2DQJL

Crystal structure of hyhel-10 fv (wild-type) complexed with hen egg lysozyme at 1.8a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqjL00
2FJGA 1A5FL 2GTZA 2H26A 4O9HL 2IFFL 1I1AA 4C59B 4LARL 1J0HA 4EQ2A 3SDXA 1PSKH 4H20L 5CKGA 4Y4FC 3QYCA 5FYLH 1OSZB 1PFCA 3HZVB 5LCVL 1UJ3B 4IHOA 5AAWA 3QDGA 5BS0E 4OV5A 3V5DA 1F58L 1QBLL 2FEDD 3QCVH 3PG2A 5F96H 1BGXH 4GMSL 4KI1A 4NO0A 5CLWA 1GOHA 4NWTH 3RWEB 2PW2B 2VLKA 4N9GB 3KYOA 1KB5H 2LE9A 1BOGA 4P2YA 3KLDA 2YPKA 4RISL 4DZBA 1JFQL 4R7DA 2A73B 5KJRH 3H9YA 4RMVA 3B3IB 5M94B 4XRCA 1PEWA 2G2RA 1NBYA 1QFWM 5DDHA 3L5JA 3UJIL 2X70A 3A67L 1CF8L 3QDGB 5I8KL 4HGWA 2CLRB 4XMKL 4YFLI 3M1BB 2ED7A 2Q86B 5EIVA 5BQ7B 4JGMA 2QKIB 4ZYKB 3EYQC 2FX7L 3PWUB 1A2YA 5IT2L 3HUJE 3RGVB 1QFPA 1OTSD 5E1HB 5J3HD 5DC4B 3V6FA 5T1KB 1CFSA 1V5JA 1GZQA 4UU9B 3UBXG 4OGAD 3PGDB 3VXNB 1IM3B 5C0AA 1UFUA 5LQBH 3CFEB 3UC0L 1CI5A 1MJUH 5T1LA 1NDMB 3TO4A 2F5AH 5ITBH 1BFVH 3TA3A 3HB3D 4MJID 2NW3B 1T5XB 1FYTA 2OL3B 1V7MH 2P24A 3PP3H 4P4KA 4PJGB 2ZG2A 3BQUB 2Y6SC 3PNWA 5JUEH 4PJDF 2A9ML 1Q8MA 5DRWB 3VWJA 4WUUD 4OIBA 4FQLL 5HHQA 1I3GH 2OTWB 4EBQH 1LEIB 1ZHNA 1S9WA 3L9RA 4EI6B 2VXQH 4GSDH 3SQBA 4H8WH 3JV4A 5CZXC 1J5OH 1BREA 5T33L 2ZJSL 5AUMB 5HHQB 4UI2A 1FO0L 3GZKA 5JA9A 2I9LB 1CE6B 1KBGH 1C5DB 4XGZB 3AU1B 2IANE 3G5XA 2EC9T 3OJ2C 4MXWH 1Z0NA 3IYLW 5FCUH 4PV9A 1FSKC 2W65A 2OL3A 4M3KB 2PO6B 1OM3L 3BD3A 4K71C 5E94B 4WFED 2A6DB 4KRMB 2HFGH 3FAWA 4HIEA 4Z78A 5LGJA 5FDYA 1MAML 1NLDL 4LHUB 1VA9A 1QRNA 1I9IL 4RRPA 4ORGB 1JF1A 3EYUH 5D1QB 4LPXA 2OZ4H 2OM5A 3HA0A 3MBED 2FJFB 5GS2D 1TTUA 5IK3A 4S1SH 2OJEA 2I5YH 3MRFA 3FQNA 3RY4A 3D87B 5AYUH 4JPWL 1TJIH 3KPQA 4TNVK 5HHOA 1CFSB 2E7LA 3F7VB 2YD1A 5E9DA 1NMAL 3OXRB 1JL8A 1NFDE 1KJ2L 3G6JE 5HVGB 5C0GA 1B0WA 4H5SA 4Q74A 1Q9OA 2CIIA 2YD3A 5C09A 3IKCB 3ARDB 3SE3A 4LLUA 5BW7C 5IQ9A 1N3NA 3MLZH 2I07B 5ESAA 2DJUA 4ZTPL 4BK5A 5ADOL 4G80B 1S8DB 5GJSL 2UUDK 3RKDD 4ELMF 4LF3B 4NWTL 3MOQA 5DMIL 3SGJC 1HZHL 4M6MH 1DL7L 2Y06L 2BNRA 2ICEB 4BK4A 4NKOA 4JDVB 4X6FA 4OLZL 1TQBB 3C08L 3T4AA 4IJ3B 4UB0L 3D25A 4ODVL 4NSKB 3ULVD 4HZLA 4JJHA 4LLUB 4OZGA 4QLRA 4NQEE 4WENB 4YQXH 4CU8A 2NX5B 4M7LL 4LPUA 5J13B 4Y4HB 1OD7A 4JZJB 3OXRA 1WAAA 1UWGH 4BSWA 5DSCB 5E2UH 5JORA 3G6JB 2D7QA 4O2FA 3VWJC 3DJ9A 1YZZA 5CWSA 2D4FA 3VXSE 3EYFA 4KJWD 4GG6E 3CVHL 2LAGB 1QOKA 3VXSA 4CAGA 1ZS8A 2IQ9L 5BCAA 4JO2H 2R1XB 1FLRL 1A4JB 5D7KD 4DK3A 3PWPD 5IJVA 2GCYB 1HSBB 3QUXA 1BFTA 1ZLWK 4A6YB 2NY6D 5D7LE 4N0YH 5DUBA 3CK0L 3TJHD 4M61B 1A6AA 2VZSA 1IGMH 4NN7B 3E3QC 4U0QB 4YK4C 1A7NH 4MXQC 1JZ5A 2CGRH 4LMQI 2COQA 4EDWL 5HGHB 1I7RA 2JK5A 1FFNA 3I75B 2YK1L 1AGBA 2XY2A 5JIPA 1P1ZA 3NH7H 5ALCH 4U6VL 4JPIA 4YK4B 1N26A 1F42A 4PJ8D 4LNRA 15C8L 3KYKH 2J1KA 5CD5C 4N0CD 1RAMA 1T0MA 4HQQH 3O6LH 4UDTA 3OPZL 3OKOB 5C07E 3VI3F 1FZOA 3G6JF 2GKIA 1RHHA 4PY7A 5FM8A 3H2WA 1PSKL 1BQHG 3L95A 1P1ZB 1M1SA 2W0KA 1E27B 4UNUA 5I74B 2BVTA 4EEEA 2JB6B 3T09A 4PB0L 3OAZH 3VXRB 2QSCL 5DD0H 1YEJL 4P23D 2GI7A 5CMAA 1F90L 5FF6A 1CICA 1QLEL 3H6JA 3QHFL 3U79A 3MRDA 3F58L 4PGDA 3VU2A 2O5YL 3LKQA 3KNBB 1NC2B 4A6YA 1IT9H 3KXFA 1U58A 4RAVA 3QUXB 4WEBH 3SDCA 1I3UA 2DQUH 2EDDA 4X5LA 3MYJB 4EN3A 3PL6B 4WFHD 1LNUB 4YDLC 1A7PH 1BZQK 1MLBA 1WCBA 4LGPB 4LEOA 4P5TB 5DXWA 1AD0A 3TV3H 5HPOA 4DKFH 1SJVA 2CUMA 1MPAH 2MKLC 1HYSD 3DV6A 1HQRB 4NN7C 1GIGH 2FEDC 3KHOA 1JWSA 1RJCA 5EWIL 4LRNL 4PRIA 4EZMA 3QDJE 1LP9E 4ONHB 5HGAB 3DSNA 5KVFH 1H8OA 2BHYA 4S1SL 1BAFL 5EZLA 4ETQA 2PYFA 3WSQL 1JNHA 5DQDH 5A2IH 5KJRL 3MRJB 1S9VB 4R7DB 4P9HH 1EHAA 3V7MA 4DVRL 2APTA 3EYSL 4X6DA 1LWRA 1Q9LB 4LSSL 1DUYB 4GLRI 3C60A 1A9EB 1U8PB 3GGWB 4NN5B 3WDJA 2NY5L 2IFFH 1OGAA 3MV8D 3WEXB 4PRHA 1JPGB 1B0GB 1EMTH 1T1YA 3MOAL 3P77A 2OSLA 1UJ3A 5E70A 1U8HB 4HV8B 3SGKC 1MLBB 4LU5H 4U05A 1JRHH 4XTRD 4NC0B 3GHEL 3FN9A 4R4ND 3RY6A 3SDDD 2VZOA 1IQWL 4OIAA 1UCBL 4YHZL 3W11D 5D7JA 2HFFA 3L3GB 4PJAA 1D9KB 2H9GA 1S9KC 3BP7A 3B9VA 1G6RA 3ARYA 4RFOL 4PGEB 1MQKH 4PLKD 3QUYC 3O3BA 1V7NL 4J23A 4EOWH 5EH1A 3WHE1 4ZDHB 4DFIA 5B3NA 2BHUA 3FOMA 4ORGA 4D0DB 3C2AH 4MQTB 1EBAA 1EAPB 2R0WH 4HAFA 4WHCA 3MMEB 3BIAX 2ZG1A 4KK6C 3ULUD 1MFCH 1EUUA 2OX5A 4LSDA 3HNTH 3X11B 1EAJA 3ESUF 4KMTH 4PG9A 1WCQA 2VLKE 1AGDA 4GAFB 2VDOL 3QO1A 4UBDC 4QOKE 5I19H 3IDNB 1N2RB 4CVXA 2I9LA 5IFJB 1ZLUH 3JXAA 4PRDA 4P3CH 4HK0A 5T5FL 1K8DA 5MERA 3O6LL 1NSNH 1KFAL 3KLSA 1R3LB 1I7UA 4UQ3A 3FO9A 2DD8H 2ATPA 3EJZC 5LVEA 3JWNC 3WXVH 2HT4D 1JNNL 4HWBH 1D5BA 4XCCL 2E7HA 9CGTA 3FQRA 4P4RA 3G08A 1N5YL 1U2HA 1G7HB 5HJ3B 2QSCH 5DD0L 4QRUB 4IRJA 3QISA 3RVVC 2FBOJ 3FO1B 5D4QA 4G9DA 3L3DB 3MMEA 1KJMA 1Z9SA 5T3XD 3LQMA 3DXAE 4BJLA 3FOMB 2C5DC 4F7TB 4LSVH 3B9KC 3CFBB 4CADB 2YSSB 1T89A 3GMLB 4FTVE 2A74B 1K6QH 4WJ5B 3EFDH 5C70A 2DI9A 5GJTL 1TJGL 5DHVH 2DBLL 4ZFOA 3MGAA 1NC2D 2CQVA 1PVHA 2Y5TB 3KLHC 3CFCL 2B0SL 3LH2L 5KW9H 4UT7L 1ZLWH 2Z35A 4JFOB 4MXQD 2NX5A 3L3OB 2X4OA 4PS4H 1BP3B 1T1XA 2UZXB 4ODUA 5CFHA 4NSKA 2QHRL 4DKFL 3T4AB 2IBGA 3QXDB 4APQD 1KACB 5BVJA 1J10A 4Y16A 1S7SB 2YRPA 1A0QH 1AQKH 4FFYH 5EWIH 3OAYH 4XPFH 5D7JD 3U2SA 1KEGL 4FQQB 5D5MA 3PHQA 3HZKA 1U3JA 3QIUC 1IEBA 1KXVC 5ESAB 3K0WA 3RVWD 1R3HB 2EDHA 3KYNB 4N90E 3DI2B 1JK8A 3E6HB 4H5SB 4LIQE 4JJ5B 1Q9KA 1ZSDA 4Y2DA 1LO3L 4JANA 4U31A 4L8DB 5DURD 5BRZD 1LE9B 4PLJD 1QA9B 2AK4D 1FNLA 3OG6B 4A2MA 1K4CA 1AI1H 4JHZA 5AZEL 5ALBL 5E4EC 1JRHL 3V2AR 4XP6H 3FOLB 3S96A 2ADGA 2JE8A 1CFQA 3EZJB 5IEHA 5FA4A 2OI9B 3B9KD 4QRRD 4LEOB 5K9OA 5KANI 5M7QA 3CGTA 3FB5A 1LO5A 3GJEB 4UNVA 3FMGL 1U95B 1FRGL 2NTFA 1S78D 4C4KO 4K94L 1ZA3A 3VFTA 3HMWL 4AZ8A 3JV0A 1CDIA 4ODHH 3KNBA 5DYOB 1BVKB 2F9BT 4RGND 2JF1A 3WLBB 4DZ8A 1PY4A 5ANME 4L29B 3LS5H 1NANI 5JTWA 2GTWB 3FO0L 3L3JB 3EYOA 4L9LA 1PDKA 4FXGB 4MCZA 3ZL4H 2WK2A 1P7QB 4X99B 4KMTL 5FGBA 1JGEA 5EUKB 2JELL 4PY7B 2LAAA 2GQHA 1I8KB 4W6YB 3MXWH 4POUB 1IAOB 3SO5A 4LCUA 1S7RA 4HJ0C 4X4YB 2WWKT 1JNLH 43C9B 1Q94A 3HC4L 1U93A 2EH8H 1JJUA 5F93C 2WW8A 3DGGB 2EO1A 3X14B 4PRPB 3EYOB 3L3JA 3CDYA 2DMKA 5HGBA 4L4JA 2ZP0T 2IGFL 3W0WE 2BVEA 1QUNA 4RCAA 4RGMC 5ETUA 1KLGA 3WSQH 4ZFGL 4OZFG 5BZWA 3ZTNL 1CG9B 3SHSA 5DMKA 5I1AA 2EDOA 4P3DA 5TQ0L 5GS0D 1M4KA 3LN9A 2HFEA 4XBEH 1MCOH 3PWUA 3UYRH 5HI4C 1YMMB 4AL8H 4M9OA 1A4KB 1OOAA 3OJMB 3CSPA 1JPFB 1KENL 2GAZB 3N0PB 4R6UA 2XTJE 4U3XA 4QCIA 4X6CA 2GFBA 3TPKA 4CMMB 1HHJB 4MDIA 3VXMD 4JR9L 1RD6A 3P11H 2OL3H 3S98A 4UOJA 1J86A 4Q9RH 2VLJE 3GKWL 4XNZB 1Z3GH 4YLQT 5TH2A 4Z6AT 3BI9X 5EO1A 3ROLA 3X13A 1AGFB 1GGCH 3B43A 1W0WB 3HNVL 1O7VA 4OV6F 1ZA6B 5B38A 1C16B 4N9GA 1P9MA 3FB7A 3HCVB 3W82A 2NY0D 2OJZH 5TDPA 1OP5H 5HY9B 3SO3C 3I9GH 4NPYB 4XPBL 5TDOA 1QFUL 3GIVA 3PE9A 4I48B 4IRSD 4W81A 1I3RA 3EFFB 3SKNA 1CGXA 1UB5A 1M6OB 1U91B 3WNKA 5B39B 2A9NL 2XKSA 3BKYL 3GIVB 1SY6L 1CZ8H 1UA6H 4ZUUB 3EJZD 4XAKD 4PJ8A 5HY9A 3HNTL 2IPKB 3LV3A 2GTZB 1JVKA 3IRZA 4MNGB 4YHLH 4HDIA 4HUUA 3O2WH 3WJLC 4LNVA 5D1XB 1JPSL 2VL4A 4JLRA 5B21A 5IROC 3RU8H 2YSSA 1E4KC 4QRQB 1NCTA 4LLMB 3T0DA 3FMGH 1MRCL 2DQIL 2EEAA 2R9HD 4XP6L 3LS4H 3QXUA 3T3PF 5BOZG 2GFBB 4CMMA 1FCGA 2P7TA 2YMXL 4H1LG 3TBYB 1JWSB 3OB0K 1J5OL 4LSRH 3HE7A 2E7LC 2R2BA 3DTXB 3O0RL 5ICYA 2IG2L 1T83C 3VXSD 2DQGL 3IFNL 4AEIL 3BW9B 4HEME 5BZWB 2EICA 3CDGA 3WS3A 2RIKA 1JGVH 5I16B 4GG6F 3EO1B 5DJZB 1W8OA 2JIXA 4BQ9A 4K8RH 4RBPK 2HFGL 3MV11 3KGRA 4NOFA 4N0UE 4PJ7A 4LAQL 1BFSA 3FQWA 5DVLA 4K3GA 3WE6A 5A3IC 3IDGA 4RMRA 2OZ4L 2ZCLL 3BIKB 2ENSA 5C08E 1DN2A 1SM3L 4I0PD 4OJFL 3D5OF 3CPLA 3KPOB 5C6WH 3EJYC 3LN4B 4KUZL 1OSPH 4B7LA 1QSFE 2ICWB 2Q1EA 5GJTH 3SKJH 5D6CB 3VWJD 5IVZB 4OLUL 3TO2A 1ZHBB 1T7ZA 4G8GE 5TFSL 1KCUL 2MHAA 5ESVA 5B4MD 1F11B 1L7TL 2Y7QA 1DFBL 2ZSWA 1U8NA 1S7WA 2RB8A 4L9LB 1IAKA 4KROD 1MI5D 2A77L 4GW1A 3WO4B 1TCMA 1TZIB 3UTTD 4PJCB 2XG5A 3MRCA 5T1DL 5IEKB 4FTVA 3WLBA 5D1XD 5I71C 1ITBB 3VI3E 2NYYD 4M61A 1KJVA 5BJTA 3ULVF 1RFDH 2W0FB 2ZCKH 3QDMD 2GCYA 1CDGA 3EDKA 3QIWD 5FYLL 1YNTB 4CN4A 1KGCE 2DTML 1JUFA 3NCFB 2FATL 4RFEA 1FJ1A 1KIUA 5E56A 4L3EE 5IW6B 5J6HB 4NM4L 4TUOA 5I1KL 4L4TB 5ERWB 3RIFF 3KDMA 4U6HA 2O93L 3LMJH 5F96L 5C0FA 4U6YA 1CN4A 4JE4B 3X3FL 2CRYA 1HXMA 3ARFB 3HI5H 4AY0A 2EDJA 4PTUB 1TJGH 3IS0X 5CS7A 4JFDD 3H9ZA 1Q9KB 1ZSDB 2VDML 3DVIA 3KPRB 1WBYB 3T0EE 4U7SA 3X12B 4HKBA 1AP2B 1TDQA 2OTUA 5I8CA 3I02B 1UH2A 3DGCR 3QPXL 2ZUTA 1CGSL 2NY4B 3BFOA 4WU7B 1H3UA 4BQ8A 3RNQA 1YYLL 4H0IA 2XG4A 3HG1E 3T0AA 5CJ8A 5DJYB 3WKNA 1NLBH 5ANMA 3PXHA 4HPYL 1I1AB 4QHUA 1FFPB 4WI8A 1OAZH 1YY8A 3BVNA 4NDMA 1KCLA 2W9EH 1U2CA 4L8BB 3T2QA 5KVEH 1Q9OB 3GBMH 5C0BB 4GKZA 3UP1A 3EJJX 4G6AC 2YC1A 3MJ7A 5BW7A 5F6HI 2YD9A 2DAVA 5F3HB 5SWSB 1SQ2N 4G3YL 1MJUL 3PDOB 4G7YH 3IFLH 3BGFB 1V7ML 5INCA 1JPFA 3ARGC 1IGYB 3HNSH 5C6TL 1UWGL 1C08B 4Q58C 1QO3A 5L7XH 2PNDA 4Q6IC 3WD5H 1OTTC 3BPLB 4YIQA 4OCRL 2BXYA 3WXWL 3BZFB 2H3NB 5L0QB 1AJ7H 3O6KL 4XPHH 1KT2A 3U9UA 3NCJL 3CLFH 1I9EA 1BJ1H 1E28A 5JQHC 4KMLB 4KAQH 4X6BA 5FUOL 3HPLA 4K9EC 5I66B 2J88L 5JW3L 3VRLE 2ZUUA 4OSUH 1N5AA 1VEPA 5F7UA 4KK9D 3X14A 3PF2A 1OTUD 4GKOA 4YNYB 1L0QA 3VXRD 2EKJA 3IDJA 2RAMA 3WFHA 1GGUA 1DQLL 3MNWA 3V5HA 4ZUSA 4S1DD 2EZ0C 2CO6B 3AB0B 4LL9A 4XNQB 1IC4L 5GRJH 3V4PH 1EEZA 1IAOA 1H0DA 4O5LH 5EIQA 1WIPA 4UZGA 1A4JA 1EX0A 1N7ML 3L7EA 4GXVH 4WEUD 1WWWX 1QBML 5AZ2H 3X11A 2FH6A 1UWEH 3HC0A 3UTPE 4ETYA 1Q72L 12E8H 3T3ME 1QSVA 4XCYB 3TWCH 4QF1A 5IKCA 4XPGL 4UT6L 1BVLB 2FJHA 5BVPL 4Y7MA 1UM4L 3ZDXF 5IB5A 3MYZA 3O3BB 5DRNA 4I4WA 5FK9A 5EIIA 5HI3C 3V9FA 3DHJA 1MLCB 1KJ2B 5DVKA 5HBBA 4TQEH 1LGVA 3JBG7 3ARVA 1Z9MA 1NGPH 4F33B 25C8H 4IOSD 2VLJA 2ICEA 4P9ML 4OT1L 1ETZB 4FQJL 3CFKA 1UCBH 1TENA 4YHZH 1RUKL 3GSNH 2PYEA 3JTTB 1HI6B 3TIDA 3BXNB 1UB5B 3O3UN 4JEGB 4AQ1B 5L8JB 3WEXA 5F7LB 3CFKB 2AK1H 4IIQB 3QDHA 1D9KC 3KXFE 4NPYA 3BPNC 1A9EA 1EJ6A 3PJSB 5IF0A 3ALXA 2M1KA 5T3XH 3HI5L 5CSZA 5B38B 1GC1H 3DYPA 3KPQB 5F97E 4RGOL 4NKDA 2H6PA 2QSQA 7FABL 2VDRH 3DO3A 5D2NC 3PV7A 5C0CB 5I9QB 2C1OA 3I6GB 4ZPVA 3BX7C 4YZFE 5D7LA 5EOTA 4LHUA 2MQCA 5HGAA 3KPSB 3DBXB 3GSUB 2HH0L 3M45A 4ODUB 3KG5A 4KQ4H 5BJTB 1OT2A 4H1LB 1JHKH 3IT8D 5JDSB 1C8PA 4A6YL 1H0DB 5HI3D 3MYJA 4EN3B 5H2BB 3MRCB 5C07D 4PJCA 4R97C 4J6RH 1DEEB 2ZNXA 4R3SB 1JHLH 3Q0HA 5DJ8A 5I1LB 1U58B 3NFPA 2X89D 5BV7B 2XPGA 4RZCA 3IU3A 4YEEA 4OUUA 5I1IL 3LY6A 1PG7L 3MNZB 4JFHD 1A7NL 1EEYA 3OAZK 3SJVD 3ARGD 5E2WL 2V2XA 4KKBD 4WU5A 2O5XL 5HGBB 4RBPH 5LGKA 3UBXB 3VD4A 4E5XA 5JLZB 3VWJB 3NH7L 3MV9B 1MAJA 5D6CA 1MRCH 4LSVL 4DUVA 4QRUA 5GRWA 3F7YB 5IBTH 2P24B 3FFDA 3W9EA 3QEQD 4UDUB 4KKLC 4LLWB 3PUCA 3FTGA 4JFDA 3IDGB 3ME0A 3STLA 3NZHH 4DOHE 4L5FH 3GM0A 4M5YL 3N06B 1ZT7A 4B5EA 3THMH 5IMOB 4JFPA 3V4UL 5IBUB 3WFBH 3MJ6A 2YPLD 1G9MH 3AREA 1X5GA 5CEZH 4HUVA 5I1LA 4WI2A 5EBLA 1XIWC 4MJ4A 1KIQA 3R8QA 2I60L 3QIWA 4KFZC 1A7OH 4OCWH 4KDWA 4M62L 3UTTA 1INQB 2CLRA 5HDLA 4UOW0 1I8MB 1PKOA 2CK0L 3TT3L 1RJLB 2P43B 5GZND 4Z7NE 5K9OB 3VE0B 4YZFF 3OKDB 43CAA 3H7BA 1T21A 2LVEA 3BMVA 3SKJL 1ZS8B 3D48R 4JDTH 3KLHD 4OCSL 4X98B 4TQEL 4OZFB 3BD4A 5EO0A 4LLVA 1P4LA 1A6TB 2K7PA 1SJEA 3ULUC 1BAFH 1OAKL 4FABH 5CWSB 3VGHA 4Q0XL 2K3TA 4K71B 3QO0B 5E00B 3DRQB 5EUOF 3BP4A 1UZ6E 2OR9H 1EA9C 3K1DA 5FO8A 2BSSA 4TULH 5CJQL 4JZJA 1MCIA 4U3HA 4XH2A 1NCBL 2MPAL 5JOEA 6FABH 3MUY1 3D3VA 1KJ3H 2AXFB 3DUUB 5E8OA 4P9MH 3P2TA 3FRUA 5KSUB 1IGCH 4G7YL 4G42A 4L4TA 3UCRA 2Y1VA 5D5MB 3A6BL 3U2SB 1ZOXA 3C9NA 1JUFB 2PKDA 1LO4L 3Q2CA 2JKXA 1OQOA 2FL5B 3DLQR 3MV7D 4NM4H 4HIJB 2A1WH 3DECA 2RCSL 2DMBA 3ARDA 4TRPH 5DTFB 3SKMA 4JDZA 1U3HD 3MROB 3GNML 1FZJB 1MRFH 2HTKC 3FQXA 5E9DB 4BH7B 4Z0BL 2ZSVB 5SV3A 4QNPF 4AEFA 4NZRH 3BJ91 2BOCB 3K46A 3VGGA 1MHHA 2Z31A 1CT8B 2ZPKH 5GZNC 3JWOH 3KJ6H 3RZCA 2QEJA 1RUAL 1EFQA 2JJVA 4XWOD 3HPJB 4XZUA 2Q8AH 3O6ML 4K94C 4U33A 1GGBH 4KTDL 3PWVB 1YNKL 1AI1L 3GSWB 4N1CA 3VMNA 3JTSA 4R4BB 3ZT5A 3ABZA 3D18A 4ZFGH 2P8MB 3TBSB 3KR3H 1U8MB 3DSFH 4K07A 3AM8A 4NM8L 4KK9C 2HJKB 5KVDH 4YX2H 5IBLD 4Z7NF 1Y18B 1HHKA 4GAGL 1JCKA 2E27L 4NN6B 5GGQH 1DLFH 1B4JL 1YQVH 3GMOB 3HFMH 1ONQB 3Q6FA 2VDQH 3B2UC 4OFVA 1NEZA 1U8KB 2FLRT 2W07A 5I66A 4CU6A 3L95B 2UY6A 4LARH 4KROB 1FFOA 2IH3A 3W39B 5J11B 3MX0A 2NXZD 1EUTA 2GT9A 4HUWA 3CUPB 1KCVL 1P84J 5JOFA 4LSPL 5J11C 4PD4J 3QUKA 5FAAA 4O9HH 1OP3H 3ZKND 3QT2A 5I1EL 1HHIA 3FFCB 5INDA 5FV2A 5INCB 5KSAC 1CTNA 1NAMH 3P73A 4P5KA 3CSGA 3VGBA 3ZKMC 4FNLH 2ICCA 5DVMA 4YHPB 1I7ZA 4ZS6D 4JHBA 2BVPA 2J6EA 5CIPH 4JN2B 4XWOC 1J1XH 5IJKA 3UJJL 3JSSA 2VNCA 3O3AA 2IH1B 3CDFA 2PW1A 3TESA 4ZFFA 4Q2ZA 2EC8A 3NIFE 1ZVHA 2KL6A 1YY8B 3PGDA 4NDMB 4YR6A 1U95A 1JI2A 4HWUA 1CLCA 3WIHA 3O2DL 3TF7C 2NY7H 2NXYC 4FQ2L 2A6IB 1YPZF 4QNPE 2XZZA 1MF2L 1PQZA 3DUSB 4ELMA 4HLZG 3VXSB 3V8OA 4IMLB 4R97B 5F6IB 1T1YB 1BZ7B 2FZ3B 1QBMH 5AZ2L 1MCDA 3LRSA 2LQRA 4QRRE 4X0KB 4JY5H 2CKBA 5CILL 1AO7D 3B3IA 1ZHKB 1E4XI 2J8UE 4KQ4L 4PTUA 4DZBB 3BYYA 1F4YL 4BFEA 1IGCL 2CDEA 2Q8BL 3HG1B 5JNYB 5DMJB 1W0WA 1QEWB 1YYMH 4OFKA 3VFOB 4XMLH 5EU7E 1NAKH 1S7VB 3KDMB 4RGNE 5I9QC 1QSEB 2VDPH 4NYLB 3NFSL 4WHDA 2VE6A 3AFLA 4X6DF 1IGIL 3LZFH 3HNVH 4MDIB 5GHWL 2EZ0D 3TA3D 3U83A 1MI5A 3VH8A 2O5XH 4QRSB 2YD4A 1WAAF 2AV7B 5DWUL 4HT1L 3AM8C 1GOGA 1HQRA 1EFXD 1XMWA 2V5RA 4JPKH 1LO4H 2W0FA 4MD0B 1TZHB 5C1MB 3OGOE 4IMKA 4DEPC 3OR6A 4YBLB 5KANG 1JGDB 2FD6H 4M93C 4PJGE 4ALAH 1KIQB 3C6LD 4JPVH 1MFAL 1J05B 4LEXL 4K3DL 1JFQH 5A16A 4ESKA 1Q38A 1KEML 3L3KB 3ZE1F 1Q1JH 2VISB 1F11A 4H20H 3DYOA 2O5ZL 2FJFA 5JW4M 1GHFH 3E6FB 1AXSA 3OHXA 1FFRA 4R2GD 3ZYOA 2YBRB 4RX4A 4PRPA 3SEPA 1A64A 3ULVL 1H8NA 1RUML 3L3DA 5TF1H 5TFSH 2FX7H 4KDVA 3KPOA 4FQCH 3CPLB 4NO2B 5SWSD 4MX7B 1WT5C 4KDTC 3KPNA 4XCNB 2ENYA 3NIFF 1HCFX 2B1AL 3G5XB 2BNUB 4OCWL 4NJ9L 5IMLA 2HKHL 4JM2D 4CUCA 1KTLA 4RWHA 4UQ3B 4F80A 4C83A 2CRZA 2W9DH 3AMLA 1P84K 5IV2A 1NCAL 1UZ8B 3JV4B 4K9EH 4X5WB 5I16A 2XN9E 4R7NB 1MCRA 3DRTB 5JXAL 4RZCB 1LP9B 3T1WA 3RWCB 4GG6B 3LD8C 4LASL 1N2RA 3OB8A 1KB9J 4P4KB 3NABL 4PJGA 4OIIL 1BQSA 3OKKB 4WNQA 5GPRA 4EXKA 1PYWA 5J12B 4HAGA 3IRPX 3GSUA 3HI1B 3HLAA 4Z77B 5TE6L 3P30H 5H94B 3ZTJH 4UIKH 5E4IA 2R1XA 1KEGH 1X3DA 3QQ9C 2GEEA 1EHLH 5GJSH 4WY7L 4UTAL 4JN1H 3TIEA 4LAJH 4L4TD 1Z2KA 2BSED 5T5NF 4D2NA 2H45A 5JIIA 5LCVH 5DFVD 4FA8A 3BRDA 4KZEL 3Q5TA 2HLAA 3G6JA 1INEH 1HYSC 4YC2C 3UYPA 4ZO6A 4U1LA 3RWIA 4IRJC 4Y2DB 4PGJA 2UWEF 3WNNA 1WFNA 2NCMA 4LPCA 5LXGL 2ATKB 1GJIA 2EEBA 3E6HA 2ERJC 1BQHB 2P5EA 5B39A 1BQLH 3D25B 3ULUH 4F2MB 3RHWF 1HQ4A 4MA7H 3KLAA 1AGEB 4TNWK 1U8JA 3HZKB 1WF5A 3D69B 3SOBH 4XBPB 1SVCP 1RMFL 1KELL 3IXTA 3IFLL 2DB8A 3VXPA 4WI5A 3S8WA 4IDJH 1UYWH 2UZIH 1T1XB 5KSAD 1SY6A 5F89A 3RX5A 3X13B 4AENA 5D9SB 4YPGA 2FJHB 3UTTE 4G6KH 4OFYA 4N1EA 2P5EE 5IIEB 4PG2C 1U8LA 4I3GA 1UADC 4OCXH 1JGUL 1ORQA 4YHNB 4IHOB 3BZEB 2AEQL 3ARED 3RL2B 2YPLA 2BXZA 4KJQD 1GPOL 3HKFA 4G7VL 4OF7A 4PJHF 4YHKL 1O0VA 1KTRL 1CLOL 2E9JA 4I5BB 4QKXB 2P4AB 3OG4B 4HHAA 5GGSY 1KCRH 2A6DA 3A6CL 3QHZH 3U7YL 4MCYB 4PR5B 3FCTA 1XR9B 5IFHH 3KYMA 1B4JH 4MSWB 4NRZB 5HDQH 1X5KA 3DX9B 4NKMA 1YECH 2NY2B 2NXZB 1CICB 1PW3A 1OGTB 1HEZB 4MNQB 4Y1AB 4O5LL 4KU1A 4KXZH 5EN2B 1AXTL 1ZTXL 2X1PA 4XXDA 2LVCA 3L5XH 1I4FB 1S7TA 3L7FB 3WNMA 5JR1H 1OQXA 1QKZL 1FYTD 3EUUA 1S9WB 4BSVA 3WO4C 1O7SA 5AYQA 5IGXL 3OKEB 1PZ5A 4XP4H 5L2KB 2YA1A 4NBXB 4PJ5E 1G7MA 5L8LB 3KHQA 1X7QB 1XGYL 2JJTC 5MENA 3OKOA 2Q8AL 4V2BA 3CCHA 1E6JH 1G6VK 2EIBA 3Q3GA 5GGTL 1SEQH 1W72A 1D5MB 3O2DA 3O3DB 2H41A 5EG6C 1BBDL 2NPLX 5DJ6B 3UTQB 5L7XL 1EXUB 1ZHLA 3NGBC 3RWDB 2DKMA 4O2CB 4MA8H 1MFEH 2D03L 2IAMD 2FYYB 2X4PA 1A6UL 4ZXBA 3ZHKA 1ULVA 2HTLC 3PWJB 2IFGA 5JA8B 4D0DA 2GTWA 5EORL 2G5RA 3W5MA 2X41A 3VFSA 1T0PB 5GS1C 3L3IA 5C0BD 4XNZC 5IVXA 4G43B 5SWZA 1F45A 1T2XA 4UAOC 1HK6A 1MCQA 4LBEA 3O3EB 5HXMA 2HMID 3BPLC 3ILQC 4YJZL 1XCTA 3OJDA 4OTXH 5B39G 3K80A 2EDQA 2QKIA 4X8JB 5CGYD 2D7MA 5B8CA 2ADGB 2VDRL 2ITCA 2F8XC 3GHEH 4PRHB 1T66C 1QLRB 2AJSH 3K2MC 1BJMA 4EDWH 4XRCB 4U7KA 1BM3L 2AJZA 3SJVB 1LDSA 3QPQD 4M1DL 2EIEA 2D7PA 5GIRB 4QTHB 3SGDH 4MA7L 3GK8H 2AEWA 1T4KA 3KYOB 1HE7A 1JTTA 2QQKH 4WWKB 4OBRA 4UT9L 1HH6B 4XNXL 3QUXC 1DUZB 1F4AA 3ELAT 1OAQL 3GJFH 1VFAB 3T65B 1WEJL 2UZIL 5D7LD 5DO2C 2DICA 2ZUQB 4EOWL 1GL4B 4HKJA 3TNMB 3SOBL 4EIZC 8FABA 4ERSL 4MQ7A 3VDCA 4EUPG 4AIZA 3KWWB 1MCWW 1KTKE 2AK4B 1FL5A 3M07A 1KJVB 4P9HL 5LBSH 1LE5B 1DJSA 3UROR 1CICC 2NNAB 4PJDA 5IB4A 1FPTH 3CDCA 1CLZH 5F7EL 3UTSA 5I74C 3F7VA 4KPHL 4YHOH 2V2WA 4MAYA 1FLRH 1TVHA 1N8ZA 5GSRB 3U7WH 4P46C 5DHXB 3SDAB 3SO3B 1BIIB 2Y7QB 2VERN 1IFHH 4TTDC 4QOKA 3CFBA 2EH7L 3S35X 4ENED 1KB9K 2X4NA 2W91A 5DQ9A 2IPTL 2VSCA 3MRNA 2C3HA 2AEQH 5DFWH 3V5KB 1A02N 4JGJA 2IF7A 3BN9D 5M95B 1CFVL 2LU4A 3BWUC 4XVSH 2BC4A 1P4BL 3MBXH 2B1HL 2LTQB 5GHWH 1I1CA 2FEEI 3KPNB 5E8NB 4HT1H 3ZTJG 3WJLA 3BIKA 4NO3A 4KVCH 1NBVH 3EDFA 3LKPB 4FFWD 3PGCB 1VGEL 4PJAE 4RAUB 3KYKL 3FO9B 4NUGL 4BYHA 2A0LD 1J0ZA 4IRSA 4JY4B 3NABH 5KSBE 1B0RA 1CVRA 4UTBL 3C09B 3VXOA 2RBLA 4JQIH 2EDKA 3R1GL 1P6AB 4WI6A 1HXYB 3WN5B 4KHTL 3GO1L 4LKXA 1AGCB 5I1IH 4PB0H 1T80A 1L0YA 4OD2A 4Y4HD 3GI9H 2GUOA 2YWZA 1FDLH 1CXHA 3WUWA 1OAUH 1QBAA 4E42A 3HE6A 2AJ3A 2AXHA 4PJBE 5DD5H 1EK3A 4PRBB 1KN4H 2QQNL 4MD5B 2DWDB 1RK0A 3RNKA 4TPRH 2NXYB 1F3JA 5F7WC 1GGTA 1G7JB 1LO3H 3BN9C 4HJGB 4OF6A 3BWAB 4ZS7H 3AS1A 4TTGA 5D2LA 5I8OL 3DVGA 1X5YA 3ARQA 4BSWB 2HG5B 4JFYB 4XHJC 1IGJB 3ZDZF 2C26A 5F9JB 3EDEA 1II4E 4OZGB 1LILA 4Z7QF 2FECI 1KPRA 4ZQKA 1BQUA 2J8UA 2J6EH 4WUKL 5T3ZL 4DCQB 5IQ7H 5FO7A 2VWEC 5KSAB 4I2XE 5FDWB 2NY4C 1G9EA 1A6ZB 4F7MA 1XCTB 3OJDB 1OB1A 4PJFB 3K8MA 4JFYA 2V17H 3AUVA 1ORSB 1DUYA 3EYVA 3HCVA 4YFLF 3P9MA 4LFHD 2YPKB 3WIHH 3G04A 3JUZA 1LQSR 1O5DT 3IKCA 3RJQB 3ES6B 4R9HA 4PGCB 1OD9A 2WWMD 3RX7A 2HT4C 4ZTOH 5E4EB 2BVPB 1JN6B 2GSGB 1U42A 5I8KH 5F1SA 4G8GB 3CVIH 4IRZH 1CZ8L 3QIBB 4OV5B 2HT2C 5GQBA 1VPOL 4K3JL 1JYNA 5IFAL 3FT3A 4BUGA 1MCPH 1YMMA 1F8TL 2R1YA 4U2YA 3ZHDA 3KPPA 1H3XA 4KK5D 4KH2A 2DN7A 1EH9A 5I1AB 3SPVA 2H26B 3ECBB 4NZTH 4XPTL 1FAIH 5BV7H 1TJHH 1FE8H 2DQFA 1FFOB 5HYJA 3N9GH 2OS7A 4JHAH 3NACH 1AHWA 4N0UB 4P46D 4YEFA 5ITBL 2Y23A 1I8IB 5CEYB 1SEBB 2YA2A 4QYOA 3KPMB 1T03H 2HMIC 3GMOA 2R39A 1T89C 3QNYB 5IGXH 4LSPH 4Y4KC 4HK3N 3D0VA 4Y1AA 4NRXA 5IBTL 1MEXL 4HWEL 2JJTA 3QWOA 3DX9A 4ZNEA 2W92A 1I1YB 4NHCL 4N0UA 1AQDB 1E4XL 1CIDA 1FRGH 1G7PA 4PR5A 3AY4A 1MCOL 3UYRL 3F8UB 3BH8A 1GPOH 3SPVB 3PWVA 4XP5H 5F6HJ 3I6LE 2FO4B 4LNRB 3MLYH 3MUGB 1EVUA 3GSQA 1R3JA 5K9KA 5AG9A 3IAPA 3QEUB 1B4RA 1DQQA 1AC6A 1JNJA 5I8EA 5C0DA 1RI8A 2DQCL 3FB6B 5CSGA 3LEVH 5LAXA 5MEOA 1I9IH 4U1MB 3MGOA 2GSIB 4ZNEE 5AG8A 1PG7W 4ZO8A 1J9CT 1IC1A 4KWUA 3LRGA 3GRWL 4K8RD 3TYFA 4YFEA 3SKMB 3GUTA 4WW2B 2P5WD 1HILB 2HJFB 4J3TA 3RI5K 3E8UL 1MJJA 3ALWA 4Y5XA 1DBKL 3NA9L 4K2UH 2HJLA 1HH6A 4Q0XH 4HXBH 3U0WL 3LS5L 4PJBF 2HT3D 1RZJC 1H5BB 3G5ZB 4L1HA 3QHTC 4GQPH 1CFNA 1YEDB 1CD1A 4DW2H 4G8FA 5K9QI 2VN7A 4X4XB 4KY1H 3ZDYE 5I1EH 2AJYL 1WV7T 4U1LB 3HC3H 3DWTA 5JPMA 4RMTA 3UAJC 3BESR 5GGSB 5MP6H 3KJ4B 5DJAA 2F54D 3TLRA 4R4FH 2I26N 3A67H 3O45B 2D0HA 4X7TB 4Z76A 4CNIA 4KVNH 1KJ3L 3BD5A 1AR1D 2NY3D 3ET9F 4ELME 3V52L 5I18L 4PUBH 4CKVX 5D93B 2G5BA 1AFVH 4GRLC 4E42B 2G75A 2V5TA 3QCTL 1Z3GL 1VEMA 5L2JA 5FOBA 1CK0L 5L9DH 1JWMA 5C0IA 4G43A 3MLPA 5C92A 3IU4L 5EOQH 1KOAA 2I27N 1AGCA 1HYRC 4XCFH 4L3AA 1XGPB 2AQ2A 1VEOA 4KRPB 3M8OH 4NZUL 4ZFZB 3S35H 1F00I 3SDYL 3INUH 4QHLA 4S2SA 3G9VA 2AXJA 2HT2D 3O6MH 4LP5A 4ZXBD 2UVEA 4XBEL 1ZT7B 1OAYH 3LKPA 1RIVL 3STLB 4XHJD 4NO3B 4XC3H 3V4VL 1J0IA 4UIMB 2VMFA 4S1QH 4RWYH 1SBSL 3BE1H 4EKXA 2J5LB 1EDQA 3AXLA 3IJYB 1E4WL 5D7JC 2XY1A 4UIMA 5T33H 3RWFA 5J1TC 4PB9L 2FH8A 2ILLA 5EN2A 5CJ5A 5F9AC 1D3CA 3UBXA 1I7UB 2YRLA 3MV8A 3WD5L 5CEZD 3BGFC 3S7GA 4R90L 1JGLL 4JHWH 2E27H 4GO6B 1D6VL 1K8DB 1FC2D 3ESVF 2FNBA 3GI9L 2Q6WB 3DVNB 1F2QA 2HRPL 2ARJB 3LKNB 4HUMB 5DRZA 3VGAB 4P99A 1S5IH 4M7KL 4U1IA 1PLGL 3L5IA 1P53A 5DK0B 2FBJH 5FM5O 1B2WH 1M7IA 1U36A 5T1LD 1M05B 1BX2A 2HFTA 3MRQA 4D8PB 1BMGA 3NIGE 4WEBL 5EULV 3Q6GH 2Y36L 3I6KA 1ZGLA 1HDMB 2QSVA 1RURL 2GSGA 1VKXA 4M6OH 1FG2B 1ED3A 4QRPD 4MLIA 3UO1L 1A1NA 1MH5B 3VXRE 2EO9A 4KGJA 3B5TA 4LSUH 5D8JH 4DKEH 1TFHA 4LFHG 5KVFL 4PREA 3U36A 2X40A 4ZAKB 4JQIL 4HMCA 2NR6C 3QQ3B 3L3HA 1UENA 3HI6H 4U6TA 1R5IB 4YXHL 3QPXH 4KUCF 3H9SB 4RNRA 5C7XL 3KXFD 1NC4A 3H8NA 1MNUL 5E8PB 1U8JB 1NMBH 1JF6A 2OI9C 5FO7B 3NZ8A 4C56B 3VFUB 4WHTA 5CILH 3IGAB 2ZUYA 4F7EA 3QXAA 2NY5H 1W0VB 4M03A 2DS4A 3QR2A 3EGSA 4PJBB 3RWIB 4FQXC 5DT1L 2VZUA 3I9GL 4ZSOA 2V9QA 4X6EB 5BXFA 1R0AH 3P30L 3N50A 3ZLQC 4D0BA 4JB9L 1WITA 2NY5C 2PTUA 4NQXB 1FG2A 4I77L 1JNHB 3BEVA 2W60B 4DJMA 4FFZH 4JREB 3RWGB 5J9PB 2DWDA 5SX4H 4MJ6A 3OZ9L 1OTUC 4QRRA 1FNAA 3BZDA 3OXSA 4I0PC 4KUZH 4X6CE 5CJOL 2YUVA 1FZKA 4LLYB 1SJHA 2A83A 3HE6B 4DWHA 5E8EB 4FS0A 2AV1B 3LKOB 3VI4E 3GMNB 1AD0B 2CGRL 4Z8FL 1GC1L 3S35L 1L6XA 2FO4A 1L7TH 2AEPL 5C0CD 5HVFB 4TSBL 4OQTA 4Y2DD 5MENB 1NJ9A 1FNGA 5E6ZA 4HUWB 4Z7WB 1G7PB 3QULA 2V17L 3WIIH 3O6KH 2HN7B 3LKQB 4XP5L 1M7XA 5F21B 3SDYH 3C8HA 3PP4L 4KGLA 3V4VH 3P0GB 1DTUA 1W0YT 1B9ZA 4F37F 1JZ6A 4AEHH 1KCSH 3T0VA 5LKNA 1OLLA 2C9AA 2FX8L 3QFJD 1RHHB 3O8XB 4MSWA 1E28B 5DHVB 4NO2A 4GUPA 1WK0A 4ODSL 3TZVA 4U4BA 4Y5VB 3FT4B 4JRYB 3X3FH 1G84A 2CRMA 3K4AA 5BRZE 4NT6A 1QO3B 5F1NB 5CUSH 3CZJA 4NQUA 2P1YA 1ADQL 5KOVC 1I7RB 5DO2D 3QNXA 2V5SA 3TV3L 1YN6A 1IT9L 4FQIH 3O2VH 2CUHA 3ILPB 3S6CA 4D3CL 4MAYB 3NVQA 1JZ8A 4GMTL 1FZJA 4I13B 4CVZB 4HWEH 1BPVA 5BVPH 3X17A 4NRYB 2R2HB 25C8L 5FOBB 5KS9B 5TE6H 4U1NB 1MRDL 5GS3A 1DEDA 1H3WM 3DROA 1EHLL 5IW3A 4R4FL 1XF1A 1E6OH 3VH8G 5C8JB 2A77H 2D9CA 4PRNA 1QFWH 4OSUL 3E2HC 1V3JA 4DKEL 5KSUA 1C5BL 1RURH 1S78C 1GAFH 4XNUL 1FZMB 4AIOA 4PD4K 3TJEL 3S34L 4YDJA 2IEPA 5CEXB 3HG1A 5JNYA 3ZYJA 5CJXA 1NUFA 4MJ6B 4MMXC 5FHBL 1VENA 2HAZA 2NY1C 4DEPB 4OZGE 3VFMA 4QXUH 5EUOB 4CGTA 3HMXH 4OZHF 1IC7L 3QQNA 2DTMH 5D2LF 4F15B 3AMKA 3TCXA 1YMME 1CGTA 1CFNB 1YEDA 2IADB 5IMKB 5EU5B 2FZ3A 1FZMA 1WWAX 4J2XA 2AVGA 3FT2A 5FA3B 5JW4R 1JZ2A 2W0PA 1YQ2A 2IQAB 3PDDA 4X8JA 2R69L 3MNVA 3HZYA 2C1PB 3ROOA 4MB3A 3NPZB 5GS0H 5C0ND 3L5HA 5GXBB 3WUWB 2CLZB 3RGVC 1PZUB 2EXWC 4Q2ZB 4P2QB 4YO0A 2I9TB 2CIIB 2F5AL 3OKKA 4KKLD 5F8QC 4XC3L 1M71A 2J5LC 4UV7L 5E2TL 2DLEA 5BMFH 2ICES 4Z7UF 4JN2A 3L5WB 3BE1L 1PD6A 3WS6C 2ZCHH 1DSFH 2DJ4A 5HPMB 5GGTA 5DHYA 4P5KB 1RIVH 2OMNA 1U8NB 4GRLB 3RWHA 1K2DA 4NWUL 1U8IA 3RUGF 3REWB 4KVCL 2A6KB 2A9MH 1QYGH 2CDFB 1EHNA 3FO0H 4G9FB 5LGJB 4N8VB 4NHUA 2OQJB 3PWNB 3UPCA 3QXWA 4YDIH 2MQ3A 2H32A 5C0AD 3CX2A 3WXVL 3NZHL 5EZJB 3VXUE 2UZYB 4BH8A 5DK0A 3QZWA 4J4PC 3RTQA 5JPNB 1BFOA 1I4FA 3V6ZB 4L4VB 2EE9A 2EDLA 3HN3A 3QI9C 3VGEA 4LVOB 5ESQB 2ZNWA 1VFBA 5H35B 1AE6L 5EPMA 1GGBL 3CH8A 4QOKB 3MXWL 5ESQA 4KPHH 3L3KA 2X4SB 5GSRA 2EYSB 3O8XD 4HX1A 2YN3A 2EECA 4OZGF 4EXPX 4NGHL 2IAMB 5DRXA 1GZPA 4Y8DC 2DYPD 3FKUS 2J4WL 1AR1C 4GXUN 1GXEA 2A0LC 3IDYB 1NLDH 2X4TA 2XQYG 4GAGH 5C0EB 1K8IA 2E8ZA 5E8EA 4U1SB 2D3VA 4P49A 4GMTH 1OLZA 3RHWK 2BVQB 5L88H 1MFEL 3OF6A 3RWGA 1A3LL 3SGJA 5T1LB 5KAQG 3C5JB 32C2A 5F89B 4HH9B 1IM9D 4JRXB 2NR6D 4Y0GA 4Z7OF 1RZJL 5T1KA 2PCPB 4QHMA 4HKZA 2XN9A 3EYVB 5HHNA 2ESVA 1S7QA 5IVNA 1UWXK 3WHXB 1T1WB 3S37L 4S0SD 1GAFL 4P2QE 4JQVA 2OR8A 1JHKL 2NLJB 3NPSC 1PLGH 5KSAA 3D0LA 4D0CB 4MNQD 4M6NL 1JWUB 2BNQE 2JJWA 4PRHE 1TCRB 2Z91A 5E8OB 5B8CB 5HHME 3MV8E 4L9LC 3MO1A 5LWYH 3CSYA 3WHE0 1J0JA 2H2PC 5CEZL 5FO8B 4PJDE 2F19L 1BOYA 3U36B 5DVOA 4P57A 1MAMH 3K4DA 1MFBH 3IAQA 3PDGA 1CGUA 5FFLA 3PIQA 2D2OA 4JM2C 3RWEA 3VRJA 5J6GB 2LFGA 5DRNB 2L4OA 5A1AA 4L3EA 4HCRL 1VKXB 2V7NB 4R8WL 2VLJD 3MO1B 5J4MA 3QWQB 2NY6B 3CMGA 1ITCA 4D9LL 4YHLL 5HYJE 1HN1A 5IB3B 1TJHL 2IQ9H 3QP3A 2AQ3A 4LDEB 1RQ5A 2X4UB 1Z0MA 2VXVL 2UV3A 1EERB 1QRKA 4WFEE 3LKSB 2EXWD 4WNQB 3UJIH 2G60H 2ZCHL 3HRPA 2NZ9C 4AT6B 4H8WL 2PTTB 4FABL 5JXEA 2J8UF 3QIWB 2PCPA 4QRPB 1HILA 3UYOD 4MDJB 1YNKH 4NRYA 4OKVB 2YA0A 4HGMA 5IHZA 4OLZH 4QO1A 3QQ9D 4QY8B 5IMOA 1EZVX 4BFBD 5CEZE 4HFWB 1OCWL 4V1DE 4XMPL 2ADIB 4XXDB 5DC0A 5JW4Q 1H3PL 5EBMB 3QUYD 2HJKA 4JRXE 1IKNC 1CXIA 4AH2B 4O58H 4H8WC 1QHOA 3DXAB 5F1NA 2P8MA 4PJ9C 3DV4A 4PJXF 5D2NE 2VDKH 2PO6C 2E8YA 3H0TB 4X4YA 4HBCL 2H3NA 2KBGA 3QB7C 1OAXL 3OB0H 4XP1L 1MRDH 1OWWA 1EHXA 3MRLB 2XFXA 1PKQA 4LPYA 1U8LB 5E5RB 5BOPA 3EOBA 5TQ0H 3RVUD 5D9SA 4GKZB 4NFBA 5C0NC 1XF4B 5JW4N 4Q6IA 3MROA 4XAWH 1TXKA 5JO5A 5GRVL 4NQCE 2QQNH 4P2RB 3VXQA 4N8VA 1FQ9C 5E99L 2SEBA 1KPUA 2BRQA 2CDFA 4NM8H 4WI9A 5CP7A 5E1AA 4Z0XA 2J12B 1A3LH 4G6MH 1U8IB 2ESVE 5D7SL 1FZKB 3H3KA 2H6PB 3C6SB 5E2VL 4O51B 5IB3A 1DLHB 1RZKL 2GW5A 2YUWA 3VMPA 3ZT6A 3N1QC 5IF0B 4FZEL 4AMKL 3QUZA 2X1WL 4D0BB 4V1DB 3TBWA 4MD4B 5T3XE 5EBWB 2X6MA 3ULVE 3SDXE 2F15A 3VD9A 1UZ6F 1T1ZA 3BISA 4OZFA 4IMLA 5EO0B 2VZ1A 5J89A 3F58H 1W0VA 3CXHJ 3QCUH 1IQDB 2XRAH 4PJEF 3LMJL 4KI5C 4F33A 1RVFL 3QXDA 2UVFA 5EZOH 3HRZB 3O2WL 4ALAL 3SE4C 1MLCA 1EJOL 3O3AB 4PJXE 3QH3B 3BH9B 1D5ZA 1FL6B 2WWKO 2XWTB 5SWQB 5ILTH 4OZ4B 3TBVB 4PRIE 1MPAL 2EYTA 1I7TA 2Y5TA 2XWJA 2VXVH 3U7AA 2GSIA 4M7ZC 1R5WB 5FYLE 3CXHK 3FQUA 4JVUA 1L7IH 4QF1B 4R0LA 3SKOA 4GKSA 4OI8A 1IC7H 3QA3B 4XX1G 4LHUD 4BZ2H 1N6UA 4DKAA 2K9UA 4X5WA 1G0XA 3MRPA 5DF0A 5KVGL 5CP7B 5C71A 1C1EH 3I2CL 3GMRA 3QHFH 3GNMH 1DBBL 3OX8A 5AWNH 1ZHBA 4FQXA 4PV8A 3NPSB 1K5NB 2BFVL 2R0ZL 4GRWH 4U1NA 4YGVB 1PEZA 5IP4A 4HULB 4ZPTA 5C6TH 1RUMH 5TF1L 4QGYA 5HHXL 4OD2B 3EDJA 5JW5A 4NCC1 4G3YH 1MHCA 1JNNH 4YHIB 3C8KB 3WFDH 5SWZE 4NRXB 2F54A 4KV5F 2AI0L 2EIZB 1IC5L 1LEGB 2J8HA 4MWFB 2ZUQC 3DVNA 1QD0A 3SGEI 3V6OA 4M93B 3L6FA 2Y36H 4H88H 3VI4F 3AB0C 2VIRB 5DURB 4L4VA 3NCJH 3V6ZA 3GSRB 1GIGL 1NCWL 5H2BA 4I5BA 4I1NB 5ICYB 1V7NH 4H1LA 3NCYS 1AXTH 5T1KD 5K33A 1G7LB 1QQDA 2BX5A 4JFQA 4UTAH 5TJWK 4MXVF 5CZXD 3RVXD 2C1OB 3I6GA 4N68A 1XGTB 4ZPVB 4PP2A 3P4OA 1E4WH 5HDBF 4NOBA 3ULVH 3DMMA 4PGCA 2VXUH 2Z8SA 4PB9H 1RFDL 4MDJA 5ABDE 3BN3B 3BUYB 4JN1L 4DN3H 1UQSA 4Y2DC 1NJ9B 4MHHG 5BS0D 2D03H 5DJYA 4Z18A 4HXBL 3UDWA 4NJ9H 4J1UB 3MRMA 2I25N 5E5MA 1SJXA 3O6FC 5JIKA 2VXTH 1NCUA 4NUJA 4OGAC 4KY1L 1BQHA 3N1FC 5I8CB 2FBJL 4RMSA 3RBGA 1IGJA 4M8QA 3DX7B 5IVOA 4L3EB 1CLYL 4G8IA 5CJOH 4OZIA 2G60L 3QNZA 3MFFA 4Y5XC 3QCUL 4M8VA 1EGJA 5CIPA 4DVRH 5C0BE 5MP6L 1AGFA 1AC0A 1CWVA 2BY0A 5KVMC 3B2UD 1RK0B 4F7EB 3ARSA 1H3VA 2DIAA 5GGVH 4I18A 4DQOH 4NUJB 2NXZC 3HMXA 4F9LA 2AAVA 2FHBA 1Y0LB 1KLFA 3IDXL 3WHXA 1R6VA 1U8QB 3C6LB 4P4KD 4OCNC 2VDPL 4F15C 5HI5C 3RVWC 4IS6B 1AJ7L 1IEAA 1YJDC 3JWOC 5DA0B 4RAHA 3RPIB 1NEZB 3CMOL 2BOBA 1A1OB 5E8DH 4CJ0A 1T0NA 3BYTA 1CICD 2P48B 3IF1B 3ZE1E 1MFAH 1U8MA 3QIWC 4KKCC 4KAQL 5K9KB 4IDLA 5DA4A 3FFDB 3EIFA 1SMOA 5KW9L 3QRFM 4WO4D 5C08D 1GHFL 1YN7B 5F7DB 1AHWC 2Z8RA 4PGZA 2R1WA 3VXTA 1QFWI 4GUPB 1G9NL 5EB9A 4MAYC 3WV0A 5KSVB 5I1JL 1NFKA 3RZCB 1VFBB 5H35A 3MV8B 2D7NA 1U3HB 5A16B 2ITDA 1KC5L 4JHWL 4M5YH 3ULUL 1FAKT 3FAXA 4XI5C 4XHQA 3CX5K 3RVUC 3MJ7B 2YC1B 1Z5LB 1EFXA 1KN2H 1OF2B 4TN9A 4BQCA 1JMZA 4I0PB 1AY1L 3HTLX 4UT6H 1BHGA 2YR3A 4Z7WA 2AKRA 5GGRY 1EO8H 5EO9A 3LD8B 12E8L 5GRUL 4QOKD 3QUXD 4OGXH 1AIFA 3LEXB 4G9FA 2AXGA 4NQSB 4DN4H 1N64L 4JGUA 4Y8AA 4WW1B 1DE4A 1YEHH 3SCMB 5FKAB 2QBWA 1QBLH 3U4EA 3RL2A 4RRPG 2OK0L 1IGFL 4LLDB 4BZ1H 5C0CA 3CFDB 3EYFB 3B8SA 3MRRB 1QA9A 2XWJB 2DQEH 3V95A 5DUMH 4JFZL 1W72L 5BS0B 3ZSTA 2BSSB 1BF2A 4N0FB 4ZXBC 1HXMB 3ARFA 4NNXA 3PIQB 4JFFB 4KXZI 4P5TC 2I5YL 4WO4C 1NFIA 4K7FB 1QPPA 3B9EA 4PJFE 4GT7A 3JZ7A 2QADD 1KCKA 1TTFA 3RI5F 4P2OA 4CVWA 3CSYB 1IM9B 3MLRH 3TO4C 1A7RL 1IAIL 1ZAGA 1T1ZB 4OD3H 3O45A 4PJ5D 4YR6B 5DC9B 3E0GA 3P0VL 2DQIH 4ERSH 2PR4L 5HYIA 1ND0B 4I0KA 4P2QD 1IAIM 1T7XA 5BS0A 35C8H 2DBJA 5EUOA 2J6EL 5T3ZH 5IQ7L 4IOIA 1TZIA 4LVOC 1NC4D 5TE4H 2Q7YA 4P0DA 4Y4KA 4ODWA 4OD1L 1P9MC 3FQNB 2X4PB 1FV1B 4FFZL 4CADA 3MREA 4DGYL 3WIHL 5D1QA 3RNKB 2IGFH 3LDBC 4LSRL 3MV01 2X1XR 4LDLB 4MS8C 4HIEB 1G7MB 3HE7C 4Q9BA 4YBQC 4KQ3L 2GUOB 5GRYA 2W65B 4HS6B 1M7IB 4NQTA 2VLRA 1Q0XL 1S9XB 2IAMA 3WE6B 4YNYA 1FH5H 4YUEH 4Y4FD 2AK4E 2ATPB 1N5AB 1SY6H 1KPVB 3VXOB 1FVDA 4QWWD 4KHXH 3HMWH 4EBQL 5L2KD 3C5ZA 2R4RH 4PRDB 2DIBA 3IDUA 4JFFD 4KK6D 1T6VN 4Y5VA 5DRWA 1WJ3A 3RA7L 5J1AA 3BQUA 3K3QA 1MY5A 1YN7A 3NGBB 2ADJB 3QUZD 1MSPA 3C2SA 3HE7B 1P7HL 3PL6C 1MQ8A 3QG6A 3BO8A 1X6LA 3W9DA 4CVUA 5JZ7D 3RVXC 2QQKL 5JMRA 2A6KA 4TVPD 3QUML 5CBAB 1XF5A 5HYEA 1NPUA 2CK0H 1JNLL 4ZS7L 3FJTA 1CFVH 3EO0A 4D3CH 4JLRB 5T1DH 2BSTB 5FYJD 5ISZE 3QULB 4CW1B 5I1DA 2IC2A 3BP5A 3FHAA 4JDTL 3OKMB 2DQHH 4HFUL 5DR5L 3V7AE 3L5WA 4CJ1A 8CGTA 1U8QA 4S0TD 1IGFH 5FGRA 3CSBA 3IXTB 4PJ9B 5I6XC 1WT5A 5ICZA 3CFJA 1NAML 2O61A 1JRHI 2AV1A 4G42B 3C8DA 3I6LD 4M1GL 3UTZA 3BMWA 3STBA 5DEGA 1OAKH 2X70B 4QXWA 1K4CB 3ZTNH 1AKJB 4G6FD 2XZAL 4FXLA 3NAAL 5GGRA 4JR9H 3W0WD 1CL7H 2BVYA 2IPTH 4B41A 5B4MC 3MCLH 4WO4B 5C08B 2WBJC 3QO0A 2V9RA 2FSEB 1NCDH 5GGVL 1HINL 1P4BH 4WTZA 4X98A 1WFTA 4HPYH 3UTPD 1INDH 2AJZB 3SJVA 3C60D 1EZVY 3MSPA 1XF3B 4OUOA 3GDBA 4G8FB 3IDXH 2F53E 3EBAA 1EBPA 3CMOH 1ZVSA 3IS1X 4MAUL 3V5DB 2AJXH 2YS4A 1JWUA 2R69H 5CZVH 4FMKA 5GRVK 3O8XC 2M26A 1DQJA 2QHLA 5TDNA 1LNUA 1DN0A 1FP5A 2YPVH 3JV6B 1R5IA 3MLTB 4P3DB 2FGWH 4OZFH 1YEIH 3LQAC 1CG9A 4JPKL 3R1GH 1FYHB 2AW2A 2IBZX 4WW2A 4ZFOB 2EYRB 4J3XA 2VR4A 3GRWA 4KTDH 2DQDH 4CVZA 4JFEE 1I1RA 3WFHB 3MLSH 2BRRH 3P4OB 3IVKB 5D96C 4ZUVB 3IAGC 5I1HH 3TFKD 1FDLL 5CMAB 1CLZL 5F7EH 1FBIH 4IJ3C 4TUKH 4ZXBB 4LLQA 4OB5L 5DI8B 5HVWA 1MJ8L 1D7FA 4RFOH 3Q1SH 4LLWA 1AO7B 3WUWG 3GJFA 2Y9RT 3MR9B 3BGMB 4LKCA 4FQ1L 3QUKB 5CCKH 3T0EA 5CGYC 4MJ5A 5I76B 3VJ6A 4GG8B 2GT9B 4OCYH 3F62A 5EBGA 4U1JB 3PHOA 3ZZ1A 1WZKA 2B5IC 1U8KA 2HT3C 5J0BA 2DKSA 2VXSL 4KZDH 5ISZD 3ARBC 5SWSA 4AG4L 1Y18A 2ZCKL 4YHYB 3OKLA 1HEZA 3PGCA 4MNQA 4UINH 3K7UA 3ZYZA 5DFTA 4N8CH 2ORBL 3T2NH 3MPCA 1RZKC 1ZLUK 4BFIB 2B1AH 3QUZC 3KYMB 5JOPE 2VDLH 3STZB 2JCCA 3R0MA 3MZGB 3WL9A 5FHAH 4FZEH 4OFYD 3DIFB 3KPPB 4KV5E 4NQEB 3LKOA 4QHNB 5D70L 1NBZB 3JUYA 4GRLA 4HUXA 4NKDB 4PJXB 4G8GA 4XTRC 3X12A 2DI8A 2ZUXA 4YPGB 4E0RB 4RMUA 1DZBA 4OZ4A 2W1NA 5DR5H 4FG6D 2CKBB 2UWEB 2J3SA 3WFEL 1MHPH 1K6QL 1WC7B 4U0RB 3EOTL 4HIJA 2C3WA 3RFZC 1QLFB 2XZAH 4FMFA 4UIKL 3RVVD 2GY5A 2BCKA 3QUYB 4J3UA 5HYFA 3MJ8B 3MOBH 3LH2H 4ELMB 5TDOB 2M2DA 2A6IA 1UB6A 2XT1B 3SKUD 4BFGA 3MJ8A 4ONFL 3D9AH 4WWKA 1OWRM 3ARBD 3BDYH 3TBWB 4X6DB 4Y1AD 3DMMC 4EUPH 3MFGB 4X7EC 3VW3L 1CFTB 1F2XK 1FO0B 1KIRB 1VACA 3MRBB 1MY7A 2FCBA 3C60C 1WZLA 1FNSH 2FD6L 2HYMA 1BD2E 2IBZY 4P59L 2C3GA 1B88A 2YPVL 3ALPA 1H15A 4Z0XB 1BEYH 4FQHB 2HJLB 2BHZA 3K74B 2NW2A 5C0RH 5C8JA 2E7BA 3B6SB 1KPUB 2SEBB 3VD3A 3PL6A 5F6IC 4G9DB 1J12A 4GRWB 1HIML 4F7CA 4RA0C 1KYOJ 3UTTB 4XNQA 2F53D 4HZAA 2AJYH 5JO5B 2VJXA 3RA7H 5HHPA 1CGSH 4D9QE 1R5VA 1OAZL 3ZKQD 4Y19A 3IDJB 1NGXA 1F4XL 1QRND 4IIQC 4XWGL 4FN0A 4GLRH 3Q1SL 4HUVB 3O6FB 2NYYC 2AABH 1PGRB 2XZCH 1LP9A 2R15A 4QWWC 4UV4H 3ULUF 1RZGA 2BSRB 3DHMA 3NA9H 2YKLH 4Q7DA 4M43L 4WDIB 1TQCC 4C83B 4HK0B 1OT1A 3TH4T 4CMHB 5D2NB 4X9IA 1ZLVH 1Z9LA 4OCYL 1YY9D 3QHZL 4LQFH 1Q72H 3GEWB 3HNSL 4PYGA 1CK0H 3SE3C 3U0WH 5FYJL 1CDBA 3IDNA 4UUJB 1CGWA 1X7QA 3V6OE 4CVXB 4XVJH 3BZFA 1YEEH 3ARFD 4XCNA 1D5XA 3QUMH 2ZUVA 1I1YA 2H8PB 1RUQL 2XNAA 4P46A 2NW3A 4TSAH 3QWOB 1IKFL 1BJ1J 4OFIA 4M6OL 1GVIA 4WUUA 2MQ0A 5C2BH 4XCEA 2K7QA 5TQ2H 2YZ1A 4LASH 4N9OB 1MJ7L 3AC0A 2DM4A 1KLUA 5IHZB 4FFWC 3VRIA 3CFEA 5EU6D 5ECJE 4OT1H 1YUHB 5I18H 4YBHA 3SGEH 3CVHB 4QHLB 3VFGL 3TT3H 1CL7L 5IHLB 3BVNB 4R3SA 5DJ8B 4JVPA 2XTJD 2XYCA 3P9WB 4L1DA 5HD8C 2PTTA 3G6DH 2PF6A 1CXFA 4U1GB 5AYUL 1E0OB 4TUJA 5IHUL 4AIZB 3S3SA 3FOLA 5DK2B 3S96B 7CGTA 3FN0L 4LLYA 5E6IC 1MNUH 5D6DC 4JKPL 3S88H 5EOTB 1IC4H 3AAZB 4UOW1 5IIEA 3SDAC 3ARDD 3ZO0A 5I0DA 1LE9A 4G6ML 4YXKL 3S97C 1N4XH 1ZT1B 3MODH 4WFFE 3AREC 1N7MH 3JVGA 3RBSA 5C0FB 2Z4QA 3OAUL 2AQ1A 1F6AA 3P9LB 2OL3L 2GJZA 3VXPB 5HSFA 3AVEA 5EO1B 1RZ7H 1DVFB 4Q9QH 1P2CA 4XNUH 3QXAB 2H2SC 3OKDA 2CMRH 3U82B 4RFEB 1CR9L 2GJ6B 2IPUG 1TCRA 4NFDA 5CZKA 2FGWL 1HQ4B 5E0QA 1K85A 1EJOH 5E6IA 3VFUA 2X4RB 4C56A 5GS2H 3SY0A 3S3JA 1CGVA 5GGUA 1GYAA 1RVFH 2F53A 4PTTA 1KNOA 4Q9CA 4XPBH 4K55A 2WM0A 3RAJL 3S37X 1RSFA 5KSBA 4LVNC 1FVCB 3BIBX 3KPSD 3U46B 3BWAA 1KJ2A 4HUNB 3KPLB 2CK2A 1WBZB 1S9YB 3GMLA 4CMHC 3C5JA 1FPTL 4FQLH 3WFCH 3H3PL 4OCSH 1VCAA 1K4DB 2DYPB 4XCYA 3P73B 4ONGL 4OZHB 3S9DB 1U93B 1XZ0B 2EH7H 3SDAD 3RWDA 3E1F1 3AROA 3I50H 1Q9WB 4ODXB 5GRXG 1U92A 3GSQB 4F57H 2KQMA 1D5MA 5HYSG 1LK2B 2RFXA 1GZPB 3D39A 3IKKA 5E9DE 5CBEB 1P5VA 1NGZB 2YEZA 2V2TB 5ISZA 1MAKA 3VFPB 4HEPG 5GZOD 2AGJH 2AI0H 3C6LC 3MNZA 4IEFB 1FFNB 4FRWA 2WV3A 2X9WA 3QWRD 4M43H 1JV5A 2Q7NA 2QADB 3ZKSD 1J18A 3RWFB 1U9KA 5GRZA 4G8GD 3U1SL 4R96B 3TJHC 5CD3B 1XT5A 2CR3A 3SDDB 5ADPH 1P7KB 1QVOB 1LEKA 4X4ME 4GSDL 4GRLD 4GQ9H 2R1YB 3HPJA 4MNHA 4OLYH 4XZUB 4X6CF 5F3BA 4YQXL 5KSBF 2NY2C 1DR9A 3QIBA 3LB6C 3V4UH 4P2CG 2MOVA 1G9ML 2ZSVA 3TJEH 3BRFA 2XTJB 2KQNA 5FHBH 4M7LH 5FIEA 3QAZC 3WS6A 2M8XA 4PJEA 1A21A 3M1BA 1CDJA 1MOEA 5FCUL 4MD0A 1GOFA 3VH8B 2HRLA 3UJTH 1KN2L 4I48A 4TNVF 3SBWA 3UTOA 2VXTL 1BWMA 1CGYA 2C4XA 1Y6KR 2IQAA 3ARUA 4TTDD 1DCLA 4G8EA 4Z76B 4LLAA 1HHGA 5LGHL 2IADA 5IMKA 3RKPA 1AP2A 2OTUB 5DUPH 2F8VA 3MGTB 4I4WB 5FK9B 4TSCH 3QXTA 2AJUL 3ROLB 3MZTA 3OV6A 4JFED 1OAQH 1ZT1A 5EZLB 2YK1H 4DQOL 3DRQA 4U6YB 2VLME 4BKLA 1G7JA 1XIWA 2XACC 2OJEB 5LWYL 5C0CE 1MREL 3FO2A 3QDGD 1Q0XH 1A4KA 2CO7B 1FIEA 3HZVA 2EC9U 2F19H 4MB4A 3U7WL 1XH3B 3H7BB 4NQEA 1WCBB 1IKNA 4I9WD 1LDPL 2ICWJ 2RHEA 4TULL 4KJPC 4GRWF 3D2UB 2JCCB 5F1IA 1GC1C 4IRJB 5CD3A 3HMXL 3N1PC 5DJ2A 3CVHA 5JXED 1OW0A 5KS9F 1ROWA 3FQRB 4P4RB 2JB5L 3JWDC 1D5BB 4NQDA 1OARL 5FM4A 4I8DA 5AEAA 3U9PH 4B50A 1C5DA 4U2ZA 5FF6B 2XA3A 1NGWB 4GG6A 4Y5YA 4ZUTB 1LO2H 2BY3A 2L0DA 3H3PH 2EKSB 5AUMA 5FYKU 3ARWA 4Y4FB 3B2VH 3AREB 3FB6A 3G6AB 1JPST 2YPLE 2JB6A 4NQVB 5EC1B 5EOCJ 4WGVB 3VFRA 4X7SL 1UZ8A 2YUZA 1OHQA 3SQOL 2RCSH 1CTOA 2CUIA 2D0FA 3NN8A 4X9FA 3VFVA 3CLEH 4X7DC 4PJIF 3TO2B 1A7PL 5IFJA 1A14L 2PYED 3VXTB 1F02I 5I0ZA 4UUJA 2XIDA 3WJJC 3OGCA 1D6EB 3CXDL 3TBTA 4N0RA 4JM2A 5F71A 3H9SD 2HKFL 1A3RH 4OLVH 3VFWA 1AGBB 5A2JH 1XGUA 4UMGA 1MUJA 4HKXB 4XVTH 3NCBB 4HW6A 4NQCD 4Y5YB 4ZUTA 1FC1A 1L4IA 4E5XB 4GW4B 4YH6A 4EI5D 1NDMA 2AERT 1KULA 1G7QB 4B7IA 1G6RB 3NOIA 3SDAA 3QIUD 3IU3B 2XPGB 4LCCC 5CUSL 1GGIH 2KZ1B 1J05A 3DSFL 1L9MA 4HG4J 3ULSA 4QHUB 2ESVD 4E41A 4F3FB 4YE4H 2FB4L 3FB5B 1EMTL 3MOAH 4M1CC 3LHPH 1XFPA 5D71L 2AK4A 4YPJA 3FO2B 3S4SG 2MNUA 3RNQB 4WCYH 4HWZA 2WIIB 1MHEB 3DURB 2ZZUT 2GJ6A 4UT7H 1NGYA 1WBYA 2NZ9D 1DVFA 5FXCH 5A43C 4D9RE 4MAUH 4JO4L 3FHQA 2VUYA 4QTIL 1T2QH 4QRTA 4X6EA 5BXFB 5T1MA 5HTSA 1CVSC 1MVUA 1RJYA 1RIHH 2CXGA 4QTHA 4XPGH 3CAFA 4YFDB 2PW2A 5I1GH 4KKAD 4PJBA 2WP3T 4OZHE 1MFBL 5HI4D 4C56D 5FCSH 3B83A 2AP2A 2R2CA 2NTSP 1FJ1B 1OGAD 5A2FA 2LU7A 3WFCL 2BZDA 3GSXA 4P9HC 2BK8A 2J8UB 3E2HB 4HUKB 5E8PA 4PYHA 2VABB 3QEQE 4XC1L 3TN0C 4LRNH 3R06B 3RJDA 3QQ3A 2W9EL 4M1GH 3O3EA 3DVGB 4MA1C 2FJGB 4TSCL 2VDOH 1ZA6A 3BUTA 1NSNL 4AM0A 1HNGA 4XNYL 4HUXB 4G6KL 1QZ1A 1F3JB 4LLVB 1FORH 3QDMA 4E9LA 2JJSA 1CD0A 3CH1B 2C3VB 1AKJD 3GI8L 4OM1L 4Z95H 5H37G 3HI1A 3PWJA 4KZEH 3WL9B 1T03L 3BEWA 1DANT 1ZEAL 2YUXA 4IOFC 4LHUG 2EE6A 3WNPA 1C5CL 4D8PA 5DJ6A 3BPOB 3F12B 5CJBA 1J0YA 4O58L 2DQJH 3BHBB 3O3DA 4PV9B 4Z7VF 4XCCH 3HR6A 4MJIE 1CXEA 1FZOB 2WNGA 4XP1H 3BP6A 4G6JL 1BQLL 1JV5B 4X7SH 4Y2OA 3ZE0E 5HHVH 4ZUSB 4BSVB 4HBCH 3GB7A 1T83A 1V3LA 4YUEL 4OLWL 3VFPA 4NQVA 3MA7A 1T20B 2I24N 1WGOA 4FFVC 5JR1L 3MBEC 5GGTH 3IJSB 4HJJL 3MJ9A 5AD0A 4KHXL 4GFTB 2P8PB 1DQLH 4JFDB 3P0YH 3V0AC 4LIQL 1X5HA 2R0WL 2BRRL 3DX8B 1CL7I 3HPLB 4NRZA 4RA3A 3MR9A 4ZPTB 1Q94B 2Z31C 4OQ1A 1A0QL 1AQKL 1S5IL 3MV7B 5D1ZA 4LLQB 5DI8A 4QT5A 3MQIA 1Q0YH 1A3RL 2HVKA 4YAQB 1EAPA 1A1MA 3QIUB 1YMMD 2XZQL 4HIXL 2X05A 3MRNB 4M7JH 2C3VA 1MHPL 3TO4B 3V6BR 4I2XA 3QPQC 3DARA 5ID1B 4FQHA 1GH7A 1YC8A 5LXGH 2E7MA 3GJFK 3TVMA 5D1XA 4JG1H 1X44A 5A3ID 1CXLA 4U49A 2DF3A 1B2WL 3WDIA 1BIHA 4IOIB 5HDQL 1FO0A 2P49B 1NFDF 3LN5A 2XICA 2A38A 4OCMC 1WFOA 4Y4HA 4DW2L 1A3QA 1ND0A 2F5BH 4JRYE 4ZUUA 4L8BA 1JWMB 5C0IB 3UBXI 5DQDL 1B6DA 5J1SC 4NP4L 3W2DL 5D1ZD 1HHGB 1MIEH 5E03A 1M6OA 4Z7OE 2VRAA 4G8EB 3PHSA 4N8CL 4JO4H 5J12C 1NCNA 4WCYL 3PWLB 3T65A 1T2QL 4K7PY 4LPVA 1S7VA 4G80A 1XGRA 1HINH 1F6AB 1RK1A 3ARBA 3P9LA 5EBWA 2ADFH 2P45B 1IRAY 1X5JA 2DLGA 1S3KH 4WO4A 5C08A 5CSZB 5F1OB 1KCRL 3DI3B 4AEEA 4LCWA 3LIZL 4N0FA 3MRJA 4RGOH 4E0RA 5B38G 4YHKH 3T04D 4NKQB 2JB5H 3GMQB 2EDRA 4PJXA 5KVGH 4ONHA 2ZUSA 3C6SA 3B9DA 3G5ZA 2BNQA 1T3FB 3N1MC 1KG0A 2ITCB 1URLA 4OF3A 3JTTA 5B8CC 4N5EC 5IJKC 4QHNA 4YXLH 2VLKD 5IW6A 2O61B 1YJDL 5FUCE 4CDGC 4NC1E 3NTCH 3TN0D 5EOQL 5IVXE 4C56E 3U9PL 3H9HA 3PL6D 4P3WA 4E41B 4F3FA 3QDME 2WBKA 2P44B 2R23B 3BJLA 5EO9B 5E94A 5DZLA 4D9LH 1C7SA 4FHBD 5ETUB 4G5ZL 2FHFA 5EIIB 3GMMB 4PGDB 2D7TH 5A2KH 4GKNA 3EHBC 2VDNH 3HR5B 1ZEAH 2AJUH 1A14H 3C5SB 1T7YA 3DGGA 1S7WB 2DQJL 2APWA 4C4KT 3WDHA 3AS0A 4WHYG 4TVPL 3ZKNC 2H8PA 5I75B 1FHGA 1J1PH 4NN5C 3J7HA 1OL0A 2CRIA 3BT2H 4O02H 2KUTA 4X5XA 5KG9B 1T5WA 1D6VH 3OGCB 4HSQA 3ZKMD 1OCWH 1YEKH 3T0EB 1RZKH 3RDTB 1SYSA 5JQ6L 3OJVC 3C5ZB 4KK5C 4NQCA 3VFVB 1YEFL 4G6AD 2R56H 3VFGH 1T2JA 3N1GC 4HD9A 5C6PB 2BSRA 2Z0BA 2HLFD 3ILQD 2HRPH 2ZCLH 5EU7C 4RIRB 4Z7WE 5I30H 5CKAA 3MV9A 1RHFA 1AH1A 2OCFD 1KENH 5JLZA 2YBRA 4M7KH 4X6DE 1GGCL 4PJEE 1OARH 2XOTA 4NKMB 4MA1B 1SEBA 3RZCD 1CD9B 5ID0B 3PWPA 3V79C 3VXUA 1BVKA 3MC0A 4KRPC 1MWAL 4MXWL 1V8HA 1XAUA 4XX1E 3VXNA 1G9NH 2R23A 4P2RE 3ZKXB 1KT2B 3U9UB 3UTSD 5MI0C 1JZ4A 2VLLB 1CBVL 2QQLL 4J4PA 1R3KB 4M62H 4QXTB 5JDSA 5D70H 2CDGB 1AGDB 4YWGH 2X89A 3F12A 1LK3L 1VHPA 4I0CC 2I60H 5K9JL 2XZQH 3ZHLA 5FOJA 4X4MA 1LO0L 1TZGH 4QTIH 1MHHB 4JG0L 3O9WD 4JQXA 2K1MA 3DPBA 2V5YA 1P2CB 4K7PX 5IVXF 3O41A 1FVEA 3OKYA 2A73A 3GBNH 5J6GA 5GGVY 3MGTA 5CIPB 5J8OA 5FO9B 1RZFH 5DTFA 1A22B 4P57B 3VWKD 1PX4A 1FFPA 4HF5H 4LPTA 5IG7A 4MJIB 4ZOEA 1TPXB 1E4KA 3MRKA 3FRPA 3QG7L 3H9SE 4M8QB 4FQQA 1IFHL 5IT2H 3D69A 2PXYA 3CFIC 5HYSB 1L0XA 1UM5H 4O2EB 3EDDA 4F2MA 5IESL 1IEHA 4WU7A 3ARPA 3DX6A 5DK2A 5E9DD 3GSXB 2Y72A 4CRPA 4JZNA 3D0LB 4D0CA 2YMXH 1A6VL 2WBJA 2ATKA 4KROC 2DQGH 2Z35B 1MF2H 4JFOA 3IXAB 1KV3A 1T1WA 2HG5A 1NL0H 2APBA 5HHNB 2XN9B 3HUJA 1TETL 3U6RB 3LIZH 5DD5L 5D93C 1REIA 5E2UL 2IH1A 3MLRL 1UVQB 4Z0BH 1YUHA 2WAHA 2A1WL 4UV7H 3HAEH 4PGBA 2LV4A 3TT1H 1F4YH 3DETC 4WW1A 3SCMA 4K23H 1NGYB 4Q6YA 1R24B 2VB5A 4NCDA 1AIFB 2GY7B 4HWZB 2NY3C 2EDBA 1J8HB 1D9KD 3HC0B 4MLSA 4BSJA 1HOCA 2X4TB 3UX9B 3AS3A 5C0AE 4XT1C 3SDXF 4MQXD 5F72S 4BFIA 1XIWD 3CK0H 1QR1A 3N9GL 4JHAL 3CUPA 1TNMA 5AD0B 2MCG1 3QEQA 1IGML 4DGYH 4ODSH 1KLGB 3BKJH 3PABB 2FLBT 5KSVA 4DGVL 1YQVL 5D6DA 4GG8A 2YKLL 4NHCH 2F54B 4NZJA 4ZOCA 1R3IH 2P8LB 4XBGB 1WFUA 4OLYL 1OP3K 3T2OA 1KN4L 3LEYH 4Y5VC 3V0VA 1E27A 3FQTB 3OBAA 1G7IB 1Q9WA 1JZ7A 3P4NB 5C2BL 1UKTA 5JQ6H 3PP3K 1K9TA 2AEIT 2ZOKA 4LCUB 3VCLB 1NBQA 4M3JA 4NP4H 4YIQB 1TITA 3MUZ1 1KCVH 5E8DL 4ZDHA 1A1OA 3MTRA 3IFNH 4AEIH 2R8SL 5DJXB 4KK8C 2VISA 2RJMA 4N5ED 1P7QA 4X99A 4ODWB 1C7TA 3PDOA 3CD4A 2EYRA 5F88A 4YWGL 3HUJF 2P5WA 1KIRA 4C55A 1UM6H 3NACL 3UTSB 1UWEL 1VGEH 4O00A 4HJJH 5DMIH 3RGVA 2Q20A 3LPFA 1JGDA 4PTTB 3QH3A 4P23B 5BQ7A 5C9JA 5L88L 3HRZA 1CFBA 2R29L 3BPCA 2X2YA 1T22A 3KPSA 1F3RB 2IBBA 5DDHB 2UWEE 1R24A 3MODL 1VPOH 4K3JH 4NYLA 1WWCA 1OVZA 1XH3A 1U8PA 4QXUL 4P2OB 4AYFA 1F8TH 4YBQD 1X4ZA 1QLFA 1XIWB 1FFQA 4YXKH 5IM7A 4S1RH 4QRTB 1NFIB 1PY9A 4MNGA 3QJFA 5CHNB 4K3EL 2V5MA 2VZVA 3O4OC 3DX7A 4PJ8B 2DLIA 5DK3A 4F8TA 2N56A 4JKWA 1QLRA 3JWDL 4YDJB 4EDXA 4PRPD 4PRIB 3MBEB 3DV6B 2X9XA 3UTZB 4DAGH 5J6HA 4EUPB 1PQZB 4M48H 4P5TA 1X5IA 1FIGH 5KAQF 3MRKB 3LEXA 4F7PA 1T66D 5IB1A 1A6WL 1QFOA 3SDCB 1C16A 4M7LT 3WJJA 1KXTB 1P7QD 5T5NG 2J88H 2X1QA 2IMMA 5I1DB 3L3OA 5FYKH 3WFZA 1NEUA 5DEFB 5DFVC 2QL1A 3U4BH 1Y6MR 1SBBA 4LCYA 1OF2A 1MCNA 3TN0B 4M9PA 2R56L 3O9WC 5EBLB 5CZVL 1IAKB 3KPRE 1UYWL 4HBQA 3W9DB 4A2LA 4HC1L 3GSVA 3RL1B 4M02A 4OI9A 4DTGL 1WWBX 4F7TA 2HFEB 4OLXH 5E6YA 1JF1B 3TBTB 4QXTA 5IVZA 4GS7B 3P0VH 2DLHA 5MEQB 2R0KL 3RUGB 2Y4SA 3FO1A 5ITFA 5T5FH 4PJ5A 3LN4A 3R4DA 1HWGB 4Y16C 3V0WH 2LTQC 2PO6A 1G7HA 2PUQT 2B2XH 1CBVH 3VXUB 2C7UA 2VKXA 5MI0B 1ONQA 1IZKA 5DQJB 2EDYA 4DUWA 4G5ZH 1MI5E 2FB4H 1NGWA 2DQUL 2D7TL 2NY6C 3C8KA 3RPIA 1FAIL 3ARTA 1M7DA 1FN4B 4NO5B 4XCFL 4OUUB 3CZFA 5HHPB 1X5ZA 3PGFL 4PJCF 2GITB 4HIIB 1HSBA 1NKOA 3RUGA 2W9LA 3C6LA 4LCCB 5IOPA 4OCRH 1DBAL 4LCWE 4JKLA 1B90A 4O4YL 3KJ4C 2MCPL 1UEMA 1ODAA 3CLEL 3EFDL 3MJ9H 1IGYA 3MREB 5ICXA 3U48A 2WWMC 1JGEB 3QCVL 1UACH 4OZHA 1DANU 1UC6A 4KK8D 4NN6C 1ACYL 4WY7H 1UJ3C 2WMPA 4JM2F 1IVLA 2B0SH 5J7CC 2PTVA 1XF3A 2V7NA 3BKML 3OQ3B 4GAJH 4WWKC 2PETA 3QDMB 3GMMA 5GRJL 2R29H 3VRJB 1F6LL 4YHML 1S9YA 2IALB 2HFFB 4PJAB 4OI7A 1P5UA 2UYLA 5HGDB 3VWKC 3TZVC 1IM3A 5C0AB 3MFFB 4I18C 2VITA 4G8IB 5ANMB 4AMKH 2V6HA 2X4QB 3IXAA 1SYVA 1KNOB 4DKDC 1YPZE 1KSRA 3KLAB 4LOUC 3V8CA 2R9HC 4OKDA 4HGWB 3DX6B 1JI1A 1BLNA 4LCIL 5DEGB 2X4RA 3OAYK 5IUSA 4O2EA 5CJQH 3I02A 3QJHB 4HKBB 3D3VB 3MLUH 5DGRA 4J6RL 4JRYD 3OZ9H 4OM1H 4ZUWA 4KTYA 1YEGL 2FX9H 5EOCL 1CCZA