2DQHL

Crystal structure of hyhel-10 fv mutant (hy58a) complexed with hen egg lysozyme
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqhL00
1A64A 1MFDH 3QEQD 3HPLB 1KPRB 1CLZH 4QHLB 2EECA 1UXWB 2AV7B 4LKXB 1A6PA 3FAXA 5GGRB 5HGGS 4OCWL 5T33L 4TUOA 4Q0XH 4OZGE 4IRJD 4L4VE 4ZD3H 4KZDL 4AEHL 2QQLH 1FFQA 3FB5B 2CRIA 2VSDA 1IQWH 4YDVA 5I73C 3G6AB 1VESA 2H26A 3K4AA 3RWCA 5B3NA 3ESVF 3P9LA 1KB9J 2V9RA 2BVOB 1AGCB 5H94B 3C9NA 3OKDB 1YEFH 2CUIA 3QQ4B 4XNXL 2X89D 4N0FA 3DPBA 1T04A 4E41E 4PUBH 2D7PA 3SE3A 2C26A 1H8NA 3GHEH 4PJ9D 3O3EA 2ICWI 4ZXBB 1ACYH 4PRIE 1AR2A 2ITDA 1JUFA 2D4DA 3MV7E 4F7MA 2FEEL 3QI9D 4U1LB 4OM1L 3QUYB 5D6DC 2QKIA 3R4DA 3RAJL 1T7ZA 3Q48A 1KIPA 4YK4B 4ZOAA 4ZFZB 2VIRB 5EU5B 4OZIF 2BOCA 5DR5H 4K3EH 3W0WB 3X12A 2E9BA 3WDIA 1X5FA 4WV1B 2PTVA 4MVBC 5HDOA 4S1SL 3CX2A 1AXTL 3RX8A 2QR0A 3FT4A 5HDLA 2YR3A 3CFCH 3WS3B 3BRFA 3STBA 4XPTH 4XP6H 3T0AA 3QQ9D 4BFGA 1QLRB 1OAQH 4WRLA 4WI5A 1AIFA 1KEGH 1F4XH 4PJEE 1O5DT 3CFJA 1YY8A 4YHPA 2RBLA 5F1SA 2QADB 3FQRA 1MVUB 2ZJSL 3D39B 4EI6B 2NY3D 2HFGH 4G6JL 4AIZB 4HX1A 4P2OB 4MJIB 1NAKL 5EO9A 3C6LD 5INDB 4HPYH 2MMXA 4N8PA 4GT7A 3KJ4C 5F6HI 1FNGB 1T2QH 3T4AB 2DQJL 2FRGP 4NWUH 1DBKH 4WFFD 4LAJH 2R1WA 4CN1A 1DN0B 3GUTA 5M94B 2B8OT 3FB8A 2IFFH 1MHPL 4HS6B 3FO1B 1BJMA 4JY6B 1R5WB 3G5XB 4OIBA 1M6OA 4FMKA 1NFIA 5SX5H 2YUVA 4PGZA 2BHUA 1YEEL 2B1HL 4K3JH 3RWIA 4DN4H 4M03A 1X9QA 4WUUB 4ZDHA 4QXUH 5IVXA 3EFDL 5TFSH 3MRNA 5C0IB 1X3DA 1F3DH 1WBZA 4ZO9A 1KPVB 4G8IB 1HIML 5D2NE 2ZCKL 5J6HB 4LCIH 3B9KD 4P3CH 5DRNA 5EUKA 1QNZL 4BM7A 1Z9OA 3QDGE 4F7CA 4XHQA 2AJ3B 3ESUF 5GS2H 1CIUA 5HHQA 1EEZA 5L2JB 1S9WB 1RHHA 3MRIB 1P7QB 2I60H 2Q76A 1S7QA 5E2WL 3MJ7B 3PWJA 4B53A 5ENWA 1F4WL 15C8L 4X4ME 2APTA 4JDTL 3HRZB 2AXJA 3HZYA 5D1QA 3TPUB 1TDQA 4YHOL 4DUXA 3IU4L 5IM7A 1X7QA 2ZSVA 4WVRA 5SX5K 4ESKA 4ZS6C 1WSST 2ZPKH 3CUPA 5HJ3A 5CGYC 5GSVB 4QRPA 3D85D 1QFWI 4R9HA 2WM0A 4IRSC 4PJIA 1WJ3A 2ZWLT 4IDLA 2C4FU 4LDLB 2ERJC 3SGEH 4OFPA 1HCFX 1N0LA 4YDJA 5T33H 1AP2B 1FN4A 4R7DB 4KZDH 2BNUA 4AEHH 3NPZB 4G7VL 1UEMA 5C3LD 3DMMC 1FGVL 4FFWD 4YDVB 2R1XB 1OGTA 3RWCB 4MJ6A 1ZAGA 3P9LB 3V9FA 3QUXD 2ZUTA 4NDMA 5DT1L 1KB5B 4XNXH 3CDGB 3MXWL 4NP4H 4JQIL 5D7SL 3AS2A 5FYJL 1CFNA 4N8CH 5DVNA 1R3HB 2P44B 3U79A 4Q6IA 1FV1A 3D48R 4HKBB 3O3EB 5IW1B 1WAAF 4PJDA 4U05A 1JUFB 4F7MB 4OF7A 3VXOB 2VLJD 4ODTL 1NFDA 4RA3A 3JBG7 1RUKL 1XR9A 1N8ZA 4X6EB 2ESVE 3CIQA 4L3CB 4EVNA 4JRYE 1R3JA 4YBHA 2R0LH 4KRNA 2BOCB 4JKPL 4WWKD 5JLZA 3X12B 2WW8A 1U6AL 5JW4R 1RK0A 4M00A 4OLXL 2ZNWA 4P2RB 5ANMB 3FOMA 4TRPH 4S1SH 4EI5A 2QR0B 3FT4B 1AXTH 3FCTA 5GSRB 4P5TA 4OV5A 1CGVA 1UZ6E 2JIXB 1MCHA 5CINL 3A6OA 4PTTB 4Z6AT 1A4KB 3C5ZA 3KLAA 3NIFE 3RWDA 3BE1L 1YY8B 3OKLA 4YHPB 5I1JL 3ARFA 4NZDA 3G5YA 1CGWA 2K7QA 3FQRB 4MS8D 3MLWH 3QAZB 1OWWA 1U36A 1Q94A 5L8JB 3U7WL 4EOWL 3EO1B 1OD9A 1ZSDB 5KVEL 1MEXL 2GK2A 4HX1B 5E00A 4PRHD 1RURL 1GZQA 1NAKH 1VHPA 4KTDL 1HHIA 4V2CB 3VXPA 3HZKB 3TT3L 4Y16D 4HDIA 4G9DB 3UEZA 5I30L 2AJVL 1BECA 2R1WB 1REIA 4KROC 3DIFA 2OK0L 5JQ6L 3CU1A 4XVJL 4OZHF 2JELH 1NCAH 5EB9A 3LH2H 3PWUA 3SDXA 1M6OB 3WXVH 1NFIB 1DVFC 5DK0A 1ZLVH 3RWIB 1YEEH 2NXYD 5LVEA 1RUAL 5DRWB 4OZ4A 1G7LB 2X2YA 1IT9L 2QEJA 4ZYKB 3V0VA 5KTEL 2H1PL 1HKFA 1CDBA 3MRNB 5J12C 2ZCLL 1GXEA 5FGBC 3ZO0A 1WBZB 5JR1L 1QBLH 1HIMH 1W0VA 1DQLH 2OTPA 3VFUA 5DRNB 4IMKA 1QNZH 1S7SB 3EFFB 5D7IE 4GW5A 4IHOA 3D87B 5B4MD 4WEMB 1TJIL 4Y4FA 1X5AA 1X4YA 1IGIH 1RUMH 1EEZB 4FTVE 2MKWA 4CRPA 1RHHB 4WU5B 3S8WA 2QL1A 1A7RL 3D3VA 3VFWA 2Q76B 1U8PA 5HGDA 4Q2ZA 1BHGA 5E2WH 5FHAH 2ZNXA 4PLJC 2P48B 5CBEA 5DFTA 2MOVA 3SKNA 2AKRA 3E8UL 4YBQD 3IAGC 4JDTH 1YUHA 1X5KA 1LEIA 4XWOD 3NFPA 3U9UA 4MJ5B 1OAYL 1S5HA 2ZSVB 1ZLVK 1FVEA 4EBQL 5HJ3B 3CK0L 4C4KT 2BNRD 4DGVH 1D9KD 4QRPB 3MFFA 4PJBB 1HKLL 4MQ7A 2XTJD 3MYJA 2N56A 3SQBA 3CDCA 3F58L 4CADA 2AEIT 4YDJB 3HAEA 3DI3B 1FN4B 2HH0H 2Z91A 1AE6L 3B8YA 3BW9A 3HZMB 2BNUB 2VDRL 3N1PC 1OGTB 4NQEE 4NDMB 1BZ7B 1YPZA 4QHMA 4HWNA 1EHXA 3WN5A 5KSVA 2ORBL 4LLWA 5F44A 4XAKD 3S34H 4CMHB 2HKFL 2OR7A 4Z95L 2W07A 3HB3D 5FYJH 1A7QL 4WO4C 4S1QH 3QIWB 3IDMA 1TVBA 1FV1B 4KUCF 4EXPX 3KXFE 2IQ9L 3TJEH 5IEHB 4R97B 4JFEA 3AUVA 4Y5XC 3VWKD 5CGTA 3T0DA 2V5YA 4ZS7H 1XR9B 5FUOH 1N8ZB 5D72H 3DXAE 2W59A 4YLQT 1R3JB 3ME0A 2FECL 2YPVH 4MB3A 3MRKB 4UT7L 4JKPH 1QPXA 5JLZB 4PGBA 3MNZA 3PIQA 3DUSB 1JN6A 1JF1A 4EI5B 4QXWA 3F7VA 2D7NA 4IMLA 4P5TB 2QQNH 3RVUC 5J9PA 4OCSH 3UBXI 5IWLC 4JFDD 5I1DA 3UPRA 1WZLA 1VSCA 5D5ME 2AJUH 3ARGA 5C0DA 3C5ZB 4Z18A 1J5OH 2OR8A 1FE8L 3RWDB 5ADPL 3SDDD 2FIKA 3BE1H 1IVLA 2VZ1A 1HE7A 4DCQA 4PP1C 2H2SC 4MNGA 1QRNA 1G7MA 1Q94B 1EVUA 3U7WH 4EOWH 5KVEH 5TGBB 4Y8AA 4DZ8B 2P5WA 2X40A 4IJ3B 1RURH 1HHIB 3U36B 4KTDH 3SJVD 3FRPG 3FB7B 3IDNA 1MHCB 3IKCB 1B9ZA 2GTWA 4P99A 4HDIB 3PGDB 4OF6A 3MLPA 5I30H 5DK2A 4JANA 2OK0H 1WZ1L 4S0TD 4Z7QF 4QWWD 3UTPD 5DGQA 1Q72L 1NCBH 4HGWA 3PWUB 4OGYL 3KGRA 3T4YA 3TYGL 1HH9B 4HJGB 1TMCB 5DK0B 3GNML 3GHBH 3QIUC 1ZWIA 2F54B 4OUOA 1H9VA 5D7JD 3GSNA 4OZ4B 2Z9TA 3KJ6H 2H2PD 4NKDA 5KTEH 3EYUH 1MCDA 5KG9B 1ITBB 1R6VA 5CHNA 3U0PA 5KS9E 2YS4A 1IKFL 5JR1H 1EV2E 2R39A 2YD6A 3UJIL 1BVZA 4RCAA 3Q5YA 3MODL 3CLFL 4IHOB 3IF1A 3VD7A 4RGNC 2GITA 1OP9A 5C08D 1TJIH 3EW3B 5GS0D 3SGKA 3RWEA 4MA7L 3FQTB 5DTFA 3LPWA 3UTTD 3EDDA 3VFWB 3EYQD 1NMCB 3OZ9H 3EYVA 3O8XD 3GDBA 2XG5A 3OB8A 3L3GB 2AKRB 5FYKE 1AGDB 3VD9A 3HUJE 4MNQE 1CGYA 2XFXA 4V1DA 1LEIB 3NFPB 1FO0L 1PSKH 1GGIL 3MUJA 1QQDA 5FYKU 3MTRA 1FVEB 3SE8H 3QDMD 4NJ9H 3DV6A 1GGCH 1S3KL 2P24A 1MAML 4MQ7B 3QCUL 1HKLH 3NPSB 4EN3D 1CZ8L 4EKXA 4CADB 3P9WB 1FIGH 2O5ZL 3UP1A 3IFNL 4HUXB 2A6DA 3V95A 1JYVA 3HAEB 2VZUA 1K8IA 4U1SA 3BW9B 1LEGA 5I74B 4LP4A 1AE6H 4WTWA 1EFQA 1OARH 1Q1JL 2VDRH 4NZRH 1YDPB 1IGMH 1AGBB 3RKPA 5BMFL 3JWNC 1DEEA 3QO0A 1L7TL 1XGUA 4LVEA 1OF2B 1S5IL 1CVSC 2XWJA 4ZXBC 3UO1H 3WN5B 3PQYD 1WBXA 2P47B 1DL7L 4LLWB 4NJAH 2HKFH 1Q38A 5GS0L 5CJ8A 1EVTC 3IDMB 1TVBB 2YPLA 3HE6A 5J11C 1RZGB 2NX5D 1EZVX 2IQ9H 3NH7H 1P84K 4G7YL 3E3QE 4FQXA 1S7WA 4JFEB 4JCMA 3LEVL 4JKKA 4PGDA 5EUOA 2Y7QB 3QCVL 1SY6L 3ZHLA 2IG2L 2ICWJ 3RDTA 1U95A 5C0CE 3WHE1 2DLGA 5D71L 1CD0A 3R0NA 4HZLB 4PGBB 2VLRA 4UINH 1JF1B 2FBJH 1IBGL 5EU3A 3VFNA 1B0RA 3F7VB 4FQCL 1YMME 3OHXB 4IMLB 5DJXA 3C2AL 3Q6FB 4KU1A 5J9PB 2B39A 2QADC 5T5NG 4O5LL 3SE4A 1IC5L 1XH3A 5CCKH 4PJ5D 3IJHA 1ZVSA 3ARGB 2VDLH 4P2OC 4N5UA 1FE8H 3L6FA 4FZ8L 2FIKB 3BDXA 1ZVHA 1OAKL 4DCQB 4YHZH 1T20A 4F33A 2Y07L 2Q7YB 4MNGB 1PW3A 1QRNB 5IHUL 3RGVB 2C4FT 3O0RL 1FVDB 2IAND 1O7SA 2P5WB 5FYLD 3RY6A 1JTTA 2CUHA 4LCWE 1EO5A 2I25N 3VXNA 1FVCA 1OCWH 4P2CG 3LRHA 5E94A 4PJGA 5MHSE 1BQHA 3IDNB 4JPVH 1UXSA 3EOBA 3DBXA 3F7YA 5JDJA 4M3JA 3CNKA 4CGTA 3BGMA 3O6LH 4JANB 3OBAA 1IAKB 4HF5H 1JHTA 2DM4A 4DZBB 5F6HJ 2AEPH 5D7KE 3U7AA 5JHDE 4PY7A 4YGAB 4OGYH 5C0ND 3MJ9A 4PRPA 3VGDA 5E70A 4GRWF 3GNMH 5B22A 4PJAA 3GSNB 5F93C 1JPFA 1BD2B 2B5IB 2BC4B 3TZVA 4F9PC 1J1OL 1T83A 4ZAKC 5I9QB 5BOZG 3U0PB 2ZZUT 4G6FD 1MNUH 4DQOH 4XBEL 3ALPA 2FO4A 1TCMA 2L0DA 3IAPA 3VE0B 5E9DE 4PJCA 3UJIH 2HT4C 1FNEB 4QRRD 2X4NB 1WCQA 5HHMB 5FO8B 3IF1B 2IBBA 3OL2A 5D96B 2GITB 3RJDA 1OGAA 5SV3A 3B3IA 5EOTA 3DVNA 1WWCA 4JPWH 4YHNB 3VCLB 5DTFB 4MA7H 1S7TB 4DAGL 1N4XH 2P8LA 3ZE1E 3R0MA 4KDVA 5FYLL 1PG7X 3EYVB 3L3JA 2HTKC 1KTKE 4YXKL 1X5ZA 1EBAA 4PGJA 3DRTB 4U1NA 1QVOA 1C5DA 2XFXB 4JRXA 2MPAL 3G04B 1FO0H 4LPCA 4PRNB 4NQDA 2AJXL 2JLLA 1QQDB 1KG0A 3QXVA 1KF9B 1QACA 3QWOA 3DV6B 2R0KH 4W4NA 2P24B 1S3KH 2ID5A 1MAMH 4N0YL 3QCUH 3RBGA 2BNQB 5HHXH 3ARXA 1NGWA 2EH8L 4J3VA 2JJVA 5T1LD 3UZQA 2A6DB 2VC2L 1LEGB 1TITA 5IVXF 1F90H 1Q1JH 1NLDH 4IRJC 3SE3C 1QLEL 4GJTB 5BXFA 5BMFH 3LQZB 1XGUB 1AHWA 4HXAL 4OLUH 1KYOJ 4XHJC 3QHFL 3LRSB 4EEEA 3H3PH 1DL7H 4L29B 1BQUA 4TYUA 3H42L 1L7IH 2EYSA 3HE6B 3T3MF 5IVOA 1XCQB 2UV3A 3N0PB 4FQXB 3U7YL 1S7WB 3KYMA 5FHBL 1I9JL 1GHFL 1V3MA 5I1IH 4LQ1A 4P9ML 4NQCD 5EUOB 3QI9C 1WC7B 4MLSA 5F7WC 5F72S 1J0IA 1A7NL 4HWEL 1UT9A 4YNYB 4KI5D 3QR2A 3IDYB 4FHBD 5CILL 4WI3A 4HW6A 5DGRA 1GVIA 5D2LB 5DVMA 3PDOB 3BPLC 3E2HC 4YUEH 3WFEH 4DW2H 4JG0H 2FHBA 3HZVA 1RSFA 5EU3B 3JTTB 1B0RB 3FKUS 4ELKA 1J1XL 2ZOKA 5T3ZH 2R1YA 5ABDE 2AABL 3QAZC 1ZLUH 4NIKB 3GMMB 5DD6B 1XH3B 2EE2A 5B8CA 1IC5H 4C57C 2VDNL 2XT1B 2I9LB 3QG6B 3QQ9C 2XI9A 3L6FB 2YD2A 4FZ8H 5HHOD 3IS1X 4Y2DB 3ARQA 3N50A 1GL4B 3B2VL 1MY5A 35C8L 2IEPA 32C2A 3BJ91 1J86A 4JHAL 2V5MA 2Y07H 1XAUA 2DKUA 5AD0A 3MACL 2D0HA 5E5RB 4RAHA 2HT3D 1FVCB 4IOSD 2VKXA 1NUGA 1WITA 2WIIA 5E94B 3RHWK 4PJDF 1BQHB 3I3BA 1UXSB 3EOBB 3K81A 2DBLH 4QY8A 1FSKB 2DQGH 2PW1A 2X4OA 1NFDF 5IB4B 4OFYD 5FCUH 1JZ6A 4R96A 1YA5A 5K59E 1JHTB 4ZNEE 4NOBA 3ZT6A 3IJYA 1E27A 5IMKA 2WINA 1A8JH 4JFFD 3F65A 3HRPA 4KXZI 1A4JA 4NC2B 4G8GE 4NQTA 2W9EH 3UJTL 2NW2A 1ZLUK 2DL2A 3QUYD 1NBVL 4I2XA 5SWSE 4OCXH 3B5GA 4Z7UA 5TE7L 2Z35A 3ALWA 5D7LE 2BFVL 4LU5H 2E6PA 3MROB 2CK2A 1AXIB 5GGTA 4PJ8D 3H9SA 4GG8B 4N8VA 5A1AA 4P4KB 4PJCB 4UQ3A 3QYCA 5BW7A 3PGFH 2EYRA 1FDLH 2RCSL 5E8PA 1CFTA 2OZ4L 3DVNB 3K2MC 5D1QC 1T0NA 3P30L 5C07E 1A7PH 1ZHBA 1CFVL 2KDGA 4HUMB 4NKQB 1PKQA 1GOHA 1VPOH 1A3RH 4WW1A 4DAGH 2CXGA 3SDAB 4HIIB 3LB6C 1NMBL 2B4CL 4BK5A 1FLRH 5CKGA 1K8DA 3I9GL 3C8DA 4YXKH 1QVOB 3MJ9H 4HXBL 3D39D 1C5DB 1MPAL 2W38A 3TP4A 1QSED 1T7YA 4XRCA 5KW9L 4NQDB 1MFAL 2AJXH 2VUYA 1Z5LA 4ZOBA 2Y4SA 1B2WL 1I75A 3HMWL 3QWOB 1U8KA 2DKSA 4O51A 2WUCL 4WHTA 1U2CA 2NYYD 4X7SL 1VDGA 5IW3A 3BIKB 1JNHA 4U31A 3MPCA 1X6NA 1NGWB 1OTSC 2NPLX 4NHCH 3SDXF 1TJHH 1JV5A 1ORSB 3MBEA 5FB8A 3AS0A 2VC2H 4LSRH 1G7JA 2YHGA 4OZGA 2WAHA 3GK8L 5IT2L 4MA1B 1HHJB 4XCEA 5K9OA 4ISVA 4Q6IC 2R29L 1AHWB 4ERSH 4WY7H 1R3IH 4BUGA 2DQHL 3QHFH 2DYPB 4FFWC 2BSRA 3FTGB 3UC0L 2J12B 3O45A 2VN4A 3X11B 5KSBB 2DIBA 4AL8H 3ZHKA 3MRCA 1KLGA 2ATPB 1LP9E 4E41A 5J3HC 5T5FL 4OZFA 5HHVL 5JHLH 3CFBA 3FQXA 3NZHL 3KYMB 3S36X 2PTUA 3RTQA 3O11A 4LARL 3ZHDA 4PRIA 1CLYL 3MV7A 4P9MH 5E8EB 4AZ8A 4GKSA 5I1HH 2CDFA 2R2BA 4D9RD 1P7QD 2F5AL 1BFSA 4HWEH 1I1YA 2J5LC 4P5TC 1I9RH 1YMHA 5DJ8A 2EDQA 1KJ2A 1A5FL 1PY9A 2YSSA 4X99B 3O3BB 4PRAA 1DBAH 1XEDA 1MCKA 3QEUB 5IROA 3C5ZC 1YEGL 1JVKA 3WCYA 1FPTL 3OR7B 2GIYA 3D69A 3ARFC 1AI1L 1V5JA 5DUBA 4ELKB 1CXLA 3EYSL 2R1YB 1J1XH 1LO4L 1KCKA 2AABH 2K1MA 1J8HD 2PKDA 1TZGL 5B3JE 1I85A 3KPRB 1AY1H 3L7EA 2O93L 4PJEA 5LGHL 2PNDA 1F4YL 3VWJD 4U3XA 4G5ZH 3ARBB 4LPWA 4WEBH 5AD0B 4NQXB 5I18L 1J9CT 1AR1C 1D5XA 1WGOA 3UDWC 3RA7L 3LS4H 4GMSL 2WIIB 3HG1E 2YD9A 3BPCA 2VLLB 2AGJL 5FM8A 2EEDA 2XKNA 3BP7A 4PD4J 2ARJQ 3KLDA 4NN5C 4LLMA 3BISA 1F02I 3IJYB 3QJFA 2E8ZA 5DMYA 2WINB 1A7OL 4W70A 4G43B 3ES6A 3UJTH 5I1KL 3IETA 4IMKC 4QRUA 5KOMC 2VZ3A 1D5BA 4J7RA 3C8HA 1XF5A 1MCLA 2Z35B 2AXFA 4D0CA 3QJHA 4X6BA 4Y4FC 1DFBH 1HQ4B 2G75A 1LDPL 5E2UL 2AXHA 4TULL 3FO2A 4N8VB 5IG7A 2BOBA 3GMLB 5D2NA 4P2RD 4UQ3B 4LPVA 2HLFC 4ETQA 1LK3H 5E8PB 2RCSH 2JIXD 3QDGA 5GJTH 4WFHD 4ORZC 2C1PB 5CP3A 5GPRA 4XPFH 5B4MC 3P30H 1T22A 4F7PA 5CIPB 4G8FA 1J05A 1CFVH 3ARED 4UBDD 3L5WA 4WFGD 2DQTH 3MGTB 4X5XA 1NMBH 1ERNA 1K8DB 2EDXA 3LKOA 2R2HA 1Z6JT 1Q9WA 1ZXQA 4O2FB 1KB5L 4HXBH 4ZTOH 5I8KL 3CX5J 5ICXA 1KB9K 1NCTA 5GGVL 2F19L 4QKXB 5KW9H 3IAQA 2VDPL 4FQ2H 3WIIL 1B2WH 4DN3L 3OKEA 4HUVA 4WHTB 2WUCH 4X7SH 2J88L 4UILL 1JNHB 2UYLA 3UYOD 1CK0L 1VENA 1KTLA 4OZIE 2FR4A 3O3AA 5TPWH 4KK9C 3V4VH 3HAEG 4OIAA 3WN5C 4DFIA 1OM3L 4PJHB 5DJCB 4OZGB 2X05A 1UYWL 4ODWA 5IJKA 4L4VB 1CYGA 3D18B 3GK8H 2WMPA 5IT2H 1E4XL 4XCEB 2GTZA 5K9OB 5JW4M 5CUSH 2VLKD 4G42A 2DQHH 4YFDB 2BSRB 2K3TA 1CG9B 1NC2A 4D3CL 1FL3A 2LE9A 3TA3D 1EIBA 4NCC1 4UZGA 5C2BL 4LQFH 5HYQB 2QV2A 1URLA 3MRCB 1PYWB 5AYUH 1DQML 4E41B 1WVZA 1RU9H 4HMEA 3U6RA 1IQDB 4H25A 3RTQB 3D25B 3O11B 4Z0BL 4F80A 3MV7B 2HA1A 1CLYH 2YXMA 3W81A 3ORJA 5DHVA 1RULH 2H6PA 3RKDD 5DFVC 2VH5H 4UTAL 5E2VL 3VRIA 5LG1A 4LLDB 5EA0H 1I1YB 4JRYA 5J06A 2X10A 2X9YA 2R8SL 4WHYH 4RFOL 3MA9H 5DJ8B 1KJ2B 3RZWA 2ED7A 5EBLA 5EIIA 3NIGF 2YD5A 1RPQA 3NFSL 4DEPB 5E8DH 3D69B 3SKOA 5A43C 5HYSA 5T1DH 1CFQA 3EYSH 1U8HB 2A6JB 1LO4H 3RHWF 3ILQD 1BGXL 4OT1L 1PX3A 1A1MA 4OZFH 3OJMB 4DKFL 2GUOA 1KN4L 5FXCH 2NXZB 3QULA 1RJCA 4NQVB 1MWAA 5LGHH 4OGXL 5DWUL 3SDDC 3VXMD 4TUKL 3SGEI 3P4OB 1G0YR 4HIHA 4XAWH 4YR6A 5DUMH 3VI4F 5ADOH 3BQUB 4JFYB 5TDOB 5I18H 1DLFL 4GBXA 4Y4HB 3EDFA 1J1PL 3RA7H 4PFEA 4LGSB 5TJWK 1MIEH 1B88A 4GMSH 4B5EA 4KRLB 3FRUA 3QWQB 3A6BL 3C60B 3HI1B 4H26A 4HSQA 4QNPF 2JB6A 3QIWD 4PB0L 1MFEH 2VR9A 4PB9H 4MZ3A 2Z31A 3K74B 1HDMB 4L5FL 2ZOLB 4U7MA 5I9QC 4G8EB 1RZFL 2V7HA 2GSGA 5HHPA 4OF0A 1JNLL 1KSRA 2WBJB 1K85A 2A9NH 4POYA 1D5BB 3QFJE 4QRQA 1AQKL 3TBVB 2AXFB 3QJHB 2PYEE 5JPMA 4ZUVA 4JAMB 2XRAL 4R2GB 4K9EL 3C5SA 2ICES 2Z92B 5E2UH 2BVUA 3FO2B 4GW1A 5D1ZB 5IG7B 1MREH 4U6TA 3A6CL 4NFDA 3STZB 4ETQB 2NLJA 4AMKH 1PZUB 1UJ3B 4UT6L 4ODXB 4KK6C 5D7IA 4KC3B 3FN0L 4F7PB 2NY6B 4HWBL 1BMGA 4M6MH 4G8FB 1J05B 1OLLA 4FTVA 4KHTL 3ALXA 3OKMB 4BUHA 4LCYB 2YN5A 4XNQA 1K3IA 4CU8A 1WZKA 3HI5L 1Q9WB 4U1JA 4PJGF 4GKNA 2Q1EA 4X6FB 1WAAE 2O5XL 1FC2D 4JM2D 4G9FE 2GSIA 5LJYH 2F19H 1A6ZB 1KV3A 3FO0L 4DN3H 2HVKA 1DQTA 4WHDA 2V17L 5HSFA 2J88H 2GJ6E 1T1YA 1KTLB 2FR4B 1CK0H 4KKLD 4P5KA 3N1QC 4EN3C 4LBEB 2Y06L 3QCTH 5J1TC 1Y18B 2BY1A 1H3PL 3EO0B 5CP3H 1OM3H 3HR5B 4WUKL 4LNVA 4UNVA 1IEBB 1IGTA 4JHZA 4OCRL 1E4XH 5FM5M 3VXRE 4KKNA 4MWFB 5I0ZA 4JFOA 1JGEB 5L9DL 2F54D 4MD0A 5I16A 4NN7B 3WJJA 4FQXC 3HPJA 1DLHA 1NC2B 3J7HA 1FL3B 5C7XH 3GJFH 3WKML 4GAJH 5C2BH 5DD3L 1IM9A 3NCMA 4RISL 3RDTC 1N64L 1CDIA 1FZJA 3U6RB 2R9HD 5DDHB 3ZDYF 1KXVC 4PG2A 3SEPA 3KXFA 3SE9L 3LVEA 2E7HA 4Z0BH 2H6PB 3QUMB 4OAWA 4TSCL 3MLVL 1V7NL 4UTAH 3VRIB 5E2VH 2OL3L 2ESVB 3DXAA 1NGYA 2AJYL 3Q5TA 3B6SA 4Y5YA 3NCBB 1JK8A 2CDEA 3SE4C 4RFOH 5DYOB 3PL6D 5F7NC 4FABL 2OMBA 3D0VA 2XPGA 2VZSA 1YECH 5EIIB 3TVMB 3DX6B 3IDXL 3NFSH 4OZHE 1QFOA 4XMLH 4FQIL 3SKOB 3TT1H 1NBQA 5HYSB 3NTCL 1KBGH 5IMLA 2NY2B 2O5YL 2G9HA 1ZHLB 4OT1H 3HE7B 3LPFA 2CKBB 3TLRA 4UAOB 3BKYH 5HVHB 1FORL 4OGXH 5DHVH 3TIDA 4TTDD 5EC2B 4FA8A 4DWHA 4HIHB 4YR6B 3NCCB 3RWGA 1V3KA 1KIQA 2BVPA 4Z77A 1YN7A 1D5MA 5MP6L 2DQEH 2FX9H 3MV9D 5LXGL 5J13C 1W0WA 3IXTB 4U0RC 1BQHG 2LVEA 1KIUA 1CF8L 4HEPG 4WWID 3QRGH 3WNMA 1JZ5A 2ICWA 3A6BH 3HN3A 5IR1B 1KXQE 1EMTL 1IAII 4FN0A 1OTTD 2L7JA 3RIAF 4ELMB 3TZVC 5DHYB 2RR3A 1Y6KR 4JO3L 2APXA 3KPQB 2XA8H 5CEYA 4LLQA 4NUJA 2Z0BA 2V7HB 2Q8BH 3BEWA 1GPOL 4J4PD 3WIHL 5FM5O 5ID0B 3BFOA 4EDWH 4NO5B 1MWAH 4Q74A 1IKNA 3MV8E 1QLFA 4R8WL 1AQKH 1JZ4A 3BRGC 1VACB 1U91A 4ZUVB 1X4XA 1T5WB 5DEFA 1NC4B 1FZOB 2XRAH 1EGJA 3C5SB 1MCRA 1VGKB 2CGRL 4LMQI 4GXVL 3EJYC 3WNLA 5KJRH 4GW1B 3CMGA 2YA2A 4KI5F 2HFFA 1A21A 2D7TL 4OBSA 3WL9B 5KS9A 5DVKA 2NLJB 3IDGA 3PUCA 2OJEA 12E8L 1MCOL 3FN0H 1U58B 5F9DC 1HI6A 2EKJA 2ZKHL 3ZL4L 4FTVB 4O4YH 5I8EB 4PLOB 3QP3A 4K8RD 1KPUA 1ZGLA 43C9A 4PG9A 1KJVA 3NABL 4JJ5A 4M43L 5FIEA 3WE6B 2HJFB 3KPOB 3QXUA 4GKNB 4HUNB 4UDUA 5EZOH 3RGVD 1X5GA 3HUJA 3V4PL 4OM0H 2EH7L 4RGNE 5SWZB 2BY2A 5HTSA 4CN4A 1S7RA 4NNXB 3ZKMD 1KTRL 1WBYA 3PABB 4HC1A 3VGFA 3EOTL 3WNKA 1T1YB 4P5KB 5HI3C 1AHWC 2WK2A 4XB7A 2Y06H 1BOGB 3SCMD 2KH2B 3DARA 1H3PH 2F58H 1MFCL 4LASL 5F1OB 1AXSA 2XZZA 3VMPA 1MRDH 2DLTA 3TO4A 4JFOB 3BGFB 5I16B 2DIAA 2CK0H 3B83A 1MF2L 4PBVC 1JNJA 4NQEB 3SKJH 4PRDB 1BD2D 1DLHB 5ECJE 4RAUB 5F9WB 1R0AH 2YMXL 1AC6A 1MI5E 3WHXA 1IGYA 2XA3A 2FLBT 4RISH 4OBRA 3ULVD 1N64H 5I71C 1FZJB 1Z2KA 1ZANH 4K8RL 2AK1L 5DA0B 5C0BE 3ET9F 3S7GA 1U3YA 3SE9H 3T1FB 1NSNL 3VGAB 3EDJA 2HFEA 1RZ7L 4OAWB 1DQJA 4QT5A 3BN3B 1CGSL 4JPKH 2UZYB 3VFTA 5IMOB 1TCRA 1V7NH 4YHLL 1YEJH 1RK1A 5HDBE 3B6SB 3RVVD 1JK8B 1T21A 1CD9B 2CDEB 3P0YL 3MUGB 4LRNH 2EDFA 3D0VB 2XPGB 5B8CC 3TJHD 4HH9A 3CD4A 4KMQA 4XCYA 4Z7QE 5I1GL 1MUJA 3RI5K 3P0VH 5DMIH 5GZNC 5FUZL 1YMMA 5D93B 2A74B 5DD0L 5EBWA 1RVFL 4JZNB 1P4IL 2XN9E 2DQIH 2D3VA 2BNQD 1WIPA 1UWEL 5D5MB 5ICYA 4F3FA 3BPOB 4WCYL 2CMRL 3TIDB 1KIRB 4HAFA 4KRPD 4UB0L 5DMGD 5BZDA 4ODSH 1KIQB 1A6UL 2BVPB 1YN7B 1WEJH 1FGNH 1I1CA 1QUNA 2DB8A 5I1LB 4LNRB 3ULVL 1W0WB 5LXGH 2A0LD 2AJSH 4P23D 4PJ7B 3VH8A 2Y25A 4KPHH 4LCWA 3VFMA 4OJFH 2R4SL 5JORB 2VXQL 2FL5A 1KCUH 2ICWB 3VXUD 3UROR 3HC0A 4XVTH 4XMKL 4P46A 1DUYB 3EHBD 3V6FA 4RZCB 4QXTB 4GLRH 4I3GA 4LLQB 1RJLA 3LD8B 4YXLH 5JHDA 3QUKA 3P77A 3QPXL 1DN2A 4S1RH 4GH7B 5BW7C 3QT2A 1C08A 4MX7B 4YJZL 2E7MA 1YJDH 3CFKA 4R8WH 4D9QD 4WDIA 1U91B 1WFOA 5GJSH 5DEFB 5D1XA 4Z7NF 1FP5A 3B2UC 4PS4L 1F2XK 5L2KD 2CGRH 1LNUA 4HIEB 4N8VG 4HWZA 5IHBA 5JA8B 2FECI 4GXVH 1HZHH 2A1WL 4KVCL 2HFFB 3TNNA 5MEOA 5D6CB 2D7TH 4M3KB 1FYTB 4LLUB 1HNFA 3RGHA 4I77L 4GRLB 4PJEF 5EZJA 1UM5L 5C0AE 4XPAL 2SEBA 3FONB 2PCPA 1IARB 1VFMA 4E5XB 2ZKHH 3ZL4H 1RD6A 3QZWA 1KPUB 3LEYL 2HWZH 4K23H 1ZGLB 43C9B 4YHYB 4Y2DD 5FO9A 2YZ1A 4MAYA 2AV1B 5DLML 5EU6A 2WUBH 2Z8RA 4I9WE 3ZYOA 1LQSR 1P4BH 4TUJA 4UDUB 1KLUA 4YHIA 4MNQB 5FECA 2J6EL 4OB5L 3MBEC 4XP9H 4IIQA 3VDBA 4PR5A 3QFDA 1EGJH 1T1ZB 4M7LL 5F7KC 3BMWA 4G6AC 3CPLA 5DJAA 3M8OL 3VFGH 4YX2L 2NYYC 2ADGA 3LQMA 4N9GA 1CDYA 4K07A 1TPXC 5FA4A 3RY5A 1BIIA 1JHKL 4K71C 4WHYG 5JUEL 5IV2A 4LGRB 5C0JA 3TO4B 1T1XB 2UWEE 1EEYA 3ZT5A 1MF2H 3K2UH 3LHPL 5ISZD 3QEQE 4MAUH 2JJWA 5MI0C 2FBOJ 1R5IA 2D0FA 2D7MA 3AS1A 4OZFG 4I0PA 5IW6A 2P8PB 4C56B 1EO7A 4P4KD 3KYOA 1OB1B 2Y6SD 4HC1H 3AS3A 2XWBB 3S35L 1NSNH 4ZSOE 2HFEB 5C0GA 4QT5B 4NUGH 1JPSL 2VE6B 1W8OA 1CGSH 1TCRB 4YHLH 1IE5A 1JWMB 3SDAD 4L4TD 4RGOH 1G9NH 4LHUA 4MGXA 4RMUA 5C0CB 1CD8A 4HH9B 5LQBL 1I85C 2XTLA 5T1KA 4QRTA 5DJ2A 2LTQC 2G5RA 2PYFA 5FUZH 1IAOA 1I7ZA 4GRWE 5DD0H 1RVFH 3QQ3A 4OD2A 3QHZL 3KLHC 4YDKL 3L9RB 5DJ6A 1JFQL 3U0WL 5ICYB 4F3FB 2EE3A 5GRVL 2C9AA 2X4TB 5FOBB 5HYJD 2CMRH 4XPGL 1XF1A 1SM3L 4GRMA 5BZDB 1UG9A 25C8L 2X1OA 4HT1H 4M61A 4Q7DA 2IBZY 2YRPA 3LKSA 4EDXB 2DYPD 3SDCA 3VH8B 4LCWB 2BVTA 4BH8A 3C8KA 2VXSH 3TPKA 2NY5L 1P7HL 2FL5B 1EO8L 3SGJC 4HPOL 3OR6A 3H7BB 3QXAA 4FFZL 5EC1B 4P46B 3EDKA 1EJOH 4X98A 2DTMH 2FB4L 4F57L 4UTBL 1U3ZA 4ZNEA 4R2GC 2CLRB 5JHDB 4HKJA 3QUKB 3EJZD 1FZMA 5D2NC 4XP1L 1BVKA 1PLGL 2EXYC 5IOPB 5SWSA 4RX4D 5F9OL 1CD1A 2R4RH 5D1XB 4WGWB 2A9MH 5D7LA 4JFHD 5F3BA 1LNUB 5K9QG 2EDBA 3EUUA 3GMOB 4HWZB 4APQB 5EG6C 1G7IB 1ORQA 3L7FB 3TBWB 4BELD 4QYOA 1NEZG 2CJUH 5E9DB 4P4RA 5E6IA 5C9KA 5EZJB 3G6JF 2UVEA 3L5HA 3JZ7A 4KJQC 2SEBB 3DJ9A 3O2DA 4FQLL 1RUPH 1BFTA 5DA4A 3L95B 4MD5A 1Y6MR 1UWGL 1FAIH 3QZWB 5LKNA 1H15A 3KPRD 3GSQB 1EPFA 1H3VA 2Q87A 3T3ME 3ARBD 4MA8L 1K6QL 4U6YA 1T4KA 3GMQB 1M4KA 2E9JA 3TH4T 4QHUB 5JXEA 1E4KA 4NO0B 1KLUB 3TYFA 1Q0XL 3MLSH 3U1SL 5EN2A 4IIQB 4PR5B 4ZO8A 3HNTL 5IJKC 2FDBP 1RHFA 1S7XA 1YN6A 5FYJE 1CU4L 2ADGB 5I19H 4RFEB 5FA4B 2P7TB 4Y4KA 3VD4A 1BF8A 5IFJA 4MD4A 1JHKH 5FYJU 4F7TB 1NKOA 3GMRA 4Q9BA 3IU3A 5IV2B 5C0JB 1C7SA 3RUGB 4ZPTA 5TF1L 1EEYB 1GZPB 2JB5L 2FYYA 4UOW1 4UOJA 1AFVL 2VERN 4YAQA 4NN6B 1Y0LB 5LWYL 2BVYA 2XY2A 5GGSB 3TA3C 1BQLH 5IW6B 5BS0D 1LP9A 2D7QA 3G5VA 1T66D 2PTTA 3QNZB 4JO1L 3VFPA 3S35H 1CQYA 1F4AA 1XZ0A 5C0GB 4LSPH 4MXWH 2A6IA 1I7UA 3LV3B 2BMKA 4HQQL 4PJDE 4FMFA 3W9EA 2JKXA 4O58L 1D3CA 4B41A 5J4MA 1KT2A 4JHWL 4POZD 3MRLA 3CLEL 5LQBH 3OAUH 5T1KB 5IEKA 5DJ2B 5HYSG 5EZIH 2JCCE 4C83B 5CEZH 2HLAB 4JDZA 2PYFB 4N9OB 1IAOB 4JM2F 4JM4L 1MHHA 3A67L 4JREC 3L3HB 3QQ3B 4OD2B 3BPNB 1NH6A 3QHZH 4GBXC 4YDKH 2DM2A 1NGPH 3KPMA 2G2RA 3GIZL 2AK4A 2PO6B 1I1FB 2X09A 4WGVB 2H41A 1NCCL 4GRMB 4LIQL 2Y72A 4Y0GA 3SO3B 4L4VD 3BZFB 3LIZL 3X14B 4BJLA 4X9FA 2HVJA 1H3GA 1I1AD 2Z31C 1RMFL 2F8XC 4XC1H 4BZ2L 2LU3A 4BH8B 1PEWA 3HG1A 4F37K 2VR4A 2D9QB 3N9GH 1TZIA 4GKZB 1F00I 3DHMA 2VDQH 4IDJH 5HBBA 4X98B 3WLBA 1X4ZA 3VGHA 2FB4H 1SBSL 4UTBH 4JR9H 5KVGH 1NCNA 3ZT7A 4F58H 1HYRC 4FQJH 5C0EA 4G8GB 1FZMB 4PJFE 1PLGH 3T2NH 4KKAD 2COQA 5SWSB 1QTYT 4PRHE 4NM4H 3SDXE 3X3GL 3OJVC 4ONGH 4P49A 5D7LB 5F3BB 2IADA 5IJVB 2ENYA 1QA9A 1UQSA 1CXFA 1V7ML 3HC4H 1FZKA 4X7TA 3O6FA 4P4RB 2DWDA 3KDMA 4JGUA 2XZAL 5JIIA 1KJ3H 5FOJA 2DQDL 1SMOA 4MD5B 4KQ4H 5C07B 4AENA 2VRAA 1I8IB 1HILA 2NXZD 1UWGH 1H15B 3CXDL 1OSPL 4X4YA 1LMKA 4YQXL 4U6XB 3PJSA 5ACZB 1LO2H 3D3VE 1MJ8H 3BZ4A 5HDQH 5BV7L 3BQUD 3TYFB 4OFKA 3KPTA 5IHZA 1T5XA 1FNSH 1Q0XH 1KC5L 1QD0A 3NN8A 4LSVL 4Y4HD 5EN2B 4JM2C 5IK3A 3WFZA 5BOPA 1DBMH 5DC4B 2LQRA 7FABL 3JWDH 1J87A 3HNTH 1HNGA 4J3TA 2XQBL 4YHKL 4TSBL 3C60D 1LHZA 1GC1H 4X4XA 4Y4KB 4ZO6A 3WJJC 5IFJB 4KKLC 3ZKNC 3KPNA 4G3YL 4OF3A 4AG4L 3MOBH 3O2DH 4IS6A 4R0LC 1MVFA 2DL9A 1ZV5A 1XCTA 3BP4A 3CFEB 3GMRB 5AG9A 2P42B 4Z7OF 2HMIC 3ZTNL 2WBJD 4ZPTB 3QIBA 4OLZH 2FYYB 1T6VN 5I1AA 3DV4A 3GI8H 4PG2C 4ONOA 5L88L 5J8OA 4UV4L 2B1AL 2BNRE 1NCDL 3P4LA 2XTJE 5J1AB 5DD1L 3BGAA 1SEQL 3OMZA 5D1ZD 5DQDH 2DDQL 1LP9B 4K7PL 3KWWA 3G5VB 1N59A 4Y5YC 2H8PA 4JO1H 4K94L 5C70A 5EWIH 4OKVA 3QUZD 3ARWA 2A6IB 1ZMYA 2H9GB 2VB5A 3DMMA 4RMWA 2BMKB 5I73B 1JCKA 1DDHB 2VWEE 2OQJA 4DUWA 1QSZA 1LEKA 1E28A 2J8HA 5JMOC 3DHJA 3MRLB 3JUZA 1A6WL 4XAKE 2NY4C 4NT6A 2BSTB 5LGKA 3CLEH 4X7DC 1QBMH 2HP4A 5JPNA 5IEKB 3AY4A 4LCCA 2DOCA 1GGTA 3KPSA 1G6RA 4JDZB 2D2OA 1UM4L 1YJDC 3PG2A 1JYNA 1MHHB 3H3KA 3LEXA 2AW2A 5MENB 4JZOA 5IESL 1E6JL 2G2RB 2BHYA 3GIZH 1UB5A 4JJHA 1QSFD 3TN0D 1XGTA 2CDGB 3LIZH 1JGVH 2Z8WC 1I8LC 3SKMA 1RMFH 2ADFL 3FZUC 2EE6A 1JMZA 2EXWC 3TH3T 3TCLB 4BZ2H 3WKNA 2R2CA 1HOCA 1CFSB 4JFDE 5GRUH 3TEUA 3ARDD 1SYSB 1U42A 5I66A 1XR8B 1MRFL 1QFPA 4X0KB 1IKNC 5ESQB 3LKPB 3MBXH 2MQCA 4YGVA 5EPMA 5I6XC 5I8CA 4YDLC 3GBNL 2ZCHL 5ITFA 1RQ5A 3X13A 4JFZH 5C0EB 1EHLH 1OTUC 5BVJA 2I24N 4YEFA 1KELL 2YRLA 2ESVD 1NAMB 3QFJA 4X7CC 3KJ4B 3L3OA 3SJVE 3X3GH 2CRMA 2PYEA 4OQTA 2DBJA 3F7QA 2KQNA 3OKOA 1GGBH 4OQ1A 1GJIA 3GFUA 3TVMD 1QA9B 4S2SA 1FZKB 3AMKA 3OV6A 5T3XL 5JW3L 3CDYA 3RVXD 1WK0A 4ZTPH 3FN9A 3QA3B 3UTPE 5AZ2H 3KHOA 2DWDB 1JGLH 3KDMB 3HE7D 3BESR 2D4FA 5E2JA 1HILB 1A3LL 2B2XH 4X4YB 4J6RH 2YUZA 4W6WB 4LSDA 3WV0A 4YQXH 2VZOA 3S5LA 3MRBA 4MMXC 5ILTL 4KKBC 2V5TA 4JO2H 3BZ4B 3U9PH 3HNVH 5BV7H 3MXVL 4TTGA 1U8QB 4G9FA 2VABA 4LSVH 1Q0YL 2V7NB 2VKWA 7FABH 1OAZH 3I75A 4U0QB 3HNSH 1G9NC 2XQBH 4HJ0C 5C08E 4YHKH 3P4NB 3ZKMC 1ZHKA 4XI5D 2GJ6A 3TO4C 2LFGA 3QUML 4OZIB 3UTTE 5KSAA 3KPNB 1ZLSL 4G6MH 4IS6B 4ZFOA 3CDFA 5E99L 5CJXA 1N0XL 4HS8H 5AYQA 3OF6D 3I02A 3QIBB 2GK0B 5I1AB 4ZUSA 3DV4B 4AM0B 2V2TA 1WWAX 1HK6A 1YQVH 3MLXH 1UKTA 3F12A 4NRZA 5EFIA 5K9JH 3QDME 3ARSA 4Z9KB 3IFOB 3OJDA 1NC4D 4IRSB 4ONHB 4Q97A 5DD1H 3LSOA 3MOAL 3OPZL 4LL9A 2ERJB 3BEVA 5AAWA 1SEQH 1B0WA 4LFHD 2CKBL 3KWWB 5DO2D 3VI4E 4F2MB 3ULSA 1N59B 2H8PB 2XZQL 1IM3A 1FRGL 2ZUVA 3GSUB 5F7UA 4OKVB 1T2XA 5DSCA 3DMMB 3OAZH 2FATL 3BZEB 4FTVD 4U1HA 1L0QA 3MA7B 1DTUA 2OQJB 4BSVA 4IOIB 2OI9B 4TVSa 1IC4H 5C09D 1E28B 3PQYE 1MAJA 4IRZL 4QNPE 1WFNA 3G9VA 4NT6B 1BFOA 2YC1A 2M1KA 2Q3ZA 3PV6B 5JDSB 2NX5E 3GMNA 4NCDA 4XNMA 4OZHA 3NZ8B 1JNNH 3O4LB 5SWZD 2VLRE 3P9MA 4X8JA 4KY1H 1MOEA 3LEXB 5IFHL 3RL2A 1JPGA 3WIFA 3TH2T 1AKJA 4JZOB 1EH9A 3DVIA 4X9HA 4MDIA 2Y5TA 5K9QI 5CWSA 3O3UN 5GIRA 1XGTB 5IB5A 5DD5H 5EO1A 2C7UA 4NKOA 1MH5A 3FQUA 3TIEA 3VH8G 5GGVY 2ADFH 1RZ8A 1E4XI 4NQED 3KNBA 2AEQH 4F9LA 1X5JA 1DE4B 3BH8A 3LKNA 2A0LC 4P23C 1HHGA 1U3HA 5I66B 4PJ5E 4H0IA 1B0GB 1MRFH 1A1NA 1G6RH 4HG4J 4PJGE 4W68A 2EDRA 5EOCL 3CVHA 5JW4N 2R0ZL 4YGVB 5EPMB 2I07B 4A6YA 4X7FC 3W11C 2OP4H 1N7MH 3EHBC 2VXVL 2QSCL 5ITFB 1W72B 5CJQH 4MQTB 4YFEA 4X6DF 3UYPA 2VAAB 4HBQA 43CAA 1K5NB 5FYLE 3QFJB 4L8BA 2YBRA 1VCAA 3MV8A 3L3OB 1TZHB 2MHAA 6FABL 1XIWD 2PYEB 3WJLA 4JDVA 3ZDXE 1DBBH 1QOKA 4LKCA 4KHXH 3MRGB 3DRQA 8CGTA 2X6MA 3PWVA 4KROB 4FP8L 1MCWW 4S2SB 5INCA 4JO4H 4OGAD 1U8OA 5T3XH 5JW3H 1B3JA 2H32A 3P0GB 4MAYC 3L3KB 1A6TA 1NL0L 1P69B 3SOBH 1JMXA 1G0DA 3RWHA 3U4EA 4FXGA 1DVFB 3QZWG 3QIUA 4YBLC 2E7LC 3GKWH 2HYMA 5J56B 3MRBB 1PZ5A 2FX8H 5J12B 3PWLA 5E1HB 4QOKE 4M6NH 3X3FH 2IAMD 2VABB 5IBLD 1DSFH 3LPGA 4QRRE 4NYLA 2IGFH 5L6YL 3GO1H 4OQTH 1ZT7A 4JRXE 5TF0A 2E9WA 1ZHKB 4RDQF 1YNLL 3J8F7 5F8RC 2GJ6B 3RZCA 4OD3L 4XP4H 1M05A 5KSAB 3UTSB 5TDPB 4ZUTA 2F53A 1ZLSH 5ID1A 4U49A 4GW4A 4NBZB 1I7RA 3K8LA 5I0DA 2BVQA 5LAXA 2NY1D 4P59H 4I0PC 5J6GA 2K7PA 2BHZA 2W9DH 4H0HB 4DUVA 3VXRB 4NWTH 4KJWD 4OI7A 3VMOA 3INUH 1MFBL 3JWOH 3O3DB 5EFIB 3DI2B 2H45A 3F12B 5I8OL 4GAYA 4MJ2A 1HCVA 1C12A 3MOAH 3OPZH 1MI5A 5F1NA 2YUWA 5AWNL 3QNXB 1AO7B 5ESVA 1FYTD 1IM3B 2XZQH 2EKSA 2NR6D 4GRLD 3NFNB 4KKCD 5C9JA 5DSCB 1NGZA 1ZTXH 1BZ9A 5IBTH 3V5HA 2FATH 5C6PB 4U1HB 4I48A 3ECBB 4BSVB 3DTXA 4LHUG 3V4UL 2NNAA 2ENSA 2OCFD 4LLYA 1NMAH 5K9KB 3KYKL 3O9WA 4ORGB 2AAVA 1BFOB 5F6IC 2L7UA 2XWTA 4WO4B 2NY7H 4KAQH 2QSVA 3P11H 5CGMA 4MNQD 4WHCA 1CDCA 3V0WL 3HKFA 4OZHB 1LD9B 5DC9B 3M1BA 4Z7WF 4Y5XB 1T6WA 3SQOL 4Y19B 1BFVL 3BAEH 4BH7B 3SO3C 4M5YL 4K2UL 1HHKA 1JPGB 3PP3H 3RL2B 1WWBX 4M48H 1AKJB 3WIFB 4C54A 1UH2A 2XN9A 2NW3B 5IB3A 4MDIB 2YEZA 3SDCC 2HT2C 1CGXA 5ALBH 3D0LA 4KI5E 1QFUH 5GIRB 3ZTJH 1MRCL 2C7UB 3O6ML 3PWPB 4NKOB 4N1CA 1FNFA 1MH5B 3D9AL 1S9YB 3MMEA 4HBCH 2IALA 1I9IL 3ZYIA 4MXQD 1NLBL 1WUNT 4L3EB 5BQ7A 3TBYB 1RZ8B 1NCWL 3KNBB 1Q9OB 3ROOA 1U3HB 3MUY1 3NACL 4KZEH 9CGTA 3ZKQD 4DGYL 1A1NB 1MCCA 1AJ7H 1R3KA 4C56D 5HHOE 4OFDA 4A6YB 2R0ZH 1BP3B 1VEPA 4YXHL 3JWDC 1P7KA 4X9IA 1G9ML 3CVIL 4J3WA 3G08A 3W2DL 2FJGA 5DJ0B 4PLNC 4Z76A 1GC1C 2A6KB 1TQCC 3PGCA 1F45A 5E6IC 1ADQL 3P3YA 3WNOA 1VKXA 4L8BB 3MO1B 2MHAB 5C0CD 5F9AC 5HI5C 6FABH 4JDVB 1CDUA 3DRQB 1I3RB 1DQQB 3UX9B 3PWVB 3TBTA 5INCB 4FP8H 3FT2B 4OSUL 1KLFA 1U8OB 3I6KB 1UB6B 1A6TB 3TFKC 2A73A 3B8SA 3H8NA 3H9SE 4JFFE 5L7XL 5C0AA 1NL0H 2ARWA 3RWHB 5JXEC 3K4DA 2NY0B 3QIUB 1YYLL 3KPPA 3CVHH 4P2QB 4A6YH 4YHMH 4ZOEA 3BVNA 1BBDL 3LN9A 1KN2H 5E08L 1PZ5B 3W39A 2A77L 4AEIL 3PWLB 2W0PA 5EOQH 1F58L 4LF3B 3WDJA 4NPYB 4Y4KC 1ND0B 4XVUD 2R0WH 2DQCL 2AI0H 1WTLA 4UV7L 4NYLB 4FZEH 4RGNB 2IBZX 5CSGA 3BWAB 1K2DB 2KZ1B 3MRHA 1BLNB 5KVDL 2WWMC 5MHSD 1E4WL 2ED8A 3RZCB 5JMRA 1M05B 2ZG3A 1CFBA 4L9LA 5FF6A 2CPCA 2H32H 4G80B 3VI3F 4XWGH 4ZUTB 5K33A 4GW4B 1LK2A 4YO0A 5I15L 5E5UB 1I7RB 1OAXH 4HFUL 2BVQB 4LEOA 5LAXB 3D39E 1AD0B 4HH8A 1QSEE 3ARUA 5I1CL 1OQOA 5FGRA 3HFMH 5LCVH 2HG5B 3BDBA 4Z7VB 2UWEA 3SBWA 4M6OH 1ZEAL 4GAYB 3EKCA 3QEQA 4X80H 1CE6A 5D1XD 2B0SL 1F6AA 1G6VK 1ZA3A 2V9TA 1MI5B 4PLKC 4APQD 1FYHB 3FFCD 4ENED 2VDOL 4WI9A 5ESVB 1AQDA 5E9DD 2VYRE 2EKSB 5C0BB 3FJTA 3ULUD 2Y36H 4IRJA 5C9JB 5F1IB 4ZSOA 4HWUA 1BZ9B 4KJYA 1HXYA 3S96B 1MCPH 1B6DA 4JFQB 1JPTL 3C6SA 3DTXB 3DX9A 3GRWL 3I6GA 4N5EC 3RU8L 4J3XA 4CVZB 4HULB 1RY7B 3MUHL 1L6XA 3KYKH 4P2YA 2X89A 1H5BA 4E0RA 4NO0D 5J11B 3N1GC 4I0KA 3V0WH 5CFHA 4M1DH 4PJ9A 3SQOH 2E6QA 1BFVH 1P1ZA 5HVWA 1HHKB 3QI9A 4K2UH 4QTIH 5JTWA 4R26H 3JV6A 5IB3B 4Z7NE 1EA9C 2YA1A 2YEZB 4D9RE 1JHLL 3DVGA 4C58B 5AZEH 3D0LB 2YD8A 1S78C 2FJHA 3CZFA 3Q6GL 1NGXA 4HUWB 4RSVA 2ILLA 1P9MA 4DK6A 1BWWA 2OMNA 1WT5A 1WISA 2IALB 3I2CL 1I9IH 3NCJL 5BQ7B 3TNMA 5SWQB 1NCWH 2EICA 4O2EB 3U2SA 5HD8D 1J8HE 3ULUL 3IVKA 3IDJA 1RZJL 1JE6A 3KPLA 4XC3H 4LSQL 3DURB 3BP5A 3FB6B 4R4ND 5HI4C 1R3KB 4O00A 1KCVH 5ETUA 4CUCA 3S3PA 2GCYA 3HI6H 1P7KB 4JQXC 1AGEA 1G9MH 4NO3A 4P5MA 2FJGB 1UADC 3VW3H 3W2DH 3U83A 4JE4B 3K8KA 2QLVB 3O6FC 4JGMA 4F7EA 1ADQH 4XH2A 1BM3H 3BUTA 3BP6A 5HY9A 1KTDA 5GGUA 4WTXA 4R4FL 4CVXA 5DURB 2ZUXA 4OI8A 3FFDB 3MCKA 4Y88A 3MUZ1 1EUUA 2FHFA 3BJLA 3WFBL 1KCSL 5AUMA 5C86A 1XMWA 1W0YT 1UACH 2IMNA 2P43B 3KAAA 3ILPA 4FFVD 5C0AB 3OSKA 4GAGH 5E8OA 2EZ0D 1UH3A 3KPPB 4QRSA 3NGBC 2W0KA 1OQXA 5EBMB 3BVNB 4XMPL 1BBDH 2PO6D 3NAAL 3W39B 3MZTA 4ZAKB 4TSAH 4X9BA 2IF7A 3ROLA 1BF2A 2DICA 5JZ7C 2FWOA 4AK1A 4MNHB 2DRUA 4V2BA 5SX4H 1KFAL 1MCBA 3HC3L 2J4WH 4P2RE 1SJEA 3P4MA 5ANME 4LVHC 3B9KA 3QO1A 1LVEA 3MRHB 3HS0A 1QO3A 3AROA 3R1GH 1E4WH 3IGAB 3QIBC 4L9LB 2X9XA 5FF6B 3S9DB 1K4DA 1QG3A 4U1IA 4XNYL 4WFGE 2YOCA 1LK2B 5JIHA 4BQ8A 1SQ2N 1YEDA 4HFUH 5JIPA 4I1NB 2FHCA 4S1DC 4G8GD 2EEBA 1IZJA 2G5BA 4TUOB 4OCWH 4M8VA 3QEQB 1T03L 1CVRA 4D0BA 1F6AB 1ZA3B 3D85A 5GRZA 1N2RA 2H26B 3SGDH 4Y5VA 2BJML 2WP3O 2OI9C 3UJJL 3C9NB 2VDOH 2O26U 2FGWL 4N0FB 1T04B 4Z0XA 4ETYA 1HSAA 4XTRD 4IRJB 1QHOA 2HTLC 4KJYB 3AY4C 4LCCC 3VG0L 5A3IC 3TESA 2VLKE 1EERB 2BSED 5C07D 1A02N 5KVFL 2ITDB 3DX9B 4M7JL 3GRWH 5CZVL 4BZ1L 3QUXA 5GXBB 4M8QA 1GGYA 1AGFA 3UXFA 2QKIB 4L8DA 4OM1H 4URTB 4F15C 3RAJH 4JY4A 1DUZA 1KIPB 3D6GA 2WBWB 4MCZA 3MR9A 2JCCA 1EBPA 4GG6F 3LMJL 3QPQD 1P1ZB 3MSPA 3RVWD 3S37L 2VLJA 1IGFL 3QI9B 1TVDA 3JV6B 4J3OC 3DVGB 1JHLH 3BKML 1AC0A 3IRPX 5A2IH 2FJHB 1JL8A 2CUMA 1JWSA 4Y8DC 1VERA 5DS8A 5AAMA 3BPLB 3E2HB 3F6LA 4WWKA 1AIFB 2PW2A 3G6JE 3SDYL 3D1MC 3CFJB 2ICEA 2DJSA 2VO5A 3TNMB 4KDTA 2ZJSH 5CEXA 4FQQA 3MV01 4WTZA 3U2SB 2PUQT 3T3PF 3IDJB 1RJZA 4G6JH 1RZJH 4XCCL 1E4JA 1MCJA 3U4BL 3BP5B 5KSVB 3WO3B 5EO9B 3Q1SL 2OYPA 1G1CA 2UZIL 4NO2A 4XX1E 4GRWH 3VXME 1D7FA 2FEDC 3BT2L 1AGEB 4U1KA 4P5MB 2DQJH 1G7QA 4NKMA 3UDWA 3GUTB 1A6VL 1ZGLP 1Z3GL 3FB8B 4PJFA 3OKKA 3VFOA 4F7EB 1ED3A 4XH2B 1MHPH 4CJ1A 3RJQB 4KRMB 3BP6B 1MCNA 3MCLL 4KUZL 5F7FA 3WFCL 4PRHA 2MWCA 5HY9B 1KTDB 4M1GL 2NMSA 3OGCA 4CVXB 2D31A 4Y16A 2B1HH 4JEGB 4ZDHB 1Z0MA 1S7UA 3Q0HA 3OX8A 5IVXB 5ITBL 3EFDH 3JWOC 4ZUUA 1SVZA 1SVCP 3ILPB 2XIDA 3F7RA 2OXHA 3CCHA 2ZCKH 5CZXD 1EK3A 2UY7A 5MEND 5EUKB 3RIFK 5CLWA 1G7HA 4F7CB 3S5LG 5DMKA 4U6HA 5HHQB 1K3ZA 3ROLB 5GRJL 1ETZA 5TE6L 3E6FA 5DEZA 4K3DL 4HV8A 3WFDL 1KFAH 4MVBD 2MFNA 1S7QB 5I1EL 1UH4A 5KSAC 3HC3H 1SJEB 1A9BA 3PWJB 5ENWB 3QO1B 5CJXC 5DZOA 1F4WH 4HCRL 15C8H 3H9ZA 5E56A 1QO3B 2BSSA 3HZYB 5D1QB 1B4RA 3MGOA 4U1GB 3EYFA 4M7ZC 4YHOH 5C3TA 3IU4H 5ESAA 1X7QB 5IM7B 2H3NA 4XI5C 3HCVA 4U1IB 3V52L 2EE9A 3CUPB 4XNYH 4D94A 4PJIB 1YEDB 5IFAL 4KMTL 1HHHA 4X6CF 4UQ2A 2DJUA 1J8KA 1S8DA 1PY4A 1TENA 4JHBA 4TPRL 5JNYA 3AFLA 1T03H 1HEZA 4G7VH 3V6ZA 1S9KC 4KK8C 2BNRA 5GGQL 1FGVH 1D9KA 3P2TA 4XCFL 3D85B 1N2RB 4MJ6B 4EXKA 2BJMH 3DX8A 5DT1H 3TO2A 1MQ8A 2FGWH 5FAAA 1HSAB 1LO3L 3MXWH 4JQIH 5D7SH 3ZTJG 1CFNB 5CD5C 4IOFC 4Q6IB 3S3JA 4N0UE 1K9TA 4PJDB 1QFWM 1PD6A 2F54E 4M7JH 3ARVA 1U0QA 4HS3A 4NKIL 4ODTH 4M8QB 5C6WH 3SPVA 4TVPD 1NFDB 3BYTA 3VGEA 4L8DB 1RUKH 2KL6A 5FGCE 4EVNB 5DXWA 3HMXL 1DUZB 5D8JL 1DJSA 4EQ3A 3I85A 3NCEB 3LMJH 1RK0B 1U6AH 3S37H 4OLXH 2E6JA 3VWKA 3FOMB 1II4E 3V8OA 4PJ7F 2FZ3A 3FCTB 4N68A 4OV5B 2J5LB 1RUQL 4F9LC 4JFPA 1JWSB 2FJFA 4Z8FL 5I75B 1NAML 1U3HC 5CINH 3QRFM 2VR5A 3RQ3A 2PW2B 3IKKA 3MOQA 3KLAB 1I3GL 3OKLB 3T0EC 1CBVL 3ARFB 3MQIA 3G5YB 4PBXA 5I1JH 3W5MA 1JGDA 4OV6F 5H35A 4RMQA 4ZS6D 3TC9A 1T0MA 5CGYD 4LK4A 3BZDA 5FV1L 4IRSD 1RJZB 5B38A 1CS6A 4JFDA 4QHKI 1MEXH 4XCCH 3X17A 4JFXA 1FL5A 3DLQR 3WS6C 4HIXL 5E00B 3CFIC 1GZQB 4RGMC 4DK3A 2IC2A 1GIGL 1S7VA 1WIUA 2WV3A 4NNYA 3SDDA 3VXPB 3TT3H 5HDBF 3WJLC 2AS5M 4U1KB 4TVPL 5CAYB 3F5WA 2AJVH 4NKMB 3DSFL 3BKJL 3DIFB 3MV9E 1M7IA 3OKKB 4NGHL 3VFOB 1ED3B 1N6QL 5JQ6H 1CICD 5JA9A 5A2FA 4XVJH 4PRHB 3SDXB 4I4WA 3SJVA 2NY0C 4M1GH 3OGCB 4M9OA 2D31B 3MRJA 1XIWC 4U3HA 3JV4A 2A38A 1FO0A 4NN5B 1RUAH 4XPBL 1IT9H 1B4JL 3HLAA 1XGYL 3V0VB 5ITBH 4Z7OE 3FMGL 2H1PH 3O4LD 4HAGA 1I4FA 3D5OF 2ZCLH 2XG4A 1F13A 3BIBX 4MYWB 1W0VB 3I6LE 3VFUB 2VQ1A 2DLFL 4OLEA 1R5VA 4GW5B 2VDKL 3AB0C 4AYFA 3FAWA 4KJPC 3UPAA 5D7JA 3STLA 1ZT4A 4Y4FB 4AJ0A 5DUPL 3IFLL 4H0GA 1WIOA 3RZCC 3E6FB 3OKNA 3D3VB 5CKAA 1A7RH 5HGDB 1U8PB 2IFGA 3O81A 4OLWL 2VZVA 4Q2ZB 2Q86A 3V6OE 1GSMA 1A9BB 3L3IA 5I1EH 5CBEB 1IEAA 4ODUA 4CMMA 3SKNB 2IAMC 4HCRH 3E8UH 3T2QA 1YUHB 1IRAY 3QEGL 3U9UB 4I5BA 5C08A 3QHTC 4Z78A 2B20A 1N6UA 1S5HB 1OAYH 2YK1L 3HCVB 1YNKL 4EBQH 2LABA 3ETBF 3CK0H 3UTTA 2N4IA 3MFFB 1BVLA 4N1EA 3RX7A 3LZFL 3MYJB 5IFAH 3QWRD 1XF4A 4YE4L 5E24E 3F58H 4UQ2B 1SY6A 2O61A 3F7PC 2Z91B 5JNYB 3B9VA 4KJWC 4TPRH 2M2DA 3GI9L 1MCIA 3QDMA 3V6ZB 2BZDA 5CSZA 3E1F1 2BNRB 2PYED 5GGQH 5C0FA 2DI7A 1QEWA 2X9WA 3R8QA 4EN3A 5IQ7L 1YPZB 4QHMB 4KROD 3TO2B 3GIVA 2DLIA 2ORBH 4N90D 5CP7A 1LO3H 4HKZA 3O9WC 4NZUL 4LEXL 4Z95H 2EDHA 1A7QH 4KQ3L 1PQZA 4R7NA 3L5XL 1TXKA 2DD8L 3U46A 1DVFD 3PP4L 3EYOA 3DX7A 1BD2E 2P45B 1TJGL 4NKIH 1CE1L 5EZLA 5GS1C 1WQVT 3QDJD 4OKDA 3VXSD 3PQYA 4EUPA 1G9MC 2X4RA 5B39A 2N7BA 3IB4A 2GQHA 3VGGA 3ULVE 3S4SA 3FO9A 4UT7H 3GM8A 5HGAA 3UMTA 3V2AR 2NX5A 3ZKXC 1X5XA 5DJYA 3PHQA 3MNZB 2VJXA 3PIQB 1N5YL 4CN6A 1JN6B 2FD6L 4MA3A 2HKHL 2W65A 1W72L 5CJ5A 2FZ3B 4WNQA 4GMTL 2DF3A 4XXDA 2C1OA 3UTSD 1FBIL 2NZ9C 4JFPB 3RWJA 2UWEF 2OSLA 4Z8FH 3WNNA 5I1DB 3UPRB 4MMZC 4M02A 5C0DB 5IIEA 1MELA 5ADPH 2W0FA 1I3GH 3VXRD 4J3SA 4NSKA 3S98A 1G7MB 1RJYA 1VFAA 5B38B 1HWHB 3O4OC 4JFDB 4OLYL 4QXGL 4YIQA 2BNQE 4JFXB 3WUWG 1A6AA 1FL5B 5BO1L 4PJ5A 4HIXH 4M5ZL 3SY0A 1TVHA 1AO7D 3SDDB 1GIGH 2VMFA 4LRIC 5M95B 3T08A 2DI9A 2GTWB 2PXYD 4YC2C 2OTUA 2C3HA 5DK2B 3NIDF 3RIFF 4K3GA 3ULUF 1M7IB 3NCFB 1WZ1H 4NGHH 1G84A 1HWGB 1Q72H 3JTSA 4HGWB 2EIZA 1INEL 5DF0A 3V5DA 4I4WB 3T4YB 1OAUL 3TYGH 1TTUA 3VXUE 1ZWIB 3MRJB 1UGNA 3JV4B 4WO4D 2FNBA 1FO0B 5E95B 1FFOA 3HLAB 4NKDB 4K7PY 1C16A 1I4FB 5CHNB 1KENL 4Y19D 1ZKAA 1IKFH 5BVPL 2VQ1B 1KJMA 5D70L 1R5VB 1HN1A 2DLFH 3MODH 2X4PA 1NUDA 3CLFH 4D9QE 1ZT4B 3BRDA 3SHSA 5GZOD 2KBGA 4PJXA 2MCG1 3NA9L 3RWEB 4Q9QL 3IFLH 5L2KE 3OKNB 3AM8A 3PWPD 4L9LC 4BYHA 4QOKA 2Q86B 3L3IB 4OLWH 1IEAB 5EU6E 4L3ED 4ODUB 3RVUD 4CMMB 5JO5A 4QRRA 4CVUA 3EAKA 1J0JA 4V1DB 3RUGF 3QEGH 4PV8A 1Z9MA 3WXWL 1IGCL 3GJEA 1GGIH 1TNMA 3P73A 1NDGA 3WMSA 2VXTL 2XZCL 2YPKA 1YNKH 4HUUA 3SBWC 3UTTB 2KPNA 4BFEA 1BVLB 3IRZA 4PP1D 3IXAA 5DI8A 4OFVA 2H2SD 1CZ8H 1XF4B 1JZ2A 3QEHA 1EHNA 4JPIA 3T0WA 2O5ZH 2LU7A 3IFNH 4CKVX 2O61B 1K8IB 4U1SB 3WO4B 2P5ED 3IJSA 2FX7L 3GI9H 2DIJA 2ATKA 5CSZB 5DJDA 5C0FB 1DEEB 1Z9SA 3QO0B 1ZLWH 1L7TH 1S5IH 5E8NA 4EN3B 1ZA6A 2XWJB 4CNIA 5CEZE 4MCYA 3GIVB 5T1LA 3MNWA 1WBXB 3D2UD 4HKZB 2YKLL 3BD3A 4Y1AD 1KCLA 5GS0H 1H5BC 2XY1A 3VFVA 2YPLB 5FO7A 3LS5L 2FSEA 4TNWF 3H7LA 3QIUD 3EYOB 3PP4H 3DX7B 4P2QD 4G7YH 4WFED 5ISZE 5EZLB 4PJ9C 4J8RA 3LEVH 4PGDB 1T89C 4PRBA 3CXHK 3MJ8A 3PQYB 3QCVH 2X4RB 3EO9L 1SY6H 3RDTB 2IG2H 1U95B 2F5BL 4BSJA 4S11A 2IPTL 3CH1A 3WHE0 5BRZD 3S4SB 3W5NA 5HGAB 4X6DE 5D71H 3PHQB 4UI2A 5KN5A 2WWKO 2VLRB 1KCRL 3V7AE 4OTXL 4MA3B 1P9MC 2FD6H 2IBGA 2W65B 1U92A 2UY6A 4HG4K 1WT5C 1AH1A 3VFNB 3L3DA 1IBGH 3MRMA 3B9AA 4FQCH 5IKCA 4WNQB 5DJXB 4J12A 1ZLWK 3KLSA 3C2AH 2C1OB 4M62L 5F9JA 4L4TE 1WZMA 1FBIH 4O5LH 2OSLB 4D0DA 5HGBA 3IJHB 1ZVSB 1OP3H 2UVFA 3IT8D 4HKXA 4I18C 4OLVL 1OAKH 1T20B 4F33B 2GJZA 4YDIL 5E4EC 1PVHA 4OF5A 2VOTA 4EUPH 1FFNA 1MFDL 2RGSA 4JKWA 5IHUH 1VFAB 1CLZL 3O0RH 4QHLA 2NY3C 4YIQB 2QQQA 1ZT1A 2OS7A 1MI5D 4PJ5B 1UCBL 5BO1H 3VXNB 2AV7A 4MXVF 4PJGB 5HYJE 4PIRF 5HHOA 3C6LC 3DBXB 1OT2A 5IBUB 5C0BD 4Q0XL 2OZ4A 3F7YB 2OTUB 4ZD3L 1UM6L 2VAJA 3BGMB 1SYVA 2QQLL 1NCUA 1N3NA 3FB5A 3RY4A 4XCNA 2FO1A 5J13B 1IQWL 4U0RB 4ZXBD 4ZMAT 3ZMRA 4PY7B 4EQ2A 2JCCF 5FV2A 3V5DB 1BAFL 7CGTA 1INEH 2XV6B 1GCFA 2BVOA 1AGCA 4BSWA 5H94A 1YEFL 3M45A 4PRPB 1OAUH 3B9DA 4KTEL 4PJAB 1JPFB 1CXKA 4PUBL 3TZVB 4OFYA 4J2XA 1J1OH 1D6EA 3W0WD 1YZZA 1ACYL 2IMMA 5DZLA 2FO4B 4JFFA 2B7DT 4XBEH 5BVPH 4OCNC 3LOWA 4U1LA 1G7PA 4MSWA 5D70H 1WICA 3B9KC 3QUYA 1OGAB 3B3IB 5EOTB 4LLAA 5BJTA 2VIRA 3CSYA 4JFHE 5DR5L 4U1GC 4K3EL 2P8LB 4QOKB 4BQ6A 4G6FB 3L3JB 5FYLH 4PJ8A 2ZUQB 4WV1A 2F8OA 5JO5B 2QADD 4U1NB 2HFTA 1DP0A 2D0GA 5IMMA 1YNTA 4JRXB 1BBJA 2MPAH 4XPTL 4XP6L 3VXTA 3T1WA 3GJEB 3P73B 1NDGB 4P2OD 4P9HL 1KG0B 2YPKB 3C2SA 4JKLA 4MJID 2XZCH 4W6YB 3KPRE 1KEGL 3ISWA 4PJFF 1BJ1H 4N0YH 1NANH 5HYFA 2GKIA 5GS2D 2EH8H 3QEHB 3LDBC 4Z7WE 3D39A 4Y5VC 4EI6A 4WW2F 2HFGL 1QSEA 3VD5A 4F8QA 4AIZA 5HVGB 1SJXA 3LN5A 3T8XA 5BXFB 1QLEH 8FABA 5INDA 4HXAH 1T2QL 4CNIB 4BK4A 1FNGA 1H3WM 4F8TA 4MCYB 2BK8A 4WUUD 5T1LB 3MNWB 4NWUL 3QUXC 3F8UB 3OKYA 1CLCA 1A2YA 3H42H 4BQBA 3VFVB 2EYSB 2YD7A 1EUTA 1JJUA 3LS5H 5D4QA 4JY6A 1R5WA 3G5XA 3U7YH 5FHBH 1I9JH 1GHFH 4J8RB 4K3JL 4DN4L 1Y6NR 4LIQE 4PRBB 2EO9A 3MJ8B 5KAQF 4QXUL 4ZAKD 5TFSL 3PWNA 4CJ0A 1CN4A 2F5BH 2IPTH 1A7NH 5C0IA 5I71B 2HT4D 5BS0E 5FDWA 2A83A 4HGMA 4U33A 5CILH 5KN5B 5I75C 2Q20A 3PE9A 4JLRA 1KCRH 4NBYB 4WWKC 4OTXH 1OY3B 3HZVB 1U92B 3ZSTA 3L3DB 3MRMB 1J0KA 5IKCB 3LCYA 3RPIA 4KDTC 3AVEA 2ZOKB 4M62H 3MRIA 5KZCB 2HTKD 1P7QA 4D0DB 4BQ9A 5B8CB 3MJ7A 4H5SA 2VDNH 1MCWM 2AK4E 4OLVH 1CTOA 1MQKL 1KEML 3B2VH 32C2B 35C8H 4P3WA 4WTZG 1LO5A 4GXUM 4JHAH 1FFNB 2ZPKL 4MS8C 3MACH 4M6AA 1J8HA 5EIQA 5GSVA 3MLUL 1ZT1B 2W92A 4NFCA 1UCBH 2DMBA 5HHOB 4PJHE 5IHLB 4QY8B 3VWJA 3ARZA 2CR3A 1QBBA 4QHKJ 3EDEA 2PW1B 2X4OB 1AP2A 4WW2C 4Y16C 1UEYA 1UM6H 3QXWA 4R7DA 4N0CD 1SYVB 4ODBD 4R96B 1N3NB 4XCNB 4XHJD 1CR9L 1E27B 5IMKB 2R1XA 1A4JB 1BAFH 4BSWB 3VI3E 2NW2B 3SGJA 1KB5A 4NQUA 4KI1A 2MTPA 4KTEH 3CDGA 1NBVH 4I2XB 4NP4L 2FCBA 4Z7UB 4N8CL 4GS7C 1R3HA 5TE7H 3ZZ1A 5L0QC 2NXYC 1D6EB 2BFVH 4HKBA 5IW1A 4JFFB 3VXOA 3H9SB 3RIAK 1G7PB 4MSWB 4OIIL 4BFIA 5CZXC 2EYRB 1NEZA 1CFTB 4X6EA 4L3CA 2OZ4H 4C55A 5L8KB 1T0NB 2R0LL 3CSYB 5BJTB 2ZUUA 1ZHBB 1M71A 1PKQB 4ZPVA 3C09C 4WW1B 4WI4A 4PJ8B 2B4CH 3EZJB 4LVNB 5KAQG 4P2RA 4TRPL 5ANMA 1I3VA 3I9GH 5IMMB 1YNTB 3GJFA 5GSRA 1MPAH 4HHAA 1BBJB 3T77A 2JIXA 4LVOB 2DWEA 3VXTB 2IH3A 1FLTX 4XRCB 1ES0A 4YBQC 1MFAH 1Z5LB 4XWOC 2EEAA 4P9HH 2CIIA 2R69L 1U8KB 3HMWH 4O51B 3AREA 4PTTA 1E6OL 1A4KA 2G60L 1D9KC 2XYCA 2XTJC 1JV5B 4HJJL 1JF6A 3MLWL 1GGUA 3RWFA 2AJZA 2YA0A 3MBEB 1QSEB 5FB8B 3MCG1 1PBYA 3EO1A 1ZSDA 1G7JB 2Q6WA 5IGXL 5EO0A 2ZG2A 3LN5B 2Z8VC 3T8XB 4ISVB 8FABB 1T0PB 2R29H 1L0XA 3HZKA 1TPXB 2VWEC 3O45B 3UC0H 4G9DA 4K71B 4GSDL 4QEGA 1A2YB 1GOGA 4UMGA 1KLGB 1W2KT 4OZFB 5T5FH 4JZJA 2JELL 5HHVH 3FQNA 1NCAL 3HB3C 1FFRA 3LH2L 3CFBB 3FQXB 3S35X 3WXVL 2VLKA 3NZHH 3JXAA 4LPTA 5MI0B 4LARH 4PRIB 4P0DA 4XNZB 1S9VA 1WFTA 5DRWA 1G7LA 3VWKC 5DK3A 4GKSB 5DJZA 4ZYKA 3TA3A 3PWNB 2CDFB 2R2BB 4M7LT 2F5AH 5FDWB 2A83B 1QBLL 1YMHB 1DQLL 2YSSB 5AEAA 1A5FH 4PRAB 5SX4I 4JLRB 1S7SA 3EFFA 1YEGH 5D1QD 5JOFA 3KPSE 1FPTH 2X4SA 1IGIL 1RUML 2ADIA 5FYJD 3RPIB 1F42A 4MJ4A 1AI1H 5DUBB 3ZE2F 3LB6D 2BY3A 4WU5A 1NQBA 4DVBA 4QRPD 5FHAL 4B50A 4H5SB 3C5JA 1HQRA 1TZGH 3L7EB 4U6VL 4PJEB 3G6JA 2LTQB 1IGJA 1MQKH 1F4YH 1KEMH 4J23A 1RV6X 4MJ5A 1LO5B 3B43A 5B38G 3N85L 5J7CC 1D5XB 1SJVA 1QZ1A 3LKRA 4DGVL 1J8HB 1OTSD 4PJBA 3MLUH 1P2CA 1NUNB 2VDML 4M93C 5T3XE 1JPST 3BPCB 3LN4A 1QSFE 5TH2A 1YY9D 2AGJH 3SGDI 1MJUL 3VWJB 3VXMA 2HH0L 2XKNB 3BP7B 5TDNA 3HZMA 4ODHL 4HWBA 4LLMB 4ALAL 3JUYA 3QJFB 1CR9H 2QJDA 4B7LA 1A7OH 3VDAA 4QWWC 3UPCA 1BZ7A 1CICC 5JOPD 3ES6B 2CKNA 1IAIL 3S34L 5I1KH 1JRHL 3IETB 4QRUB 2FEEI 4K55A 5J3HD 1RIVL 1XF5B 1U8IA 4S1QL 4D0CB 1OLZA 3QIWA 5D7JC 4X6BB 4QLRA 2G75B 3TJEL 2H2PC 4X8XA 2HRLA 1LDPH 3ZDZF 5IEHA 4TULH 2BOBB 5D2NB 4EI5D 4ZS7L 2JJSA 4BFIB 5FUOL 4OIIH 5D72L 1NEZB 4P5TD 3QDGB 1DEDA 2LVCA 2YPVL 1T22B 1WV7T 1M71B 3MRKA 4ZPVB 5GS0C 4JN2A 3L5WB 3C5ZD 5I17A 4X5XB 3DUSA 3RP1A 4UNUA 3LKOB 3ARFD 3EYQC 4X5LA 5TE4L 2R2HB 3ARTA 2WZPD 3O8XC 1KB5H 2GYSA 2QQNL 3GJFB 2EC9T 4HHAB 4OCSL 3T77B 5ICXB 2DWEB 5I8KH 2IH3B 1ES0B 2J8OA 2YZ8A 5GGVH 1VB9A 1TFHA 1FL6A 2VDPH 2X1XR 2CIIB 3WIIH 2AJUL 3OKEB 2R69H 3WO4C 3AREB 4HUVB 1J5OL 1E6OH 1Q9KA 2UYLB 1C5BL 4UILH 4WI7A 2HRPL 1XGQA 1V3JA 2G60H 3O3AB 4L1HA 4HJJH 1AR1D 4DKEL 2J8UF 2E8YA 1J0YA 3ZDXF 3RWFB 2AJZB 4GG6E 3T0XA 3MJ6A 4JM2A 2E9IA 3BX7C 2OL3A 4GQ9L 4NC1E 5TGBA 2Q6WB 4DZ8A 4ODWB 1UYWH 5IGXH 5EO0B 3DYPA 2GTZB 2W1NA 4H1LA 4OGZA 4GFTB 3U36A 2WLZA 4LPUA 4G42B 5ICZA 3FB7A 2E27L 1MHCA 3IKCA 3CSPA 3U30C 3PGDA 4A2LA 4D3CH 4R0LA 3CSBA 4ELME 2RHEA 4GSDH 5FKPA 3UAJD 4PJXF 3L1OL 1DQMH 3FL7A 4RQQA 4JZJB 3FQNB 1NCBL 4N0UA 4XGZA 2VLKB 3T3PE 4H25B 1HH9A 4HJGA 3GHBL 3THML 5IUSA 2F54A 1S9VB 4EUPG 5DHVB 4Y4FD 5DFWH 3KJ6L 1MIML 5B39G 5DJZB 2C4XA 5KSUA 1KGCD 3EYUL 3TA3B 3T65A 1I1RA 5KG9A 3S4SG 3D3VD 4JRYB 3BSZL 3ZLQC 2HLFD 2EO1A 2R8SH 4YPJA 5LGJA 1UZ8A 3MC0A 5EBLB 1BEYL 1LE9A 3BDYL 2DI8A 2VL4A 5JOFB 2X4SB 2ADIB 1BWMA 1CFQB 3FQTA 5C09E 2LU4A 5IVZA 4DVBB 5E2TL 1BGXH 1A1MB 3OZ9L 3C5JB 3GJFK 2GUOB 4DKFH 3S97C 1HQRB 3PL6A 1KN4H 3VD3A 3QULB 3WIHA 3L3GA 5GGSY 1MWAB 1AGDA 4U4BA 4U6VH 3G6JB 2P8MA 1IGJB 1PSKL 3PXJA 3MJGX 5DWUH 4TUKH 5SWZE 4JREB 3SE8L 3N85H 4NJ9L 1GGCL 1DQDL 2AEWA 3LKRB 4GBXB 1DLFH 4KH2A 4U3CA 5ERWA 1P2CB 4WI2A 1J1PH 2RFXA 4KK9D 2VDMH 4M4PA 1U8LA 3LN4B 1FIGL 5IBUG 5TH2B 4HUXA 3FRUB 1MJUH 3VXMB 5TDNB 4L3AA 2PN5A 4H26B 3VFSA 3T0EE 1OARL 2JB6B 1A1OA 2PXYC 4ODHH 4PB0H 4NZRL 2Z31B 1I8LA 1IGML 1YDPA 1C8PA 1QKZL 4A2MA 4ALAH 1AGBA 2AQ1A 3MV9A 4JFED 4L5FH 1OF2A 5CJBA 2GY5A 1RZFH 2GSGB 3KG5A 5HHPB 3UO1L 2X5PA 1QYGL 3K46A 3ZYZA 1JNLH 4NJAL 1IAIH 1JRHH 5C0NC 4QRQB 1U8IB 1RIVH 3VMNA 5JPMB 4X6CE 1RZGA 2DQUL 4K9EH 3NH7L 3AM8C 5DZNA 5DFVD 4J4PA 4U7KA 3A6CH 1IC7L 4L8SA 2Y7QA 2ZUQC 4UT6H 3CH8A 5D7IB 3WDHA 1IMHC 1JYWA 1CT8A 1TIUA 5GZOC 4HWBH 1OW0C 3ARGD 4JN2B 2FLRT 4KHTH 2QQKL 4HZLA 5I17B 1J88A 1PG7W 4UINL 4XNQB 2YUXA 2FBJL 2GEEA 3V6OA 5TE4H 3HI5H 4U1JB 1DBJL 1EJ6A 2UZXB 4OCYL 3OHXA 4XPHL 3Q6FA 3GSWA 1QRND 2O5XH 4KV5E 2GSIB 4Z7VF 2P5WD 1FL6B 5CCKL 3FO0H 2HVKB 2VDLL 1D5ZA 2V17H 1Q9KB 5MEQA 1C5BH 1XGQB 1SHMA 2HRPH 4YHZL 3MLZL 2F53E 2Q7YA 4DKEH 5DEGA 3DGGA 3RGVA 4JM2B 2OL3B 1FVDA 1LWRA 1VADA 4GQ9H 4WUKH 1QPPA 4PJ7E 1IGTB 5EOCJ 1OCWL 4H1LB 4OCRH 3FOLA 5ICZB 4JPVL 4MD0B 2E27H 4NCC2 5L9DH 2DLEA 3HPJB 4DJMA 4R