2DQDH

Crystal structure of hyhel-10 fv mutant (hy50f) complexed with hen egg lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGFVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqdH00
4XAKD 1CVRA 4BH7A 4X4MA 2EYSA 1J0JA 4I4WB 3UXFA 1OW0A 3RVXD 4LCWE 1HQ4B 5BS0D 1DE4B 3VXRE 3LKQA 2YPLE 3NTCL 5CWSA 4X9GA 1PKQB 4GXVH 3T0AA 2V2XB 2J4WL 3UTQA 1IFHL 1GGCH 3UMTA 3HAEA 4KZEL 32C2A 4PJBB 4NRYA 4AIZB 1HCFX 1CK0H 1QKZH 4NM8L 5CINH 3B2UC 1EEZB 4L8BA 4NOBA 1LO4H 2XFXA 1BZ9A 5KVGH 1CDBA 3T1WA 2ITDA 1XF4B 4JPIA 4R7NB 3MUJA 1QSFB 4MSWA 4ZFOL 2D9QB 1EFXB 3IDUA 3IDMA 2BNUB 2YEZA 2PR4L 5FGCE 2R8SL 4XP1H 1S7WA 4PJDA 3UTPE 1NGXB 1TZHB 3QXDA 2GSGA 4HSQA 3TIDB 1CFBA 3MRGB 2R1XB 1NFDA 3EYFA 1MI5D 1WVZA 5D5MF 3GMRA 1CICB 1FN4A 1I9JL 1QPXA 5C6PB 3MRKA 3EFFA 4JQXC 3DTXA 4H25A 4S10A 2HTLD 5L0QC 1LD9B 1YNLH 4P2QA 1JP5A 4WI2A 2CR3A 3JWNC 2V7HB 1PX4A 4JO3L 5C86A 5J7CC 1VPOH 5LAXB 4HG4J 2JCCA 2FD6L 4M8VA 3UTSE 2XKSA 4JY5L 3AY4C 5I1AA 5BO1L 3UJIH 1JJUA 4JFYA 1G7MB 1VHPA 4OM0L 5GISH 4OZ4A 3RVTD 4L9LA 5HHMB 3D9AH 3S6CA 3CLFH 4X6CB 4I9WE 2AEWA 2AJSH 1NFIB 3BMVA 4PLJD 3SPVB 3AS3A 4K07A 3K0WA 3L3JB 3ZSSA 3HG1E 5EG6C 1V7ML 2VMFA 2X4NA 5HDQH 5FF6A 3KPOB 3Q2CA 4FRWA 3L9RB 2G9HB 4NT6A 5IMLB 4U1SB 2FYYB 4G5ZH 1W72L 4XMLH 4WWKD 2F5BH 4M7LT 3LQAC 4XP6H 3HNSL 4GG6B 4LSQH 2OR7A 1P4BH 5L2KE 1RK0A 3JTTB 1W0VB 2NTSP 3ZHLA 3VI3E 3BP7B 3WYRA 1KCSH 4UILH 4OQ1A 5EFIB 3U2SA 2CLVA 4XPAH 2F54D 2JF1A 1OAKL 1UWXK 3KJ6H 4WTZG 2NX5D 5GRWA 1T7YA 4HS8L 4AMKL 5HPOA 4HD9A 2UZIL 1UCBH 3V6FA 2LU4A 3EJYD 3MBEC 2R2EB 4PJ5A 5DFVC 4OLXL 2ZOLA 3NCEB 4WRLA 1P6AB 3MO1A 2BCKA 3FB7A 5DMKB 1RAMA 2W91A 5FUCC 1TDQA 4LAJH 1KPVB 1UM5L 2HFGL 5J9PB 5CJQL 1CXIA 1ZANL 1N59A 4ZO6A 2LU3A 4TULL 3GMLA 4PBVC 1GOGA 4ALAH 5JW4N 3GFUA 1KG0A 5HHQB 3LKRA 5TF1L 1UKQA 3ZKSD 1A9EB 2I26N 2PYED 3KYAA 4KXZH 3HI6H 4O5LL 4JFDB 4FQCL 1EVTC 4F58L 4L4TB 4JQIL 2CKBB 1WIOA 5F70A 2CGRH 1T22A 2NY3B 1YEIL 1BBJB 3STBA 1JMZA 2JK5A 3S88H 3TO4C 5E6ZA 1JGVH 1A0QL 2NY0D 4Y5VB 3DRTA 1WFTA 4WDIB 5EIIA 3RVWC 3OX8A 2ZPKH 3ZKQD 4KI5C 3TYGH 5GRUL 3TNMA 3NIDE 3WJJA 4KV5E 1CGUA 4I13B 5CLTA 1OAXL 1I4FA 4YXLH 4XHJC 4V1DE 1P7QB 35C8H 3EKCA 1Q9KB 2XRAH 3Q6GH 5IMKA 1SQ2N 3WFEL 3MCLH 1F4WL 3QO0B 4PJIE 4YDVA 2Y4SA 3G5VA 3V7AG 4KQ4H 4BSJA 4Z77B 4G9FE 4R7DB 1MCLA 4JG1H 4DN3H 3O41B 5IVXE 4XP5L 3C5SB 2NLJB 3GB7B 5DO2C 5CP7A 2Q6WA 1KB5H 2DB8A 4IDJL 5ERWA 4JHBA 3UBXB 2HVKB 2PXYA 4AT6B 1RULH 5C71A 1DBJL 2FL5A 1RK1B 1NUFA 2FX8L 3E6FB 3SOBH 4GMTH 5F7KC 4KMLB 2P7TB 4LAQH 3QUYA 4XC3H 3HE7B 4XH2B 2NYYD 1LGVA 2DQJH 1EMTL 4H1LA 3W11C 2X4QA 1T1XA 3NACH 1MJJA 5F7WC 1U36A 2DBLH 2OXGA 3NA9L 4NOFA 5GSRB 3X11A 3FQTB 4FFWD 4AH2A 3PWPA 4X99B 1LILA 4TQEH 3O2DH 1BD2D 4JFHE 3UZEA 4QKXB 4BUGA 4AG4H 1VEPA 1S8DB 4ZO8A 3SGJC 4P46A 5C0BE 1U8KB 2OMBA 3RL1B 4KTDH 1TJGL 4JKKA 1KB9K 5HYFA 4QXTA 1N6QL 1M7IB 3OXSA 4YK4B 5I1IL 3PNWB 4Y4HD 3U0PA 5I15L 5L9DL 3MOAH 4L1DA 3CUPB 4P2OA 3BPOC 1FFRA 3O2WH 4X6DF 3SDYL 1QLRB 5HD8D 4S1DC 1YEKL 2QHLA 4X6FB 2A6IA 1NCDL 1I9IL 4JANB 5JIHA 3TP4A 4LCUB 1CFQB 3VXRA 2ESVE 2YPLA 4JFPA 3RZCD 3GK8H 1H3WM 3X17A 4R97B 3SCMA 3KHOA 4IRJC 4XC1H 5F7DB 3TCXA 3WDJA 1FORL 4Q9CA 1UZ6F 4JFXB 2NXZD 2AABH 3OAYK 3BH8A 1SY6H 4NQSA 1MQ8A 5K59E 4RBPK 5EZJA 3WMSA 4LLQB 2HFFA 1JUFA 5I1KL 5D96B 4BFGA 3FL7A 2MNUA 3BPNB 3GIVA 4XGZB 1J0ZA 2AGJH 5H35B 3PV7A 5E08H 4L8SB 3W0WD 4PR5B 5FV2A 4NZDA 2FECL 1KELL 1ACYL 4LDOB 3HNVL 1SMAA 2F5AH 1WFUA 1ADQL 4YJZL 1U3HC 2R2HA 4KKCD 1XGQB 1H8SA 1ZA3A 1FE8L 4MMZC 2GCYA 2HMIC 3VRJB 1AGDB 2J6EL 3QISA 3J7HA 3VGGA 3GMQB 3UC0H 3CC5A 4OGXH 5J13C 2R1YA 4M61A 4QTHA 1CU4L 3QUZA 3DUUA 5DD3H 1EHLH 3WO4C 4Z0BL 3MCKA 1ZLUK 1NDMA 5D8JH 2JJUA 4PJ8A 3S36H 4X9BA 3O8XB 3UTSA 3MXWL 3QIUA 1NBZB 3RIAK 1JPST 3I2CH 3BDBA 1G7IB 4A6YB 1CDHA 5HGHB 1FFNB 5J4MA 1FC1A 4HUNB 1VGEL 2JB6A 1PVHA 1FZMB 3P73A 1IKFH 1KCLA 4I0PD 5F3HB 2AJZB 1W0WB 3T3PE 4KKBD 3F7YB 2HFEA 2VLKD 3H6JA 2GT9A 4G8GE 3BRFA 5F97E 5DJXA 4LFHG 3L3HB 2V2TB 1HQRB 4XVTH 3SEPA 2D03L 3C5ZC 4DCQB 3LN5A 3SKJL 1A7NL 2R4RL 3QI9A 3RDTB 4ZDHB 3T8XA 3E2HC 4K2UH 2ZZUT 1XMWA 5L2KA 4ODXB 5GRYA 3U82B 3WNLA 1FAIL 2BVEA 3B2VH 1G1YA 2Y06H 3SDAD 2VYRE 3FTGB 4M93B 1UYWH 2O26U 4XP9L 1ZWIB 5T5FH 1GCFA 4MXWL 1G7PB 2FJHA 4F37F 1PW3A 2H6PB 5HHVL 1A3RH 5A16A 3OAZK 1IRAY 3SDDD 1F58L 4OCRL 4P3WA 1R3HB 4WTWA 4MXVE 3T0EE 1P9MA 4XVJL 3TBVB 1JE6A 3OKMA 3ULUF 2CXGA 1HINH 4EN3D 4OZGB 3BUYB 3OR6B 1OSZA 4Y1AD 1KJ2A 3BGAA 3O6ML 1BVLB 3UJJL 2ZWLT 5ESQA 3G5YB 1EAPB 4FS0A 3LQAH 5KOVC 3FAWA 4O2FA 1DCLA 5C08B 3BP4A 1DQLH 4GXUM 5FUZL 2OJEB 2W92A 1RIUH 4YEFA 5GS0D 1LDSA 4YHZH 4WY7L 2QSCH 5SV3A 3RWCA 3SO5A 2DKUA 5GSVB 3KXFE 4PJXF 5FGSA 4FQIL 4RZCB 5TDNB 3ZL4H 2AK1L 3UPRB 2Q76B 2X89D 3RJQB 4AZ8A 2FJGA 3VXOB 3MXVL 1EO8H 1PQZB 1AD0B 1KSRA 5F6IC 3T0WA 1BLNA 2GK2A 1FAKT 2Z9TA 3VU2A 2CMRH 4MDIB 2RBLA 3OF6D 5DUMH 5IMMB 1BAFL 1ORSA 2QQNH 2H26B 4LOUC 2Y9RT 3VW3L 5BJTA 3GHBL 2CKBL 4LRNH 4V1DA 1F4HA 5HYQB 4HUXB 5I8KL 1JYWA 2XKNA 3T2OA 1X5KA 3GMPA 1M1SA 1BECA 3CJJA 4PJIA 4S1SH 1H5BB 4G9FA 3CGTA 1S7TB 1T0MB 3OKYA 4XNYL 2YN5A 4PP2B 5IVXA 3C09C 4KDTC 4MD4A 5JXEA 4YHNA 3MLUH 1Q94B 4DWHA 5HHPA 1OARH 5DJYA 3IGAB 1KTDA 3GSUB 5GZND 1JTPA 3BZ4A 4Q2ZB 1E6JH 4YHLL 5DK2A 3SBWC 1KC5H 2DQCL 5DGQA 2JELL 1VACB 3TBTB 2E27H 4ACPA 3MACH 5F7EH 1G0XA 2EO9A 3P0VL 1DBMH 4LHUA 2W9LA 3MQIA 5L8KB 3HMWL 5EBLA 1I85A 1FH5L 2EDWA 3QWRD 4YEEA 1CYGA 1JYVA 3JVGC 3QNZA 1MCRA 5IB5A 3K2UH 5E8EB 3SJVD 3PV6A 1INEL 3ZE2F 5J06A 3MNWA 2VLRE 4ZYKA 4OGAD 5FYKU 2BSRA 2D4DA 3ARBC 5HDBF 1HNGA 3WIFB 2AEQL 5EU7C 2WWMC 1Y0LB 5E6YA 2EDNA 2XY1A 2MQ0A 5ID0B 1MVUA 2RQ8A 3MV8E 3S35X 2X4UB 5C0BA 2WIIB 5BZWB 4UBDD 1CBVH 1QOKA 3HLAA 4PLKC 5CHNA 1MIEL 1U93B 2B5IC 4QTIH 3UBXG 3ALWA 1OPGL 5JHDD 4WO4B 3MRNB 4UZGA 4D9RE 4ENED 4PGBB 1V8HA 3D85B 5I1HL 3HZYB 5IOPB 1IGFL 3TO2A 4QCIA 4NYLA 1OSPH 4JFZL 1D6VL 2ESVA 3R06A 1WIUA 5KSAD 3TESA 4CJ0A 3VRLF 2MHAB 3V5DA 2YD8A 2Z8SA 3GBLA 3DX6A 4HKZB 3FO2A 1BOGA 5E00B 4M5YH 3QHFH 1KCUL 5SWZD 4EDWH 2QV2A 4ZS7L 1RJZB 1IT9H 1W72A 5DDHA 2J5LB 3G6JF 4G8FA 4D9QE 1R0AH 2HJFA 1JRHH 3FZUD 3KLHD 4OBRA 4OZIB 5E94A 5C9JB 4X6CE 5DEGB 5IGXL 2B4CL 1MH5B 5TDOA 4Z7NF 3IU4L 1FNLA 4XPHH 3C60A 3JV5A 4YBQC 2EDBA 1X3DA 4BQCA 4CGTA 5LXGH 5ESAB 4OLZL 3IJSA 2CDFB 5DFWH 3QZWB 4JREC 3A6BH 1XAUA 5C3LD 3PL6B 3VXQA 3ILPA 1YJDL 5ID1B 4GG6E 4NM4H 1FG2A 3LPGA 5F9WC 5KAQG 4MWFB 5CJXA 3WBDA 2NY1C 5GJSH 4PRNA 5MEQB 5EOQH 1FYTA 2VC2H 1NEZG 3UZQA 3S34L 4PB9H 4LGRB 1XZ0B 2OJZH 5DFTA 1WCBA 4JDZB 3PP3K 4OUOA 1CDCA 3VFMA 4KZDL 3EOBB 3A6CH 4KJWD 5CKAA 1IGTB 2H1PH 2QQLH 4I3GA 4PV8A 5IG7B 4EI5B 4RGMC 2ORBL 2BY1A 1KENL 1QVOB 5FGRA 2ZUSA 3V0AC 5KVMC 4S1RL 1D9KD 4OGYL 1TNMA 5F7FA 4R3SA 2L0DA 1GHFL 1H3VA 4NWUH 4QOKD 3H7LA 4JB9H 1A7BA 3QUXA 1I3RA 1NLBH 4MA8L 4G8GA 1IZJA 3RGVA 3ARQA 3RQ3A 2XWJB 1VCAA 3P9LB 3MRDB 2VXSH 2X4OB 3HI1B 2AV1A 5J6HA 1SJEB 4ONOA 3O6FC 4A6YL 3F5WB 3IJYB 4W68A 5TE7H 1FCGA 5EUOE 5D70L 4K94C 2W9DL 1QBLL 2DAVA 4R0LA 5FYJU 4M1CD 3VWKB 3ZTNH 3JTSA 3VXTB 3KPPB 2Z92B 5EOCJ 3W81A 1UM6L 1IBGH 2YD2A 3Q1SL 2EKSB 4XPTH 4OZFH 1NGZB 4PV9A 5F1NB 2JIXD 1RMFH 1HHHB 2W9EL 5DSCA 1CWVA 1Z5LA 1B0RB 3T0EA 4LSSH 5C0RL 1JNJA 1C1EH 3LKPA 1L9MA 4D8PA 5FYKH 3QHZL 3FFCE 2GTWA 3NIFE 1JTOA 3DV4B 1UXWA 3DWTA 1E4XL 1NCUA 1MIMH 3DGGA 3EJJX 3LN9A 1DQMH 3IFOA 3FT3A 3JV4A 3LRSA 4P2RD 1QBMH 3TM6A 4ZUSA 4URTB 3IFNL 1A7OL 1G0DA 1RJYA 1VA9A 2C3VB 5CJ8A 3VXPB 2R2CA 2V9RA 4AL8L 3KXFA 1KPUB 1YMMB 5ISZB 5I9QC 1S7QA 4NJ9H 5JO5A 1N8ZB 5ABDE 3MRIB 1S9YA 5C09B 2X05A 2XT1B 3HE6C 3MNZA 1P4IH 3BT2L 1A4KA 1IGIL 3MRHB 3G5ZB 3O3UN 4QT5A 5I8OL 1XGPB 2ERJB 4QWWD 3IT8D 2Y6SC 2RJMA 2EIZB 5DEFA 4NKQB 3DI3B 2Z31A 3EJZC 4IHOA 2VDPL 3BGMB 4CMMA 4JR9L 1ETZA 2I60L 2UZXB 4XMPL 1TJIL 1K8IB 1KTLB 3BKMH 3C6SA 3MV7B 4KK8D 4RRPA 3STLA 5DHVA 4D0DB 4QHUA 2GAZA 1MEXH 4O4YH 4GQ9L 1AGEB 4ODWA 3FB6A 3MJGX 1X44A 3OWEA 4LEXL 4HGKC 2FEEL 2XKUA 1WZ1L 1LEIB 1E4WH 4NN7B 1FBIH 4BFBD 5JMRA 3RWGA 4MGXA 4UNVA 4ZUWB 3C6LB 3P40A 2QLVB 4IS6A 1BGXL 3STZB 1JPSL 3VG9C 1SBSH 3QO1B 1MJ7H 2BY2A 1NUGA 1N6UA 4PTTA 1S3KH 4M6MH 5ALBH 5IROC 3EHBD 4LSRL 3SKNB 1RD6A 1INDL 4LARL 1DE4A 4XNZB 3WS6A 2V9QA 1IARB 1U58B 2ICEB 3G5XA 4GJTB 1CT8B 1AFVL 1ADQA 2V2XA 4ZAKB 2MPAH 4D0CB 1NAKL 3LRHA 4AIZA 5DRNB 3FQWB 3UZVB 2Q1EA 2DTMH 1EEZA 5DD0H 4N0YH 3WLWC 2VLRA 1OGAD 5E8PB 3K8LA 1F13A 1T2QH 2J6EA 1JHTB 1XCTA 1XF4A 4R7NA 1CXFA 5BMFH 1C08B 3MV8A 3LDBC 2OX5A 1DSFL 5EZOH 3WCYA 4NQDB 2BNUA 1I7TB 4QHLB 4MZ3A 3BSZL 5BV7L 3QWOB 2NY2D 4XXCA 2HT2D 4RFOL 4NJAL 3TIDA 4ODSL 4BYHA 1NH6A 3MRFB 4E41B 1ZGLB 2R1XA 1CICA 4NZJA 3LAFA 1PLGH 4Q6YA 1IQDB 3KAAA 1NBVL 4R4FL 1I8IB 5ITBL 4HJJH 2AERT 4LF3B 2WK2A 4GW1B 1G9NC 3S9DB 4ZNEE 4IRSB 2IADA 5FYJH 2BHYA 4QRQA 2P48B 4KKLD 3RRQA 2A6JA 1GXEA 2DQTH 5LAXA 3OBAA 5K9QI 3U46B 4OQTH 1SM3L 3KLAB 2IFGA 4LQFL 4XTRD 4HQQH 3BKYH 1JCKA 4H8WC 4OD3L 1UEYA 4MCYA 4YHPA 1HIMH 2ADIB 3GKZA 2HLFC 12E8L 5KSUB 1YEDB 5BOPA 1MY7A 4X6CA 4BK5A 3L3KB 4JFEE 3SPVA 4NUJB 5GQBA 3CXHJ 4PGEB 4YFDB 3L3JA 4IRZH 1OCWH 4X4ZA 5AAWA 1CGVA 1QLEL 1GAFL 3N0PB 1I9RH 5DJ8A 5JA8B 1PG7L 1BBDH 4DUWA 2G9HA 5D7SH 1Z9LA 2DMKA 3KYOB 4U1SA 2C1OB 4GRLA 4PY7B 2MOVA 4WGWB 5E7BA 1MFEH 4PJGB 4GG6A 1C12B 1MY5A 1LDPH 4WU5B 4PJEF 1FZOB 4PJ5D 3LS4L 3V6OC 1W0VA 3O2VH 2Z4QB 1MPAL 4NQVB 1I7ZA 3VWJD 4LLYB 2XACC 4ZD3H 1RZFH 4PP1C 5EFIA 3U0WL 3LKNB 3UPAA 4Z7QE 1F11B 4YHML 1L6ZA 1WWAX 3U0TA 5BVPH 4ZOAA 4OLWL 1LEKB 5I30H 1AY1H 1Z9MA 1H3PL 1T2JA 3AB0C 3CPLB 3LEVL 3QJHA 4PJAF 5MHSE 3NABH 3IKCB 1YPZE 2ZP0T 2YWYA 5E8DH 4EBQH 4KROD 1CIDA 3VFGH 5IT2H 2M1KA 5JNYA 4WEBH 1HEZB 1KPVA 1YQ2A 5K9OB 2VQ1B 1T1WA 4M43H 1DBBH 4K8RL 1FVEA 4GOSA 5INCB 1OAQL 4GRMA 4K71C 4XNXH 5HHQA 1XGRA 3DSFH 5GIRA 1JF6A 2MKWA 2HTKC 2OL3L 3WNMA 3SGEI 2YBRB 1M6OA 3D6GA 2VDKH 4B7LA 3VGFA 5EUOA 3TN0A 1BBJA 3H7BA 4QRPE 3QEHA 4XNUH 1B6DA 4R9HA 3WS3A 4FMFA 5M94B 4Y5VA 5FHAL 1HXMB 4AENA 5CJBA 4WDIA 4RGOH 4XMKL 4HCRL 2XWBA 3L3GB 2PTVA 3O3DB 4NSKB 2A1WH 4DKFH 4Y5YB 3VD3A 5I1EH 4J8RA 1DVFD 3INUL 4B53A 4M1DL 4PJXB 3JWDC 4W6YB 3QQ3A 2IGFH 2DI8A 1ZT4B 3TLRA 3MODL 4KI5F 5AZEL 4ZTOH 1OQOA 2IANE 2D31B 3FFCA 3ARDA 4JN2B 1FDLL 3S97C 4X5LA 2NYYC 4XPBL 4Z77A 3O41A 4GBXC 3HC3H 2NLJA 3QCTH 3GB7A 4YX2H 3RUGE 1JNHA 3LN4B 4LP5A 4Y4KD 3MUY1 2UZYB 3UBXA 2YD5A 2HVKA 2AJVL 4AT6A 3VE0A 4K94H 3SGDI 1EHXA 3SKOB 3RU8L 3WHXA 4KVCL 3PIQB 4K7PL 2J12B 4P4KD 4ZOBA 3ELAT 3PWPD 4POZD 1OF2B 2P7TA 1JF5A 4ORZC 3M1BB 2AVGA 2DIJA 3HE7A 2FWOB 4XH2A 5BOZG 4GRWH 1IAIM 3DROB 4Q74A 4DW2H 1QO3B 2HA1A 5T1DL 2DQGH 2X5PA 4P46D 2FX9L 3TZVD 1AQKL 3FO0H 3WJLC 1ZEAH 1B0WA 2C1PB 3QQ4B 1A7RH 1KGCD 4HC1H 4X99A 2BVOB 4P2OD 1TCRA 4ODUA 1MHCB 1YMHB 3CLEH 3ZKMD 2LTQC 1FL3A 1S8DA 3HRZB 4Q9QH 4UTAH 5D1ZD 2R69L 3RL1A 3DVIA 5I74B 1KXTB 3WHE0 4BZ1L 5CD5D 5DD6B 1YEGH 3MLZL 1M7IA 3VXRD 3IXAB 4RAVB 4ESKA 2CIKB 2ICES 4NUGL 2ARJQ 1XGYH 1JPTH 3CUPA 3BIAX 5T1MB 4UDUB 4N0FB 2R29H 4PY8J 5D1XB 3TJHD 3BXNB 1X4XA 3O9WC 5C2BH 3H3KA 3K4ZA 3MMEB 4LK4A 5ADOH 1ZOXA 3OKKA 1RUPL 1F3JA 3E3QE 4FFVD 1GZPB 2I5YH 5DF0A 1FYHB 1F4AA 4MD0A 4TNVK 3GSNH 4UV7L 4TUOA 4WHYG 5F1IB 1B0GB 5F7DA 3ARUA 4G9DA 2BNRE 5LKNA 2NMSA 4TSCH 5D5ME 3NCYP 4YBLB 3V6ZA 5HYJB 1ZSDB 3PXHA 3PGCB 4OIIH 1AD9A 3PJSA 4GAGH 4IMKA 4XGZA 4LDEB 4HXAL 3TVMD 4NZRH 4L8SA 4ZFGH 2EDHA 4PR5A 2E3VA 1OP9A 3P4OB 3QT2A 4PGZA 1GGTA 4LASL 3DMMB 2VIRB 3RVUD 5M95B 3G6JB 4CMHC 4X83A 1U8JA 3QIBC 2OI9C 3BQUD 3ZMRA 2VXUL 3WUZA 3T2NH 1KIQB 5HHNA 1AGDA 2XA8L 5DD5L 3GIZH 2EICA 1LK2B 2HH0H 3SDCB 1XF5B 3GMQA 3QDGE 4LRIC 5FKPB 1Y6KR 4AIXA 4CU7A 2NY4B 5K9JH 2ZCLL 4JDTH 5T3ZH 4I18C 5GRVK 3HZKA 2W0FB 3MLXH 3HNTL 2AEPL 4WW2F 4ZNEA 5KVFL 3HCVA 4OI9A 3IDNB 2GIYA 3EFDH 1J88A 1Z6JT 1EEUA 4I0KA 2V5TA 3O8XA 5MI0C 3GJFH 1MRFH 5D93B 1NBZA 1NMCB 4N0CD 2J88L 5GS1C 3SE3A 1JZ7A 3ORJA 5HGHA 4A6YA 2Z91B 5AZ2L 4JFEA 5FYLD 3V4UH 2BRRL 3UAJD 4H26B 1NGPH 4JVPA 2ICWA 3QI9D 5IV2A 3DVNB 5C0FA 1CFNB 3BN3B 5L2KD 3SDAC 3FQRB 1N26A 1MFBL 1W0WA 2DD8H 1UM4H 3F7YA 4YPJA 2Y7QB 1IKNC 4L1HA 2J8UF 2P8PB 3L3HA 2V2TA 4X7FC 5HDLA 5KG9B 4LHJB 1DUZB 1HQRA 4KK6D 4HS3A 4DCQA 2EH7L 5KS9F 4JJ5B 5GGTH 1N5AB 2DLIA 4KFZC 4MVBD 4NRXB 4ZDHA 5CILL 2VLJD 1I1AB 3N06B 4HUWA 4ODXA 1RJCA 2DDQH 4ONHB 4YUEL 3SO3B 2NX5B 4NQCD 1SVCP 4KJPC 4WI6A 3BEWB 4WIQA 1N5YL 1MCBA 5IB1A 3PHOB 1ZWIA 3CSGA 5C0AE 4NZUL 4H8WH 3ARFA 4BZ2H 3TA3D 1IAII 3NFSL 4M7ZC 4XCNA 3ZDZF 1XIWD 2GTZB 1OB1B 3I85A 3ULSB 1R3HA 1YPZA 5GS0C 2AAVA 4G7YL 4PREA 2CIIB 4XHQA 1KB5B 2P5ED 3LZFL 3BUYA 1KUMA 2WLYA 3A6OA 5ADPH 4KTEH 4ZTPH 5A40E 4GW5A 3H42H 2KPNA 5SWQA 5CGTA 4RIRB 4F3FB 4DEPB 5T1LA 2YR3A 4YGVA 4P5KA 3WKNA 3CVHL 3DARA 3Q6FB 3IDXL 2OJEA 4BH8B 1MFCH 1Q0XH 3TV3L 3G04B 4X7SH 1RURH 5AD0B 1Y6NR 5ECJE 3H0TA 2HJLB 2Q8AL 5I71C 1AGBA 2H8PB 4X7EC 1YMME 5ISZE 2OP4H 5TDNA 5LGHL 2BSTB 1MJ8H 1YNTA 3VXOA 3BW9B 4C4KO 5KSBF 4FHBD 4P0DA 4Y8DC 5TFSH 1R3IH 4S1QL 4MDIA 4K3GA 2FCBA 1Y18A 4UIKL 1QA9B 3HI5H 5D7JD 3S35H 5JXED 3ULUL 5IW3A 4ZXBB 3CVIL 1H15B 4P48A 1RIVH 2MWCA 5HYQA 1UB6B 4HKJB 4HUXA 2PO6C 5JW4M 2IANA 5FAAA 1TQCB 3OPZL 3C2AH 4C54A 1CXKA 4F9PA 3OKNB 3MV01 4MD5A 4PP2A 3Q5OA 2WNGA 3B9KB 2QSTA 1QHPA 3RUGA 4P5TB 1Q94A 3H9YA 3X3GL 3IGAA 3GSUA 4L3EB 4R26H 1A6ZB 2P44B 1T04B 4YNYB 1MHPH 3C8DA 4OGAC 4IOSD 4XB8A 1F3RB 3LOWA 4IM8A 4OKDA 1XEDA 3TBTA 4NQXB 5I6XC 1AH1A 3GMNB 5E7FA 1U9KA 3CMOL 3HS0B 1MJUH 3SY0B 3U1SH 4GSDH 3JWDH 4X6DE 5BRZD 3S3PA 1JFQH 5DLML 3BZEA 2VJXA 1Q38A 3WXWH 2X7LB 2BVQB 2KZ1B 1YN7B 1KNOB 3BDYH 4Y5XA 2YSSB 5F93C 4GXVL 2NZ9C 3KPMB 2OMNA 4F7CB 3KPLA 3PHSA 5FDWB 1CIUA 3WIFA 5HHXH 2D7PA 2P8MB 3ARWA 4C58B 5ID0A 1KIRB 2NW3B 2MCG1 3BP6B 2X4UA 2WIIA 3CH8A 1QKZL 5CINL 2BVPB 5D7KE 3TPUB 1UZ6E 5IVOA 5FA3A 3GHEL 5KVGL 5H94B 3QFJE 2ESVD 4EUPH 2D0GA 3RI5K 3RP1A 1U93A 4LSDA 4PD4K 2E7LA 1OTSC 2DJSA 3DX7A 3HMXH 4JRYD 4PS4H 4WO4A 1PEWA 4E41E 2R23A 5B3NA 1CE6B 4PGBA 1ZVYA 3HZYA 4XP1L 2Z35B 4JPVH 5IOPA 3KLHC 4PJFE 3RWJA 4C83B 4WFHD 1TTGA 4NC2B 2AV7B 4R2GD 4QLRA 6FABL 1S7VB 4RA3A 1MCWW 4QRTB 2MKLC 2IH1B 3CMGA 2FB4H 2BNRA 4MQ7B 4HKZA 3DHJA 1YEHH 1RUAL 2EXYC 5E00A 3S5LB 5D5MA 1HSBB 3MBXH 4LPTA 5KVDH 3LRGA 1RJZA 2R0ZL 5E6ID 3P0GB 5TQ0L 4FQXB 5CGYC 1WITA 5C0NC 4JFOB 1Q0YL 3DOSA 3LMJH 1VPOL 5J1AA 5C9JA 5F9JB 5DEGA 4ZUTB 1DFBH 4FG6C 1MH5A 5E2WH 2MTPA 2NNAA 5L0QB 1ZXQA 4JZJC 3B6SA 1YA5A 2FDBP 1PEZA 1FYTD 3CLFL 2W07A 5ESAA 3BVNB 2AJSL 4DKDC 2CDFA 4MJ4A 4O58H 3QZWA 3S98A 5SX5K 5I1DB 3H3PL 3IJHB 2YMXL 2P42B 3QDGA 4MWFA 5MEQA 4U1JB 5JMOC 5KSVB 2R0LH 3OKLA 4G5ZL 4XMLL 2B1AL 5B4MD 2F5BL 4M62H 2N7AA 1H3TA 4I3RH 3UP1A 4LSQL 4H5SB 2BZDA 1P4BL 4E5XB 1HI6B 5DMIH 2Q3AA 4JDZA 1QG3A 2OZ4H 1HZHH 1KCSL 1IGTA 4PRIE 2VE6B 5IG7A 1R5VB 4PJEB 2OL3A 2ARJB 4XPAL 4IIQC 1QVOA 3K2MC 4U31A 1CDGA 3L5XH 4LP4A 3U9UB 4I0PB 4Y4FB 5DTFB 3BYTA 3KJ6L 1UQSB 5GGRA 2VLKB 3LS5H 1JGDB 4W6XB 1UEMA 5B39B 4RMQA 5GGSB 5HXMA 2E8ZA 3K1DA 3X14B 4PJAB 4LLWB 1DN0B 2XTJC 5GGRY 4U2ZA 5F7LB 2XWJA 1UZ8B 4TNWF 3W39B 5TH2A 1F8TH 2X4OA 3HI1A 2GUOB 4DK3A 3ULUE 3HKFA 1SJEA 4ALAL 3MBEB 1NC4D 1Q1JL 3IJYA 3V0WH 4G42B 1J7VR 3ZDYF 2PF6A 3RY6C 4F2MB 3HI6L 4UUJB 4OZHB 3VWKA 3ARGA 1MCHA 3NH7L 3KS0H 3KPPA 2X40A 1HOCA 2CGRL 1IC5H 5C0AA 3MJ7A 4U1IA 2EKSA 1T20B 3VGBA 5MENE 3S88L 1NGZA 5F1NA 5D72H 4RNRA 1II4E 4EN3B 5HVGB 1MFDH 2VAJA 3EO0B 1E4KC 1SMOA 5J89A 4EJ1C 4U6VL 3VDCA 5EIQA 4QHKI 4DGIH 2ZPKL 4GRWF 4LEOB 4FQJH 1LO5B 4LBEB 2VDML 3P2TA 1FIEA 3HPLB 4JLRB 1VFAA 1JZ2A 2RCSH 2AK4D 4WVRA 3TO4B 1F2XK 5IMOB 2XG5A 4CN4A 4YXLL 2GI7A 1CDYA 1QYGH 2CDEA 35C8L 4K7PY 3Q6GL 3MCLL 1JNLL 3DETD 1C5DB 4UDTB 4FZ8H 1QSZA 2X4PB 1R3KA 3LEXA 4JG1L 4RGNE 3ZT6A 3VXPA 2VSDA 3TPKA 4KRPD 3U48A 3SKMB 2QHRH 4KK8C 4R96A 1YMMA 1PSKH 2NW2B 5ISZA 2A83B 1N8ZA 1JWUB 1UWGH 1FJ1B 3MRHA 3G5ZA 4DUVA 1VGKB 3SOBL 1XGPA 4EIZC 3AVEA 1U8MB 1BQHB 3W5NA 2FO4B 2EIZA 1AXSB 3MLTB 2HWZH 2JLLA 3RFZC 3X13B 4WGVB 1BF2A 3PE9A 4ZFZA 3BGMA 2NXYD 4Z7OF 1HK6A 4IOFD 1ZTXL 4FA8A 5SX4H 3FOLB 5FHBH 1RZ8B 2DQDL 1K8IA 3GSVA 3MV7A 5GJTH 2DBLL 4KTYA 4KRMB 4X4YB 2PN5A 5K33A 5ICXB 4P2CG 3L1OH 1K8DB 4TQEL 3O2DL 1YY9C 3T4AB 1LEIA 1X5JA 2A0LC 4XAKE 3L7EA 5HY9B 2FHBA 3ZE2E 1T3FA 3U4EB 1MCDA 5BS0E 3GSWB 5HDBE 4KTDL 3T4YB 5FM5O 5T5NG 3LIZH 1BJMA 3SKNA 3MOAL 4DFIA 4D3CH 5ANMB 3KJ4C 1NJ9B 3NFPA 3O2WL 1AE6H 2EDJA 4LPXA 2ICEA 3MOBL 2YC1B 1CT8A 2DMCA 3F58H 1QSFD 2VABB 4X6DA 5IEHB 1EFXD 4D0CA 5E1AB 1MLCB 1JGEA 3LPFA 4G8IB 5EUKA 2HT2C 4JO2H 5DRNA 5CZXD 4ZFFA 5I1JH 1X5IA 3BPOB 1L9NA 1U8QB 4XC1L 5E8PA 1O7SA 1JHTA 4HFWB 4LFHD 4IMLB 5IFAH 1GPOL 4NKMB 2AABL 5CBEB 5CSZB 1G7JB 4LKXA 1CICD 5IB4B 1SY6L 1T03H 1DQDH 1FQ9C 4L9LC 5I66A 1X5LA 2CJUL 4CW1B 1A22B 3QFJA 4QHLA 1MI5E 4WHTB 5EZLB 2I9TB 2AGJL 1W8OA 3G6JE 3S37X 1FO0L 3MRFA 4E41A 2F5AL 4OCYH 1G84A 2R4SL 4QEGA 4WENB 1AO7B 2XNAA 1IQDA 1ZHLB 3D25B 1BP3B 1EJ6A 3GGWB 4Z7NE 1A7QH 1B4JH 4LQ1A 3MUHL 4EQ2A 5HHMD 2UVEA 5SWZB 3C9NB 2YA0A 2XPGA 4OCLC 1AGFA 1U91B 4N5ED 3UC0L 1U3HB 5I73C 3O3EB 2I9LB 3KLAA 5DR5L 3BZDA 1WWCA 2IAMD 1VERA 1EHLL 3FAXA 2H9GB 4RFEB 3C5JB 3F7RA 5KSUA 3TBWA 4OFYD 4PUBH 1YEDA 4NN6B 1V05A 3VD4A 5D8JL 3L3KA 4RMRA 3S36L 4WW2B 3ARSA 3KYNB 3UTZB 4NUJA 4PGEA 1T5XB 1C5BL 4GAYA 2VDQH 5J13B 5E4IA 4TUJA 4R90L 3KYMA 1PZ5A 1P4LB 4NN5C 3WO4B 3LSOB 3KYOA 5D2LF 4S2SB 1AHWC 4QHMB 4BA8A 5KZCB 4PY7A 3Q5TA 4JZOA 2V9TA 2H2SC 1C12A 4U1GC 2D9CA 4WU5A 2F54E 4F15C 4LLAA 1FZOA 3IDIB 4HULB 2HAZA 1R24A 4BQ9A 1BIIB 4H88H 3MRQB 4M5ZH 3CFKA 4XCCH 1YEJH 2EDEA 4NQVA 4F7EA 2NX5E 4YO0B 1WLHA 4XVTL 1E28B 4HIHB 1F11A 2J8UB 1A5FH 1BVKB 3I6GB 3S5LG 5A3IC 1VSCA 5E5RB 2MFNA 3OJDB 3CVHA 1LEKA 5KS9B 4NNXB 3B2VL 4PRIA 3T0VA 3CPLA 4JZNA 2Y06L 2DQEH 3IXTB 3EIFA 1GC1C 1UYWL 1F4YH 3IKCA 5T5FL 4LL9A 4JRXB 4KKNA 3C5ZB 4CU6A 4JFDD 1HHGB 1AKJB 1GGBL 1I3UA 2VN4A 3E2HB 4HBCH 4UT6H 1HEZA 2XA3A 3MGOB 1A3RL 1FVDB 4L4TD 4MJIB 1SHMA 3ZYJA 1SEQL 2PYEE 4ZS6C 1RY7B 2NY3D 4YXHH 4M6NH 4OI7A 5IFHL 1KN4H 2QBWA 3QJFB 4BM7A 1HINL 3OZ9H 3PF2A 1KPRA 5J3HC 3FT2B 3D2UB 2WIMA 5EU4A 2YBRA 4GG8B 4O02H 4RFNC 3A0OA 2WBJC 4TSAH 3LQAL 4CVWA 2PXYC 3QUMH 1T7ZA 4YFLI 1A6VH 3UCRA 3MLYL 1RIUL 3RTQC 4ETQA 1P7QD 4YHZL 2QSCL 1K2DA 1YN6B 4FQPA 3L3GA 3QUYC 5A43C 1R5IB 5GZOD 3ZL4L 4NSKA 1JBJA 5MENA 3PWNA 4R4BA 4JVUA 8FABB 3CZFA 1IGCH 1NLDH 2AJYH 4J4PA 2Y25A 3JUYA 5IQ9B 4JHWL 1Q9LB 3DV6B 1A9BA 4FFZL 5DUML 3MSPA 5B39G 5KSBB 1EVUA 2QQNL 3IETB 3NOIA 1MRCH 1T7XA 4JO1H 3HE7D 1LO2H 5DJ0B 1UFUA 4S1SL 3NZ8A 3VFWB 5IJVA 3SKOA 2HT3D 1ACZA 4PRHB 2ZKHH 3PIQA 5E2TH 3GMOB 3RWDB 3WFZA 3MLUL 1BIHA 2YK1H 5IKCB 1E6JL 3T65B 4GMSH 3MRMB 4P3DB 1KC5L 1QO3A 1BD2E 2C3WA 2E27L 4J3UA 3GBNH 5F7EL 3C09B 2C1PA 4JCLA 3GSOB 2YXMA 3QQ4A 3K8MA 3SCMC 4YAQA 3N85H 5F9OL 2BVOA 3RX7A 1CXHA 5L88H 3GM8A 4DGVH 1YMHA 2KQNA 1T66C 4FNLH 2JB5H 3SDXE 3HRZA 4R4ND 5E24E 1EA9C 4J3XA 1GGIH 3PGFL 5TE6H 5DD6A 3DJ9A 2C7UB 4RAVA 4Z76A 1OAYH 4UDUA 2RAMA 4OCSH 4OLYL 3H3BC 1AR2A 3FQXA 1S9VB 3CU7A 5IVZA 2AKRB 2DICA 5HGDA 4QTIL 3ARBB 1XGUB 5MEPA 3H9SB 3MA9H 3MGTB 4HPYH 3FO9B 4OF3A 3ZYIA 3WL9A 2H45A 5J12C 5I17B 3GDBA 3FQNB 1BQHG 3EO1B 4P3CH 1B0GA 5F1IA 2Y36H 4Q97A 1OGAB 3HAEH 4HIEB 4NBYB 5HDOA 5KN5B 2EDKA 3QUZC 3QRFM 3OKDA 2K7QA 2P47B 2GHWB 3W0WE 2EC9U 1ZSDA 2P5WB 1V3JA 5CJOL 5M7QA 2OR9H 4HJ0C 4PJ8C 3F7VB 3QIUC 4AIOA 1BVZA 4M5YL 4M6OL 2NY2B 4EDWL 4GKOA 1R0AL 1TJHL 5F9DC 1JRHL 1MI5A 2XQBL 4MA3A 2Y5TB 2DLFH 3G6JA 1M71A 4OAWA 5E0QA 2H2PC 1KIQA 4XPHL 1O5DT 2F53B 4QYOA 3O8XD 1WISA 3SDCA 2CKNA 2FATH 3RIFF 1IQWL 1EERB 2EYTA 1NANH 2XG4A 2W0FA 5H2BB 2V5SA 2R9HC 4MS8D 4NKOB 1I8MB 3I9GH 3ULVD 4QY8B 5DVNA 3BPCB 5B3JE 5I1LB 5C6TH 4PJEE 1DQJB 4JREB 4YFEA 1CZ8L 2OJZL 2DF3A 1TVBB 2QR0B 3A6CL 4H26A 4WCYH 2VLKE 1BJ8A 1KXQE 5F9WB 1P84J 3RDTD 3DVNA 1P9MC 4YZFF 1ZS8B 4YQXH 1XCQB 4WWKA 3FQRA 1TETL 3VCLB 4BELD 1MCPL 2WP3T 2NR6D 2P8PA 3RL2B 1KLFA 1ZLWK 4WI9A 4NWUL 4R6UA 2UWEF 3PG2A 3PQYB 2K7PA 2HT4D 4RMTA 4JB9L 3NGBB 2MJWA 3TWCH 2F54A 2CO6B 2IQAA 4JN1L 4KH2A 2PNDA 4ONHA 5MHSD 4UINH 4QRUA 2A74B 1ZHKA 2NX5A 2KKQA 3OKEB 1EGJL 3BHBA 3DBXB 1RZGB 2W60A 8CGTA 1A6TB 1RZJL 3QPXH 5TE7L 3B9EA 3VFVB 4GUPA 4PTUA 4UU9B 3QDMB 3B3IA 4HEME 3ARXA 3CDGB 4OB5H 3ZTNL 2OYPA 3ULSA 4XWOD 4Y1AE 2Q20A 3B43A 3N1MC 5EA0H 5C08D 1QQDB 1IBGL 5CEZD 4XAWL 5EBMB 5GXBB 1RMFL 4J1UA 1KFAL 3MRRB 4JHZA 4LSSL 1C1EL 2V6HA 3TT1L 4RIRA 4YH6A 5JR1H 4F3FA 3K3QA 4KI5E 4GRWB 1HXYA 1VFUA 3G04A 1DQML 2HJLA 4HKXB 1HHJA 3OG4B 3DVGA 2EEDA 1QBML 4OFDA 4O2EB 3RJDA 2Q7NA 3O2DA 3W2DH 1NGWB 4EIGB 3TYFB 4K55A 2APBA 5AWNH 2XN9B 4MJ5B 4NJ9L 1QA9A 3GKWH 5EU6B 3U7YH 2IWGA 1XR8B 1I85C 5JXAH 4L4VB 4RWYH 1WBYB 1P4IL 3QG6B 5FV1L 2Y1VA 2HLAA 1BEYH 4OTXH 4ZXBA 1MFAH 5L6YH 3I6KB 5DYOB 1H15A 4Y2DC 1QR1B 1G9EA 3NIGF 5CEZH 3DYMA 5I9QB 1TTUA 5IJKA 1MAMH 1KIPB 3HE6B 1OY3B 1SYSB 3UBXI 2R0WH 3B9KA 2V2WB 4LVHC 4Z18A 1G6VK 1MEXL 2VUYA 4O4YL 4I5BA 1A6ZA 3DURA 2BOCB 1T04A 1E4WL 3GSNB 1IZKA 1FBIL 5C7XH 1RIHH 1U0QA 1EZVY 4LLVA 3TZVB 1GVIA 3HS0A 5K93A 4HK3J 1S5IH 1SY6A 1LE9A 5GGVY 3SY0A 1L4IA 3RAJH 1SBSL 1MJ7L 4TTDC 5MEOB 1T83A 3QIWC 4M6ML 4I2XE 1BD2A 3MRLA 4LLDA 3TNNB 5JPMB 1WAAE 5J56B 1P6FA 3OAUH 2P4AB 2X7LA 1FO0A 3A67L 1YN7A 1CLYH 4NQTA 1I7RA 1SBBA 3KPMA 4F7CA 4BSWB 1CF8L 3VG9B 4BSVB 2FO1A 4WO4D 1IEAA 2P8MA 2X2YA 4U2YA 2VAAB 1KIRA 2NW3A 4Y4HA 1X5AA 4YDLB 3SDXA 4GH7B 1BQSA 3D85D 4OFKA 3ZE0F 4LIQL 2WV3A 2J7LA 5JHDE 4N0YL 3R1GH 5L2JA 3TEUA 3TPUA 2EEBA 1RPQA 3CK0H 3GBML 3V2AR 4YDKH 2QJDA 5BMFL 3GSXA 3VH8B 3C60C 2CH8A 3VFRB 4XCYA 4Y8AA 7FABH 2R2BB 4K9EH 4F7MB 1MF2L 3QEGL 1WBZA 1B6UA 2EZ0C 3RZCA 1FGNH 5IW6A 1N0XH 4C83A 5CMAA 3QDAA 1HCVA 3GJFB 1P2CB 4U1NB 1TFHA 3LDBB 1S7VA 5SWZE 5CJXC 4QRTA 1A1MB 3QCUH 5DMJB 2IH1A 5BCAA 3BD5A 4MQ7A 4HJJL 5D6DC 3S5LA 1HSBA 4EDXB 2VXQL 2B2XH 3TVMB 3W0WA 4FQXA 3MA7B 4HWEH 4NFDA 3U9PL 1U2HA 4KVNH 1OAZH 1YYLL 3SQOL 4OQTL 3PL6D 5MP6H 5DRZB 3FN0H 4HQQL 5FECA 4JQXA 3BKYL 4ZSOB 5GHWH 3BQUB 1K9TA 1LE5B 2QADC 1HIML 1J1XH 1DZBA 1WGOA 2COQA 3DYOA 4HLZG 2OLDA 3BVNA 4LLMB 3MZTA 3EO9H 4K8RD 2P43B 5ESVB 3QUXC 4IRZL 1OCWL 4KPHH 3AY4A 1IM9B 2IG2H 5I1DA 3RGVC 1I9RL 1V3KA 1BBDL 4EI5D 4K3EH 3QUKA 3OXRA 4F37K 4HDIB 1JI1A 2DRUA 5HI5D 1OP3H 2QSQA 1MFEL 4CU8A 3RWIB 5D2LB 4BFEA 2J8UE 1LDPL 1T6VN 4M8QB 5HPMB 4X6EB 1KCVH 5KS9E 2EDOA 1G7LB 4KWUA 4ZD3L 1WJ3A 4PJEA 4QOKE 4I0PA 4JRXE 4Y4FA 5DTFA 2FSEB 2XZAH 3GRWL 5BVPL 1UQSA 2VL5A 2VLKA 5I30L 1AY1L 4Y2OA 5E9DB 4XNMB 3T0EC 1ZT7A 2ITCA 5B39A 3V5HB 3NABL 4HIJB 3T09A 1SYVA 3ZDZE 1MAJA 1QFHA 4BFIA 5E8DL 4EBQL 3UEZA 4OJFH 3VWKD 3VFGL 5IT2L 4LLWA 1MCKA 1DN0A 2CRIA 4CN1A 3W39A 4M43L 1G6RL 4WW1A 1DBBL 2GUOA 3WE6A 3VFUB 3AB0B 3MBEA 2APVA 4L3AA 1A1OA 1NGYB 4D0BB 1E4XI 3S36X 4G42A 4XNXL 4ZUVA 5C2UB 3DXAB 4BQ8A 3LVEA 4J3TA 4UUJA 5IEKA 3P9WB 3BKCH 5FO9B 1UWEH 1HH6A 3QCVH 4MA1B 4OT1L 2VDKL 5T3XD 3SDDA 1JNNL 1J0IA 2HRPH 1O0VA 3QG7H 3LB6D 1MWAH 1KN2H 4HHAB 4XNUL 3HB3D 3KWWB 4EN3A 2P5EB 4K71B 3QEQB 4S11A 1TQBC 1H3XA 3EO0A 4NQEB 1KF9B 4RGOL 3PWLB 2AW2A 1HHIA 2IFFL 1LO5A 4LBEA 2Z31C 4JLRA 1ZHBB 4E0RB 1KBGH 2VDNH 4HV8B 1KJ2H 2EDYA 4LCIH 3TFKC 4WUUB 4CVUA 3DIFB 5JLZB 2X4SA 3QAZC 5C09D 1FLTX 5FO8A 1FFOB 1HNFA 4MXQC 1C5DA 4UDTA 2X4PA 1H3GA 3U7WH 5C0JA 1B9ZA 1T5WB 5GGQH 3WKMH 3D39B 5F44A 3BAEH 3G9AB 2FBJH 5E70A 3MLPA 3QCTL 2VLLA 1BQLH 2DL9A 2A83A 4P57B 2WQ8A 2DKSA 3KYKH 4BQBA 4LIQE 1JWUA 1OAUH 4K94L 2V17L 3MV7D 3OF6A 4NO3B 3CIQA 3P4NA 5FOJA 3IFPB 4WFGD 3WS6C 1LEGB 5T3XH 1OGTB 1X7QB 4GBXB 4HX1B 1Z9OA 1BJ1H 3MLTA 3BI9X 5B38A 5CSBA 5KW9L 3CDYA 5E8OA 4ZG1A 5ITFA 3RHWK 3IAGC 3C6LD 2DQGL 4EUPB 4MX7A 1BOYA 1ZEAL 3IF1A 3O3BB 1P5UA 1JGLL 4XBPB 3W82A 3S37H 3ZLQC 1H8NA 5ICXA 3NTCH 4HC1L 3UX9B 3LQZB 1IAKA 3T3ME 2J4WH 3UTTB 4U3CA 5HY9A 1LO0H 3MJ9H 3O45A 4Q9RH 4NO2B 4UTAL 4ZAKD 2LVCA 2YRPA 1S9WA 4LPVA 4NM8H 3L7FB 3T4YA 4LKCB 1DJSA 1WZMA 4L3CA 1YEGL 4WI8A 4X4XB 4G6AC 5JOFB 3LKOB 1YQVH 5J6GB 1XGYL 3QWRA 2AQ2A 5ANMA 4N1EA 4HW6A 1QNZH 3EYSH 2R29L 1AR1D 4PJDF 3JWOH 5CIPH 5KAQF 2LTQB 2C3HA 2PR4H 4I2XA 2R8SH 4PFEA 1MQKH 1OGAE 2Y72A 3DVFA 1NFDF 1MLCA 3S96B 5F6HJ 3P0YH 1MHEB 1WAAA 4G8IA 4NQDD 5ADOL 3ECBB 1T1YB 3P77B 3T77A 2E5EA 2I5YL 2ZSVB 4JM2C 3VMPA 3I50H 1KXVC 2P5WE 3DYPA 3GSNL 1U8QA 2BY0A 1IGJA 5B21A 4HWNA 3Q48A 1G1CA 4E41D 4IMLA 4NKMA 3O9WB 4TSCL 4JAMA 1G7JA 5IR1A 1QBBA 3KVQA 3QR2A 1BFVH 4HAFA 5EU5B 4WHDA 4H0GA 3AAZA 4UIMB 4JO3H 5BXFB 4WHTA 5EZLA 3DGCR 1MCNA 1L7IH 3U36B 2FLBT 4N8PA 4IRSD 4ZFGL 4JY5H 4HMEA 4OLUH 5BO1H 5F89B 1SJHB 4R2GB 5L7XH 4ELMF 4OM0H 3WEXB 5EOCH 3FN9A 5KSAA 5BZDB 2X44D 1YEFH 3IDJB 4GRLC 4U1LB 3PDDA 3K4AA 5CD3B 1J11A 3F62A 1ZLSH 1HHKA 5SWZA 3EYOA 4I48B 3C9NA 3UO1L 3WNNA 3P30H 2C26A 3AXLB 2JTDA 1Q72L 1U91A 4PJCB 4YLQT 5BVJB 1F6LL 1TZIB 5K9JL 3O3EA 5LBSH 4JDTL 5F1OB 4OGZA 4CMHB 1W72H 3QIBB 2OI9B 2H9GA 4RFEA 4JFFB 3VXSD 1QEWA 1CFTB 4WW2A 3KYNA 3E0GA 3UTZA 1GOHA 1MRFL 1T5XA 5HYSA 1JPFB 3OHXB 1EGJA 2VZ1A 4GKSA 3MFGB 3WDHA 4I18B 4JDVB 1P4LA 1Y6MR 2GSIB 3VH8G 3V4UL 3HZMB 4F7TB 5TPWH 4Z78B 4HS8H 4AMKH 3HC0B 2UZIH 4OUUB 4QHMA 3HUJE 4MJ6A 1INQB 1V7NH 4OLXH 5MI0B 5GS1B 1UM4L 1VADB 1QFUH 3IDIA 4OZFA 2HFGH 1ZVHA 1PYWA 5JIKA 5CJQH 1ZANH 3BUTA 4TULH 2CQVA 1DBAH 1E28A 3TN0C 4HIHA 1D3CA 2J8UA 3I6GA 2UWEB 2D7OA 5TF1H 4Y5VC 5KS9A 4O5LH 3FT4B 1D9KA 1A6AB 2PTTB 3I75B 4FQCH 4ZOEA 3IXTA 3ZDYE 1CVSC 2CLZA 4QOKA 1X5XA 2AJUL 2ID5A 3V4VH 4JRXA 4H8WL 5IF0A 4BZ2L 1HHGA 3DX9B 4YDIL 3MGOA 1CDJA 1FVDA 3D69B 1O7VA 4OZGF 1A0QH 3KLDA 4ZQKA 2DJ4A 4HEPG 1JF1B 5C3TA 4CDHA 5FK9A 3ARDC 3QJFA 4NKIL 3AREC 1F3DJ 3BH9A 1CDUA 1UVQB 5GRUH 4ZTPL 5F88B 4M7ZB 2IALA 1C16A 2Q86A 4YWGH 4D9LL 1OTUD 2FIKA 3VFTB 3DI2B 1KB9J 3O6LH 3RVVD 4M1GH 5C0EB 4G43B 2EE6A 4ODHH 2NY6C 3QQ9C 5DVOA 1MCOH 4ISVA 1MFCL 2V5MA 2JJWA 2JIXA 25C8H 4X7SL 1RURL 2J3SA 3RKDD 1U3JA 2D0FA 1P53A 2OP4L 1TLKA 2XN9E 2ATPB 2XZZA 3H9HA 4X98B 5F1SA 4N8VA 1MJ8L 1QSEB 5GGUB 2P1YA 2RFXB 4NP4H 3ZKND 2VRAA 5TFSL 1R3IL 4U0RC 1WIPA 2W0KA 3K1KC 1MCCA 4KAQH 1Q9LA 1LVEA 3WNOA 1FNGB 5I71B 1MVFA 4KMTL 2FJFB 3S35L 2EDRA 3ZDXE 3L6FB 2SEBB 2YUZA 3VRIA 2JJSA 3PHQB 3IETA 2YRLA 2H32H 1RIVL 4HZLB 3TJEH 5D1QC 4YC2B 4XX1G 3PWPE 4ZPTB 2BVUA 2AEIT 2X4TB 1DDHA 2P24A 1F4XL 3T0BA 3FB8B 3UJTH 4OF8A 3TH2T 4PRHA 4Z6AT 4O51B 3GMOA 5F7MC 2WMPA 4C56D 2PO6B 3O11A 4Z7UB 5IKCA 4OCNC 4R4NC 3MRMA 4P3DA 3HHRB 2KDGA 2ZOKA 1MHPL 1KGCE 4RWHA 5EC1B 2B4CC 4MNGB 4BKLB 4PJHE 3THMH 5I19H 4KDTA 1Z0MA 2EEAA 1MJUL 4JRWA 4P59H 3GSOA 4U1KA 3QXAA 2DQFA 1YEKH 3KNBB 3U1SL 5HYIA 1NCWH 3JWDL 1NCDH 4U1MB 1JFQL 5D1XD 3RPIB 1PGRB 3WXWL 5I6XB 1YJDC 2I25N 3BDYL 4KUZH 2HKFH 4IMKC 4LVNB 3RNQB 1S78D 5HHXL 1DQQB 2RIKA 3L5WB 1FORH 3KG5A 3S4SB 1JK8B 2KUTA 5IBLC 5DRXB 2VNCA 5IB2A 4U0QB 1R5WB 1S9VA 2AKRA 4M7KH 2PETA 5HYJD 4OQTA 5C0CB 3HMXL 1C5CH 3ARBA 4JY6B 4PS4L 2J1KA 3H9SA 4U05A 1KELH 4PGCB 1ACYH 5I17A 1XF3B 2GQHA 1MHHB 1OGAA 4HIEA 3MYJB 2DM2A 5KN5A 3ZSTA 1UT9A 5IP4A 4E42B 5DQJB 1EBPA 3DMMD 3GMMB 2P5WA 4EUPG 3VD5A 1CD1B 2FB4L 3F7VA 2AXGB 2BSSB 3MBXL 5IIEB 3SE3C 4OZIF 3BZFB 1UA6H 3SDCD 4FQLH 2FH8A 5DA4A 3TGXA 2ENYA 3E6HB 2NY4D 4Z0BH 2WSKA 3LMJL 1U95B 4KUCF 3WUWB 2Y5TA 3DNKA 1DFBL 1WTGT 3QQNA 5E2WL 3TF7C 1ZKAA 2YPVH 4PRBB 2VWEE 4P23C 4HWZA 2DWEA 2W65A 4M00A 4MQXC 1A6WH 1CQYA 3GRWA 3WNPA 4O58L 4U6YB 3RBGA 1UB5A 1PD6A 3KGRA 1LMKA 3UYRH 1AIFA 4EXKA 2HJKB 2IAMB 4LVOC 2C4XA 1IL1B 1D6EB 5CAYB 5ALCH 3BIKB 1JL8A 4P9HL 5FA4B 1I8MA 5HI3C 1B90A 4KDWA 4M93C 5FYLE 5I1LA 1PY9A 2BP3A 3VFOB 3OV6A 4M62L 4AQOA 1G6RA 1DQJA 3ARFC 1A7NH 1D5XA 3ZO0A 1U8HB 1KEGL 2LABA 4KKAD 5DMIL 2WUCH 5F7NC 4CVXB 1YYML 2Z93B 4XNQA 2OZ4L 1LNUB 1HZHL 2X1QA 4W4OA 4XCEB 5CSGA 2DYPB 3V6OE 1EXUA 1ZS8A 1I1AD 1RUQH 4XP9H 4Y16C 4MXWH 1WZKA 2VDRL 3QUMB 1BWMA 1NPUA 3SGKC 2VLJE 3LS5L 1KACB 2YZ1A 2H3NB 3HUJA 4JO4H 1YEEH 4Z95L 3SE9L 4XX1E 3W9EB 1FRGH 2P8LB 3EDDA 4OCRH 5B8CC 4NQCE 3VWJA 5AUMB 4XVJH 2VQUA 4IIQB 3WFDH 2B0SL 1RFDH 1E27B 3HR5A 2EIEA 1WBXB 2KH2B 1RZGA 3QSKB 3NFNB 5EB9A 4OF5A 3IAPA 1CL7I 3EYQC 2P5EE 2QTEA 4MB3A 4WFED 4X5WB 2D7MA 5EH1A 3QEQE 5FUZH 2XTJB 1NGQH 2BMKB 1CTNA 2BJMH 4NQEE 5I16A 4JEGB 4WY7H 1KJ3H 1IC5L 4FQIH 3RWHB 5E5MB 2JKXA 5JZ7D 2AK1H 5D72L 5EBMA 1FFPA 2FR4B 1NSNH 2AJXL 1VKXB 5AYUH 1MFDL 4Q0XH 4WUUE 1S7UB 1U8NB 4MAYC 5GRVL 5DJZA 5ACZB 3NIDF 1I3GH 4FQJL 4KJQC 5FFLA 2D7NA 4DZ8B 5HI4D 1KJVB 5DI8A 4F9PC 2C4FT 4FP8H 1J8KA 4L4JA 3TIEA 2VISA 3D39E 2O5ZH 3GHBH 1QYGL 4HKXA 4U7SA 1S7XB 2ZG2A 1J8HB 5FIEA 4NDMB 4ZXBD 4FZ8L 4ZPVA 3BWAB 4OKVB 5ELIA 2XI9A 4HC1A 1DVFA 2BY3A 4POYA 2B1HL 4KGJA 1N3NA 1NGWA 3CFIC 3HFML 2ILLA 3TYFA 5E56A 4WNQB 2QHRL 1Q9OB 2IMNA 2XN9A 4HPOH 4PJ7E 4JJHA 3ROLB 5EBWB 3EYUL 1UJ3C 1UWGL 1WBYA 4Z5RA 1I1FB 3B9KD 1WZLA 5BV7C 4QNPE 4P5TD 3I6KA 3WN5C 4KHTH 2VXVH 1Z0NA 4L3ED 3V4PH 4Y5XC 1RU9L 3P0VH 4M02A 4Y4KA 4BH7B 1IC7H 2EYSB 3HMWH 5FHBL 4YHYC 4MMXC 3LV3B 1D5BB 4U7MA 5FKAB 4LCCA 1OTTD 2X1OA 3NCJL 4P4KA 3SE8L 2EH8L 5CWSB 4M7LH 1QSVA 4YXKH 3N9GH 2BOCA 4M3KB 5DD1H 3GSNA 3UTQB 2E7LC 2CDGA 3HAEB 5DRWB 1J1PH 2WBWB 3HC4H 5BRZE 3TZVA 1PX3A 4GS7C 4HGWB 3EBAA 4L8BB 4F7PB 1AC6A 3S3SA 2ITDB 4JPIB 1MIEH 3TNNA 4D3CL 4PJHA 1JZ3A 4LSUH 1AE6L 3WIIL 15C8H 5HGAA 4G6KL 2EC8A 1MRDH 5D1ZA 4C59B 3VDBA 2X4RB 5GRZA 5I1HH 4BSVA 2A77H 1S7WB 3NCYS 4PJDB 2GSGB 2MQ3A 3O4OB 3ZKXC 3ILQC 1D6VH 4JO2L 2UUDH 5DA0B 2IH3B 5C6WH 5I1JL 3KJ4B 1NEZB 4JRYE 1NFDB 3EYFB 3FN3A 4HJGB 3GMRB 1FN4B 2XXCB 4HGMA 3MRKB 2X1PA 3H9ZA 3EFFB 4DAGH 1T0NA 1G7HB 2B8OT 4H25B 4JQVA 3VH8A 1F00I 1T03L 4WFHE 1DQDL 4AK1A 4P2QB 3VFRA 2N56A 1ES0B 2GYSA 1FL6A 2MSPA 1MNUL 4UT7L 4QRSA 5C9KA 5TF0A 2IPUK 2AJ3B 2JCCB 2IPKB 5IGXH 1YY8B 1GZQA 4FQXD 2B4CH 1P2CA 4U1NA 5I1AB 3ISWA 3PDOA 4JFYB 4P49A 3EDJA 1A1MA 5B22A 5SWSB 2VDOL 2ARWA 3RWFA 2O61B 1YC8A 1KLUA 4WV1A 1A7QL 3WIHH 4ELMB 5DWUH 4EDXA 4K8RC 1Q8MA 3TVMA 5JW3H 2A6KA 2A6DB 3O4LB 1NFKA 3NVQA 4ELKA 4JFFE 1Z3GH 1R3JA 2YRZA 3MV11 1FYTE 4JHAH 4LU5L 5DRZA 5JORB 2Y07H 1JN6A 3BQUA 5HI5C 1F45A 5I18H 5CEYB 3AFLA 1EFQA 4L5FH 4PRDA 3S34H 3ES6A 4PUBL 3L5JA 4CVZB 3S4SG 4MB4A 1ONQA 4GXUN 1LP9E 2LQRA 4LLMA 5D2NE 4NFBA 4R8WH 2RHEA 5I73B 4NKDB 5EO9B 3FCTA 1I75A 1PFCA 4PJGF 2XXMB 4S1RH 1MCQA 2L7JA 2EXWC 4HDIA 2NTFB 3V6FB 1MCFA 4KMQA 4Y4FD 3V7AE 3F7QA 3T08A 5MERB 2BCKB 4M8QA 5T33L 4JKMA 4P5MB 4X6EA 3ARGC 2UWEE 4M5ZL 3OKOB 4XCCL 5DUBA 4NN5B 1N59B 5F96H 4NZTH 3GMLB 1AHWB 2GEEA 4OD2A 1N7ML 4KXZI 4XWGL 1A5FL 2CLRB 5KJRH 43C9A 4HT1H 2FSEA 1N64H 3ZZ1A 4F15B 3L5HA 1QBLH 3MBED 4XNMA 5DFVD 1TVDA 2DQEL 5E2UL 3V6OA 1F4YL 1MCSA 4HIJA 4FQ2H 3V7MA 1AP2A 3WUWG 3VFNB 2VTFA 5IHUH 3PWJA 4HBCL 4RAUB 1P7KA 2JK5B 2VLJA 3KR3H 4NO5A 1CG9A 2CSPA 5JW4R 1ITCA 4NQCA 3DRTB 4LSPH 3VFUA 1V5JA 4JGUA 5EIIB 2XZQL 1KN4L 1NGYA 1G7QB 3OX8B 3QB7C 4AY0A 4D0BA 3DXAA 1CCZA 1FIGH 4L8DB 3TA3A 5FO9A 3FO1B 3T1FB 1XIWA 2EIBA 4O02L 2E9JA 4TSAL 4F80A 1EPFA 3QUML 3G08A 1A6VL 5IMKB 4HHAA 3TO4D 3KWWA 3ZYZA 2P5EA 4ODTH 2YPKA 1A7OH 1QSEE 1UH4A 3QEQA 1JYXA 4NNYB 2R1WA 2YHGA 2VR9A 3FMGL 4NQEA 1RJLB 2AK4E 5HGBB 4OCXH 4PRAB 5ETUA 5CGMA 1RZKL 2YOCA 5DC0A 4KI5D 4RFNB 2WBJB 1JHLL 1FV1A 2OTPA 1HYSD 5JIIA 2WLZA 2PXYB 1CQKA 1LO3H 4WUUA 1B2WH 3BT2H 3DIFA 5LCVH 2FL5B 5JLZA 4KY1H 1NLDL 2AJYL 5CUSH 4XHJD 3RTQB 5I8OH 3CX5K 1TPXC 3QUYB 4NN7C 1N6VA 1F90H 2VDPH 3MROA 1T5WA 3D39A 3GSQA 4JR9H 4ORGA 3NIGE 1A3QA 5DO2D 4JO1L 2ZNXA 3FHQA 5EWIH 1LO2L 3EDEA 3VFPA 1IC4L 4MDJA 2OTWA 1CD8A 4L9DA 4JY4A 1QP1A 4HUUA 4LGSB 5D7JA 4NO3A 3ABZA 5E2TL 4MNGE 4PJ7A 1OGTA 1X7QA 4GBXA 5DMGC 4M48H 2YK1L 3BKJH 1KCRH 4KQ3H 1JPSH 3W11D 3MRCB 4GMSL 4U7KA 4GLRH 3OXSB 3MREA 4XI5C 3U0PB 4XVSH 5KANG 3GBNL 1INDH 4LARH 3O3BA 4ZFOA 3HMXA 4QXUL 4XPGH 1AR1C 3N85L 1PKQE 1AFVH 5I2IA 5A2LH 2XV6B 4DGVL 4N90E 5L88L 5DS8A 4PJBE 4LCWB 3WLBB 4TOYH 2ZJSL 2JB5L 2AXJA 2YPLB 4JFPB 4NO2A 4Y88A 3OR7B 2NY5L 3BN9D 4PBWD 5TE6L 2EDTA 5J1TC 3SCMB 2BFVL 2PW1B 4X4XA 3LKOA 2YD9A 3CFJB 5J6GA 1OAYL 1QSFE 2B20A 5BRZA 4S1DD 3ARVA 3RHWF 4TRPH 2HFFB 4KK5C 1JUFB 1A02N 1U6AH 3FRPG 1YNKH 3GIVB 5BV7H 2DWDB 3X12B 4RFOH 3MA9L 4QHKJ 4ODSH 4ZO7A 4MNHA 2ZSVA 1QFOA 5EOTB 4DTGH 4IRJD 4P3CL 4DZBA 1FNAA 2R2HB 2Y36L 3IYLW 1NBVH 4UQ2B 5H37G 5D71H 1G9ML 1SJVA 1ZA3B 4JM2F 1AO7D 4Q9BA 4W70A 3P11H 4JRYA 3V5KB 1MREL 2GCYB 2OR9L 4UIMA 5BXFA 4YHKH 4WTZA 5J12B 1OP5H 4QHNA 4GAFB 5F8QC 2R1YB 4QTHB 5JW5B 4N1CA 1CE1L 2X1XR 4ODVH 1MUJB 3QUZB 2BX5A 3CCHB 3DUUB 3MRBA 4JGMA 3EGSA 4M7JH 5F89A 3W9DA 5DQ9A 3HAEG 4MB5A 1IGMH 1U3HD 1X4YA 5HHME 2F74A 5LGJB 4ONGH 2RB8A 3MZGB 1NDMB 2DLFL 3IDJA 4U1LA 1BJ1J 3UTSB 1YUHA 3QIUB 1FP5A 2XOTA 5CD3A 4JPKL 4QO1A 3F12B 5FGBA 5JOPD 3AU1A 2I27N 4I48A 2DM4A 2HMID 1H3UA 5E6IA 1CGXA 2BDNL 1AXTH 1PG7H 2PTUA 2HG5B 2FATL 1TZIA 4HUVB 1A64A 2OK0L 2DI7A 5EO1B 1I8LC 5IWLC 4DK6A 3HG1B 3QIBA 4XP4L 4JFFA 4GKZB 4PRPB 2OBGA 1SEBB 5KZCD 2DMBA 2GT9B 4OIAA 3U4BH 5DJXB 2DLHA 1MPAH 2OS7A 4A2LA 4TNWK 5C6TL 3OHXA 4MA7H 5CKGA 3LN5B 5GS2H 4I18A 3T8XB 4JDVA 1IM3B 2GSIA 4YHMH 3D18A 1LP9A 1XH3B 2WUBH 4TVSa 4OLWH 4WCYL 5D2NA 4Z78A 4HH9B 1NKOA 3HC0A 4OUUA 1H3PH 3LEVH 2E7HA 1INQA 2BC4A 4RA0C 5FYKD 3VI4E 1VADA 1MWAB 4OLEA 3ULUC 5E95B 3QPQC 2O93L 43CAB 4JRXD 3C5ZD 3DUSB 4APQC 1K5NB 1AKJD 4JFQB 2LFGA 3WNKA 5EPMB 2E7MA 4MJID 2YD4A 3NPSB 1HDMB 2UWEA 4UINL 4UQ3B 4DKEL 4JFDE 3QWQB 1OSZB 3FT4A 1KJ2B 3AUVA 3QFDB 1A6AA 1L7TL 2XTJE 2DJUA 3I75A 2PTTA 3BRGC 2OL3H 4L4TE 1D7FA 4CBPA 1EEYB 1RZIA 2BNQB 3QPXL 3VGAC 1WICA 1FCCA 3D2UD 4B41A 3DX9A 4O2FB 4RQQB 5CS7A 3BP4B 3MR9A 4OB5L 5DHYB 3D69A 1QFWH 4J4PC 3ULVL 5FHAH 4P99A 1A4JA 5EA0L 1JF1A 3RWCB 4RCAA 1NC4A 2PCPA 4QGYA 1C8PA 5L8LB 3VJ6B 3FRUA 2E8YA 1CFVH 4M1DH 2WWKT 1WUNT 4H0HB 2AXHA 1PAMA 5JR1L 3MODH 3VFTA 5AZEH 5T5NF 1BWWA 4G43A 5CCKL 4G6JL 4RGNC 1BFOA 1ORSB 2W1NA 4LSVH 4XPBH 3ARYA 4WJ5A 5BJTB 3SN6N 1S7RB 4V1DB 2X70A 3GMPB 3HZVB 1QSEA 4FQHB 2RFXA 3VMOA 1CD9B 4G9FB 1NBYB 1SVZA 2AK4A 1QRKA 5E8NB 1I1YB 4K7PH 4X8JB 5AWNL 5C0GB 4QRRB 5LWYH 1FNGA 3GKWL 5HHPB 5DJYB 3NBNA 2YZ8A 4PRHD 5CP3H 5E2VH 2O5XH 2YN3A 4XBEH 4LOUD 5DK2B 1BEYL 4OTXL 5L6YL 3PHQA 1UKSA 3DECA 4HZLA 4CL7A 4QGTA 5CEZL 4N0RA 4MLSA 5CIPB 2X4TA 3MC0A 5C0DB 3FB8A 1U8PB 3BISA 3QP3A 5EBLB 3QDJD 4O51A 1CLOH 4OD1H 3B4NA 3RVXC 3Q3GA 4Y2DB 4XRCB 3PV6B 5I75C 1ZA6A 4PJ9B 5C7XL 4X7TA 1RIHL 4MNGA 4BKLA 3MRJA 1MVUB 2Q7YA 1S5IL 5C0BB 2VL4A 3CSPA 3RAJL 2ATKB 1IAOB 4NNPH 4I4WA 3KNBA 1EH9A 3IFLL 1UH2A 3GJFK 1HQ4A 4U1MA 1JWMB 5IQ7H 3RPIA 3OAUL 5FYJD 4Z9KB 1CLYL 1PKQA 1RUPH 2NQCA 2OQJB 3ARBD 4UV7H 4I0CC 2WWMD 3ARZA 3H9SD 4PJBA 5J0BA 1DQQA 3TO2B 5JQ6H 2EYRB 3QIWB 3S4SA 1JK8A 2Z0BA 4X80H 4H1LG 3RWEB 4KRLB 2F15A 3WFBH 3R1GL 5DRXA 5F1KC 3PP4L 3CFDB 1R5WA 3CK0L 4PLKD 3V5DB 3DX6B 1QSFA 1ERNA 2HTLC 1EFXA 1J10A 3V0VB 5C0CA 1JRHI 3LKSB 4HXAH 4RMSA 2P5WD 1T21B 1W72B 3TH4T 7FABL 2IMMA 4K9EL 4XPFL 3MLWH 2ED8A 1FGNL 1NGXA 1TZHA 1MHHA 5E94B 1CI5A 1N0XL 3MYJA 2FLRT 4ELME 3MRGA 5TDOB 5DQJA 3AS1A 4FTVD 1BZQK 1MCJA 3GMMA 3REVB 3C60B 1V3LA 3RVTC 1DEDA 1I7UB 3MUZ1 4NO0B 2XA8H 1CD1A 1TZGL 3FJTA 3GSRB 1DL7H 2LU7A 4HLZH 4PLJC 2BSSA 3IJSB 1LD9A 3QXTA 5IIEA 2F53D 3LY6A 3BZFA 2K9UA 3KPRB 2V7HA 1IGYB 2XTLA 3VXQB 3ILPB 3WSQH 2NY7H 1FG2B 3WUWA 4KVNL 1CTOA 1OAZL 4OV5B 5MP6L 5JHLH 1T80A 1JZ6A 1G7MA 4WWKC 5GHWL 5E99H 4YBQD 1DP0A 4PRBA 2BXYA 1J1XL 3V8CA 4OFPA 1NFIA 2YUXA 1WCBB 1P1ZB 4UB0L 2BRRH 4HXBH 4U6YA 3FQUB 3MRPB 4PV8B 3ULVE 1YECH 4KPHL 3KPOA 3JXAA 1A6UH 2DL2A 2HJKA 2IAMA 2IG2L 3BIKA 3L9RA 2QADB 1EO7A 2NY1D 4K3EL 5FA4A 3VXSB 5IMLA 3EAKA 4OFYA 1A6PA 2FYYA 3S3JA 1FVCB 4R3SB 3EJYC 2D4FA 1WCQA 3BYYA 4I77H 2EH7H 1F02I 3QUXB 1U8HA 3QDHA 3OMZA 3CXDH 3JTTA 4G8GB 4Z7QF 3RGVB 4CVXA 3BP7A 3PQYD 2CUHA 3ROOB 4YUEH 2DYPA 2LVEA 5ACMA 2ENSA 1N5YH 2Z8WC 3D0VB 1ZVSB 4NZUH 1QFWI 3MFFB 3QUMA 2R2EA 3BFOA 1AI1L 2APTA 1NC2D 2P8LA 5DMKA 3NZHH 4DEPC 2CK0H 3QDMD 4G7YH 3ALXA 1D5IH 4IIQA 4OZGE 5J9PA 4PV9B 2NY0C 1QLFB 1WBXA 3U6RB 5DSCB 3O6FD 4OZHF 4MZ2A 3T0EB 1T7WA 3NFNA 5I0DA 1A9EA 5C08E 3CVHH 2XIDA 4JFDA 3BKCL 4X5WA 3UDWA 5CEZE 3IDXH 1UWEL 3DGGB 1E6OH 4L4TA 3TV3H 2CKBA 3QCVL 2H32B 3IFOB 3JV4B 3QG7L 5T1KB 1MWAL 3RWHA 4JVWA 3AC0A 5HVHC 1KN2L 2R0KL 5IM7B 1RJYB 2ZUYA 2FR4A 3V8OA 1U8NA 3GI9H 4HKBB 1ZLVH 3KXFB 5IJKC 4UIKH 1OT1A 4DZ8A 1KBGL 3MJ8B 4X8XA 4LCIL 1A4KB 2XN9D 4LPWA 1P7QA 1TQBB 5EU6D 1Q9KA 4L4VD 3I3EA 1S7XA 4HK0B 3QO0A 4NDMA 5ENWB 3BWAA 4DVRL 3U7WL 4OKVA 3F6IA 4R7DA 2Z31B 4IHOB 3RUGF 5GGQL 3WKML 3R0NA 3C5SA 2CD0A 1VFBB 2FBJL 4PG2A 3C6SB 3STLB 2VZ3A 1BQLL 1Q9OA 4HIXH 3QAZB 4QHUB 4XB7A 5E5UB 2CK2A 1MFNA 5C07B 3ROLA 3HE6D 1S9KC 4FFWC 4ODWB 1T83C 3FB6B 1RK1A 1I1FA 3BIBX 1JTTA 3E6FA 3M17B 2Y6SD 2ADJB 5T3XL 1QFPA 4OBSA 5TQ2H 1NCTA 4IS6B 1L0QA 3EJZD 1FZKB 1RSFA 4J23A 4PTTB 4Y4HC 1MAKA 3LV3A 1D5BA 1U3YA 1RV6X 1ZAGA 2FX7L 3AM8A 3E1F1 4WEMB 2PYFB 5FKAA 5GSRA 5DLMH 3FQTA 3S37L 5HD8C 1R3LB 2VH5H 3G5XB 4HUMB 4MAUL 4C56B 2L4OA 2ZUVA 3BPLC 3M8OH 3OB8A 5DJCB 2VKWA 5DRWA 1LO0L 3MJ9L 4Q9RL 1S9XB 1QZ1A 1U8KA 3T0DA 4NGHH 4HGWA 3RZCC 4F7PA 2VLRB 3M07A 3PNWA 4V2BA 3GHEH 4BZYA 1YQVL 1XCTB 2NXZC 3MV8B 1QLRA 1QNZL 4Z8FH 3EYSL 3CNKA 3JWOL 4X6FA 2ADFH 4JANA 2X4RA 1MQKL 4RX4A 4LCUA 5T3ZD 3P0YL 3X3FL 1CFQA 5ILTH 4FQXC 1FFQA 2IH3A 4DGYL 1NEZA 6FABH 3WLWD 4HJGA 3I50L 1OWWA 3V79C 4KKCC 4DQOH 3PWVB 4JFXA 1LK3L 1G7HA 1RUAH 2IPTH 5FEBA 1UCTA 1M7XA 3K74B 4LHUG 3RIFK 4LLQA 1BFVL 5FXCH 3OJ2C 2R0ZH 4N8CL 3UYOD 4J3OC 1ES0A 3IAQA 3GO1H 5TQ0H 2IADB 4QRQB 4OZIE 1Q0YH 2A6JB 3AMKA 4JM2B 1L7IL 2VZOA 5H35A 1HKLH 2AJ3A 2IPKA 1YY8A 5IB3B 4OLUL 5L7XL 1YZZA 4MCYB 1XGQA 5EOCL 4YHPB 5SWSA 2Q87A 4UI2A 4ZODA 1YEFL 5INDB 2O61A 1AJ7L 4Q6IC 2FHFA 4H20L 4ELMA 2N4IA 1QRNB 4GW4B 4J6RH 2ZUXA 1ZLSL 3V52H 2A6DA 3VRJA 3O4LA 3CDFA 3ME0A 3P30L 3H3PH 4HFUL 4N9OB 5I1GH 2YMXH 3IU3B 4Y89A 4PRPE 5DJ8B 5TE4H 1EHAA 4AYFA 2A38A 6CGTA 1VFMA 5LBSL 1IM9D 2GJ6D 3BRDA 2Z8RA 3BE1H 4GRLB 5EC2B 5JORA 2B1AH 1F97A 4I0PC 2F8OA 4Y4FC 5CEYA 2HLFD 4KKBC 5SV4A 3Q5YA 4CVZA 5C0IB 5L8JB 1JGUL 4TUKH 4NHCL 1I7ZB 4TSBH 4WI7A 1A7PH 4NKDA 5EO9A 1G7IA 2F19L 1FGVH 1NUDA 1FFNA 1N4XL 4O9HH 3U0TB 5TPWL 1L0XA 1FZMA 2NTFA 2VITB 3QJHB 3T2QA 5E2JA 5F3HA 3QRGH 2AJZA 1V7NL 4AEHH 5MERA 1IILE 5E9DD 1QFUL 4FABH 1NAMH 4P5MA 1GOFA 2DI9A 4XBGB 5JNYB 1KOAA 3F6LA 3OKOA 1QBAA 3SDDC 4PP1D 3U30C 1T1WB 4G6MH 4EQ3A 5IESH 3RDTA 1DBAL 1AHWA 1FVEB 3P3YA 1G9NH 1ZT1B 2BNQE 1Q1JH 2CLRA 2YKLH 4GRMB 4MJ2A 4EN3C 1BM3H 1XGRB 5GIRB 2WINB 4DFHA 4G3YL 4YDJB 3FTGA 1AGCB 2M26A 1FPTH 3NH7H 1M6OB 2YA1A 3DXAD 3V4VL 1G7PA 3VFNA 5EUOB 4G7VH 4RAUA 3TN0B 2DKMA 3H7BB 2H6PA 3QEHB 1UGNA 3WS3B 4PLOB 2BXZA 4AENB 1JIBA 3TBVA 1WEJH 4U6VH 1G7QA 2XWBB 4OZGA 3QEQD 4MLIA 5T3XE 3OR6A 1OD7A 2VDMH 4NQED 4L8DA 1BVLA 4J8RB 1UJTA 3VXUB 1HYSC 2HTKD 2VSCA 3FO1A 2A73B 5DT1H 3T1FA 2BRQA 3E8UH 3G5YA 3QQ3B 4S0SD 5DZNA 4YWGL 1CS6A 1EAPA 1RUKH 5C08A 3O6LL 4FMKA 3REWB 4M1GL 2FGWH 2Q8BH 3FFCB 4WUUD 3ARDB 4GT7A 4ODHL 4YR6B 1JNLH 1TVHB 1MCOL 2DIAA 2AI0H 4NNYA 3AREB 1CL7L 25C8L 4YIQB 4Z0XB 1RJLA 5GSVA 5HGBA 1EJOL 4RZCA 4PRAA 2AP2A 4QRRE 3UPRA 2Q76A 1JNHB 5FOBB 5C09E 2WBJA 1PQZA 1WF5A 1AD0A 3D39D 3VE0B 3ALPA 3QHTC 2NY6B 4MCZB 4NP4L 3WHXB 2PW2B 1FSKC 5DGRA 3RTQA 4DN4L 3WFCH 4KAQL 1DEEB 1U8OB 2FH6A 5IMMA 2ZUQC 5GZNC 1RHHB 2DBJA 2H26A 5A2IH 5DXWA 3VFSB 1FHGA 1ZTXH 3RBSA 2DQUH 3MV7E 4GBXD 5FCSH 3OJVC 2DQDH 4NCC1 3TJEL 1WC7B 2FZ3B 4WFGE 4U0RB 4ERSH 1H5BA 5E1HB 5CZVL 2AS5M 5J57B 1S7TA 1T0MA 3UJTL 1TCRB 4ODUB 1UH3A 3B9VA 2XYCA 4OSUH 3AGVA 2F8VA 1FL3B 4G80B 2ICWJ 4Q2ZA 3UTTD 5D1QB 2G60L 3MRCA 4KRNA 3BN9C 1QPPA 4HLJA 1VACA 3CFCH 3O0RH 1CLCA 1EAJA 1IEBB 3THML 1M7DB 5I19L 4P59L 2VDLH 4UBDC 4Y19B 5DMYA 3MOBH 1UXSB 3C87A 1NCWL 1X5ZA 5E8EA 4LCWA 3WLBA 5BW7C 4F33B 4WUKH 5GGVH 3OKKB 3OR7A 1F3JB 4KUZL 4ENEC 2HKFL 4X7CC 4MD0B 1GGCL 2PW1A 1Y0LA 4TUOB 4G9DB 3CFJA 1CK0L 3DRQB 1GPOH 4K3DH 5J8OA 5BZWA 3V6ZB 1LO4L 1P69B 4NQDE 5KSAC 1OWRM 5EDXA 4RRPG 2CJUH 3O9WD 4M7KL 4U6HB 1AD9B 3PJSB 2DWDA 1C5CL 3X12A 3MRNA 3ZYOA 2QQKH 4PJFF 1CXLA 1FO0H 3TCLB 3D85A 5EOTA 5JTWA 3FZUC 2R4SH 2E9BA 4UQ2A 1U8JB 2M8XA 1AC0A 4NQUA 3OGOE 5F7UA 2GW5A 2BSED 3KPRE 2MHAA 4NN6C 3V5KA 5HHNB 4WW2C 5IHLB 4UT9H 4YE4H 1F5WA 4P2YA 1E4JA 1YNLL 2G5BB 3R0MA 5JW5A 1OVZA 5DR5H 1MUJA 3HZKB 3CCHA 1UA6L 1RZJC 4FQLL 4NIKB 1NMAH 3HCVB 4OZIA 5LGJA 5HBBA 1QD0A 2KZWA 4J3WA 4V2CB 1ZV5A 3OQ3B 3QIBD 3MYZA 3UJIL 3I6LE 4JFFD 2VZSA 1C5BH 2YPVL 3F12A 5GISL 5HSFA 3MV9D 4R90H 4DKAA 3D9AL 1XF1A 1A6WL 2HG5A 4JFEB 3VXSE 2GITB 3MLVH 4KJWC 4HUVA 2ICWB 5IV2B 3PL6A 3UTOA 5EO1A 5C0FB 4JKWA 3DO7B 5HDQL 4FXKB 3HG1A 1X4ZA 4PJGE 3UYRL 2VERN 5ID1A 5ALCL 4GKZA 4PRPA 5LQBH 1HILB 1SEBA 4PYGA 3T2PA 1D9KC 4P23B 4OM1H 2EDXA 4L29B 1ODAA 4XP6L 2I07B 4L8CB 4HS3B 4U1HB 1XZ0A 1IM3A 2WUCL 4PBXA 1J86A 4LVOB 3EOBA 3IRZA 4HUWB 4RISH 1XH3A 4UILL 4HH9A 4WEUD 4EI5A 3C2SA 4XZUB 5DJAB 1RUQL 5IB1B 1ORQB 3ARFB 1GGYA 1MWAA 5DJ2B 1GGBH 1UCBL 2M2DA 4XCNB 4IOIB 4M1CC 4JO4L 1YEEL 43CAA 1SEQH 1FRGL 1RUMH 4HG4K 4OF6A 3DUSA 3NMEA 1B88A 1K5NA 4HCRA 1YPZB 4D2NA 4JFQA 5EPMA 5IFHH 4PREB 3WFDL 1HDMA 3P9LA 4Y16B 1RFDL 3MRDA 4UQ3A 4KJPD 3MLSH 3OGCB 3QFDA 3SE4C 4GW5B 5J11C 3RA7