2DPKA

The crystal structure of the primary ca2+ sensor of the na+/ca2+ exchanger
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
136
structure length
124
Chain Sequence
HGIPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSESALACLGSPSTATVTIFDDDHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium/calcium exchanger 1
publication title The crystal structure of the primary Ca2+ sensor of the na+/ca2+ exchanger reveals a novel Ca2+ binding motif.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Metal transport
total genus 22
structure length 124
sequence length 136
ec nomenclature
pdb deposition date 2006-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2dpkA01
3H6AA 3GINA 2KLSA 2FWSA 2FWUA 2DPKA 3FQ4A 3FSOA 3E9UA 3E9TA 2KLTA 2QVKA 2QVMA 3RB7A 3EADA 2LT9A 3RB5A 3US9A
chains in the Genus database with same CATH superfamily
4HS6B 1E9OB 1YMMA 2B8OT 3BH9B 4ZO7A 5F44A 5EEZA 3DXAE 4AQ8C 1RZKC 2DS4A 1CJYA 3TNNA 1JFHA 4YK4B 3W9EB 1JJUA 3HMXL 2TSBA 1NC4D 3CC1A 3PJNA 3SDAB 4OUUA 3NJVA 2A73A 4PLKC 4ENED 2QKIB 5CLYA 4G2AA 4NKIL 3BX7C 5L9DL 3C2SA 1ITBB 1HDMB 5J12C 3CUPB 3VRJB 4HP5A 2A74C 2O5NA 4TPRL 2W0KA 3X1EA 1CG9A 3Q2LA 2B9AA 4XP4L 4XO3A 1T7WA 1MVYA 2FJUB 2EVFA 1BVNT 4U05A 3VSTA 3VJ6A 1OPGL 4JHVA 1JXFA 1AIFB 1R5VA 4L4TE 1BDYA 4GMSL 2BIPA 3POHA 5LNDA 1CFQA 1F0LA 3ARFA 2JCWA 1EHAA 5DUBB 1PD1A 2NDFA 4JNXA 2V7NB 5AW5B 3L3GA 1X5LA 3VTMA 3E6HB 5JMRA 4JFZL 4HJGB 3G5YA 4ZTEA 2GJ6E 1VAHA 5JHDE 4R2GC 4EZJA 1EGJL 3CSYB 4QT5A 4XGZA 4MMYA 3T65A 2NDGA 3Q2WA 4APQC 2YC1A 2H47C 1AGFB 5HY9A 3A47A 1I7UB 4X6DE 2P43B 5BXFB 1GC1L 3BVTA 1D6EB 3PU7A 4FZ8L 3RFRA 5GISH 1TTAA 3U9PH 4GO8A 3D18A 5IR1B 3BKJH 1KCBA 2OTWA 2VMCA 3E2HB 3OKOA 4IJ3C 2ZIDA 2HCZX 5DC2A 1A6WH 4ECNA 4U6HB 5DWUH 5DR5H 1YMHA 3RY6A 4LCCA 4AH2A 4NZDA 1KN4H 1XO8A 2GJ6B 3L9EA 1ZS8A 1ZV2A 5JHDB 2EIKB 5I1CH 5IMMB 1FV1A 2A3TA 4M6AA 3VI3A 2XVGA 3LN4A 1H0DB 5J4MA 4LLMA 4OKVA 3T2NL 2VITB 3HFFA 3D07A 4X6DB 4AUYA 4LOFA 4RRPA 4WHDA 4JFHD 1U8LA 3OWEA 3PPSA 2LTQC 5IVNA 2P8PA 1ZRUA 1TQWA 2Z8SA 4LSVL 3F58L 3CFMA 2P7TA 1INEL 2DRUA 3EO1A 3SJVA 4YIQA 1Y1DA 3LPOA 4TQPA 3A6OA 4JFUA 2VDQB 2OM5A 3CSBA 3WMQA 4MXQD 1M1XB 5JOPE 3P0VL 1URIA 3ESPA 3T9WA 4Y9FA 1TO4A 4HK0A 5HGBB 3UAJC 1A8JH 1FHGA 3RWJB 2K9FB 1NC2B 3QIUA 2EYSA 3MV8A 2W81C 1EX0A 3VRLF 1UVQB 1TQCB 4J1UB 3FUJA 3HE6C 2DJMA 5E8DH 2ATKA 3GSXB 3RILA 3N50A 1EZUA 1DJIA 3CXFA 4AV0A 1JFQL 4LLWB 2WLJA 5MP6L 2V4LA 4FQ1L 4N2LA 4R26L 2ZUWA 3FONA 3U46A 1EZVX 3S37L 2WQUA 1FG2B 2YBGA 1WWBX 2YGPA 5KSBB 1X7QB 3O9WD 5L0QB 4BDVB 3G5VB 1OVZA 3TYGL 2B4CH 4TSAH 3NEOA 2VLLB 4MAUL 3CLFL 4M7JH 2X3CA 1G9ML 1Z5HA 3WIHH 4BZ2A 1D5IL 3M46A 1LQBC 4K8RL 3RL2A 1V8HA 2XTSA 1U3HA 3D85B 2P5WA 2JFCA 4UZUA 5IOKA 1RMFH 1SBBA 4JMXA 4XNMA 3QCUH 5TDNB 3FJTA 4Y19A 1A4AA 2F15A 3WNOA 3PQYB 3KWWB 5ETUB 5GGVL 3BDYL 4WU7A 4GQ9L 1NKRA 2X44D 4PVNA 2XICA 1N19A 4D3CL 2HVKB 1DVQA 1QOKA 3K4DA 1T7YA 1Z5LA 4N9OB 2VT0A 4LVNC 5DJAB 4I3RL 5IHZB 1YJDH 4K0OA 1MHPL 4BSJA 5K9OB 1KWGA 2O5YL 4DW2H 2QVTA 3KBPA 5AVUB 4FQQA 1CB4A 2IFGA 4WWKB 4K5MA 3OX8A 1HIMH 5H8DA 4C83B 1AKJA 1C5DB 1YZZA 2GBUA 1QTSA 2EQDA 3SBQA 2AQNA 1R5WB 2I5YL 3WIHA 2V2WB 4OLYL 1IT9L 2JJTA 3V5KA 4AM0Q 1TJXA 1MY7A 5B39B 1XXFC 1I85C 4F7KA 2E7DA 1IL1B 3MVSA 3BVDB 4S1RH 1CF1A 2A4ZA 4LMQE 2X4PA 1OO2A 1ZANH 4MD4A 1R3LA 1G7IB 3APFA 2KLTA 1ACYH 3FT3B 2F18A 4A2EA 1IRAY 5GGVY 4CRPA 1A7PH 1F02I 2UWEA 3QZLA 5BVJA 2I60H 5IESL 3L5IA 4AYID 1B4LA 3H9YA 4GP5B 4Q74A 1HHJB 3ZZSA 2HH0H 3C6LA 3HNVL 2Q7AA 4YC2B 4D0BA 1OB0A 3TBBA 3BVWA 4NCDA 1KJVB 3OSKA 4PJ7E 1QWHA 3VXSD 1O7SA 5I76A 4XO8A 1YUHA 2ODIA 4AKOA 1PG7L 2HT3D 4OZHB 2OR9L 1I1FA 2Z91B 4DTGL 4BRVA 4N20A 4UAOB 2PR4H 2YZ1A 3HCVA 2VISA 1SOKA 1GTFA 1IM9A 4PJIF 4C56D 4XMWA 3IXAB 5I18H 1XR9B 5CCKH 4M00A 3AT9A 1I1YA 4OZGB 1OAYL 1UKTA 1F3DH 2HRLA 2DMKA 3WUWB 3LEVH 3IGAA 4PB9H 5LXVA 1AO7D 3FOLA 3QA3B 3SE4C 2VUOA 3EGXA 1VEOA 4Q9RH 1D9KD 1YEDB 4MQSB 2AQPA 4X5PA 1JI2A 1KZYA 3O2VL 3JWNH 4A7GA 2G5UA 5KBMA 5EDSA 1II4E 3RU8H 1RUAL 5CEZE 3NPSC 1JN6A 2FE0A 1SF5A 5E2WL 4PRIE 1HWWA 1QBMH 3C9NB 2XZQL 1CF8H 4X98A 5HYEA 3LV3A 3ZY7A 5B38G 5T3XL 2XN9E 3PJSA 2AAAA 4DJMA 5E0QA 3UYPA 2WJ5A 4U1LA 4HH9B 3UTZA 4GG8A 5E94B 1O5PA 3L48A 1ASOA 4XCYB 4GRWE 4DGVL 2NX5A 1WRFA 3OPZH 5D7JD 3DO4A 2F53A 3P9WB 1G1KA 2XI9A 1JPGA 4MMZB 3S5YA 1EHNA 1WWAX 3IKCB 3KYOA 2HKHL 1JZ5A 3MO1B 4UWQB 1OTTC 3FN3A 3CFKA 3HLKA 3QIWA 4PRIB 5D1XD 4I89A 1OCCB 3ZDYE 2BVEA 3QEUB 3X13B 1CBVH 6TAAA 5KVGH 4NB7A 4HKXB 2QSTA 3LIZH 3TTSA 3BH4A 4XHQA 2RJMA 4E5XB 4YSQA 3TN0B 5EU3A 3MV9B 4KVNL 3FF7A 3WY1A 1RZ8A 4FQJH 4G9DA 3PL6B 4PJFB 2WBKA 4B0MM 2NXYB 2FNBA 3BUTA 3FQTA 2PO6B 3MRHB 4KI1A 1XEUA 4WHTA 1MFEH 5IEKA 1MLBA 3SQOL 5BW7A 1A4KB 1EO7A 1PZAA 3K5RA 4JW3A 3DSFL 4N90E 1NOAA 1KGUA 5FHBH 2D0FA 2Q86A 3A24A 2EO9A 5HHQB 3GRWL 4ZTOL 2VZUA 4QUOA 1F90L 4L8DA 1XBRA 1BECA 5E2TH 4ETQB 4X9IA 3SIKA 4U1MA 4NRXB 4YOKA 1WEJH 2CRYA 3RZCC 5D72H 4IEFB 1E6OL 1T21A 1UXSB 3CH1B 1RZJC 2PLTA 4O58L 3LIZA 4H2AA 1KCUH 1HOCB 2B20A 4HS3A 4DKTA 3UTQB 5CZVH 4OSUH 1MCNA 4G6AD 2IBGA 1BXUA 2WMPB 3MRBA 3V0HA 4N0UB 5DD0H 5AVQB 2XIBA 5G5DB 1J1XL 4CNIB 3G5ZA 2EIZB 2BS71 4JCLA 5HVHC 3LKOB 1HHHB 4FNPA 1WG3A 4PREA 3FSZA 2DBLL 1ZTMA 1C5BL 5J1TC 2GJJA 5F9JA 1Q72L 1K8IA 4ANWA 1N5YL 1KPUA 4YSCA 3IDMA 2XX1A 4F58H 3HKZA 3IDYC 1NC2D 1V5JA 2JVUA 5DD3H 5EBGA 5ABDE 2JJVA 1S3KL 2VRKA 3A5VA 4HIHB 3QBTB 3RHWF 1OAKL 3OLIA 2NY3B 5BZWB 4M5SA 1YQVH 5IB1A 3GBLA 2FL5A 1NLBH 4QO1A 4MDJA 3K6SA 3V55A 4JG5A 3IFOB 2XV6B 2YKKA 4TSCL 4O00A 3WJLC 5JORA 5FW8A 2BFVL 4G3YL 4YDKL 4KQ3L 1A1MA 2OMYA 1GPOL 4L1LA 5JOPD 5IM7A 2O6DA 1OGTA 1NBVL 2X1WL 3RBSA 3F12B 1QSVA 2C26A 2OLDA 2X0VA 3MBEA 1WVZA 2BSCA 5KOVC 1UOWA 4JHZA 1ULVA 4GYBA 3D85D 3VXRA 3BT0A 3WTUA 2PTTB 1XZWA 2G0KA 1G7HA 1UHVA 4NENB 3GJEB 5F6IC 2RAMA 4PBWD 4FG6C 2A1WH 3I6LD 3X1FA 3C6SB 5E6IB 4DPCX 1AQHA 1B2WL 2LU4A 4B9IA 3PQYD 1MCLA 1LE9B 4AL8H 3D33A 1SGKA 4MTMA 5IHHA 4NKMA 3LEXA 3RWFB 1WSST 4HWUA 3H42L 4MB3A 2IH1B 2HVJB 4FS0A 2DQFA 1QACA 1WTLA 4QJ4B 4EUPG 3P0YL 1B4JL 2N3JA 2FYYA 1IAIL 1WPCA 3V7AG 2GI0A 1AI1H 4K3JH 4WWKD 1A7OH 1KCSH 1JK9A 4RWHA 4UBDC 1NC4A 2LFGA 4AQEA 1TETL 2K6YA 4HC1H 5DD5H 5AVYB 5FIEA 2HTLD 3JT0A 1C5CH 4JM4H 3UO1H 5J12B 3L1GA 3N85L 3SE9H 2A74B 1CIUA 3DDGA 4OD2A 2GJZA 4WJG3 3RJDA 1QG3A 1NCBL 1TTCA 2ZCKH 2BVQB 2VDKB 3RY5A 2QVFB 3VXOA 3GMNA 1J8HA 3NCXA 4OZFG 4BBWA 2R7EA 2Y5EA 3SOBL 2IF7A 2UXGA 2D7TH 4XMKH 3PLYA 1CTMA 3EJZD 2EYRB 4JDVB 4B9FA 1PAZA 3S88H 2WO3B 1UJTA 1CQKA 2M2DA 4MHHI 5E2UL 2A6DA 4E9RA 2XKUA 4ZD3L 1IAOB 1TYJA 1ZJBA 2BY0A 3PNWA 3PABB 4R2GB 1LO2H 1LEGB 3VWKD 3UZEA 4APQB 4HD9A 3VGDA 3O11A 2C3WA 4HC1A 3RJOA 4XPFL 3THMH 5FLVA 1P5UC 5D1QC 1WWCA 4QHMB 2O6PA 4YEEA 3BPLC 4HJIA 4H8PA 3S4SG 3SDDC 4YBHA 2M1KA 1ET8A 1S9VA 1FYTE 4TUKH 3TBWB 4LL9A 4IJ3B 1NFAA 1CE1H 3O41A 3KEDA 3NCMA 1ZXKA 1LDPH 3CMGA 2WO2B 4NPJA 5DRWB 1GGIL 1U6AL 2XPGB 3BZFB 5HDQH 4XXWC 1NGWA 2OTUB 4OH2A 4PG2A 4M5ZH 1I4FB 4N2GA 3TC9A 1PMYA 2OJEB 1JDAA 2P8MB 5FPIA 3CZEA 1F1GA 4M48L 5FA3A 1I82A 2YZ8A 2H32H 2VDMB 3GNML 9CGTA 1OHQA 2OP4H 2LTQB 3FTVA 4L8BB 2Y7SA 2DTSA 1IBYA 2WNXA 4I1RA 1UASA 4LCUA 4OLWH 4CDHA 5D4QA 5ECJE 5C0CE 1ZT4A 2QMJA 3TLRA 4DETA 4UINL 4XTRD 3ARGD 3ZJAA 1C9SA 4X7DC 4LF3B 4L48A 3G7TA 1A6WL 2OAAA 3TBSB 2W88A 5BV7C 2A9AA 1OY3B 1UUSA 1ZHBB 2XY2A 2XZAL 4XHJC 1IZKA 5DWUL 5DR5L 3UTTB 1ZGLM 1G9HA 5ITFB 1KBGL 1KN4L 4JFXB 2J8OA 3DSNB 4RRPG 5I1CL 2RACA 1JZFA 2FVNA 3O3BA 5CEZD 4MA7L 3HE6B 3QH3B 4G1MB 5C6TH 1ETZB 3K1KC 3OLGA 4N0YH 2AXFA 5C07B 3KLAB 1AGEB 2BP3A 3EJPA 2N7AA 3S5LG 3KGSA 1MIMH 4X4ME 4CVWA 4XMPL 5CJXA 2H32A 1DDHA 5KVEL 4LLAA 3W2DL 4OD3H 2BNUA 1YPZB 3EYUL 5D6CA 3MV9D 2XBTA 3TN0D 2ADJA 2LVEA 5E7BA 4HPOL 4P48A 3O9WA 4TNEA 2H2PD 1E4WL 1JRHH 3PL6D 5EPMB 3TV3H 4X7SH 4BZ2L 5IQ7L 1NANI 1IILE 3L2LA 4NZTH 4OCXL 3ZKND 4S0HA 2PO6D 4F24A 4ZPVA 1MHCB 4H88H 4KAQH 5D5ME 2GUOB 3CNKA 3N1QC 5AB1A 2JJWA 4P05A 1DQDH 2VZTA 1W8EA 5IFJA 1AJ7H 2WOYA 1DBMH 4XCFL 5IKCB 2AQSA 4PRAB 3KXFE 5T3ZE 2FEDD 5DRZA 3MOBH 2Y7QB 5E4OA 1JPFB 5HPMA 1V3JA 1NBYA 1U36A 2AQQA 5ECGA 2HT4D 2WJ7A 4QXTA 3QFDB 3CFTA 5KBKA 3EYQC 3VSUA 2X6UA 1MRFH 1AMXA 2VSCA 4BEIA 3HLAA 4LVNB 2R0WL 3GZOA 4JFQA 5FO2A 4QGYA 4RISH 4UOW1 4LOEA 3A23A 4TSAL 4EKXA 1SVZA 4IBQA 2BW4A 1EBAA 1MCFA 4HWZB 5CU9A 3PIQB 3QQ4B 4LK4A 5AVXB 4NT6B 3RI5F 3WIHL 5D5MB 5DSCB 5HHPA 2D3LA 5EC2A 3MCLL 2VR4A 3EDKA 3LNDA 4AOFA 4UF7C 4XNBA 1KGIA 2I9LA 3KBHE 2PPDA 1XSJA 2F61A 4LSSH 1R46A 4UNUA 4YJZL 4A6YL 1K2DB 2R69H 3NFPB 3P77A 4L29B 5IB5B 4AXWA 2IOIA 4WWID 5DRXB 2YN3A 4NKQB 2XN2A 5EORH 1E5CA 2ICWJ 3A22A 1U2CA 4GUPB 5ADPL 2X0WA 1RD6A 3IFLH 4ZFOB 2ZYHA 2Y06H 1R3JB 2EVIA 2IAND 4FFWC 3U9UA 5DZNA 1C12A 3KPQB 2WBJC 5FV2A 5SWZA 5FDWB 4DW2L 2VKXA 2NY3D 1AHKA 3L4CA 1E9QA 1DUZB 2X1PA 3RLSA 2AI0L 3VXMB 1A6UH 1E4XH 1QFPA 1PBYA 1TFHA 1UOVA 3QDAA 5CEXB 1WT5A 5JW4N 1LE5A 1XF4B 5KAQF 3GBNL 5K9KB 1CUOA 3ELAT 2L7UA 1F58L 3SD5A 3ZR6A 3BWUF 1P6AB 2DLFL 4LDLB 3HVDA 1FVEA 4JRYE 3UGUA 3D25B 4ZOAA 4G8IB 2I24N 4PGJA 2FUTA 1M2VB 3IETB 4I7ZC 1MLCA 3AU1A 1AO7A 5E6ID 3AY4C 3IPEA 2L4OA 1V3MA 2CDGB 1M6OB 5F6HI 1QUNB 2HH0L 1RZQA 4GRMB 2CXGA 4G7RB 4Y7MA 4YBLC 5EU5B 5FCSH 1I7RA 2C1OA 5JQ6L 4IBVA 5ICXA 1WFIA 3NPSB 5ESAB 3QJUB 1Q9OA 1MVUB 3NFNB 2GK0A 5FM5M 5K39B 1IJ9A 1KBBA 3BWAB 3GBMH 4Y2LA 3AJ7A 3II2A 2FO1A 4HS6A 5EO0B 1IE4A 4HIIA 3BH9A 2E86A 4PEEA 4Y7OC 3RNQB 1A65A 2GBTA 1XV8A 4NHCH 1XF1A 5JW4R 4N86A 2WCPA 4JRYB 2FK9A 4OJCA 4OI7A 1TVHB 3V2AR 4HA1A 4JG0H 2JELH 5CCKL 3FN0L 3H6JA 2ZG3A 1CFTA 4AKQA 4IDLA 4BD4A 3CUPA 5ITBH 1UD8A 2UUDK 3WELA 3QPXH 1U42A 5D7JA 3BKCL 3BVUA 4MA8H 4JO5A 3HC3H 5FYLL 4Q9RL 2AQTA 2J1XA 4JQVC 1KTJA 5E5MB 1T1WA 5CFAA 4G6FB 4DO6A 1E50A 1ESOA 5DJ8B 5GPRA 3I74A 4P9HL 5D1XA 4YWGL 1T0MA 4HS8H 1N6QH 1AS7A 4KNSA 4BGLA 1SY6L 1CF8L 2GQHA 4KJQC 3GS4A 2FO8A 4D94A 1EEYB 1T22B 4W9JC 3OKNA 1DVTA 1U2YA 1UACH 4HZLB 2DQTL 3E6HA 3QUMA 4HJGA 2WXKA 3SCMC 2QQNH 5J3HD 1A6AB 4NO2B 2YEVB 4QEGA 4R2GD 1AC0A 3TIDB 1ND0B 1MCOH 3BHBB 2C4FU 1IU1A 3CSYA 3LS4L 1TZHB 5CBEA 3WDHA 2G9HB 3I9GH 2CO7B 4TQIA 1A3QA 4C59B 4KNUA 5T1LD 4CVZB 2ADYA 5A3ID 2A6JB 1D6EA 2C9RA 1O6SB 2NTSP 5I2IA 4RX4D 2VDQH 1BIIA 3N1FC 3BDBA 1O9WA 2KH2B 3PY9A 3EXJA 3EBGA 3INUH 3RNKB 1CBVL 1G7PA 4JFOA 4GAJH 4LPVA 3LIZL 3RZCB 5HDRA 4P5TD 3TPUA 4MKMA 5GZNA 1J86A 2Z92A 4GAYB 1U8MB 1UA6H 3F83A 5TGBB 5IMMA 5KSAA 4NQVB 5E00A 2WVTA 5IHLB 4G5ZH 1GZHC 3AXLA 1I3GL 4W9GC 1IGJA 2YGVA 1MFEL 2BW5A 3MRFB 5D71H 4FA6A 3V52L 4Y5VC 2XNAA 4IRJC 2KZWA 3VVWA 5FHBL 2VRAA 4QRRD 3SQBB 1RUKH 5HVHB 4F91B 1U8QB 4QCIA 4YDLC 3EH2A 4UTCA 3BPCA 4AMKH 4YVUA 2P80D 5I23A 3LMJL 3DBXB 5MI0C 3MBXL 3U7YH 2VN3A 5GGQH 4BA0A 1A8ZA 5BS0E 1LL1A 1EZSA 3P4OB 3O2WH 5D72L 3UTTD 5BOJA 3IDYB 1A5FH 4X7CC 5HGBA 1NC2A 1YCSA 5L88L 4P46C 3UP1A 4ABVA 2HFFB 1KACB 3HE6D 5CZVL 1XZ0A 4P3CL 3EH4B 1QYGL 2YD6A 3K6OA 4PV9A 4DFIA 5C07D 5LBSH 4WFGD 3K91A 4KO6A 1J5HA 3U48A 1KB5B 3VQLA 4NKOB 5DD0L 3MGTB 2EADA 4A37A 1A9EB 4JRLA 2UVEA 4MZIA 3F7VB 3HG0A 3CMOH 5KTEL 2E0PA 1U93A 4BDVA 3MI6A 2WC7A 4NLHA 1SHSA 2NY7L 3F7YA 3UPRA 2VLLA 3H2PA 5BS0B 5IW6B 1ZPUA 2FQEA 2QVMA 3HFMH 2M8XA 4FOMA 1MG3C 5I8CB 1KFAH 4M7LT 3C8DA 4F58L 3CQQA 1RURH 3D85A 5DD3L 1ETB1 2XTJE 1KPRB 5HHME 5F6IB 5C0GA 4NBXB 12E8H 5IUSA 4BSWA 5TDNA 1FG9C 3DX6B 1FNGB 3QG7H 1PVHA 4WK4B 1S7SA 3C5JB 2DQ6A 3L9YA 4KTDH 5BRPA 5ETUA 3A6BL 3O2DL 4XOCA 1UT2A 5LBSA 1CU4L 4KTEH 2VW7A 3MHZA 2HVKA 4TUJA 3S3CB 3V6OC 2FATH 3O6ML 4YH6A 1NINA 2X3AA 2R29L 2FLBT 3ES6B 3NTCH 2IV9A 3Q48A 3WLBB 1C1EL 5HYQA 3QRFM 2DDQL 1CICC 4F2ME 3H0TB 1U92A 2DJUA 5K9OA 3CZGA 4OV5A 2GEEA 4E9VA 4WWKA 3SE3C 4C83A 1LO4H 1AZZC 1QEWB 2COVD 4Y9CA 1C5DA 5F9AC 3HE7C 4ZDHA 1XWVA 4QRQB 4PJ7F 3WXWH 5K9QG 2GT9B 1TZIB 5HHMB 1RI8A 1UD6A 4X6FB 2IG2L 5B39A 4K7PX 4KOCA 3JV4B 3L17A 4EI0A 4K73A 1JRHI 4JFDB 3HI6L 3IMVA 4ALAL 1KJ2A 5D2LB 1AKPA 1OAUL 5D1QE 1T2QH 2XA8H 4UCFA 2GC7C 1QZNA 1SJMA 3V5HB 5BVPH 1BZOA 3B43A 5I6OA 1RUQL 4Z7OB 1TU2A 2X4SB 4M7KH 3CN2A 1OQXA 3DX0A 3MRCB 5A16B 3IDJA 1QASA 1RZIA 1BV8A 2JQZA 3B3BA 2NYZA 4F2MB 4LDCA 4TNFA 4KDTA 2W0FB 4C47A 2VQ1B 3LQAL 3TNMB 3N41B 3U2IA 1HHJA 2H0JA 4RH4A 1A7OL 2AJXH 3FRPB 3MLUH 1KCSL 2JJSC 3CK0H 4IGBA 1ZHNB 3ROOB 3SE6A 3UGEA 4EE2A 3NN8A 1KJVA 3BKMH 3VXMD 4HC1L 5DD5L 1R3IH 1TLMA 1U8KB 3EFOA 5HHXL 3NH7H 3F6IA 4JM4L 4ATTA 3ZE0F 3VWKA 4AYFB 3WNMA 2D03H 5C6PB 4DKFH 5I17B 1P5UB 5D1QB 4AX3A 3IDUA 5MHSD 3BPLB 4H25B 2Y6SC 4ZTPL 4K3DH 5K1NA 1BQLH 3SDDB 1DVZA 2NW3B 3GIVB 5EU7E 5FOBB 4JRXA 1HL4A 2VDLH 3FQNA 1XR9A 1ZKAA 3GMPB 4GRWF 4X5XB 5HI3C 4OZGA 3WHE1 1MCKA 3WUWA 1MJ7H 3MUY1 3O3UN 2NNFA 1KGJA 1FL6B 2LGNA 4FFZH 2OS7A 2KC0A 1R3HA 2ERJC 3CZLA 3NA9H 2J5LC 2CBTA 3P30H 5D9SB 4S0SD 3T5WA 1QRKA 2DEYX 3ILPB 1N0LA 3BOVA 5DHYA 1P1ZA 3CXDH 1NEZB 1YEHH 4PR5B 3BP4A 3ZDYF 1LO2L 3T4YB 1IQDA 5E99H 3EKCA 2HXAA 1BD2B 4PP1C 1UWXH 3C9NA 1KIPB 2ED7A 3THML 1N3NB 2HLAB 1A7QL 4GNKB 2RB8A 3SDCC 5ID1A 5I8KL 3ULUE 5LBGA 2DMHA 2ZX8A 4Z7OE 4H26B 4MMXA 2QADC 5CJ8A 1REIA 2VE6A 3QG6A 1E4XI 4JFWA 3VGHA 4JRYD 1KXHA 3SPIA 4R8WH 2WLMA 3ARGA 4FNLL 5A40E 5EZJB 3D51A 5E94A 4ERSH 4DGUA 3KYKL 5BV7B 1TZAA 5GZOC 5AOKA 2C3HA 5KANG 4ZT1A 2WKOA 3BSHA 2OK0H 3RVXC 2IXQA 4W93A 4TNVF 3GC3A 4H40A 4M5ZL 2C9SA 3C60D 4YL9A 1ASPA 3E8UH 1BQKA 4LLDA 4FFZA 3K8MA 2PW1B 3MO1A 1OTTD 1UGKA 3SYCA 1XFPA 2QGDA 3UZVA 3QEUA 3QPQC 4KPHH 1ZEAH 3G08B 1MHHB 2MMXA 4HKXA 3K81A 1S9WA 4XPBH 4YDIL 3T08A 5C9JB 5DJ0B 5AOJA 4GO6B 2VLME 3TN0A 3MV9A 4OLWL 4RA0C 1ZHLB 3W56A 2C9AA 1VKXB 5FUCC 3QIBC 2NSXA 3PL6A 4PJFA 3OM3B 5DD1H 5T1MB 3K6DA 1UM4H 2B59B 4Y4HC 2PXYB 3CDZB 4YSOA 3STLA 3PP3H 2VL5A 1OP4A 1SLUA 5T33L 6CGTA 4ANVA 1RCYA 3PPEA 3T0EA 4HJTA 1XQ4A 4GSUA 5LXGH 3VMOA 4R3SA 5DZLA 4HCGA 3SGKC 1TMCB 5F7UA 2IH9A 5GS1A 4ZOEA 3S3SA 4LLUB 2LLLA 4XO4A 3CHOA 5DFAA 5C6TL 1XH3A 2DIJA 4LLQB 1RLWA 2H4EA 5EH1A 1MIML 2VC2B 5ISZE 2E27H 2Y4SA 3OLDA 4B97A 3TL5A 4OD3L 2DL9A 2N4IA 3OAZH 4H5SB 3CN1A 4ZUUB 4IEFA 3OG4B 4FXTA 2YUVA 3C08L 1KC5L 2C7FA 4ODVH 1SM3L 1TJIL 4IDJL 3H7BA 2V5TA 2F54A 5DUPH 1HOCA 4X7SL 5IQOA 2CR6A 1QHQA 2VTFA 2W8CA 2D9QB 4NZTL 3S36H 5IFHH 4L37B 2W07A 4X9GA 3HZYB 5DMJB 4P4RB 4QD2E 4GB9A 4KAQL 3D2UB 4N0UA 5ESVB 3UAJA 1MCBA 4PWIA 2EIZA 3ULVE 4MCYA 4ZSOA 1WBXB 4F8NA 1DBML 2CDFB 1E5ZA 4RMTA 5FYJE 3BAEL 5D7IB 4YDVB 5DJDA 1NCDL 4GRLC 4WDIB 4BSVA 3FQWB 3FO1B 4NYLA 5FWQA 2WQWA 2IBZY 4OLUL 3FC8A 3VM5A 3GTVA 4AGLA 1D7FA 3K72B 2IANA 3WEMA 4HIHA 4RAUA 2WBJB 4K9EC 5EIIA 3L7FA 2WTRB 2COQA 2IGTA 3CVIH 3B2VH 3HG1D 3IFOA 4PJBF 5DUJA 1RHFA 1PQZB 1DQMH 2DJ4A 2X4QB 2YD1A 3QZWG 5EBMB 2GCYB 3VXTA 5MENE 4LSSL 2VSDA 4KU1A 3ZE2E 1FJ1B 2WIIA 3BE1H 1JS4A 3GKWH 4X5LA 4IMKC 4K3GA 1RZKH 2L8AA 3WS6C 4FRWA 1LO3H 3F12A 4B5EA 3LXUX 4GH7B 2RTTA 2AP2A 3K8LA 4LVOC 2Y06L 4TQEH 2IMMA 1S7UB 3GJEA 4FG6D 2VDKH 2GSIA 4R0LB 2P5EE 5AD0A 4MJIB 1O6VA 1AQKL 2DQJH 4D0DA 4O9HH 1P6FA 1L9SA 1T4KB 3LHPL 3F05A 5AW6B 4TOYL 1YA5A 2Q5BA 4OFIA 5I82A 4LASH 4OZIE 2XXMB 4W68A 1SVCP 3ZE2B 4LEOA 4Q4IA 1J0HA 3RWFA 4U4IA 1UWGH 1KTDB 2IH3B 2YA0A 2IH1A 3DX3A 3EBAA 5GJSL 1QBBA 1T2JA 1CK0L 2IWFA 3VXUA 1CI3M 5CWSA 2J57A 3DETC 1IGCL 3HMWH 1MQKH 1OP5H 3WBDA 5HBBA 1BZEA 2K45A 5JHMA 3T0DA 2ARJA 2GFBA 1L7TH 3OG6B 3HNSL 4EI6B 4JPSA 3GXMA 3L8QA 3WE6B 1H6UA 4U1HB 3VD5A 4JFDD 1KCRH 4UQIM 5IB3A 2K6ZA 4FYSA 4R4FL 2P8LB 1SBSL 1CL7I 1B9ZA 1I3RA 4G6JH 2R51A 3H3KA 4FMKA 1DQTA 2XKSA 3NCFB 1QA9B 2D3NA 2HJFB 4WCYH 3UL4A 4EZLA 4PV1C 4ACTA 3GBML 3QUML 4NN6B 3KM2A 3FH7A 1BVKA 1DBKH 2ZSVB 2FBRA 2VDMH 3PABA 1WC7B 3D06A 2YOCA 3FTSA 1A7RL 2JELL 2ZPKL 3DBSA 3L16A 3RKDC 3EXLA 5ITBL 3CFEB 3HC3L 2BP0B 4ODTH 1OSYA 4QHMA 5T1LA 4X80H 3MX0A 2DYPB 4S10A 5IVXE 1FFOB 3SDDD 4RX4A 3DIFB 1F6LL 3WTSA 1V7MH 1GZPB 3VI4E 3TBWA 3DVNB 1OXYA 4NAMA 2VLRB 1BBDH 4HOXA 4PSRA 1QBLH 1W91A 5FFGA 4P5TA 2NRDA 3IVKA 1UACL 3M1OA 3SKMB 2OTUA 4M1DL 4EI5A 1BAFH 1J0ZA 1I4FA 2JCCE 3K4AA 3NJNA 1HHKA 3KGTA 4WV1A 3W5NA 3GMRA 1P2CB 1CGTA 3ZZ1A 3FPYA 4FHKA 4TL5A 1TJHH 2F7QA 1BD2D 2JK5A 2PP8A 5E24E 1M7IB 4Y5VB 1D5ZB 4IRJB 5E1IA 3FB5B 3FKUS 3P4NA 4LGRB 5KW9L 1S7VB 3FUEA 5IB2A 1VACB 2VR5A 5G2NA 1QEXA 1QAWA 2NY5C 4QRRA 5IVXB 3VTAA 1SOQA 4XCNB 2OL3B 5C3IA 2AJZB 4YDLB 5E1HB 4UDUB 3HC4H 5MI0B 3JWDH 3NIFE 4WWOA 4LF3A 2VJ0A 1BPVA 2UZYB 4N9GA 4XXDB 5I0DA 5D5MF 1LEKA 5J9PB 4XHJD 1CZ8H 1YEKL 1ES0A 3LKRB 3DTUB 4BH8A 4NC1C 3UTTA 3G6AB 3CIQA 3WFCH 1UA6L 5LGJA 4P46B 1O7DC 4BZYA 3GUTA 2V8LA 3RZWA 2PP7A 1A25A 4G1MA 4WK0B 3GIZH 1JTPA 4KI5C 3ZYIA 3JZ7A 1ED3A 3KLSA 4TMPA 1T20A 2Y23A 1DJWA 5DJ6A 4L4VE 1RUKL 3GSUB 5EZOH 1YPZA 4ZMVA 1EH9A 4YHNB 2ZUXA 1Z2KA 4HD5A 5JW5A 1U0QA 2ENSA 3GM8A 2PXYD 4W9ZA 3U7YL 1I9EA 1FZMA 3DARA 4XMVA 4KO5A 5J6SA 4UYPA 4A39A 2EVJA 3ETBF 4E9XA 4C4BA 1MHCA 3P73B 2GUOA 3L7EA 1A5FL 1BLIA 2J3SA 5EF2A 4FADA 4MS8C 3U7WH 4O2EB 5BRQA 4O02B 2ROXA 4QRTA 1BEYL 1E4HA 3B5HA 1EJ8A 3FB7B 5A2LH 3N9GH 5I1GH 5LBSL 3EOTH 3QEQB 5AVTB 2Y7QA 2JI2A 4L4VB 1GYWA 5TK2A 2FIKB 3IRZA 3EYQD 3ARVA 4ZW5A 6FABH 1QWNA 1BMZA 4XP1L 1J48A 1LNUB 2UY6A 3AROA 3UERA 1CICB 1F42A 3MJWA 2V7HB 3M8OH 1UWYA 3BEVB 4JHUA 3L81A 4PN6A 1I9JH 1MFCH 3LRLA 4HWZA 1S7TA 5T5FH 2H9GA 2YJQA 2ZXCA 3H55A 1KFAL 2FZ3B 5DSCA 2UV3A 4MNQE 3WNPA 3HE7B 4QXWA 4AYBA 2AFNA 3CVCA 1CL7L 5A2AA 4U3CA 3RTLA 3ZSSA 2EC9T 4MJ6B 1KIUA 1KJ2L 3CVDA 1T6VN 5E9DB 1F4HA 12E8L 5ABAA 4NBYB 2PUQT 1I8KB 5IB5A 1ID2A 2VZ3A 4WNQB 3EHBC 5F7NC 5IG7A 4LOVA 1OZTG 5L8JB 2BSTB 5HHOE 5ALBL 3H8NA 4JZNB 2ITDB 4KTEL 2P49B 3SSGA 4ZFOA 1ZHKA 4FLOA 1R3JA 5IQLA 3VRIA 1WZMA 4G42A 3NTCL 2IDTA 1MFAL 1JZIA 4O2CB 5DFWH 4OF0A 2WBJD 3KPQA 5B39G 2C3GA 1ETJA 3GSNB 4WU5B 1IZJA 5FDWA 3AGWA 1ROCA 4R7DB 1ML0A 1DUZA 4WFFE 4HJJH 1KIQA 2VH5H 2WWKO 4YPGB 5C09E 3K0YA 2BOBA 1CGSL 2HKFH 3BQUD 5T1KB 3OGCA 3CAFA 5T5FA 3KW7A 2D3JA 3R06A 4HKZA 1N8ZB 3VXMA 3WXWL 4LSDA 2FECI 2JI1A 4M7ZC 4EN3C 5BPPA 3FS9A 3TCLB 3J07A 5KVEE 4YO0B 1JPST 2YEZB 4ZFZB 1SLXA 3JVFC 4WI7A 2AANA 2H1PH 4G6KH 4DGIH 4YHIA 5ESQA 4PY8I 4XAKE 5BVPL 5I6LA 1J87A 2D9CA 2VDOL 3DJRA 3FH5A 2J6EH 1DJZA 1VHPA 4N8PA 5MEPB 2XZZA 4UILL 2E3VA 3HR6A 1E5AA 5I75C 3IETA 2CKNA 4F8TA 4MJID 3WTXA 1IAKB 2VXTL 3MU3A 1RZ7L 3NFSL 4IRSC 2ERJB 2CDGA 1M6OA 2J5LB 1QUNA 1AXSA 2AJXL 4FKEA 1NICA 3CK0L 4GRMA 3CHSA 3M17B 5CMAA 4ZO6A 5DD6A 2OI9C 2HTKC 1R3IL 2FGWL 2H8PB 4ZG1A 2VN5A 3H3PL 5EA0H 5K39A 2D03L 3WFBL 1NWOA 3BWAA 2MPVA 5I6XC 4EEEA 3SDCB 3QR2A 1EFXB 1HI6A 4OY9A 2PR9A 2YBRA 2YPLB 3KJ6L 3ZDXB 4I5BB 2QADB 4JUTA 3WUWG 2BHZA 3MOAL 3OJDB 3MLYL 2WB1A 4GBXC 2BWIA 3NIDB 5FUCE 3GSRA 4XRCA 2VDLL 5DHEA 3DTXB 3FQXB 5HI4C 4HOMA 2WM0A 4GXUN 3QEHB 4FQHB 1E4JA 2J6EA 4KK5D 1MJ7L 4KVCH 5E6ZA 3HBZA 4AENA 4G7VH 4AW7A 3S0PA 2JKSA 3RI5K 2XDHA 3U1SL 4AGMA 4MXWH 3NA9L 3P30L 3C60A 5F7EH 4W6XB 5A7BA 5JXED 3WOVA 5FB8B 3CXDL 1SRDA 1N4XH 4POZD 2EAEA 3Q44A 4FXGB 3HJ0A 4BWWA 4M8QA 4ZMWA 4RRPM 4UQ2B 2FX9L 1RZJH 1FSKC 3OC8A 4KJQD 1IC0A 2OFQA 3UGXA 4IRZH 3V4UH 1EEYA 1T22A 1JG9A 2P46B 1XCQA 2QKSA 2HX7A 3QIBB 5BZXA 1QFUL 1Y18A 2R23B 5DQ9A 2P52A 2DTML 1A6AA 3KH4A 4NO2A 1DVXA 2Q8BH 4Y4HB 3BHBA 1TCRB 1WK0A 4UZGA 1BFOB 2AJSL 2G9HA 2V17H 3HS9A 2OK0L 3VFWB 5IW3A 4HX1A 4MJHA 3GMLB 4AZ8A 1ILSA 5KVMC 4RIRA 1H3XA 3LPFA 1O6SA 2DYPD 2BC4B 4HGWB 4MAYD 3VMPA 4TLSA 3QXVA 3E8UL 4E41A 2FQGA 5I0VA 4NQEE 4NO3A 5FM4A 4KX9A 4E5XG 1JNHA 2VABB 3VGEA 3TZVC 4QTHB 1ZEAL 2KDYA 2VLRD 1IV8A 4R96B 4G83A 2AXGB 3PJLA 5J13C 2J8HA 3UC2A 1MN4A 2ZXAA 4H1LB 2AQRA 1HHGB 1U8MA 2R15A 4IRZA 5TGBA 1OK8A 2XZCL 3GSWB 3OAYH 4NQVA 1BX2A 1A64A 1UM4L 4PCTA 1FFPB 1AXTH 3PGDB 5GGRB 5I1JL 4IRJD 3QK0A 2EZ0C 3SQBA 3VD1A 2HN7B 4GG6E 2FHBA 4HJ1A 4HIJA 4JLRB 1VB9A 1UD3A 4XOBA 2Z1PA 1TVBA 2C3VB 5CGYC 2QTEA 3DBXA 4GRLB 1GJWA 5FDYA 3MJ7B 4WTWA 1TNMA 2G3MA 4RNRB 3ZYZA 2J12B 3IJHB 3P4OA 1QKZL 2G5BA 1NGQH 4ODVL 2OMBA 2FECL 5I0YA 4K7FA 1BPLB 5ERWB 5MERB 3LKNB 2ZKMX 4FDWA 2KL6A 2YRZA 4LXFA 5FYKD 2G0LA 3B5GA 3S6CA 3S36L 1GC1C 3Q0HA 4PLJC 4TUOA 1GH7A 4G8AC 5EDXA 3HG1A 5K93A 1VENA 4NKOA 4MDIB 1NCNA 3UEQA 5GRVL 2E4FA 5CLXA 5C0BB 4Z7QE 4GG6B 3FFCE 4Z7OF 4AJWA 3QUZC 1KCVH 1FORH 1KEML 2NCEA 4Z3FA 3UJJL 3CPUA 3IDIB 3WL9B 5IW1A 1JPEA 4NUGH 4F7PB 1JGLH 1DTUA 3VTTA 4E9QA 4N3TA 1DQIA 4WEEA 5EIIG 3G04A 1IC1A 2VAJA 3I9PA 4PRDB 4FAAB 4LVOB 2QEJA 3RL1A 3VYOA 2BVTA 2LAAA 1KPRA 2O6CA 1NGXA 2FSDA 3QEQD 3B1TA 4OR1A 2CPCA 5AW9B 2J88H 4C8XA 4NI6A 2Y1VA 3F5WB 5CUSL 5D7SL 1DQML 4ZO9A 3KYAA 1Q90A 1G7LB 3VFVB 2XPYA 4JCWA 4JVUA 3ES6A 3GKWL 3LPWA 4GS7C 3QI9C 1CICD 2WB7A 4PJ5A 4XODA 3H0TA 4JFPB 1UXWA 3STZB 3DX4A 1LO3L 4HUNB 1QEWA 3HE7D 3MLZH 3HZ3A 3FB8B 3NDYE 4G80A 1RP9A 2GT9A 4XVOA 4YS4A 3TH4T 4HUUB 2N7BA 2BY1A 5E9DD 3JV4A 3EZJB 2G75B 1G7QB 1FVCB 3D9AH 5D2LA 4NGHH 3WS3B 2X6AA 3TPKA 3AG1B 2ENPA 1H3UA 5JPNC 3B5TA 3V5HA 1CVRA 2XWBA 1NDMA 3NCWA 4AYMC 5JHLH 2B08A 2YUWA 3LKSA 4LASL 3BP5B 4P2CG 3WJMA 1TYEB 2X4SA 1XCTB 5EN3A 4K23H 4H8WC 1UWGL 4AI7A 4HGMA 3MRCA 4B60A 5A16A 1G9MC 4HZAA 1GS7A 1YN7A 4NNPL 2ZWZA 1JPTH 4KC3B 4FQXC 4NDMA 3TNMA 3AAZB 1P53A 5HPOA 4G8FB 5B3NA 1AFVH 5EMYA 1NIFA 1MQKL 3A67H 3G6JB 5T1KD 5I66B 5L2KE 1BM7A 3KLQA 2BDNL 2NT0A 4GSRA 4L5FL 4M4RA 4B9KC 3ZOAA 4WEBH 3VYPA 1K6QL 1MFUA 2F8XC 3WG7B 1XGPB 4LIQE 3ULUF 3B2UC 2Y6SD 5HP5A 4H25A 1MW3A 2F74B 4GW1A 4PJDB 3SDDA 3S98A 2WN3A 4FTDA 4RA3A 3ARRA 2BNRB 1HCZA 5BV7H 3IF1B 3L4YA 4YE4L 5FOBA 5HDBE 1HINL 1NM9A 5IVZA 1BYPA 1EO8H 4NZJA 5HI3D 5F0PB 5JHLA 2JLLA 1CTNA 4PYHA 3N44F 3TASA 4KGLA 5EC1B 1FL6A 1YYLH 1JXKA 4NC1E 4HOWA 3BKYL 5INDB 1AACA 1SF3A 5D9SA 2DLGA 1NGYB 1F6AB 4OVUA 3A21A 4YX2L 1M7XA 4PR5A 4CADB 4PP1D 4ZZKA 4KI5E 2ZYSA 3LZPA 4LARL 3WY4A 1CDBA 3K6NA 2XWTB 2BIMA 2NYYC 4FYTA 1BYNA 2YPLD 3X14A 3HVNA 4JFFB 4LHJB 2QADD 4ZBJA 2LU5A 5AAWC 5DZPA 5HDBB 4CMMB 2E7LC 1KLFB 4Q9QL 1E8WA 1SYVB 5I30H 3PDGA 4B3EA 3MYJA 3NRFA 1BBDL 3D69A 4OCWH 5DS8A 2G2RA 3V4VB 1QHPA 1QBLL 2AEQH 2V6HA 1A14H 3GZQA 4XVUC 1LJMA 4MQ7B 3RVXD 1T7ZA 4NPYB 1F4WH 3EYSL 3P40A 4P4KA 3SEPA 1UKQA 3WYRA 1WAAE 2QV4A 5L6YL 1NCWH 4JO1L 2VC2H 2X0UA 1CLZH 2YQGA 1I3VA 2CO6B 1TZOA 2EO1A 1EK3A 1K5NA 3CTTA 3G08A 4S2SA 2WTPA 3VU1A 1AS6A 3RGVB 5FXCH 3QXAB 4AM0B 5JIPA 1JZEA 4P2AA 3ARDA 1OAXL 4U6VL 1ZSDB 2QSVA 3QIBD 4G59C 1QWUA 4PJ9C 4AQ1C 3IJSB 2OMNA 5KS9E 5LGKA 1ASQA 1JGEA 2KQMA 3BAKA 4Y4HD 1ZWIA 3CZFB 2PXYA 3CDZA 5BNXD 2OTPA 4ZX6A 1GHFL 1L0XA 3DUSB 4JPKH 5JXAH 4BHUA 4HT1L 1ECZA 4JGUA 5FHAL 3ULVF 3JVGA 1KGWA 2NNRA 3CZNA 4D9LH 4LLUA 1A3LH 2R83A 4FNUA 1MW2A 4IKKA 4YHZH 1XGRB 1DL7H 2CKBA 2CE6A 4GI8A 5IEHA 4GO9A 2ZNXA 5EZOL 3TCTA 4TVPL 4LKCB 2W59A 3HHSA 1MDAA 2E9BA 5KS9B 2R0KH 4W6YB 2HX8A 4HMEA 1CT8A 3CFJA 3W81A 1KUMA 4U6XA 4JY4A 5C0JB 3MV7E 1R19A 2WYHA 3FCSA 3HZYA 4P4RA 2Q6WB 5HHNA 2FBJH 1I7TB 4WF7A 5E6UB 3QCVH 4QKTA 5IV2A 1VFMA 3SQRA 3ZE2F 3LNGA 1WBXA 2JB6B 2BZDA 2AITA 2QQQA 2EE2A 3T2QA 3EHBB 3FNKA 3II1A 4GRLD 2ADFL 5D7IA 1FH5H 4LDOB 3CFBB 2HPOA 4K94H 4WDIA 1M71B 3FQWA 2ZWNA 5D6DC 4ODHH 1TNNA 3MFGB 2WQAA 2A7BA 6FABL 1TIUA 2DYRB 5JO5B 1HH9B 1L9QA 1AHMA 3ECQA 1UH2A 3R1GL 4DEWA 1MCPL 2EE6A 3DGDA 4I0CC 2NW2B 2CJUH 3EG9B 1Q9LA 1C7TA 3M8OL 1E42A 4FI8A 3L3KB 2WTRA 1SXNA 1XGTB 1Q0YL 2BRRH 1T80A 1ZA6A 3LIUA 5EF3A 3BQUA 4OZIF 4TNVK 4RMQA 1AZCA 5C0BD 2BVOB 3WKML 3K4ZA 4M7ZB 4P99A 2GCYA 4EN3B 4PRHB 2CBPA 1AANA 5EIQA 3EYVB 4U3HA 3D0VB 4YXHH 2B14A 2Q3AA 3D50A 3K3QA 5A6IA 1CLCA 4NNXB 2WUCH 3RP1A 4YZFE 3QDGD 4YFLF 2LFEA 1H3WM 1UADC 2YA2A 2YWZA 3ABKB 1EDYA 3OAZK 5TQ0H 4DZBB 5I75B 4R0LA 4MJIA 3AY4A 2D7OA 2IAMC 2JE8A 4YHKH 3T8XB 3TVMD 1LO5A 3UCQA 5C2BL 3RWCA 1KXQA 1T4KA 2OI9B 5ICZB 3L1FA 4JPQA 5IOPB 3DNKA 4UTAA 2FWSA 4KTYA 2XC8A 1YNTA 1RIHH 2BS9A 2VL4A 2IH3A 2EIMB 3V6ZB 5C92A 1Q1PA 2K7PA 5I6XB 4QAWA 3NCBB 1KG0B 3L6FB 1U3JA 1QABA 4TV3A 5EF1A 2WLIA 2H1PL 4TF4A 3SY0A 3V4LA 1OF2B 3DETD 4LE8A 1G94A 4O51B 4GBXB 2V3EA 1RUPH 4LQFL 4FNQA 4OAWB 2VXVH 2J6EL 2Z9TA 1ZV5A 5FKAA 3SDYH 1F1DA 2F7RA 2X7LA 4EI6A 3HNTH 4JVWA 3EFFA 3LRSB 4JJOA 1XB8A 1TQVA 1E7VA 2X09A 3RQ3A 5DQJB 4LPWA 1E8YA 3L4WA 4TTDD 1Q9KB 4P5RA 1R75A 4BQ6A 4JQVA 4AEEA 3TURA 5IVXF 4LSTH 5JXEA 3I6KB 5I1EL 1PZSA 3MLVH 3IU4H 4JM2F 3VI4F 2YQ3A 3FRUB 3BUIA 3JZYA 4YLQT 4L3EE 1YRKA 3HZMB 2HJFA 3DYPA 1FSKB 4DVBA 4F3FA 3PNRB 3IS1X 2GYSA 1MKFA 3LSOB 4X8JA 5I16A 2JCCF 2PYEE 2W1NA 1U8IA 3IM1A 1U8JA 4RDQG 4UQDA 2VLKE 4I48B 2H2SC 3R0MA 4XNQA 5CHNB 3B37A 5ADOH 3ULSA 2BOCA 1RJZA 3RKDD 4OJYA 4Z0BL 1MFNA 1G7JB 1I31A 4DN4L 1A4CA 1OCRB 3JSSA 1DQKA 4KVCL 2OL3H 4MDRA 3EH3B 4YHLL 3OSVA 4MXWL 4MAYA 1BOGB 5JUEL 1K3ZA 2FX8H 3H9SB 2ZYIA 3QO0B 2BNRD 2WHVA 4XP5H 5ID0A 4Z7VE 1I8LA 1GZPA 1CS6A 3NIFF 1E9PA 3TZVB 4A55A 3MRJB 2CJTA 3US0A 4H13C 2VLRA 3QJTB 3V4UL 2JKIS 4IRZL 5FUZL 1BIHA 1USZA 3QWOA 5J13B 4TLKA 3ROLA 2KHAA 4AIOA 1OT1A 2OCFD 5FYKH 3TH3T 4ZFFB 4Y1AD 4UDTB 2O26U 3GO1H 4MSWA 1J5OH 3VVVA 4WI4A 2Y24A 1DP0A 1S7WA 1M7IA 5E56A 1D5ZA 2DEWX 1NAMB 3FB5A 5DHVB 1BAGA 1W0WA 3ARFC 3VW3L 1XMEB 4JFFD 4QRPE 2OL3A 1KWKA 4Z7VB 3ZUCA 4YSRA 5I8OH 2EDHA 4NRYB 4OCYH 3NSCA 3GZPA 2X88A 4G11A 5F3BB 2AKRA 4M03A 4ABQA 3N04A 2VIRB 5EU6E 2UZYA 3NSDA 4PPTA 5JIIA 1KOAA 4DN3L 1P4BH 3G6DH 3SDXA 1UB6A 2UXFA 4RQQB 3LKRA 3K6FA 1MCJA 1QSEE 4O02H 3E6FB 5IY5B 2HG5A 4AEIH 2N7SA 1NLDL 1XF5B 1A4BA 2IALA 4JX0A 4L23A 5GRYA 1UFUA 2BM3A 2FJHA 4UUJA 4HF5L 1AXTL 3LH8A 4AQAA 2WUBL 5C2UB 5EZIH 3H56A 4AGOA 2ARJQ 3QJSB 3KS0H 3RGVD 5LGYA 5CKAA 4OVVA 3KPLA 5C0DB 1C08A 4QRPB 4X99B 4CW1A 3P2TA 1YEJH 4HHGA 3QUZB 4X4XB 3AG4B 5A1AA 3U36B 3RY6C 2W60A 1EZVY 1SEQH 3RY4A 1H8NA 2WP3T 4HZ1A 4Z78B 1NGZB 1XIWD 1W80A 2B7DT 5EU6B 2X4NA 2IGLA 3B9DA 2IQAB 2BVYA 4F27A 4BFGA 1XR8B 5F8RC 3UPCA 1K8DA 3BP7B 1ZT7A 1NGQL 3E8VA 1OQOA 2RFXA 2WYTA 4PJXE 4LAQH 2EJ1A 4O2EA 4O02A 4YPJA 3O6LH 2CQVA 5KSUB 4YHPB 4DGYH 1IO4C 3ATFA 4BHUI 3FB7A 1GS8A 1IGMH 3VGAC 3QEQA 1S46A 4MX7A 5L4MA 2KZKA 2WXHA 5D7LE 2JF1A 2FIKA 1QLFA 1MUJB 3DX1A 5EV7A 1VGEH 1WAEA 4GS7B 3GSNH 3UJTH 3QI9B 3PWVB 2E6QA 4BKSC 3QHZH 3LXCA 3QIUC 4HUWB 3B2DC 5HVWA 2V7HA 3BEVA 3AG3B 5J57B 2WVUA 4HDIA 2FZ3A 3HE7A 4P0DA 1BF2A 4MJ6A 2ZUUA 4MWFB 1A21A 1E6JH 3EJYC 3WIAA 1F8TL 2BSBA 2E4TA 2H6PB 7TAAA 1IBZA 2F8VA 4A2DA 2IPTH 2DQGH 5C8JA 2Q7YA 4OT1H 3TBVA 3EHBD 1HYRC 3NZSA 2EEDA 4PCYA 2LVCA 1KELH 1UEYA 5D70L 1DQLL 5DFVC 4JZNA 1NUNB 1T3FA 3HB3D 2OMTB 3K6IA 4GAFB 2ATPB 4XPTH 1MCSA 2EABA 1WCBB 4UNIA 4KFZC 4FQXB 3GSNA 3NBNA 1YDPB 2WAHA 4R7DA 4XC3L 2JJSA 2Y36H 4D7BA 2X1XR 4YPGA 5JW4Q 2W80C 1LWHA 5CZXC 3SGDH 1CGYA 3OTTA 2IOOA 1B9KA 1N8ZA 2P44B 1E2VA 4IS6A 5EOTA 5AW0B 4EN3D 4PRHD 3ZTJH 3CHRA 4Y4FA 1FL3B 3QNZA 5BQDA 1FL5A 3D9AL 1UZ8A 3UYRH 2YEZA 4KKRA 4NGHL 4ZFZA 1S78C 4I0KA 1JWSB 4ZFGH 3P3YA 3Q8EA 1HSBA 1XGUB 3EYOB 2IVFC 4JM0A 2YFNA 5JHLL 3KPSE 3ASNB 4G6MH 3FRPG 4K23L 5AW8B 2C4XA 5T5NF 2ENJA 5CIPB 1RIVH 1ZA3B 4XMLL 1YNKH 2JJTC 1NGPH 3NEXA 1T89C 4O5LL 3TBCA 3J2PA 1P7QD 43C9A 1PAMA 3BUPA 5C3TA 1AFVL 2NY1C 1J1PH 1G5AA 2HTKD 4ODSH 5TF1L 4IBSA 2H3NA 1U8HB 2EIDA 1HK6A 4WEBL 1JHLH 2C7UA 1XTLA 2D7MA 5B22A 2NQ3A 2PF6A 2YPLA 3ZKMC 1TKWB 1R6VA 1OCWH 4KKZA 3GINA 3SGEH 4QAMB 3FBQA 3RPIA 1QW9A 3KPSB 4GBXD 4MD5A 3O4LB 3B7SA 3C6LC 5DC9B 4UMGA 1YJDC 1EO8L 2GTWA 2XG4B 3RWGB 4BQ8A 1ITCA 5I5MA 5HI4D 5L2JB 3DTXA 3FQXA 3GYRA 1TPXC 3QEHA 3FT1A 1YNLH 4FFYH 1KLGB 4FQHA 4NZ8A 4R97C 1NEZG 4N0FB 5J6GB 1A4JB 1PSKL 1ZY9A 5JIDA 4RGMC 5FECB 2R39A 4HHAB 3CV5A 3MRLB 1S5IL 1KGXA 1VDGA 3GMOB 2P26A 3T1FA 1NDTA 1UTDA 5DJYB 1ACXA 4WSGA 4AKPA 1QFHA 2DI9A 3VFMA 3FAWA 5GHWH 5DLML 4DSYA 1HH6A 3ARUA 4AJ0A 4FXGA 4OFDA 4V1DA 5T3XE 4H1LH 4M93C 1ZVYA 1T83C 3ERXA 4DUWA 5EU4B 2CM6A 2R56L 2FSEB 2OMWA 2X53A 4GI9A 2OJ1A 4PJ9B 4AQ1B 3K2UH 3QIBA 4POUB 5C7XH 2ZAGA 4DGWC 3PDOB 4Y4HA 2F8OA 4PJ7A 3TIEA 3FU7B 4G8EA 1XDTT 1OKEA 2UX7A 4MRBA 3UG5A 4OCWL 1BFOA 2AEQL 2A9DA 4U6YB 2R4SL 3VFGH 4PBXA 1KV7A 2ADIB 4JANB 4HV8B 4FFYA 4Y5XA 4J3TA 3UTSD 1WP6A 4YL4A 3BSZH 4NQXB 2CR0A 2ZOTA 2ICWB 3R4RA 2WWMC 3H9SD 1EA9C 2J8UB 3RUGE 2CKBL 4M5YH 1E5BA 1B0WA 1NMBH 3TZVD 1TVDA 2BHUA 4QTHA 1PNCA 2VLJB 3DOIA 3QZPA 4BUHA 2ORBL 4R96A 1XGZA 4PW3A 2AXGA 4JPVH 1G9NH 4NP4H 1CXLA 1CVSC 4PP2A 4QGTA 4K9EH 3IJEB 5E8NA 4J3WA 4CBPA 1X5YA 2NYKA 3V0AC 2X70B 3T0VA 3VH8B 4UOW0 3CSPA 3PGDA 5JW3H 5GGRA 3QIWC 4UB0L 4WSKA 3SYPA 1BP3B 3JWNC 2MPAL 1DCLA 4Z7QF 2HKAA 2I9TB 1IBDA 1WTGT 5FCUL 4P9HC 4OU3A 2HN7A 1HXYA 4D9LL 3ILDA 3ECVA 3GHPA 3RUGB 2GBVA 5KBNC 4NKDB 3BSZA 4P2QB 1NPUA 2C3VA 1FPTH 3ZTDC 1OTSC 4GRLA 2O5XH 1DL7L 2VWEC 3RPBA 9PCYA 4HJSA 3MJ7A 1PZBA 4GXVL 2JV6A 4RNRA 4IOSD 1HE7A 4XXCA 2V9TA 5BW7C 3KH3A 1DUYA 5AAMC 3RWIB 3D2TA 4UV4L 1IUZA 4W1TA 1G1CA 5MERA 3LKNA 3ETSA 4MB1A 5KN5A 5HYIA 2XV3A 3TWYA 2O6EA 2XU9A 3VD0A 1DCEA 1S9YA 2L0DA 4OIFA 1KYAA 1WBYB 4PLJD 3IRPX 1INDL 5CGBA 2X1OA 5GGSB 3QJZA 1TTBA 4MDIA 4EMZA 2YSTA 4GQRA 5C0BA 3V8CA 4X0KB 1MCCA 4JS7A 5IZ7A 1N18A 4NQSB 2IGFH 3QUZD 4N2NA 3FYIB 3RYMA 3WMPA 1U3YA 1XH1A 1CGVA 2BSRB 5AKVA 5TE6H 5AKSA 1FH5L 3ARXA 3VXPB 1AVAA 4K94L 3IMTA 3QDGA 1QTPA 3WKNA 4H20H 4I77H 2X4UB 1D7CA 1WZLA 3SKUD 5IFAH 1E67A 2CNZA 2CRMA 1D7DA 3QZNA 3WIFA 2CJUL 2QSQA 3LH2L 3PWPE 2IAMB 1U58B 4X8XA 3TVMA 1N2RB 4MASA 3NIGE 4XPHH 4UTAL 1BLNB 4DPBX 2Y2TA 1ZTXE 4LSQH 4U2YA 1WCQA 1M53A 1SJEB 4PU2A 5HGGS 2D31B 5FS5A 5SX4H 1G7LA 5IMOB 1VPOL 2AK4E 4LKXB 3L4TA 3QI9D 3P02A 3X11B 1NFIA 1JZJA 4AQZA 2WSDA 4HULB 3TEWA 3PGFH 4M8RA 4UT9L 1HKFA 1N64H 2Y07H 2APXA 3Q2VA 5IGXH 2CHDA 2WUCL 2X87A 1FN4B 3NCCB 1F3DJ 3G5XB 3FB8A 3PRZA 3L08A 8FABB 5JDSA 5TH2B 2VDPL 5D7HA 5DT1L 4MCZB 3AGVA 5DEFA 1CLYL 4EBQH 4CGTA 5TQ0L 5C0FA 3V9CA 4DK6A 2QSCL 1L4IA 3I2CL 3ZRSA 4F7TB 2Y9RT 1HILB 1HAWA 4DQOL 2MHAA 3PWJB 1FNEB 1YMME 2O6FA 3P3TA 5CKGA 3Q1SL 3WN5C 5GS0L 2AQ3A 4TULH 2VXSL 1PG7W 3EFDH 3OB0H 5GSRA 1KGCD 4XE0A 3MGAA 4AY0A 4DESA 1KJ3H 4K8RD 4FQXD 2YXMA 5DMIL 4Q6KA 2FX7H 3AAZA 5FUOH 3CBRA 5MEOB 4FXKC 3G6JA 1RUPL 3FSAA 5I66A 2BP8B 4WSJA 5I6NA 4HJEA 3OXRB 4KI5F 5JQHC 4I0PA 2XBDA 3P11L 4CKVX 1AE6L 2NY5H 3IJYB 1E27B 1A2YB 3F65A 2YMXH 1PJ9A 3QHTC 3B2UD 4JBSA 1OD9A 5CLZA 1T0PB 2WZ5A 1IBGL 2F74A 4DVRL 1Q9WA 4PJDA 3MLVL 2BNRA 2DKMA 4JY6A 1ANUA 3TNNB 3V4VH 1NA8A 3SKOA 1BG1A 3UOAB 4GQZA 3D0LB 2APFA 3L1OH 4M7LL 2A73B 4H8HA 4Y16A 4QMEA 4I8DA 5IROA 2QZ5A 1FDLL 2I07B 5EC1A 3UBHA 5DUMH 1NAKH 1MW1A 1CG9B 1K4DB 1WAAF 4Y1AA 1DVUA 4WJKB 1NGYA 1W9XA 4GUCA 4PJBA 4N1CA 4QHPA 3X3FH 4EZMA 1OAZH 3VJ6B 4BFKA 1F4YH 5BJTA 3PREA 1W72A 1R5VB 1WGOA 2WOBA 2YAQA 3SPVA 3ARFB 1OSZB 4PI0A 3L3GB 1D7BA 1GAFL 1GS6X 4GKOA 5FO9B 5KS9F 2WVVA 1KLFA 3G5YB 3KPSD 3UIZA 1WFUA 1KLUA 3O4LD 4KUZH 3ZZLA 4ZI8A 3LJ3A 5KBPA 3W39B 5IMKA 5EIVA 1P4UA 1IQWL 1U8PA 2EH7L 3LQAC 4M62H 3VI3E 4HLZH 3V4VA 4H8VA 3VU2A 4MMYB 3T65B 4XVUD 4M1CC 2CO2A 1P6WA 4B9JA 2YC1B 4N5EC 3U25A 1PNDA 3OD3A 4NPYA 5HY9B 2Y5TB 3D3VA 3FU0A 2HUHA 3GS7A 3HI1B 1JPSH 1X9UA 3GO1L 2RR3A 2QFRA 2NTFB 3D18B 4EAEA 4JDTL 3S3JA 2OTWB 3OKOB 1QUPA 3SJVE 1DBAL 1KBVA 3TOPA 2X6CA 3RGVA 3QXAA 4GW4A 3GT6A 1YMHB 1I75A 1KY6A 2MNWA 4PJ9D 2AJVL 4AH2B 1ZSDA 5ABZA 2I26N 1JP5A 5I8OL 1MCIA 1ZS8B 4OCYL 4L1HA 5DC4B 4X4YA 1FV1B 3MV8E 2EVHA 1XIWA 2Y1ZA 4TRPH 2BVUA 3LN4B 4LNRB 5KUKA 3DUSA 1F56A 3BT2H 1G0DA 4LLMB 3APDA 2W0LA 1P4BL 1A9BA 2Q20A 3L9BA 1KT2A 1OP3H 1TUPA 4QWWC 4NAQA 1U8LB 3ZQ9A 3SGEI 3I9AA 2P8PB 1UZ6E 2P7TB 1FYTA 4HKBA 4ZQTA 1J5IA 3EO1B 2A38A 3VGAB 4YIQB 5T3XD 4PMFA 1XGRA 2VLJD 4J23A 4Q14A 2A9NH 2BIHA 2JQMA 1F5WA 3JQOB 4MXQC 2Y72A 3AS1A 3C5ZD 4IOIA 3R8QA 3GSOA 3QIUB 1SEQL 2ZTBA 3MV8B 3IN2A 3B7UX 4MXVE 2O93L 3FU8A 1PLCA 2ATKB 3UC0H 5BCAA 4X5QA 4LGSB 3DO7B 3A6CL 1RFDL 4HBCL 4P5KB 5CJXC 1MJUH 4OTXL 5LQBL 1NCJA 3MYZA 3FONB 2F1EA 1K72A 3E3QE 3O6LL 5DEGA 4OJAA 1PKQE 2JB6A 3U46B 4DGYL 5KYWA 1BQSA 1SZNA 2DQUH 4P2QD 3UO8B 3O9WC 2XVKA 4FJ6A 3WDIA 1GYUA 4PJCB 4AMXA 4ZQKB 1IEBA 1YEFH 4JY5H 1AAJA 4YZFF 1AD9B 4ZODA 3ESUF 4LCYB 4L18A 2YJLA 4H0LC 3Q6GL 3RL2B 4K5PA 1QLRB 1U30A 5HSFA 3CN3A 2Z8WC 5T3ZH 4DP9X 1EXUA 1G43A 2P5WB 4EQ2A 4MQXC 3BD4A 3W5MA 3LEYL 3AITA 1XGTA 3GXTA 1BZ9A 3I9IA 3MCG1 1TITA 4Y19B 1AGCA 2A9ML 1GIGL 2EEXA 3CFQA 3MJ9H 1FBIL 5F8QC 3ZO9A 1XVSA 3VWJA 4N2IA 5SWQA 4HXBL 4WU7B 4PTTA 1E6JL 4RETB 4POYA 4EN3A 4PRHA 4R5VA 2YPVH 3MBWA 2MEJB 4RGOH 2IPTL 2DQGL 1NUFA 5HGHB 1HKLL 2O61A 4PRPE 2UWEE 4Z3HA 2LW3A 4U49A 1ZK9A 2ZWSA 1KELL 4N4YB 5T1DL 2IPKA 1WA0X 1NUGA 2YSSA 3OX8B 3E1F1 1AKJB 2AJYL 5TE4H 2A9CA 5JIMA 1LK3L 3I50H 2X28A 3IGFA 4DZBA 2VQ4A 1HL9A 3MUZ1 2IAMD 4FD0A 1P7QA 1MCRA 3MZTA 2YKLL 2NY1B 5KVFH 3QQDB 2Y36L 1NFKA 2HZHA 3TJPA 3BPOC 5IOPA 2X4PB 3MJ9A 2CMRH 1R3LB 1N59B 3HG3A 2GIXA 3MRKA 3V6ZA 2WSPA 5K5YA 2EE0A 2XPZA 1SNRA 2UWEB 4HAFA 3IFNL 2WNWA 4FERA 5BVJB 3WD5H 1W2KT 1IC7H 1B0RA 1TEYA 1H5BA 2PW2A 4PJAE 2PWGA 5HD8D 3L4ZA 4P9ML 3C6LB 1DSWA 2X89D 4GBXA 4GW5A 2MWCA 4OAWA 5EO9B 4D0BB 3MRPA 2B0SL 1TPXB 3LRSA 1BWWA 4R97B 5I76B 1NGPL 5JR1L 1EHLH 2XFXA 2HRPL 1YUHB 3CCHA 4DKEH 4RGMB 1NBZB 3T8VA 3F85A 3S37X 3I6KA 1J1PL 2EILB 4Z7VF 1LTXA 2F0CA 3FF8A 2XUWA 5EBWA 2NUTA 1UGNA 1JV5A 3ESVF 2K3TA 3FRUA 3HCVB 1CXKA 2VISB 3HZMA 1IM9B 2BK8A 2ARWA 4JDEB 3PGCA 4UOQA 3QCTH 2WANA 2ZZUT 4M93B 1I1YB 4NKIH 5F70A 7FABL 3TFKC 5AW1B 3LSOA 2BINA 1JHKL 3VQ2C 3IGAB 5BQ7B 3FOLB 4TPRH 2NX5E 2IH8A 3EGXB 1A3ZA 2XQBL 4XP4H 1FP5A 2F53E 2H2SD 5CGTA 4I48A 3BRFA 5CHNA 2WD0A 3WTYA 2FHFA 2Y22A 4HAKA 4N2OA 3QJQB 5DHVH 5K33A 5SX4I 3UH8A 1JN6B 4NQCE 1OPGH 1G7JA 4FFYL 5IBLC 5FGCE 4X98B 3JWNE 5IBUB 1UUNA 1NIDA 3UTSA 3DLQR 3Q8AA 1MI5A 3LV3B 4JZJA 3PJSB 3H9SA 4JFZH 3POCA 3SB3A 5GHWL 2Z31A 3A3YB 4U1LB 3RWDB 3V0JA 2C8NA 1EGJH 1QSFA 2QHLA 1K9TA 1EANA 1MRDL 2L7JA 1MEXL 1I8AA 2NX5B 3IGKA 4PGEB 5D7JC 2F53B 2C9UA 3DURA 1P4LB 4FZ8H 1PX3A 1OAJA 1HNGA 2IV8A 1HJCA 1SN0A 3O81A 1M4KA 1OARH 3K71B 4KZ0A 1P84K 4FQCH 2J1WA 3DHUA 3QIWB 5FGCB 5D1XC 3KYNA 4HMCA 3I85A 5F1IB 3VFGL 2GIMA 1NCUA 2Z6FA 1KIRA 3BSZL 4WW2F 4D0CB 5AZUA 2ZCZA 3T4AC 5EU3B 5KVGE 2XYCA 4M5YL 4H1LG 4NRYA 4G9DB 3OHXA 3PWLA 2YAFA 1S9XB 1IC5L 3FQTB 2W5PA 3NRPA 1UT1A 4M6NL 2NNCA 4NJAH 1G9NL 4RQQA 1EGJA 4PJXF 4AV5A 1HCYA 5HVGB 5BRZB 2Q86B 1R3KB 4FNRA 1CBJA 1INEH 4LCIL 3CFCL 4P2OC 5JW3L 4L8DB 1K85A 3JYBA 3OGOE 4U1MB 1ZLSL 5IIEA 3P0VH 3GPSA 1X4XA 5GZNC 3U36A 3MGOA 1NFDA 3DO3A 1RXLA 5KSAC 1FE8L 3TYFB 2MCMA 4UM9B 3AC0A 4ADJA 1DEEA 5B1JA 4OV6F 2D2OA 3BC9A 4GAGL 1EUUA 1S8DA 2Z3FA 3KGRA 4G6AC 4D9QE 1JFQH 4NO0D 4J3OC 4FLHA 4WGKA 5MP6H 2R8SL 2DQMA 4F8QA 2HFGH 3ZBMA 4Z7NB 2WXOA 1MCEA 3G5ZB 3NABL 4YHPA 3T3PB 3U0PA 1W15A 5FM8A 3CDCA 3RIFF 2L3BA 3AXIA 4XN7A 2ZJSL 3LZQA 4YGVB 1K8IB 3CLFH 5LGHL 3T2OA 1D5IH 2IGFL 3J27A 4K8RH 1J0YA 2BWQA 3TESA 3KVPA 4HH8A 3VD7A 4RLDA 2A99A 2WXPA 5C0EB 4GIAA 5DA0B 5IWLC 1JMXA 2X40A 1UJ3A 4JFEB 1LMKA 2BSSA 4R4NC 4EPSA 2FL5B 4QO1B 4MDJB 3K6SB 4I77L 4TN9A 2ZXDA 3EJYD 4LHUA 4PTUA 1BQRA 4EXKA 4XWOC 4GQ9H 3MTXA 5LNGA 4HFWB 4K7PY 5CN3A 4CC0A 4R90H 3L1EA 5AWNL 2OMYB 2ZKHL 4P5SA 4I3RH 5DI8A 35C8H 4MB5A 4QXVA 3QNXA 3VX1A 3CGTA 5IM7B 4JFVA 5DFVD 1OGTB 2O5YH 4JHWH 4HSAC 5CIPH 3WN5B 2ATPA 3U4BL 5C97A 2VOTA 1WCBA 4OLYH 3VXRB 4F8LA 2P5WD 1JZ8A 3PGFL 2DM4A 3SBWA 4FQXA 5C0NC 4U33A 2ZUYA 2Y07L 1KTLA 5IJBC 1JWUB 5IGXL 4Y19D 1A7NH 4FXKB 3VCLA 5CZXD 4KKAC 3ZGIA 4JO2L 1FA4A 1WGVA 5EUKA 2ZOWA 4KQ0A 3K5SA 1J8HE 1ODAA 1ZLDA 3GD1C 3VXNB 5JOEA 5LVEA 1ZOXA 2ZT9C 1MFVA 3DMMC 4OB5L 3LEXB 1MPAL 5GQBA 3AG2B 1S78D 2FLRT 4J27A 2Z34A 2FYYB 3EYOA 3FULA 3FW6A 5ANMA 2BWDA 1AKJD 3QR0A 3WEXA 1Z9SA 3EFDL 2MCPL 4U1SB 4AQEB 4L8CB 5CIPA 1T1XA 1ZA3A 3DGCR 1N26A 1KJ3L 2HTLC 3V79C 1N10A 4XAWL 1DLFL 1PG7H 2FX7L 4OD2B 2GJZB 2NY1D 1I1AA 2OR9H 1HN1A 3IMSA 1WIUA 4G9FB 4ISVB 4OD1L 4DTGH 1W72L 1P69B 3SN6N 3SYAA 1J8HB 2A6KB 4ZMAT 4JFYA 3WO3B 4LBAA 2ZE0A 2R7EB 2Y7OA 3N40P 4WUUD 4Y2NA 5FGBC 1OAYH 3TEXA 2DLEA 3ZHLA 2AEPL 4FI7A 2E7LA 2A6DB 4CVXA 4QDGA 1XL6A 5KBLA 4IGBC 3PNWB 4A66A 2XG4A 2C9XA 3O2VH 5L2JA 5JZ7C 4PLOB 3GKZA 4N0FA 4L2YA 3DX8A 3VWKC 3O11B 2XZQH 4U1KB 4PGBB 5IF0B 5FECA 3OKMA 4J3SA 4ODXA 5DUML 1NAKL 2B1AL 1F45A 3MRLA 3OZ9H 2YXWA 5DJYA 3MLWL 3Q05A 4KRPC 4UAOC 3RUGF 3X3FL 5A2FA 1OAZL 2DYSB 1S9VB 3TWCL 1IM9D 1JWMA 3DDFA 5M7QA 3O41B 1FCCA 4F57H 1FZOB 5E1AA 4OBSA 4DGVH 4DP0X 3BN9C 4XR8C 1C7SA 2FSEA 4ETYA 1NGWB 4PJ9A 2EACA 2HA1A 4AQ1A 1FIGH 3ENEA 3C09C 3AQXA 4KUZL 5EB9A 4X8GA 4EIZC 2FIRT 2N1TE 4K4KA 4LRNL 1PLGL 3FU9A 3ULUH 1T6BX 5F93C 4U6YA 1K4CA 2QJDA 2ADIA 4Y9EA 5IQNA 3ZL1A 4F1SA 5F1KC 4P8QA 1JPSL 2VGLM 3NJHA 2XWJA 2WWMD 5C71A 2ICWA 4KXCA 5CJQL 4MMXC 2XKNA 1KSRA 4JFTA 5LWYL 4JO8A 4CN4A 3P54A 1EBPA 3ARGC 2QGEA 2QLVB 3JTSB 1L0QA 4AV4A 2Z4TA 4NNYB 2WINB 2AEWA 3PHSA 1PU0A 2WLKA 3VFPA 1YEEH 2NX5D 4M8VA 2XJKA 4R6UA 3SQOH 4B9ZA 3CPLB 2CGRL 4FN0A 3ZDZE 2F53D 3C5ZA 4XT1C 4S1SL 3MUUA 1IAMA 1L6XA 1HHIB 1FLRL 2Z7WA 5PCYA 1JNLH 3FQRB 4DAGH 5ES4B 5FYLD 3O3BB 1PYWA 3GRWH 4TRPL 4ZTOH 3SBPA 3VH8A 2I25N 3BT2L 3D1MC 3QIWD 3ATAA 1F90H 2FNWA 4XI5C 4EIBA 2I9TA 3PF2A 1DDHB 4NBZB 4MD0A 3QDMA 2NZIA 2BNUB 2X38A 3BXNA 4LDEB 5D6CB 4O58H 2ADJB 4RCAA 3SD2A 5BO1H 2XXGA 2V9QA 3O9WB 4P2QA 2K1MA 1OTSD 4PBDA 2H2PC 2IADA 1BQHA 2A9NL 4A04A 1HZHL 2YD7A 5H35B 3IDNB 1NZRA 4ZPVB 4F9LA 1KTBA 2G9KA 2R1WA 3AWFA 1EXHA 4PIBA 2TAAA 3RWIA 5LDSA 2GY7B 2E7CA 3T0EC 5BRZD 5IFJB 2ZICA 4Y8AA 2ZG1A 1YG9A 5GS1C 3QWQB 3NIGF 4AJYV 1EXGA 5D7EA 1OSPL 5D2NA 5DRZB 1IM3D 3GRWA 4PV8B 1Q72H 5HPMB 1NBYB 1FNSH 4QXTB 5EN2A 3RFZA 1BFTA 3HLAB 2DQUL 4JFQB 1S3KH 1H3TA 1PGRB 3VXPA 4UM9D 5DMGC 1AG0A 1LEIA 1UH3A 4JY5L 1OAKH 3L4VA 5GXBB 5IVOA 4U4BA 5HDLA 3MROB 2JQAA 5HHPB 5EC2B 1A6TA 4OM0L 2X4UA 2EO7A 1BM3H 5FYJH 2BP5M 2I9LB 3JTTB 2M26A 2HWZL 2AMUA 2Q3ZA 2Q7NA 2ROYA 3KD4A 4Q52A 3JUYA 4TSCH 5T3ZL 3VXSE 3P77B 1U58A 4G3YH 2X05A 1MNNA 2VO5A 3SO3C 1BZDA 1YUKB 3DJZA 4KQ3H 4N0CD 1GPOH 4ZMLA 3MJ9L 2KT6A 2PPAA 1QFWM 5EBLB 1NBVH 2BFGA 1BLNA 3BPOB 1XCXA 1GCFA 3GSVB 3KL3A 3E0GA 1SJEA 2D31A 4DP1X 2UXVA 5IMOA 1ZPLA 4LKXA 4UV7L 4C56E 5LB1A 4CL7A 1WWWX 3LD8C 2MFNA 4J6RH 3SY6A 1CXFA 1C12B 1N7ML 1RZFH 4FG0A 5E5UB 4L9DA 3QXUA 4JFED 3MRIA 2B9BA 4LVEA 2N01B 5E2JA 5SWZB 1AO7E 1E9QB 5J6HA 4X6CE 3G5XA 1B2WH 2X89A 2EH8L 8FABA 3MR9A 2AC0A 4DO5A 5HJ3A 5FM5O 4H7VA 3I50L 1MJJA 3N42F 1N6UA 5G4NA 4F5CA 4GKZA 2ZXQA 3HA0A 3NCJH 2B1OA 3HN8A 4GSXA 3H42H 4WI0B 3F84A 4P04A 4HWBL 3P0YH 3F2LA 2JKTM 5F9OH 3RVUC 1IAIH 2CK0L 3DUHA 3B7TA 1FNEA 2H45A 2QR0B 2CMRL 4PG9A 3ZL2A 1QATA 3L3OC 1TETH 1FVEB 3VXRD 2R4RH 3R19A 5C08D 4ONHA 1MLCB 3AU1B 4ESKA 2MOGA 3VGGA 1ORSA 2BP8A 3NAAL 3L3IA 3S35H 1I7RB 2C1OB 2DQHL 5ICXB 5MENA 3OXRA 1Q9OB 1Y6NR 5BUAA 3MREB 5CGMA 3IJYA 5AVSB 4A2MA 1A2YA 5FO8A 1BGXL 3BESR 3CC5B 4N87A 5D1XE 3VD4A 3SOBH 1QO3A 1X7TA 3AS0A 1KCLA 3NK3A 1BHGA 1J05B 1N8OE 2ZOKA 1RIUL 2F19L 4HIIB 5E2UH 4ZD3H 1AP2B 5A2KH 3D0LA 3F6JA 1MCWW 1JHTA 3PAVA 4KUCD 4OJDH 5AW3B 2WQVA 3NSJA 3VI3F 1HWHB 3QCTL 5AQ0A 1CFTB 2P5EA 3WNNA 1GCYA 3GI8L 1PLAA 2I07A 2YMOA 4FQPA 4XPFH 5D7JB 5LKNA 3APCA 1K4DA 4G9FD 1TO5A 4LPTA 5EO1A 4C58B 3S7GA 3AREA 3FTGA 1T1WB 4B7IA 4FI6A 4JGJA 4WHYG 1J8HD 2I7SA 5CSZB 2L7EA 4HSQA 5D1XB 3BPNC 4JO3L 1T0MB 4ZAKA 1KYFA 4C4KO 3UDWA 1GGIH 1OSZA 1U6AH 4YDZA 3OKNB 2EDLA 3T4AB 1W8NA 1EMTH 4HEMA 3QUMB 3L2MA 3F64A 5FO9A 3ZYOA 3OAUL 3VGBA 5J3HC 3W39A 1DO6A 4M48H 1QD0A 3IS0X 2F1BA 4M1CD 3QDHA 1D5BB 5CBEB 1NCAL 5EFIB 4AJVA 3BIKA 1ZLVK 4N5ED 3OB0K 5KWYC 3GNMH 2Y5TA 1QPPA 3H9ZA 4XNAA 2AK1L 5DU7A 3HI1A 4E2OA 5I71C 4Q6IC 5I2IB 5A3IC 2ESVD 1GGUA 1UOLA 4XN2A 1BIIB 1IE5A 4S11A 1OARL 2NTFA 3GHBH 4FQCL 4P2OB 6PCYA 4UINH 2E9GA 1F3JA 4ZZFA 3O4OC 1GVIA 1G7PB 4JFOB 3U6RA 4D9RE 2CLRA 3KPOA 1H3PL 2QGBA 5CJOL 2E9WA 2XZAH 3I75B 4P5TC 4Y2OA 1KBWA 4XMZA 3TPUB 3UJIH 4D2NA 2Z92B 4EI5C 4JCMA 4WO0A 4MXVF 1KBGH 5DVKA 1GOHA 5KSAB 2WPGA 5E00B 4WV1C 4MA7H 4LNRA 3GLEA 5I6MA 4WEUD 3AXLB 2HLFD 1IGJB 4IIQA 4NJAL 3FO0L 2DWXA 3L95B 4HCRL 4QWWD 2XNAB 4NO0A 5KJ7E 4XMPH 2EUVA 2ZP0T 3W2DH 3B8SA 3GI9H 3ABGA 3MCYA 3EYUH 3WJJC 3HUJB 4JM2A 4QCIB 2NQDA 1MF2L 4LP4A 4ODWB 4MJ4A 5C9KA 4HPOH 3BPCB 3IE4A 1E4WH 4AG4H 3MN8A 4LO9A 4QHUA 5J11C 4BZ2H 5IQ7H 5KSBE 4OCXH 3GB7B 2ICWI 1T5XA 2KDGA 4M29A 1Z7JA 1QX1A 1M3IA 2D3VA 5F7BA 3BFOA 2JCCA 4LPUA 4QYOA 1FLTX 2WY3B 3H4FA 1RPQA 3UAAA 3NP4A 4RVBA 1FNFA 1TDQA 4XCFH 1XZ0B 2DWTA 3QNYA 3ZU8A 4NZRH 4PV9B 3UMTA 3I6LE 4M6OH 3DO7A 3ZKXC 1XGYL 2CAKA 4U3XA 3PQYE 4P5KA 1XAUA 1M9WA 2HFGL 2DY2A 3MACL 1LO0L 4J3UA 1U93B 2R0WH 2UWEF 4S1QL 3MUGB 1V05A 4PJCA 4OM1L 4XH2B 4ZQKA 3F7YB 4N5UA 3V4PL 3UPRB 4PB0H 3FH8A 2VR7A 1AD9A 2WQRA 4LCYA 2Z0UA 3BYTA 4Z7WA 3GHEL 3MCLH 3JWDC 1QLRA 1M7UA 1LD9A 5C0GB 4MQXD 4A6YH 2CZNA 2JB5H 1X5KA 2QFPA 1GKEA 4BSWB 4Q9CA 4OLVL 3DGGA 2GITA 1HL8A 1M9SA 1MREH 4KJPD 4XOAA 5HXMA 1S7SB 4UIMB 4IK7A 1UQSA 5ADPH 2DD8L 4H8QA 3KG5A 4MLIA 3VQ1C 4PRNA 2P3YA 3DMMB 1ZLWH 3T8MA 2X4RA 4TUJB 1S5HA 3CDFA 4R90L 3B1UA 5HGHA 3IFPA 5LNEA 5HYQB 3OQRA 3QC6X 1R0AL 1JF1A 35C8L 3FB6A 3M1CA 4PJAF 4XE5B 1U92B 3S3DB 4JHAL 4JHWL 4OV5B 1MVFA 3QFJD 2W92A 2AI0H 4ZDHB 3HN5A 2BNQA 2CLZA 4URTB 4L3FA 1T89A 1CFSA 2IMNA 3MLXH 1KXVA 4R5XA 1KJ2B 3GBNH 1A7NL 3QQDA 3TA3B 4OZHE 4A6YA 1F58H 4LT7A 4XPAL 4WGVB 2GABA 2DLFH 3JWOH 3NK4A 3VNZA 3GEWB 1N59A 3MXWL 1HOEA 1TU2B 1LDSA 4OFVA 4KNQA 4B5ZA 2B2XL 1SYSB 3IDJB 1JGUH 1GGBL 1RZIB 2EIEA 4WUUA 4OZGE 1CD9B 4N26A 1QTYT 5GSVB 5I5IA 5SWZD 1QFWL 4MZ3A 3QXDB 5EO9A 4IGBB 1JZHA 1XD1A 2PCFA 1ZLUH 5JQ6H 4FFVC 3RGHA 2X3BA 2V0AA 3NN8B 2PP9A 3EFOB 4HUKB 1FAIL 2ZX6A 4KBPA 3RX9A 2RH0A 3VWKB 2AABL 3RDTC 3UX9B 4PJ6A 6PAZA 1NBZA 2ZSWA 5AVRB 4IKNA 4MNGB 5KJRL 4FTVB 3CU7A 4KROC 4K71C 2LOEA 4KRPB 4Q56A 5DGRA 3WFEH 4K2UL 4PS4L 4HJUA 5AG8A 4JRXB 3FQNB 1PLBA 2NNAA 3JUZA 4JDEA 2V2TA 4YBQC 2AXHA 3FN0H 3TFKD 2VDOB 1T83A 5FFOA 1OIOA 1XGQA 2OW7A 2VKWA 3ISRA 4A63A 4BCZA 5BQ7A 3L45A 5SX5H 3BKCH 5FYLH 4WY7H 3C09B 1R3HB 1LP9F 4HMDA 3SGJC 1J11A 5LN8A