2DQDH

Crystal structure of hyhel-10 fv mutant (hy50f) complexed with hen egg lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
b'DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGFVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqdH00
2OP4L 4AENB 3BUYA 5I74C 4Y19E 1X5IA 3PXHA 4G9DA 1CFSA 1G7JA 1WFOA 2SEBB 4G43A 3GUTB 3GSQA 3VXRD 3MLUH 5DI8B 1P1ZB 5K9QG 2V7NB 5IW1B 3Q1SH 1NL0H 1T2QL 4X9GA 1EJ6A 3K2UL 3T3MF 1KOAA 3N85H 3RWIB 3Q6FA 1I8IA 4OZ4A 2J88L 4OLYL 4YDKL 1A7QH 1CE1H 3WN5A 1Z3GH 1SBSH 4QRPB 1DQQB 2XWJB 2FEEL 5DJ0B 3S5LA 3LEVH 3THML 4NRXA 2X1WL 1Q9KA 4FXGA 1A7NH 4YE4H 1QBMH 4HFUL 1KYOK 3G04B 1MI5A 4L3EE 2E9IA 1NAKH 5IGXH 1P4LB 3KPOA 2X4QA 2VDRL 4JPWL 3BE1H 3Q0HA 1OTUC 3PHSA 1T5XB 2NTSP 3RGVD 1Y18A 2F58L 3QJFA 3PHOA 3VWJD 3I02A 5J0BA 5JPNA 1A5FL 3VXTB 1U8IB 1WIOA 1J18A 3BN9D 5D1QD 5HHXH 3QAZB 2DLHA 7FABL 1T03L 2NY7L 1A6AB 4NJ9L 5BOZG 4N8VB 4WFGD 4WU5A 3S3SA 1YN6A 4GJTB 4I4WB 2XKNB 3RVTC 1EHXA 2BZDA 1NC4B 3VGGA 2R1YA 1RAMA 1TTGA 2NPLX 4GW1A 2VIRA 2CKBL 4J3VA 4YBLB 4LVOB 1F4XH 5L9DH 4R4BB 3RAJH 1RFDL 5E9DB 1CDIA 3WN5C 5JNYB 1I8MB 1RD6A 4HWBA 5C8JA 2O93L 2W59A 4CVXA 4J12A 2GI7A 5HHMD 2C9AA 1S9WB 3BJ91 1NGXA 4MNQE 4G6MH 3ZKXB 5B4MC 1A6WL 5C0RH 1QQDA 3NA9H 3EHBC 1AD0A 1CGUA 1UWGL 4UIMB 4KZEL 1TXKA 3ZYJA 3QIBD 3IXAA 3O9WB 3AAZB 4G8EB 5C0BA 4YHNA 1XGPB 2ADJB 1FRGL 1LEKA 4AEEA 3NFNB 1CBVH 4JRYD 1NGZA 3BKCH 1M7IB 3WFHB 4L9LB 5M94B 1S7UB 2E5EA 3QHFL 1FZKB 3IAQA 5ID0A 2FX8H 2Y06H 1OD9A 1XIWB 3MSPA 5C0CD 3P0YL 1AXSB 5DS8A 1FZJB 5F7MC 4AG4H 2NTFB 4XC3H 2AVGA 5DRXB 2AEWA 5ICXA 3MRKB 1I1RA 4PS4L 4I1NB 2CD0A 3C6LD 1GGYA 1WEJL 1PY4A 2BSRA 5IVOA 1BQHB 2Y9RT 1M05A 1BZ9A 1C12B 1FORL 3OAYH 3BZEB 4CNIA 5F6HJ 4LNRB 4RIRA 4OFVA 4PRIA 1B4RA 3VFRA 5EUOE 4QRQB 3G6JA 1FVEA 1I3RB 4P46D 4X7CC 4LAQL 5CJXA 4PJ9A 3GNMH 2YPLE 3MOAH 4XP5H 3TV3H 3PNWA 3RZCC 1N7ML 2V5RA 4C83A 1AD9A 4EN3B 4ZUUA 43CAB 3DYPA 2F9BT 5DHYB 1F6FB 1HZHH 5C2UB 2Y6SC 4NIKB 5IVNA 4JRXB 2OL3A 3NOIA 3V52L 4K9EL 4EBQL 5EU3B 5KN5A 2AGJL 4UQ3B 4MNGA 5LBSL 5T1LB 2D2OA 1A3RL 1S8DA 4GBXB 4X7SH 1KSRA 5GS0H 3MJ8B 1KT2B 1RZKH 4JFYA 2QR0A 4GAGL 4PRNB 3INUH 4E5XA 3S37L 5GS1B 2ZCKL 2YEZB 1MRCH 3U0TA 3SO3C 4WWKB 4XGZA 4JKPL 2CO7B 1FGNH 1OF2B 3EOBA 4M1GL 5HXMA 4JFXA 3EYQC 3CVIH 5FYJD 5SV4A 1G7LB 4CGTA 3UAJD 1B0RB 3MRJB 3UZEA 4RAUA 5EBMB 1CDBA 4ZS7L 1VFUA 3ZTJH 5EIQA 3LEXA 4WO4D 4NO5A 4Q0XH 5FA4B 4E41A 3GSNA 3H7BA 1RJZB 4BZ1L 1J5OL 2WW8A 3DX7A 1NSNH 5EC1A 5CJXC 3W9EB 1FVDB 4PJ9C 3CH1A 3SQOL 4LU5H 2EYSA 2VUYA 4POZC 4S0TD 2J4WL 4HIJA 4RMSA 3W39B 1AHWB 4L8CB 3O4LA 3QDME 1UEYA 1YEIH 3TNMB 2F5BH 1OSPL 5I1AB 1YPZA 5JMOC 3OSKA 3PL6A 4L4VE 3C5JB 1II4E 3C8KA 3EO1B 3KYKH 1PKQE 3TBVB 4FTVB 1A4JA 3T0WA 3HMXA 5FYKU 4JY4B 5J12B 5DJDB 1OAZH 2CMRL 4OCNC 3CFDA 5EU6B 2WNGA 4KQ3L 3SGEH 5TE4L 1F02I 1QSFA 4JPKL 4WJ5A 5F3BA 1HDMA 4PYGA 1AR2A 1NDMB 4XH2A 3OR7B 4BQ8A 1HHIA 1KPUB 3MODH 5F1IA 1CICC 1ZEAH 1AE6H 1YEDB 4YNYB 1M7XA 5F97E 1LK2A 3KWWA 1NCNA 1KIQB 2CXGA 3U46B 3TBWB 2XN9D 1GOFA 3P73A 4ONFH 4XCFH 2VDNH 2GJ6B 5I74B 4UI2A 4XMLH 2R23B 1R5VB 5EORL 1KIPA 4HAFA 5D5MF 3SPVA 1Z5LB 4CKVX 3C09C 1KELL 5FIEA 1HWGB 4HK0A 3BAEH 5C0JB 1U3HA 5TQ0L 3RNKA 1UXWA 5IOPB 1R3KB 3MMEB 3MRBA 3PL6C 1CDCA 1FN4A 4U6HB 3O6FC 3K3QA 4WTWA 2B0SL 3LSOB 5JW3H 2HJKA 5J1AA 4JY5H 5E6ZA 2AEQL 3VG0H 1INQA 1TDQA 2A77H 3IDIB 2ZG3A 3GHEL 4M61A 1WBZA 4LSPL 1QKZH 2L4OA 1FIGH 1CLOH 1M4KA 4GKNB 1ZGLM 4RCAA 2XT1B 4R4FH 1L6ZA 3KYAA 4Y4KB 2W07A 5HHNB 1TVBB 5EPMA 2ZNWA 2V17H 4YFDB 2MOVA 2F5AL 1LO2H 5IROA 4K2UH 4V2BA 3VFGL 3OBAA 3LY6A 4G9DB 1CFSB 1G7JB 2FZ3A 3BDYH 3E8UL 4G43B 3GSQB 4FQXD 2R29L 4Z7VE 4OIIL 1I1FA 1Z2KA 3CX2A 1VEPA 4QWWC 2I9TA 1I3GL 1U3HC 1WUNT 3Q6FB 1I8IB 2BSSA 3QCVL 1XR9A 5L7XL 3WN5B 4OSUL 4J8RA 2Q3ZA 4NNPL 3ZT5A 2L0DA 3S5LB 5FYLE 4YHPA 4FQHA 4NRXB 1Q9KB 2DLFH 4FXGB 1AGFA 1OLLA 4FXKA 1G7PB 5HHOD 3QRFM 4LASL 1QFUH 1QRNE 2ITCB 1C08A 2F8XC 1FNFA 1FDLL 1GGCL 3KPOB 2ZP0T 2X4QB 1IMHC 1CGSL 2DM2A 2EKJA 4HXBH 1PW3A 4PV9A 1Y18B 5HVFB 1IC5H 1AC6A 3QJFB 3PHOB 2F15A 3I02B 1AGEA 5GGSY 2C4FT 2PYEE 3D6GA 4JFOA 5JPNB 4HT1H 4X4MA 5DWUL 3SHSA 1UWEL 4FQ1H 3CXHK 5CMAA 3DECA 1VB9A 5IROC 1TZGH 1EZVY 4K3HA 4TPRL 1NBVL 4S1QH 3HKFA 4DGVL 4DN3H 1YN6B 5DMGC 4LCWB 3BRDA 1ZTXH 2NY4C 3CK0H 4UTAL 3L3DB 4DVBA 5JMRA 2R1YB 3VFMA 2XIDA 4GW1B 1RIUH 5F7LB 3WLBA 5JOFA 2WIIA 4NKIL 1GHFH 3STBA 1EJOH 1NCWL 3SDYH 4YHLH 3UTPD 3KLHD 2XFXB 3VWKA 5C8JB 2R0LL 1J8HA 1YYMH 4DN4L 1NQBA 4TSCH 1RMFL 3DO7A 5JW4Q 4ZAKC 1XF5B 3TT1H 5KVFL 4Y16C 1QQDB 2FB4L 2FRGP 2H9GA 1AD0B 5I18H 1BJMA 3F7QA 1I9EA 3RZCB 4OV5A 3TZVA 1N6UA 4X0KA 5C0BB 5K9OA 1LEKB 2OR8A 2UZXB 4XC1L 3QRGL 4Z7UE 1NGZB 1DLFL 2DTML 3A6CL 5F9DC 1JGUH 3FO0H 3GRWH 3SKJL 5ID0B 2NXYC 5C0AE 4NQTA 2DQGH 2DM7A 5DS8B 2MPAL 5AUMA 3SEPA 1JNNL 4U6TA 3JWDL 4HKBB 3REVA 5MEPA 5MI0C 4LGPB 4BH7A 5ICXB 3SO3B 4ORZC 4EDXB 3WEXA 3IU3A 1S9XA 1FPTL 4LCYA 1MF2L 4G9FD 4ZFFA 1T1YA 4OIBA 2BSRB 4KJQC 1M05B 2N4IA 1BZ9B 5GS0C 1OAXL 1MQKL 3RL2A 1RZKC 1RURL 5ERWA 3VWKC 2IAMA 2E6JA 2P24A 1D6VH 2Y07L 4ELMA 5F7KC 2ED8A 5I1GH 4PRIB 3VFRB 3G6JB 1FL5B 1FVEB 3RIFK 2NY3C 4N0FA 4EI5D 5DRNA 3MO1A 1MJUH 4PJ9B 5GIRB 4S0SD 3PNWB 1D9KD 1U3ZA 4C83B 4HPYL 1NCUA 3VXSD 1AD9B 1YUHA 4LEXH 1MHPL 3TZVC 4ZUUB 2JJSC 4LKXA 3V5DA 3KPQA 4ISVA 3KS0H 3WCYA 4OD1H 3OQ3B 5D7LA 2VDOH 3LKRA 2OL3B 2Z31C 3DSFH 4PJ5E 4IDJL 4QRRD 1PAMA 1ZS8A 4OLWL 2BOBA 5ENWA 1NEZG 4ZMAT 4PJIE 3VFTB 5EOCL 3B9AA 4OGXH 3UYRH 4JFYB 4GW4A 2QR0B 1UB5A 3BT2L 3LPFA 4R7DA 5EB9A 2JB6A 4E5XB 1ZHBA 1CFBA 4G7VH 3U0TB 4YQXL 1IBGL 3GB7A 4X9BA 1IGMH 4XGZB 5GRWA 5D7IF 2P47B 3ULUE 4HWBL 3EOBB 4JFDA 2BNQE 1CICB 1WBXA 4JFXB 5SWSA 4LFHD 5I9QC 4WI9A 5DEGA 2R0KH 1FAIH 3U30C 1ORSA 1A6ZB 1L0XA 3LIZL 4RAUB 1UM4H 2IAMC 1KJ3H 4MB5A 4PJCF 3EJZC 3LEXB 3GSWA 3DV6B 5J6HA 4E41B 3GSNB 1BOGA 3H7BB 2APXA 5IESH 3GSUA 1EO8H 2E27H 5EC1B 3CH1B 2EYSB 3FO9B 5FUOL 3MRIB 4L8SA 3HC0B 4HIJB 3C09B 4UNUA 5KG9A 4DTGH 2EDRA 5EDXA 3O4LB 3C6SA 5D1ZC 3WIIL 4R26L 1YPZB 2N7AA 3PL6B 4KKLD 4K3EL 1DEEA 1Q9OB 5T3XD 4UTBL 2YOCA 3O6FB 2AJSL 1A14L 2Q87A 1TJIL 3HI6L 4ODTL 3N1FC 4NO0D 3QZWG 5MEND 3KPNA 5E8DL 3CFDB 2YK1H 3BIAX 5E2JA 4WJ5B 3NGBB 5F3BB 3IFPB 4Z7NE 1EFQA 4KK8D 4XH2B 1XCTA 1C7SA 1HHIB 25C8H 4K71C 5F1IB 1DLHA 1LK2B 3KWWB 5ANMA 4JKKA 3K7UA 4QF1A 3B43A 1JYNA 4DCQA 3K80A 1KTKE 3TESA 3C2AH 2QQKL 5D71L 3ULVC 4HH8A 1HH9A 3O2WH 5GGQH 2XQBH 3NCCB 3OAZK 1IT9H 1VEOA 5KS9F 4OZIA 5TGBA 4FQQB 1AGDA 1KIPB 3SPVB 2OL3L 4L8SC 1T04A 3LRSA 4HK0B 4JFZL 4R2GD 1U3HB 3RNKB 1DL7L 1UXWB 5D93B 15C8L 4KTDL 5DHXB 1KNOB 3DWTA 4I2XA 3V5HA 1FC1A 5CGYC 1NAMH 5HHPA 1U2CA 2HJLA 2VLRE 4X83A 4XP9H 1A9BB 4AEFA 1TENA 5J1AB 5BRZE 5JOPE 1FSKC 1CL7I 3WV0A 2FX7H 3EJYD 2H3NA 5TFSH 2XZQH 3ZSTA 4LSVL 4ZYKA 1INQB 1J1XH 4JREC 1BD2A 2IGFH 1NLDL 1WBZB 2PXYD 3T77A 2KQNA 1U36A 3KPSD 3UBXA 1WIPA 1OPGL 3L7EA 1D5MA 3SGKA 2BNRE 1XGRA 4DOHB 1YNTA 1SYVB 2VR5A 4QXTB 3AU1A 5BV7H 1V05A 3V4VH 5C70A 4R3SA 2N7BA 1CFVH 3PQYA 5MEOA 3P30H 3LPGA 1BBDH 2FZ3B 1OTTC 3TH4T 4HWEL 1NFDF 4PJFA 2NY4B 3FTGA 2NZ9C 3LV3A 3P4LA 1I1FB 1CXIA 3RJDA 2AJ3A 1C5DB 4DFHA 4PJHE 3GRWA 4MXQD 4I9WE 2GT9B 1CD1B 2BSSB 5CWSB 4P5TB 5GRUH 5ALCL 3HMXL 3QIWD 5E2TL 3Q1SL 4ETQA 3AREA 4U6VH 4J8RB 3AMLA 4KXZI 5IQ9A 4XI5C 5D7JD 1JF6A 3U0PB 4YHPB 4FQHB 2LABA 4QY8B 4ZAKB 3RTQD 4Y16B 1Z9MA 4FXKB 5DLMH 4Z8FL 5HYSG 3S4SA 2R4SL 1PZ5A 5IKCA 1C08B 5EBWA 4NKMA 3H9HA 3NIFE 2EEBA 4PV9B 2G60H 2VDMH 2EIBA 3MZTA 3SGKC 4KK9C 2Q8AL 3TM6A 4D2NA 1AGEB 1EZVX 5F6HI 2EDBA 2D9CA 4JFOB 2EIDA 1ZLVH 4O2CB 4AH2A 4PRPD 1VGEH 1INDL 2JJWA 2NXYB 1NKRA 5CMAB 4QHKJ 2CK0H 5I66A 2HKHH 1DQTA 1HSAA 4YXHH 2HVKA 3GMOA 4B5EA 5LGKA 2O26U 2NNAA 5ALBL 1YMMD 2QADC 2Z8WC 5MI0B 4UT7L 5I71C 3ARFA 3MCG1 4GMSH 1RZJL 4G5ZH 1P9MA 5AD0A 5TPWL 3WLBB 4R8WL 2WIIB 3X13A 5JOFB 2QJDA 2HLFC 3QDHA 1KCSH 2ESVB 3AREC 3VWKB 4ENEC 3ESVF 2MFNA 3QPQC 4ZPVA 1J8HB 3P0VL 5IB4A 3U7YH 2KQMA 5HDOA 1MRFH 1F8TL 5DQDL 2DI8A 1EO7A 4NZRH 4ZQKA 2NY3B 1MCNA 4YWGH 2H9GB 3F65A 4APQA 4OD3L 4XVSH 3VI3E 3VGEA 1ZA6A 1EEZA 4XRCA 3EFFA 1J0KA 2CRZA 3TJEL 3TZVB 4X0KB 5I0ZA 4MJ2A 1PKOA 3RGHA 1DANU 5SWQA 5BOPA 4J3WA 2FD6H 3ZKQD 2Z31B 4QHLA 2CDFB 3GGWA 1DN2A 4OAWA 1FNEA 1VKXA 4XPFH 3REVB 5DQJA 1I9JH 3HUJE 5MEPB 4BH7B 5IJVA 4XPGH 3V5KB 3ARFC 4HZLA 5CP3H 5L2KA 1MCDA 3IU3B 1P9MC 3WEXB 2J5LC 1S9XB 2ZJSL 3RIFF 2BXYA 8FABA 3NCYS 4ZFFB 1FO0B 2JJVA 3MV9A 2XKSA 3ILQC 3MLVH 1UM5H 3U30B 4LHUG 5DHVH 2X4PA 1LILA 3QA3A 3RL2B 4D9LH 2IAMB 2P24B 2H45A 5D2LF 4ELMB 1FLRH 4M3KB 4OM1H 3SE4A 4DZ8A 4HWNA 2LV4A 1NCDL 1ZLWK 3T0BA 4H5SA 4N0FB 5DRNB 4M8QA 4APQC 1T4KA 1EGJH 1RZ7L 4PJGA 1IGFL 1UQSA 2CGRL 2YA1A 2GTZB 1YUHB 4ZFOA 3VXQA 5FM5M 4LKXB 3NMEA 3V5DB 3KPQB 2ERJC 5A3IC 2ICWJ 4PJAE 4J6RH 3MNVA 5D1ZB 4XMKH 5D7LB 3LKRB 1SJEA 3OJ2C 5HDLA 3CMOL 1ZS8B 4X6CE 4BQ9A 3HB3C 2BOBB 4M7ZC 1ZAGA 3CSPA 4UQ2A 1KCLA 3IU4H 2HYMA 3K8MA 2FHFA 2DLGA 4GW4B 4KKAD 5E2VH 1KJ2H 1UB5B 4R7DB 3OG6B 2FHBA 3E3QC 1JWSB 2JB6B 4GQ9H 1JHKL 1WZKA 4F9PA 5LXGL 3GB7B 3MJ7A 1DQJA 4PYHA 3VD4A 2P45B 5IVXF 1A6VL 4GS7C 5EO1A 1NAMA 3BH8A 4JFDB 4OB5L 1NPUA 4K71B 5GGSA 4P9HH 1WBXB 5SWSB 5DEGB 1ORSB 1ORQA 4TVPL 4WUUE 1S7VA 4M7LH 2GK0A 2YS4A 4MQSB 4OGYL 4B50A 5KSBF 1I7ZA 3GSWB 1QSEE 4PLJC 5KS9A 3BZFA 3SE4C 4JANB 9CGTA 5J6HB 1BOGB 4NNXA 4NT6B 2ZKHH 3GSUB 4IJ3C 4NHCH 3VRIA 3CDGA 4HDIA 3I6LE 2HTLC 2OQJA 4L8SB 1MFBH 5HPMA 1E28B 1DANT 5KG9B 2C1OA 1U42A 1WAAA 4LLYA 3SKMB 3LKPA 4NQXA 2XACC 5I1CH 4FFYH 5J3HD 1HXMB 1FFNA 1DEEB 3IFOB 3F7RA 3MJGX 3NAAH 1HNGA 3ARUA 1WZ1L 3QNZA 5CZXC 1FSKB 2WBJA 3AM8A 5C0ND 1GXEA 1OGAE 4M1CC 3KPNB 4H20L 4F9PC 5CJOH 3QXUA 5FGBC 1C16A 4PRDB 1OAZL 1GC1L 5C09E 2FHCA 5BS0A 3HPLA 1XCTB 2UVFA 5JXAH 5IFAH 3I3DA 1WFTA 4QF1B 3FOMA 4H0IA 3RGVA 1PQZA 5ACLA 1IKNA 4DCQB 2VLLA 3MUY1 2GSGA 1R3LA 1HH9B 1NCTA 1U58A 4P2RD 1ZMYA 4OZIB 5EIIB 5C3LD 3FT2A 5TGBB 3LMJL 1DN0B 3IAPA 1LE5A 4QLRA 2GTWA 1T04B 3QI9D 3TO4A 3LRSB 5BV7C 2HWZH 5JOEA 1IC1A 3OAZH 2P5EE 4LPVA 4U6XA 1FHGA 3DVGA 3BQUA 3V5HB 3DUHA 4HJ0C 5GGVL 5CAYB 2A6KA 2HJLB 2FGWH 1BQHG 4HV8A 4JCMA 4GQPH 5CKGA 3QDGD 1UZ6E 5CZVH 2WBJC 3AM8C 1TVDA 4MHHG 2GY5A 2H3NB 1J1PL 4ZYKB 1B6UA 1UYWL 1BD2B 2B2XH 3X17A 5BO1H 5D70L 2D7MA 3UBXB 5LG1A 1D5MB 2MCPH 1F3DJ 1HILA 4L5FH 3ZDYE 3ULVL 4V1DD 1XGRB 4Z7QF 2BY0A 1YNTB 3U1SL 4YEEA 3AU1B 1KC5H 4ODWA 3MLZH 3RGVC 1IKNC 2BC4B 4Z0XA 3MNWB 4R3SB 3PQYB 3V4UL 4N90D 4EDWL 4BQ6A 5IMKA 1SM3H 2DMCA 2V17L 3BN9C 2NY1C 3H42L 3ZKMC 3DMMA 2QADB 3LN9A 4PJFB 3FTGB 1TQCC 5I71B 4WY7L 1HKLH 1N6VA 3LV3B 5TDNA 3IKKA 2AJ3B 1RZ8A 1A6PA 3BDYL 3TO4C 3ZE1F 4NGHH 4X9HA 2FATL 4O9HL 4P23B 1I7UA 1QLEH 5C6PB 3MBED 2A6JA 3BQUC 3MV8E 4ETQB 3AREB 5DTFA 4AM0A 4UILH 1PG7H 4JFHD 5EWIL 5IQ9B 1MRDL 4X6DF 4JFFD 5CP3A 1T22A 4XTRC 1UG9A 4A6YL 3S4SB 3ZSSA 1PZ5B 5IKCB 1LP9F 4NKMB 3H9HB 4JR9L 1BP3B 3EDDA 4HUVA 5DHVA 5JLZB 3ARBA 1UWXK 4QGYA 1BFVH 2LQRA 5DUBA 3Q6GH 2B4CH 3CFKA 2PW2A 3HFMH 5INCA 2G9HB 3NPSC 2R56L 3UTTB 4HXAH 3TH2T 4HIEB 1EGJA 1AY1L 3T2QA 5I66B 1HSAB 4FG6D 2HVKB 4RMTA 3GMOB 1FZOA 2NNAB 3DMMC 2BRRL 1JPTL 1UC6A 2VLKA 4H88H 4HUKB 3ARFB 4FN0A 5D8JL 4X7DC 4KVNH 1C7TA 2J5LB 4AJ0A 4RFOH 1YA5A 5AD0B 1XF1A 1ZT4A 1E27A 3X13B 4XVTL 4LSTH 4L4TA 2EDOA 4NQCA 3TPKA 3NCMA 3OJDB 1KJ2A 3FB8B 4N0UE 2ZPKL 4M6OL 4ZPVB 1JIBA 5HDBE 3UJTL 1KPRA 3MOBL 5IB4B 4HLZH 4IOSD 4JO3L 2GW5A 3CFBA 4DAGL 4ZQKB 4PY8I 4APQB 3WJLA 4MJIB 1ZA6B 1PG7X 1EEZB 4XRCB 2Z35B 3EFFB 5FKAA 5I15H 1M6OA 4P46C 5DD5H 3ARBC 3DXAE 2ERJB 5SWQB 1BQLH 3G6AB 4F80A 1FNLA 4QHLB 1YEKL 3GGWB 4OAWB 5GJSL 3MLSH 4D0DA 5MERA 4M7ZB 4ZUTA 2KZWA 1FAKT 3WIFB 3TBTB 1S9YB 1VKXB 3MCLL 3FT3A 5DQJB 5IVXA 3N0PB 6FABH 4UOW1 1C8PA 2VZ1A 4CADA 3HNSL 4HZLB 1CQYA 5L2KB 5JW4R 1SMOA 3EYOA 4GXVL 1ACYH 2R0WL 8FABB 4GS7B 1EBAA 3FZUC 3X12A 1JGVL 4BSWA 4PJEE 3MV9B 2A73A 2X4PB 3HLAB 4L9DA 2ZCHH 4C54A 1BFTA 4URTB 4DZ8B 1IJ9A 4M48H 4UIKL 5DMIH 3MJ6A 3RA7L 4IJ3B 5I1IL 4H5SB 1GAFH 1T4KB 5I1EL 3WJLC 1CGXA 4P57B 4P9HC 1C1EL 5HI4C 4Z7OE 4ZFOB 4JDTL 1FFRA 3O4OC 1ZLWH 4N0CD 4JJ5A 1FZMA 4LSDA 3UPCA 1BIIA 1NGWA 3MNVB 2I07A 4NZTH 1YJDH 5ISZD 1SJEB 1MHEA 4IIQB 1E0OB 4GRWF 5A2IH 1HHKA 1RI8A 2AJXL 1SJXA 2QEJA 2OR9L 3LB6D 2JLLA 4LOUD 4UQ2B 4O2FA 2JKXA 4GAJH 1MCFA 1NMBH 5DJZA 1OTSD 3S5LG 4QOKA 4OLVL 2IBBA 1OP5K 1DQJB 4YC2C 4Q9RH 3BH8B 3NN8B 5IBUB 5GGSB 3T0EE 4MA8L 1LEGA 1HEZA 4MCYA 1ORQB 4MJ5A 1S7VB 3HNVH 4YLQT 3FFCD 2GK0B 1J0YA 2D0FA 1I7ZB 5D1XA 1FYTD 3UO1L 3WHXB 2J3SA 5KS9B 5DURB 3BZFB 2O5XL 4NNXB 1T66D 3QEQD 1GZPA 4M1DL 4W4OC 3ZT6A 2I60H 4I0PA 3CDGB 3VRIB 3TT3L 2FX9H 3O8XD 3F7VA 5C6TL 2YKLH 4IRSD 1B4JH 2FSEA 1UXSA 4RGNC 2OQJB 3D9AH 5T3XH 5HPMB 1MJ7L 2IBGA 5BV7B 2C1OB 4LLYB 3JTTA 3LKPB 1BLNA 3Q48A 4XP1L 3FT4A 4AL8H 2AK4A 4E0RA 4GUPA 1CFQA 1A3LL 2XY1A 4YPJA 2BJMH 3U4BL 1MJ8H 4YDJA 3OGCB 4O58H 4KGJA 3ULSA 3IT8D 2GAZA 3BHBA 2WBJB 3VXPA 4X5XA 3CU1A 1NCAH 3IFLL 1LDPH 1C16B 1KCVH 4Z18A 1F4WL 1Q72L 5D7KD 3QUKA 3HPLB 5BS0B 1BZQK 1A7BA 1P4BH 5JORA 1CL7H 3FOMB 4M43L 5LQBL 2AV1A 1LDSA 1PQZB 4OLEA 3RGVB 2VLLB 5D1XC 5IEHA 2ZSWA 3QWRA 3O41A 2GSGB 4RA0C 2LVCA 5FA3A 2NY1B 2MTPA 1BFOA 4XBEH 4YHML 4I0PC 1LO3L 2VDPL 1TQCB 1U8JA 3FT2B 3IDXH 1JGLL 1MWAL 1LE5B 4X6FA 3TO4B 4GRLD 2J8OA 1GPOL 4XBPA 2EXYD 1P84K 4FQXC 3UROR 1VFOA 5IMOA 2MSPA 5DJ6A 4PJXE 4MYWB 4U6XB 3DVGB 4YXLL 3FKUS 3BQUB 3MX0A 4X6DA 4HGKC 2R4RH 4GKSA 5DJXA 2A6KB 4Y1AA 4P5KA 3HAEB 1NAML 1N5AA 2B8OT 4HHAA 3V6OE 5F8RC 1LD9A 1BGXH 1N3NB 1BHGA 1RIVH 2J6EH 4KXZH 5EOCJ 4AIXA 2AW2A 4JFEE 4JN2A 1HILB 4KHXH 5JZ7D 1FGVH 3B2UC 4PJBF 1NMAH 1AGCA 3NPSB 4RAHA 5KANI 4LLQA 1T0NA 4ODWB 2UY7A 3KPRE 4V1DE 4Z0XB 3L3JA 4JRYB 4OQTH 4NC1E 2DQCH 2CJUH 5IMKB 5FEBA 4N5UA 3DMMB 1OHQA 2WUCL 2MKLC 2XTLA 3HZYA 5C0CB 2B4CC 3TYGL 1QR1A 4EI6A 5E8OB 1H3TA 5TDNB 4WI5A 4HSQA 2KH2B 4AK1A 1RZ8B 5DC4B 1VESA 3TH3T 1DBBL 2JTDA 4XNXL 1F2QA 3GI8H 4KQ4H 5CP7A 3RY6A 1PVHA 2W9EH 2ZOKA 1ZOXA 3P0GB 4KDVA 2A6JB 1NCCL 4R9HA 3W11D 4TULL 3EYUH 4NM4L 5DTFB 3MLRH 5E8NA 3SE8L 2R2BA 4NQUA 3L5XL 1NDGA 5IJKA 5I30H 1T22B 2XZCL 2VITA 3DX8A 1M1SA 4ODHL 5L2JA 1KEGL 4HUVB 5DHVB 2GCYA 4P46B 3NABL 1KBGH 3ARBB 1PFCA 4PJ8D 5DUBB 3CFKB 1ZT7A 1DUYA 5INCB 4S1DD 4IM8A 1UWXH 4N1HB 3FN3A 4YDVB 2A83A 1FZOB 4ODVL 3BO8A 4TNWK 1MHCA 2VDLL 3CVHL 2V9QA 3FAWA 3KR3L 1KIUA 3C08L 3RKPA 5GISL 1AFVL 2VLKB 1Q9WB 1W0WB 2C4XA 2ICWI 2JCCF 4MQXC 4CVZA 2AK1H 2JELL 3S3JA 4ORGA 5M7QA 4NC0B 3N1MC 2Q7YA 3RY6C 1ZT4B 4OCRH 1E27B 1A4KA 4L4TB 1REIA 4FFVC 4NQCB 4OKVB 2X4RA 3PG2A 2W92A 4UT6L 5DJCA 5GRJH 3Q5TA 5LWYL 1KJ2B 2WINA 1KPRB 5HYJA 1GGTA 1FNAA 3DRTA 3PGDA 5GGUB 4ZOEA 4LHUD 1XH3A 4NQEE 3D3VD 4U1HA 4GG6E 1H3XA 5F44A 2D31A 3GSOA 4PLKC 2DIAA 5FKAB 1M6OB 3O4OB 4JPIB 1LO0H 1XGYL 3B9DA 3GEWB 4TN9A 1TPXC 5F7DA 5F1KC 1HKFA 1RZFL 2VKWA 1D9KC 4M6AA 5CEZD 3PUCA 4I0CC 3RI5F 3WYRA 1E4KA 3DIFB 1JCKA 2YZ1A 4D0DB 5MERB 4KVCL 5BCAA 4ZUTB 1VACA 3LHPL 3ABZA 1BAFL 4Z7WE 3MACH 5IVXB 4CADB 3MROA 2BMKA 3C8DA 4HUMB 3OHXA 1YJDC 2ADIA 1O7VA 1GGBL 5JHDA 2G2RB 2D7PA 2H2SD 3GDBA 1DBML 3X11A 1F58H 3X12B 4BSWB 4XAKE 2A73B 4XNQB 5D7SL 5I0DA 3QPXL 3NFPA 2VN4A 4MQ7A 4IHOA 3RJQB 2OMNA 1OT1A 4RBPH 4GAFB 3C87A 3MGAA 1KGCE 3MLVL 5AWNH 5CJQL 4J7RA 2B1AL 1EPFA 2QV2A 4U1LA 3LVEA 3W0WE 4MQTB 3VFUA 5EOQH 1RJCA 4RGNB 4TVPE 3H2WA 1UKTA 2HT3C 4OFDA 1KLFA 4JJ5B 3IDJA 6CGTA 3VJ6B 1BIIB 4S1SH 1NGWB 3UJIL 1TETL 2I07B 2D0HA 1MHEB 1E4KC 1HHKB 4X5LA 2YMXH 4N0YL 3VCLA 2OX5A 4O2FB 1PYWA 1CXFA 2IPKA 1NC4D 1RULH 2WAHA 5DJZB 1KTLA 4KPHH 2APVA 2Y5TA 2HFFB 4G6FB 4QOKB 4WEBH 5AG8A 3O11A 4F8TA 5EOTA 4R0LA 3CNKA 3RUGA 4OGZA 3SJVA 1HSBA 2NY5H 1IVLA 5ESAB 1LEGB 3VG9B 2FBJL 3RKDC 2QQNL 4MJ5B 4POUB 1P7HL 2ORBL 4KK8C 1OP5H 1NBYA 4XNYL 5FO8A 5FOBA 5D1XB 2FGZA 3I9GH 3TNNA 2WQRA 1GZPB 1FYTE 3O9WD 2J6EA 2DQDH 1IFHL 2D7TL 4I0PB 4OCXH 4YJZL 3R4DA 2YPKB 2W0FA 4N8PA 5J13C 5ITFA 2FSEB 3VU2A 1UXSB 4G3YH 4NWTH 3OXRA 4YHOH 2Q3AA 2RCSL 1NCBH 2XRAL 3JTTB 4OQTA 3P77A 1BLNB 4FQXB 4K8RD 2IBZY 4E0RB 3FT4B 2AK4B 1HQ4A 4GUPB 1CFQB 1XIWD 4CN1A 4WHCA 4P4RA 4YDJB 1K5NA 3HMWH 1B0GB 4I8DA 1KTRL 5GS2D 3I3EA 3ULSB 1ETZA 2VL5A 2GAZB 3BHBB 5LGJA 2FYYA 3VXPB 4NUGH 4U1MA 4YZFF 4G6AC 1JP5A 1IM3B 2YD1A 1JGEA 2W1NA 4R0LC 3BOVA 3QUKB 5I1DA 2J8UF 3ORJA 1KB9K 1SQ2N 3GM0A 1DBJH 1YY9D 2AV1B 2OK0H 5JXAL 5IEHB 2ZSWB 3O41B 5B3NA 4Y19A 3IVKB 1MY5A 5FA3B 4R4ND 3DYOA 5A16B 3EAKA 4XZUA 3LQZA 2BVPA 1BFOB 1G9ML 4EIZC 2UWEE 1U8JB 3GBML 4ZTPL 4N1CA 2PTVA 1NBQA 5DFVC 5DT1L 1MIEH 4LLAA 1QYGL 4X6FB 5EFIA 4KK5C 4XBPB 4JRXD 5MP6H 1KN2H 5IMOB 1A64A 5DJ6B 2EDXA 1A0QH 4NRYA 2DIJA 2EDLA 4X6DB 5T1LD 5H2BA 1I85A 4GBXD 3ROOA 4GKSB 1EVUA 1HCFX 5DJXB 4Y1AB 3T2OA 4P5KB 4L3EA 1CCZA 4YH6A 3QIWC 3WXWH 3QUYA 4L4JA 3BXNA 2ZZUT 4WWKD 1T6VN 5DR5H 2RIKA 4HHAB 2YUVA 2ITDA 1T20A 4RQQA 2DBLH 1LD9B 4KFZC 3RTQC 2Z91A 4OD2A 1G7QA 3PDDA 4JN2B 3NPZB 3D1MC 1IQDA 1AGCB 1JJUA 4M00A 4LLQB 3OPZH 1T0NB 2XWTA 1RUQL 4MA3A 1CFTA 3L3JB 2CXKA 3QUMA 3DUSA 3DX9A 2WLZA 5LJYH 4WRLA 4MA7H 2OJZH 1ZGLP 4NBXB 1F97A 3HZYB 4EI6B 5ID1B 1ZLUK 3M8OL 2G5RA 3KLSA 1QO3A 4W4NA 1DQLL 3FN0H 3ZHLA 5CP7B 3B9EA 1R0AH 1IILE 3IDYC 4LHQB 4DKFH 4XNUH 2YD2A 2ZOKB 3OKLA 3OF6A 1I85C 5HVHC 4FTVD 3M17B 1QLEL 2R2BB 4MNQA 4EQ3A 1NDGB 4KUZH 5EU6D 3QUYC 2VITB 3DX8B 4PD4K 2Y7QA 2B1HL 2HFGH 1CLCA 1MLBA 2HKFL 2F53A 5GGTH 1J0JA 5L2JB 2GCYB 4HC1H 4TNWF 3EYSL 4HS6A 1K4CA 4HCRH 1TPXB 5K9QI 1ZT7B 1DUYB 1D9KB 1OT2A 2YD6A 3VXSB 5IB3B 5I1HL 1CFNA 43C9A 3J8F7 5KTEH 1PDKA 2FO1A 2GYSA 4P59H 3STZA 4DGYH 2AP2A 5JIKA 4WW2F 1RVFH 2GJ6D 2IADA 3LZFH 2A83B 3MRGA 5T3ZL 3BO8B 3CSGA 3AGVA 1MHCB 5FYLH 4XWOC 4Q9CA 3LEYL 3GIVA 4NZDA 4CVZB 5E08H 2YXFA 5A2FA 3LH2L 3MPCA 4ORGB 4DWHA 2Q7YB 4H88L 3T0DA 3AUVA 4I48B 4RX4A 1WSST 4LIQE 3HG1A 2X4RB 3H3BC 1UM6H 5DJCB 5EZJB 4HKXA 5F7EH 2EICA 2WINB 5EUOA 3FQWA 3BIKB 4XP6L 4ZDHA 2YPLA 4PGDB 3PGDB 1UACL 3DRTB 3I2CL 2Y72A 5TH2A 3EZ8A 4U1HB 1T1WA 1OTUD 3NIGE 1J0ZA 3MV7E 2D31B 3GSOB 1WLHA 3QHZL 3MA9H 2NCMA 4UZGA 2APFA 3SO5A 2EDJA 5BMFL 5DJ2B 3QDJA 5F7DB 1IC7L 2HH0H 2Y25A 3FRUA 2EH8H 1OD7A 4KJPC 5GGRY 3I50L 2YPVL 1T7YA 1F90L 1KENL 4Q58C 4RGOL 5TE6H 5CEZE 2A6DA 1VACB 4UINH 3MLSL 4DKAA 4HUNB 4EZMA 2BNUA 1G6RL 3FB7A 1A7OL 2XQYK 2BMKB 3MROB 1X5XA 3DBXA 3OHXB 2ADIB 3TPUA 3CFCL 1P4IH 5JHDB 4GFTB 5ILTL 6FABL 3X11B 3VGAC 1PGRB 4WI2A 3NFPB 1MLCA 4IHOB 5FO9A 4OLXH 3UBXG 4JO4H 2C26A 3P4OA 4QRPE 3EO9L 4QTIL 5B4MD 3NTCL 4D8PA 1ZT1A 1MI5D 3EHBD 3JV5A 2V2WB 1DQDL 2OSLA 3ZTNH 4U3CA 2F74A 5IFHH 2OYPA 3DV4A 4U1LB 2NY5C 1D5IL 5J13B 2WUBH 3VFUB 4FS0A 4Z9KB 5JUEL 2EYRA 3QDMA 5EN2A 1JTOA 3L7FA 1CLZL 4OLZL 3IDJB 5JR1H 4GG8A 4BSVB 5I76A 3ARGA 1B2WL 4HIIB 1R3IL 4J1UA 3QFJE 2XWBB 4JHAH 4NZTL 1YJDL 4QYOA 1JZ7A 4O5LL 2DD8L 2IPKB 5F7HA 1XEDA 1JNLL 1KTLB 1W8NA 1TZIA 5DMKA 2Y5TB 4AYFA 3O11B 5EOTB 2BERA 4R0LB 1NMBL 3RUGB 3W2DH 5DJYA 3S4SG 3SJVB 1HSBB 3K0WA 3SKUD 2DQIL 1MCOL 1UCBH 5FHAH 5DGQA 5E9DE 1WGOA 3F58L 1NBYB 2NY0C 5FO8B 5FOBB 5CILL 1IGIL 1OARL 1KJMA 5B22A 1DFBL 1GH7A 4ESKA 3TNNB 1H3PL 1LK3H 5E94A 2NR6C 4EOWH 5C0BD 5IV2A 1FFPA 2IBZX 3PGCB 2W0FB 4LLWA 5FYKL 3UPAA 5ITFB 4F15C 1XGTA 3ARTA 4YHKH 4F7MA 3P77B 1BM3H 3UPRB 2YKLL 3ULUH 2UWEF 5E5MA 4PJ7E 3ARGC 4P4KA 4QGTA 4HJJL 1N26A 3ELAT 4FOMA 1WIUA 2ZUWA 3KJ6H 1OAKL 1K5NB 1XGUB 5DC0A 1Z0MA 1ETZB 3X3GL 3QIWB 5HD8C 2VL5B 3AS3A 5LGJB 2FYYB 4Q2ZA 1IAKA 2MMXA 4GKZA 1IGCH 5HYQA 4U1MB 1QFWL 2BXZA 4KRPC 4UB0L 1JGEB 3ARDA 3RTQB 4PRAA 1QG3A 3SKNA 2I26N 2DQHL 5F9JA 3DNKA 2X1OA 1CR9L 5I1DB 2P5WE 5CUSH 3QBTB 5F96H 4PRID 1QSVA 2WM0A 2WANA 1CDYA 4K3GA 5GGTA 4PJ9D 1CYGA 2V9RA 1ROWA 5C1MB 1MCEA 1I3VA 1I9IH 4XZUB 4Z7VA 3LQZB 2YBRA 2BVPB 1CE6A 1NMCC 4QNPF 4HCRA 1RSFA 4KKBC 2I25N 3GSVA 3GKWH 1D5XA 3ZE0F 2EXWC 4KMQA 5I19L 12E8L 3QO0A 4E9LA 3IDYB 2CRYA 2Z9TA 1FNGA 2LTQC 4GSDH 5D6DA 3QWOB 4P4KC 4NRYB 5I17A 3MGOA 3B9VA 3WFBH 5H2BB 3IDGA 5HVHB 3ROOB 3STLA 1K6QH 3ECBB 3I3BA 1OAYH 1CD9B 4L3EB 1QRNA 4V2CB 4CDGC 3QUYB 4LSQL 4J3SA 3VW3L 3BXNB 4JHWL 1BQUA 4PBWD 1GIGH 2ITDB 1T20B 1UB6A 5C0GA 4RQQB 2IMNA 3G9VA 3ARDC 2GUOA 2VH5H 2Z91B 4OD2B 1G7QB 2PYEA 2NW3A 4LQFL 3FJTA 2Y36L 1M71A 2XWTB 5CEYA 4PJDE 5FV1L 2OP4H 4ZS6C 4E41D 2W65A 2UZYB 4MA3B 1U8NA 3DUSB 5FFLA 1DDHA 3FFDB 2Q8BL 1G7HA 5F3HA 1T2QH 4NHUA 3VGDA 3K2UH 4JKMA 3O4LD 4KUCD 1QO3B 1FE8L 2RB8A 2J88H 5GSRA 4OLYH 1UJTA 3PL6D 5IWLA 4YDKH 1CIDA 5D6DC 3PWPE 3T2PA 5E6IA 3OKLB 1ZLUH 3THMH 1QEWA 3QJHA 4BA8A 5IBUG 4PLOB 4HFUH 4MNQB 4W81A 4FTVE 3ISWA 2ZWLT 1QSFD 1NLBL 2Y7QB 2VDRH 4JPWH 4EEEA 2AJZA 5EU6E 1MLBB 2F53B 3UYOD 4RZCB 2F58H 4MXVE 4Z7UA 4BH8A 3IDNA 4OZHF 5KVGL 4HS6B 1A5FH 1K4CB 3LQMA 1LNUA 3QT2A 4TUOB 2WQ8A 5CSBA 2H8PA 1X7QB 5C0AA 1CFNB 7FABH 1T03H 1HHHB 2HFEA 2NY7H 2YZ8A 3STZB 4NJ9H 5EZLA 1RUAL 3MRGB 4XX1E 5L8JB 3SBWC 4HEME 2DF3A 2GITA 4QWWD 1T0MA 3GIVB 4P0DA 5DFTA 1U3HD 2CKBH 5ITBL 1RFDH 1H15A 5EU5A 5IWLC 1LVEA 3VGAB 3G6DL 4DGIL 3MC0A 3UTOA 3HG1B 5E6IC 3ARYA 1V3JA 4JQIL 1T3FB 3WFDL 4HKXB 5EUOB 4NZUL 2OXGA 1G0DA 2G75A 1A6WH 3FQWB 1UWGH 4KZEH 2YPLB 5BQ7A 3JVGA 4FFWC 1HI6A 1T1WB 1V8HA 4YGVA 2A1WL 1FRGH 4M3JA 5C92A 5DQ9A 3VFWA 3QHFH 3QUML 3QDJB 1KXTB 4PJ5A 2N1KA 4QHMB 2W9DL 4KDTA 4WEUD 2W0PA 5K9JL 2XTJE 4PJIA 3FQXA 2DS4A 4HEPG 1OW0A 4KHTL 1RUPL 2A6DB 32C2A 3P3YA 4HBQA 5DMGD 4FMFA 2NY4D 5I1JL 4HH9A 3IRPX 4TQEL 2IALA 1ZVSA 4PS4H 3LB6C 3O6ML 2BNUB 3ZDXE 3FB7B 4LEOA 4RFNC 2VLME 1WEJH 2BNQA 3HAEG 3TPUB 4FQCL 4LDOB 3WSQL 2YD5A 1T7XA 1O0VA 5HPOA 1I7TA 3VGHA 1FORH 4Y8AA 1MLCB 5FO9B 1FC2D 2NX5E 3QHTC 4GO6B 2NY0B 5CINL 3P4OB 2C5DC 4RRPA 4LAQH 1ZT1B 4D8PB 2OSLB 3JVGC 5FOJA 2A74B 2F74B 5E00A 1JK8B 3DV4B 3CDYA 3N06B 2EYTA 3D2UA 2R0ZH 3VRLE 3S36X 4F15B 1YECL 2EYRB 3QDMB 5EN2B 4R90L 3H3PH 4P48A 3N1GC 3QNXA 1QZ1A 3QQNA 4NCC2 3C8HA 1QBLL 3HRZA 3RWFA 3V52H 4K9EH 4GG8B 5I76B 4EBQH 3ARGB 4KDTC 2AGJH 2NYYC 3QI9B 5LBSH 4JM4L 1A3RH 1EMTL 3U36A 4XVUC 2O5YL 4J1UB 1OW0C 1F3DH 3QEUA 1I8LA 1N4XL 1PEWA 4QYOB 3S37H 2ZCKH 4JN1L 4LCWE 2Z4QA 4W70A 1R5IA 1TZIB 4JKPH 4KRPB 3ULUC 5ESVA 3CX5K 5J11C 5KZCB 1F4HA 2J8UB 4NN5C 3BWAA 4Y2DD 4KJQD 1RJLA 5DJYB 5GS0D 4YFEA 4WEBL 3VWKD 1J1OL 4ZS7H 3UYPA 3QNYA 1J8HD 3MRCA 2A0LC 3BGMA 4PGBB 1J5OH 1Q9LB 3O3AA 2Z8SA 4XP4H 2NY3D 4Z76A 1KJMB 4MJ6A 1HNFA 2P7TA 3SQOH 4OUOA 1AXTL 2PKDA 5E94B 3TZVD 1NMCB 1EEYA 2BHZA 2X10A 4OZGE 1EFXA 1FFPB 4KC3B 4LLWB 5IV2B 4YDLB 1L0YA 1XGTB 1OSPH 3W82A 4F7MB 4M8VA 5GS2H 3N9GL 3E1F1 2LTQB 4P4KB 4NQVB 1CD8A 1U8PA 2VLRA 3AS0A 4GRLC 2IQ9L 5IG7A 3HC4L 1I8LC 4NFCA 5BRZA 5JIPA 1I1CA 2CMRH 3DTXA 4U7SA 4KQ3H 5TE4H 4Q2ZB 4GKZB 3UC0L 1CN4A 3UTZA 2IPTL 4Y5XA 4YUEL 5I8EB 1CWVA 4HWUA 2MKWA 1BBJA 2FJFA 4M03A 3ARDB 4NM8L 2VDQL 2BNRA 3A67L 3S37X 3SKNB 4AQOA 5F9JB 4WI8A 4LLDA 5I8KL 3VE0A 2IAMD 2ICWA 3IXTA 3P11L 4O02L 4YDIL 5DZNA 5GGRA 3QEGL 4OCSL 3MV11 1S5HA 5JZ7C 4WGVB 3DETC 3G6JE 4Z7VB 5EORH 1U93A 2YBRB 3L3GA 2HLAB 1IAIM 1UGNA 1UH3A 1XZ0A 4PJHA 1KELH 4F33B 2FWOA 1SEQL 2I5YL 3L5WA 4EKXA 2PO6A 3TFKC 5TQ0H 1U0QA 1DBAL 2FECL 5IW3A 1FVCA 5D7LD 1M7DB 3QO0B 5J8OA 1FNSL 3WNLA 4LPTA 1FNGB 3MYZA 4OBRA 5DRZA 4F7TA 1MIEL 4MA1C 3O3BA 3Q2CA 4YBHA 2B0SH 3IDGB 4JQVA 3STLB 1N2RA 4CBPA 3ZL4L 2EDEA 4DK3A 3VD5A 2AEQH 2Z8VC 3MLPA 1QRNB 4PP2A 2CKBA 3GHEH 4LSPH 4LCCA 3T3PF 5EU4A 1UB6B 3TN0A 4Y5XC 5IT2L 4JFDD 2GUOB 5SWSD 1J0IA 2UYLA 5DR5L 2E7MA 2PYEB 2NW3B 3NIDE 1Q38A 4WW2B 4D9RE 1RUML 1G9EA 1G6VK 4L8DA 1M71B 3RWEA 5CEYB 2F5AH 1PX3A 4BZ2L 3ULVD 3VFGH 1P5VA 2W65B 1K9TA 1VSCA 5ETUB 4E41E 3E8UH 1DDHB 2R29H 5IW6A 4O51A 4OIIH 2Q76A 2EO1A 1G7HB 2X9YA 1RY7B 4HUXA 1P7KA 4NHUB 4JCLA 1I3GH 4TYUA 5T5NF 3U7AA 5JA9A 3QCVH 5GSRB 5CJ5A 4OI7A 3H9SE 3O4LE 5K33A 1J11A 5CGYD 3VFOA 5L7XH 4MLSA 4OSUH 1GGIL 4F7PA 3RWCA 4NNPH 5E6IB 5T3ZE 1EAPA 1QEWB 3QJHB 4OJFL 2MQ0A 2V5TA 4LASH 1L4IA 1WZLA 3UP1A 1GGCH 1FDLH 1MCPL 2AQ3A 4LCCC 4ZO8A 2IG2L 1CGSH 2AJZB 3PWVA 2OS7A 3TN0C 4LLMB 1EA9C 3IDNB 4Z7UB 1JN6A 1BVZA 4XCYA 5K59E 2CLVA 1LNUB 5TF1L 5DWUH 1UWEH 3MXVL 2H8PB 3R8BB 4HD9A 5C0AB 3AXLA 3C60A 3TGXA 5EZLB 4OCYL 2OZ4L 3IJYA 1S7RA 4TPRH 1NBVH 1OTTD 3S97C 4DGVH 5IBTL 5C7XL 3HUJA 3PWJB 2AS5M 4U0RC 4UTAH 2NZ9D 4ODXA 1Z9OA 3D39E 3T3ME 4XMPL 2GITB 1T0MB 1BF2A 5C08E 4I18A 35C8L 4NKIH 5KJRL 1NCWH 1F6AB 2CQVA 5EULV 1H15B 4P3WA 5EU5B 3BIBX 2R0LH 1A8JH 2EE3A 4DN4H 2YD9A 4XI5D 4M5YH 1RMFH 2VN7A 3T2NL 3WLWC 5KVFH 2G75B 5CEXA 2FB4H 2HVJA 4XPHL 5E2UL 1BD2D 3QFDB 2CIIA 1CVRA 1HI6B 1HQRA 4YGVB 4XC1H 3T0VA 4MD5A 4JQXA 4X98A 4KK9D 5DD3L 4ETYA 4PJAA 1DLFH 4HG4J 5DQ9B 3I85A 3VFWB 1JNJA 4PJ5B 3SKJH 4DOHE 2VXUL 2IANE 2OI9C 4X6CA 3PQYD 1OAQL 4PJIB 3C60C 1NC2A 3FQXB 3VXMA 4ZD3L 3QULA 2MPAH 2X4UA 1S9KC 1JNNH 3UCRA 32C2B 3JWDH 3U6RB 5T5FL 5DD6A 2EH8L 4N8CH 5JPMA 3S88L 4Q97A 4HH9B 3ROLA 4NP4H 2ZUVA 4U1IA 2IALB 1ZVSB 4XCCL 1FPTH 4K9EC 4LEOB 1MF2H 4MB4A 4YEFA 5J11B 2DL2A 4NN5B 4I18C 3WDHA 1MY7A 3QEHA 2A38A 4ZOCA 2HLFD 3NZ8A 5B38A 1OAXH 1MQKH 4WUUA 3ARED 1RURH 1I7TB 3BGAA 4ENED 2Y07H 3AY4A 3QPQD 4OI9A 3LKQA 1QSEA 5L0QC 4BFGA 3FQTA 4J3XA 4NJAL 4WFFE 4HLZG 4F7CA 4ODSL 1YEHL 4PB9L 3RY4A 5E00B 4HPYH 1ERNA 1MHPH 1D5BA 2EYTB 3D2UB 3E6HA 4PBVC 3NACL 4JQXC 5SWZE 3QNXB 4F37K 1PEZA 4Q74A 3HRZB 4WI7A 3QP3A 4HGWA 3DJ9A 3C9NB 4OFPA 5FUCE 2XOTA 3V9FA 1U9KA 4OLWH 4G8GE 4KY1L 2FLRT 3U36B 4GRLB 5EOCH 5EUKB 3F6LA 3SE9L 3QEUB 3S7GA 3BT2H 1OGAA 4M02A 3MUGA 3PP4L 2E8ZA 2P8PB 3ARFD 1IBGH 2Z4QB 4NN7C 3L5HA 1U3JA 2M26A 5ESVB 5C09A 3LS5L 5LVEA 1TJGL 3BWAB 4BZYA 3ILQD 3VD3A 1RJLB 4NCC1 2FNBA 3LIZH 3WNNA 4JLRA 2ZCLL 5HSFA 3QNYB 3AY4C 3BSZL 4O00A 1A7RL 5E5RB 4C56E 2ESVE 3BGMB 4RWHA 3O3AB 5BVPL 1AI1L 4Z76B 4APQD 4MJ6B 2NZIA 4HBCL 2P7TB 4GLRI 5EH1A 5FUOH 1UFUA 2GIYA 2ADGA 1EEYB 4HUUA 4MWFA 5F7NC 5GHWL 5HI5C 5A3ID 4S2SA 2X89A 1TCRA 2P5EA 4XPBL 3GBNH 4R26H 3RWDB 1FYHB 4K3EH 3SKOA 2DKUA 1VFBA 4UTBH 2AJSH 3HB3D 1A14H 3DGGA 4MA1B 1WF5A 1U8PB 4JDZA 4M5ZL 1TJIH 3HI6H 4ODTH 5IG7B 4I3SL 4LRIA 5BRZB 2E6PA 3LAFA 4OTXL 3DTXB 5E8DH 1ZWIB 5L2KD 1K8IB 3UTZB 1OCWL 1Q94A 4Y5XB 5FYJL 3MV9D 4RMUA 3CPLA 2BNRB 3SCMA 4Q9QL 3IXTB 2ICWB 4WTXA 5GGRB 5DUPL 2QQKH 2OJEA 2YUXA 5D71H 5EZIL 4U1GB 5FM8A 4U3HA 1JZ4A 4PJ8B 1S5HB 4YBQC 1INEL 1DBKL 2ZG1A 4YX2L 2HTLD 4EXKA 1U93B 3L3GB 4XB7A 1XZ0B 4UDTA 3KLAA 4PJHB 3NCJL 3L5WB 4JFZH 1DL7H 15C8H 4KTDH 4Z5RA 4P2QE 4WFEE 4WFHD 5DRZB 4YXKL 4F7TB 4U2YA 3O3BB 1N2RB 3GIZL 1HH6A 3CLEL 4LRIC 1BFSA 2YSSA 4M1CD 4X5WA 4KUCF 1EX0A 1NUGA 2VQUA 3EUUA 2FR4A 4LSVH 4PP2B 2CKBB 5MHSE 1YPZF 1NLDH 2EECA 4LCCB 3REWA 1U8HA 5EU4B 1OPGH 3TN0B 4LCUA 5AZEL 2FL5A 2XY2A 3SCMC 5DFWH 2ZOLA 2UYLB 2XA8L 5DZOA 1JPST 4L8DB 5IFJA 4RMVA 4KTEL 3W5NA 3B6SA 4KMTL 5IIEA 3GM8A 3BD4A 1I8KA 4LLVA 5B8CA 5HGHA 4HWEH 5D5ME 4U0RB 5IW6B 4Y0GA 4O51B 2AABH 2Q76B 2E8YA 5DVMA 4HUXB 3BN3B 5E1HB 1P7KB 4LF3A 3NCEB 3MZGB 5IHLB 4MHHI 5ALCH 3RNQA 3HMXH 2L7UA 5E2TH 3VFOB 4HJ0D 1S3KL 3BEVB 5CGMA 4HULB 5HHQA 3T8XA 4N0UA 4F7PB 3MLYL 4L8BA 3MGTA 1EAPB 4A2MA 1FV1A 5EZOL 2WBJD 5DRWA 4Z8FH 3JV4A 4K3JH 2R4SH 2GJJA 4FABL 5LCVL 3WNMA 1MOEA 2JIXA 5BS0D 3DXAA 1PSKL 2VMFA 3ZT7A 2Q8AH 2ZUQC 1JN6B 2RJMA 5GGVY 4TUKL 1N5YL 2KDGA 1V7ML 2CLVB 3D0VA 4OFIA 4C59B 3NVQA 3B5TA 2EKSA 1INDH 1WBYA 2OI9B 3D25A 3AXLB 3FRPG 4FQIL 3BPOC 2NY1D 1IGJB 5E6YA 3ZKMD 5B8CC 3W5MA 5ALBH 3LN5A 1OSZA 3HUJB 1FBIL 4UT7H 4NYLA 4K94L 2WSKA 2D3VA 4ODXB 1RZJH 4Z78A 1RV6X 3TO4D 1PLGL 2BDNL 3ILPA 1PD6A 4I18B 5TPWH 4ZTOL 4R8WH 1ZANH 4MGXA 3BQUD 1N64L 4XBGA 2WP3O 3E6FA 3JWDC 4PG9A 3TLRA 3LN4A 3L1OL 3P0VH 1QR4A 5L0QB 3V0WH 1F13A 1F8TH 5DQDH 4F57L 4XTRD 5CEXB 4QEGA 1I9RL 2HVJB 5I8CA 4OD3H 1CF8L 4OUUA 2CIIB 2V9TA 3KGRA 4NSKA 1AH1A 4X4XA 3TJEH 1HQRB 3S36L 1Q1JL 1BD2E 3EYFA 1RHFA 3QXVA 4X98B 2N56A 1U92A 4PJAB 3UTQA 5FECA 4LARL 1HCVA 4TVSa 2VOTA 3MJ9L 4X6CB 3S35L 1NC2B 3VXMB 2X4UB 3AVEA 3GKZA 2X6MA 4JZNA 3DMMD 1TNMA 3BRFA 5JPMB 3BUTA 3ROLB 1UH4A 4UAOC 3HE7A 4U1IB 4NN7B 1QVOA 2X4OA 5CIPH 2C3HA 2ZJSH 3VH8A 2D4FA 5I2IA 3D5OF 3T0EA 1CD0A 4NNYA 3QEHB 5B38B 5ADPH 5AG9A 4WUUB 2FLBT 1CGWA 4WHYH 1QSEB 3OR6B 3FQTB 4NQDA 1NCDH 5GRXG 4PRBA 4U33A 3PIQA 5JQ6H 4TTDC 4BK5A 1RZ7H 1KB5L 1IGFH 1W72L 1IGTA 2CGRH 4BUGA 2VXQL 1D5BB 3E6HB 3ARBD 1QA9A 4LMQI 4C4KO 3TYFA 1JMZA 3N1QC 1FLTX 1H5BA 4JFPA 4HGWB 2R0ZL 4UUJA 5TDOA 3CMOH 3UTTE 5GZOC 3H3PL 4XT1C 4TRPL 1A7PL 1W0YT 4P2OA 2EDFA 3NFSL 3QCTL 4MDIA 3RL1A 3MUGB 3O2DL 2VLKD 4F9LA 5LXGH 1JHKH 1CI5A 5D2NA 2VQ1A 3HE7C 1OP9A 1CXKA 1A6VH 1SJHA 5C09B 4OB5H 4X8JA 3FZUD 3BJLA 3T0EC 2XZZA 4L4TD 5C07A 4NQCD 4TVPH 2Q86A 3QDAA 4C58B 5JO5A 4Q9BA 1E6OL 4OGYH 4JLRB 4QHUA 2WK2A 2LU7A 3GMLA 1AO7A 3FHQA 2FO4A 3DI2B 3EZJB 1MNUL 5TE7L 4KRNA 4JDVA 5HI4D 3HCVA 3TBSB 4P49A 2ADGB 4GKOA 3O3EB 2C3WA 4HUUB 4MJIE 4MWFB 4XP4L 4ELMF 3IYLW 4E42B 1CK0L 4S2SB 1TCRB 2V7HA 3LKNA 4PJXA 2CDEA 5I6XC 1H5BC 3SKOB 1VFBB 1MCIA 3CGTA 5CCKL 3DGGB 1A1MA 1WZ1H 2QQLL 4P2OC 1J8KA 4I3RL 1EERB 4XPAL 3V6OA 4H20H 3CSYA 1KCKA 2P8LA 2AJYL 5D2NC 5D7IE 3CFEA 3E3QE 2BVEA 4HJGA 4NUJA 3HN3A 1Q94B 4J4PA 3S96A 1GC1H 2IH3B 4BSJA 1V7NL 4JFEA 3RIAK 1LO5A 3SCMB 4PJCE 4HAGA 3MV9E 3KPRA 3MRLA 3O0RL 2R1WA 4MAYA 2OJEB 5F7UA 2A9ML 4TSAL 1ZGLA 5K93A 2C4FU 3KDMA 3GJFK 4Y8DC 2FDBP 1SEBA 5ICZA 3LMJH 4RGND 2XYCA 2HMIC 3WFEL 3JWNC 4UDTB 3KLAB 3U4EA 2EDTA 1F3RB 1JF5A 3ULVF 3L3HA 5FUZL 3EIFA 3RVVC 4LPCA 4Z5RB 5H37H 3ARSA 5GGVH 2GQHA 2D03L 3IF1A 5E5UB 4PREA 1T21A 2YSSB 4X5WB 2XNAA 5F9OL 1J1PH 4JO2L 1R3HA 3V6OC 1UYWH 4G6FD 4QOKD 5HHVL 5D70H 1U8HB 2H26A 5GSVA 2AXGB 4J4PC 4LCUB 3VXUE 5I1LA 2FL5B 2ZUQB 3ULVH 2ZOLB 2J2ZA 4I13B 3U1SH 2F54E 2YD4A 3PJSA 4ODBD 5D1XD 4LVNC 5IFJB 1VERA 4MAYC 3B6SB 2R69L 3QSKB 5IIEB 4NC1C 4X9FA 4M7JL 3V4UH 1E4WL 1A6TA 1I8KB 4EDWH 4Z77B 3BPOB 4LLVB 5KS9E 1WC7A 3H42H 5B8CB 4Y7MA 5HGHB 3MQIA 1GRWA 4I0PD 1CLYL 1YNKL 1AQKH 4EIGB 4WY7H 2OTWA 1P7QA 3BUYB 4L3AA 1CIUA 4LF3B 2FATH 4O9HH 3BKML 3KYMA 1MELA 2AK4D 3BVNA 3RNQB 1WAAE 4PTUA 3VXRE 2DBJA 4OZIF 1HIML 2PR4H 5HHQB 4ELKA 3T8XB 4N0UB 5EWIH 4B7LA 4OZ4B 1MRDH 3MGTB 1JWMA 3L9RA 1RZJC 4K3DL 1FV1B 2NY6C 4U0QB 5CIPA 5DRWB 3IFNL 4K23L 1QUNA 4NQEA 4A6YH 1MFAL 4GG6A 3WFZA 4KTYA 4JR9H 2KZ1B 4BK4A 1D6EA 2JIXB 1MI5B 5FDWA 1S7TA 3DXAB 5KW9L 3CLFH 3B2UD 1ZLVK 2R56H 5BS0E 3D0VB 2EKSB 2M8XA 1WBYB 2X9XA 3HR6A 5KAQF 1AY1H 3QWRD 1Y0LA 3VI4F 1QNZL 2W60A 1NFDE 5IHUL 4PB0L 3LN5B 4Z7WA 1OSZB 2BRRH 1JPTH 1MCJA 1F42A 4NYLB 2BVOA 4UAOB 4X4YA 5D8JH 2H2PC 5JDJA 4Z78B 4WU5B 3DO3A 5EBGA 2VKXA 1GOGA 2V5MA 3WL9A 4FZ8H 4WFGE 4XVTH 4YFLI 2OXHA 4PJFF 4MXWL 5DYOA 2ZPKH 2VIRB 4M6OH 4Y1AD 3UJTH 3MOBH 4Y2DA 1N8ZA 1XF4A 4JO3H 2WBKA 1OAUL 5FAAA 2Q20A 4DAGH 1PBYA 1JNHA 1MCHA 5I8CB 3DARA 4CVXB 3BGFC 3HI5L 4FQJL 4M5YL 4D0CA 3W0WA 4OUUB 4NSKB 1E4XI 4X4XB 3QUZA 1NGXB 2H41A 2V5SA 1BWMA 4OGAC 5HHME 3EYFB 2WWKO 3IXAB 3UTQB 4WUKH 4OF0A 4YHNB 1YEKH 2HG5A 3O45A 5GJSH 4OFKA 4Q7DA 4JRYE 1B3JA 1WWCA 3MCLH 2Q6WA 4JZNB 3HE6A 1TLKA 4X9IA 3HNSH 3IKCA 3HE7B 4MQXD 1QVOB 2X4OB 3NH7L 4GXVH 5ELIA 5C0CE 2WZPD 2R0WH 3VH8B 5F7YC 3OKDA 4N8CL 5I2IB 1JGVH 4NP4L 3T0EB 4NNYB 3B8YA 3OKMA 4FFVD 4PUBL 5CD5C 1QP1A 5C86A 1MREH 4P2YA 4Y2DC 1A6UL 4UIKH 4NQDB 3RA7H 1AKJA 4PRBB 3QG6A 5I1IH 4CNIB 3PIQB 1DJSA 2FJGA 4LK4A 5I1EH 1GVIA 4RIRB 1C1EH 1ZA3A 4PLKD 1IGTB 1SHMA 1RZIA 1ZHNA 1QHOA 1QBAA 1QA9B 4JDTH 3HTLX 4QXGL 1NGYA 4WVRA 1C5BL 3TYFB 5EG6C 5IMLA 4QXUL 5I6XB 1H5BB 4JFPB 4AEHL 4UUJB 3VA2C 2AJXH 1ES0A 2D7QA 5TDOB 2OR9H 4JKLA 2VR9A 1T1XA 3IS1X 2DIBA 4OFYA 4P2OB 2GHWB 3ZYOA 5AZ2L 4MDIB 4DUVA 1EK3A 3MRRA 3HE6C 3RL1B 5KN5B 3PV7A 2VLJD 4MNGB 1MEXL 1S8DB 4OLVH 2VQ1B 5D2NB 1T2JA 2VLKE 2QQQA 4NQSA 3W9DA 1QLFA 1SJHB 1QD0A 4X8JB 2DMBA 5ADOL 4MA8H 2K9UA 5C07B 4HF5L 4PY8J 2Q86B 5JO5B 5D2LE 3ET9F 3VRJA 4L4TE 3UO1H 3CZFA 3GMLB 1AO7B 3L5IA 2IJ0C 5HYJD 2O5XH 2FO4B 4M1DH 3CDCA 5FYJE 1G9NL 2W91A 1GC1C 4NO5B 4PPTA 2APBA 3M07A 3TT3H 5IVZA 5C6TH 4WHTA 1LO4L 2HT3D 2C3XA 4MB3A 3KYNA 3DX7B 1MJ7H 4JZJA 1SVCP 4XCEA 2VSCA 2B39A 4XP1H 1J10A 2V7HB 4U3XA 3LKNB 5FYKD 4PJXB 2CDEB 1TIUA 5CHNA 2ARWA 1A3LH 1ZSDA 3WO3B 4PJGF 4FQLL 5E2WL 3U4BH 5D6CA 4X7EC 3WNOA 3GBNL 3VMOA 2CR3A 2O61A 5ECJE 1X5ZA 1VHPA 2OTUA 4P5MA 3C8KB 3HC3L 3GMRA 3CSYB 3IFLH 2P8LB 4IS6A 2BSED 1A4JB 5IVXE 3CFEB 2NXZD 4HJGB 4NUJB 5JHDD 4H1LH 1F4WH 1Q72H 1CTNA 1XMWA 1B90A 5DUML 4JFEB 3WS3A 1LO5B 1QSFB 3LKOA 3RKDD 1HDMB 5KSBE 4M43H 5LQBH 1D5ZA 1S7QA 3KPRB 3MRLB 5I8OL 4LVNB 4A6YA 5HYSA 2R1WB 4MAYB 4F2MA 1R5WA 3IDMA 2A2QT 1RU9L 2CLZA 5KOVC 1JF1A 1CDGA 3KDMB 3O2VL 4XVJL 4YHMH 1LO3H 1SEBB 2VDPH 5ICZB 3P73B 1EHNA 3LQAL 1JGLH 1U8QA 1MWAH 2XN9E 1MCSA 5DD0L 3HZKA 4CAGA 3U4EB 4RGNE 1GPOH 2B5IC 2BOCA 4JZJC 3GJFH 4B7IA 1QFWI 2UV3A 3L3HB 3QCUL 1FFOA 4OLUL 4YXLH 3ARPA 1HINL 2IMMA 3CFIC 3ZDZF 5T1DL 1EUUA 2IH1A 1JE6A 5B3JF 1GL4B 3MRBB 3IF1B 2NY6B 3K1DA 2RFXA 1FN4B 1WAAF 4PREB 1CDJA 1T21B 3ARWA 3GBLA 2XNAB 4G6AD 1R3HB 4Z95L 2Y1VA 2YD7A 3VDAA 2HJKB 1GCFA 2H26B 4RRPG 4QOKE 5KSAA 3SJVD 5HI3C 2EIZA 5I1LB 3PDOA 3KXFA 4M61B 4X7TA 5E24E 3ZYIA 4F58L 3VFVA 3V6FA 4BELD 1JZ6A 2AQ2A 4QTHA 1A6TB 2CUHA 5EPMB 4S10A 1WC7B 4ZUSA 4XXCA 3FQUA 2WUCH 3D69A 4UT9L 3TYGH 2OTWB 1P7QB 5DFVD 4LBEA 3AFLA 4WI3A 4XCNA 1AC0A 5KANG 1DBBH 4XNXH 4QRUA 4KK5D 3RX8A 3KYMB 2AABL 4R96A 4GXUM 3BVNB 1NCCH 3A0OA 4TULH 1U8MA 2VR4A 4NM4H 4YR6A 2I9TB 1U6AL 3VGBA 3SE8H 4OIAA 4ZUVA 5HGAA 1JWMB 1XR9B 3L5XH 2X5PA 3L9RB 4HMCA 4BUHA 4P9ML 5E8PA 5CIPB 2JJUA 2XZCH 3FB6A 4ZXBA 2YRPA 4GG6B 5L88L 3BGFB 4ODHH 1J9CT 3MV7A 3GHBL 1OM3L 1KEGH 1MSPA 1AGFB 1D6EB 2RGSA 4IRJA 3NABH 3LD8C 5KSAC 4K3JL 5FDWB 1ZXQA 4Z7QE 1AQDA 5HHOE 4M6ML 2BFVL 4KI1A 3RVWC 1ZE3C 2YHGA 3BX7C 3UTSA 5GRVK 4Y19D 1Y0LB 3B8SA 4AENA 4KROC 3FO2A 1UT9A 2W60B 4ODVH 4M6NL 4YAQA 5FF6A 2VDLH 3UDWA 3CVHH 3KR3H 4XXCC 4Z7WB 3C08H 3GUTA 5GISH 1AFVH 3JWOL 3Q3GA 2BVOB 1JFQL 1P1ZA 4ALAL 4RWYL 4JVUA 1KCRL 3ZE1E 1GOHA 4JB9L 4KK6D 2JELH 3VMPA 3WL9B 3D18A 1P69B 3F62A 2FBOJ 2EEDA 4IMLA 4DVBB 4LCIL 3VFMB 3PP3K 3SY0A 1SBBA 5B39A 5EO9A 4UT6H 4AIOA 3ZKNC 1S78C 5DYOB 5LWYH 2BVTA 4X6DE 1ZANL 3U48A 4Y2DB 1N8ZB 4L3ED 1IZKA 4DQOL 3QUYD 4MX7A 4Y1AE 1JNHB 4ZXBC 3UTPE 1LP9E 4JM2A 2DQEL 4D0CB 1EHAA 3W0WB 3DO7B 2VC2L 1YY8A 3V0WL 4KKNA 4EVNA 4IRJC 3RVUD 2HP4A 4KRMB 1Q0YL 1XGYH 4CU6A 3RQ3A 4ZSOE 5JA8B 1RZFH 4OV5B 3OXSA 4YHZL 5K9OB 1PZUB 2HG5B 3O45B 1U3YA 2DI9A 4KVCH 3QFJA 3LHPH 2Q6WB 1BAFH 4XWOD 3MYJA 3UDWC 4JPVL 5BJTA 3HE6B 4CN6A 3QQ9C 3IKCB 3BKYL 1AR1C 5AUMB 1GGBH 3F12A 2MQCA 1DBMH 3OKDB 5TQ2H 1MQ8A 1NGPL 5D7SH 3OKMB 3QPXH 2VZOA 2W0LA 3OF6D 5E9DA 4L29A 4LCYB 1T1YB 4JG0L 1I8MA 3RHWK 3RBSA 4MNQD 5I9QB 3BRGC 4G9FE 3GK8L 5ADPL 5IQ7L 1S9WA 3FN9A 5CJQH 2B1AH 1AKJB 5ERWB 3QG6B 1L7TL 4H1LA 1Q0XL 1T2XA 1W0VA 3F6IA 4JM2C 2VDKL 3JTSA 2F53D 5DJAA 1JVKA 3U7WL 1ZA3B 2EIEA 4LRNL 1DVFA 1L6XA 1RZIB 1ZHNB 1XGPA 5FGCE 1CGVA 2ADJA 1QTYT 3MO1B 4S1RL 3MOQA 3NFNA 4HPOL 3ZHKA 5JQ6L 1NGYB 4GMTL 2DM4A 4L1HA 1TETH 3UJIH 3FONA 4L9LA 3WFHA 1A2YA 4DUXA 4PJ7A 4KJPD 4B0MM 1EAJA 5DD1L 3VXSE 4ISVB 1ES0B 1JTTA 4FNLL 1T1XB 5I73C 2E9JA 4N0YH 1MWAA 3MRRB 3C2SA 5DRXA 4QRRE 5ENWB 3GJFA 1KIRA 3SDXF 2Z93A 4NDMA 4NQSB 1IL1A 3W9DB 1QLFB 3WO4C 5A2LH 1ZHBB 2P46B 3MLWL 4RX4D 2P5WA 4M7KL 4KI5F 2FBJH 3HG1D 2QQNH 2ORBH 4XNYH 3VRJB 2XQYG 1EXUA 3CZFB 4LNRA 5JDSA 5SX5H 1YEEL 2YPLD 3N50A 5DA4A 1IFHH 2D7TH 1MFDH 1IAMA 4WHTB 3HHRB 3LS4L 1DVFC 4EN3A 4RFEA 1OQOA 3SGJA 3KYNB 5DHYA 4CRPA 2I27N 4JZJB 2RCSH 3QDJD 2XRAH 4XCEB 4FP8L 1NANI 3P4NA 4HIXL 4N8VG 4GRWE 5CHNB 4UNVA 2OMBA 2R8SL 4H0HB 3KPMA 2F19H 5D6CB 3C6SB 3BKJL 3TVMA 2O61B 5IHBA 1RIHL 2OTUB 4P5MB 3GMRB 5T3XE 3OGOE 4IS6B 4LHJB 1X9QA 3WS3B 2YRLA 4JREB 3LKOB 2ADFL 1MFNA 4Y4HA 3V0VA 5MENE 4YHIA 3GFUA 1D5ZB 2NY0D 2AJUL 1S7QB 4PJDA 5ESQA 1J86A 5HVGB 1MCKA 4A6YB 1JBJA 3RWGA 1DLHB 2LE9A 4X80H 5ANMB 3ALPA 2CLZB 1JF1B 2NR6D 1G9MH 2ZUYA 3GBMH 5EA0L 4ZTPH 3ZE2F 1U8QB 4EN3C 3QDMD 5DT1H 2DQUL 5FYJU 3H3KA 3HZKB 1QYGH 1F4YL 3CJJA 3MR9A 2BOCB 2DQJL 2VZSA 4DK6A 5HGBA 1AGDB 3ARGD 1FFOB 5D4QA 4JFQA 5F72S 2YWZA 4U1SA 3PWPA 4M62L 2EC9U 2VISA 3CVHA 2IEPA 4JEGB 2IH1B 5KVDL 3EO1A 2ZNXA 2LAGB 5B38G 4RISL 3TVMC 5HD8D 4I2XB 2RFXB 5HHPB 4Y4FA 5DJDA 3OAUL 3EDEA 4KRPD 5CBEA 2HRPL 4P3CL 5KZCD 2C1PA 2UZIL 4LSUL 3LD8B 5KSAB 4WHDA 2EIZB 3SDAA 3SGDI 5KVEL 1YEDA 2GSIA 3KXFB 3T77B 4Y4HC 4X7TB 1VFMA 2DQFA 3AS1A 3OB0H 1H9VA 1RUQH 3U46A 3L7EB 2FECI 3V6FB 1SYSA 3KPSE 3ZO0A 4KROB 2APTA 5EIVA 2X05A 5CBAA 1TJHL 3FQUB 4BKLA 5L6YH 5FM5O 3D69B 4PP1C 4KKBD 1R5VA 1YEGL 5MEOB 3M8OH 2PW1A 4Y5YA 3VFPA 2EXWD 1DQLH 4QRUB 1KF9B 3L3KA 1AQKL 1Z9LA 3T04D 4R96B 4P4KD 1R3KA 3MMEA 4PGJA 1U8MB 4U6HA 5HYFA 4YR6B 3WXVH 3CAFA 4ZUVB 5HGAB 3O6LL 4U2ZA 5E8PB 2AXFA 3CXDL 2PR4L 3FB6B 1ACZA 4ZXBB 1PJ9A 4Y4FC 2VERN 2B1HH 3TWCL 2HKFH 3IDIA 2EO9A 3MV7B 3B5GA 3ARDD 3B9KA 3EYSH 4IRJB 2DLTA 1F6LL 4XAWL 1N6QL 2YR3A 3GJEA 5AYUL 4PJBE 3SDAC 5EBWB 1G0YR 1AQDB 2QKIA 4Y4KA 1J7VR 5I1HH 4ZS6D 4NKQB 3UTSB 3CLFL 2R2CA 1WCQA 2R2EA 1N59A 5FXCH 3FO2B 3WFCL 5T3ZH 4YAQB 5FF6B 4AH2B 4XWGL 1LQSR 5I16A 3RBGA 3Q3GB 4JKWA 3LEYH 4PRPE 4RMWA 1ZHLA 1KN4L 1MAKA 4Y5YC 4KH2A 5IMMA 3LH2H 3D18B 1S5IH 5EBLA 4IMLB 3GI9L 3OTTA 5FK9A 2EC9T 1YMME 3SY0B 4EXPX 4LKCA 5B39B 2NX5A 5EO9B 4M7LT 5FYLD 1CU4L 4FZ8L 3ARQA 1FH5L 5F7FA 3RP1A 1KFAL 4AMKL 4XP6H 1QRND 1LHZA 1UACH 3PP3H 3H0TA 4MX7B 1T89A 4FQ2L 1G7PA 1Q8MA 3I2CH 1VADA 4JM2B 2ITCA 3EDFA 3BH9A 3WUWA 3QHZH 1YY8B 4WI6A 3B9KC 5BMFH 1CG9A 4EVNB 1X4YA 4BFIA 1HYSD 2K1MA 2PYED 5HDQL 1QRKA 2Q7NA 1IC7H 3OXSB 1TVHA 5T5NG 2X4TA 4Y4KC 3I50H 2YPVH 1F90H 1KENH 2XTJC 4RGOH 3EKCA 4U7KA 3QFJB 5I73B 4ONHA 3JV6A 4WUKL 2ED9A 3ALXA 2ED7A 1SY6L 3KYOA 3X3FL 3SDXA 2UY6A 2YC1A 2A9NL 3MYJB 5BJTB 4LCWA 1KACB 3RHWF 2VSDA 1FNEB 1G6RH 1A7OH 1LMKA 2JCCE 3L3DA 4LIQL 5GZNC 3CFCH 4FXLA 1J0HA 3F12B 1EEUA 3J7HA 4ZPTA 1H3GA 4OV6F 3WO4B 5ILTH 5FHBL 5IJVB 3QUXA 4MCZA 2DYPA 5E6ID 2XFXA 2R9HD 4L29B 3O3DA 4RBPK 3PHQA 4MAUL 2ILLA 4B41A 4ERSL 3EO9H 4QTIH 3NTCH 4KMLB 1XF5A 3QA3B 1DQDH 3MRDA 4FFWD 3UJJL 4L1DA 4H1LB 1T89C 1W0VB 1MREL 1O7SA 3DRQA 3JTSB 3MUJA 5DEFA 4Z0BL 5DJAB 4U1NA 1D5IH 4OZGA 3RZCA 1DVFB 5JUEH 4P2CG 2F53E 2X9WA 4M8QB 5CEZL 4KV5F 4PJGB 1CLZH 1QLRA 4OLZH 1UQSB 2JB5L 4PFEA 4D0BA 3FONB 1A2YB 2H6PA 4PJ7B 5C0AD 1B2WH 3VXQB 5T33L 2NY2C 1R3IH 3RWJA 2DJ4A 2BK8A 3WD5L 3MA7A 3GO1L 4DJMA 4G6JL 4O5LH 1MWAB 2DD8H 1IEHA 1NFIA 2QSCH 3I84A 4TSBL 4HKBA 4FZEL 3X14A 1JNLH 1R6VA 4G7YL 3GJFB 1YN7A 3A6BL 1KIRB 4EDXA 4QHNA 4KI5C 2Z93B 3VD9A 4NDMB 1IL1B 2PTTA 2DQIH 2P5WB 1MCOH 3QUXC 3V4PL 3OMZA 1DQML 3MJ7B 1ZV5A 4DUWA 4MLIA 4H8WL 4LAJH 3F58H 4PV8A 2GKIA 5EO1B 1NAMB 3HG1E 5CILH 2KL6A 1WICA 4OCMC 1EXUB 1IGIH 1OARH 1TNNA 3OKNA 1DFBH 3C5ZA 3WNPA 5JDSB 1FL5A 1H3PH 2QHRL 4KJWC 1UH2A 5GIRA 5FYKH 1V3LA 4KKCC 4RFEB 3PXJA 2K3TA 2ICES 1MHHA 4HDIB 2VUOA 4PJ5D 2PETA 3P4NB 2AI0L 5C9JA 4HJJH 3QDJE 2NYYD 5E99L 2F8OA 3KPMB 4XVUD 1G9MC 4DVRL 5BXFA 4MDJA 4NQXB 2XKUA 1OAKH 3VFTA 3TVMB 1FFNB 3X3GH 2I9LA 1YMHA 1QFWH 4UB0H 4NN6C 1S9VA 3ULUD 2BNQD 5C0DA 3QNZB 5LGHL 3U9PL 3BYYA 2DQHH 3BEWA 2EZ0C 1CICA 2Y5EA 1CR9H 4HGMA 4DKEL 4XPTL 4Y4HB 2XICA 4X7FC 1A6ZA 3V0VB 4IBLT 4YHIB 2A0LD 4AEIL 4PJDB 3N1PC 5ESQB 3H9ZA 4OF6A 5DMJB 3RWGB 3DV6A 3C5ZC 3IRZA 3RUGF 1YEJL 1I1AA 2W0KA 2V2XA 4W6YB 1AJ7L 3D2UD 1JYVA 1R3LB 3FO9A 5D72L 3MRIA 3HC0A 2AEPL 1U58B 4K8RL 3OKEA 3MXWL 2EH7L 3MR9B 2ID5A 5I19H 2CR6A 12E8H 3H9SA 5HGBB 4P2RE 1QPPA 4JFQB 2X41A 4U1SB 2GTWB 3PWPB 4HK3N 1Q9OA 2VISB 3VH8G 3O6FA 3CVHB 1UA6L 1FO0H 1MFEL 1RZGA 5DZLA 4LSQH 4YZFE 3VW3H 2AXHA 4Y4FB 1YNLL 4JHWH 3B2VL 2RQ8A 4HV8B 5CBEB 1CTOA 1H8SA 4LPWA 2EEAA 2C1PB 3IFPA 1YQVL 2VZTA 1JHLL 1RK1A 2J8UE 3QDGE 4LQFH 3SDAB 1MCWM 2AJVL 2GSIB 4MJ4A 2Y36H 2DQFB 3B5HA 3BYTA 1SYSB 4KZDL 3QXDA 4PY7A 2AKRA 5DK2A 3DETD 1JRHL 3NBNA 1I1AC 4OCWL 1E6JL 5CBAB 2Q8BH 4BKLB 3D39A 5JXEA 1EFXD 4F8QA 4FQQA 4LSSL 3TFKD 2PW1B 4Y5YB 5C08A 4XNZC 1FE8H 5A1AA 5C0EA 3VFPB 5CFHA 2DDQL 3BZDA 5CSZA 3CDFA 4N90E 3L3KB 2FJHA 2YWYA 4LPXA 1YDPA 2QSVA 2VLRD 1KNOA 4RSVA 1I7UB 5BRZD 5JOPD 1G6RA 3I75A 4B53A 3F5WA 1JYXA 1A9BA 4RMQA 2X40A 2AXFB 1BEYL 4AM0B 1NLBH 1UCTA 4HQQH 3RU8L 3C5SA 4ZFZA 3NGBC 1H3WM 3KG5A 1IAII 4U6YA 3B9KB 4JFHE 1CXHA 5KVGH 2BNRD 4JFFE 3GJEB 3WKML 4NWUL 2QKIB 3SDCA 4GXUN 1SYVA 4QXTA 2IANA 4ZOAA 2XTJB 4IOFC 2VNCA 1RUAH 2PW2B 1MAMH 1EUTA 2VWEC 2R2EB 1N59B 1VPOL 2IF7A 3SOBL 1P5UA 1IC4H 1L7IL 5I16B 3DOSA 2PF6A 4XHJC 5JXEC 1WZMA 3GZKA 4NFDA 4I9WD 2PO6D 1ZHLB 5ITBH 1C5DA 1LGVA 5IMMB 2GT9A 3MLXL 5EBLB 2VLJA 3G6DH 4DGIH 1CD1A 4HKZA 5FK9B 5CWSA 4P5TA 5D93C 2VABA 5T1KA 4LKCB 2M1KA 1GYAA 2NX5B 4JQIH 3WFDH 3JUYA 4NZUH 4ZODA 1YC8A 3U0PA 4QY8A 3FMGL 2B20A 4ONGL 4ZAKA 4DW2L 1FJ1A 2HT2C 3H0TB 4Y16A 1X4XA 5AEAA 1NEUA 1VADB 4LP4A 3TN0D 2A1WH 5EU7E 3BH9B 5IJKC 3CFBB 3WUWB 2WV3A 3G5XA 5SWZA 1XGQA 1CG9B 4MVBC 4BFIB 2HJFA 3QUMH 5E0QA 1F3JA 3MRNA 2DQTL 1TVHB 3ARRA 2X4TB 3SDCC 4CMHC 2W9DH 5F70A 1ZLSL 4O2CA 1DP0A 4G8GA 5K9JH 2NY2B 1EHLL 2WP3T 1RUPH 4KHTH 3P4MA 2HFTA 2P49B 4ONHB 1X5YA 3JV6B 1F00I 2VXTL 3KYOB 5I1JH 2ICEA 4TQEH 3SDXB 2YC1B 1IEBA 5LAXA 1U95A 5KOMC 3O6MH 3DI3B 3EDJA 4GAYA 4K7PL 4N9GA 5FO7A 4KU1A 1SJVA 1XCQA 3FT3B 2VXSL 1T7VA 4FQCH 3WSQH 4HX1A 1KEML 4ZPTB 3ARZA 1P6FA 2QTEA