2DPKA

The crystal structure of the primary ca2+ sensor of the na+/ca2+ exchanger
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
136
structure length
124
Chain Sequence
HGIPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSESALACLGSPSTATVTIFDDDHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the primary Ca2+ sensor of the na+/ca2+ exchanger reveals a novel Ca2+ binding motif.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Metal transport
molecule keywords Sodium/calcium exchanger 1
total genus 22
structure length 124
sequence length 136
ec nomenclature
pdb deposition date 2006-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2dpkA01
2FWSA 2QVKA 3GINA 3RB5A 3RB7A 2KLSA 2KLTA 2LT9A 2FWUA 2QVMA 3E9TA 3EADA 3FQ4A 3E9UA 3US9A 3FSOA 2DPKA 3H6AA
chains in the Genus database with same CATH superfamily
1R5WB 1B0WA 4JG1L 5FK9B 5A2FA 3BUIA 3HI5L 1Y18A 3DX7A 4LLWA 2UZYA 5F1OB 5EO9A 2OMBA 3VXUB 1FBIH 1FZOA 4P2OA 1RUAL 3PV6A 4P59H 3CXDH 4DKTA 4I3SL 4JR9H 3FCTB 1KCWA 5JOFB 4Q9QH 3IE4A 3QC5X 3FBQA 5LKNA 1T2QH 3WE1A 1JTOA 3KH3A 3CFIC 32C2A 1F2XK 3M8OL 3NJFA 1YQVL 4YSRA 1ACXA 2DJSA 3U6RA 4Y9CA 4HFWA 1A7QL 2AK4A 1WA2X 5IIEB 3MZTA 1XGRB 1T03L 2IAMB 4M7LT 4E9QA 5FO7B 4Y4HC 2WNWA 3NCCB 4WAFA 1M7IA 3DX8B 5K9QI 3HZMB 1T80A 4D8PA 1G1KA 4RA3A 5FF6B 4MJID 4AH2B 1VLXA 3IDYB 1ZIAA 4KKAC 4F2MA 2DLEA 3P9WB 3CZGA 2PP9A 4F9PA 4NNPL 2BS9A 3S5ZA 4KJQC 4WFGE 3QRFM 3P2DA 4PVLA 1PNCA 1LTXA 3ZTEA 3AQXA 1ET8A 1ASOA 1C1EL 4OIBA 3IE9A 1RIVL 3E8VA 4LKXA 1UKTA 5F7AA 5TPWH 1NAKL 4DTGL 2GBTA 5DURD 4OFKA 4FHBD 2H9GB 3EUDA 1AI1H 4LBEB 4WFEE 1D5MA 5GRJL 3QXUA 4HJUA 5FR3A 5IEKA 1U8HB 3MLSL 5IEHA 3QNXB 2WBJA 4IIQB 3Q3GB 4QPEA 4YL9A 2VR8A 2EECA 4GAYA 5IESL 3EYFA 4N2CA 3MRNA 1UACH 4ZS7H 2BIOA 5AYTA 4MCMA 5DSCB 1TMCB 3L5XL 3EYFB 4F9PC 3APNA 2DIEA 1R9FA 5AZEH 5H35B 1M57B 3VW3L 4KFMA 2RH0A 5LXGH 5I1IH 4UTBH 4Q74A 1ACCA 2Z8WC 4XCNA 4F58H 2CRMA 4A68A 4CUCA 5JXED 1RSFA 3WLWD 4IMLB 5FOJA 1H6EA 2BPBA 1XGTB 4U1SA 2Y6TE 1AR1C 3Q43A 4P5TA 4B7IA 5J11B 3IJHB 1WBZB 5SWSB 1KXVC 3CU7A 3A3YB 1UZ8A 4H8VA 2IV8A 5AOKA 3UACA 5JIDA 1S7SA 3DX6A 4NQTA 1P4LA 2A9ML 2UV3A 2EXTA 4PJCE 1SVZA 3K6SA 3MRLB 4O51B 2GFBA 1N6VA 4LEBA 1DQIA 3N2JA 4B97A 1RZ7H 1XMEB 3NIDB 4M48H 4PJ5B 1B4JL 1PFCA 2V37A 4NQCA 4N6RB 4A2GA 1OP4A 1IKNA 1CT8B 3GXMA 3PWVA 1DEDA 2YRBA 5HHVL 4N85A 1PZCA 2E0PA 1XH3A 5AOLA 5C0DA 4UTBL 4GOSA 1OTUD 2L7UA 4XPGH 5KSUA 5JR1H 1RUKH 5D7JA 1AGFA 3SE4C 5KSUB 2V2TB 1IEAB 4ZMTA 3T0EB 2FHCA 2NY4B 2AEIT 4G72B 5DJXB 3GTTA 1YY9D 4A2EA 2Y72A 4A6YH 2DDQH 2PP8A 2P80D 1MXGA 4WSKA 1KSRA 3C5JB 4OGYL 1FZMA 4NBYB 4PRPD 3GJFA 3OL2A 3B9KB 4RBPH 3TCXA 5AVRB 2OX5B 2RFXB 3L3OB 1NCCH 4AQ1C 2H6PA 1UXWB 1CVSC 4NKMB 3WN5A 2VDNL 1I85A 4XMZA 3IJ9A 2FT6A 4J1UA 5FO2A 4AITA 1T5WA 3KWUA 1I31A 4YQXL 1KGYE 5TE7L 1P7KA 2W9DL 4MS6A 2MCAA 3B56A 1INDL 5EC1B 5FV1L 1O75A 3WD5L 3ZR6A 4GH7B 5DD3H 7PAZA 5GS1B 3RU8L 3HAEA 5FV2A 3GMLA 2VUKA 3VXRD 4E68A 1BZ9A 1F90L 3TT3H 1WH0A 4WJG3 4ETQA 1JWUB 4MXVF 4HUUA 4DPCX 1UZ6E 2QFPA 4OD3H 4OCYH 3SJVE 4U0QB 2EE6A 3P3YA 3PUUA 4G59C 2J88L 4KVCL 3MV11 1HHIB 5F0JB 3VRJA 5DD5L 4ICXA 5GRXG 1O7SA 3FT3A 2DN7A 2XQYG 4L37A 2Q0ZX 4N3UA 3UBXA 5IFHH 3ZT5A 5LCVA 3QZLA 4Z7WF 3KYKH 1MLCB 4GQ9L 4ABVA 5A7EA 2ZUSA 2KLTA 5DC2A 1V05A 4XXDA 1OCCB 3KL5A 1FL6B 2ED7A 1L0QA 4YHNB 1HXYB 2UVEA 4LLMA 4XNBA 3PU7A 1I8LA 4OLWH 3AXHA 3WAJA 3WY2A 2HTKD 4DJMA 4W9KC 3GUTB 3FFCA 3OKNB 3QT2A 1QPPA 3GIZL 4FJYA 2EIKB 2LLLA 4NENB 3NRQA 1BXVA 1XH2A 1NANI 2B0SH 2BNRB 1MAMH 3MNVB 5B1CA 1QBMH 2F7PA 3Q44A 4TVPD 3MRIB 4L4VA 2NY3D 3TT1L 1KLUA 2BVPA 2B5IB 1JXKA 1MVFA 5CP3H 4E41E 5FFGA 5C0GA 3QQNA 2C34A 2HKHH 1A8ZA 4X7EC 5B4MC 3DMMC 5DD5H 3FSWA 1BVKA 1KJ2A 3HMXH 4N2LA 1YEHL 3CFEA 3HMWH 1O0VA 2AHIA 2AVGA 1RUMH 1OOWA 1KEML 2ED9A 3DK0A 3TNNA 1FE8L 2EXSA 4XTRC 4JX0A 4I87A 3TS8A 1DEEB 3C60C 4O02H 1NOAA 1NDTA 3P0VH 1I7UB 4GQPH 3N1PC 1Q9KB 2A74A 3TC9A 1TJMA 1CG9A 1A6ZB 3I3EA 2BLFA 4HIQA 1PF3A 2E4TA 2QVFB 4JG1H 4OLZH 3Q13A 1KB9K 2H32B 2JB5H 1E5YA 1MRCL 3C6SA 4MFHA 5DWPA 1QUPA 2FWLB 4X4XA 3U2SB 1FVDA 3S7GA 4X80H 2O5YH 3KPSB 1AQKH 1DANU 1QWNA 1UENA 4LSQH 4P23B 4KZDH 2OPCA 3EG9A 3I6KA 2OZ4L 4HS6A 4ZPVA 1HT6A 2IXQA 4ODUB 3WUWB 4DN4L 4DP4X 2PN5A 2Y7LA 1H9VA 1JK9B 2IDFA 2IG2L 2VMJA 3QQ4A 4F2FA 3THMH 2QLYA 4GKSA 4N2EA 1KJ2H 1EZVX 4YDIL 4M7KH 3IAPA 4PI2A 1GGCL 1NMAH 2JELH 3ZKQD 1A7BA 2A74C 1I8AA 5JHDD 4ELME 1Z9MA 4IW4C 1A6VH 3C60A 3K0YA 3UTSB 5MEOA 2WLZA 3BGAA 4UQ9A 2HFFA 3VDAA 3MRMB 2CO7A 4MAZA 2BVOB 4RDQF 3BKCL 1DDTA 4NNYB 4PJDE 2C7FA 2MPVA 2YLHA 2IVFC 3KJ6H 5CWSA 2Z35A 1KENL 3IGLA 3G9AB 1SHMA 4Z7WB 2HCZX 1L7TL 4G6FB 3L3IA 4X9GA 3KBHE 4F80A 3MLVH 3UPRB 2XYCA 1W8EA 2BHFA 5F89B 5LGHH 2JB6A 4J3OH 3SCMC 3ZHDA 1EFXA 3V8CA 1ITCA 3BEVB 4P9ML 4XNXH 3SO5A 3T0VA 1UHVA 4S1RL 3AWFA 3STZA 2NY5H 4BA8A 4EXPX 3PJSB 1FGVL 1A6WH 4QXWA 1CVRA 3BH8A 1I53A 4HX1A 1JGUH 3ZL2A 1QFOA 4KKZA 3VD1A 1I8LC 5BQ7A 2OKMA 1ZLUK 4PJEE 4MZ3A 1U8QB 4Y2OB 3VG9B 1WFUA 1FH5L 4HULB 3OXRA 3BCFA 1ECZA 2JKWA 4NUJB 4TULL 1URLA 4NC1C 4X4KA 5D6DC 3GXIA 5FUCC 2W8CA 2YD0A 3HNVH 2MNUA 1W0YT 1N70A 2GJ6A 2P49B 3LV3A 2KC0A 2B4CH 2KT6A 1KFAH 1FH2A 3BKMH 5EU6A 4BGDA 4KTDL 4MJIA 4PTUB 5FYLE 4G6FD 4N8VA 2FT7A 1KULA 2H4EA 1OE1A 2YGPA 3R0MA 4NSKA 5ICYB 1IGJB 1QBLH 4L3CA 2WQUA 1W0WB 1K5NA 3ZE2B 5EEZA 3WE6A 3U1SH 4ZOBA 1C5DB 4YJZL 3RUGB 3HPJB 1O9VA 3FZUC 5K1NA 5C8JB 2P5PA 3MRDA 2GJZB 3S97C 4XNAA 5BVJA 4N5ED 4Y19E 4X9FA 3MCLL 1OQOA 2IPTH 4OJFL 1SZNA 1J5OH 1SDYA 3MRKB 2Q7NA 4RIRA 2QHLA 3O6FD 3P11L 3FQXA 4L05A 4NKQB 2PTUA 3GQFA 4R90L 1IKFL 5I6LA 1FFRA 4IBYA 1BVNP 2XPZA 3A67H 5GGVH 1KTLB 1OGAE 1BQLH 2F5BL 2H26B 3FHQA 4KY2A 3LN4B 3S34H 2FAUA 4IGBD 3MOAL 5B8CA 2ZAHA 3H3PL 4NZTL 4ZW8A 1FA4A 2B3RA 2XNAB 4LSRL 4EIBA 3CVHH 4BFNA 4OVUA 3RJDA 1SM3H 4N68A 4XP6H 3TIDA 5FFLA 4YHLL 3AMLA 4HETA 4XAKE 2YXMA 1GKEA 4I9XA 4LL9A 2QMKA 3WNLA 2O61B 1A0QH 1E30A 3ULAB 1IC0A 2IDUA 3TV3H 2UY7A 2DWDA 5BZZA 4JJ5A 2YSSA 1VAHA 5DWUL 1BG9A 1YYCA 3R8BB 1AXIB 1IBHA 1MJ8H 4P3CH 2GT9A 4F7EA 4NOFA 4WTZG 2CKBB 1FSKC 1X44A 1JNLH 1IGIH 4ZPTB 3HE7B 2DB8A 3TT3L 3RY4A 4Z76A 3FTZA 1IT9H 4BHUA 1IQWH 5EPMA 1QFUH 2XV0A 5CLTA 5BS0A 5G5DA 1CMOA 2IH3B 1IGML 4W9HC 2VDPH 1I9RL 2UZIH 2ZKXA 2OP4H 2QQKH 3T0ED 3LKRA 2DQUL 1I4FB 4MNQE 1CQYA 1JGLH 4N8VG 1NOFA 1RK1B 4N2NA 1B0GB 2YLKA 1LEGB 4OBSA 3T4AC 4G83A 3ARRA 3ARDD 2PWGA 5C6TH 2QSVA 1G5GA 3VJ6B 2FH6A 4AQEB 2HLAA 4K8RL 4I9WE 3IWVA 3GHEL 1F5WA 5D4QA 3NA4A 3KJ6L 1K6QH 4JFEB 4WWKD 1Q1PA 1QUNA 5K9JL 2NY2D 1T04A 4XHJD 4LPWA 5HYJD 1UOVA 4WW2C 3FUJA 3V4VH 3KYAA 5ID0A 2ZOOA 1EJOL 5C0ND 4RMWA 3MV01 3I75B 1S8DA 2QDWA 5CMAA 3K71A 1D7DA 1NLBL 5TTRA 5I9QC 3O41A 1PTZA 4BZ2H 3VNYA 3VRIA 1N0XL 2N0KA 3N55A 4EN3D 4DGIH 3O11A 4Z3TA 4EAEA 1RVFH 1YYMH 4YVNA 3X12B 2PETA 3QXDA 5FYLL 2W5PA 3N5AA 5B21A 1AQKL 5ECJE 4TQ8A 2BMKA 5LGJA 1L0PA 2QPEB 1T5XA 2WQWA 3RPKA 5B1BB 3CFJA 4ZBJA 1CD9B 4HW6A 2VC2B 4JFZH 1DE4A 2AQSA 5CEXA 3CCHB 1TLMA 4FI6A 2VDNH 3FQRB 4KVNH 1J87A 4EJ1C 3OKKA 5LWYL 1A4KA 4ZFOB 4Y0GA 5J6GA 2WNKA 4HWZA 5HYJB 3L4WA 3NP4A 4XVOA 3UBFA 5KS9F 1PVHA 2WLIA 4BSJA 2OZNA 3BLBA 1IC5H 4P5KB 4N1HB 2VMFA 4OFQA 2FWUA 1CDIA 5T3XL 4JBSA 3JYCA 4P5RA 4LP8A 3QCTH 2PYEB 4XO3A 1I8MB 3SGEI 1UFGA 4FFWD 1N0XH 4BZ1A 2VR6A 4EN3B 4K94C 1TOXA 2WKLA 3EO9L 3FJTA 5EU4A 4LCYB 2DQEL 4F15C 2KUTA 1XCWA 3AUWB 3T09A 3W0WD 5IB5A 4D2NA 5IW6A 5BZXA 5JMOC 4JZJB 4ELKA 2A77L 4WW1B 4NZFA 4WEUD 2Z34A 1B0RB 4ISVB 3KD4A 5K59E 1G6RB 1NCDH 1Q0XL 2PCPA 3FCUB 3FFCE 3TONA 2XN9E 4Y4FD 3BAJA 3D30A 2OSWA 3K8MA 4HU8A 1R0AH 1KCSH 4LHQB 3MODL 1SYSA 3PDGA 1U8PB 3KZ8A 3GSNA 2PWFA 5AYUH 4XVTL 4ZW7A 5ISZB 3H4FA 1HEZB 4DEWA 5C0AA 3NZ8A 4NQEE 1GGIH 1FVDB 1VPOL 3IN2A 3QZNA 1I3RB 3VXNB 4DGYL 1Y6MR 4OCRH 2Q6WA 2DMCA 3BPOC 5F7BA 1S9KC 4KU1A 4P2RB 2CDEA 3M1BA 4OGXL 4URKA 1LEIB 2O6PA 4XMXA 1A3RL 2WLKA 3ABGA 3DPDA 2QKIC 3QPQD 2WY3B 3S3SA 3UTSA 2AQ3A 3CFEB 4FKHA 4J2XA 2AQTA 5IEHB 1MFDL 5E03A 1Q38A 1QFWL 1V27A 2AW2A 4CSPA 3AQZA 2HKFH 3QI9D 5TE7H 3ASWA 3ZO0A 4MCZB 3L3HB 4DUVA 3EGXA 4WK0B 5EZIH 2UX6A 2NRDA 2DLHA 1JD7A 1AY1H 4MMXA 3UTSE 1MHHB 2AK1L 4HCRH 3UDWC 4ODTH 4OI8A 4M5ZL 4R96A 1OCOB 1IKOP 1RK0A 1V54B 2OMTB 4AE0A 4Z5RA 4CDHA 3Q2LA 3RVXC 4XODA 4ZAKC 3STZB 4QYAA 3BVWA 4LLYA 1GH7A 3B4NA 4QXGL 4JANB 4IK6A 3QUYA 4LQFL 4Z7WE 4YLCA 2X4TB 3NEXA 1KCVH 4A2HA 1UJTA 5CUSL 1QI3A 4AUYA 4JANA 4ODHH 3NCWA 1NGWA 4TSCL 4NRZA 1J8HD 1KCRH 2OXGA 3CFTA 3EJPA 3F7PC 5KZCB 3Q6GH 1KIRA 4QRUB 2YARA 3T4AA 4X6DF 1GZHC 3L81A 3L4CA 2B5IC 3NA9H 1KGXA 5EU5B 4Z6AT 4OH2A 4IM8A 3LVEA 4RMVA 1OAZH 1CQKA 2GJ6D 3O8XB 4L0YA 3CXDL 2EE3A 3KJ4B 2DI8A 2NMSA 4EUPB 1OCRB 2EDNA 2XKSA 5A16A 3X13B 1G9ML 3QUKA 3HC4H 2VKXA 3L3IB 1A1MB 4GBXC 2RFXA 4YHIA 3CX2A 3BFOA 1KGCE 3LQAL 4Z3FA 4ZTPH 4LOUC 3SKMB 5L88H 1JPTL 1WCBA 4KFZC 3VFVA 4CADB 1LDPL 1U95A 5IB2A 4NKDB 4O00A 4WF7A 4EZMA 3ZY7A 3CV5A 3QAZB 5FGBC 5D8JH 2HKAA 1BX2A 5AW4B 5IQNA 1KNOA 2I07B 4X6CA 2X3CA 3VFMB 4LCWE 3WIAA 1CT8A 3BQUA 3P30H 5GGSY 1KNOB 2I07A 4X6CB 3VFMA 4Z7AA 4WU5B 2ZCZA 1U93B 2P44B 5HHOD 1CFVH 3BX7C 1F97A 3BEWB 3Q1EA 4BFGA 5L6YH 4PR5A 4P04A 5BW7C 4WI6A 1ORSB 2W95A 5IMMA 2OJZL 2MPAL 1J5CA 1IEHA 2FJFB 2HVJA 4HBCH 1FFPA 1SQ2N 3I6LE 4CRPA 3TIDB 1GXEA 4G7YL 3GMPB 3PXHA 4M5YL 3LZFL 3IDXL 4JY4B 5ITBL 2V5YA 1HQRA 4UCFA 1HJCA 3S8GB 1KB9J 4G7RB 1GOGA 3QO0B 4YFLI 3S35H 4MNGA 5E5UB 1PAMA 4HS3A 2B14A 1S9VA 3N43F 4M48L 3GZQA 2ZAGA 4F37K 2JJTC 1JYVA 1CDCA 3H9HB 1F45A 3SCMB 1F3JB 7PCYA 2NTSP 3HB3C 5DJ6A 5E2WL 2WCSA 1F1DA 5SV3A 2WBJB 4IIQA 1U8KB 3BZ4B 4N0CC 3SDDD 4LLUB 5SWSD 3W0WA 2DWEA 1LL1A 2B4CC 4ZNEA 4MWFB 4XNMA 1CC3A 2EEDA 2I5YH 1KLUB 1DUZA 5E8OA 3P3TA 3PL6C 1A02N 4U6YA 4HH8A 5EO1B 4X6BA 4ANUA 1QATA 3QQDB 3D48R 1HNFA 1D9KB 2K6ZA 4MJ6B 5DC4B 2OSLA 3BWSA 3IT8D 3M6DA 1F0LA 4KI5C 2DH2A 2WBXA 4Q58C 4XRCB 4FABH 2BNQB 3H42H 1HX0A 2VABA 4H26A 3VI3F 3MTRA 4IJ3B 1DDHA 4YXKH 4YS4A 4JRXD 3BXNA 5CKAA 1BF2A 2A77H 3W37A 1J1XH 1AY1L 3SDXB 1J12A 2CCWA 4EI5C 5F7UA 4NBZB 4F7EB 3ML8A 3K71B 4HT1L 4BZ1L 3RGBA 5FCSH 1EEYB 2FQDA 4NKIH 3QORD 4M1GL 2Z91B 2MNWA 4J3SA 4UIKL 5CD3B 4X99A 3OR6A 1W72A 2CIIA 1BJ1H 2Y07H 3HNSH 3BSZL 1UASA 3SJVB 5BS0B 4FTVA 4C47A 4HPYL 3O2DH 2ED8A 3D4ZA 1AP2A 4NFBA 1RZIA 3KPNA 1I8UA 35C8L 1KC5L 1N7ML 4LL1A 4FXKA 4N2AA 3VI3E 5IREA 2DMHA 2DKMA 1DVFC 2PPCA 3SBPA 3QWOA 3P3SA 4EVNA 1NEZG 3STLB 1GOHA 3VFSA 2DMKA 4U4BA 1EV2E 4XPFL 5EU6D 3VYOA 1B9ZA 1S5HB 2SODB 1USQA 1GGIL 5BRQA 3QFJD 2HFGL 4M62L 1YMME 4P57B 4A38A 3NSFA 3WNNA 3VXMA 3TO4C 1TU2B 2HG5B 4FFYH 2V17H 4BKTC 3QXVA 1XGYL 5TE4L 1UD6A 2B2XH 2DIJA 5BOJA 1YNKH 1E5UI 4UT9L 3BP7B 5DK2A 5IP4A 5D7LD 1S5IH 1ADQH 5C09B 2Y06H 3VXTA 3NFPA 5JPMA 1XT5A 4GEJA 2W60B 2KMWA 2XWCA 3WNOA 4B9FA 3V7AG 4N90D 3CFBB 3D08A 4JPKH 5CEZL 5HPMB 2XWZA 4FZ8L 2HJFB 4C55A 1RJZB 1QSZA 2CHWA 4X6DB 1IBGH 3MV7B 1XF4A 1NMCC 4DGUA 1NCWL 5FFOA 3D0LB 1A1OB 3O4OC 3FFDB 3TZVD 4ZO7A 4POZC 5DEJA 2DTML 4IYKA 2WKOF 3FQUB 4LASL 4ZW6A 3G5YB 1T20A 3DUSA 1MLCA 3L4VA 2QVMA 2EC8A 4NO3A 3QEGH 1KPUA 3V9FA 5T3XH 1G7MB 4FP8H 4LT7A 4V1DE 3RKDD 4PRHB 4KTDH 3UYPB 1DVYA 1ZTXH 5D7IA 1KXVA 4JDTH 1B4RA 3HVNA 5HXMA 3QZOA 1WGVA 5AWNH 4Z7NB 1JCVA 2A83B 5G4MA 2QFRA 3X3GL 1XB3A 1CF8L 2DWSA 5C92A 5H4ZA 5E94A 1U3NA 1BZ8A 1HSAB 2AQNA 4Y9BA 1H15B 1NGXB 3MLTB 1EDHA 3QUXD 4OIAA 5EUOF 3IXAA 1B2WH 1P5VB 1OZUA 3QQ9C 4GP5B 2D7NA 2NUTA 2LGNA 1JZJA 4LE8A 5IG7A 5J12B 5CU5A 1KCLA 1S7XB 3FAWA 1CLCA 4ENED 1A65A 4LVOB 4XBPA 4B9ZA 1E6OL 5H8DA 5BZDB 4HPOH 5LB1A 4ANKA 4PG2A 2IPKA 4QRAA 3QEGL 1MWAA 2VUOA 2RGSA 2XG5A 4KKBC 4LIQE 1BJMA 4P5MA 4JM4L 2X41A 5GSRA 5EBWA 5JXEA 3RDTC 3FMGL 3ULVL 3KXFD 1NWPA 3LEYH 3TBYA 3MLVL 4PWHA 3TCLB 5IR1B 3CVHL 4JVWA 2QR0B 4AG4L 5KVEL 2OCCB 5GS0H 3NCFB 1I85C 1HYSD 4Q6IC 1YRKA 1G1CA 4KAQL 4NZ8A 3OMAB 1NIFA 2DY2A 3WN5C 3ZRCC 2RAMA 3DPBA 5CGBA 2IBZX 3RI5F 2IGFL 1PX3A 3OWRA 4ZPTA 4EF3A 2IF7A 3SBWC 1IZJA 3KPQA 5KBPA 5FYJD 1IQDA 4W9ZA 4OD1H 1UG9A 1JGVH 5C6WH 4FQ1H 4KXBA 1ZLWK 3U1QA 2W07B 2QSCH 3GMNB 5B3SB 3VFGL 1G4MA 4OGZA 3KCPB 4NCDA 2ZKHH 4WUUA 3IDMB 4I1NB 2CMRH 3MRRB 1A6WL 1MRCH 1FIGH 2FIKB 3MYJA 1ZHKA 4WWOA 1U95B 2X70B 3X1EA 3C2AH 4YSAA 5AZ2L 4MXWH 2EDFA 4FQJL 5DUBA 5T1DL 1ZT4A 1T0MA 5E8NB 3PWUB 2PABA 3WFDH 3CHPA 3HJEA 4ZQKA 5CSZB 2D4DA 2IOOA 4HJIA 2JIXA 4HUNB 1WJ3A 1ZY9A 2H41A 4R2GC 4GRLA 4NO0B 1NCOA 1A6PA 4X2UA 1S7UB 3FQ4A 1U58B 2E9IA 1A4AA 1Q9OA 2ODIA 1MCCA 2XI9A 5IEKB 3QK0A 2WWMC 2X28A 3LS4L 4M93C 5AL8A 5IHZA 4MNHB 3BRDA 4NQVA 4G8EA 4WV1C 3ZDZF 5AYUL 2IBZY 1AZRA 4PGZA 1SXCA 4XB8A 2VSMB 2X4SB 1K2DB 1EZUA 3QXDB 5CJXC 2YZ1A 1B9KA 4MCYB 1SXSA 5AUMB 2F6AA 2QHRH 3PWNB 1Z3GH 3BAIA 4ES8A 1CDGA 3FU7B 3NIDE 1TJIH 4K94L 1A1NA 3MNZB 3W39A 1VADB 4U1SB 2Y5TA 3UL4A 4MJHA 3GBNL 4Z7OE 3GMQB 5AG8A 3C5ZA 4LCWA 2Z0BA 3S36X 3VB8A 4DZ8B 3BO8A 1F56A 1WFOA 4HCFA 4PJFF 1TPXC 4J3XA 4UM9A 4OLUL 1X5HA 4PJCA 2R29L 1X7QB 1MEXH 4P4KC 3QA3A 1TQCC 4WJ5A 3ATAA 5DHVA 4RAUA 5GS1A 2NX5D 4WO0A 3SYQA 4PJAE 2WN3A 1CFVL 3VI4E 3BH9A 5KSBE 2WO2B 4UNVA 3MREB 2C3XA 2OJEA 3QDJD 4RRPM 4PGDA 4DP5X 4I0PB 1O6SA 4UTAL 3GJEB 3O2DL 4MMZB 3WS3B 1CTNA 2IBGA 1GGTA 1HI6A 4AIOA 1SJVA 3U0WH 1B2WL 3EJJX 1UB6B 3NK4A 5D72L 4Q14A 4R26L 2OSLB 1QRND 5GS2H 5DHXB 2H8PA 2YPLB 2B77A 5I6XB 1BREA 1DUYB 4HC1A 4JKPL 2DMBA 5D7LE 1TZIA 4XMWA 2YEVB 4LLAA 1IO4C 2ITEA 5F0PB 2FSDA 3GYRA 4JY4A 5D7KD 5I75C 5T5NG 2IGFH 5A2KH 4DZBB 1DDHB 1F4WH 3CC1A 3PG2A 3NIFE 1O9ZA 3OF6A 1ONQB 4ZW3A 4NQDD 4PJ9A 1KIPB 2ADGA 1U6AL 3A6CH 5C0AB 3CFDA 1IEBB 2W0FA 4JE4B 2VLRB 3REWB 4AWJC 5E08H 3Q6FB 2I32A 4P5KA 1SBSH 3SOTA 3HVDA 1DVXA 4D0CB 3CDGA 1XF5A 1BFOB 3HHSA 2R2HA 2JKJA 3MRIA 1ETA1 4X42A 4ZD3L 2B7DT 2DQFA 3RURA 3O6LH 1F8TH 1U36A 4KK6D 5PCYA 3DV4A 3OPUA 1NFDA 3B2PA 3HUJE 3BP5B 5CGYD 4JAMB 5E8EB 5FKAB 1UXSB 3S4SG 3SKOA 5IJKA 2CH8A 2I9LA 2DF3A 3UGUA 3ZYIA 5ID1B 1FG2B 2XIIA 4FJ6A 4XVUC 4N0FA 2OMVA 4MCNA 1FG2A 2NZ9D 2LFEA 3BUBA 2GY7B 4AYMC 4PBDA 1F4WL 2VCOA 5LN4A 2EKSA 3VWKD 3CZJA 4ZFZB 1GHFH 1SPDA 2AXGA 3IYLW 1N18A 1BEYH 3FT3B 3V4PL 4JM2D 3GINA 1S7QB 3II2A 5ESAA 2HKFL 3IGAB 3APDA 1YG9A 2D03H 1EERB 5EB9A 4AVHA 1C5BH 1IVLA 4GY4A 5HYIA 4A7UA 5EF0A 1DCEA 2IH9A 5HHPB 4POYA 4H2CA 4UBDC 5F7MC 4PMFA 2J25A 2K7QA 3QDMB 1A3LH 1JUFA 2DBLH 2OXHB 4M5TA 5CJQL 3RIAF 5HGHB 3QIBD 1XV8A 1T2QL 3GMOA 3ZHKA 4IKLA 4NENA 2VDKL 5C9KA 5C0BA 4OKVB 1KC5H 2Y2TA 3DDFA 4FRWA 4YHKL 5E2VH 3U9PL 3UG5A 4ZFFA 1IUZA 2M2DA 4OZFB 3RWJB 1HFUA 5CUSH 2WYHA 5E4EB 4KXDA 2WXLA 4K5LA 1AE6H 3MLUH 2FSEA 3H7BB 2BVPB 3QG6A 5CZRA 1LP9E 4B6ZA 5T33L 3E3QE 1JDDA 1WIPA 1BEYL 1GGYA 1JNNH 3BOVA 1LM8V 3CPLB 1PD6A 2ZCLH 4AVIA 1QA9B 2ZWYA 2BVYA 1UKQA 1QA9A 3MODH 4YBLB 5HGAB 3BVNB 3HE6B 3V0VB 1M05A 2YGNA 3EGXB 2CD0A 1IM9B 2X09A 3VXSB 4XMKL 5I2IA 3KPMB 2EDOA 2LT9A 1ZSDA 1CICB 4BFBD 1LO2H 1T7ZA 1ZV5A 4F3FA 3IFOA 2BERA 3S5LA 4S2SA 4FLHA 2MKLC 4ZUTB 3FCTA 1F6LL 4WNQB 1DVFD 3RVTC 1H15A 2KS0A 1JDCA 3APCA 4LDLB 3VE0A 1KZYA 2VUYA 4FA7B 3OJDB 2HXAA 3U0TB 3HPLA 4CMHC 4YHOH 4GRWB 2F1EA 1NJ9B 4PJEB 4E9XA 1QRNE 3BMVA 4TLSA 4Y4HA 1GYUA 2IAMA 3BN9D 3ZW3A 1KY6A 3ESVF 2ZSVB 1YA5A 1CFTB 2NXZB 4FQJH 5T1DH 2NXYD 3M17B 1JWSA 3N04A 3UPAA 4OZGA 5FYLD 5GZNA 3MFGB 4Z77A 1BGXH 3FQUA 1IB5A 3NAAL 1EFQA 5FYKH 4BQ6A 1SJHB 1OIOA 3N40P 1M7XA 3BN3B 2CJ3A 4TVPL 4TLUA 3NIFB 2X4OA 4FQXB 3LNGA 4M1DH 1GY1A 3SE8L 1DQJB 2UVFA 3CFUA 3DRTB 1A1MA 4I77L 4A7GA 3FQ1A 3VD0A 4J39A 1TG8A 2I7OA 3SDCA 5IJKC 2NW3A 5DRNB 2MQ0A 3LEVH 4WK2B 1A6AA 3VXOB 3ZE0F 1BVZA 3MXVL 3NSXA 5JOFA 4HK3J 5EBMB 3FTVA 2PP7A 4JJOA 2CRIA 4F8OA 3OB0H 1MCKA 1UM4L 2M8XA 2P45B 3W5NA 5GGUB 4XN1A 3ARDA 2B20A 2C4XA 4X7SL 2WBKA 2DWEB 2QADC 2H7WA 1JS4A 2UYLB 3ES6B 1A6TB 3IJSA 3GS7A 4WNJA 5T5FL 1XSOA 1HHJA 2AEQL 3MLSH 4LCCB 3C6LC 2IBBA 2PKDA 3FQXB 1NCGA 1SMAA 5CHNB 5BRZD 3QEHB 2EIZA 4AMWA 4BFKA 5K9JH 1RZFH 2R2EB 1BCIA 2BHYA 3G6DL 3OVUB 1OGAD 3R18A 5L8LB 2AJXL 5B8CB 8PAZA 1WA0X 1XH1A 2E7CA 2HFTA 1TVDA 1EK3A 2WXNA 3LCYA 4C56A 4APQA 3NQKA 2WXQA 1VPOH 5CBAB 3AVEA 3WEMA 1PY9A 3MRLA 4ZTPL 1DO6A 1E5BA 2QPFA 1AIFA 4M8VA 3F64A 4MD0B 4YDIH 5L88L 2DQTL 3CNKA 3K74B 1CI5A 2LLGA 5F8QC 4ZX5A 3VXSE 1YEDB 2CCLA 5I1DA 5IQOA 1T4KB 1R6VA 4QHLB 3MRHB 3TBSA 1XO8A 1UD2A 1J48A 2C7UA 2F74B 3L3JB 5D7SH 4AYFB 2CPCA 3J7HA 1RJLB 4GXUN 1MFVA 1OAUL 2AP2A 2NQCA 5HGDB 3IJEB 3WTSA 1VB9A 2YGOA 4XTRD 2IWKA 3BZ4A 1N2RB 1BYOA 3MLWH 4PBVC 4U1JB 5DZVA 5GS1C 5C09D 3T3PF 4GG6E 3ZDXE 4KV5E 4Z7UF 1E4WL 2ITCB 4OZ4A 1N0LA 1P7QA 1GTNA 4BSVA 5L4JA 5E8OB 4MJ2A 1MFCL 4MHHI 3WXVH 5L2JA 1ZTXL 3LPWA 4NKOA 5AVXB 3WNIA 2J21A 2W0KA 1XZ0A 1T1XB 1CDUA 4R5XA 5JO5A 1WHOA 2Y36H 5G2NA 3UPCA 2BZDA 2HRLA 4MZ2A 1PIFA 2FHBA 3RA7H 5GJSH 4OIFA 4HIHA 1MW0A 5JYMA 1A8JH 4FNSA 2ZCLL 4AW4A 1L0XA 1FQ9C 5DFVC 4XC3H 3RJOA 5F6HJ 3SPHA 1YNLH 1X9LA 4IBZA 1A6UL 3ECWA 4AIXA 3ZKMC 1JHKL 3RIAK 4MB5A 4O2EA 5B1JA 1C08A 4WV1A 1CL7H 5EZIL 1WCQA 3DBSA 2BFGA 2YRLA 3CFCH 4JJ5B 1B3IA 4MRCA 4RSYA 4HKBA 1HXMB 4IOIA 2WYIA 1XCQA 1IGIL 2TAAA 2BO0A 1SUJA 1BGXL 1PBYA 1CJYA 4I0PA 4UOW0 1IV8A 1IT9L 4WEMB 1HNGA 1IAIM 4UT9H 3EJUA 3HE7A 3E1ZA 2QMJA 3KR3L 5KSAB 3Q05A 1CWVA 2ZXCA 4HUMB 5ESVB 2Y0SA 5J3HD 4RX4D 2QL1A 3AS0A 1YNTA 3REVB 1DJYA 3UAAA 3WFEH 7FABH 2XZQH 3MJ8A 4FXKB 1BXAA 2JF1A 1A1OA 2QGEA 3DMMB 2BIPA 4Q8BA 4K71B 4CSSA 2O5NA 3MUGB 4JDZA 1GJUA 4LVHC 2G2PA 3B9KA 2Y5TB 4XNYL 1AQDA 3GIVB 4LKCB 4YSDA 4YUEL 4PW9A 1J0HA 4RISH 3GI9L 2CALA 1G7JA 3DGCR 3O8XD 4UZUA 3CFDB 4ZFOA 5JZ7C 4QJ3B 1F90H 4MJ4A 2FEDC 4ZI8A 3QA3B 1XF5B 1YN6B 5HI3C 1BQLL 1AGEA 1GC1C 4PRPE 1YPZE 3MRPB 2CKBL 4UIKH 1SXAA 1Y6NR 3H9YA 3N85L 2AJXH 2DS4A 2ADJB 2X6AA 2YAOA 3CMOL 1RH8A 1NZRA 2FGWL 1IKNC 5EU4B 3FQWA 4FNLH 3H2WA 1S78D 5A2IH 1VACA 4YNYB 5HHXL 4XR8C 4S1RH 3MBXL 2QQQA 3HKZA 3S3CB 1RCYA 4GQRA 3I3BA 5JHLL 4U31A 5GGQL 1IIIA 2P8MA 2H8PB 1N8OE 3EHBB 3FS9A 4PRPA 3RX5A 3GXTA 1NKOA 1XX9C 4HISA 2FWSA 3CHXA 4K15A 2E7LA 3VH8B 2CJUH 4BH8B 3DX3A 4HIJA 4JFTA 1U8PA 2GITB 2QPSA 4MQ7B 2VXTL 3X3FL 1CF1A 2MCMA 4OSUL 3NK3A 1SXNA 3QRGL 3RIKA 4JLRB 4QXVA 1U91A 3UBHA 4TOYH 5C0RL 2F53A 4MDIA 1IL1A 1L9OA 1ZJAA 3RHWK 5L0QC 4XO5A 4RNRA 4CU7A 4ZMOA 3WGVB 1VDGA 3CSGA 1MFUA 4TVPH 4PW3A 1CFBA 1HSAA 4XN8A 4AUUA 4OZFA 3V0WL 1RL1A 3V4UL 2G75A 4MGXA 2XC8A 3RWFA 3II3A 2X1XR 4KDVA 4FE9A 4M62H 2ZWKA 4QRRD 4Z7UB 4YSQA 3OAZK 3MRMA 1S7XA 2C8NA 3ETSA 1HTYA 1ZLUH 3F83A 1AYOA 3D07A 3AZUA 1RZJH 2OTUB 4W9GC 5AD0A 1CLYL 2VITA 1QRKA 4GUPB 5GS2D 3TFKC 4OSUH 5EUOA 5I6XC 4OI7A 4OCSH 5AD0B 2NY7L 4KQ4L 4NP9A 3INUH 4HWBH 5J6HA 1TYRA 1EVTC 4OB5H 7TAAA 5LXGL 2Q9OA 3KPMA 2QVKA 5FS5A 3U1SL 2AEQH 2WUBH 1SEBA 1V3LA 3B2VL 5HHOA 1SOKA 5GGRB 3VXMB 2X1OA 4WJKB 2X70A 3FRUA 5F7LB 5HHOB 4HMCA 2OR9L 3OZ9H 3NTCH 2KPWA 5SWZA 1RZ8B 3D4YA 3LIZL 3V6BR 4ZQKB 4ONHA 2YQGA 3V0WH 2E7BA 4YSOA 1E5CA 3EJZC 2NCMA 5C09A 4JKPH 1Z9PA 5B38A 4N0RA 1MJ7H 2NX5B 2DQHH 2GBUA 3DX9A 1WVZA 4JO5A 4AC4A 4BXSV 4TVPE 4ZX4A 3RFZA 4FQ2H 3AG4B 1XL4A 3TF7C 1N6QL 1YSOA 4FFTA 2Z7ZA 4YHML 3ULSB 2ZUQB 2NXZD 3ZHFA 2ENYA 4R6UA 4JREC 5CILL 1QPKA 1LXMA 3ZE1E 4FQLL 4P99A 4BWWA 3QISA 5AWNL 1BPLB 3AAZB 3EJCA 1N9PA 4IKJA 3VH8G 1C12B 1BYPA 1L0YA 3RWEA 1MNUL 2YPLD 3NRFA 5E1QA 2YK1L 3IMTA 3P77A 4TRPH 2DQDL 2C9SA 3CHQA 4WI8A 4X8XA 5K1VA 5JIIA 3D2UA 4YO0B 2X6VA 1SLUA 3LIZH 1E40A 2NW3B 2AXHA 4DCQA 4NRXB 3OX8A 4H5SB 1T89A 4XPTH 1MHHA 3BQVA 4KRPD 2YIHA 3GBNH 2A83A 1UXLA 4FI7A 1OHQA 3D5OF 5ANME 3BGMB 3HMXL 1FH5H 3L13A 1HVXA 3K91A 4X98B 1AXSA 2VDRH 4RRPG 4EI5D 2C3GA 1I3GL 1WZ1H 4G8FA 3MCYA 3ZSTA 3LZLA 4FZ8H 4NO0A 5J6SA 3HPLB 1BVLA 3V4PB 5B7EA 3I9GL 1G9EA 3U4EB 4E36A 1R0AL 4WGWB 2XTJB 1GGCH 2JELL 2YD3A 2ZUTA 4JPIB 4YQXH 4XBPB 3NJLA 5ANMA 1QI5A 4YFDB 5E4EC 4AG4H 2I69A 4K3GA 3AXIA 5HI5C 1MCHA 3JV6B 4JCMA 2ZOUA 1S2EA 1O5DT 1QO3A 3KDMB 4ELMB 1WGOA 4GG8B 3B6SA 3QIUC 3KDMA 2VR9A 1NMBL 4TNEA 2HTLC 4M7LH 3I6LD 4MDRA 4YBLC 3DJZA 1JCKA 1KBGH 5KYYB 1U3HA 3HHMA 3C2AL 3GSUB 1QX1A 4YDMA 3S48A 4B60A 5F7FA 5FGCE 1CICC 7FABL 4U6VH 1QOKA 3TN0D 3SY0A 3V4VB 4HJEA 3NIGE 5D7IF 1NGPL 4EBQL 3T0DA 2EEBA 3W0WB 1U8HA 4YBHA 1P2CB 2YBRB 1MI5E 2IADB 43CAB 3N9GH 3X2QB 1A6TA 3IJSB 4X6CE 3GEFA 4FS0A 1F4XH 2Z4TA 3D7PA 1KBWA 2G9HA 1CTOA 1OW0C 3SZKC 1CFSA 2F8VA 3QNYA 3U30C 3V5DA 3QEQD 3AGWA 2EKJA 4XB3A 3B2UC 2V5SA 2NCEA 1KZQA 2XKNB 3BKJH 3NABH 4PJ7B 3UO1L 1BZEA 2EVGA 3LKPB 5FX3A 1NEUA 5C08E 3ILPA 1BEXA 5TF0A 3CXHJ 2F53D 3MYJB 5DS8B 4BCYA 2X7LA 4YHOL 1DBBH 4MD0A 1ZHNA 3W2DL 4Z1PA 3UYOD 4UU9A 5GJSL 2EINB 1KBKA 4HWBL 2OAAA 3T71A 4I18C 2AEPL 2OTPA 1MY5A 2YEZA 3PIQB 3WI9A 1GIGH 3N1GC 1Z2KA 3ULVH 4FFWC 5TQ0L 3ZE2E 3HBZA 2OQJA 2CKBA 4IKKA 1KJVB 1W2KT 4GSXA 4HYTB 4O2CA 3TEZA 4GXFA 3CZSA 1DQQB 1W72B 3QJHB 1MSPA 4XZUA 5C0DB 5EZOH 3CSTA 3UBGA 1OV8A 2EXYC 5IY5B 2Y06L 3KPNB 2QADB 3MKKA 4ZNEE 4S1SH 2R0LH 5HBBA 1MCOL 4DN4H 2Z31C 5AAMC 5B1AB 1G7IA 4H8UA 3KG5A 4M6ML 2R29A 1II4E 3UP6A 3HRZB 1T7YA 4S0TD 3FONA 3TBTA 6TAAA 4OFDA 5G55A 5AVSB 2F2HA 4AIZA 5IROD 2PYFA 3FB5A 5EEXA 3VVWA 1S7RA 2DRUA 1FNHA 4PJBB 3V0GA 1MKFA 4N9GB 2EYTB 1TIUA 3OSVA 1RURH 2EACA 4WI5A 4X7DC 1WUNT 4M43L 3W82A 3NESA 3ZKND 1N5YH 4APXA 2YOAA 3BE1L 3SBRA 4RLDA 1U2YA 3U4BH 3PAZA 4PB9L 1A3ZA 1X3DA 2J5WA 4U0RB 3IK2A 5DHMC 4G42A 4TTGA 2G3NA 4JKLA 1CE6A 2ESVD 5HGBB 3VXTB 3DV6B 4GP4B 1O6VA 3CDZA 3Q1SH 3ZX1A 5KSBF 1OB1B 5JUEL 3WJJA 1NGQH 3BSZH 4PGCA 1EGJA 3V4LA 4UQBA 1NL0L 4L8SC 2DM7A 4UIMA 1E8ZA 1CFNA 3HG1E 4R83A 1C7SA 3V0AC 2V8MA 4IU3B 3KLHC 1SMOA 5HHVH 2Y7NA 1FGNH 2H2SD 5DA4A 2J44A 3G5YA 4TLKA 4Z7NE 1FYTA 4WFFE 3FFDA 4RESB 3RX9A 4NCC2 5C0EA 2IANB 1AQDB 3GIVA 5KSBA 3JWOL 1SF3A 3MLXL 2R7EB 1SXBA 5GISH 4GS7B 3FOMA 2AITA 4G9DA 3ZIYA 2GSMB 3KVDD 2NQ3A 4WK4B 5IVXA 3ULVC 1IGMH 3QEUB 5GGSB 1LK3H 3CDGB 4I4WB 4JRWA 1JN6A 1NGQL 3BZFA 4AGQA 3CN4A 2WAHA 2XJLA 2Z64C 1T1WB 4EN3A 5DYOA 1KELL 1S9WB 4KX8A 4BKSC 3A4AA 1XGUA 2H0EA 1PMYA 5DR5H 1ZDSA 3Q6GL 4GMSH 5D1ZA 4M4RB 2UZPA 1F13A 2CIKB 2W60A 2XHNA 3BFWA 4KK9D 4WO4C 4UQDA 2X2JA 1BQ5A 1LD9B 5KSAC 5FF6A 4KK5D 4XHQA 4AXWA 4L5FH 1D5XA 5HHMD 4PIRF 1P7QD 1OT1A 1CL7L 3BD5A 3PJNA 1XF4B 1XR9A 4NP4L 4UV4H 1FYTD 2DYRB 2JI2A 4OIIH 5IKCA 3VFGH 2AJYL 4AEEA 3AREC 3Q2WA 4G6AC 3GSRB 3U79A 1FZJB 5C2BH 2O6DA 4K5OA 4LVHB 3G6DH 3KJ4C 3GD1C 5C3IA 3LRKA 3X14B 5I17B 1K5NB 2AV1A 3K8LA 4UNUA 1SQMA 4V1DA 2YC1B 1H0DB 1OKEA 5DRWB 1A4JB 1MCOH 2XN9D 4WFHE 5B39B 3MRDB 3VU1A 1WAAF 2QSTA 4GB9A 2NYYC 4AL8C 5H2BA 3NTCL 1ZLEA 4FJZA 2HP4A 3EJZD 3ZQXA 5HD8C 5CLZA 3MRKA 1UH4A 4HAKA 2KYIA 1E4KC 5GGTA 2BY2A 2EIMB 1OAKL 3L1FA 3NJGA 4G8GE 2B9BA 1X5IA 2DQJH 3CK0H 5TFSH 4PTTA 4XP4H 1MFEL 3O81A 1QKZH 4KOCA 4XCFL 5DFAA 2DYPA 2F08A 5EOQL 5BUGA 4NRYA 4KK6C 4NHCH 3ZMEA 1JXJA 1BYNA 4LPYA 3AADB 3IPFA 3IVKB 4WGVB 2O4EA 1JPFA 5EBWB 1K4DA 5J13B 2O93L 4XMPL 3I74A 4FQQB 4LSTL 1Y1UA 3OAYK 3DVNB 4MLSA 2OMTA 4IDLA 4OQTA 3PGFH 3ZGIA 1ETJA 2EXWD 1OM3L 3V0DA 4J27A 4FTVE 5F7WC 1XGPB 4MX7A 4FNPA 3U6XA 4FQ2L 2ENQA 2NY1B 3ROOB 5GRVL 3TBBA 1FFOB 3HG1D 3VTAA 4U1HB 2HFEA 3N9GL 3NJIA 2PXYB 3C75A 3HB3B 2A6JA 2WTRB 2VL5A 4FOMA 1SN5A 4G8EB 4HEPG 3UJIL 4QRTB 3KLAB 3IDJB 3QIWB 2CNYA 3VW3H 4RGMB 2AEPH 4FP8L 2FJSA 4CN6A 5E6IC 3H2QA 5G5DB 3D8MA 3NPSC 1UB5A 5DU7A 3IJYB 4PY7B 3BC9A 1YEGL 5CBEA 4KNSA 5L6YL 1MCPH 1UD4A 1KTBA 1CYXA 2XZAH 3UZVA 1J8SA 1ZA3A 1I1AA 2FJHA 4FDWA 4JFHE 4Y8AA 3SE3C 1WBZA 5SWSA 4DZ8A 1AO7E 2MTAA 4W93A 1QEXA 2O72A 4H20L 2CO4A 2CR0A 3NCYP 1J1XL 4AQ8A 3BT2L 1PZDA 4ANWA 2UWEF 3L3OA 5FM5M 5BZWA 1XL6A 1AIZA 5DUML 1XAUA 1WV7T 4L3EB 1IM9D 4HHGA 4IRZH 2QBWA 2X6UA 3DWTA 5AW1B 4GQQA 4L29B 1C7TA 3VGAB 4G43B 2NY7H 3ARBB 2YO3A 4Z3HA 4FC3E 1E8WA 3LNDA 4G43A 4EDWH 4U1GB 4G80A 5KAQF 3A21A 5DR5L 3LB6D 4K9EC 3HJ0A 3D18A 2ENJA 2CR3A 3ARGC 4UBDD 5D2LA 4C59B 3AWGA 5FECB 3FT2A 1OT4A 3IKCA 4XMLH 1VCBC 2BRQA 3GC3A 2VSCA 2WWOA 3FT2B 5I8EB 3WIHH 3EFOA 3NACH 1I8KB 1TETL 2VDMB 5AUMA 3M7OA 4NO5A 4PJDF 1F6AB 3QIBB 4TSCH 1TCRA 2EDXA 3IRCA 3L4UA 3MVSA 4AEIH 3VWKA 1NFIA 1VF5C 1N6QH 2YSSB 3ZDZB 5JHAA 1T0OA 4OLXL 1KIPA 1YJDL 1FGNL 3JTSA 4FQ1L 4H0IA 3VQMA 2FX8L 5IMOA 1U2HA 5A6LA 1FN4B 1OCWL 3BH4A 3UTQB 3O6FA 1RU9H 4Z3GA 3FUMA 1YYLL 4JJHA 5AKTA 3RX8A 1FNEB 3V6OE 3TJEH 3SQRA 4OZ4B 4IGBA 5ICZB 1NOLA 3H0TB 3SO3B 1RZIB 2VMCA 5D72H 2APVA 3STBA 1KPVA 4YHKH 4IBQA 1I4FA 3SDAC 1CIUA 1KJ2B 4XWOD 2CGRL 3UFIA 1JHLL 3LKNA 4IBVA 4YDVB 5DRZB 1OGTA 3ARVA 1NMCB 4GW1A 3WKYA 5I0ZA 2CLRA 3MU3A 4GMSL 2YPVA 1MRFH 3EDJA 3O4OB 2E9BA 2XWRA 2XRAL 3GLDA 6PCYA 4TNVF 1JZGA 1KCUH 2C3HA 1JL8A 1NBYB 1GMEA 4EI6A 2ZF9A 2QVIA 3LPGA 5DMGC 5DZNA 4ZFGH 4JFYA 3T3MB 1NC2A 4PRHD 2XWJA 4PJXB 4NQSB 1OAUH 2XX1A 5D1QC 1IX2A 1I9EA 4PU2A 3WHE1 1QW8A 3HAEG 5FW6A 1IGCL 2CDEB 5LDUA 1I7TA 1CR9H 5B1KA 3WKMH 4MNQB 2PTTB 5FYKE 2HJFA 1L7IH 3ILDA 2GUYA 2NDFA 2KL6A 1MJUH 3FPYA 1BBJA 1KWKA 5JDSA 3QHZL 5CCKH 1X6NA 2WANA 3GHEH 5DFTA 1WITA 2BY1A 2ZP0T 5AL0A 1RQ5A 3ORJA 1DE4B 2VWEC 5CEXB 2P3YA 4DGVL 4N2MA 4HKZB 3TNNB 1A9BA 1T22A 1H8SA 2ICEB 2EYRA 1QTYT 3APFA 4HLJA 2BNUB 2NNFA 2EO9A 2J6EA 1R33A 1DCLA 4GUOA 3WNKA 4Q97A 3FAXA 1OD7A 4X0KB 4WFGD 1UZ6F 2YK1H 3HTLX 3S9DB 4YSSA 5F89A 4A67A 3V0FA 4NPJA 4B9IA 4RFNB 1QEWB 2ZONA 4Y5XA 4I9WD 5DK2B 3RUGF 5T8IA 2EDRA 2G30A 3FOLA 5AVQB 5SWZE 3CGTA 1FIGL 3HRPA 2VC2L 2YA0A 1OSEA 2WLJA 2Z1KA 3AACA 1JGDB 3HN3A 3QPKA 4M3HA 4IBUA 3BH8B 3X3GH 1JGIA 2CLVA 4L3EE 4PJ6A 1ML0A 1HN1A 4X9HA 1B4JH 3IETB 1MW3A 1EHXA 3C60D 4PJGF 3D87B 4Q0XH 3RVVD 3OSKA 3FUIA 1NBQA 2WINB 4UNTA 1Q94B 1WDAA 3QDGA 4AVJA 4TN9A 4MA1B 1R24B 1J9RA 4DGIL 1RJCA 2XYBA 3QI9B 2COVD 1SY6H 4LBAA 5EEWA 2Q10A 1ZXQA 4XPFH 4L3CB 1TVBA 5A16B 4HFUH 4EQ2A 2BXZA 3F5WB 3DO7A 2GJJA 2VN4A 4YHLH 1LEKB 5T1LD 4LKXB 2X4OB 3F5WA 3DO7B 1R5WA 5FK9A 1GKOA 1NCBL 1GYVA 1Z3GL 1UWEL 4KV5F 2YFNA 4Z7UE 1URIA 1LO4H 4GKNA 1KTDA 4N8UA 1NCUA 4IJTA 4K5NA 3C8HA 3QR0A 3E6FB 1RULH 4KH9A 2H2SC 4GKNB 1ZXKA 5CIPA 1XTLA 2ATAA 4WNQA 5KJRL 3FH7A 3BAEH 3ULUD 4DP2X 1NSNH 3AU1A 3OXSA 1TVHB 2BY0A 2BVTA 5I1CL 5T1JA 5DJ8A 4QTFA 4P48A 1XSJA 4L1HA 4HGWB 3L9RB 4A2FA 4NN6C 3IJ8A 4L8SB 3VA6A 1G6RL 1QFUL 3EHBD 5CHNA 3RUGE 1YNLL 1MFNA 2YD2A 4PTTB 1TQWA 3PHOB 4N5EC 2AJYH 1MCPL 3FUHA 3QULA 2NY3B 1BV8A 4D8PB 2PR4H 3UADA 5IB3B 1QQDB 4U1KB 1MHPH 3DX8A 3WO4C 2JB5L 1BZOA 2E5EA 4X7CC 4YZWA 2XFXB 3U7YH 2IC2A 5T1LB 5H37H 4P5TD 2ED6A 2WQ8A 3BZEB 2F7OA 1KG0A 3FB6A 5JOEA 4FI8A 2DWDB 2CUAA 2DQCL 1HQRB 1ZHNB 5EIIG 1RK0B 5IT2H 1GCFA 1KBPA 4WVRA 4RFOL 4TF4A 3CX5J 1NINA 1WC7A 3WEXA 2BSBA 2G0KA 3JQOB 2J72A 1F86A 3PPSA 4X8CA 1G0XA 3U1PA 4YDJB 1JFQL 4GPVA 3SY0B 4KITB 2G60L 2H9GA 4PJFA 3V52H 2WXGA 1U58A 5B38B 3H1ZA 5DJDB 1UT2A 3Q7JA 3QQ3A 4U1JA 1BG1A 3IXTA 3IJEA 3QQ3B 3MTXA 4Z76B 3SE9L 2V2TA 2IGTA 2EIBA 3IJYA 3EOTL 4I0PC 4NHCL 2XG4B 2SEBB 4WO4B 3MGTB 5E9DB 1MAML 5ETUA 1E9PA 4JN1H 4L4TA 1C12A 4HWEH 3E80A 5CN2A 5ELIA 3KBFA 3VWJC 5IZ7A 5D70H 4DEPB 1LJMA 1LILA 4UT7H 5C08A 3PPEA 5DZPA 3RZCC 4NUMA 4Y4KA 1VENA 4PRAB 2LABA 5E9AA 2GIYA 4AZUA 2GFBB 5I75B 4ODHL 2W91A 1FO0A 4U2ZA 5DUBB 2F15A 4HKXB 1AD9B 3T0BA 4JFOB 5JNYA 1AXSB 2FH8A 3GWJA 2PLTA 5I1DB 2OL3B 1TNMA 1L9TA 2NTFA 1K8IB 3H54A 4PGDB 4FXGC 1VGKB 2BDNH 4XN9A 4M5ZH 2PXYA 4OFYD 2WCPA 3K4ZA 1OCZB 1N26A 4DERA 2VM3A 2VB5A 5C2BL 4HBQA 2O5YL 4UIMB 2APWA 4AM0A 1IEAA 1MXDA 4NT6A 1FNGB 3PWPB 4YK4C 1BAFL 4HMEA 2EC9T 3POHA 4RBPK 1SOQA 1DLFH 1V7ML 1PQZA 3LQAH 4FFVC 1F6FB 3MRGA 4HAFA 3O3UN 3U9PH 2XXFA 5JPNA 1A66A 1MRFL 3T1FB 3V4PH 2WWKO 1I1CA 3FQRA 4R26H 2WVVB 3SKNB 4Y7OC 4YSEA 3AFLA 3VWKB 5I8CA 2MHAB 3CX5K 5I24A 3TZVB 3VVVA 4W6XB 2TSAA 4G9DB 4J3OD 4M6NL 5K9OA 2WLIB 4HZAA 4XMVA 5CAYB 2BK8A 4WTZA 5E8PB 5LAXB 5T1MA 1MCQA 5I66B 2JI1A 3HE7D 3SKUD 1BA9A 1JK8B 2W38A 4M7JH 1SRDA 1KEGL 3MRPA 4JY6B 1KJMB 2HB0A 1AZNA 3NGBC 3KPTA 4MBRA 5DVKA 3WELA 4JMNA 1KJMA 3JV4A 4P0DA 3LDBB 2A73A 3KAAA 4LLVB 5I18H 4OBRA 2VZUA 3RGVD 1BMZA 2B8OT 1LQSR 2Z0UA 1MAJA 3DHPA 3DVIA 5SWZD 1XD0A 4TTDD 1NPJA 4KNTA 5CLYA 2NY2C 3SDAD 1TYEB 1KLFA 5BPPA 2N4IA 4YUEH 5DLLA 3O4LE 1KTRL 4L3ED 3DUUB 1SOXA 2VZTA 4OIIL 1J1PL 3LQZA 5EBLA 4KNUA 2HT3C 2AGJH 1GW0A 1E4XL 4HKJB 2VLRA 3REWA 3QDMA 5ABAA 1G7QA 5D7IB 5D1XC 1CBVH 4B50A 4F7TA 3VACA 4WHYG 4RNRB 3BVVA 3MNVA 1BM3L 4OJAA 5E70A 1KCVL 3DV4B 3CD4A 1A3LL 3H9SD 4MYWB 5K9KA 3BJ91 3WYRA 1UM5L 4GO8A 4C56E 4DHLA 3LY6A 3P4LA 1FLTX 3LN9A 2FVNA 4PSPA 3RWIB 4N0FB 1HEJC 3RGVC 1G7LA 1ZS2A 2BVOA 1LD9A 3FF8A 1OPOA 1FG9C 3GS4A 4JUSA 3WJMA 5I1KH 4E0RA 4KZEL 5EUOB 3ARSA 1ACYH 2P24A 3BP4B 2A9NL 4PJDB 1INQB 2W1NA 2Z8VC 4OKDA 1A9BB 1JPST 1XZWA 3ZRSA 4XAWH 5GSRB 3ZVVA 4F2MB 1CG9B 1JXFA 2C5DC 2XPGB 3EH3B 4I77H 5JW4N 1HYSC 1RZGA 3U7WL 2WVTA 1WD9A 3DVNA 2XTJD 2F7RA 4FQXC 4P2RD 3HBGA 2YRZA 2VR4A 3SDXF 1LE9B 2V5MA 1TYJA 4S0HA 4R5TA 5M94B 1ES0B 2X6BA 1GMIA 5F3FA 4XP9L 1Z5LB 4ZS6D 1HIMH 3TESA 4FG4A 3KLKA 4P2QB 4G11A 4K3JH 4Y2OA 3IF1A 4FA6A 3DRQA 2C9PA 3IF1B 4JQVC 3KPQB 4KO7A 4GKSB 4F7PA 5HPOA 1AACA 5H35A 4QTHA 3MLRH 5FUZH 3VFNB 3RFZB 3VFTA 1WZKA 2V33A 4QTHB 5DO2C 5CINH 3CPLA 3MUZ1 4PV8A 3LS4H 5AVUB 3CLEH 4UUJA 1DSYA 4H7VA 3SN6N 5ICYA 3T8XB 4FCHA 4NQXB 2DW5A 4IOSA 1BZDA 4OCWL 4NRXA 2FGZA 2W9DH 1XVSA 3KCWA 1U8OA 1YDPB 3UYPA 4DVBA 4G1EB 3CZEA 3V6ZA 4F27A 4PJ8A 3BGMA 4G1EA 4JCWA 2PTVA 2Z9TA 4J5VA 1J8RA 2WQAA 4MSWB 2G0LA 5B22A 3N43B 1VESA 1IC7H 4PY8J 4IMKA 3X1BA 4FLSA 1WAEA 1KCRL 4Z3JA 3C5ZC 1KXTA 2D7MA 1U93A 3MJ9H 4DP1X 3LNFA 1S7UA 3R0NA 2MEJB 4PWJA 4RMUA 3ARBA 5F1KC 2OMXB 3G6AB 4H4NA 2YAMA 1X5LA 1O9WA 5ANMB 2WP3T 3TWCL 1EJOH 1CYGA 4G70B 5K93A 4NXSA 4OU3A 3OXRB 1ZAGA 5CN3A 5F96L 1DFBL 1YNTF 3ZE1B 5FECA 4PRIB 4OT1H 1RZPA 5I1JH 3IGFA 4UAHA 1GRWA 1KN4H 4XXCA 3M86A 4CL7A 3QWNA 2RQ8A 2AJVH 4BYHA 2VZVA 4EOWL 1PAZA 1OWRM 2J4WH 2Y69B 3ZRFC 4KHTL 1ND0B 3P2BA 3TA3D 3VTTA 2BNRD 3S5LG 5IBUB 1SDAB 2ZJSL 5B4MD 5FM4A 2VDLB 1O7VA 3KGTA 1X7QA 3L2MA 5DHVB 2F19L 4EI0A 4Q89A 3MBWB 3BPNB 2FT8A 3PRZA 2P5EA 3GHBL 1V5JA 5JYLA 4D8OA 2E86A 4PV9A 1JTPA 3P2TA 4G8FB 1BX2B 1JNLL 3BYYA 1MFBL 2DIAA 1N0LB 1PKOA 3VGBA 2BIQA 1ZK5A 4N26A 1ZD6A 3J07A 3KBPA 3HHRB 3WFHB 3DI3B 2IQAA 3AB0B 3FB8A 1CFQA 2PW2A 3RI5K 3D34A 4H0HB 5AAWA 5AKVA 1BZ7B 1PLBA 3O6LL 4NB7A 4OZHA 5E9DD 4QAWA 1N7MH 4BHUI 1X6LA 1L9MA 2F53E 3SHSA 3U4AA 3LKNB 2QGCA 5CZKA 5E5RB 2FBJH 2EEFA 3R7RA 3VX0A 4A2MA 4KUCD 4W6YB 5BNXD 2X88A 2FB4H 5DS8A 4ZZFA 2R39A 1K4DB 5DI8B 2YWZA 1BWMA 4JN1L 4G1MA 3RY5A 1QTSA 4XCEA 1AIFB 5MI0C 4Y4KD 4OY9A 5EOCH 1FL5A 2YR3A 3UTPD 1T7WA 4MNGB 2CBTA 1IQWL 2NY6B 2JIXB 4AKQA 4WTQA 2V5TA 2VM9A 1JZIA 5IBTL 3RVWC 2CM5A 1TQBC 4NQCD 3MN8A 4H1LB 1ADQL 4I5BA 5C3TA 4JG5A 4LASH 5KVFH 4I7ZC 1X5ZA 15C8H 1WO2A 2J43A 5AW7B 1F02I 2ZICA 4S10A 2CWRA 2Z8RA 4Y5YC 2R2BA 3QXTA 4X4MA 3Q8EA 4XNMB 4S11A 5I30H 3E9UA 1MG2C 4E5XG 1R3LB 3KPOA 1MRDH 3L3GA 3OAUH 1RVFL 2CM6A 3GRWH 3HG3A 2WZ6A 1DSFH 1I8IB 4KBPA 1H3GA 2DQIH 5EV7A 2EKSB 1P6FA 1MDTA 5I15L 1G7HB 4TSBL 3KW8A 1CD1B 1JZHA 2W88A 4OQTL 3V7MA 4DWHA 3FZUD 3WKQA 1ZT7A 3NJVA 2YAQA 3JWOH 3RILA 3OD3A 3ZL4H 3MROB 4XMTA 3KR3H 2A5UA 3DHJA 1HH6B 1SFDA 2ATPA 3APMA 4XCYA 4PJ8D 5L0QB 1QAWA 4KKQA 1SJMA 1EBAA 3WGUB 5GZOA 1SEQH 1Q9LB 5A7BA 3L5WB 4TVSa 3RTQA 1RY7B 5F7DB 3X1FA 2X1PA 2A0LC 4IU2A 2PO6B 3ZDWA 3IETA 2V9TA 3CLFL 4ZNCD 1P6AB 3FCSB 5DHDA 4GG6A 4E9WA 1K85A 1G6RA 1XCXA 3LPPA 4BV1A 1T1YB 4JPWL 3WEAA 1HKFA 4QRRB 4OLYH 2EYSB 5DDHB 1HILB 4DAGH 4HIJB 5I1EL 3BGFB 3BWZA 2BNRE 4FFZA 2AQ1A 3OAZH 4CILA 2A38A 3VQ2C 4Y4FA 4BIKA 1FHGA 1JHTA 2WXHA 3MXWH 3VWJB 1H8LA 1NGZA 3HIZA 4M6OH 2FBOJ 5K9OB 2H0PA 3VTMA 3N85H 2XETA 4LDOB 1KFAL 1I3RA 1I9RH 4AK2A 5JXEC 2N7BA 1C1EH 4TUOB 1MFCH 3BZFB 3CH1B 3QNFA 5KVGE 1K3ZA 2VQUA 1I8MA 4I0PD 2Z7UA 1YAIA 5EO9B 1KGUA 3ZZSA 2G4EA 1OE2A 3P4NA 4N8CH 4CU6A 3KPSE 4P05A 1MDAA 2E74C 3EGSB 5E9DE 1C16B 3OJDA 3U0TA 3H3PH 4F91B 4EIZC 3PY9A 5DJ8B 4E5XA 1NAMB 1J8HE 2A73B 5FKPB 3MLRL 3O4LA 3OKYA 4XMPH 4KC3B 3ISWA 3LX9A 1A64A 5CINL 2JK5B 3WSQL 5J1TC 1DO5A 2RD0A 2YQBA 4FEIA 4IU3A 4YK4B 5LBGA 5T3ZL 4JUTA 5I0VA 2GVYA 2XXMB 3P1VA 4QRPE 1R3JB 4XP4L 5EU6B 3O3AB 4ZZKA 2APFA 2X5PA 4HUWA 4KQ0A 4RGNE 1FYTE 4OAWA 4ZTEA 1KENH 1CLZH 1OGSA 2QR0A 3OBAA 1RJYB 5FYJL 2WW8A 4XO4A 5GRUL 2GABA 1U8JB 4BSWB 1RJYA 1AQHA 1U8CA 4QMEA 3MV7D 3ZE1F 3OG6B 3NZ8B 5T1KB 2GI7A 1XDTT 3KPRE 5TDNB 1RZKC 4P2QA 1RZJC 3QRLA 1YN7B 5IW1A 2WOBA 5F1IB 2DQUH 5KBLA 4NI6A 2A6KB 2VO5A 1ZE3H 3AU1B 5JIPA 4PP2B 1LO5B 3NJMA 4K8RC 1EXUA 4FMFA 2WC7A 3O9WC 4D9RD 3CSBA 1FFTB 3SGKC 2UYLA 3LXBA 2VXQA 1Q9WB 3VFNA 1Q90A 3CIAA 5K39B 2WKOA 2XTJC 2ZXAA 3D39D 4NLAA 1DBML 5FO7A 2X4PA 1MELA 3ABKB 2BCKA 4QGTA 2W92A 2VXVH 3LXUX 4JN2A 4L9LB 4PY8I 3NH7H 5E4AA 2EH8L 2FHFA 2I60L 4WUUB 4CVXB 4E9TA 2EYRB 5FHBL 1VA9A 2BNUA 5JW4M 4JM2F 1QSFE 1U3ZA 2WJ7A 1JPFB 4DCQB 4CKQA 1IVTA 4LHUA 2Y7MA 5ILTH 2MOQA 2EUZA 4UDTB 1UWGL 1ZT4B 2O5XL 3GMMB 3W3BA 3L6FA 1I3VA 1W8OA 4DOHE 1AHKA 1QSEE 5CJ5A 2F19H 2O30A 3B5HA 5IJVA 1W6LA 3HFMH 4N0UE 1XGPA 1UEYA 4MX7B 1MWAL 5EA0L 3S96B 4R3SA 4P59L 4FTVD 3JXAA 4B96A 4AYFA 5C0CB 4RFEB 4HU2A 3FU9A 1HHKA 1OP9A 1VIWA 3F85A 3GDCA 3FFOA 4LSUH 5LCVL 3BZ5A 4E9LA 2CHDA 2Q3ZA 4DPAX 1UURA 4JRXE 3KLAA 2NLJA 3QIWA 2BY3A 2ZT9C 3CK0L 5TFSL 2ARWA 4OZGB 4QRRE 3I9GH 3ZYZA 1H5BA 1F4AA 3AROA 1JWMA 3LKSB 5I76A 4AMKH 3RTQC 2FO4B 1LE5A 1P9MA 1LO0H 4W4OC 2EUWA 3VGGA 3HR5B 5L8KB 3QUKB 2OS7A 4YPGA 5ACZB 4F57L 3O3EB 4PN6A 3EAKA 1E27A 5E6IA 5KTEH 4EZJA 4LCWB 4UQAA 5EU7E 5GHWH 3TWYA 3ECBA 2FZ3B 3QUXC 2DAVA 3NT0A 4JFEA 5DZ9A 4HV8B 1GYWA 3LQAC 2VGLM 4Y5VA 3MBWA 4PREA 1BWWA 2D9CA 5I6OA 1O6TA 5JHLA 2VDMH 4M6NH 5CSZA 2ZQKA 1TEFA 2YN5A 1TFHA 4O02L 4P07A 4YC2C 4WU5A 3PL6A 1VZGA 4YDKH 2BZCA 2JKRM 5ICUA 2CO1A 3L9RA 2IPUG 2J8UB 2BVEA 1CXEA 2YFOA 4JFEE 2H3NB 2H26A 3J8F7 2E27H 4Y5YA 4NIKB 4XAKD 1PZ5B 4N2BA 4KI5F 3KM1A 4A6YB 2L7EA 3OGOE 5AVWB 2ZP8A 4ZMNA 2XZAL 2E46A 2F9BT 2OBGA 4MCYA 4N87A 4DW2L 1WK0A 3DYOA 4TPRH 3VSUA 1G9MH 5CCHE 2Y1ZA 1KN2L 2XY1A 4H1LH 4N90E 4NO5B 5A2AA 2A99A 3VXUE 3Q8FA 2EVIA 4OD2A 4XMUA 1TSHA 2VR7A 4LKCA 1NICA 4Z7VA 2FBRA 3EGDB 2WO4A 4PRID 3WTYA 1AO7A 4QT5B 5C0IB 5IK3A 2ORBH 5ALCL 4N1EA 4LLMB 4YR6B 2DZEA 5EFIA 2FR4B 5D6CA 5EEUA 3B9VA 4U3XA 3OWEA 5DJ6B 4QTIL 3WY3A 1SMDA 3FN9A 4HCGA 2AC0A 4AEHH 4MMXC 4PJIE 4WHCA 2XWXA 2GUOB 4CN4A 3WFCH 2YKLL 2IDTA 4X0NA 2AKRA 1M6OA 1KYOK 5FXCH 5IROA 1SBSL 4QXUH 3SE4A 1KGWA 1LDPH 5JLZA 3D85B 1CPUA 2OMVB 1ZANH 4K0OA 3LKQA 2EDLA 4FKKA 2XTJE 4JFSA 4PJGB 2NT0A 3WJMB 1J10A 4ZTOL 2FQGA 5INDA 3RVXD 2VTFA 1OF2A 3UG3A 1TJGL 4JFFD 3P3RA 1G9HA 3O2VL 1QTPA 2J1WA 2XPGA 4HQQH 4FG2A 3LXCA 4QNPE 4ZMVA 2HG5A 4XE0A 4G7VH 3BAYA 1WFNA 2AQPA 1J7VR 1MFMA 3J2PA 5E00B 1M53A 1IL1B 4IRJD 4L8BA 4HAGA 4X5XA 4TNFA 3BHBA 3CN2A 1XMWA 4P5TC 4N28A 3BE1H 4BQ9A 5CSGA 4Y16D 4CSZA 1XFPA 4D9QD 1I7RB 2G2RB 2GSIA 3T0WA 1UCBL 5DUJA 2DJ4A 1NMBH 2C9RA 2HJLA 3ESPA 5F0MB 2K9FB 4L2LA 5K9KB 4XP9H 2WLMA 1DSFL 3MBXH 3QCUH 2J2ZA 3GO1L 4HLZH 1BBJB 4JO8A 1MZZA 1UGNA 4RWYH 4IGBB 2A6DB 4FYSA 2FSEB 3H7BA 3QG6B 4XBEH 3ZKXC 3HS8A 3KVQA 4PGEB 5D70L 5TGBB 5C0JB 3PP3K 4F1ZA 1GHFL 1LMKA 2IOIA 3SPCA 4P2OD 5BV7L 1ZLSH 4JFFA 1M05B 2ZX8A 3ZR5A 1ZEAL 4J4PC 5KVDL 2DJMA 3GB7A 3PDOA 4X4YA 1HL5A 3HZVA 3S35X 2RALA 4JGMA 4DVRL 4MQTB 4A7GF 4S2SB 2IFFL 3L8QA 1NBYA 1HNYA 1UOWA 4PJXF 2F8XC 5E6ID 2F5AH 3IMRA 3W0WE 5F3BB 1UCBH 4IRJC 4PRDA 3TBWB 4D9LH 3UYRL 3G08B 2E7MA 2YN3A 1ES0A 2JJWA 4BCZA 3I84A 4Y16C 5CCGE 1TQBB 4LCYA 4N2IA 4AQZA 4JM2B 1U8LA 2ZOLB 3FRPG 4MXWL 2ITDB 3GDBA 1U8LB 2ZOLA 3QPXH 4PWFA 3BDYH 5EZPA 1AH1A 4QRUA 1U8QA 3MI6A 1QW9A 3WY1A 4C83A 1G7PA 1P0SE 2XWTA 3I85A 2WINA 3N44B 2WZAA 4WNSA 5LXVA 2VLKB 1E6OH 3CSFA 1SDDA 3QORB 1LO3H 2VLKA 4IS6B 2Q7AA 3ESOA 3FL7A 5AAWC 1TZGH 4HUWB 4KMLB 1LWHA 1N68A 4HVBA 1G7MA 2TRHA 4M02A 3S88L 1MY7A 3PJLA 4AV5A 1IFGA 2FEEL 1WG3A 3SDCB 4FQXA 1TJHL 2YSTA 4ELDA 2ZPKH 3ZU8A 1WEJH 1G5AA 2NY5L 1P5UB 1A4JA 4XBMA 2X3AA 2LOEA 3RAJH 3CU1A 3MRFB 3H9ZA 3EOAA 4BFOA 2V7NB 4A6YL 3MV9B 4FCAA 5D5ME 3QWQB 5CJOL 4NDMB 4L3AA 5IFAH 3TURA 2ZCKL 1LK2A 3D3VB 3DROB 1TVHA 2ESVE 4ZUVA 1PKQA 4N2OA 3IXAB 4XVUD 5D1ZB 4LSSH 4QOKA 5KTEL 5EULV 1WWBX 2XKUA 5DJZB 4LCCA 4P46D 1ZVNA 2AQQA 1EIBA 4H1LG 4Y9GA 1RK7A 2M83A 3QH3A 3UTTB 4CAGA 5LLIC 4ANXA 3ZKSD 4OZIF 3QIWC 3A24A 4QHUA 4PJ5D 4PGBA 5HI4D 5KYNA 1DQLH 1AR2A 4PUBL 4QF1A 4DETA 4S1QL 2LVEA 1QBLL 1CK0H 3NSCA 2D7PA 5IFJB 4CVXA 1A14H 5DRXB 1IGCH 3M07A 5MEQB 4GSUA 3C9NB 3FH8A 3BGFC 3QI9A 3NFSL 3I02B 1TF4A 4PJIB 3HW7A 5CP7A 2FQEA 1DFXA 1PFOA 2F8IA 4BQBA 3NABL 2DL9A 5C0NC 3V8OA 4Q6KA 3MJ7B 1T4KA 2JQZA 2PPEA 4D9QE 4Z5RB 3D50A 3D9AL 4IMKC 4DKAA 5DRNA 1ULVA 4IKNA 4YIQB 1D5BA 5D1ZD 5IVXE 1F3JA 4U7MA 3WFDL 3ZQWA 3WDHA 4WTXA 1OAKH 2O5XH 4YHYC 1GC1H 1DL7L 2AK4D 5T3XE 4MD5B 5H37G 4P3DB 4NWTH 3B5GA 2K3HA 3DRQB 1DVQA 1PIGA 5F3HA 5A3IC 4XI5D 1RI8A 3VGAC 2D3NA 4PRIE 1K2DA 2G9HB 3PP4H 1PJ9A 3FB8B 4TULH 5DMGD 1MHPL 4IMLA 1P7HL 5J0BA 5AVTB 2CKNA 4EUPA 1I8IA 5E99H 3U7YL 4KWUA 4HPYH 1M1SA 4K3DL 4EPSA 3RTLA 3HS0B 4DKDC 3OKDB 4Y2DD 2B9AA 4XRCA 1KB5L 5TPWL 4APQB 1U8OB 1YDPA 2COQA 4V2CB 2QQKL 2XZZA 2P52A 4PH8A 4KZEH 5EU3A 1M7DA 2Q76A 4LCWD 3T6WA 3DNKA 1W6WA 2Q8AL 3VD2A 3X17A 3HE6D 4PJEF 3P9MA 5DZJA 1HHGB 3KW7A 3ZSSA 4BRVA 4NERA 1VGKA 2X1QA 1CICD 4WW2F 5DC0A 1BZ9B 2Y1AA 3QR1A 1BIIA 1VZHA 1Q9OB 2C7UB 1CZ8L 3GJEA 4ZS6C 5KVMC 1VFBA 3TJHC 4L8CB 4GP8B 4XVJL 5INCB 3UAJC 3VDBA 2D3JA 3V9EA 3HNTH 3D4CA 3G5WA 5D7JB 3DBXA 3SO3C 4IBWA 1J9CT 2RACA 1UA6H 4JFDE 3T0AA 3VFOB 1MREL 4UT6A 2CU9A 1E8YA 2W9EL 1BIHA 4KVCH 4GG8A 4G8GB 1ZA6B 3D69A 4L4TE 4GIOA 4ZOCA 4X5RA 1X4ZA 5LGKA 4WY7H 4Z0XB 1E27B 2CUHA 4FQLH 3W39B 3K72B 3B3IB 2H6PB 3LH9A 2ADGB 5I23A 5FDWA 1BLNB 2BIMA 2IMMA 1S5HA 1EAQA 3LH8A 1G7JB 4PRAA 1KB3A 3C12A 3A47A 3CFCL 4L3EA 3PHQA 4U05A 1P9MC 2EO7A 2ZSWB 1MHCA 1BVNT 5ISZD 5DLML 2V2WB 3DI2B 3PWPE 2VDQB 4GW4B 3JWOC 4DKFL 1CLVA 2XN0A 5D1QB 4X6FB 3SPJA 1RLWA 2IADA 3Q9QA 3P4NB 1RP9A 2IPUK 3EZ8A 3GK8L 4HBCL 2APXA 3INOA 3HOGA 3OV6A 3WUZA 4O5LL 3U4KA 1T1ZB 3WFHA 5E2JA 5JQIB 1O6SB 3W1ZA 3VFUA 1PZ3A 3SB3A 4NJ9L 3ZDYF 4LB8A 3D3VE 1MVYA 2FK9A 4LARL 1HE8A 2YKLH 4RVBA 4EUPG 4Z7IA 4B9JA 5I6NA 2HKHL 3KXFB 2VW6A 1GYAA 4OZIB 3VFWA 1CUOA 5ES4B 3VGDA 4D94A 3REVA 4DGVH 5IROC 4PRPB 5A43C 5KAQG 1JZ4A 3QUYD 2ZUYA 1RMFH 2MH4A 3CFJB 3BWAA 3DUUA 1SLWA 1R5IA 2N7AA 1GW6A 3INUL 5ALCH 1OCWH 1OAQL 1KLFB 1OGAA 3DX4A 4JB9L 1QLFA 3OJ2C 2DWTA 2R7EA 3CN3A 4KUCF 2YEZB 4PG2C 2R27A 3ASOB 4YE0A 3GKWL 3DGDA 5FDYA 1FAIL 2BWIA 1YMMB 4G7QB 5ESQB 4OFPA 3PAUA 1YN6A 5E8PA 5T1MB 3VUAA 2X0WA 2G9KA 2E4FA 3LIUA 3PUCA 1X5YA 3CLEL 3S88H 5JIHA 1KDIA 2GEEA 2EDBA 4F8NA 4PWKA 4IOSD 1YEKL 4YC2B 2M26A 3N42B 5F7KC 2WNXA 3MMEB 1JE6A 1HZLA 4RZCA 2C4FT 1IC4L 4IRSD 2XA8L 1N8ZA 4UNIA 3TBCA 1NIEA 1DYZA 2R59A 3KEHA 2BCKB 4HJGB 4A66A 2VDML 1ZMYA 2LAGB 2MIZA 2VXTH 4LOUD 3MXWL 4XXWC 5IHHA 1NLDL 1S7QA 4LGSB 4CVZB 5DZLA 3L1OH 4AYEC 4LRIC 1IE4A 3CZKA 3MJ9L 1CU4H 4QRPB 4JHAH 2VN3A 2ICWI 3PAVA 1AXTL 3F3HA 5JW5A 4M1GH 4WI0B 2BSTA 3SCMD 3GXNA 2VWEE 1XIWB 1JUFB 1DQTA 2WQXA 1BBDL 4B95C 3CDYA 1KLGA 2FX8H 3V0IA 1MLBB 3F12A 5HD8D 5I19L 4JHVA 1QI4A 3AS3A 4NPKA 4HCRL 5TDOB 1LGVA 3B2XA 2XQBH 3GMOB 3VAEA 3VFRB 2A4CA 2JIXD 5D71H 4Y4KC 5C0AD 3N44F 3B7UX 4WY7L 3MRNB 1BMGA 4F8QA 4LEXH 4PRHE 3RNQA 3OG4B 2QV4A 1IQDB 1WBXB 5DWUH 3JWNH 1S3KL 1Q1JL 1KIQA 1E2WA 1UFUA 3UZEA 3T08A 1IBZA 4NNYA 4XPGL 5EZLB 1SJHA 2JKTM 2HFFB 2V9RA 1JZ2A 1P1ZA 1F11A 2NNAB 2Q87A 1UA6L 2WPGA 3WO4B 1JV5B 3NA9L 4M6AA 2D31A 2F5AL 4E42B 3P4MB 4Z78A 5I1IL 1FIEA 3TH4T 2GK0B 4J4PD 2BCMA 4I4WA 1F58H 2W0PA 2P4AB 3FRUB 3EYOB 3PQYA 4TVUA 1YEIL 2FX7L 4X8GA 1QSEA 2VE6B 5D4IA 2X12A 3EYOA 3FT1A 3PQYB 4LCIL 5EIVA 4OZIE 1J0YA 1A7OL 5KOMC 1UH3A 1ZWIA 4ODBD 4R3SB 3F58H 3SJVD 1RZKL 3MCLH 2JLLA 4N2FA 3ES6A 1TJGH 5C0CA 3KYOB 5K5YA 1RULL 4HWUA 2NX5A 4ABQA 1I1AC 1H6UA 3EXJA 3QWRA 2EZ0C 3LN4A 3BEWA 1IBBA 1Z9SA 4ZMWA 1I3GH 1WZ1L 4HD9A 4MA8L 1SYVB 4U1IA 4ZXBB 5T1KD 2HWZL 1ITBB 1Q8MA 5E2TH 1QSVA 3RVWD 1EZVY 5DRXA 3GBEA 4BKLB 3B6SB 3LAFA 3R06A 1S9YB 1MFDH 3IMSA 4ONGL 3O8XA 3QS3A 3O3AA 5I5RA 3N91A 3VCLB 2YMXH 3T6QC 4UOQA 1VKXB 1DJIA 3NZUA 3PWLB 4WQOA 1LEKA 4KO9A 3KH4A 2OJZH 2OR7A 4FNQA 2VO8A 3EBAA 4NCC1 5IR1A 4B0MM 4OD2B 2ZXGA 3MJ7A 2HT4C 1A9EA 4L1LA 1F3DJ 1WT5A 2CGYA 4YHIB 1PEWA 5L4IA 3TTYA 3RNKA 2CO6B 4JL1A 5DS2A 1QBAA 1Y1DA 3IDYC 3RWGA 1EUUA 1J11A 4X5LA 4J1UB 1QNZL 1WICA 1WWAX 3KWTA 4WI7A 3F2LA 1HQ4A 5CEZE 4P49A 5FO9A 4GAYB 2A6KA 4GSDH 5LWYH 1BAWA 1E9OB 4UT6H 4FA8A 1EAJA 4ESKA 3GBML 5DJYB 5HYSA 3RWHB 3JWDH 2DEXX 4LSPH 4J3WA 4Y16B 2JTDA 1HHJB 3L9YA 3WS6C 1BHGA 5HJGA 4PCKA 3SSGA 1CGSH 2FL5A 5LN8A 1T21A 2BSCA 1TTBA 2A6IB 4XCNB 4YEFA 4JPIA 1HCYA 2RIKA 4K7FB 4KO6A 5ERWB 5K9QG 4K7FA 4QRBA 5ISZE 3QO1B 5AW0B 2K45A 3BQUD 3UGXA 2DMGA 4EOWH 3OC8A 1IBYA 3QYCA 4ZUUA 3TFKD 2FIKA 1EEUA 4AQ1A 2ROXA 4HF5H 4FQPA 3SDYH 3HS9A 5KVEE 3C6LA 1EEZA 1UJ3C 5L2KE 1MCDA 2F18A 3LHAA 1X9RA 3D3VD 2XWBA 1WC7B 4I1RA 3VWKC 1SGKA 1K6QL 3TN0A 4NQCE 3ARDC 3TZVC 4HXBH 2NTFB 4NZUL 4OJYA 4M7KL 5IOKA 1ICTA 4X5XB 2B39A 1BW8A 3S36H 3ML9A 1DQQA 5E6ZA 3W2DH 4WUKH 4JGUA 2X9XA 2IGLA 2F74A 1EAPA 1S5IL 3L3JA 4R97C 4AENA 4IRSA 2C3VB 3FYIB 2LR4A 3OR6B 5LBSH 3MZGB 2WYZA 2XLLA 2E27L 4A2DA 2J6EL 1B6DA 1U8IB 3NGBB 2DQGH 2DIBA 2NUPA 3V7AE 1HOCA 2B1AL 1BVKB 3I9PA 1RK1A 3LDBC 2VXSL 5GIRA 4C4UA 5JIMA 4EMZA 3V0EA 3U25A 4PJGA 3FU7A 1GTFA 1TXKA 4JQIH 4G8GD 1RAMA 3GZKA 1BAFH 5TDPA 3LKPA 5GZNC 3OHXB 1IJ9A 4DIXA 2PW1A 4K5MA 4F5CA 5EEYA 1TEYA 4G7YH 3DX6B 4Y88A 4GEIA 2CJTA 4YSPA 3UTZB 5EOQH 2ZZUT 3T6ZA 3OKOA 4EN2A 1RV6X 2AABL 1FF5A 4PWGA 1EUTA 1GZHA 3QJQB 3NN8B 5DJAB 2OXHA 5D1QA 3QXAB 4P23A 2IFFH 4PGJA 4YHYB 1KJVA 3CFKB 4XNQA 4CKVX 2HAZA 2GTWB 1JNHB 2AQ2A 4ORGA 2JWYA 4OZGF 5KS9B 4K94H 1XGQB 5FPIA 3SJVA 2ZXEB 1SF5A 3ISYA 1LO0L 3BIKA 3JWNE 4I48B 4LPUA 4X4ME 2WZ0A 5FUCE