2DQUH

Crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
224
structure length
222
Chain Sequence
b'EVKLVESGGGLVKPGGSLKLSCAASGFTFSNYAMSWVRQTPEKRLEWVVSISSGGSIYYLDSVKGRFTVSRDNARNILYLQMTSLRSEDTAMYFCARVSHYDGSRDWYFDVWGAGTSVTVSSAKTTPPSVYPLAPGSAANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN 6D9
publication title Thermodynamic and structural basis for transition-state stabilization in antibody-catalyzed hydrolysis
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 222
sequence length 224
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dquH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dquH01
4H0GA 4F58H 4PJEB 4PJBF 2QSVA 2ORBH 3CX5K 4PRAA 3ULVD 2V2WB 3G5YB 4RMSA 4L5FH 5CFHA 4M8VA 3FO0H 3LB6C 2BNRA 5BV7B 4Q6IB 2ZSVB 1F4HA 2GY7B 3TJHD 1TJIH 2GK0A 2F5AL 3V0WL 3QCVH 4LMQI 5DRNB 4S0SD 4X6CB 3LQMA 3BZ4A 2MPAL 2KQNA 3NFSL 1R5IB 3U46A 4UBDC 2NLJA 2WSKA 4JRXD 1ZA6B 3A6CH 2ERJC 4YIQB 3VWKD 4HUKB 5D93B 4QXGL 4B7LA 5C0IB 4MCZA 1CGSH 3H9HA 1NCBH 3HPJA 3MXVL 5A2LH 4GH7B 4WEBL 3GBNH 4LHUB 4YBQC 5DC4B 1INDH 2VN4A 4KQ3H 3JV5A 5JIKA 3RRQA 3ZKMD 5DQJA 1KYOK 2VO5A 1PSKL 5F7HA 2HH0L 4X5WB 2ADIB 3OF6D 4KTEL 3GNMH 3V6FB 1QBBA 5B21A 2E27H 4TQEH 3TT3H 3ZE2E 5DDHA 5JTWA 2VL4A 4BFIB 3QNYA 5C1MB 1A1NA 1DCLA 2VITB 3ET9F 2B8OT 4EBQH 4JEGB 3CXDH 2G75B 3IDMA 2HJFA 3MRQB 2NMSA 3RFZC 3WIFA 5D5MF 5HDQL 3WV0A 4QRUA 2FBJL 5J56B 1FZJA 4HMDA 4M93B 1A6VH 2FJFB 3RY6C 4P2QD 3QPQD 4A2MA 1FC1A 2ARJA 3HC3L 1QKZH 3K1KC 3LQAL 4XVTL 1NKRA 4I9WD 4JFYA 4CMHB 4KZDL 2IPKB 3S88H 3ARBB 4O2FA 2DTMH 4TN9A 1PKQB 2A83A 2H2SD 2HTLC 3G04A 4OZGA 3OR6A 4J6RH 1NCWL 4KROC 4GBXB 1K5NB 1BFSA 1JWSB 1MAMH 4KUCD 4HC1H 4NQDE 1HHGA 1ZANL 5I30H 1NJ9A 3K2MC 1MFAL 4P59H 4X9HA 4XNQB 5KANG 4K2UL 5F6IB 4KH2A 2RFXA 3RHWF 1OVZA 2QQLH 5IBUG 2CKBA 4NO0B 2Q6WB 3BPCA 3D85B 5JLZA 4XI5C 4A2LA 1BWMA 1R3KA 1IM3A 2EC9U 5E00A 1BD2A 2LFGA 3LEXB 1U8JA 5IWLA 3LKNB 2P42B 4LLVA 5EN2B 1A6ZA 1UZ6E 3EO0A 1TETH 3RU8L 3X17A 3HE6A 1FGVL 1JRHI 2WWMC 3HRZB 5CD5C 4WUUD 2BNQE 2PW2B 3JTTA 1CE6A 3PWJB 4M02A 4KVNH 4TRPH 3X14B 2Q87A 4JRYD 3O6FC 1G6RA 1G0XA 1KELL 4Y8AA 3L5JA 1NUDA 4NDMA 4Z76A 5HDBF 4NKMB 4Y4FC 5FYJU 2FR4A 1T80A 3BAEL 5CJQL 4XGZA 2D7OA 2Y9RT 5DRXA 4CVWA 5CIPH 3I50H 3CMOH 4IMKA 2AABL 4RWHA 3ZDXE 1KSRA 35C8L 3O4LB 3LEVL 4JFFB 4OQTL 3VXUB 3RWCB 4YXLL 5SX5K 5BVJB 5I1KH 5DC0A 3MJ8A 5JNYB 5KOMC 3MV8A 4PLKD 3BIAX 2AKRA 2H9GA 2P5WA 4Y5YA 3EDFA 4AJ0A 1I85C 3FQNA 3HZMB 1A6PA 4F8QA 3BQUB 3VFMA 1M7XA 3IETB 1C5DB 3HTLX 4N90D 3K7UA 5DVNA 1OWRM 3VDBA 3ZDZE 4FQXD 1YN6A 1XT5A 3G6JF 4WWKC 1OSPH 4P3WA 1E28A 1DBJL 3FT2A 4R4FH 1BM3H 5IKCA 1JGVL 1UACH 4FP8H 4QHUB 3N0PB 5HGDA 4Z8FL 1CLZH 1N4XH 2BY0A 4J3WA 2YXFA 2BVUA 3E6FA 3S6CA 1H3TA 4KKAD 3FQRA 4G8IB 2ZSWB 1MCWM 1TVBB 1V8HA 3BZFA 3QCTL 5CSBA 1NGYA 3S9DB 4K3GA 3VFRB 3CH1A 1S7TB 4KK5D 4D0CB 3MRKA 4JVUA 2CD0A 3RJQB 4AQ1B 3UZEA 5SX5H 3BWAB 4M6NH 4YHML 5J57B 1P84K 4FQ1H 5F1OB 3GSNL 1J8HA 5EUOB 5F7YC 1E0OB 4HFWA 5C0AD 1QSEE 3EFFB 4EI6A 1K8IA 1TZHA 2AJZA 3RQ3A 1X6LA 1UH4A 5H2BA 3K81A 1WAAF 1SY6A 1BGXL 3T8XB 1YY8B 1QSZA 2P45B 3AC0A 4EIZC 3MRRB 4HIJA 1HNFA 2FX8L 5EO1B 4X7CC 1NAMA 3BT2H 2ED9A 1BREA 1U3ZA 4L4TE 4X6DE 5JQ6H 4ZTPL 4J1UA 2XWBB 4PR5B 1U2CA 4M3KB 3LS5H 1VENA 5SWSD 3PQYD 1EEZA 4AM0B 3W0WD 2RCSH 3QO1A 1SJHA 5ITBL 4JFEE 4P3DA 1FPTH 2C3XA 4GW1A 3D69A 3SGEH 5F93C 1KJ3L 2P5EA 2PTTB 1TVHB 4YDLB 5AUMB 2KUTA 2BY3A 1FHGA 3K3QA 4IDJL 1PX4A 1RZGB 4HBQA 5GJTH 2YK1H 3ZKNC 5MEQB 3FFCB 5DRWB 1BVKA 3NCJL 1HDMB 2PN5A 3NA9L 4QRPD 1S7XA 1T20B 5GQBA 4QF1B 2VDPL 1RUPL 5F21B 3WIHH 1NCUA 4K7PY 1WBXA 4ZFZA 1OAYH 1TMCB 3NIDF 3TVMC 1X5ZA 4GT7A 1NDGB 3UTTB 3B3IB 4V1DB 1A3RL 4JPIB 2OJZH 3HS0B 3U0PB 5FECA 4JFDE 4WI6A 1A4KB 1JK8A 1KGCE 3QUYB 4IHOB 4WI5A 2JK5A 4F7PA 3ULVL 1RUAL 3QHFH 2R1WB 4M1GL 1JNHB 4MD0B 2A74B 3IKCA 1MSPA 1ZXQA 5F7MC 1JPTL 5GZND 2P49B 4E5XA 3UTQB 4OCNC 3S35H 5FM4A 4JKPH 3SDCB 1TTFA 1WF5A 3PHSA 5FHBL 4URTB 3P3YA 2R2BB 1XIWA 1RSFA 3STBA 4Q9QL 1HI6B 3ZT6A 4Z7UF 1QFOA 1JWUB 5SX4H 2F54A 3EOTH 3LDBC 2OP4H 2VXTL 3E6HA 1KLGA 5IW3A 4XMLL 4PY7B 2NY3D 4NZJA 1EUTA 4OCRL 5EO9A 4JG1H 1D5IH 1NGZA 3GJFA 2R69H 4WV1C 3T0DA 2QLVB 5GGVH 3OHXA 3WO3B 5EIIB 2ADGA 4KGLA 1NEZB 3CSGA 1UWGH 2Q76A 1JFQL 1IVLA 1PY9A 3MV9B 3TEUA 1H8NA 1RZ8A 3S4SA 5KSAB 2DJ4A 1JL8A 3DX8A 2WBJA 3VFPB 3ARRA 2HKHL 4TOYL 2D0FA 4XC1H 4LKXA 2KBGA 1GXEA 4KKCC 2PO6D 3ZTNL 5IEKB 4K3EH 1IGTA 3QUXC 5I74C 5ESQB 5FDWB 5KVFL 1KF9B 4K7FB 3VG0L 3DYOA 4OKVA 4UINL 4E9LA 3VXRA 1NQBA 2FGWL 4KMQA 1N5AA 4KDTC 1C16A 1J0ZA 1RK1A 4Q9BA 5BJTB 2VZOA 4RMVA 4WENB 2Y5EA 3VXNB 2AJSL 4BKLB 4PJ9B 3DYPA 2LVEA 4XNMB 3D1MC 4YC2C 1RZKH 3WHXA 2WWKT 3TBWB 3DV6B 2EIEA 1AGDA 1BQHG 1S7WB 3MBXL 2QSCH 4UOJA 4EUPB 3T3PF 1N64H 4G6JH 4ELMA 4F7CB 3T3ME 1VGKA 5C0DB 2DQGL 4KI5F 3UDWC 4HBCH 4MCYA 5MEPB 1NDMB 5BS0A 4MA1B 1WSST 2C26A 2ICEA 4RAHA 3A67L 5CHNB 5TH2B 5D1ZD 4FQIH 2ADFH 2UVEA 3X3FL 1Q1JH 5A3ID 3NTCH 1N5YH 5IMLA 3AS1A 4DTGH 4NGHL 1X9QA 1UEYA 1DN0B 1KPRB 4WO4C 4M48L 4BFBD 1XGQB 3OX8A 2YKLL 1O0VA 4JVPA 1JCKA 1LILA 4LGRB 4AENA 4WNQA 5I8OL 4UMGA 4P2RD 4ZDHB 3HAEB 2Y6SC 3EYUH 3QWOB 5D8JH 3HB3C 3EGSB 4M9PA 4PJBA 3OZ9H 1GIGL 3CH8A 4R4NC 5CGTA 3SE3C 3I84A 3ARDD 1J12A 1AP2B 1MCBA 3NFPB 5LGKA 4OJFL 1JTOA 1IAOA 1YMMB 3MRLA 2FBOJ 4XPAL 4MJIA 4HJGB 2Y06H 5FUOH 1RZIB 4KV5E 2VH5L 3DMMD 3T4YB 4G9DB 2DAVA 3RZCC 5IUSA 4JO1L 3WLBB 3PGFH 4QHKJ 5EBWB 1Q9WA 1U95B 2HYMA 2IQAB 3FL7A 4HHAB 2XTJB 1YEEL 3TN0A 5EZJA 4F33B 4G42A 4GKZA 5E6ZA 3TNMA 3WHE1 1UYWH 2PKDA 4XNXL 4OZIF 3T2OA 1TJHH 4AEHH 4DGYL 5KZCD 1BJMA 4DGVH 4E0RB 4M43H 3NH7H 1YNKL 4OD1H 4QTIL 1AJ7L 3LPGA 3GMLB 3WJLA 1CF8H 2N56A 5JPMA 2YSSA 3HG1E 1RIHL 3RNQB 4XCFL 1EGJH 2F8VA 4KXZI 4L8DB 3KJ6L 4BZYA 2BVPB 4LPVA 1QSED 3HI1A 1JYVA 3O6MH 1XR9B 3KVQA 1AO7B 4I0PB 1JUFB 1LP9E 5CMAA 3UAJD 3VWJD 1OWWA 4OLYH 3U7YH 1IKFL 3OPZH 3X13B 5FYLE 3QWRD 3QZWA 1XF2B 2O5ZH 4OI8A 1DBAL 2E7CA 1Q9OB 3L3IA 5J1AB 4L4TD 2VQ1B 3C09B 3ZO0A 1IGJA 2NY4C 3I6GA 4OB5H 2XFXB 4NN7C 3ARGA 3H0TA 3FB8B 1M7IA 3IJHB 3C60C 4APQC 1Q72H 4O2CB 5HPMA 2R2EB 32C2A 3GMPB 2O93L 4NO2A 1E4XH 1DVFD 1F2QA 1PLGH 1ZHBA 5BMFH 5DJZA 5IVXB 1QBAA 1NCAH 2E9IA 3BD4A 3JV6A 2JIXD 3CVHL 1U8QB 4NNXB 1F11B 4Y5XC 1F5WA 5T3XH 3L9RB 1UFUA 4GQ9L 2ATKB 3MYZA 1U8NA 2V5MA 4N9GA 5JIHA 5EOCH 3GRWH 2V5RA 1JGEB 1A9BB 2A6DB 1C7SA 2GTZB 2Z93A 1CDHA 2NXYC 4RDQF 5BRZA 3S36H 5I18L 3OJVC 1L0YA 1KIRB 3TCLB 3W11D 3AS3A 4HCRL 2CLVA 4JR9H 5HDOA 3RZWA 1FBIH 4GAJH 3Q5TA 2FL5B 1MLBA 2EDKA 4WWID 5GZOC 1KGCD 2CIIA 2FD6H 5JDJA 3FT3B 5A16B 4KZEH 1XF1A 3WD5L 1XF3A 1ZHLB 3LHPL 1M7DB 2YUWA 1P1ZA 4Y1AA 3GMQB 2N4IA 2NQCA 2XT1B 1CFTA 4L8SB 3U7WL 1FC2D 4WTZA 4BH7B 3SCMD 5HGHB 4LHUD 2YD1A 3QPXH 3BP7A 3DX7A 1QSFE 3MFFB 2AV7B 4PB0H 1WGOA 5JUEH 1F13A 4EVNA 5DZOA 1DBMH 2VB5A 2O61A 2HWZH 3LKSA 3BPOB 4WI9A 3OKLA 4XNUL 5IHBA 4MXWH 3TP4A 2B0SL 5ELIA 3DYMA 4B0MM 1I7ZA 5FO8A 5HY9B 3G6JA 4HZLA 4PJAE 1R3LA 2BXYA 5CCKL 4POZD 5DGQA 1OD7A 3C2SA 1CDCA 3FO9A 3CLEH 1OL0A 1TTUA 2QSTA 3C87A 4RBPH 3ZL4H 3T08A 1A1OA 3EO9L 3BZDA 3OKMB 4FFWD 1G7LA 5SWSA 3TWCH 1MIML 4MB4A 3KPLB 1P4LB 3O81A 4J3OC 3VG9C 2DD8L 5JIPA 4P49A 2VWEC 4FQHA 3EOYG 3U9UB 3ARBD 3IU4L 2MQ0A 2EYRB 3I3EA 3O6KH 5HGBA 1FFPA 1AXTL 1C08B 1QACA 4JZOB 4GBXD 1YEKH 3RVVC 2IQ9L 4ODVH 2YBRB 4LBEA 4WIQA 2E6PA 2B1AH 1GOGA 5C07A 2BFVL 5MI0B 3GKWL 1Z9SA 3WFCL 4XHJC 3B9AA 2QKIB 4NO0D 1CGWA 3D85D 5D96B 4OD3L 5I9QC 3MQIA 3DVGB 1I3RB 3MLVL 5CEXA 2G60H 5HSFA 1FH5H 3HI6L 2DLGA 2IAMD 4H5SB 3KPRA 4N5UA 3TYFA 4JQVC 5BZWB 1T5WB 1WZMA 2ICWA 1A6AA 4JO2L 1EK3A 4OT1H 3MUJA 2NZ9C 4FXLA 2NNAB 1OTSC 1WFOA 5D6DC 4MAYC 4OD2B 4PYGA 2V5TA 4NM4L 4KRPB 3QFDB 2P7TB 3UYOD 3GIZH 4G8GA 4PJXB 2VL5B 1I8IA 1OTTD 2VE6A 1KCVL 3V6OC 4ZMAT 2NR6C 2O5YL 4XX1G 4RRPG 1D6EB 3BN9C 3C08L 4JPVH 3O4LD 4FG6C 3MNWB 4JFXA 4UAOC 1TCRA 5GSRA 1LQSR 4GG6E 1HXMA 1JGDB 3GBMH 3WJJC 3FB5B 4MSWB 2ZUSA 3RPIA 3BQUD 3GMNB 1RURL 4JQXA 2NY5L 4LNVA 2HT2C 3KYMA 5I8EB 4GRMB 5FB8A 3MCKA 4GKOA 1F3JB 5TJWK 4XCNB 4L4VA 3V5KB 3BGMA 3DI3B 1FO0B 3VGAC 5JO5A 2NXZC 2ZKHL 4P48A 2YPLE 4HF5H 5HGAA 1MJ7L 1L0QA 2F74A 3LPFA 5F3HA 1AGFA 1PFCA 1MJJA 5D2NB 3HZYB 3K74B 1L6XA 4WW2F 4KI5C 2V6HA 2I07B 1T89C 4LCCA 4F9PC 3MA7A 5EC2A 3NCBB 4RFEA 2X4RB 4Z7UA 5DRZA 4BZ2H 2FX7H 4NN5B 3FQXB 1XCQA 4DN4H 2X1XR 3SE9H 3TZVB 2HP4A 3QDJB 5F6HI 5KN5A 2YPKB 4QRRE 2VAAA 4XWGL 1IGCH 1R5WB 3UJJL 3O3AB 1I9IL 1Y6NR 4MNQA 4RNRA 4HKZA 1RIVH 1EEYA 4XP5L 3CVIL 4CMMB 3RIFK 2J8UB 1AO7E 1LO2H 4PRNB 4HKXA 3SDAC 4Y4HC 3SN6N 4M1CD 1V7NH 4XCYA 3V6ZB 4LVOB 5A40E 2XKNB 4DK3A 2LQRA 3QG6B 1D6VL 1CGVA 2X4UA 4JO3L 3O2DL 3UYRL 1BZ9B 2NY0C 1D9KC 1BVLA 3CK0H 1IAKB 4HX1A 4P4RA 3O41A 2R0WH 3B5TA 4KK8D 4NT6A 1EEQA 4PG9B 1NCDH 2DLEA 1FFOB 1KUMA 2SEBA 3QQ9C 2M2DA 1KCSH 1CD1A 2HFTA 1XFPA 2K9UA 5J11C 5MERB 5DHVB 3REVA 3BEWB 3P4MA 4GW5B 4F37K 4YEFA 5A1AA 1MFEL 1WBYB 5CZVH 2ZPKH 1LDPL 2D7TL 1EMTL 1FAIL 4PTUA 2DM4A 1XGTA 3L6FA 5FOBA 3TBVB 1WEJL 5DJCA 2CUMA 3KDMB 4LPUA 2Y72A 5EUKA 4Y2DB 3QA3B 5DUBA 3OBAA 1D5XA 2YRLA 3VXTA 2EXWC 3MUGB 4HWBL 1NC2B 1PG7X 3NIFE 1B0WA 5CD3A 5KBNC 1X5XA 2I26N 4BQBA 4L29A 4HXBH 5C2UB 3PXHA 5E1AA 3MRPA 4FTVE 4V1DD 1OCWH 1KBGL 4OCWH 1T83A 5ADOL 4IRZH 4PRHB 4JFPB 5DJ2B 1QVOA 1H5BB 2YD3A 4G7VL 3GSRA 4P57B 2Q8AH 1JNNH 5FXCH 5HHNB 2Z9TA 1I1AA 2ZOKB 2E8YA 1A7BA 3U0WL 2IH1B 3MRGB 3TBSA 1DQTA 3QDMB 3BPNC 3QRFM 4HS8H 3RWIB 4D0BA 1RIUL 3U0TA 1AQKL 3BRFA 1MELA 1NBYA 2HRPH 4ONGL 1BFVL 1QSFD 4U0RB 2R23B 3C5ZC 5DZNA 3LEYH 4QTHB 2YD6A 2Z92A 5TQ0L 3BP5A 4HIHB 2DQUL 4AY0A 2OSLA 1G7HA 1ADQL 3BX7C 1F8TH 1UG9A 4M61B 3T65B 3OJ2C 1MCIA 1HCVA 3VXPB 3QWRA 4AL8H 3R06A 2J7LA 2XZAH 1VEOA 4GRWF 2Z91A 3QYCA 1FFQA 3TA3C 3P30L 5C0GA 3QISA 1T7YA 4AT6B 1U8HB 2CLZB 5KVGH 1YQVL 3TBTB 4P5MB 4LPXA 2AQ1A 5E99H 4R3SA 4FZ8L 3DIFB 2BNUA 5JXED 5BO1L 4MWFB 5F88A 4MX7A 4RIRB 3QEQB 3SGJC 5E5UB 4CRPA 3DSFH 4OZIA 5J13C 2AXHA 3OXSA 4C56B 4JM2F 5BOPA 2CIKB 4YO0B 5EU3B 4U1NB 2EDEA 5DQDH 3QZWG 2UZIH 2W60B 4M00A 4OZHE 4NYLA 4U3CA 4X4ZA 1FYTE 4TVSa 3MACH 5L7XH 4TSAL 3HMWL 3O9WC 4QRQA 1MFNA 2IBGA 5GSVA 3MBEC 2E8ZA 3AREB 1DQQA 2DS4A 4IRSB 4TNWK 5DLMH 2E9JA 1I8LA 3RTQC 1IT9L 4MA8L 4PJEA 5FA3A 4W6WB 1ZVHA 4XMPL 1LE5B 3JUZA 1S7RA 4PJ9D 1NAKH 5L2KB 5B39B 2V2WA 3G5YA 1H9VA 1F3DH 1FLTX 2VDOL 1FAKT 4XPTH 4EN3C 3U4BH 3PWPE 4X6CA 3MYJB 4WDIB 2HKFL 3QJHB 4X8XA 2X1QA 1ERNA 1R5IA 3ULVF 1V3MA 5C0CB 3AMLA 1ZA6A 1I7UA 3IU3A 3OKNB 3P4OA 3NCYS 1IL1B 3Q0HA 1T04A 1FNEB 1MCKA 4G7YL 3CUPB 5C0IA 1WCBA 2P47B 5JDSA 4FQLH 1X4XA 2H8PB 2VZUA 1F00I 3TH3T 4PG2A 4ZFOB 4X7SL 4PJXE 1RVFL 3DRTB 3U1SH 2H41A 2ESVE 2YPVL 2CK0L 1PBYA 2DWEB 1GPOH 2DKSA 2D9CA 2BVQA 4X5WA 3D3VB 4R6UA 2ADIA 2AJVH 1X7QA 1G9MC 5J12B 1T66C 1MCLA 3P4LA 4ZO7A 4RZCA 1PYWB 4BFIA 1OAKL 1GVIA 2C3WA 1LK2B 4P23B 4ZUSB 1XR8B 1N7ML 1T2XA 3HR6A 3WUWG 1DLFH 4GS7B 4FQJH 3UC0L 2J4WL 1I3GL 1IC4L 4O4YH 1M1SA 1OTUC 3JWNC 3JV0A 2EECA 1A7NL 1IARB 1MRDH 1T1WB 1YMMD 4FQ2L 3VFUB 2FJFA 1MCSA 3BIKB 1MRFH 3O3DA 2DB8A 3DVIA 2Z8SA 3QIBD 1Q94B 3LN9A 2IPKA 2XZQH 3MLUL 4NZTH 5T33H 5AWNH 2ITCA 5EZOL 1L9MA 4YZFF 5D7JC 1R3HB 1EO5A 1RJCA 5F44A 3K8KA 1K5NA 5FHAH 4AG4L 3QFJA 4YNYB 4LASH 3VFSA 4XNQA 1RPQA 2Z31B 1EO8L 1BF2A 4HQQL 2Q3ZA 1F58H 3QIUB 3QWQB 4U2ZA 5DURB 4HIXH 1A0QL 3FKUS 4J4PA 2J8OA 4LLMB 1YNLH 3VD5A 4R97B 4HJJH 2F8OA 3LEXA 3AAZB 1IAIH 5LBSH 3BP6A 1IZJA 2GEEA 3CD4A 3DXAE 3HRZA 1ITCA 1KACB 1MFDL 2X42A 4BK5A 1SVZA 2PW2A 3Q3GA 3PWJA 4YQXH 4EJ1C 1FNFA 4MQXC 1AO7D 1LGVA 4I0PD 5IB5A 2J3SA 4JLRA 2UYLB 1KPVB 1GGCL 1FNGB 5D1XA 4XC3H 2OR8A 5ERWB 1LE9B 4P4KB 2X4OA 4ZSOA 1CGUA 4O51A 2GAZA 3VFVB 1NGPH 2EDWA 3VXUA 4JFFA 4POUB 3VGGA 4MQ7A 2N7AA 5FYLL 1LHZA 4GMSH 3P0YL 1LO3L 1R0AH 4G9FE 4YX2L 4PS4L 4G5ZH 3CFCL 3U6RB 3U9PL 3BD3A 2I60L 5CP7B 1AFVH 3ROLB 5DMYA 3WXVL 3RI5F 3PWUA 5EPMA 4WW2C 4PJCE 1OB1B 1SYVA 4Z7OE 4JN2A 3CFIC 4U6TA 1B90A 3HNTH 4OSUH 5E03A 5F9JB 4KKLD 4YHLH 5GHWL 1S8DB 3I3BA 4HUNB 3MGTA 4L1HA 1QQDA 1SBSH 4QHUA 4U6HB 1IBGH 3TIDB 4ZOCA 5CEZD 1IEAB 1NBVH 3ARFB 5DT1H 3NGBB 2YRPA 3HMXA 1V7MH 4YFEA 2ZSWA 3QEGL 1IQDB 2UWEF 5KS9E 5ANMB 4FN0A 4WU5B 1CLYH 1T21B 1FORL 4NNYA 5HHXH 1LO4H 3T0VA 3LAFA 1I7TB 1NFIA 1SM3L 2FJGA 5C08B 4PJIE 3HUJB 1S7TA 4ZAKB 4ENEC 1F90L 3UJTL 3WKML 1A8JH 4XVUD 1G9MH 3SDXE 2MJWA 3NPSB 3M17B 4NM8L 1CXIA 3D0VA 4KU1A 4X9BA 1VSCA 3P9MB 4HGKC 3UTZA 2NX5A 3K2UL 1EZVY 3DUUB 3EFFA 1ZGLA 1ZMYA 5EU4A 1KJMB 2PXYA 4LVEA 3ZYIA 1G84A 5DVOA 4OLUL 1G6VK 5F96L 4XMKH 2H2PC 2ZJSH 4YHIA 1YY8A 3OR7B 1I1YB 3QG7H 4GXVL 2AV1B 2W9EL 4UTAH 4KK9C 2EIZB 5GS0D 1WITA 4DK6A 2GQHA 3REWB 1P7KB 4L3CB 5C0RH 1NCCL 3FOLB 1BHGA 1RFDL 4N0FA 5JHDA 3NN8A 1AE6H 1LMKA 2XWBA 2F5AH 1DQJA 4LCYA 4MVBC 2YHGA 5DD3H 4AM0A 1J05B 3NFSH 4YUEL 3RVUD 4PUBL 2KH2B 4UT7L 3TM6A 5AYUH 4BELD 4D9QE 4PJGF 4J2XA 2Y36H 4QXGH 5ISZB 1BOGB 3MXVH 1JNLH 4KWUA 3EHBC 3HLAB 3QUZA 4WEBH 2VLKA 5I17B 3FFCA 2VLJA 4HH9B 4XPGL 5MP6H 3MV7A 4I0CC 2HH0H 3D2UB 1G6RH 4KTEH 4RGNB 1W0VB 2FGZA 3DLQR 3RUGB 2FYYA 3W39B 3UTTA 2AXGB 3PWPD 2ZUYA 4V1DA 3EJZD 3I2CL 1ND0A 5DJ6B 3BVNB 4QYOA 5D6CB 1Y18A 2DQHH 2RHEA 1A4KA 3QUYA 1X3DA 2ED7A 3K4DA 2VLLB 1MJUL 2FBJH 2R1WA 2R0ZL 1JNHA 4MD0A 4E41B 1WVZA 2C4XA 3VGBA 3RL2B 4OQTA 3HC3H 2V5YA 3T0EB 1KJ2B 4XVTH 4KRPD 3U82B 3UTQA 3VH8B 5IHZB 5DC9B 5CAYB 1QUNA 5J3HC 2I25N 3SDCA 2V2XB 3LMJL 3QXAB 5HYJB 2BHZA 4H8WL 2VUOA 4JFHD 1GRWA 4OLVL 4UTBL 4P2OC 1NC4A 1H3PL 4KKNA 3H3KA 2W9LA 4M5YL 3DBXA 1HHJA 5D7LE 5F9WC 1CLCA 4OM1L 4K7PX 3MCLL 4U6VL 5IFJA 4X5XB 3GHEH 1YMHB 3MLXH 2FZ3B 5IQ7H 4GLRI 4JANA 2LU3A 1II4E 1YEDA 5EIIA 1D5ZA 4WFGE 1RUML 5DMKA 5JOFB 1R24A 3MV9A 3VFNB 3ZE2F 3W9EA 3LN5A 4I2XA 5INCA 2IG2H 5KSAA 4PJ7B 2P8LA 1JPGB 4PJ5E 4LPTA 2P43B 4U6YA 3RU8H 2NW3B 2JCCB 2XQYK 1JHLH 1UM6H 4PJFB 3QR2A 3H7BA 3T1WA 2Y1VA 5BXFA 1RJYB 1IKNA 4FXKA 5J6HB 3QDGE 5DEFB 2I5YL 5L8JB 2Y07L 3B9VA 2PYEB 4P5TB 2J6EH 1RK0A 4L3EE 5ESQA 4DZ8A 3ZDYE 1XCTB 4K7FA 1KELH 4GOSA 43CAA 5GS1B 5KJRL 3T4AA 2OYPA 2GITA 4ODHL 3ULVC 4PRIB 1DUYB 3IGAB 3WDHA 3PNWA 3MOAL 4H1LG 3BAEH 4AMKH 2X4TB 5ITFB 4BKLA 5CEYB 4PJ9A 2GFBB 2GHWB 1NGQL 5IFHH 3FT4B 3LEVH 1MAKA 5IROC 3VXMA 5HI4D 1WFUA 3TBWA 2VSCA 5D4QA 1T2QH 3TZVD 1T1YA 2MTPA 4TULL 1LO5A 2X4NB 4B41A 4F7CA 3LH2H 3VWKC 2QBWA 2X09A 3BEVA 4J7RA 5IT2L 4LVHC 4Y16B 2V9RA 3HZVA 4NUGL 2XN9E 5CHNA 1G7IA 1I7RA 2ZUQB 3SGKA 2PCPA 3G6AA 3IAGC 4A6YL 4BZ1L 1DBJH 3AB0B 3ZKMC 4RX4D 4JM2A 4JDVB 3BN3B 1DN0A 3G5ZA 5T1KA 2KL6A 4AEIH 5IB1B 1CFVH 4Q2ZB 4MNGE 3WFBL 4XVJL 4PBWD 3QUMB 1XGQA 3DECA 1QZ1A 1INQB 1VHPA 1CR9L 2OL3L 2ZCHL 4RSVA 2VLRB 2VQTA 4JY5L 3F7YA 5FUCC 3F7PC 4X80L 4KXZH 3P9LB 2VOTA 4ZDHA 3KLDA 1QRNB 2PYFA 4P2YA 2IANB 4ONFH 1LK3L 1S7UA 1DQMH 5FYKD 4EDXB 2A6KA 1K3ZA 3S34H 1ZOXA 1JMZA 3RAJH 5T3ZE 1EFXB 3QPQC 4LHUG 3ZDXF 3BGFB 1QLEL 4ERSH 4XPBH 4DAGH 5EU6E 1MREL 2XPGB 3BKJH 4F9LA 4HJGA 4YHMH 4OZ4A 1RZIA 2H2SC 2MOVA 3GSNH 2VZ3A 4KTDH 1HYSD 1G7PB 3C6SB 4FA8A 4I48B 4RGMB 5GRVK 3WLBA 1YPZB 4Y2DD 3W82A 3MRMB 3BRGC 2IQAA 4ORGB 2OMBA 2YUXA 2IGFH 4LSUH 1FLRH 4LEOB 3LD8B 3LN4B 1Z9OA 3O4OB 3CJJA 1AGBB 4JG0H 4L5FL 3V4VH 4CVXA 4PRHD 3X3GL 4NC2B 1GL4B 3RGHA 3NZHL 1BZ7B 1P4IH 1FZOA 3SQOH 1AXSB 5FM8A 5I71C 1TJIL 3QCVL 5C08E 3RDTD 5I8KL 2DLTA 3QDMD 4WVRA 5IW1A 3B43A 5IB3B 1HEZB 5HYEA 3RNQA 3IXTB 1JP5A 1U3YA 3A6CL 5GIRB 2AJYH 1KN2H 1UB5A 1QRKA 2VIRB 5I19L 2EE2A 2EKSB 2GJ6E 1W0YT 3C9NB 1XR9A 1CGSL 4U7KA 4EI5B 1NCBL 1B2WH 4I0PA 1JUFA 1PD6A 4F2MB 4JN1L 2HTKD 3GBNL 1CZ8H 2OTWB 3EYSL 1INDL 3NCJH 2F5BH 4HUWA 3S98A 4B7IA 1HYRC 5JW3H 1DFBH 3RWDB 1RUPH 3GNML 2VQ1A 3UTSB 5I1CL 2D7QA 4TQEL 3TT3L 1NLDH 2XFXA 4PLKC 1UA6L 4NCDA 5C0FB 4MYWB 3FB8A 1UWXK 1XGYH 5B3JE 3STLA 1HQ4B 2BSRA 4RFNB 5HVWA 3QEQD 1YY9D 2CRMA 4EBQL 2HT4C 2R2EA 3CXDL 3GMPA 3IAPA 4C56D 2GSIA 5GS0L 3ULVH 4XXDB 2NY1B 5C09B 2QR0A 4XB8A 3GB7A 4X6DF 5IVXA 4CADA 3GMMA 3N1QC 4LL9A 4UT9L 1FVDB 3Q48A 1A6VL 4FQXC 1JE6A 3O0RL 4DUWA 1IMHC 3RIAK 1TPXC 1L7IH 2ATKA 3WO4C 3S88L 2DQJH 4NQXA 3WL9B 5LGJB 2DTML 3SKJL 1KCRL 5F9AC 2APFA 4Q9QH 2AGJH 2XNAB 5D7IE 1A9BA 1KB5L 5L0QC 3RWJA 4J6RL 1MAML 4HC1L 2HVJA 5L2KD 2BOBB 3KPSE 4KKAC 4HG4K 4P59L 3SJVA 2A73B 2HG5B 3TCLA 2GJJA 4R90H 1OGAB 2QQLL 3W9DB 3MLRL 1GGUA 1MCNA 1AY1L 3FO2A 4U1IB 3MGOB 1U3HA 3FT3A 4N0UE 5A16A 4LDEB 3ZT5A 5C0CD 3R8QA 4QCIB 4R9HA 2W0FA 3QIWD 4TOYH 1X5HA 5TDOA 2IFFH 4RMRA 3HPLB 1FV1B 3VXSB 1TETL 1S9KC 1UWXH 2CXGA 1UXSB 1W0WB 5DEGA 4KVNL 4TRPL 2DMCA 1QOKA 5HYJE 5C9JB 2PETA 3C8DA 4I8DA 4ZFGH 3MUHL 4NP4H 4P9HL 4WTXA 3LRHA 4P23D 3I50L 1DE4B 1KTLB 3UYPA 4JZJC 4WFGD 4PY8I 5GGQH 4YLQT 5I1KL 4QRTA 5E95B 3ZE0E 4PJ5D 4Z95H 1TXKA 4HUXB 2WWKO 4HPYL 4NO3B 4U05A 4LFHD 5FGBA 4J3VA 2DQGH 3MRDA 3TBYB 1C08A 5HHQA 4GUPA 4JZOA 4PRPE 1I3VA 1AIFB 1UVQB 2EDBA 1OSPL 2VZSA 2YC1B 4R4FL 2WBWB 2YBRA 2CO6B 2Z31D 1UACL 3VD9A 2OI9B 1CLZL 4M48H 4XNYH 3L3HA 4I3SH 3SPVB 3HE7B 5DURD 4CUCA 4F57L 2ARJQ 5FV1L 5I8OH 5HHOA 5C6TL 3PXJA 4X99A 4R4BB 3MJ6A 1HKLH 3IDJB 1ORQA 5ACZA 1MVFA 2CQVA 5HD8D 3EYVA 5FUZH 5GZNC 4OFDA 3CDCA 5IM7B 3R0MA 3RX8A 1HHHB 2XN9D 2NNAA 3LKPB 1ZS8B 2OCFD 5ADPH 3CSBA 2UZYB 4FQ1L 4OCYH 1BLNA 3V4PH 3Q2CA 1E27A 3MRNA 1EFQA 3P73B 4ZPVB 1KEGH 2Q3AA 3T3MF 2VL5A 4LLUB 3CDYA 2M26A 3W81A 3EIFA 1YEEH 4GKNA 4P4KD 1EAJA 2NY3C 3CVHA 2DQFA 3AM8A 1N0LA 3N1GC 4XNXH 2VLRE 5K93A 5TGBA 3BT2L 1U8KA 4NQSA 1SJEA 1JBJA 3EJJX 2BNRB 3IXAB 1FSKC 1JGDA 4ODBD 5T3ZD 2GK0B 4QTIH 3LS5L 3GMNA 4L9LC 3VJ6B 5B8CC 1F3JA 2RCSL 2PO6C 2W9DL 2WW8A 4JRWA 4XCNA 3U46B 2R56L 2XTLA 2NLJB 4NCC1 1FPTL 3M1BA 1A2YA 3D18A 2QV2A 3BPLC 3DX9A 1FO0A 3O45B 5IK3A 4MCZB 2XWJB 4JHAL 3H9HB 1YPZE 4S0TD 4MA3B 4LK4A 1QG3A 5GJTL 4XH2A 2YK1L 4QXTA 1J0KA 4KV5F 1MCJA 5CILH 1IKFH 1NEZG 5D2NA 5K9QI 5DQJB 5T1MA 1TCMA 5E2VH 5LXGH 4I5BB 5ENWB 6CGTA 2VZVA 5DDHB 2M8XA 5C08D 5HVHC 3QNYB 4ZAKD 1A1NB 3SO3B 2QQQA 2MFNA 4R26H 5ALCH 1H3XA 2HJFB 3QDJA 5TE7H 1F4WL 3WIFB 2CDEB 3BMWA 1FZJB 3K4AA 3MLTA 3QSKB 2GJ6D 5CIPB 5D1ZC 1MWAH 1S3KL 4QY8B 3S35L 4CMMA 4M7LL 3CMGA 3H9ZA 3CFEA 1HZHH 3G04B 1BF8A 3K4ZA 1PG7H 3OR6B 2AK4E 1W2KT 2NY5C 3L7FA 4EUPG 4Q0XH 3EOTL 5I18H 2OP4L 2NW2A 4GAGL 1LP9F 4Z7WE 1QBLH 4JG1L 4HCRH 4WU7B 1IAMA 4JO4H 1W72H 3BPCB 4NRXA 3GSOA 3DURB 5B8CA 1DTUA 4XPFL 2C5DC 5GGVL 1ZV5A 1FFOA 1IM3B 3RKDD 5C09E 4LRNL 3QCUL 4JFZL 1BD2B 3WD5H 1U8JB 3LHPH 2XY2A 3LS4H 2DLFH 1P2CA 5KOVC 2K1MA 5ISZD 4LLVB 1A6ZB 3DMMC 1IC7H 3BEWA 3EO0B 4NQDA 4XCEA 3U7WH 2QQKH 4K3EL 2JJTC 3JTTB 3MRIB 5F7NC 1CE6B 2D31B 3PWNA 3TO4A 2YUZA 5I66A 3HAEG 3TBVA 4G43A 4HJ0D 4OCXH 3QT2A 3D2UD 4Z7VE 4Z76B 4NDMB 4N8VB 1NC2A 4BQ8A 5GXBB 4XNUH 1ZKAA 1BECA 2B0SH 1EPFA 3CX5J 2JKXA 2GUOA 4WGWB 3RPKA 1BX2A 1CFNB 4XGZB 5DRXB 4DUVA 3GMOB 1RZKL 3SHSA 4JHWH 1RD6A 1H5BA 4IDLA 2PR4L 4P57A 5HHNA 3FN0H 5HYSB 3MV8B 2QSCL 2IH1A 2AKRB 2H9GB 4E41D 1MIMH 3QDMA 4G6JL 2YRZA 1ZE3C 3FQNB 3T0ED 2H1PH 3AY4C 2B4CH 1T6VN 3IU4H 3MJ7A 3LRGA 4MNHA 1F6FB 3UAJC 4FQIL 4QTHA 3VWJC 5HYJD 4MS8D 1NMCC 1E28B 4HIHA 1NKOA 1Q1JL 2VZ1A 3NTCL 3FT2B 1KIUA 4JCMA 1N5YL 3H9SE 5IKCB 4XZUA 4M61A 4DTGL 5HGDB 3GKWH 2X9WA 3TNNA 3VXPA 4R8WH 3WFCH 3H7LA 4RCAA 2J8HA 4Y5VC 2OM5A 3IRPX 4IS6A 3E6FB 4X98B 3HHRB 4HWZB 1U8HA 2CLZA 1UJ3A 3FQRB 1WC7B 4P5MA 3BZFB 5D8JL 1DVFC 2BERA 4MWFA 1IE5A 2J88H 3QEQA 3MLZH 4M5ZH 4ZNEE 3CH1B 4C56A 4YO0A 4U1NA 4I18C 3NFNA 3QNXB 2Q20A 3RGVC 3ZTJG 4XAKE 2XACC 3QH3A 2PYED 4KPHL 4P5TD 2Y06L 3O6FB 4NM4H 1BPVA 2ADJA 4JPWH 1J8HB 3AREA 3QUKA 1EA9C 5GGSA 3SBWC 4IRSA 4HFWB 4EI6B 3PGFL 2HFGH 1KCVH 4PRID 2P8MB 1FN4A 5K9QG 1LE5A 5BV7C 4Q6IC 3W11C 2P46B 4OGYL 1CQYA 5BW7A 5L2KA 4HIJB 1TJHL 4R7NA 1NAMB 5ICXA 5FGCE 5IVOA 4DGVL 5HI3D 1UKQA 1KENL 3MYJA 1OHQA 4J1UB 3NH7L 2JJVA 4OD1L 4U2YA 1J1OH 2NY5H 1FIEA 3BD5A 5DJDB 2GJZA 1EEZB 5HHPA 3GKZA 4Y16D 5EA0H 5IESH 1IL1A 5HYQA 1SJHB 1E4KA 3SCMC 1CICC 2ZUTA 2A2QT 4TVPE 1FNEA 2RGSA 5EIQA 4P3DB 4DOHE 5J1SC 2MKLC 3KXFE 3D69B 5JXAL 2XY1A 4U6XB 3BH9A 4HEME 4M7KL 5E8EA 1EO7A 3DVNA 4C54A 2X89D 4U1LA 1A4JA 2YWZA 3UZQA 2DWEA 3U30C 3D3VA 2B7DT 1VFUA 1BVKB 5DO2D 1T03H 3U7YL 2VLRD 3ESVF 3OPZL 2O5ZL 4POZC 5KVMC 4NHUB 3VRJA 4NQEE 1QRND 4IOSD 4LRIC 3JXAA 2V7HA 1WBXB 1I1FA 2IAND 4JFEA 1LK2A 4P23A 4ZUSA 4FFWC 1NUGA 5CJXC 5EU5B 4ALAH 2MMXA 1EFXD 1KB9J 3WS6A 1A1MA 4LP5A 1Q72L 5M94B 4WFEE 4HWBA 1T1WA 2UV3A 2F8XC 5FECB 3ARBC 1E4XL 4GG6F 3ZKXB 5BMFL 3MOBH 1NCAL 2AJ3B 1Q94A 4P46A 5T3ZL 4GBXC 1HHKA 2NTSP 4E5XB 1BZQK 5CJ5A 3CVIH 1ZVSA 2YS4A 1R3HA 5F6IC 3OL2A 1EIBA 2VXSL 1KULA 3U48A 5E8PA 3GRWL 4DW2H 2CPCA 5EZIL 1PJ9A 3DI2B 3WNLA 4TTDC 3SGEI 2F54B 5CZXD 4JFDA 3O8XA 4JO3H 1QYGH 3O2DH 3MLYL 4XP4L 3S36L 4AK1A 2VUYA 2P24B 1KLGB 6FABL 3I02A 1NMBH 4LIQE 3QIUA 1UH3A 4KKBC 5EO9B 4JR9L 2QADB 1NGZB 2IAMC 3GJFB 1FBIL 4GAJL 2GCYB 2FD6L 3OHXB 3UO1L 2NY7H 2ADGB 4NRYA 4KZEL 1CICA 1FIGL 1QFHA 1RZ8B 2X4QA 3S4SB 2G5BA 5DMGD 4ISVB 2DYPA 4LKXB 2ZZUT 3B2UD 4H1LH 3RA7L 1T3FA 2OZ4A 1OTTC 3S37X 5HHVH 1FAIH 3QPXL 2MNUA 4N0CD 4PIRF 4R0LA 5DR5L 1WEJH 4OZGE 5DEZA 3FHQA 4KJPD 5I15L 1QR1A 4HULB 1FNGA 4TPRH 5JUEL 4OKVB 5CJ8A 1DBML 4Z18A 4DEPC 2HWZL 5TE4H 3VFWA 3UTSD 4MXWL 3RVTD 1C16B 1RK1B 4BJLA 4XCCL 5CJXA 3MGAA 1UXWA 2MKWA 4G6KH 4KHTH 4PFEA 1KBGH 3Q1SH 3BQUC 4HK3N 3DJ9A 4GAYB 1X4YA 4G7VH 3CLEL 3U6RA 3VI4F 3HNSH 5SX4I 5C09D 5CP7A 3T2PA 3ZL4L 4TNVK 4UIKH 4XBPA 3ROLA 5BV7H 4FNLH 3TWCL 4XNZB 4LP4A 4ELMB 2BJML 5E56A 5CWSB 2YR3A 1RIUH 1VGKB 1OB1A 1P9MC 4MCYB 5BS0B 2P4AB 1BFVH 4YR6A 4DKFH 2I9TB 5E6ID 4HIEA 5F9JA 1OW0C 1YEKL 2E3VA 3L1OH 5I0ZA 2YN5A 1HH9B 4U6HA 4CBPA 3LDBB 4ODVL 1ADQH 5IMLB 2B1AL 3ARFA 3PGCA 2DIBA 1OGAD 4JY6A 5D71H 3OX8B 3P30H 4J3SA 5ANMA 4HLZG 1JPST 2COQA 1I7TA 2G60L 4FZ8H 3HUJA 1FH5L 3LZFH 4JKMA 2P5WE 4FFZL 5IJKC 5JOPE 1WTGT 3O6LH 3VXSD 5E4IA 2F9BT 4X0KB 3C6LA 5DK2A 3MRLB 2AK1H 1VACB 1BAFH 1G0YR 4MJIB 3S7GA 4TSAH 5CBAB 2FIRT 4DKAA 4X83A 4M1CC 3N1FC 3GIZL 1AGCB 1B4JH 1N0XH 2QQNL 3KPQA 1OAXH 4FMFA 2XA8L 1IT9H 2A1WH 4QWWD 3OR7A 1I1YA 1RJLA 3HCVA 3UTOA 2AV1A 1EAPB 4G42B 4GKZB 4OQ1A 4U1GC 1J0HA 2EIZA 4YPJA 1I1CA 4YC2B 1P7KA 3VRLE 4KK8C 4RWYL 3CPLB 2ILLA 4Z0XB 3BO8A 4OLWH 1FGNH 2EDOA 1IAIM 1UB6A 3HR5B 3KNBA 4IRJC 3GBML 2EXYD 5EH1A 1J05A 4U1SA 4YDLC 1P9MA 5JPMB 2YSSB 4LQ1A 1TQCB 3GI9L 3LIZH 5L8KB 5E5MA 3HI1B 2MHAA 2W91A 3HLAA 1AKJA 1EZVX 1WT5C 2DTSA 5I1AA 2YPVH 2CK0H 4OZHF 5D5MB 3V0VB 4WO4B 2OJEA 4HF5L 5CMAB 2Q7YB 1U9KA 3RWHB 1T1XA 2X7LA 4HGWA 1W0VA 4K7PH 1J1XL 4AH2A 4WGVB 1DJSA 2H32A 4YDVB 3HG1A 4LCUA 3W39A 1IGJB 4G6FB 4OAWB 3SE4A 1N7MH 2IMNA 2D0GA 2NYYD 1ACYL 4M7LT 5D6CA 5HJ3A 3UC0H 2J4WH 3QI9C 4BZ2L 3H0TB 1M7IB 1G0DA 2FX7L 4I3RH 4NQCE 4JGMA 4C57C 3SE9L 32C2B 1RHHA 4NO2B 1QPXA 4M6ML 4TVPD 5HHMB 4YWGL 1JI1A 1ZHBB 2OMNA 5DJZB 4WFHE 1KJ2A 3VH8A 1U2HA 3OG6B 5DUML 4DWHA 4ZUUA 3JV6B 3UJIH 1RIVL 3RZCB 5L9DH 1FNSH 5AG8A 2P5EE 2X5PA 1AHWA 4PD4K 3QXAA 1U8NB 2CRIA 1LO2L 4N9GB 3L5IA 3T2NH 5J89A 3WNOA 1V7NL 2E6QA 3I6LD 1KXVC 1YZZA 4KMLB 4U1JA 2Z93B 3PHOA 5B4MD 5IGXH 1QP1A 4JM4H 1EXUB 2BNRD 1MHHA 1J0YA 2YEZA 4OGZA 4PBVC 4X5XA 4AIOA 1YMHA 2FZ3A 2FH6A 1OAZH 2DQEH 4YBLB 5JXEC 3TFKD 1A0QH 3RWGB 4M6AA 3LKQB 1MLBB 5EG6C 5JOFA 2BSSB 4XX1E 1MI5A 1KCSL 1XF3B 2Q7NA 2JCCA 4PJFA 4W4OC 4XVSH 4Y1AB 1RJYA 5J6HA 5CZVL 2ZPKL 4PTTA 4ODSL 4YHNA 4OLEA 1XCTA 1E4XI 1PZUB 3DX7B 1IGIH 5GS1A 5D2LE 1GGCH 4WI3A 3JBG7 3B8YA 5IIEA 3S5LA 4CW1A 5F1NA 4EVNB 1LNUA 2B2XH 2X4TA 4NRZA 3OKLB 3K1DA 5CEYA 2NY4B 2EIDA 4NPYA 4X8JB 1IJ9A 2QHLA 4HXBL 1I7ZB 3FT4A 5FO8B 3DNKA 1X5JA 3DGGB 3G6JB 3QI9A 1Z0NA 4NN7B 3ZKQD 1OCWL 1R3LB 3C60B 4YX2H 1MHEB 3BYYA 3U9PH 4HKJA 1XF5B 2I60H 1JNNL 4MA1C 1H8SA 3FRPA 1A1OB 2VKWA 4LCWE 3WXVH 1G7LB 5EOCJ 3UBXA 4M7ZC 2X4PB 25C8H 4FQHB 5B39G 2YXMA 4LLDA 5HGBB 1MVUB 2BRRH 3LEYL 4G80B 4ZTOH 4JDVA 4KFZC 4ZD3H 1SMAA 4R7DB 4K8RD 5IB1A 1HHIA 1MY5A 2FEEL 2CUHA 3QUMA 5C07B 3VXRE 1F8TL 3DUSA 3QP3A 2YD7A 1PDKA 4KUZL 2XZAL 3NA4A 3ARZA 2IANA 5FCUL 4ESKA 3JVGA 1EHAA 2VR9A 1SM3H 1ZT7B 4YBHA 3JTSA 1BD2D 1HSAA 1OOAA 3UJTH 3WKMH 3TYFB 3KPRB 1M05A 4WHYG 3DSFL 3QIBC 4X9IA 3HE6D 4OF5A 5DQDL 1A6AB 2JLLA 3RVWD 4JRXE 1G7PA 5DK3A 5L7XL 3JWOL 1CDBA 1JWMB 2BVEA 3BZEA 3DROA 4G8GB 4ORGA 3GSWA 5F96H 4PJCF 5D1QA 1TIUA 4Z7OF 1JZ4A 4LEOA 5CKGA 2CK2A 1U8PA 2FLBT 3BISA 4BFGA 4TSBH 4LGPB 1KN4H 4LSQH 4IOIB 4JB9H 1AGBA 1WZKA 4FS0A 1NCCH 1ZK9A 4JFXB 4LFHG 1J1PL 1DR9A 3QXVA 3RNKB 1AXSA 2AW2A 4MXQC 3MV8D 2ZOLA 4XPTL 3IFNH 3U4BL 1JTPA 1HXMB 5JOPD 3FQUA 5B38A 5IB3A 4YUEH 1HEZA 4PJBE 5FUCE 3RPIB 4N0RA 5KS9F 1T0NA 5GIRA 2EO9A 2VIRA 4PJIF 2WQRA 3CXHK 1PZ5B 2HN7B 2YA0A 3VFTA 4FQLL 1MCRA 4EI5A 4L4VB 3SDXF 4JJHA 3BGMB 5KSBF 2OTWA 2D03H 3C09C 5LCVH 5HGAB 1GPOL 2F74B 1HSBB 5F3HB 3AFLA 1AGFB 1MJJB 2VISA 2AJVL 4XI5D 5I9QB 3D9AH 4R2GB 1OT2A 2JELL 1UCTA 1VFAA 5C0FA 5AZEL 1HQ4A 3I2CH 3MA7B 5EC2B 3UPRA 1DLFL 4FQJL 3QHZH 4Z7UB 1MNUH 4KC3B 2FX9H 4O4YL 1G1YA 1K6QH 1MJUH 1MRDL 2R0ZH 1LEGA 5T5NG 4XBGB 2YPLA 3EDEA 4MAYB 4PB9H 3O6FD 1MRFL 4EUPH 1J8HD 3GEWB 4KKLC 4MNQB 4HKZB 2XZQL 1EEYB 5LGJA 4M62H 3OV6A 4LLAA 1XH3A 3F6IA 5T33L 5C0EB 2X70A 2XNAA 3MZTA 1MCQA 4JRYE 5CP3H 4OLVH 4CDHA 2BOBA 2XRAH 4JDTH 2A73A 3QAZC 4M03A 1A7OH 2EE6A 4LSPL 4UAOB 2X4UB 4U6VH 4QRRA 3MCLH 4ONOA 3UMTA 4A6YA 1DLHA 4OZFG 1F58L 5C0BB 4HX1B 1FL6B 12E8L 4HIXL 3O41B 4ONHB 1MUJB 1FE8H 4XVUC 1RUMH 4CNIB 4O5LH 1YNLL 3H3BC 3IDXL 4ODTH 3MRCA 4HJJL 5EBLA 3HAEH 4AEEA 3NCMA 4WFHD 2SEBB 2OL3A 1IAIL 3HPLA 1FV1A 4PLNC 2FSEA 1SJVA 1CD1B 1HOCB 3LVEA 2HMID 2P5ED 4YQXL 1JIBA 4N90E 2NXZB 2Y07H 5CBEA 5FA4A 1FVCB 4TVPL 2ZNXA 5C9JA 4K3DL 1XGTB 3L6FB 5FOBB 2KZWA 5DJCB 2CMRH 4NZDA 4ODHH 3BSZH 5GS0C 1D5XB 5JORA 2ZUVA 3VXTB 4XC3L 2Z4QA 5KANI 5BRZE 5CD3B 1R5VB 1FJ1B 1S9YB 5E1AB 2CSPA 1S7QA 3G5VB 3AS2A 2EDXA 3N50A 5E9DB 4G5ZL 4YFLI 3EZ8A 1LVEA 3BKYH 3OGCA 3QJFA 1AFVL 4HUXA 5DJYB 1I1AB 3TBSB 1BEYL 5C8JA 3M8OH 1QHOA 4K3HA 5IG7A 2YMXH 3SDDA 4D0BB 1QLRB 1NUNB 4NKDB 3U0TB 2EZ0C 2YD5A 3OB8A 5EULV 4ZXBA 1NBYB 3CFKA 3HNTL 4OSUL 4Y4HB 4FTVA 4Z5RB 1XIWD 4YHLL 3OQ3B 4O2EB 1Y6KR 5C0AE 3BP5B 2F54D 1IBGL 2OSLB 5CSZA 1G7HB 1NBVL 4Q9RL 5DT1L 3EBAA 3HE7A 5ALBL 2EDTA 1V7ML 3R06B 3EJZC 4JY5H 2DQDH 2QADD 1VCAA 3G6JE 4NWTL 1BIIB 2Z91B 1NFDF 3N06B 5C0GB 3ZTJH 1VFMA 1YEFL 1CXFA 1CLYL 2BDNL 3ECBB 1LK3H 3PGDA 1R3IH 3IDJA 5HHXL 4R3SB 5T1DL 3OMZA 4LIQL 1UM5H 4QHMA 1QLEH 3GGWA 1MJ8L 3OG4B 4MX7B 5SWSE 2WBJD 3FZUD 4KRPC 4OZIB 4IEFB 5E8NA 1ZS8A 5E8OA 5K59E 4P9HC 4NYLB 3P73A 4ZPVA 5HDLA 1EHNA 3QEUA 4KK6C 5F7EL 5GSVB 4LLUA 1J10A 3KR3H 4X5LA 3DWTA 1WIUA 4XMKL 3PV6B 4OTXH 3VXRD 4F7TB 2ZJSL 2VR5A 5FA3B 5JQHC 3QG7L 5IEHB 4UTAL 1UH2A 4PGJA 4P5KB 3K80A 4QRPE 1S7RB 1SEQH 5GRUH 2CRZA 1MCDA 3X3GH 3SKMB 5C0RL 3MRFA 3IXAA 1B0RB 3NZHH 5EBGA 4Z7NE 4K8RL 1FYTA 1AE6L 5CEZH 1I9JL 2FEEI 2NY6B 5I8KH 4HC1A 2EDYA 3VJ6A 4IM8A 1MEXH 5DD3L 4D94A 3BPNB 2CKBL 4RAUA 2D0HA 2QHRL 2V9TA 3PWVB 4GRLA 3FFDB 3IU3B 3P4OB 1I7UB 4QOKB 5BS0D 1OP5K 5AYUL 5I19H 1T04B 3C5ZB 2Y36L 2WINA 3O45A 1WCBB 5JDSB 1Z3GH 3PL6C 2XWJA 1RULH 4MA3A 4CN6A 1JNLL 2HA1A 5DVLA 4JN1H 3EYSH 2JB6A 1IZKA 3I6KA 4QT5A 2JF1A 4WRLA 1QFUH 5MP6L 2BVQB 4ZS6D 5JMRA 1G6RL 1JYNA 4I5BA 5ENWA 2E5EA 1X7QB 5HI4C 3TA3B 3ILPA 5EOQH 1WLHA 4U7MA 5I1CH 1UA6H 1FVEB 1A7QH 1IM9A 4RZCB 3RX5A 5FGRA 5J4MA 5ICZB 4I77H 4WHTA 3PWLB 4IOFC 2DQHL 3SGDH 5GS0H 4KKCD 3IFOB 2CDEA 4UT9H 2ESVA 2X4SB 1ZTXH 5CIPA 1I9EA 4MJID 3O0RH 4BYHA 3GSQB 1KC5L 4QY8A 1ODAA 3O3DB 2DM7A 5H94B 5FM5M 4LVOC 5FOJA 4PJHE 5H35A 2ITCB 3SKJH 1KCRH 3WFEH 2OQJA 1CN4A 1KB5H 3TN0D 5A2KH 1OP5H 3CCHB 3QFJB 3GBLA 5DD0L 4ZOEA 5K33A 3VFSB 5MEOA 3KPTA 3Q6GL 1PGRB 2ENYA 4WU7A 3GHEL 3MLRH 3MLXL 1OAQL 5IQ7L 3DURA 1AY1H 5GS2D 4KVCL 4MB3A 3FAXA 1F6LL 2IG2L 3MO1A 2WIMA 5B3JF 5C2BH 1CXEA 3BP6B 2AVGA 1JHLL 1UM6L 4MNQE 5HI5D 3MRIA 3Q3GB 4Y2DC 4F7EA 5J8OA 2D31A 4JHBA 2J6EL 4WO4D 2OK0L 5IB5B 2DRUA 4PJDE 4JLRB 15C8L 2ED8A 4N8VA 1DL7H 2R39A 4YK4B 5D1XB 5CSGA 1J86A 2X4OB 1CFNA 4ZSOB 4AMKL 2APXA 4P9HH 4G6FD 5D7IF 4O51B 2GAZB 3GMOA 5IFHL 2UZXB 3DXAA 3ARGD 1YJDL 4MQ7B 3RDTC 2GKIA 2EEAA 4PGZA 4P2RE 1T2QL 4NN6C 5GS3A 4ZUTA 4YHZL 5FFLA 5HYSA 5FK9B 4L9DA 3RY6A 4CN4A 1HH6B 4HPYH 4WHCA 1T6WA 3LH2L 4C59B 4HDIA 4KQ4H 4ORZC 3PWUB 2KQMA 5EPMB 4C4KO 1EHLH 2D4FA 5I1HH 1SYVB 1BVZA 2HTKC 4JN2B 4G8EA 4IMLB 2L0DA 1VEPA 2CH8A 4NSKA 1PX3A 3BOVA 3PP3K 4HLZH 1IAII 2Y5TB 3MGTB 1QQDB 1FO0H 3ARQA 4AEIL 1KLUA 5BRZD 1CFVL 2LVCA 1YYLH 3DARA 1OP9A 4DVRH 5DTFA 4F57H 4X98A 4HWZA 2AEQH 1U91A 5MENB 3T77B 3ZSSA 1WC7A 1YY9C 4Z0BH 3CFBB 3VMOA 3QB7C 4OCSH 4ZQKB 5C6TH 5SWZB 5KAQG 5EO0B 2E7HA 3PIQB 4ONFL 5L6YH 4NNYB 1DQML 2FJGB 1A9EA 1NFIB 3QULA 2XV6B 3S34L 3L5HA 5ILTH 2C7UB 3RAJL 1PAMA 4ZS7H 1TJGL 5DS8A 1Z5LA 4ERSL 3QNXA 4XPBL 4Y1AD 3WIHA 4DAGL 3VD7A 3BKJL 3ZE0F 3O6FA 4PLOB 3D0VB 1JPSH 4NZRL 1JZ5A 4KTDL 1MPAH 4HUVB 3BKML 3FAWA 1RZKC 3UTZB 2NX5B 3EDKA 1EJOL 1ZGLB 1FRGL 4Y4FA 5EU4B 2PXYB 5KS9A 2P8MA 2IGFL 4LSUL 1FLRL 3KYNB 3L5WA 3P11L 2NY4D 2GK2A 1A6WH 4YHIB 3P4NA 5TQ2L 1EVUA 4RFOL 2BY1A 2ITDA 3E1F1 4JG0L 3V4VL 5KSBA 1UZ8A 1QTYT 3PP3H 4N0FB 2DQIL 5JHDB 1P4IL 3NN8B 2NY2B 2YA2A 3JZ7A 4KGJA 3KG5A 3SQOL 1I85A 1DQJB 3QIWC 4KJWD 4LCYB 5DJDA 2LAGB 4EXKA 4P9MH 1UEMA 4K71C 3KAAA 3GO1H 2W9DH 4OZIE 2R56H 4WW2B 4K55A 4MAUL 2AJYL 1KN2L 4WWKA 5ESAA 1E4WL 4U6XA 5FYKH 3IAQA 1V3LA 1JJUA 5DA0B 4XRCA 4JHAH 5DHVH 3QUZB 1B2WL 4W81A 5J12C 1BJ1J 2VLKB 2EDLA 1CZ8L 5C07D 4UI2A 2VLJB 4XBEH 1MQKL 5T1LA 2F5BL 3MV7B 4PJEE 4DJMA 4YFLF 5JW3L 1DFBL 4GS7C 3VFOA 4NHUA 2DJSA 1YC7A 3TPUA 4UILL 3MR9A 5GRVL 4PGCB 2FYYB 3DO7B 1NLDL 5EU5A 4PP2A 1XGYL 1ND0B 3VD3A 4X6CE 3KPRD 4QYOB 3RWEB 1Y18B 4EZMA 3A6OA 4U49A 4Y8DC 3E2HB 1F4WH 5DFVD 2QJDA 2AJ3A 3RX7A 4TUJA 4RAVB 5C71A 4EKXA 1S3KH 3F7VA 1L7IL 1GYAA 2C1OA 5I2IA 4M7LH 4G8GD 2DQJL 1G9NL 2EDDA 2AERT 4W6YB 2AGJL 1UADC 3FOMB 2VDQH 2EDNA 4QGYA 1T1ZA 5I73B 1GCFA 1NC4B 5M95B 2NZIA 2P24A 4GAGH 3DX6A 1U8LA 4R97C 3DBXB 1HHJB 3RIFF 4LNRB 3D39B 1VFBA 4R90L 3ARPA 1CG9B 5IFJB 1WTLA 4Y7MA 5LAXB 1A14H 3T1FB 2XA3A 5HD8C 1E4JA 2GCYA 4XPFH 4JANB 1UJTA 3O2WH 1YEDB 3NVQA 1D5ZB 3EOAA 1MQ8A 5DMKB 1R24B 4LRNH 3QCUH 4JFZH 1CD0A 3LN5B 4I2XB 5INCB 5GGTH 3W9EB 1JZ8A 2P8LB 4ISVA 2F53B 2IFFL 1YEIH 2F58H 4U6YB 4TSCL 4L4VD 3H7BB 5BXFB 4FXKB 1PKQE 5D7LA 5DVMA 4P4KC 1RK0B 1JN6A 4GAFB 1QR4A 4DZ8B 4WTWA 43CAB 1NLBH 5CS7A 1C12B 3T4AB 2GITB 3ZSTA 3SKOB 3TVMA 4F37F 4R2GD 1RUQH 3PNWB 3IDYB 1WK0A 4ZFGL 5IBTL 2EKJA 3TH2T 4HAGA 4H25B 3DETD 4NP4L 3GSNB 4OIAA 4AQOA 3VXMB 4GAYA 5KG9B 2PR4H 5GGQL 3QDGA 1T1YB 5GJSH 5JA9A 4Y4KC 4Z7WF 3MJ9A 4L3EA 2NZ9D 4Z95L 1LO5B 1OTSD 2VC2H 5CWSA 4LARH 5DVKA 3BEVB 4MNQD 4GRWB 4XHQA 3N1PC 4YEEA 1NFDA 4OV5A 3HZVB 5KSVA 1GSMA 2I9TA 1G7IB 1I7RB 2NR6D 1HIMH 1Q9KA 5ID1A 2PCPB 4BSWA 3G6AB 3B83A 1A5FH 1HH9A 1P7QA 4JM2B 3QEHA 3CX2A 1EGJA 3G5ZB 5T1KB 2BRQA 5C9KA 3P0VH 5F9WB 3KYKL 4XNYL 3CNKA 1X5YA 2AEIT 4I3SL 4WHYH 4WV1A 5AZ2H 5I1LB 4Z7VF 4ZAKC 3O4LE 3VXUE 4JFFE 3F7YB 1YNTB 2WIIB 3DV4A 4OCMC 2HT2D 3CU1A 2PYFB 3FN9A 2HJKB 4RISH 4GQPH 3K0WA 1HKLL 1S7UB 5CJBA 2A6KB 2EDRA 1HINH 3HKFA 3WE6A 2IFGA 3ELAT 1E6OL 1K3IA 4JVWA 1WISA 2EDHA 2FCBA 4X0KA 5FUZL 5I1EL 5EWIH 1KJVB 1U8OA 2XI9A 3QUXA 3RVXC 3BGAA 1FP5A 1VACA 3NABL 4KPHH 1MCPH 5ADPL 1C5BH 5CBAA 4OZ4B 3MLSH 4OCYL 3V4PL 2Z8RA 4PP1C 4UV4L 4K3JL 5CGMA 3VFGH 1KEGL 4ZPTA 1T22A 1AGCA 5ID0B 4H26B 4KDTA 1EAPA 5JHLL 4QXWA 4OGYH 5F7FA 1QFWH 2VLME 5EC1B 2VNCA 1OPGL 3CPLA 5EU6A 4Z0XA 1RUKH 4TNWF 4CVXB 4F3FA 3HR5A 1KENH 4JDZA 3RKDC 1FZOB 1FL5A 3GRWA 1MLCA 1I1AD 2R1XA 1JYXA 2IPTL 3K46A 5IW1B 4LVHB 4FZEH 3UDWA 5IMOB 5DK0A 3QQ4A 1ETZB 1X5AA 5INDA 2R0KH 1UB5B 5F9DC 4HIIB 5JXAH 3VRIA 1IEBA 4M7KH 5EUOE 4HJ0C 4PGBA 1ES0A 1FNAA 4KAQH 3F8UB 5D5MA 3V0VA 4WO4A 4MJ5A 5F9OH 3MLPA 2GYSA 2IJ0C 2Q7YA 1TZGL 1A64A 3RWHA 2BCKA 5CILL 4HUWB 5E2VL 4YDVA 5LXGL 3B9KC 2WMPA 4XP9H 5F8QC 3GDBA 4OAWA 4TUKL 5EFIB 4OBRA 4PPTA 2DQCH 2JJSC 3R4DA 4P2QB 3MRJA 2BSRB 3STLB 3FQWB 3SE3A 4LPYA 3T0EC 5ICYA 1OARL 4RA3A 4ODXA 4R26L 2QTEA 5ALCL 1MIEH 2GSIB 5TE7L 5E1HB 1DEEB 2QR0B 3WNMA 3GB7B 4CADB 2WQ8A 3GMMB 3FB7B 5JZ7D 1MWAL 5T3ZH 4JGUA 4O02H 3RZCA 4MS8C 3BP4A 1YN7A 3IS0X 3QXTA 4NQXB 1BFOA 2EXWD 1YEJL 1VADA 2VXSH 4OZFH 2BSED 3NCFB 1HZHL 2GI7A 4UIMA 3FFCE 1PG7L 2EYTA 5EZIH 1SVCP 1SYSA 4Q74A 3RWJB 1FYHB 4OF0A 2HVJB 1QO3A 2VZTA 4Q0XL 5DD6A 3MLYH 4XP4H 1EXUA 3VW3H 1RJZB 3SJVB 6FABH 2JJWA 4U33A 1QBLL 1REIA 3F62A 4JQIH 3UTTE 3GM8A 3RWGA 2NY6D 3NCYP 4JO4L 3SQBA 4V1DE 1K4DA 1W72L 1PQZB 2RBLA 3LKQA 1P4BH 4ZO6A 2BSSA 3FO2B 2HLFD 3AGVA 2R2HA 2RIKA 1GGYA 1NBZA 1U3HB 3UO1H 4WUUB 2JJUA 1FIGH 1UM4L 4QOKD 2W0FB 4P5TC 5D7IA 3LS4L 2DLFL 2BVOB 2A6JB 5TDOB 1IC7L 3KPSA 1NMAL 3ALXA 3RA7H 2QQKL 3HNVL 5FO9B 3HC0B 3PP4L 5DEGB 4ZNCD 2YN3A 5DR5H 5I6XC 5KVDH 3MREA 5I15H 4OCXL 1D5MA 1DQDH 4QXUH 3B9KA 4WHDA 3WN5C 3BW9A 1J18A 5F89B 1O7SA 3VE0A 4X8JA 4XCCH 3N85H 3DGGA 3C60A 4APQA 4JHWL 1MHEA 4CU6A 1P6AB 4S1QL 2CR3A 2B5IB 1XF5A 2C3VA 4Y16C 4QRTB 3FN0L 4OF8A 1TENA 1E6JH 3MV9E 4RMTA 1QLFB 4I2XE 3VXOA 2BJMH 1JZ3A 2X4PA 1TPXB 3ARUA 4UU9B 4Y5XA 5C3LD 2H1PL 4MZ2A 3AB0C 3GSVA 2B4CL 5JW5A 2UWEB 5IQ9A 3WSQH 2L4OA 3MRDB 5TDPB 4ZYKA 4HKBB 3HFMH 1B6DA 1MVUA 1NCNA 3GJEA 4UUJB 5HHQB 4GUPB 3TJEL 5L0QB 2D7MA 4G80A 5DO2C 1ZWIB 3OWEA 3QFJD 4R7DA 5JOEA 3L3KA 5TDNB 1YUHA 1RZ7H 4NFCA 3LRSA 5HPOA 1J7VR 1CLOH 4R8WL 1NANI 1UCBL 3KLAA 4OZGF 4DCQB 2R9HC 3KHOA 5ETUA 3L3HB 4S1DD 5F72S 1L7TH 2P1YA 3IDGB 3BGFC 4J4PD 5HHOB 3BUTA 1ZT7A 5SV3A 2XQYG 4X99B 1WAAA 4UB0H 4OI9A 4PRPA 2I9LB 2J88L 4FFZH 1ORQB 3MLZL 4M5ZL 5F70A 1P53A 3ZKSD 5ACZB 1F2XK 2G9HA 5I1GL 3EYVB 2AAVA 1FZKB 4RGMC 2DF3A 3GHBL 2AQ2A 2CRYA 2WP3O 1EVTC 3F12A 4F80A 2DI9A 4MDIB 2JE8A 1JWMA 1BLNB 4BSJA 1E27B 3GMRB 3MRNB 4JPWL 5K9JL 1CVSC 3CGTA 3KYOB 3LV3B 3LD8C 1KJ2H 3CZFB 2QQNH 4PRBA 2HFGL 2XA8H 3FQTA 3O4OC 1QA9A 5D1XD 1BBJA 4GKNB 4X4MA 1KT2B 4HG4J 1NSNH 4PJGB 2BOCB 3KS0J 3CVHB 2DQFB 4IOIA 3F58L 5D72H 4WW1A 3VXUD 3D0LB 4JFFD 1L6ZA 4RWYH 2R4RH 3PQYB 3TH4T 3MROA 1I4FB 5TGBB 2XG5A 1U8KB 3RNKA 5J06A 2YZ8A 2DKMA 3W0WB 4NQSB 1SJEB 3ESUF 3F65A 4G6AD 5D9SB 5J6GA 3GIVA 1J1OL 3AMKA 3DO3A 5DMGC 3UROR 3H42H 3B2UC 4FOMA 4KJYA 5EA0L 5IESL 1YMME 4W70A 3GI9H 1PZ5A 2HN7A 4EOWH 2NTFB 4N0CC 3M1BB 3OXRB 1A2YB 1YA5A 3D18B 3DX9B 1RI8A 5IK3B 1ZGLM 5BZDB 4RMUA 4XH2B 1A22B 1CK0H 4QXTB 2XTJE 1HSBA 3RVTC 2VLMD 1T03L 5IOPB 3KPOB 5E4EC 1J1XH 5T1MB 4YE4L 4RFNC 3S4SG 1A7PH 3MODH 3OKDB 4UDUA 4EDWH 3BXNA 2CR6A 2PUQT 3JWOC 1ACYH 4AIZA 4ALAL 4JQVA 3VRLF 2UVFA 1Q0YL 4M6MH 4XBGA 4YWGH 5D6DA 3I75A 4MAYA 5FKAA 5DUMH 3MLTB 5E6IC 3MOBL 3OJDA 1AGEB 4GKSA 2NX5D 3ULUE 2MCPH 1V3KA 2PXYD 1IEHA 5C0EA 5F6HJ 3V6OA 2X1PA 3GSXA 3CFEB 2ZCLL 4DW2L 3C8HA 3ZHKA 3QXDB 3MMEA 3L7FB 4UNVA 4DVBA 1QYGL 2B39A 3QQ3A 2NW2B 4FXGA 4HT1L 5JHDD 1NMBL 2NY2D 5C0BA 1FL6A 3WJJA 4YZFE 4ONHA 1MUJA 1T7VA 2CXKA 4NKIL 4NRXB 3GM0A 3GSOB 1TQBC 4CNIA 3X12A 5B8CB 3WDJA 4HK3J 2NY7L 4IJ3B 5DD1L 4WI2A 4PGEB 5IVXE 1HOCA 1P2CB 2XZCH 4XCEB 4NQDB 5IJVB 3QUZD 4ODSH 1FVCA 1ZSDB 4Z7WA 2VLKD 5HHVL 4BUHA 4YXHH 3FFCD 4QWWC 3PWNB 2VLJD 3TO4B 5I66B 1SHMA 3MV7D 4G43B 2AXJA 5FKPA 3H3PH 1YEHH 1AC0A 4TPRL 3TCXA 2WUCL 3KHQA 1R5VA 5TE4L 5DJ0A 5CEZE 1FJ1A 1T89A 1H15A 2GUOB 4F9PA 1V05A 5IHLB 3UTTD 1BX2B 1S9YA 3SKUD 4G6KL 3G5VA 4KHTL 2EXYC 3BKCH 4HWNA 3Q1SL 5GISL 2R8SL 5E9DA 1KOAA 2BNQB 3QUYD 3HNSL 2VKXA 5DJYA 2Q8BL 4UIKL 5BV7L 1BQLH 4FNLL 4HD9A 4OIIH 3WKNA 1FL3B 3N9GH 4U3HA 1F4YL 4Z7VA 3FHAA 1X6NA 5CJOL 1DP0A 1QLRA 4NKDA 3SDCD 1IFHL 4LKCB 2OI9C 4TTGA 3SDAA 3MJ7B 2X40A 3EYQD 4WJ5A 4DKFL 4MNHB 4Y4HA 4Z5RA 4ODWA 4O2EA 2V17H 4NNPH 4XT1C 3L1OL 4YHPB 4KK9D 4UNTA 1DQLH 1NC4D 4XZUB 4G8FB 1D9KA 1EHXA 1VGEH 4U1HB 3TNNB 3PG2A 3GSUA 3ARXA 2HFFB 1OSZA 4I0KA 4KUZH 2FO4A 2VXUH 4OFIA 5I1DA 5D2LF 1BIIA 2NYYC 4MVBD 5D71L 3MNZA 2ICWI 2E7LC 4IS6B 4HZAA 1MCFA 5FCUH 1UJ3B 3F7QA 4L8CB 3ECBA 1I9RH 3NACH 4U4BA 1KLFA 1S9WA 3MV9D 1QEWA 3LZFL 5KSAD 4J3TA 3RL1B 3O6LL 4M4PA 1ZEAL 3H9SA 4X6EA 3NFNB 2AK1L 3GZKA 3QH3B 1BAFL 1KFAL 3JWOH 2ADJB 4LEXH 3QUKB 5GGSB 1EX0A 1WWBX 1B4JL 1N0XL 3PV6A 1OAXL 4F7TA 4X4XB 2KDGA 2PTUA 2A1WL 5DWUH 1JHKH 3F5WB 2PTVA 5IEHA 2MQ3A 1FN4B 2AEPH 2VYRE 4U1KA 4P5KA 4DFIA 4ZNEA 5C7XH 4XTRD 3VXMD 3TFKC 3SKMA 5IVNA 1B0RA 4R7NB 1J1PH 4PJ8C 4OLWL 5ICXB 1FGNL 1CS6A 2FHBA 1HKFA 5DFTA 4NC0B 1QSEB 2GJZB 3PWVA 5HHPB 3QO0A 2EDFA 3FFDA 4D3CH 4QOKA 3DRQB 5FYJE 1X5KA 3D87B 4DKEH 2IC2A 5HYQB 3ROOA 1LEIB 3C5ZA 4MD5A 4WI4A 2JB5L 3LIZL 1B88A 1NMCB 1LD9A 3BH9B 1CDJA 5E8EB 3CC5B 3DVNB 4JM2D 3KYAA 3IJYA 3OKKA 1CGTA 1CVRA 4U1LB 1A4JB 5T1KD 4X6DB 5C70A 3FB6A 3NCCB 3VDAA 3MSPA 4JFHE 4Y5VB 4NC1E 4NJAL 3TA3A 4K7PL 1HN1A 1XGRA 3SO3C 3U36A 2JELH 3ILQD 3WNKA 3VRJB 1HQRA 1FVEA 2V7HB 3ZLQC 1I1FB 4JFEB 5AZEH 3ES6A 3OAUH 4JY4A 5EIVA 3KXFA 4MA7H 2FEDD 5ICZA 3SGJA 4WTZG 3VGFA 3PWLA 5E2WL 1NGXA 5F8RC 1BQHA 1Q9LA 1A1MB 2OX5A 4I3RL 3IFOA 4O9HH 1U58B 3RGVB 1A6UL 2X4SA 5EU7E 4M6OL 3O9WA 3GSQA 1C1EH 1A47A 3MFGB 1FDLH 3MBEA 4P46B 5H94A 3UJIL 1HHKB 5L9DL 1JYWA 1FNSL 3RTQA 4NQEA 1WBZA 4K8RC 3VGDA 1ZVSB 1ZHNA 2XTJD 3T2NL 2FH8A 4Y2OA 5E8PB 3CCHA 4DFHA 1CYGA 4F7MB 3FJTA 3FRUB 5D2NE 3RIAF 5BVPL 4Y19A 4NIKB 1QD0A 4LSPH 4JFDB 3O8XB 5IGXL 4JM4L 4PJ8A 3SE8L 5DXWA 3EOBA 2D7NA 4EN3A 3I02B 1KTKE 12E8H 1OAZL 2DQEL 5IWLC 2E9BA 4KUCF 4EIGB 3HMXL 3IDXH 2VABA 3HE6C 4ZOBA 3RP1A 2CJUL 4NRYB 3QDJE 3SCMB 1CICB 3RVWC 1NGWA 4U3XA 2X4QB 2G5BB 5F7DB 4PBXA 2X41A 2IMMA 3ULUD 4XVSL 3O3BB 4HS6A 2DYPB 4Q9CA 3UEZA 1OM3H 1T3FB 2J8UE 2X05A 4TVPH 3W5NA 2HRLA 3U30B 4K3DH 3QHTC 2WM0A 4R0LB 2AI0H 4QO1A 1P69B 1IGIL 3QDHA 3ARVA 4IMKC 4P2CG 1QR1B 1OAUH 5LJYH 4GW4B 5CLTA 2B2XL 3NIGF 5GGSY 3VFWB 3TF7C 1AD0A 4Y5YC 1UXWB 4LLYA 5FK9A 1BJ8A 4NQTA 3MUZ1 1GGIL 3UCRA 1HH6A 4XBPB 5FYKE 4NBXB 1AQDB 1BEYH 5JW4N 4WI8A 2HVKB 2R0LH 25C8L 1VEMA 4KRMB 5D7JA 2Y7QA 4IMLA 4L8BA 3UXFA 4WFFD 4JZNB 4YR6B 2BRRL 4HIEB 4D0DA 1R3JB 2Y5TA 1XZ0B 3N1MC 2IEPA 2N7BA 1J88A 3CSPA 4ZTOL 1IGFH 4ZD3L 5EOTA 3PDOA 2ZWLT 1AI1H 5C0ND 3SJVD 1JPFA 2CKNA 4Q9RH 3PGCB 3IS1X 5ALBH 3WDIA 4HFUH 4LHJB 3E3QE 2EDQA 4XAWH 5MENA 4JY6B 3T77A 4NWTH 3CFBA 4LOUC 2IAMB 2VXVL 4DGIH 4ZQKA 5SWZA 3WFHA 1YEFH 3EO1B 4LU5H 5EO0A 1ZLSH 3OKEA 1U3HD 3PIQA 4PRHE 3DOSA 2BDNH 8CGTA 4NKQB 5T1DH 1MH5A 2C7UA 4LIQH 2I27N 1GHFH 1MJ8H 3KPPA 3QDME 4NZUH 1N3NB 3CFDB 3C6LB 3UPCA 5DK2B 4I3GA 3KPNA 1T0MB 2AP2A 4HUVA 4N1EA 3BE1H 5F7EH 1YJDC 1CL7L 2BMKA 4FQCH 2HJLA 4UV7L 1BQUA 4ZG1A 4HGMA 3V4UH 4DEPB 3KPQB 3KYNA 4PV8B 1G1CA 4J8RB 1KB9K 5KVEH 1RJLB 3HCVB 2KPNA 1CBVH 1MY7A 1CXLA 1OT1A 4TSBL 1KN4L 4LSQL 3TO2A 4YFDB 4JB9L 2DDQL 1DBBH 1S7SA 2E9WA 3V5HA 4GO6B 2HT4D 4K8RH 3RKPA 3OGOE 5IR1A 3BO8B 4PYHA 1I9JH 3CFJA 4ETQA 1UB6B 3IFNL 1K8DA 2HT3C 5JW4Q 5LKNA 3KNBB 3QEQE 1T4KB 1KG0B 2CKBH 4M7JH 1H3UA 4U1SB 3ULSB 1YYMH 2HMIC 4WW2A 2QHRH 1JGUH 4C56E 1IGYA 1SJXA 2AJXH 2VQUA 4YGAB 5GRYA 1NFKA 1OY3B 3ZHLA 3NPZB 4WUKH 1GH7A 4S2SB 2YOCA 4HWUA 5E5MB 2MHAB 2CLRB 1AKJB 1VERA 5K59F 4J3XA 5I1AB 4QRSA 2D03L 1S7VB 1S9XB 2OJEB 5LCVL 5C6WH 1T1XB 1LO0H 2X7LB 4HGWB 5L2KE 4AH2B 2H32B 3WS3A 5JPNA 3B4NA 3D9AL 4PGCA 5HHOD 2BXZA 3HG1B 3DO7A 4LCUB 2J6EA 3PJSA 3CDFA 3ZKXC 2VXQH 3L3OA 5HJ3B 3RWEA 3QHZL 3T0XA 1MNUL 2GTWA 3ZHDA 2FX9L 4HMEA 1K6QL 2X1WL 5FYJD 3EDJA 4Z7NF 4KJQD 5C0CE 1RHHB 1LP9B 4RAVA 1IC5H 4PB9L 1ED3B 1KC5H 4JREB 1QNZH 3QNZA 1XIWC 4P99A 4ZUUB 3V6BR 4M62L 4JKLA 5D7SL 1BWWA 4LLWA 4E42B 1AHWB 4G3YL 3PE9A 1CI5A 2YD8A 3FOMA 1UC6A 4KTYA 4U1GB 4OBSA 1UQSA 2FHFA 5TFSH 5DD0H 3D3VE 2QADC 4U1JB 4NQCA 2XRAL 5IMKB 4JDTL 3Q6GH 3PHOB 1A7OL 4QHNA 3IDNA 3D39A 4LNRA 1CG9A 1MHHB 2YEZB 5LAXA 1HILA 4HV8B 1KTDA 1OAQH 4IRJB 5E2TH 3T1FA 1S9VA 3O3EB 4MDJB 3L5XL 2WBJC 3FZUC 4GMTH 4KVCH 3FMGH 1FE8L 5DJAA 3J8F7 4O5LL 4ODTL 4PGDA 1CU4H 4NFBA 5TPWH 2R15A 1MI5B 4N8CH 2F53A 3QDAA 5FYKU 2XKSA 3L3JB 2YD4A 4QHLA 1GC1L 1ZA3B 4OLXH 4ZUVA 2DBLL 4EQ2A 4F15B 3IDIA 4HXAH 3CSYB 1CD8A 4PTTB 5EZLA 4RGOH 3WFDL 4YHNB 2OK0H 2R4SH 1HCFX 2LU4A 2VDLH 15C8H 1BMGA 2MCG1 3WEXA 5KTEL 1C12A 2CMRL 4LHQB 1FNLA 3BSZL 3KWWB 3SKOA 4NQUA 3S5LB 4BQ9A 4CW1B 5IIEB 4PJHF 5F1NB 1J0IA 3GUTA 1LNUB 4H25A 4RRPA 1F4XL 4NRZB 3GSNA 1YECH 3TJHC 4NPYB 3M07A 3C2AH 1ROWA 4OLZH 1YJDH 4XNZC 3QI9B 2DL2A 1CFQA 1SY6H 2EH7H 2UUDK 5KG9A 5IP4A 3T04D 4ELKA 1G9NC 4D9LH 1UGNA 1JGLL 3MXWH 4YHZH 4YJZL 1NAMH 3QDJD 1VPOL 4MJ6A 4HKJB 3BKYL 4AZ8A 4MLIA 5DJXB 3G5XA 3MUY1 1Z2KA 1QSFB 3VI3E 5D2LA 3ARSA 5E5RB 1F02I 3M8OL 3UBXB 2EEDA 1CXHA 2YMXL 4HK0A 3EZJB 3H8NA 5T5FL 1EJ6A 4LLDB 5E2JA 3BRDA 4YPGB 1GZQA 1UZ6F 4PJAB 2OTUA 4N1HB 4P2OA 4X6BA 1VKXA 3G6DH 1TZIB 3K8MA 4ZS6C 2D9QB 1QBML 3ULUL 1A6TB 1T5XA 3BDXA 1QHPA 1HHIB 5LQBH 1ZVYA 3DUSB 4LCWA 1H3WM 5DMIL 5CINL 4K23H 3GJFK 4PJDF 5I1LA 2DQDL 1A3LL 1TDQA 1YNTA 2WIIA 5JMOC 4MQSB 2HJKA 4KMTH 5FGSA 1R3IL 3JTSB 2DKUA 4BQCA 1HSAB 3JWDC 1NBQA 1TJGH 1UM5L 2MQCA 1M05B 3HN3A 5IVZA 3V0AC 1KJVA 2ZUXA 4NQDD 2IADA 2UUDH 1AXIB 1PY4A 5IHUH 4NZRH 1OGTB 3TO4D 2ZCKH 5F97E 3TN0C 3BKMH 4FQQB 4PD4J 3BZEB 5ID0A 1EJOH 3LY6A 1FRGH 5IBLD 3DROB 1DSFH 2XWTB 4H26A 3GSWB 3KR3L 1NC2D 5D1QB 4OTXL 3L95A 3ZDZF 3P11H 4RQQA 2XQBL 1XGUA 5B22A 4AYFA 1U8PB 4Z9KB 5TQ2H 4RDQG 2A6IB 3PHQA 5EC1A 5IROA 1PW3A 3BDYH 1SEQL 1N8ZA 4NFDA 4RFOH 5GRUL 5J9PB 3WJLC 2BNQD 2DQIH 5ANME 4JRXA 4NO5A 5CEZL 5ABDE 1AR1D 2ZOLB 3VWKA 3HUJE 1TQCC 3DTXA 3CU7A 3FQUB 1UKTA 5B38B 1MEXL 2C4FT 4M7ZB 3RWFB 5IMOA 3GJFH 5HI5C 3TIEB 1M71B 4MAUH 1ULVA 1ETZA 4QLRA 1T0NB 1E4WH 4HIIA 3P2TA 5HYIA 9CGTA 1Y0LA 1N6QH 2IH3A 3VFTB 5K9KA 1Z3GL 1FG9C 3OF6A 2RB8A 1RULL