2DQHL

Crystal structure of hyhel-10 fv mutant (hy58a) complexed with hen egg lysozyme
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
b'DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqhL00
1SM3L 4JANA 4QRRD 3IFOB 4JGJA 5CZKA 4IDLA 1NCTA 3PDOB 4CADB 5HHNA 1BZ7B 3WD5H 1MAKA 5ALBH 2P44B 1R3JB 3K0WA 3NCJH 2X4TA 2QQQA 1CD8A 4FZEL 4U1HA 5D5MA 5FKAB 3MRPA 5CEYA 4M43L 2AEIT 4WIQA 5IQ7L 4NKOA 2KQMA 1FYTB 3MV8A 1HSAB 3AVEA 1MOEA 1H15A 5F7UA 1EEZB 3GJEB 5EIIB 5F9OL 3DBXA 2G2RA 1YUHA 5F7EL 1IC4H 2XNAA 1IGMH 4R7NB 5DO2C 4ZFZB 2GAZA 1AY1H 5JPNA 4XP6H 4TNWF 4I9WE 3AB0C 2VDLH 3TT3L 2JTDA 4RRPA 4XXCA 3RWFB 5E8OB 5EOTB 1AO7E 1E6OL 1P4LB 4GW5A 4DGVL 1F3DJ 2ICES 4JG0H 4LF3A 4HW6A 4TSCL 4P2RB 1MIEL 5JIIA 2V2WA 1I8MB 5KSAB 2VZVA 4UT7L 1JHTB 1YEJL 1G7JB 5FECB 4NM8H 5CJXC 1KCLA 5FA4B 1OT1A 5FGCE 4GBXA 1LEKA 3E6FB 4Y5VB 3FRPA 1I3VA 3O6LH 3E6HB 4M1GH 1T80A 1IBGH 3I50L 4IIQB 1QP1A 1IL1A 5J06A 4PD4J 1OAKH 3QI9D 5I8OL 3A6CH 4XVJL 3O8XC 3U0PA 1P69B 5C2BL 5KOMC 4LCIL 3WJJC 5I15L 4JM4H 3KPOA 2HRPL 2Q76A 3OGCB 4P9HL 5EUOA 4Y1AB 5FA3A 5E6ZA 5JR1L 5E2UH 1EGJH 1P7KA 1P4IH 4WEMB 3FHAA 5CJBA 2XWTA 5IIEA 1B2WH 1KCVL 5HGAB 3MA9L 4TOYH 4OGYH 1ZGLP 2EXYD 4R4FH 2I5YH 1MPAL 2A1WH 4JFFB 2FECI 1FFPB 5DJAB 4YNYB 1CCZA 4MZ2A 4OF0A 3HI1B 1VERA 1MLCB 1TDQA 5T3ZE 3SE4A 1GRWA 3HE6D 3G5XA 1JZ2A 4XC3H 1VACB 1BEYL 3UEZA 3VWKC 1BVKA 5JIKA 2LVEA 1WC7A 4KHTH 5DUPH 3S88L 3NIFE 4WI5A 2SEBA 1A9EA 4S2SB 3VRIB 4HS6B 3QEGL 2AEWA 4MZ3A 5INCB 2XZZA 4J1UA 4KK6C 5CAYB 4L9LB 3I6GA 3KYMA 3QHTC 2VC2L 2ITDB 1KACB 3S9DB 4F9PA 5DRXB 3S7GA 2EC8A 5D1XC 4G8EB 5CSZB 1H0DB 1CFSA 3ARWA 3LVEA 2V9TA 1OP5H 1S7QA 5D4QA 1YNTA 4JO1L 3KLAB 2YD3A 5HI3C 5IBUB 3PWNB 4Y4HC 3NA9H 3WV0A 4M62L 1JGLH 1IGJB 1YQ2A 4N5EC 5DO2D 4UQ3B 3MV01 5GRYA 5IB5A 3C8KA 1JZ8A 2Z9TA 5FO9A 1R3IH 4G42A 5F71A 3HTLX 3VXOB 3GBMH 2F74B 1XGUB 2DKSA 4P23A 1NGWB 1TENA 4PGDB 2CJUH 2VLRD 4K94L 2NY0B 1M05B 4FQCL 3WIHL 1KYOJ 3CFKA 5EZIH 3L6FA 1QA9A 4ZUSB 1EBAA 4G6JL 4WO4A 4JN2B 4LEXL 1NEUA 4TRPL 3I9GH 3MACL 4MCZA 1T21A 2FX9L 1KLGA 4DWHA 2EE2A 1A7BA 2EE6A 4UB0H 5FDYA 1NGPL 3OKNB 4HIIA 5GGUA 4TUKH 4NUJB 5SX5H 1BQLH 2X6MA 1NAMA 4A6YB 3X3FL 4U7KA 2FH8A 3ZKMC 1HSBB 2XKNB 2EDYA 1HINH 4PJAA 4W4OC 3WS3A 4GW1A 2MHAB 1MFDH 1H3VA 4JHWH 4MA7H 1DN0B 1JTPA 1OM3H 5L2JB 3MCG1 8FABA 5T1DL 2EIDA 2ZWLT 5IF0B 1EFQA 1T0MA 2IG2L 1NFDA 5EBWA 4Z7VF 3BGMB 5AWNL 3UTTA 3F7PC 4CDHA 2DLFL 2WP3O 4NQCD 4CVZA 4P4KD 3O4LB 3VWKD 4KJYA 1UACH 5L0QB 3RPKA 4PJIF 5SWQA 3M07A 2BSRB 1I1AC 4KI1A 4KK6D 3DUUA 1JZ4A 1U8QA 4PJXA 2FJHA 3BXNA 3S5LG 3VXUE 4PJDA 3RZCA 2VZ3A 3D0LB 3ROLA 4Q6YA 2RGSA 4ODHH 5DD3H 1QSFD 5ESVA 2XG5A 5T33L 4LVOC 4DKFL 3V6ZA 2F9BT 5D1XD 1I9JL 2GY5A 4APQA 2AW2A 3HAEB 5E6YA 1J86A 3B6SA 5DVNA 5AEAA 4K9EH 5JMOC 4LLUA 4G7YH 1N2RA 1UJ3A 1TJIL 4XVSH 2Z4QA 4PTTB 2B2XH 2BNUA 3DURA 4JFFE 5T1LA 3GM8A 5HI3D 1HE7A 4XMKL 1NAMH 1TZGL 3BW9B 4U1KA 1AO7A 1EXUB 5E2VH 1CG9A 1SEBB 3MLVH 3MQIA 4YDIL 1OQOA 2WBWB 1C5DA 3WFEL 4PJIB 4U1JB 1QO3A 2J8UB 1OHQA 3U9PH 1F4HA 1ZHNA 2HP4A 3TVMB 4YJZL 2PYEB 1HI6A 4MAYA 2DYPB 3P9WB 4LPTA 4ZAKC 3TESA 4HK0A 1K4DB 3K2UH 5DDHA 4NUGH 4FQJH 4HWNA 4XC1H 5DR5H 1FLRH 2QLVB 2DBLL 3TA3C 5JOEA 3AU1B 3BPNC 4LSVL 2XOTA 4HIJA 4XP9L 3NGBC 2IQ9H 3VRJA 4Y2DC 3OB0H 5IHZB 1RD6A 1YPZE 3HC0B 4XAWL 3C08H 2JCCA 2ZJSH 3FCTA 4ZOBA 3QEHA 1G0YR 2DWDA 3AS3A 2COQA 4KTDL 1H3PH 1G7QA 4QWWC 1IT9H 3ZKMD 3DSFL 3QI9B 4DVRL 3J7HA 4YR6A 1RZ7H 4MA8L 1GZQA 1U8IB 3FO9B 5HPMA 4LQ1A 2BMKB 2DI9A 4LKCB 3D25A 3L9RA 1CICA 3IGAA 1X7QA 3NBNA 1D5ZB 1R5VB 2FSEA 3BDBA 2GY7B 4JQIH 4TSBL 1ZSDA 4UILL 1RZFL 4U0QB 1B88A 1PYWB 1Z3GL 3QNYA 4KVNL 3MCLH 3HE6B 4PB9H 2K1MA 3U0TA 4KC3B 1NUNB 2GSIA 3T8XA 4GOSA 3PF2A 4Z9KB 4WWID 4PRBB 1EZVX 3QNZA 5IOPB 5LQBL 2UY6A 5K9KA 4TVPL 2QR0B 5DMIH 1H3UA 2H1PL 1YJDL 2FWOB 2OTUB 2EYTB 4GAFB 4M6OH 5GIRB 1G9EA 5E00B 1DANU 1ZLUK 4KFZC 2EECA 3EOBA 1PG7X 4LSQL 2GK0B 4Q0XH 4ZUUB 5FV2A 2R56L 4WU5A 4U1NA 3T1FB 1BGXH 4P2QB 3QR2A 1I8LA 1KBGH 1VPOL 3DTXA 2B5IC 3IFOA 3ARXA 1OWRM 4BK4A 4N9GB 4ONFH 1PY9A 2ZUTA 4R7DA 3PDOA 4CADA 2I60H 2W38A 1BZ7A 2WQRA 5FOBB 1R3JA 4GUPA 5FHBL 3W9DA 3CIQA 3AB0B 4M7ZC 2UYLB 5FKAA 4HUWB 3SE8H 4QRRE 4ZAKD 2XIDA 4CMMB 4OD3H 4PGEA 3FJTA 1NFKA 4P3CH 1CE1H 2QHRH 2W0KA 3SOBH 2DJ4A 4JY5H 2OZ4L 3NIGF 3K4DA 3GJEA 3TA3D 2EDXA 4J6RL 4Y4FC 5JDSA 1ZEAH 2R9HC 3MZTA 3WN5C 3K1DA 4LSUL 3DPBA 4Y2DD 3V4PH 5BVPH 1W2KT 4Z7VE 4NOBA 2G5RA 4R7NA 4P2OB 5ITFB 4ZFZA 1KOAA 2LAGB 4HZLA 3MLUL 3WHXA 1TJHH 4LIQH 1ZT7A 4QWWD 4D94A 5I6XC 3RWFA 1XF3B 2OTWA 1HCFX 5EOTA 3V5DB 1FORL 4X7TB 3RTQC 4PREB 5IVXF 4X4XB 5LGKA 5A2FA 2X7LA 4P2RA 1F4WH 2HG5B 4BZYA 1I8MA 1JHTA 4KAQH 1G7JA 4FQIH 4QYOB 1G6RL 3MNVA 1GC1L 4OCXL 4ENED 2XRAL 5FA4A 3CK0L 5E4IA 2E7LC 2NY2D 3E6FA 1U3YA 1JPTH 4Y5VA 4LU5H 5DFWH 3V6OE 3DX8B 1KN2H 2PKDA 1I85C 4NQCB 4IIQA 3K1KC 3OKLA 4P4KB 3MV7D 3VXUA 3BWAB 5EWIH 1VEPA 3LN4A 4TSAH 1RUML 4Y1AA 1JPFA 1NCUA 4FQLH 4OKVB 2XG4A 4FQ1H 5IVXB 4WW2C 4BFEA 1K3IA 5HGAA 4RQQB 1QYGL 4ZYKB 5C0AE 4O58H 5JO5A 3U79A 1A0QL 4G7VH 5BO1H 3IFPB 4JFFA 1FFPA 4YEEA 4BQ6A 3GDBA 1MLCA 5I30L 5D1XB 3LKOB 4UV4L 3TYFA 1MSPA 4C59B 1VACA 3RVTC 1MFNA 1NDMA 3RDTC 5L9DL 3MGAA 5INDB 2XN9E 1W0WB 1T7VA 1WQVT 4HF5H 1WEJH 4S2SA 3VG0L 3VRIA 4HS6A 4OFPA 4JREB 2OJEA 4C57C 1U8LB 4R90L 5DJ8B 2FGWL 3PABB 1T7YA 1FV1B 5DMJB 1J8HD 4P4RB 2IAND 4BZ2H 4AK1A 2J5LC 4L4TD 3VD4A 1XT5A 3C5ZA 4X9FA 2ITDA 2R4SH 1CDUA 1SYSB 5JW4M 4OIBA 3MA7B 5DRXA 4DZ8B 2VDPL 4G8EA 5FHAH 1U8JA 1H0DA 4KTEH 2IBZY 3P30H 5DHXB 1UZ8A 4Y4FD 3WE6A 5TPWL 3KLAA 1FIGH 2R9HD 3PWNA 1T0NB 2ED7A 3RNQB 3B9VA 2B0SL 2OK0L 4PJ7B 1IGJA 2NY4D 3S96B 4EVNB 5JW4N 4RRPG 3ISWA 1F13A 4FS0A 3VXOA 1RZJC 5I1DB 1FYHB 1XGUA 2J6EA 3RAJL 3E1F1 4HEME 4MCYB 1YMHA 4QO1A 1KB5L 3H9SD 5C1MB 1M05A 1KCUH 3L3DB 3OJ2C 1GAFH 3BQUC 2W91A 3RQ3A 1MI5D 2MQCA 2BC4B 3FRPG 1P6AB 1WFOA 3X3GL 1TVDA 2VLRE 3CC5B 3RJQB 3VGAC 2I9LB 2D7QA 1MNUH 3OKNA 4JZOB 2XFXB 2MPAH 3HNVH 1MCPH 1XGYL 5F44A 5EOQH 1TZIB 2X5PA 2E27L 5C7XH 2M1KA 3QHZH 4X8XA 4A6YA 2EDLA 4WGWB 8CGTA 4OF5A 1HSBA 2XKNA 2CLRA 2HJLB 1RK1B 5I1KL 5IB3A 3TPUB 4LSPL 5C0EB 3K4AA 1DBAL 1IGCH 5DRZB 5L2JA 3O2DL 5CHNB 2YPKB 4IRSB 4JO2H 5IF0A 3HR5B 5IMOA 4KGJA 3QCVL 3BGMA 5DJCB 5KN5B 1FCCA 4U1SB 4LVOB 4Z7UF 4MVBC 2DQDH 3A67H 1ZMYA 3NZ8B 5CD3B 1PLGL 3L3GB 4GKNA 5B3JE 3O4LA 3RVTD 3RDTD 2JB6A 3DRTB 3ZLQC 2J6EH 1RIUL 2BSRA 4QRRA 4L29A 1CK0L 4Y4KC 4NQCE 5I0DA 2W9EH 4RGMC 1ZANH 4DOHB 4YUEL 2Z8VC 5IEHB 2CGRL 5IQ9B 3ULUE 5JDJA 4RAVB 4U1LA 1UH2A 2W65B 3D1MC 1LE5B 4NJAH 4ZTPH 4PJ9C 3HAEA 4Z7VA 1HHIB 1LDPL 4G9DB 5GRJL 4XTRD 4D3CL 4I0PC 4KMTH 3EOYG 4PTTA 3TA3B 3JWDC 5DD6B 1E4KA 4A6YH 4RFEB 1QSFE 1EXUA 3PP4L 5DMKB 4DAGH 4QHUB 4NO5B 3CU7A 4GRWE 4PJIA 4U1JA 3IS0X 4XPGL 3HI6H 1TQBC 1YEKL 4FQXB 1FE8L 3SE3A 4QRUB 2JE8A 3WFCL 3IKKA 5A16B 3HFML 2DLTA 1K4DA 5D70L 3QSKB 1PX4A 2RCSL 3QDGD 1MFCH 5DZOA 3DUSB 3MGOB 3AS1A 3BQUD 1LO2L 3AU1A 3GJFK 1LGVA 4Z7OF 5DRNB 4XNUL 4LFHG 4U3XA 4LLWB 4GMSL 5CP7B 4IOFC 3GNMH 1YDPB 3F62A 4PGJA 4HS3B 5L7XL 2RIKA 4P57B 1K8DB 5BV7C 2ZCKH 2NY2B 5I8CB 4DKDC 3QRGL 5B3NA 2PTTA 2FJGB 3GKZA 4AG4L 2DICA 4WCYL 3GBNL 3QXAA 3HNSL 4MWFB 2YWZA 5IM7B 3RVXC 3QI9A 3Q6FA 3MV7B 3LRGA 3UTSD 4KRLB 1BM3H 3MRNB 1AGBB 4E0RA 3K7UA 1U8IA 3FO9A 4X4ZA 4P5KA 3NTCH 3EYUH 3HAEH 2EDQA 4LNRB 2X70B 3NMEA 3T77A 5HVWA 4LMQI 2BMKA 1KIUA 3HZYA 4ODSH 1MWAB 3A6BH 2FX8H 1R5VA 4UUJA 5ACZB 3OPZH 2Q7YB 3U0WL 1DCLA 4HGMA 3KPTA 3EJJX 4YK4B 2QADC 3HE6A 4ZUWB 3SDXF 3N50A 5DJ6B 2P46B 3RY5A 2B39A 1WGOA 2GJJA 3DECA 3JVGC 4Y4KD 5MHSD 3SDYH 3LPWA 2C7UB 1LQSR 5I1GL 1NCWH 5DT1L 1MUJB 1U91B 3F12B 2DM2A 1J8HB 1YYLH 4JB9H 2IANB 3LQZB 3QIWB 4L4TB 3QFJD 3EYVB 2RAMA 3IKCA 4M7ZB 2OTUA 2FWOA 4PJ9D 1GHFL 2HT3C 5E00A 4O51B 5C08E 1F4XL 2GK0A 5ESQB 3HC4L 3DGGB 2DLIA 4I0PD 4QXGH 3BP4B 1CWVA 3MXWH 2W92A 4LSTL 3JV0A 3P4MB 1ZLVH 1U92B 2PR4H 2LFGA 5T1MB 3SDXB 3P0YL 2YWYA 3UPRB 4HFUL 4JHZA 2NY4B 1IGTB 4OLUH 5TDPB 1I3RB 3UXFA 1C5CL 4IMLA 4YHOH 1C12A 4K3JL 5BMFH 3CXHJ 4FABL 1GOGA 2UYLA 3CFJB 4QRPD 5I6XB 4HUWA 1KB9J 1ZHBB 4CMMA 3ARBC 5CMAB 2YD1A 3L7FB 4ODVH 1D5IH 2VLRA 4DW2L 1X5AA 3QAZB 1X5LA 4U6HB 4E42B 4PR5B 3JV4A 4OZGB 3H9SB 4BSWB 1TPXB 3WJLC 3OJMB 4B7LA 4HUUB 1NBZA 5B39A 4IOFD 2X41A 4WY7L 5ITFA 3TN0C 1YQVH 1T04B 2X2YA 5JNYA 4G5ZH 4FNLH 3L5WB 3STZB 4Z7UE 1KPUB 3M1BB 1Q9KB 3QJFB 5J6HA 3TBWA 3V5DA 3H6JA 1CS6A 1PKQB 4X7TA 4PREA 1QRNE 4HULB 2CO6B 5DUBB 4MNHB 2C26A 3WJJA 1KT2B 2R4RH 4CGTA 2NY5L 2AV7A 1AGEA 4HKBB 2VUOA 1UADC 1IARB 3RVVC 4FG6C 2VKWA 1K5NB 3HUJF 3S34H 2MKLC 3GIVB 3DX8A 4NQCA 4NN7C 4AJ0A 2QADD 4P4KA 4U33A 4YQXH 5E6ID 3VWKA 2A6KB 2AAVA 1F3RB 1Q0YL 3MCKB 4LCWD 3RDTB 1GPOH 2PO6B 1IQWH 1JNHB 1H3WM 1UJTA 4F7PB 1BIIB 5F97E 1D9KC 2OXHA 1A47A 4ZPTA 1EO8H 5IVXA 2ZZUT 2D0GA 5LWYH 4RQQA 2XQBL 4WU7A 3AMLA 2HJFA 3VA2C 2CKBL 4YHPA 5D7SL 5C0CB 1VFAB 3VXSE 1HILB 2DDQL 3MPCA 3UCRA 3IFPA 2OL3L 3MOAH 1QSFA 5EO9B 5DC9B 2FLBT 2AK4D 3VFSA 1K2DA 1S3KH 5D1XA 4GMTL 4WI4A 5I19H 3HPLB 3UTOA 4NSKA 5IMMA 1KEGH 5INDA 1W0WA 5H94B 3MRLB 2Q1EA 4MQXC 3RGVB 3PDGA 2VQ1B 3GSNB 4WHYG 1U8LA 3CXDL 2V2XB 1T6WA 2BSTB 2YOCA 1T20B 3VXRD 3PABA 1AE6H 1CGSL 2ITCB 2R2EA 3O4OC 1FV1A 4P4RA 1KCSL 2X1WL 3UTQA 1XR8B 2OI9B 4LQFL 3TH2T 5KVEL 2NX5E 1T7XA 1SYSA 1MIML 3ARBD 1IAMA 1MCWW 4N90D 2AJYH 3SKMB 2J8HA 1WBXA 4XMPL 2EEAA 4D2NA 3HI5L 3QDGB 1K6QH 3JV6B 1B0RB 3KYOB 4DJMA 5JOFB 2K7QA 3WIIH 4MXVF 1LP9E 2BHUA 4X7SL 4PB0H 3RNQA 5C70A 2ADJB 3S35L 3TN0D 5TE4L 3ULSB 3X14B 3VGAB 5D2LF 3S96A 3UJTH 4KJQC 2EC9U 1J1OH 5I1DA 3UJIH 2VO5A 4N0UE 1T7WA 4GH7B 1C7TA 2OTPA 4MCYA 3F7QA 4KQ3L 3HG1D 2DTMH 3F6LA 1VADB 4V1DD 1ZAGA 4O4YH 1CLOL 3L3DA 5E1HB 1CXIA 1FG2B 4NNPH 2ZNWA 2BERA 2X4QB 2WUCH 3M17B 2EIZB 3RVVD 5CEZE 4FG6D 5TGBB 5MP6L 2AXJA 4YIQB 3T0BA 3CC5A 3DX9A 1N0XH 2I9LA 4JZOA 2XFXA 1CL7L 1TZIA 1A64A 3VW3H 3O41A 4HJ0C 3ZYZA 3FRUA 3OBAA 2DL2A 5D2LB 1MCDA 2N4IA 4D9QD 2BNQB 1MI5E 1NLDH 3MRBA 1YECH 1U3ZA 2B4CH 1RK1A 3TPUA 5C0EA 4KQ4L 5DRZA 5AYUL 4Y4KB 1MCHA 1QNZH 2E3VA 3HZKB 4NT6B 5HHVL 2YPKA 4HT1H 1KJ3L 4XCCL 3X12A 1KIQA 5DJCA 5FUZH 4OSUL 5KN5A 3U7YH 4B41A 5ALCL 1OF2B 1OAQL 4U1SA 5CCKH 3TIEA 4PJ9B 1NMAL 3NZ8A 5CD3A 3V7AE 3L3GA 4IHOB 2UVFA 4JFDD 1I9IL 3K8KA 5E99H 1NLBH 3SGKC 1RUPL 1D5BA 1N5YL 1FVEB 4I0PB 12E8L 4MQXD 3ROOB 1FL6A 3CDFA 1F8TL 2ESVB 4J3WA 4CVXB 3KPLA 2Y5TB 1HH6A 1JYNA 3O6KH 4ORGB 2XZQL 3GHBH 3KYKH 3GSOB 3LCYA 5IEHA 3ZDXF 4X5XB 1V7ML 1TQBB 5HVGB 1LE5A 2EDHA 3WO4C 3S97C 1AXIB 4P3WA 4ZAKA 1HHIA 1JJUA 3WFBH 1J0YA 4G9DA 5FYJH 3VD7A 2FIRT 4XAKE 5IBUG 4Z7UA 1RIHH 3TA3A 2E7BA 5DD6A 5A3ID 2D7PA 4RFNC 4QKXB 3IDXH 1A1OB 5DMKA 4ORZC 1FAIL 1BX2A 4Y2DA 2UZIL 3HUJE 1TQCC 4H8WC 5BV7B 2JB5H 4KJQD 2AJXL 1MJUH 1NGQL 2DQEH 3PWUB 4LNVA 4QRUA 2FZ3B 3W9EB 3FN0H 1JHLL 1GVIA 2P45B 4I2XE 4TTGA 4YDJA 5E2JA 1Z0MA 4GSDL 2C9AA 4K71B 2Q20A 3NCCB 3TT1H 1HQ4B 1M6OB 3B8SA 1RFDH 1BJ1J 1HZHH 1GGIL 2Z8SA 3VU2A 5DRNA 2BVQB 5I1IL 4PJBF 2VLMD 2DWEB 4U1GC 2AI0L 4KK9C 4P57A 1K8DA 3SGDH 1EJ6A 2R39A 1ZVYA 3ALWA 1P84J 2EYRB 3SHSA 2XI9A 3JWOC 4HJ0D 4MNGE 2FJGA 3JTTB 4MWFA 4O2CB 5IM7A 3CX2A 3MJ7B 5FO7B 2QADB 4QHKI 3MV7A 5HHQA 5E6IB 1LO3L 4JVUA 5GRVL 4LCWB 3MRNA 1AGBA 3FB5A 3P3YA 3O11B 3PHQB 4KUZH 3KXFD 4HG4J 3CNKA 1QFWL 3NN8A 4D0BB 2KKQA 2NY6C 2ED8A 4X0KB 4NJ9H 4EDWH 4FXGB 4RZCB 2YZ8A 5HDBE 2CRIA 4TQEH 3UTSE 3TZVC 1CGXA 2Q7YA 1FGVH 3IFLL 2AK4B 4K3DL 5KTEL 3REVB 4HAGA 4WTZA 2HKHL 1CLZH 1MRFL 4PBWD 4ZUWA 3KPQB 1K8IA 3H42L 4KRMB 3FT2B 1V7NL 2NX5A 4M1DH 4ZNEE 3B5GA 5CWSB 3QIBD 1JV5A 2C7UA 1T5XB 3VXRB 5MEOB 2OP4L 3TH4T 1U91A 1J8HA 1IAIM 2IANA 3LQZA 4NHCH 3E8UL 4G8GB 3EYVA 4L4TA 3HAEG 5BRZD 2LU3A 2G75B 4O51A 3C09C 5JXAL 3ARBB 4XNQB 4RDQF 1TETH 4IM8A 3EJZC 2QQNL 1CXHA 1RZGB 4I4WB 4ZXBB 4Y4FA 3L3HB 3BVNB 3QFJE 4N0UA 3B9KC 1CYGA 1E4WH 2X44D 3VFOB 5IP4A 3WN5A 1U92A 5EUKB 1CF8H 3B2UC 3SDXA 3IXTB 3UPRA 3TN0B 1MFAL 5I1JL 2R2HA 4K7PY 4EUPA 1IGTA 4JFZH 5TDPA 4OCNC 1GL4B 1NSNL 4LDOB 4LHQB 2X05A 2XZAL 3V7MA 5JA8B 5D72H 5DD0H 1PG7L 2V17L 3CFJA 4FZ8H 3PXHA 4JFHD 1MWAH 2BJMH 4HPYH 1WFNA 4PV8A 3QHFL 5CMAA 4KKCC 3SEPA 4E42A 4U6HA 4PR5A 2ADFH 3HG1B 1C5BH 3H9SA 4O5LL 5AUMB 3T0XA 3LHPL 2AEQH 4JGUA 1BQUA 2IAMC 4H88L 5GGTA 5D8JL 4WHDA 2GJZB 5EFIB 1QVOB 1HHJB 4XBEL 4HUUA 3HCVB 4QRPE 1S7RB 2FJFB 5DJZB 4KXZI 5A2LH 4XNXH 3WFDL 2FEEI 4F8TA 1NGZB 3NPSB 1MI5A 4KK9D 3MREA 1LEGB 1ROWA 2E7LA 4KY1L 3IJSB 1T04A 4OCWL 5BQ7B 3UO1H 1X4XA 4HHAB 3OKDB 3L5WA 4JO4L 5DHVB 3STZA 1CT8A 3W2DL 2V2TB 1ZA3B 2OSLA 1I85A 1Q9KA 4OM1L 1PKQA 5A2KH 3H7BB 2A73B 4MNHA 1QQDB 5DUBA 5EU7C 3S3PA 3BT2L 1X5KA 3EYFB 1JRHI 5I1CL 4D0CA 1ZLSL 5C0DB 2J88L 1L6ZA 3KJ4B 5GS0D 4HKBA 3DROB 2P49B 3AY4C 5GRUL 4QRTB 4UIKH 2VDNL 1C7SA 3ZDXE 4GXVL 2HT2C 4NO0B 1RQ5A 5LGJB 1C16B 5GXBB 1VB9A 1A9BA 1RHHA 4C56E 4BSJA 2F5AL 2I07B 4RFOH 3MRRB 3TJEH 4OTXL 4EUPH 4DUVA 2JELH 1QFWM 3D2UD 4JFDB 4AMKL 3MCKA 3RDTA 3KS0J 1JNHA 1Q0XH 4AZ8A 4F7PA 1BIIA 2DQFA 4ZSOB 2ZUQC 1I9RH 2O5ZH 3DVIA 4OLXL 4P9HC 1VGEL 4Q58C 1ZKAA 2X4UB 3KVQA 1VFAA 2HKFH 1HILA 1DVFC 5MERB 5GGTH 2H8PB 1MY5A 2YS4A 4LCWE 4BSVA 3D39E 3D85D 1AGDB 4BUHA 2AJZB 2FBOJ 1UYWH 4GAYB 4PTUB 2K9UA 3BYTA 1D6EB 3EJZD 3HUJA 4BFBD 4UV7H 1UXWB 4KZEH 2CRMA 3HPLA 1FGNL 2BFVH 3MJ9L 3QUYC 5H94A 4PS4H 2O5XL 4CAGA 3B9KD 2CH8A 2X1XR 3GSNA 3DYOA 3MRCB 2V2XA 2BSTA 3LKPB 4GRLC 1GGCL 3B2UD 4PJBE 4NZUL 3LZFH 2ITCA 3DO7B 1HIML 2FIKB 3OR7B 3MZGB 4NHUB 2FATH 4OFDA 3WS6C 3BI9X 1UWGL 3MBXL 5DJ2B 1XR8A 4E5XB 3HRPA 3KPNA 3RWHA 1CIDA 4JKKA 1JIBA 4AEFA 2BOBA 4YHZH 4ALAL 5ANMB 2DN7A 3RUGE 2B20A 4UT6L 4LPUA 5EU5B 3JV6A 4HUXB 1B0RA 1JWMB 5TQ2L 3BQUA 5DC4B 1ZGLB 5F89B 5C09E 5AD0A 5IBTL 4M5ZH 1UM6H 4LAQL 2ADJA 3FQNA 4I5BA 1J12A 3X14A 2YMXL 5IFJB 4KXZH 2A74B 4Y2OA 3OAZH 2WLYA 1NFIA 5EBGA 3PJSB 5EBMB 5EORH 2DIJA 1KJ2L 4JPWL 2XWBB 1NUFA 4HLJA 3UTSA 1VADA 4XX1G 2FGZA 1M7IB 2VITB 1FG2A 3QCUL 2E9JA 1J05B 4FMFA 5TDOB 1IC5H 3M17A 3TEUA 2IGFH 1G6VK 4R4NC 5TGBA 5BZWB 4Q97A 3U1SH 1R3KB 1PJ9A 2K3TA 3GSNH 1RPQA 3QPXH 3C60C 4V1DE 4ZNEA 1HQRB 2NXYD 4I18B 4XHJC 4FQ2H 4PRID 2DBJA 3GJFB 5D2LA 15C8L 1OW0C 1CDBA 5KJRH 3EO0A 1DN2A 1RZJH 3BDYL 2VE6B 2XV6B 4YH6A 1A7NH 3U9UB 3LKNB 3KAAA 1X5FA 4RGNC 1YNLH 4UDTB 3QIBB 4Y4KA 4OQTL 4NT6A 3HZKA 1UT9A 2Q6WB 5DLML 5LBSH 1DVFD 3PGCB 4S1SH 4G6ML 1EHNA 2VDOH 1MFEH 3QFJA 3Q5TA 2A77H 2APWA 5BRZB 3FB8B 4PJ9A 1OSPH 4ZS7L 4IHOA 2D31B 5D7KD 4LRIA 1FVEA 2BHZA 4I0PA 3KYNB 3QUYD 3ROOA 4KUCD 4GAGL 4IRJC 3OJDA 2P42B 1J88A 3JTSA 2NLJA 4CVXA 4QT5A 3TO4C 4GRLD 4LDEB 2Y5TA 3V4UL 4GQ9H 4M7KL 4ORGA 5F7FA 3G6DL 5HVHB 3WIFA 1ZLWH 4Q9RH 4WEBL 4KVCL 4XI5C 3MRFB 3RKPA 4QRPA 4HH9B 1OGAD 3ORJA 5C0NC 3KPRD 4M61A 1QBML 4QHMB 4MAUL 4L8DB 2CDFB 4QXUL 4HV8B 4ONGH 3BZEB 2Z31C 4PJEF 3QWRD 6FABH 5EZLA 1FC2D 2EYSB 5EPMB 3FQUB 5HYEA 5FM4A 1FZKA 5ADOH 1U6AH 1AR1C 3OKEB 1C1EH 1A1OA 3D3VD 4MHHI 4U1GB 1YA5A 5EIQA 3SO3C 3PWUA 3L3IB 1CE6B 2R23A 1WWBX 5IVNA 4G80A 3AS0A 5IMKB 4KRPC 1DQDH 3P77A 4JG1H 5CBEB 3U46A 1IAKB 2ICWB 7CGTA 5HD8C 1HQ4A 2VZ1A 3KR3L 2FNBA 3GI8L 4TYUA 5DI8B 5DVKA 1U8NA 4R4ND 2XZCL 3OG4B 2BVQA 5J7CC 2DWEA 1SMOA 1I7ZB 2B8OT 3HB3C 4PP1D 1UB6B 4PJEB 5I2IA 4NWUH 4K7PH 4IMKA 4M7JL 4ODWB 2NY7L 3BO8B 2EYRA 3C60D 3KLDA 2VR4A 5KSUA 3BH8B 4YHML 2MSPA 1CQYA 3BE1H 4XHJD 3JTTA 1NCAH 1TITA 2YD5A 3D2UB 1X5ZA 5E6IA 4S10A 2BVYA 4LCWA 4ZFGH 4HMDA 3VXTB 4FN0A 3BGFC 1NJ9A 3JVGA 3O11A 3PHQA 4RGND 4GFTB 4ZTOH 2DQTH 2F8OA 2KZWA 2R2CA 3IDYC 5E24E 3OZ9H 2CPCA 4X0KA 3MV11 3MLYL 2EEBA 4FXGA 2P8PB 5E70A 2VR5A 1QFHA 3GO1H 4MJ5A 4RSVA 3D85B 3HMXL 4OKDA 4XVTL 3BKJH 4LCCC 3UJJL 1FN4B 2AK4A 3CGTA 4PJBA 3C09B 5M94B 4Q9QH 3KXFE 5BV7H 4OD1H 4Y5YC 5EG6C 1N0LA 2P47B 3KPQA 1OP3H 3PWPB 4IRJD 5D7JC 2F5BH 4PD4K 4QRQB 3FT2A 1DLFH 3SGEI 3TO4D 5CWSA 4J2XA 3MRGB 3FTGA 1EO7A 1T5XA 3PV7A 2BVTA 3VXRA 3H3PH 1PDKA 4HJGB 5KANI 3MRJB 1QSZA 3GUTB 4HXBL 4G6KL 1QHOA 2G75A 5JW5B 1OPGH 1RI8A 3MLZH 3ARBA 5DZLA 4RWHA 4XNQA 3DXAE 1NMBH 1YJDC 2E6QA 4FFYL 3WJLA 5D96C 4I4WA 4PRNB 3L3HA 1TTUA 1AR1D 3BVNA 1A6VH 5BRZE 5IMLB 4F7CB 3FO2B 3IXTA 3BAEL 3TN0A 2Y36H 4AH2A 4J4PC 4L8CB 5SWSD 4W6YB 2VXQL 4Y19D 2YPVL 4ODXB 4ZO6A 2YHGA 4PP2B 2H32B 5HD8D 3HG1A 4NQUA 4NM4L 5AUMA 4V1DA 1PKOA 3RIAK 4R0LB 2GJZA 1S78C 1HHJA 3G6JB 3HCVA 2FJFA 5DJZA 4ZS6C 3HB3D 1UM5H 1NGZA 2I25N 3UDWA 1A3RL 1LEGA 3IJSA 2P4AB 5TQ0L 5BQ7A 4CVUA 1T4KB 3OKDA 4HXAH 4RISL 2VWEC 3TNMB 2V2TA 1YEEH 4KUCF 5DD1H 3ESVF 2NXYB 4P2CG 1T1ZA 4PRIB 3H7BA 3HMWL 3ZTNH 4R97B 2H3NB 2DJSA 3NCFB 3O3EB 4JDTL 2ZUQB 2ATPB 5FYKE 3B3IB 5I8EB 5C0DA 4LSRH 2R8SL 2GTZB 1SEQL 3DROA 2P5WD 5F1OB 3O9WC 1NPUA 5I18H 4GS7B 4DGIH 2GUOB 3IRZA 1FH5H 3OSKA 4U6VL 5LGJA 1MHEB 4B0MM 1OARL 4NO3B 3OMZA 4DZBA 3KJ6H 2I07A 4OZIF 1T83A 2D9QB 1JF1A 2G60H 4LEOA 4XPFH 3BP7A 4JFDA 4XMLL 1FFRA 3KDMB 4ZMAT 5D7JD 3F7VB 1JF6A 1JCKA 3QUYB 3BKML 4K23H 3UYRL 5CLTA 2NZIA 4ZSOA 3MUJA 1DQLH 3RWGB 4JR9L 2EDDA 3SGEH 2X4UA 1S9KC 5E5MB 5GSRB 5MERA 2H8PA 1KEMH 1LMKA 4EI6B 1TJGH 1AGDA 2YSSB 3WHE0 3NFSH 1MCEA 5J11C 3TCXA 1OP5K 4GAYA 1BZ9B 5KVFH 3MROA 1UXWA 5DHVH 2EICA 4PJFF 5CZVL 3QWOA 5IK3B 1DBBH 3BEWB 3MLTB 4OZIB 4WWKB 3RWCB 3MRQA 4EUPG 3LKPA 4G3YL 3IDIA 3D3VB 1A6ZB 3R1GL 3IFNH 3DO7A 3VGEA 1MH5B 3IRPX 2FIKA 3OR7A 4NHUA 2GCYB 4J4PD 1YEGL 2HVJA 5DJ2A 4CJ0A 4E5XA 1MFBL 2VH5H 25C8H 2V9QA 1U36A 4JE4B 1BAFH 5FGSA 1CIUA 1QBLH 5ANMA 1XF5B 2QQLL 4F58L 3OX8B 2P8LA 5EZOH 2VERN 4XCYB 5EU5A 1A6AA 1MCNA 3FN3A 4HUXA 5JHDB 1S78D 2YK1H 3L1OH 3OAYH 3QQ9C 1AGFB 5F89A 2OM5A 4ZS6D 1DZBA 4WUKH 5SX5K 1RUKH 3WEXA 3INUH 3WD5L 1KFAL 5IFJA 3G08A 3C6LC 2E9WA 3C60B 3MX0A 1P6FA 3PJSA 5EBMA 2CUMA 5F9WC 1QTYT 1MQKH 3O45B 2EXWC 5J13C 4L5FL 3LS5H 1M7IA 2AV1B 1W72L 3DV4A 3WSQL 3SKJL 1J05A 1QSVA 5EC1A 5TDOA 3KXFA 3RBGA 4QTHB 1IC4L 3QUZC 5FK9B 5IJKA 4RX4D 3O9WD 1DQQA 2Y7QB 3BFOA 1U3JA 5F6IC 1W8OA 1OAXH 1Q72H 3VDAA 5JXEC 2X10A 5EU7E 4NZRH 2JLLA 2A0LC 1HQRA 1XF1A 2VDLL 2ZUXA 3L3JB 1I8KB 3LKQA 1DBJH 4UZGA 4OLYH 5E9DE 1FNSH 5BW7C 3SGKA 1QOKA 4DKEH 4IRJB 4OZ4B 2H6PB 3U9UA 3LKNA 3S36H 4WFHD 4JQVC 1J10A 3QIBA 4UDTA 4CRPA 4OIIH 4YFLI 5E2WH 2Q6WA 1XCTB 4JY4B 3VXMD 4OFVA 4X7FC 3PGCA 4P5TC 3ULVD 1CBVH 4Q6IC 4M1GL 1IBGL 1UKSA 5BRZA 3FB8A 5TJWK 1BWWA 3MNZB 3QUMB 4S1QH 3N1MC 3Q3GA 5H35A 2D31A 2ATKB 1IM9D 4PY7A 1IGYB 1L4IA 2OYPA 3KYNA 4POZC 4Q9BA 2ICWI 1H8NA 4MD0B 5E2UL 1EGJL 4JJ5B 1B2WL 4TOYL 4OGYL 5LAXA 5HI5C 4UOW0 4R4FL 4KJPC 2I5YL 4UNUA 2QL1A 1G7LB 2A1WL 3SO3B 4R6UA 2KH2B 1K85A 4RMTA 4Y19B 5K59F 2B1HH 3B8YA 2NY1D 4LP5A 4HH9A 4J8RB 4L8DA 2CDFA 2VN7A 4HV8A 4JRYB 3MRHA 5HYIA 3BZEA 5DUPL 4MNQD 1NAKH 1S7XB 2NPLX 3OB0K 2EYSA 4W81A 3FQUA 3QQ9D 4BQ8A 2CRZA 1T22B 3OKEA 1KLUA 3QDJD 1CXEA 1OGAE 2YPLD 4GW4B 3KPRE 2C1PA 2V7HB 3C6LD 3LRSB 4X6CE 3EIFA 5I1EL 3EFFA 3SKNB 1BFVH 1A2YB 1QLFB 2WNGA 3L3IA 1CE6A 4TNVK 1M1SA 2HT4C 3UYOD 2EXWD 5CBEA 2EKJA 1IAKA 3BGFB 1ERNA 3P4OA 5DI8A 1JFQH 3NA9L 3QUZD 2ORBL 1JGLL 5F96H 2P5WB 1I7ZA 1UB6A 4PJEA 2QJDA 4ODWA 5JXED 2BVEA 4J7RA 3BO8A 1G7HB 4X6DF 3AXLB 2W0FB 3BH8A 3KPSD 2GQHA 4BFIA 1JGVH 5D2NC 1N8ZB 2OJZH 3GBML 3T2NH 4D8PB 1ND0A 4H8WH 3RFZC 4OUUB 4JN1H 3V52H 5DRWB 1KJVA 3D2UA 1S7SA 5F88B 4MD5B 4PJFE 1IMHC 1PX3A 2J2ZA 3EYSL 4TPRL 3VXTA 5D7JB 5EZIL 4JZJC 5FCUH 2ZP0T 3DGCR 1FHGA 4GG6E 2A83B 5JPMB 1EJOH 1JUFB 1NCCL 1L0QA 4Y8AA 4PJ5E 3EOTH 1JGUH 2KQNA 4P5TD 4D9RD 4J3UA 5J12C 1S7TB 4YXHL 4HH8A 4JZNA 2R0LH 3D85A 1YNKH 2ED9A 4MA1B 1ONQB 5CEXB 4RGNE 4JFED 4PY8J 2AEPH 2R0ZH 5I9QC 4NN5C 1MCQA 4X6DB 2EH7H 2VDML 3V6FA 1HINL 4POZD 3LDBB 1EBPA 3JWOH 3SY0A 2AJUL 5I16A 3IJYA 1GOHA 3RA7L 1YEIH 3FN9A 4G8IB 4QRQA 4LDLB 3GSUB 4JHWL 3B9KA 4YXLH 3U6RB 1OM3L 4LCUB 3MRGA 2A6JA 4CMHC 4LL9A 3BWUC 2FO4A 3ABZA 5HI5D 3KLHC 4KJPD 4PGBB 4HJGA 4CW1A 3N0PB 3FB7B 3MRJA 3GUTA 2N7BA 1S9XA 1CVSC 5HHOD 5GS0H 5JW5A 2FECL 5HGHB 1GJIA 5I66B 4TTDC 4LLDB 5GISH 2VNCA 1RMFH 1UACL 3AM8C 3T65B 4RCAA 2YXMA 2Q8BL 3P4LA 3IXAA 1M7DA 1Q9OB 1ORQA 4QNPF 5IMLA 4F7CA 4G9FE 5D7IF 4L8CA 2PCPB 5DD3L 5DS8B 2P8MB 1FNLA 2YD7A 4JPIB 4KMLB 3T3MF 2Z93B 5DEFB 3RX7A 1IC7H 2AJVL 2HT4D 4ODXA 3BPOC 2H32A 1JTTA 4K9EL 4G7YL 1Z9OA 1UH4A 3V2AR 3MLRH 3L95A 5EO0A 1HHGB 5FB8A 4R0LA 5SWSE 1NAML 2PXYC 3ULVF 2L7JA 5E9DA 1PSKH 5E2VL 4K2UH 3MLVL 2VLLB 3AY4A 3NCEB 4I77L 5KOVC 1F97A 1YC7A 2A9NH 3U9PL 3AROA 1T4KA 1J1PH 3SKUD 1EVUA 3SGJC 3BN9C 1LK2B 5D6DC 5AZEH 4ZD3L 1PVHA 1SM3H 1JI1A 2WANA 1KGCD 5GHWH 3CVHL 4PRIA 3NZHH 4AENB 1INEH 4MHHG 1X6NA 3K2UL 3TCLA 4NUGL 5CGMA 2D7OA 4FQJL 2E9IA 2WAHA 5DR5L 3O3EA 3PE9A 3B3IA 1Q94B 4M93C 2GTZA 4OGAC 1K9TA 2DQUL 2FH6A 4AM0B 2NY5C 1DVFA 2C3VA 1AD9B 2GUOA 5BS0E 5IVZB 1MRCH 4OLWH 2ZJSL 5K59E 1XF4A 1MHEA 4NO3A 1H3PL 3ZE2E 1FZJB 1P4BH 2VZTA 1F4YH 4N8CH 5F7EH 1IM9B 2YD6A 1RZ7L 3KDMA 5EB9A 3TFKC 4HUNB 3QUYA 1HCVA 3EDJA 4BQBA 3IETB 1CGUA 5ECJE 2H32H 2ZKHH 3RWGA 4GRLA 1OTUD 3IU3B 2GJ6E 1E6OH 4JRXD 3LN9A 3RHWK 5E5MA 5GSRA 3FFCE 4RMVA 5JLZB 2ZOLA 4EI6A 2YSSA 4ODUB 4HDIB 1BZ9A 2NY1B 4TTDD 1OGAA 3KPRA 1OL0A 2X40A 3MCLL 4XBGB 5DUML 1FIEA 1G1CA 2C3HA 4EI5C 2R0WL 3HRZA 4TNWK 4ZOAA 2XA8H 3QWRA 4MLIA 4MNQB 1LO4L 4NQTA 3RVWC 2D7MA 3BKYH 3EO1B 4Z8FH 4OZIA 4FQHA 3RWCA 1U2HA 3I50H 3D3VA 3LEXB 1A6ZA 4Z0XB 5C07E 2YPLB 3CSYA 2LABA 2ZSVA 4TVPE 2VAJA 5I8OH 1MH5A 5D71H 4X6DE 1H5BB 3UC0H 3G9AB 3K80A 1A5FH 4LCIH 5DMIL 2HRPH 4XP1H 5AZ2L 4M6OL 1S7WB 4PJHB 5F9WB 3LEYL 5JR1H 3FONB 4KZDH 4Q0XL 1KCVH 1HYRC 1MRDH 1XCQA 2HA1A 4MQTB 4XCNA 4XCYA 2WIIA 4RDQG 4Y5XB 3DX6B 2EDFA 1GIGL 4ONFL 2B1AL 3PWJB 3QXVA 4HWZB 3RL1B 3M45A 2APXA 1EHAA 1ZHLB 2BSED 4PJFA 5J89A 4NQXB 3C60A 3BN9D 3GK8L 5FYLD 5M95B 3SE8L 4Z6AT 1SQ2N 5F3BA 4OD3L 1CFNB 2BNRD 1OW0A 2CUHA 3IJHB 3O45A 3QO1A 1RZ8B 4OF8A 5HGGS 1MCOH 3R06B 1CE1L 4OF3A 3SOBL 2WBJC 4JY5L 2AV1A 4XPAL 2VWEE 3QIUD 4B50A 1B0WA 1OVZA 2PYFA 4X4ME 5K93A 1F02I 4OGAD 4QTHA 5K9OB 3V4PL 5BVPL 1H8OA 2Y7QA 5JW3H 2V5YA 1LO5B 3F7RA 4OI9A 3V0VB 4EQ3A 3BIBX 4HIHA 3L3JA 4LIQL 5HTSA 1ZHKB 2OS7A 1GGUA 1MCIA 2Q7NA 4JFEB 4PGCB 3TFKD 1M71B 1ZTXL 3LD8B 5IJVB 3FQTB 1BFOA 1S9WB 1D5MA 1F4WL 1FJ1B 4Z7WE 4IRJA 4BQ9A 5D1QC 1I3GH 4KAQL 4FQIL 3TO4A 1VCAA 5DD5L 1E27B 5DQJA 5LCVH 4OZFA 5F7DB 3V8OA 2XACC 5CJQH 1XCTA 4XGZB 5F9DC 4JFOA 5DYOB 3STLA 5D7IE 1JPTL 4X6BB 2X1QA 2ARJB 4OD2A 3T3ME 3KGRA 1KN2L 4PRDA 5HHOB 3DRQB 1K4CB 1BBJB 5EOCH 4KI5E 4WFHE 4LEXH 2ATKA 4O02H 1B90A 3RPIB 4TRPH 4EI5D 1A6TB 3PWLB 5EWIL 1AI1L 3VXME 3RVWD 3U2SB 3G5YA 3TM6A 1NGPH 3U4EB 1I7UA 4FQLL 1I4FB 1F2XK 2WINA 1AXSA 4FQ1L 1UM4L 3O2WH 5DJDB 2V7NA 1KJMA 4UU9B 4O58L 1L7TL 2ID5A 3X3FH 4P0DA 5BO1L 1G7LA 4IRZL 4LLMB 3O6FC 3D69B 4Q2ZB 3EYOB 5SWSA 4Y19A 4UTAL 4OV5B 2H2SC 2IADB 3GMPB 5DHYA 5KAQF 3VG9C 2OR7A 3GB7B 4J8RA 1NC4D 1RIVL 5T1DH 2J4WL 2WMPA 3ZL4L 4EBQL 1S7XA 4HF5L 5AWNH 1WEJL 5L6YL 2DLFH 5I74C 4A2LA 2XY2A 5GGSY 1R5IB 5CSBA 2IALB 4GW4A 1SBSL 5SX4H 1B4JH 1F58H 5F9JB 1EEYA 3UTZB 3SKNA 1I75A 5D2NB 4OZFH 5JZ7C 2R4SL 2AXFA 4UIMB 1R5WB 1T2JA 1UEMA 3MR9A 1NEZB 3QDJE 3FT4B 1HDMA 2WBJD 4KTEL 1MJ8L 5C0IB 5I76B 1KB9K 3P30L 4MJID 1FPTH 4PIRF 4JFYB 4HUVB 3CPLB 1FIGL 4WI2A 3LOWA 2W59A 4DKFH 1AIFB 2AK1H 2P5WA 1E4XI 2E7MA 4WNQA 4OIAA 2JF1A 3QQ4A 1N6UA 1TJIH 1N8ZA 4LCCA 4ZDHB 3P11H 2YKLH 5GS2D 1G7PB 5ISZD 1TZGH 4OUUA 4JANB 2HJKB 4MQ7B 2BVPA 5DRWA 1YYMH 1QLEL 4NN5B 5F88A 1CDGA 1AP2A 4YDIH 3QDME 3FFCA 4TN9A 1KCUL 5D7JA 3QNXB 3ARED 4S1RH 5D1QD 2AERT 4G6FD 1GAFL 2A83A 2X4TB 2YUVA 3KPSE 4YHYC 2GSGB 1MCBA 5JPMA 4EXKA 4U1HB 1JUFA 4X7CC 1LHZA 5CEYB 4JRXB 4NKOB 4R3SB 3DLQR 1MNUL 1S7TA 4ZODA 3MV8B 2BY2A 2MPAL 3HNVL 1MCPL 4NNYA 3Q5YA 1UB5B 5EOQL 1ONQA 3QHZL 2O61B 4IOIB 3ZT5A 2G2RB 43C9A 1MCWM 4X6DA 3EDKA 2XNAB 3GMOA 1H3TA 3ARQA 4D9RE 4XAWH 1KENL 4U0RB 3GIZH 1G84A 4KTDH 4L3CA 5DMGC 3HKFA 2P7TB 4JO2L 4NO2A 3VD3A 4GW5B 3DSFH 4MD4B 4PGBA 3O6FD 4J4PA 4MA8H 1YC8A 3JZ7A 4PJCF 3EZJB 1WF5A 1LO0H 2DQDL 3MBEC 3A67L 2V2WB 3BPOB 4LLDA 5ID0B 3VRLE 1G9NL 4OCLC 1YEHH 5GGQH 5E94B 4GBXB 1LEKB 4KRNA 2YA0A 1Q9OA 1QFOA 1J87A 1T1WB 1RZFH 2VL5A 1EERB 1J0JA 4MB3A 4QHKJ 4I3GA 5F21B 4OFKA 1X9QA 3CFDA 4HMCA 2PCPA 2QSTA 4JKPL 2P8MA 3MYZA 4GKOA 1YMME 3BOVA 4JPIA 2Z93A 5DEFA 3PG2A 4FXLA 2Q76B 4HIEA 2R1XA 4ELMF 4MQSB 1HHHB 1JHKH 2ZUYA 2BNRB 5T3ZD 5E1AB 4LHUD 3BKCH 1GSMA 3ZHKA 3J8F7 3T1WA 5MEPB 3K4ZA 4A6YL 3QIUB 1YJDH 4H20L 4DAGL 2VLLA 4U3HA 4RX4A 3O9WA 1MAML 4LSQH 4CJ1A 4Z7WA 1R3LB 3BEVB 1F6AB 3GZKA 4XCEA 5ILTH 3CMOH 1WC7B 5GS1C 1SY6L 3TWCH 2SEBB 1A9EB 5D7LE 4AENA 4J1UB 4QHNA 2HFGL 2VSDA 3JBG7 5D7IA 1BBDH 1MFCL 1SYVA 4S1DC 4NFBA 5D2NE 4FMKA 3CCHB 2BK8A 3QUXC 3H2WA 4HJJH 1KGCE 4JEGB 9CGTA 3L7EA 2BCKB 1J18A 3VXMA 1YEFL 3BZ4B 2ZCKL 5TH2B 3S98A 2CKBB 2FBJL 4KDVA 5C8JA 3BP6B 1S7QB 3W5NA 3P0VH 3PL6D 5TF0A 1IM9A 4N0YH 1BM3L 5JUEL 5HDQL 3ARRA 2CSPA 3CDGB 3C8KB 3IETA 1ZXQA 1HWHB 1F6FB 4G42B 1KXTB 1S8DB 4N8VA 1MHPH 3O0RH 4PJAF 5DMGD 3Q1SL 5TF1L 1AJ7L 4ODSL 3IU3A 4P23B 3A6BL 1FNEA 1ULVA 4PJ8D 2ZCLH 4ODUA 3MBED 4BUGA 1A7RH 5JIPA 2VN4A 4WO4B 5GGSA 4XBGA 3ZYIA 1NC4B 3MXVH 4MCZB 3MMEA 1T21B 3ES6B 3ARYA 4WJ5A 4MNQA 1EAPA 3BD5A 3EO1A 4J3XA 3EHBC 5CIPB 3VGGA 5GGUB 5C9KA 3LS4H 3QDJA 2AGJH 3L3KB 2YPLA 2JJSC 1KTLB 2R0KL 3C6LA 4DCQA 3SCMC 3B5HA 3WS3B 4PJAB 3OTTA 5FM5M 4P3DB 4HEPG 2OMNA 3FONA 4OFYD 2MQ0A 5J1TC 1U8HB 3ULVH 1QYGH 4QXGL 4MJIB 1T0MB 1MCFA 1A0QH 4Y5XA 5EBWB 4DQOH 1UGNA 1JZ6A 1FG9C 1KB5A 5E7FA 2Q3AA 1VKXB 1RZKL 3PWJA 4LVHC 4PJGF 1I9EA 3QUZA 4HWZA 3RL1A 4M7LL 5CBAB 1ZHLA 5FAAA 3QDMA 4NQXA 1A3QA 1KC5L 3LN5A 2I24N 4OLUL 5C6PB 4DTGH 5JXEA 4KJYB 4YHOL 5L9DH 4IJ3C 5BMFL 3KPSA 1JPSH 1CXLA 2XICA 3VG0H 5SWQB 5HYJD 3UAJC 5ISZB 1Q8MA 1D5IL 5BW7A 1RZ8A 2R15A 5F9AC 3R06A 1U8QB 1JWSB 1NGXB 5GJSL 4S1DD 3P40A 3K81A 1CGTA 2FJHB 3KHOA 3TBVB 3BXNB 2W1NA 3AREB 5B22A 3TJHC 5I75C 4JQVA 1QLRB 3QUXD 4MYWB 3ROLB 1Y6KR 5K9OA 4C58B 1U3HC 1J9CT 1YQVL 1LO5A 4APQB 4P5TA 3O2DA 2Y25A 4X5LA 3V0VA 4Q6IA 4OV6F 4PJCE 4LLUB 4M3JA 3VH8A 1N2RB 1UJ3B 4PJGB 1IKFH 1ZHKA 5TPWH 3S6CA 1IGFL 1P84K 5I8KL 5T1LB 1P1ZB 4JFEA 4PGCA 1AO7B 3UZQA 4QRSB 4XVUC 5IJVA 1S9WA 5HYSB 1FC1A 1E27A 4F15B 5FEBA 4PG2C 4XGZA 5DYOA 5GJTH 1HI6B 4HG4K 3O3AA 5FGCB 4PLKC 3S34L 1HK6A 3VG9B 1WJ3A 2VRAA 3DRQA 5HHOA 1K4CA 4ELME 1BBJA 3NIFF 1MCKA 1OAUL 4XNYH 4KDTC 1F00I 4YQXL 4HFWA 3RPIA 2EE9A 1A6TA 5GPRA 3PWLA 1ADQA 1GPOL 3MRKA 1IQWL 4QLRA 4V2CB 3U2SA 4XPHH 3EHBD 4J3OC 1A14H 1DQJA 1XGYH 1EO8L 5DJDA 5F1NA 3QEHB 4JFQA 4H0GA 5BOZG 1RUAL 2E5EA 5ACMA 3SCMD 1Q9LB 3VFRA 3MOAL 4Q2ZA 3EYOA 3OKKB 4YR6B 3RL2B 1KIPB 1ZT1A 2IADA 3GMPA 3PGFH 1GZQB 3GB7A 4LSPH 1DBAH 3O2DH 5I19L 2YD9A 3D25B 3L9RB 4JRWA 4LHUB 4K7FB 3JWNC 3IGAB 1X7QB 3VCLB 1KEGL 3QCVH 3MLWH 1SJHA 4OUOA 1ZSDB 1R5IA 1AE6L 3WLBB 1PLGH 4XWGH 3CSPA 2AXHA 3QNYB 3ECBB 4M8QB 5F9JA 3UTZA 5D2NA 3K8MA 4HWUA 4UIMA 3UAJD 1R5WA 1QEWA 3P9MB 4URTB 5DQ9B 2AJYL 4HC1A 1CK0H 4X9BA 1NEZA 3FT4A 3CLFL 2LTQC 5C0IA 2Y07H 1T1XB 2D7NA 4Y8DC 5I76A 1A22B 4JZJA 1K6QL 4YUEH 3GMMA 1F3DH 3TJHD 4HUVA 3WIIL 4U7MA 4PB0L 1U3HD 1NMCC 1ADQH 2ADIA 3ARPA 3RRQA 5GRJH 3DJ9A 1OD9A 3EOBB 3LQAC 5CZXC 2FHFA 5CS7A 3UJIL 5GZOC 1TXKA 1G7PA 2VDKH 5D6CA 4Z95H 5C0RH 5IWLC 3DTXB 2HJKA 4MQ7A 3PL6B 3BH9A 4L1DA 4XVUD 4P59L 2DTML 2HMIC 5GSVB 3SE9L 4R7DB 5F7YC 3IU4H 4O4YL 3QNXA 4L4VD 4OZFG 4XPGH 4GUPB 3W9DB 2GSGA 1FE8H 1KSRA 1MJJA 3NIDE 5EN2A 3S36X 5ISZE 5ITBH 4JRXA 4R3SA 1QR1A 2A6IA 5D70H 4PGEB 3OXRB 2RCSH 4PJ8B 3V0AC 1UB5A 3RHWF 3MBEB 3VW3L 1BP3B 1LO2H 3O3UN 2VISA 7FABH 4IOIA 2O61A 5JDSB 4XNUH 3AM8A 1YECL 4U1MB 2B4CL 2JJTA 2EZ0C 3PGDA 4HZLB 3WHXB 4HC1H 4PJGE 2RFXA 1RV6X 1W8NA 4WCYH 2P7TA 1ZT7B 5GGVL 2OTWB 2DJUA 4MD4A 5FUZL 3U7YL 1OTSC 1QFPA 5CCKL 2X7LB 4S0SD 2UV3A 5ID0A 4NKQB 5MENE 5E99L 3ZKNC 4CKVX 3MNVB 1T1YB 5T1KD 2CDEB 4RMWA 5IT2H 4MJ6B 5E94A 2NW3B 1BQHB 5MEQA 2FL5B 1S7UA 1T1WA 4NIKB 4ETQA 3O6KL 1XFPA 4HQQL 3KYKL 4N1CA 5C0AD 3OKLB 3JXAA 3VXUB 5H8DA 4BZ1H 3LN4B 5D6DA 3WXVL 1QBAA 1EHLH 5IBLC 1HHHA 4XPTH 1JPFB 2VLJD 3WFBL 2BNRA 4ZPVA 5FYJL 5E1AA 4P9MH 5DT1H 5DWUL 1P7QD 4POYA 4PJCA 5FDWB 2X4RB 3BMWA 5JO5B 5MEPA 2XN9D 4DUWA 4QF1A 1YPZF 1ZWIB 3QIUA 3QUXB 5GRWA 2NTSP 5CILH 3TBSB 5C86A 1F4XH 1V8HA 2JB5L 1MJUL 1R3LA 3BEVA 1BLNB 1F6AA 3HC4H 5CZXD 3TYFB 2OBGA 5GZOD 1NDMB 3ULUC 3TBTB 1BFTA 1X5JA 1G7IB 2OJEB 3P0YH 4HFUH 1N6QL 1YN6B 1X5IA 1HZHL 4ELMA 5T5FH 1A6WH 3CCHA 3S35X 2I9TB 4FABH 4WUUE 3C5ZB 1S5IL 3I02B 2BCKA 3BZ4A 4BK5A 3BESR 1J8KA 3NA4A 5TH2A 2C1OB 1U8JB 1YPZB 4BM7A 1KNOB 2CKBA 4WW1A 4F7MA 3GSVB 3QYCA 3BP6A 3KYAA 1UZ8B 3WE6B 5C0BE 5ICYB 5IHLB 1JVKA 4NDMA 1FL5A 2Z8RA 1RUQH 3NACL 4WY7H 4EI5A 5F1IA 3BSZH 1P53A 1R3HA 1Q9WB 2A38A 5FYLH 2EZ0D 3CDGA 3QO0B 5E8EA 5SWZD 4KUZL 4JVPA 1S8DA 2FX7H 1KIRA 5ENWB 5F1KC 4HLZH 3BD4A 4NJ9L 1JNLH 2ARJQ 4EDWL 1OTSD 3SCMB 1FNGB 4TQEL 2UWEF 1AQDB 1F90H 1YMHB 4OCYH 4P46C 3ZDZF 4OBSA 1FGVL 5LGHH 4FOMA 3ARSA 3E2HC 3N1GC 3BN3B 2CK2A 2G9HA 1BJMA 5JORB 3ZKND 1HEZA 3B83A 1NC4A 5CUSL 3ES6A 4WI6A 4K3EL 4M1DL 3MODH 3F7YB 5CIPA 4KJWC 1KN4H 3OAZK 3RY4A 1WT5C 2H26A 3L3KA 3PNWB 1KTLA 3WFHB 3JV5A 4ZOCA 3O8XD 5ETUB 4NHCL 3MLPA 4DFHA 2CLRB 4P3DA 5EZJB 1EZVY 4AL8H 5IB3B 1U8HA 1MHHB 2BSSA 1IEBB 4M9OA 2WBJA 3NOIA 1YN7B 2CKBH 4MJIA 5HGBB 5IMOB 3VMPA 3OWEA 4OB5H 3QZWA 1E4WL 1O7VA 1AC6A 1QPXA 1VKXA 3MSPA 1IAII 1CF8L 1U3HB 3CX5K 5CBAA 3L3OB 4NCDA 3VXNA 4GKNB 4JFZL 5JMRA 2DQHH 3ULUD 1VFMA 4LRNL 5H37H 5D72L 2JB6B 1BMGA 4FTVE 1MWAL 2BJML 5ISZA 4ZO8A 4QRRB 4L29B 2ADFL 2EDTA 3K2MC 3PUCA 1JWSA 1C5BL 1NGXA 4HWBA 2AEQL 3TBVA 1HXYA 3AREA 5D1QA 4HS8L 5GGRY 4MMZC 1QLRA 2ENSA 4F37F 5A40E 4XNXL 4U1LB 5HYJE 5EU3B 4S0TD 1HN1A 4Z7VB 4YGAB 3UO1L 4J3SA 5CIPH 5IW6B 2HLAB 4PJGA 3VFWA 4GKSA 3ZT6A 5C6WH 5CKGA 4X7SH 1P1ZA 4Y4HD 5F72S 4QRSA 3EW3B 4N5ED 5HYSA 2ZG3A 4N8VG 4WI8A 4YO0B 4RIRB 4CN1A 5KVDH 1ZLWK 3QQ3A 1A1NA 1XGRB 3P4NB 3CDCA 4UIKL 4NQVB 3DYMA 4PGZA 5ICXB 5FYKU 4KQ3H 4OM0H 1B0GA 3O6FA 5F6HI 1L6XA 3REWB 3K8LA 4QXTB 4C55A 3SBWC 3KNBA 3U36A 4DKAA 4RFOL 3TJEL 4OI7A 3TO2A 2JELL 2HN7B 2UZXB 2D7TL 1JP5A 5MP6H 3DMMC 3EZ8A 5T1KB 1Q0XL 4RMUA 3CMGA 5GS2H 4IDJH 4Z7QF 1PGRB 1I9RL 1CL7H 2O5ZL 5E0QA 5C0JA 1A7PH 4EQ2A 2PTTB 1B3JA 4HWBH 3E3QC 2HKFL 35C8H 3QXAB 3K3QA 1P2CA 1S9YA 1Q9LA 5C0AB 3SDCC 3Q6FB 5B8CC 3DUHA 4E41D 3OKKA 4XZUB 3RL2A 1KIPA 4E0RB 3T2OA 5K33A 2AXGB 2F8VA 4P5KB 4PUBH 1QR4A 4UV7L 1WCBA 3T77B 1F42A 1KJ3H 4LHUA 4K7FA 2C3XA 5I73C 3HZYB 1R24B 3VCLA 2BFVL 4OSUH 4PS4L 2XN9B 4UUJB 5ALCH 1NMCB 1YZZA 4M6NL 1NMAH 3WLBA 4DEPC 2ICEA 1IAIH 1I9IH 3ECBA 2FATL 4M8QA 1RUPH 2VDQH 2IC2A 4XP4H 2L4OA 3P9MA 4DUXA 5DQ9A 3S37H 1MF2L 3ZKSD 5C08D 1I1AD 5IFHH 4YHZL 5T3XL 1T1XA 5DGQA 1Z9MA 1FAKT 2WM0A 2HFTA 4J3TA 2V5RA 1UM6L 3IKCB 4ZQKB 4ELKA 3NFNB 5HHPB 3VH8G 5TFSL 2FEEL 2UWEE 3ZDZE 5DVMA 1OP3K 2VLKD 4OF7A 5EORL 1BPVA 1CN4A 3PL6A 5GSVA 2GYSA 5SWZB 5EBLB 3MJ8B 4IMLB 5KZCD 1C12B 2IGFL 5T3ZH 3MLXH 4YDVB 1JRHL 1JHLH 1T2XA 4GSDH 3C2SA 4JVWA 5B3JF 2VLRB 3GSNL 3OXRA 2VXVH 1MJ7H 4UOJA 2VJXA 3JV4B 4L4VE 4PJ8A 3MBEA 3FQXA 3VD5A 3WL9A 4FQ2L 4OZHF 1FRGL 3UPAA 1IEAA 5L8KB 3QA3B 5KJRL 3DMMD 1NBZB 5B39B 1QRND 2AI0H 3UTPD 3BUYB 2E7HA 4NRZB 3N06B 4U1MA 4JQXC 4L3EE 3V4VH 5IFAH 5JNYB 1YNLL 3ULUF 5HJ3B 4WEUD 5J0BA 1P7HL 1EFXD 3FB6B 1NCBH 2ZUWA 4WFGE 5J6HB 2PETA 3TBWB 3QH3A 3SDCD 4S1SL 4OAWB 1TCMA 3WKMH 3O8XB 2VDOL 2YUXA 4MB5A 3VXQB 4YPGB 3WDHA 3I2CH 4KMQA 1QFWH 4OFYA 2AV7B 1AGEB 3VFUB 4MA3A 1TTGA 1T1YA 4OGZA 1B6DA 2CDEA 4ESKA 1EA9C 4ONHA 4N1HB 1YY8B 4MJ6A 3VFPB 2NW3A 3W0WD 1BQHA 5E4EC 4GRWF 2FL5A 3FL7A 3LRHA 1DEEA 4OGXL 4GQ9L 1OOAA 1RSFA 2HKHH 2FB4H 4Q9RL 2X42A 3VXSD 3VWKB 4B53A 5E8NA 5GS1A 1NEZG 5FM8A 3CVIH 2CRYA 4YC2C 5HYJA 4YXKH 5GGRA 3AGVA 2IFFH 4ONGL 3SQOL 4ZPTB 1A6PA 3FMGH 1AC0A 4E9LA 4NQDD 1MREH 3GSRA 6FABL 5FDWA 5LKNA 2X4RA 4WU7B 2HJFB 2EH8L 4YHPB 4K9EC 3MUY1 3O3DA 5ADOL 1ZWIA 5DA0B 3QUXA 3RU8L 1QSFB 3TBSA 5JXAH 4UBDC 3VFSB 2VLJE 1G1YA 1K2DB 1G9MH 5ERWB 1WAAE 5F7KC 1M7XA 1SMAA 1BLNA 1NL0H 4GRWB 1FZMB 4LLQB 4NSKB 5IMMB 3T04D 2EDBA 2XTJC 3TBTA 4X98B 3ALPA 4WV1C 1DQDL 2NX5D 4JG1L 5GS3A 3DSNA 1G7IA 4Y4HB 3OV6A 3SDAC 4DN3L 1FQ9C 3KPMB 4O00A 1YN6A 2R2EB 4CU7A 2P43B 4Z7QE 1OAYH 3ZDYE 5IESL 2XZAH 2I9TA 3ZSTA 1JGDA 3UTQB 1PG7H 4MXWL 4MDIB 3KPPB 1LILA 3I02A 3QFDA 3QHFH 4NWUL 1IGIH 4LASH 2C1OA 1YPZA 1WBXB 3LHPH 4KKAC 1KNOA 2R2BB 3BE1L 2WUBL 3GSVA 4H88H 1NCAL 5D8JH 2APVA 4L8SC 2P24A 5ICYA 4XBEH 4F57H 4ZFGL 2P5EE 1Q9WA 3B4NA 2MFNA 4OCWH 3QO0A 4ZTOL 3W2DH 5C6TH 5ENWA 3OZ9L 3MJ9A 5CEZD 3RTQD 5F7HA 1DQML 4KPHH 5C3TA 3SCMA 1FNGA 3BP5B 1AQDA 3GO1L 3QQNA 5EU6D 3BKJL 3GSXB 1LK3L 2V5MA 5SWZE 2UUDH 4Z78B 1F4AA 3QJHA 2W60B 5CGTA 5JORA 3N9GH 3OAYK 1ZLSH 5BV7L 2J88H 2YZ1A 4OD1L 2R1WA 3HZVB 1XGTA 2Z91B 4AEHH 2F5BL 3QPQC 3DX9B 5FGBA 2O26U 4GXVH 1DLFL 3W39B 2WK2A 3F7YA 4I3RH 5T5NF 3I6LD 1FZOA 3H3PL 3O41B 4MAYC 3PNWA 4M3KB 4OTXH 3FRUB 4FFVC 1XGPB 3WFHA 4YPJA 4X6FA 5DEZA 5ETUA 4AMKH 1NCNA 1XR9A 3MRBB 3QG7H 3R8QA 5EZJA 2GHWB 1OPGL 3MLZL 5M7QA 4HLZG 3TF7C 2F53E 5C0GB 3VFTA 4FFWC 2HH0H 5B38B 4JHBA 5C08B 3ARGC 1I1AB 1NMBL 1MHHA 1IEBA 2UWEA 2OX5A 1Z5LB 1YN7A 1KJ2A 1HWGB 3X12B 5HGBA 3QBTB 1KIQB 1A6VL 1Z6JT 2ZCHH 1U3HA 3TIEB 3QUKA 3X13B 3Q0HA 3L3OA 1D5BB 5E8PA 2XTJD 3MJ9H 4OZHE 1OWWA 1FL6B 2Z92B 3SDAD 1GGCH 3KPLB 4ONOA 4NZUH 1HH6B 3MV9D 2NYYC 4HCRA 3A0OA 1OT2A 4XAKD 4L4VA 5IVOA 3C5SA 5L2KD 4PRHE 5CD5C 3PWVA 5KZCB 2XYCA 4PG2A 2R1YB 1AHWC 5EU3A 1FSKC 4ZAKB 4OQTA 4LLVB 5IW6A 2UY7A 4GQPH 4KKAD 1A4KB 1YEEL 2HLAA 5DD1L 4DVBA 1VESA 4CN6A 4YDKL 2IQAA 4Z7UB 5DGRA 4KDTA 3BPNB 4RAUB 4DK3A 3ZTNL 4LAQH 3NGBB 3DMMB 1WTLA 1BX2B 1N59B 1QRNB 2YMXH 4M4PA 4Y2DB 4RIRA 4YO0A 4AEIL 4EKXA 5H37G 3JUZA 2VZSA 3PQYD 4LSRL 1URLA 1T7ZA 1XGRA 3MFFB 1F11A 1IC1A 3P4NA 5A2IH 1N4XH 2Z35B 2YRPA 4YDJB 4JLRB 4NQVA 3PDDA 1NKOA 5ICXA 3SDCB 5B8CB 3UYPA 3REWA 1I8LC 4QXTA 3CLEH 3QCUH 2ZSWB 5HSFA 3V6OA 4EDXB 1MHCB 2CLZB 2G60L 3C5JB 2OR9L 2HN7A 3MOBH 5T1KA 5F8QC 3QPQD 3GI9H 1TZHB 4K23L 4UAOC 3GRWL 2AS5M 5KSBE 4IS6B 4UNTA 5IB2B 2H9GA 3BZFA 4HCRH 4PLNC 1Z0NA 4FFVD 1J5OH 4DEPB 4FFZH 1UWXH 5C0AA 1KEML 4M48H 3VXSB 5HHQB 3BDYH 3BMVA 4XZUA 1FDLH 3NFSL 3FB5B 4HIXL 3C2AL 2AXGA 4FFWD 3ARGD 2VLJA 4OQTH 1EUTA 3NN8B 3BHBB 1LP9F 5DLMH 3IYLW 4NBYB 1P7QA 1R24A 1QD0A 4Z76A 4G6MH 2MNUA 3EFDH 1ED3A 2D4DA 2XN9A 4E41E 5TDNA 4MVBD 1FLTX 1W0VB 1XAUA 2BXZA 3G5ZA 2VH5L 1E28B 5KSAC 1K8IB 1MY7A 1BAFL 2ILLA 2NX5B 2B5IB 1XEDA 1JV5B 3V4UH 2NYYD 3OXSB 1HOCB 4Y5VC 1I1CA 5CD5D 4WEBH 4KVCH 1T6VN 4I13B 4WUKL 1Q1JH 4ZQKA 2EO9A 3INUL 4IIQC 1LP9B 5AG9A 3NFNA 4UINH 5HHPA 4M4RA 4MAUH 3H7LA 4QXUH 5A1AA 1NC2D 4W4NA 1U8MA 2HVKA 4ZOEA 4Y88A 1MCRA 3HS0B 5HYSG 4Y4FB 4N0UB 3HMXA 5HBBA 2VTFA 3WN5B 5HPOA 2HAZA 3LS5L 4JM2C 4O9HH 4WTWA 1A21A 2R2HB 4EUPB 5SWZA 5EBLA 3ME0A 3MJ8A 2VLKE 5EU4B 1AXTH 2R29L 1EEUA 3EBAA 4YDVA 43CAA 1OAXL 1Q72L 5ADPL 4R96A 4PV8B 3RTQB 3SJVE 3RGHA 3LB6C 4NZRL 3KR3H 4WW2F 5HHME 3TC9A 4LPYA 3F6IA 3B2VL 1Z2KA 4GLRI 4OLYL 3VI4F 3FOLB 4CN4A 2CMRH 1FNSL 2XZCH 3LQAH 3QA3A 3OHXB 2XY1A 4L9LC 4DKEL 3BUYA 1MI5B 4NRZA 4NRXA 3MREB 5CJXA 4IOSD 1IE5A 4UNVA 3S36L 4YHMH 4LHJB 5HJ3A 4OIIL 1CT8B 3FB6A 5E2WL 1FYTD 2OSLB 1B6UA 3RVXD 5JHLL 4OAWA 2ZPKH 3O8XA 4KK5C 3UTPE 3VXQA 4YPGA 1EPFA 2AKRB 4S1QL 3QISA 5D5ME 4LHUG 3VGFA 3CZJA 3LMJL 3VFVB 4C56D 4D0CB 3VFUA 3E3QE 2Y5EA 4WW2B 3DIFA 1YY8A 3VFPA 1DEDA 4OZHA 1G9NC 2X9XA 4PPTA 1QRKA 3HMXH 4BA8A 3WNOA 1A9BB 1RHHB 2Y6SC 2YR3A 4Z5RB 1TIUA 4YZFF 2DQGH 2B1HL 2O5YL 1A7OL 3D39D 5KSAD 1DQTA 3W0WE 4EOWL 4NYLB 2DQFB 4HPOH 1PD6A 3H8NA 3M8OL 4KWUA 4JAMA 1NAKL 5D9SB 4JKMA 5L2KB 1QBBA 2J5LB 4BSVB 3DWTA 3HHRB 1UCTA 3W11C 2HT3D 1U93B 5E56A 5IEKB 3WNNA 2EO1A 5ERWA 4F7EB 4HMEA 3HUJB 4WRLA 4NQDE 3T4YB 1FZMA 4LLQA 3ZE0F 4EXPX 2CDGA 4X98A 4XB7A 1CZ8L 3MLSL 1A3LH 3LEVL 5J1SC 4I2XB 4Y4HA 3ZE1F 1CLYH 4JM2D 3CU1A 2AJSH 3KPMA 4JPKH 4N68A 1FNAA 4X8JA 3RJDA 3ZHLA 2MCPL 2CO7B 5HDBF 4FQQB 1JFQL 3QT2A 5EUOE 4MDIA 2F19H 5C09D 5F96L 3KPNB 3KPPA 3RWHB 5J6GB 4LP4A 3LB6D 2BOBB 2EDNA 1J0KA 4LOUC 1JGVL 2R2BA 2OJZL 4OQ1A 1RURL 5DC0A 4MNGB 3BQUB 4JN1L 4DK6A 5HYQA 5KG9A 5AD0B 4GLRH 4GAJH 1FVCB 3ULUH 5FCUL 3FQNB 1D6VH 4I5BB 2VXTL 4RISH 1EJOL 1AFVL 2Q8AH 5KBNC 1NFIB 1FP5A 4ETYA 3HR6A 1T5WA 1HNGA 3DNKA 1JGUL 4HUMB 3HMWH 4KK5D 3BP5A 2R0LL 4GG8B 4E41A 3MRIA 4LARH 4W4OA 1E6JH 1YNKL 3UTSB 3WMSA 3ET9F 3GSXA 4Z78A 3ALXA 1DBML 2W60A 4ACPA 1NANI 4AEEA 2AEPL 2R0ZL 4W6XB 4GRWH 1BQHG 2EH7L 3HZVA 3SGDI 2E6PA 4ODTH 2WWKT 1X44A 2Z91A 4M9PA 1YEIL 2F58H 5GZNC 2CIIA 3PIQB 4G8FB 3W39A 4YXLL 5FUOL 3RVUC 4HZAA 3TVMC 1NDGA 3SE3C 5EU6E 3AAZB 1OARH 2Y6SD 1AQKH 4RAHA 3QULB 1XGPA 4XMLH 1EO5A 3NAAL 4EEEA 3NFPB 3EO0B 3BKMH 2IPTL 5GS0L 3UYRH 1T3FA 1D9KD 5C0GA 5ICZB 5GISL 2LQRA 5B38A 5C08A 1I1AA 3I6LE 1GYAA 4JPVL 1A8JH 4RGMB 1Z5LA 2RHEA 4WI9A 4HKZA 3H9HB 1KTDB 3SKOA 3QFJB 1W72A 3TYGL 3X13A 4MDJB 1BJ1H 1FSKB 2VDRL 1RZKC 1LE9A 4PV9B 4BH8A 2VLKA 4NBZB 1IC7L 3VI4E 4MB4A 3OJDB 3HLAB 2Z92A 3JTSB 2NLJB 4QT5B 2AJ3A 2MMXA 3VMOA 3TH3T 3MLRL 2HLFC 4RA3A 1I7TA 3WIFB 1MFBH 1X5GA 1PSKL 2XTJE 2WSKA 4AT6B 4K2UL 2VXSH 1I1FA 1KULA 4KTYA 1JYXA 2R1YA 4QRPB 1GCFA 1DUYB 3V5HA 4M61B 2A9NL 3HE6C 4LOUD 4LLVA 4QHLB 3MV9E 4F58H 4RMQA 4DN4L 1A4KA 3UTTE 1RU9L 5AZEL 1I1YA 4F7TB 5EZLB 5L2KE 5GHWL 1FZKB 3NZHL 1INEL 4RAUA 3B5TA 1JN6B 1SBBA 3DMMA 5E08L 3UMTA 1N59A 1QRNA 1KFAH 2E7CA 3DHJA 4UAOB 3C9NB 3C6SA 3DV6A 3MGTB 3UX9B 3MFFA 2HWZL 3QEUA 1EFXA 5GRXG 3MUZ1 2R23B 4G80B 1EGJA 2Z35A 3P77B 4JLRA 4PJXE 4YZFE 3DO3A 2PW1A 3SDCA 3U46B 4C4KT 5B8CA 4L5FH 1MRCL 4OLWL 2F54D 4PJDE 1WZMA 4W70A 5CGYC 1W72H 2ZSWA 3PQYE 4EDXA 1MHCA 1P4BL 1OTTC 3SKJH 2HTLC 3RIFK 1F4YL 3WSQH 2CLZA 4WENB 1WLHA 4N8CL 1Y6NR 4C56B 3C5JA 1U8NB 4MLSA 1NANH 3CFBB 1TZHA 1CFBA 5I2IB 5GZND 1UQSB 3LPFA 1FCGA 3MUGA 3W0WA 4TVSa 3DVGA 3RVUD 3TVMD 2ZKHL 3B9EA 4IS6A 5KSUB 2PYED 4DGYL 5IB2A 1TNMA 2DYPD 3QEQE 4GRMB 1VHPA 4YHKH 1TCRA 2OLDA 2YBRA 4N8PA 3VXSA 4JM2F 3ZE0E 1N64H 3RUGF 3D39B 2J1KA 5FM5O 3O2VL 5TE7L 1NJ9B 3RWIA 3ZE1E 2X4SB 2WQ8A 3AUVA 3BHBA 4K8RC 3VA6A 4XPBL 2XA8L 4P2OC 1NGYB 4NQDA 3IVKA 3BKYL 4Z8FL 3VI3E 5LXGL 2BHYA 3OGOE 2LVCA 5ELIA 3NABL 4MJ5B 3RX8A 2D2OA 4OLVL 3BISA 2DQIH 1W0VA 1HHKB 4PJBB 5DJXB 5D71L 2YUWA 3UC0L 1V05A 1BWMA 1JF5A 1U8OA 1A5FL 5IKCB 4XP1L 1E28A 4JDVA 5E8DH 5DK2B 2JCCE 5DTFB 1RZIA 1OY3B 3ILPB 4KZDL 1OAZH 3BX7C 3OXSA 1MRDL 3DXAD 3FTGB 4JM2B 3TV3H 2C3WA 2HLFD 3N1QC 1DFBH 3RUGB 1HOCA 3QCTH 5L8JB 3IF1B 5BVJB 1DDHB 2R69H 2GFBB 5C09B 1LP9A 5J4MA 4OCRL 4P49A 1CFVH 4F9LC 3F8UB 4P4KC 2V5TA 3GGWB 3OL2A 3CUPA 5F7LB 1CR9H 3P9LB 3HS0A 4LSDA 5IROC 1KCRL 1MCOL 2X4NB 5TE6L 4JQXA 3L5IA 1TVHB 3RWJB 2BP3A 5I1EH 4AH2B 5EU4A 4O2FA 1UWEH 1ZV5A 2K7PA 3KS0H 5JW3L 4LIQE 3RTQA 1LEIA 4P2QD 1A02N 1XH3A 4UT9H 5HGDB 5CGYD 3CFCL 1A1MB 1RAMA 5EU6A 3H3BC 4V1DB 1OTTD 2FD6H 2HTLD 3WXWL 4ERSH 4JREC 1TVBA 2APBA 4U2YA 3FOLA 4AQ1B 5KW9H 4MXQC 2ORBH 3OHXA 2DQJL 1BD2D 3NVQA 4U7SA 1I3GL 4M6AA 3CJJA 4CU6A 1D5XB 5FYKD 4NOFA 5LCVL 5FCSH 2B4CC 5CJQL 1DL7H 4NN6C 4NN7B 1IILE 1T1ZB 2EDWA 3LIZH 1AD0B 3EYSH 4TPRH 2AKRA 5EOCL 3VFVA 1D9KB 5F3HB 3FT3B 4O02L 2MCG1 4K8RD 1NCCH 2NY6D 4QCIB 1FYTE 4WW2A 4P2OD 3T2PA 1CU4H 2VXUH 3H9YA 1R0AL 4YXHH 2KPNA 2GW5A 4HK3J 5HDOA 3TZVD 5DJYB 4J12A 3IB4A 3OR6B 3S8WA 1K3ZA 2GK2A 3O2WL 1WTGT 4NGHH 5I1LA 2CK0L 4DZBB 4Z5RA 4ZFOB 5IB1B 1UA6H 1JF1B 4LEOB 1OGTA 3BP7B 2VDMH 2IMNA 1NUGA 4H0IA 2AJUH 1WSST 3RA7H 4WV1A 4NYLA 3UBXB 5CEZH 2PNDA 5CJOH 3SDAA 4Z0BH 3TGXA 3S37X 1QG3A 4JDZB 3MV9A 3O4OB 5D9SA 2XXMB 3CVHA 3FQRA 1IFHL 4ZUTB 3NH7H 1WZ1H 4P2RE 3S4SA 5L2KA 3ARDC 3B9AA 3NCYP 2NR6C 3FO1A 3BRFA 4ZUVB 1U93A 5IEKA 1B4JL 4QTIH 3O6ML 3HZMB 1F58L 1MEXL 4F7EA 3MROB 3GBLA 2MKWA 5DQDH 5DXWA 2Q8BH 2VUYA 3T4YA 2J8UF 3WBDA 2J8OA 3QWOB 1F45A 1FNFA 4L8SA 1A6UH 1PBYA 4I2XA 2EDOA 3ETBF 4H25B 3MRQB 5BZDA 4IRSC 3IDIB 1FPTL 1DBKH 3QUML 3UZEA 3L5XH 3PQYA 2HVJB 4FQQA 4Y1AE 1JNNH 1J0IA 3OAUH 4HBCH 1P5UA 2AJVH 1QKZL 1KPRB 2AK1L 1EV2E 5J6GA 1U95B 4KKCD 4FRWA 2DQCL 2JIXD 2F54B 2P8LB 3P11L 2YKLL 2IAMD 3ARFC 4N0RA 1A6AB 5B39G 5DSCA 3RI5F 4MXQD 4MNGA 5EA0L 1VA9A 3QEQA 4WI3A 1J1XH 1YYML 1CGYA 1FVCA 4JHAH 3WEXB 4I77H 2IH1A 4S1RL 1V3MA 4MSWB 3VFGL 1UC6A 3G08B 4AIOA 1ZVSB 1WICA 5IB4B 4R8WH 4ZD3H 3CVHH 4S11A 3LSOB 1VENA 4GG8A 2FLRT 5I1HL 4K94C 3UROR 4X99B 3DV4B 3ARGA 5E9DD 5KVGL 5EC1B 3KXFB 5JQ6H 5JOPD 2DQUH 1OSZA 1W0YT 4LSSH 1DQQB 4L8BA 1OCWH 3CZFA 3PIQA 2HT2D 4G8FA 1JZ7A 2BVUA 4FQXC 3GIZL 3AAZA 1LD9B 3QRFM 3LKQB 5CINH 2X9WA 3QULA 3HC3L 2ERJC 1S9VB 3NFPA 4OFIA 1GZPB 3EUUA 1LO0L 2XPGB 1HYSC 4PG9B 1DR9A 3V79C 3GKWH 5ICZA 3G5VB 1VGKA 3VDBA 3DXAB 1YEHL 5GGQL 4ENEC 5FO8B 5FYJD 2Q3ZA 2NY2C 2XKSA 3ARDD 2NR6D 4MJ4A 1RULH 3H9HA 4YE4L 5I17B 1KTDA 1VEOA 1IVLA 2PW2A 3WO4B 1AHWA 4MDJA 3Q3GB 5H35B 3U4BH 5DUMH 1N7MH 2R0WH 4PY7B 1NC2A 4PV9A 1LO4H 2DM7A 1Y18B 1B9ZA 4ZFFB 4NNXB 3HLAA 1PEZA 1JHKL 4CVWA 4RFNB 4IRSD 4R9HA 2DD8H 4KHXL 3BKCL 3EDFA 2G5BB 3H0TB 5LAXB 1TQCB 1O5DT 4X5WB 3T0WA 1HKLH 5AZ2H 4AT6A 3SQBA 4YX2H 3LEYH 4YK4C 1DUYA 4U1IB 3H3KA 1E4XL 4QHLA 1C08B 5ILTL 1CFTA 3GMQA 3THMH 3MRHB 3CMOL 3ARFD 2F8XC 4F7TA 3TWCL 1JYWA 3AC0A 1GIGH 1KELH 2B1AH 2NMSA 1JN6A