M17A 5DTFB 5TTRA 4NM8H 4B96A 4DEWA 1V8HA 5FIEA 1MHEB 2Z31D 3QDJD 3EBHA 4L48A 1AXSB 2MHAA 1JZ5A 2UZXB 1PU0A 3I75B 4NWTH 1YPZF 4JRYD 1JPST 4FEMA 1I8KA 1HTYA 1T83A 4JFHE 2FBJL 3SCMA 1NGQH 1TJXA 1IEAA 2IWEA 5D7LE 4I85A 3BH8B 4WU7A 4AIOA 5HPOA 2WUCH 2ITFA 2ZXGA 1J9SA 2BSTB 3P30H 1HQ4A 3DXAE 5DJCB 3WKML 1XH0A 2ZX5A 2W0FB 4D3CH 5IQLA 3LXBA 1UM6L 1VADB 2PW1A 1QBML 3WTSA 3RKDD 1CICC 4HFWB 5LQBH 3SE4C 1CXIA 2A83A 4EI6B 5A3ID 2F74A 1SGKA 3QJSB 1GS8A 3N1FC 4M6OH 3Q5OA 1O6TA 2GAZA 1FH5H 1JERA 3HLAA 1Z9SB 4LSPL 4ZNEA 1DBJL 1SUHA 4MNGB 2WWMD 2R0WH 3DX7B 3QXDB 1Z0MA 1UD3A 3QIUA 3D0AA 1P84J 2IG2H 5BQ7A 5I1HL 5F0JB 3ZIMA 1HKLH 1BVLA 1QMUA 5CINL 3QDMD 2R0KH 3G5XB 2KMWA 2NLJB 1A2YA 3MMEA 2H32H 4EDWL 5DJAA 2EKJA 1RCYA 5C8JB 3AY2A 4YNYB 4XX1G 3WKQA 2DM3A 3ULSA 5DEGA 3FTGA 3ME0B 3KPRA 4MMZB 2W9DL 3SBRA 4Q0XH 2UZPA 4U6YB 1QA9A 4PCSA 4Z6AT 5K5YA 2VLKD 3IDMA 4FQXB 5DGQA 3D2TA 1WIOA 3QH3B 4R84A 1I1FB 2JKXA 4QRRA 2N1KA 3MRRA 1ZPLA 3L1GA 3FQ4A 4DCQA 5KWYC 5D1QE 3BPNB 5D5MB 5EZLA 2E9GA 5FM4A 3TL5A 1UADC 5IB3B 1NCWL 3L9YA 4YK4B 3VWJA 2AJUL 2NW2A 1JV2B 3X1BA 3EOBA 3MRJB 2VLJB 3NA4A 4QT5B 3KMDA 4N2DA 5A6LA 1BQSA 1P0SE 1NFIA 2G60H 3UBXI 4OI8A 4JE4B 4KQ3L 1FDLL 1A6VL 1JGLL 5MEOA 3W9EA 1CYWA 2C1OB 1PIGA 1PG7X 1CDIA 3ARDC 4B9GA 5LXVA 5TDNB 5GS3A 1NCDL 2Y07L 2VW6A 2K9UA 3MPCA 2FWLB 5HHOD 3HI6L 4LAJH 1TZIA 3RNQB 4NKDA 1U8MB 4MNHB 2DQDH 3R0MA 1C8PA 3OX8B 4JDEB 1L9NA 1BGXH 1JDCA 2UWEB 4HDIA 5DZAA 1IGJB 5F96H 2IWFA 4DP9X 5ID1B 1U2CA 1J5OL 5E2UL 4ICWA 3GGWA 1J5IA 4PJDE 4B3VA 3HRZA 4V1DD 4FFTA 4Q9QH 2VKXA 4XP9H 3VFVB 1Q4NX 2AJZA 4XPAL 1GZQA 4I3SH 5DZNA 4HG4J 3KXFD 2E47A 3FU6A 2BK8A 3OSKA 1ADQH 3DKHA 4PRPD 4UUJA 1TTCA 1IQDB 4NZRH 3QO1B 2FQDA 3DROB 3O11B 1K5NB 3ILQD 1AO7A 1NBZA 2A9BA 2A4CA 5AOZA 3WE1A 3RHWF 5DZPA 1MAML 1R4XA 3R4DA 12E8H 3O3AB 2ZKHL 2QTVA 3VMPA 4AVJA 3ETSA 3F65A 4HIHA 1RD6A 4O02L 4PEEA 3HC4H 2G4EA 4YGVA 3IGAA 1EPFA 4MXVE 5F89B 5MEQB 1W0VB 1NCAH 1AD9A 2BOCA 1DQQA 2OLDA 4HALA 3RPIA 2FEDC 1LO4H 3REWA 1J1OH 1T4KA 1B90A 3TBVB 2F58H 5J12B 2IDTA 1HAUA 1X5LA 2GT9B 5I0YA 4ENZA 1MZYA 3MODL 1P9MA 3LYRA 4TNVF 1OGAD 3QJFA 1MY5A 5F7DB 2X1WL 4CN1A 1UURA 2EXSA 5I8OL 3SYPA 1HDMB 1MFUA 1BWWA 4YXKL 1BFOA 3B9AA 1SLUA 3B43A 1BQRA 3QUZB 4A04A 4MNQE 2VXQH 3K0YA 4LEOB 1FNLA 1TENA 2WP3T 3HZYA 4K8RC 5KYXB 1F4AA 4LMQI 1M71B 5EB9A 5I75C 5BZWB 3OKDB 5B7MA 4F7PA 4JHWH 1T04B 1W6LA 3I50H 4NPYB 1DSWA 1YNLH 4PJIF 1QSED 2OL3A 4AQ1A 4D9LL 5IR1B 4UM9D 4WWKB 2IPUK 5B7EA 3RDTB 4UINH 1XGUA 1CLOH 1U8LB 3CFNA 4G7YL 4KGLA 5AAMA 2Q8AL 1INEL 3IKCB 4JFVA 3B34A 4HCGA 4HIXH 2IMNA 5MEPA 3ZDWA 2J71A 4YVUA 3SPHA 1BAWA 5AW5B 3K2KA 1BLIA 4TSAL 3RG1C 1JFHA 5GGUB 5TE4H 4ZW3A 5D2NB 4F37F 2Q86A 5DUPL 3HNTL 4A63A 1G7QA 3BKJL 3CPUA 4OQTL 1FNAA 2RJMA 1DUYA 3JZ7A 3VXME 1XIWC 3B2PA 2CKBB 1XD0A 2VXUL 4UZGA 1CF8L 1CE1H 1CI5A 4I77H 4U1JB 4YXHL 2ESVA 1F90L 3PYCA 5E8OA 1QX1A 4MJIB 3S5YA 4H1LH 5ID0B 4OIIH 1GYVA 3HMXL 4XBEL 1IJNA 3LRHA 4KPHH 4E2OA 2FIKA 1KOAA 4Y5YB 5J1SC 5DZVA 4HIJB 4BH8B 1OE2A 3RQ3A 3K5RA 4EXPX 1U93A 2GFBA 4PRAA 4EN3B 2YOCA 3DRQA 5F2FA 3K5SA 1XB3A 1BOGB 4XVSL 3MNWB 2F1BA 1NEZG 1XH1A 2Y2TA 2NMSA 4YDIH 3L1OL 5ICXB 2OTPA 3ULVD 3MA9H 1YMMA 3FN3A 3V6OE 1AR1D 1FE8H 3UZVA 3GBNL 1QVOB 4EKJA 4WUKH 3CDFA 1QRNB 2EEBA 4P2YA 1P6AB 5DJZA 5ESAB 3V4PH 4WSKA 4BFOA 2GIMA 3WLBA 3L81A 4KJWC 1Q90A 2L4OA 3T8MA 2DLIA 4KKCC 5JHLL 1GYCA 4PJFB 4NC1C 1AKJB 2J44A 3HLKA 3LPOA 4HH8A 3FCSA 5I82A 1A1NA 2XZZA 3VXRA 4G9DA 5LHDA 4PGDB 2VDOB 4F7TA 5JHDA 1IC5H 2LV4A 4YIQB 2X4TB 5FYKL 2XKUA 3U36A 5JORA 1QHPA 1BG1A 3SGDI 4GMSL 4HV8B 1OK0A 4WFFE 3EDJA 5IEKA 5IVZA 4YEEA 2AV1A 5TQ2H 1ETZA 1AGEA 1Q9OA 4KJYA 1PGRB 3JWNH 4JCMA 2IAAC 2PTUA 4PREB 5LAPA 4WW2B 5IWLC 3KPNB 3LHAA 5E1AB 3CHOA 4M5ZL 5EPMA 4F7CB 1WO2A 1T3FA 1S3KL 4BZYA 1MLCA 4YR6B 1YQVL 4KROB 3NFNA 4X6DF 3KHOA 1Z1WA 4HZAA 3MCYA 4Z5RB 2XICA 1KEMH 1KGUA 2C26A 3OGCA 4CJ0A 1E4KC 3DX4A 5FYLD 3A6BL 1QZNA 3PNWB 3U0WL 1CE6B 1KB9J 3K1DA 5HHNB 1IMHC 4HWEL 2PPFA 1GY1A 1BM3L 3FRUA 5LN8A 3VUAA 3L7FB 4MXQC 2DIJA 2WXHA 3MRQA 3WTUA 1KCVL 3KPRD 5IVXA 4ZMOA 4Y4HC 5F7HA 4WK0B 5T5FL 2E9IA 3S3CB 2X53A 1EJFA 1SJHB 4WFHE 3TBTA 2EUVA 4RZCA 2BVPA 1H6EA 4FAAB 1CICB 1BFSA 5C0EB 1T2JA 5HDLA 1W8EA 4OFKA 4WTZA 4YHZL 3NQIA 2R69L 1B0GB 1HIML 4Y2OB 1C08B 4FG4A 4OF3A 3N41B 3F5WB 1VGKA 3BLKA 4N8VG 3CZGA 2PCFB 2V5TA 3VWJD 1C8QA 4ZTPH 1ZLEA 5JO5B 3ARRA 5EZIH 2C9RA 4GRWE 2CK2A 1TTFA 2Z8VC 1SN0A 4UDTB 5I28A 5CZVL 1RUML 4LEXL 5HGHB 1OKEA 4XAWL 4H44C 5BZDA 1RZJC 4TM9A 4XNDA 3AXHA 4WY7H 2H2PC 2KZBA 4NZUH 4PRHB 2V7NA 3LMJH 1L0PA 4HQQL 2YAHA 1ORSB 2QQNL 3HRPA 3SDXA 3FO2A 3GMQA 5CEZH 5CIPA 3FB8B 3Q3GA 3CVHH 1KB5B 1TJMA 2NOYA 1N4XH 1SF5A 2DBLH 4FQJH 2X1PA 5I0DA 1TZOA 5JXED 1SF3A 3MRGB 3N06B 1N2RA 1KBVA 4NQSB 4FQHA 3WGUB 4GW1B 3WMQA 1FG2B 4BRVA 1WEJL 3BRDA 2FWSA 3EO0A 4HBCH 5EZJB 5LGJB 4A2FA 5B3SB 2FB4H 3Q48A 4DTGL 1ID5I 3EF4A 5F71A 3KYMA 2VDPH 3VXOB 4JDZB 2NUTA 4XC1L 1A66A 4MJHA 3SODB 1TFHA 3L17A 3P4NB 5CGMA 4WVRA 4FQ1H 4KDWA 4XX1E 4ODSL 4PH8A 4R5TA 1JGUH 2EIDA 1BPVA 4LZKA 1KCLA 1QG3A 1A47A 2AABL 2WO3B 2VB5A 4KQ4L 4XI5D 4ZMNA 2VQ1A 3MBEC 1UWGH 3CD4A 2HT4D 3ARDB 2G2RB 1IC1A 1UZ8B 1HHHB 2ROXA 3PJNA 5E7BA 4WNSA 1OSZB 1PAZA 1WP6A 2YK1H 3SE3C 1HL9A 3DOIA 3S0PA 3QHTC 1R1CA 3A4DA 1DQMH 3ZRSA 2X6BA 4P48A 5ESQA 4YFDB 2CBTA 1JJUA 1SNRA 2CR6A 4PS4H 3KWUA 1XMEB 3ABZA 5C0CB 4IS6B 1CO1A 3MRIB 1QHOA 2XWRA 5D7JD 3GTNA 5D8JH 5SWQB 3MSPA 4CAGA 3POHA 4MA3B 5GRVL 4LQFH 1EGJA 2DMKA 5EU6E 4PJ5A 7PAZA 1IKNC 1FRGL 5AG8A 3WS6C 1CFSB 4NP4L 1UM5H 1FFPB 4NO2B 2UUDH 4LVHC 1MJUL 1O7VA 3C12A 3UEQA 3TZVA 4Y5XA 1FBIL 1NGPL 1PD0A 3B2VH 3FN0L 1DP0A 4JZOA 3GWJA 1MRDL 3ULUC 2FD6H 4C4KT 1TZAA 4TQ8A 5DD1H 2X6MA 1HXKA 4RFEA 1KZYA 3FT2A 1ZWIA 2A9DA 2P5WA 3L5IA 1J1XH 1M57B 4HFUL 4BCXA 3V0EA 3P9WB 4G2AA 1HU8A 5FHAH 1T1YB 5DJ8A 1MIML 5SX5H 4UB0L 4P5KA 2GIYA 3QRFM 5I2IB 2NY6C 3O0RL 3FTYA 4N2IA 3LKPB 3QPQD 3KD4A 2WVTA 4WWNA 2F53B 3WEAA 5AL8A 4GXUM 3UADA 4NO5B 1GCYA 3VH8G 4P3DB 4JPWH 3C2SA 2BVEA 1X5HA 4GKZB 4GP5B 3EJCA 3APDA 4TVPL 4H8UA 3T3PF 2ESVD 4L37B 5IY5B 4LOVA 1QTYT 1T5WA 4TL5A 3KHQA 3RJOA 5FYKE 1AIFA 5SWZA 2VDMB 4BK4A 1IGYB 5F7EL 5AYQA 5FYJU 2VDRL 3IF1B 3UJTL 4AIXA 5D1ZD 2QDWA 2ZSVA 1EHKB 3UDWC