2DREA

Crystal structure of water-soluble chlorophyll protein from lepidium virginicum at 2.00 angstrom resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
178
structure length
172
Chain Sequence
NDEEPVKDTNGNPLKIETRYFIQPASDNNGGGLVPANVDLSHLCPLGIVRTSLPYQPGLPVTISTPSSSEGNDVLTNTNIAITFDAPIWLCPSSKTWTVDSSSEEKYIITGGDPKSGESFFRIEKYGNGKNTYKLVRYDNGEGKSVGSTKSLWGPALVLNDNAFPIKFREVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism and photoprotective function of water-soluble chlorophyll-binding protein.
pubmed doi rcsb
molecule keywords Water-soluble chlorophyll protein
molecule tags Plant protein
total genus 33
structure length 172
sequence length 178
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2dreA00
5EHAA 3N0KA 1MC9A 2RQ9A 2AAIB 3N7MA 1IRPA 1XYFA 3W9TA 1FWUA 1MD6A 3OGGA 1BFCA 1BFBA 3OJ2A 3ZC8A 4A7KA 2Q3NB 1QXMA 2VXTI 4I96A 1N4KA 3IM7A 1G9CA 2BFHA 1YTOA 3I2AA 1PUMB 1DFQA 3AZWA 3FJKA 4OWKA 3NBDA 4DEPA 2VSAA 3WINA 3FUQA 3MALA 2LIEA 3HN1A 4I0YA 3HSMA 2DRZA 5BXRA 2IWTB 4J2KA 1SR4C 3O49A 2VU9A 3D7WB 5BVPI 4KC3A 4I4UA 3BRGC 4WBCA 2ET2A 2WBCA 4TLPA 5BXTA 3AH1A 1TIEA 4OEGA 1R8NA 4G6JA 4EB2B 4J2SA 1ISWA 1FV3A 1HKNA 1DQGA 2R9KB 4I37A 4ENDA 3I2XA 4G9NA 3H6SE 1S0EA 4GOVA 5E24E 2K8RA 4EKXB 1IILA 3OBTA 1YXWA 2MLLB 2NP0A 4X37A 3C9ZA 4P0KA 3ZXDA 4EFQA 2GO2A 1CE7B 2HWAA 3HOMA 4AN7B 4GAIA 3UJ0A 4KEJA 2IHOA 1II4A 4IHZA 4I4VA 2D24A 4PC4A 2ZQNA 1M2TB 2KKIA 3HALA 1FMZA 1TFMB 5F90A 3CA0A 4LO1C 3ZC9A 3OBRA 1WD4A 3VSZA 2FGFA 1PUUB 1HWNB 4JQ0A 2D43A 9ILBA 3WMVA 1DJSB 3BAQA 2DS0A 4I1EA 4JKXB 3RMXA 4AN6A 3F1RA 5HPZA 4F83A 1AVXB 4I6IA 1PZZA 2D20A 4ZA3B 3UD7A 1EYLA 3FJJA 1HWPB 2LIQA 2NVHA 1HWMB 2HW9A 4QKSA 1P63A 4LO1A 3WO2A 2D7IA 3CA5A 4G9MA 1RMLA 3AZVA 4A7YA 3RMYA 1JT3A 3BAVA 5F8YA 3BAOA 3P53A 2D1ZA 1W3FA 3BB2A 3AKHA 4JP0A 1AF9A 1UPSA 7I1BA 4IYBA 1JQZA 2K43A 1J0SA 1HIBA 2Y9FA 4H04A 3QYDA 3BTAA 1PC8B 3FJDA 3BX1C 4I7IA 4I4SA 2P23A 3WINC 5G00A 3AKGA 1DFCA 1V6WA 1FN0A 1ISZA 4ZFYB 1EV2A 1NZKA 1TWMA 3SNVA 3CRHA 2D22A 2ZQOA 1DQOA 2DREA 3BA7A 3UDAA 4OWLA 1FWVA 3HBWA 5FNWA 1V6UA 2AXMA 4HA2A 4IY9A 1AXMA 1Q03A 4Q91A 3IIRA 2E4MA 4J2YA 4LO8B 1DIWA 4FGFA 3A22A 3PUBA 2M49A 2UUSA 2FFUA 3BA4A 4IZEA 3CU1B 1RZOB 4J2XA 3AJ5A 1M16A 4JRAA 2FDBM 1JLXA 2VSEA 1CVSA 2AQZA 2AFGA 3ZX7A 6I1BA 2DRYA 3T8SA 5BOWA 5D61A 2ERMA 3BADA 4Z9WB 3FUOA 5BP5A 3Q7YA 1JY0A 2D7RA 4ISQA 1FGAA 2ESUA 4P0LA 3TC2A 4G6MA 4L4IA 3CA1A 2KI6B 1A8DA 3N7LA 2Y9GA 4G1RA 1DZCA 2I1BA 3F62B 3BA5A 5BXSA 5DZUA 1I1EA 5BXPA 3WO4A 1JT5A 4QBVA 1HCEA 3CA6A 3FJCA 3H6RA 4I2SA 3VEQA 1L2HA 1TP0A 1WBAA 3O4BA 4QD2C 3WA1A 4LO0A 5FZZA 2RSTA 3Q7XA 4I4QA 4I3NA 3AKFA 1ISYA 4IQPA 1BA7A 3V0AA 5JLVA 1FV2A 3OGFA 4LO2A 3OJMA 3V79C 1QQKA 4H9WA 1IHKA 3E8LC 4LO7B 1NUNA 5I1BA 1QQLA 4X3AA 4IZXA 2L5XA 2Z48A 1Z2VA 2FO1A 3FJFA 1IRAX 4LO7C 2BEAA 2ZR1B 3IAGC 2J3PA 4IONA 2D44A 1K5VA 1IOBA 1XG6A 1BARA 4GP0A 4LO3A 1JTCA 4QBCA 4ZFUB 4I1BA 4FVVA 4EFPA 4OEFA 1HCDA 2MIBA 4QO3A 4I8MA 4DENA 3NBNA 2WRYA 3CRGA 1IJTA 1EVTA 5DSSB 1S0GA 3H6QA 4GP3A 3Q7WA 4QKRA 5D63A 1WBCA 3N7KA 3PG0A 5BQUA 4OEEA 1AVWB 3JRRA 1W3AA 5DUYA 1EPWA 1T4QA 3EF2A 4KEKA 3PHZA 4I4OA 1ITBA 1JLYA 1IT0A 1Q04A 3QR5A 4J23B 3O4DA 4F34A 2RG9B 3CA3A 8I1BA 1V6VA 3NBEA 3HMYA 3FJBA 3UD9A 3BRDA 2QYIB 2E4MC 2Y9XE 2Y9WC 4ISRA 1JT4A 3ZXGA 1AVUA 4USOA 2FFVA 2NZ9A 1YYNA 3PMEA 5EC5A 3NJ5A 2Q9XA 4ZBVB 4ZLBB 3BRFA 4XFTA 1AVAC 3R4UA 1FQ9A 2Z49A 1BLDA 3VT2A 1BASA 2X2SA 5BP5C 2F8XC 2VLCA 4XFUA 3R4SA 1TOOA 1XZZA 4ZKTB 1G9DA 3UD8A 4I4PA 2XOAA 1ABRB 3K1XA 3KMVA 1WD3A 2F2FA 3FJ9A 1VCLA 3H6RB 4YOLA 3FJIA 3NBCA 3O4OA 5DVHA 5FZYA 4HR6C 4QC4A 4JPZA 2NYYA 2D23A 3O44A 3V0AB 3AH4A 3O5WB 4LO0C 3V0BA 2KI4A 1R8OA 2MC2A 5JMCA 3FJAA 3O4CA 4LO2C 4L4HA 4JAWA 4A7ZA 1ISVA 3LLPA 3WMUA 3LTQA 1Z0HA 5FNXA 1K5UA 4Z8SB 41BIA 1S0BA 3OJVA 4QD2B 4ZFWB 2GZBA 3VUOA 4Q9GA 3BAHA 2K4AB 3IM6A 3S8JA 3I29B 3RSJA 4LO3C 4ZGRB 3FJEA 1XHBA 4QALA 21BIA 3O3QA 1SZ6B 1S0FA 4II0A 1OQLB 3CAHA 1HWOB 2QN4A 3VWCA 3P6IA 3CQAA 1BLAA 1YF8B 4D8HA 1RG8A 3ILAA 1DZDA 5EG6C 3BAGA 3CRIA 3O4AA 5B2HA 1TTUA 2YUGA 3VT0A 2NTDA 31BIA 1GGPB 3AKIA 2BEBA 1YBIA 1G9BA 3S8KA 3A07A 1SR4A 1Z4SA 2VUAA 3B9UA 4HJJA 5BQUC 4USPA 4D0ZA 4X38A 1FMMS 1ILR1 1Q1UA 3BAUA 1RY7A 4Q9PA 5F8SA 4JKQA 4OUJA 1JT7A 3FJ8A 3A23A 4KEIA 2HWMA 3RTIB 2KLLA 3A21A 4EEEB 1AFCA 3UJ4A 3MPPG 4KBBA 4I4RA 1TWEA 3AH2A 4IY8A 4DCKC 3IM5A 3P6JA 1S0CA 4P6AA 1BFGA 4I4XA 2NM1A 1T9FA 3FFZA 4I4YA 4OWJA 1PWAA 3CA4A 5F8WA 4XFSA 4CJMA 3FJHA 2VXRA 3FGMA 4GOYA 2P39A 4D0TA 3JUTA 1G9AA 4ZOTA 4OW4A 1E0OA 2F2FC 1W3GA 3WO3A 1G82A 3VSFA 4GAFA 1S0DA 1S0LA 5GAQA 4P0JA 3V0BB 2HZ9A 2X2TA 5FZUA 1KNMA 2KH2A 1D0HA 3VT1A 4X39A 5D62A 1DLLA 3POKA 4XKIA 1BFFA 1V6XA 3N7JA 4R6UB 1F31A 1ONKB 1I1BA 3AJ6A 3RTJB 1ISXA 4EFRA
chains in the Genus database with same CATH superfamily
5EHAA 3N0KA 1MC9A 2RQ9A 2AAIB 3N7MA 1IRPA 1XYFA 3W9TA 1FWUA 1MD6A 3OGGA 1BFCA 1BFBA 3OJ2A 3ZC8A 4A7KA 2Q3NB 1QXMA 2VXTI 4I96A 1N4KA 3IM7A 1G9CA 2BFHA 1YTOA 3I2AA 1PUMB 1DFQA 3AZWA 3FJKA 4OWKA 3NBDA 4DEPA 2VSAA 3WINA 3FUQA 3MALA 2LIEA 3HN1A 4I0YA 3HSMA 2DRZA 5BXRA 2IWTB 4J2KA 1SR4C 3O49A 2VU9A 3D7WB 5BVPI 4KC3A 4I4UA 3BRGC 4WBCA 2ET2A 2WBCA 4TLPA 5BXTA 3AH1A 1TIEA 4OEGA 1R8NA 4G6JA 4EB2B 4J2SA 1ISWA 1FV3A 1HKNA 1DQGA 2R9KB 4I37A 4ENDA 3I2XA 4G9NA 3H6SE 1S0EA 4GOVA 5E24E 2K8RA 4EKXB 1IILA 3OBTA 1YXWA 2MLLB 2NP0A 4X37A 3C9ZA 4P0KA 3ZXDA 4EFQA 2GO2A 1CE7B 2HWAA 3HOMA 4AN7B 4GAIA 3UJ0A 4KEJA 2IHOA 1II4A 4IHZA 4I4VA 2D24A 4PC4A 2ZQNA 1M2TB 2KKIA 3HALA 1FMZA 1TFMB 5F90A 3CA0A 4LO1C 3ZC9A 3OBRA 1WD4A 3VSZA 2FGFA 1PUUB 1HWNB 4JQ0A 2D43A 9ILBA 3WMVA 1DJSB 3BAQA 2DS0A 4I1EA 4JKXB 3RMXA 4AN6A 3F1RA 5HPZA 4F83A 1AVXB 4I6IA 1PZZA 2D20A 4ZA3B 3UD7A 1EYLA 3FJJA 1HWPB 2LIQA 2NVHA 1HWMB 2HW9A 4QKSA 1P63A 4LO1A 3WO2A 2D7IA 3CA5A 4G9MA 1RMLA 3AZVA 4A7YA 3RMYA 1JT3A 3BAVA 5F8YA 3BAOA 3P53A 2D1ZA 1W3FA 3BB2A 3AKHA 4JP0A 1AF9A 1UPSA 7I1BA 4IYBA 1JQZA 2K43A 1J0SA 1HIBA 2Y9FA 4H04A 3QYDA 3BTAA 1PC8B 3FJDA 3BX1C 4I7IA 4I4SA 2P23A 3WINC 5G00A 3AKGA 1DFCA 1V6WA 1FN0A 1ISZA 4ZFYB 1EV2A 1NZKA 1TWMA 3SNVA 3CRHA 2D22A 2ZQOA 1DQOA 2DREA 3BA7A 3UDAA 4OWLA 1FWVA 3HBWA 4UY4A 5FNWA 1V6UA 2AXMA 4HA2A 4IY9A 1AXMA 1Q03A 4Q91A 3IIRA 2E4MA 4J2YA 4LO8B 1DIWA 2NS2A 4FGFA 3A22A 3PUBA 2M49A 2UUSA 2FFUA 3BA4A 4IZEA 3CU1B 1RZOB 4J2XA 3AJ5A 1M16A 4JRAA 2FDBM 1JLXA 2VSEA 1CVSA 2AQZA 2AFGA 3ZX7A 6I1BA 2DRYA 3T8SA 5BOWA 5D61A 2ERMA 3BADA 4Z9WB 3FUOA 5BP5A 3Q7YA 1JY0A 2D7RA 4ISQA 1FGAA 2ESUA 4P0LA 3TC2A 4G6MA 4L4IA 3CA1A 2KI6B 1A8DA 3N7LA 4MZFB 2Y9GA 4G1RA 1DZCA 2I1BA 3F62B 3BA5A 5BXSA 5DZUA 1I1EA 5BXPA 3WO4A 1JT5A 4QBVA 1HCEA 3CA6A 3FJCA 3H6RA 4I2SA 3VEQA 1L2HA 1TP0A 1WBAA 3O4BA 4QD2C 3WA1A 4LO0A 5FZZA 2RSTA 3Q7XA 4I4QA 4I3NA 3AKFA 1ISYA 4IQPA 1BA7A 3V0AA 5JLVA 1FV2A 3OGFA 4LO2A 3OJMA 3V79C 1QQKA 4H9WA 1IHKA 3E8LC 4LO7B 1NUNA 5I1BA 1QQLA 4X3AA 4IZXA 2L5XA 2Z48A 1Z2VA 2FO1A 3FJFA 1IRAX 4LO7C 2BEAA 2ZR1B 3IAGC 2J3PA 4IONA 2D44A 1K5VA 1IOBA 1XG6A 1BARA 4GP0A 4LO3A 1JTCA 4QBCA 4ZFUB 4I1BA 4FVVA 4EFPA 4OEFA 1HCDA 2MIBA 4QO3A 4I8MA 4DENA 3NBNA 2WRYA 3CRGA 1IJTA 1EVTA 5DSSB 1S0GA 3H6QA 4GP3A 3Q7WA 4QKRA 5D63A 1WBCA 3N7KA 3PG0A 5BQUA 4OEEA 1AVWB 3JRRA 1W3AA 5DUYA 1EPWA 1T4QA 3EF2A 4KEKA 3PHZA 4I4OA 1ITBA 1JLYA 1IT0A 1Q04A 3QR5A 4J23B 3O4DA 4F34A 2RG9B 3CA3A 8I1BA 1V6VA 3NBEA 3HMYA 3FJBA 3UD9A 3BRDA 2QYIB 2E4MC 2Y9XE 2Y9WC 4MZHA 4ISRA 1JT4A 3ZXGA 1AVUA 4USOA 2FFVA 2NZ9A 1YYNA 3PMEA 5EC5A 3NJ5A 2Q9XA 4ZBVB 4ZLBB 3BRFA 4XFTA 1AVAC 3R4UA 1FQ9A 2Z49A 1BLDA 3VT2A 1BASA 2X2SA 5BP5C 2F8XC 2VLCA 4XFUA 3R4SA 1TOOA 1XZZA 4ZKTB 1G9DA 3UD8A 4I4PA 2XOAA 1ABRB 3K1XA 3KMVA 1WD3A 2F2FA 3FJ9A 1VCLA 3H6RB 4YOLA 3FJIA 3NBCA 3O4OA 5DVHA 5FZYA 4HR6C 4QC4A 4JPZA 2NYYA 2D23A 3O44A 3V0AB 3AH4A 3O5WB 4LO0C 3V0BA 2KI4A 1R8OA 2MC2A 5JMCA 3FJAA 3O4CA 4LO2C 4L4HA 4JAWA 4A7ZA 1ISVA 3LLPA 3WMUA 3LTQA 1Z0HA 5FNXA 1K5UA 4Z8SB 41BIA 1S0BA 3OJVA 4QD2B 4ZFWB 2GZBA 3VUOA 4Q9GA 3BAHA 2K4AB 3IM6A 3S8JA 3I29B 3RSJA 4LO3C 4ZGRB 3FJEA 1XHBA 4QALA 21BIA 4H75A 3O3QA 1SZ6B 1S0FA 4II0A 1OQLB 3CAHA 1HWOB 2QN4A 3VWCA 3P6IA 4MZGB 3CQAA 1BLAA 1YF8B 4D8HA 1RG8A 3ILAA 1DZDA 5EG6C 3BAGA 3CRIA 3O4AA 5B2HA 1TTUA 2YUGA 3VT0A 2NTDA 31BIA 1GGPB 3AKIA 2BEBA 1YBIA 1G9BA 3S8KA 3A07A 1SR4A 1Z4SA 2VUAA 3B9UA 4HJJA 5BQUC 4USPA 4D0ZA 4X38A 1FMMS 1ILR1 1Q1UA 3BAUA 1RY7A 4Q9PA 5F8SA 4JKQA 4OUJA 1JT7A 3FJ8A 3A23A 4KEIA 2HWMA 3RTIB 2KLLA 3A21A 4EEEB 1AFCA 3UJ4A 3MPPG 4KBBA 4I4RA 1TWEA 3AH2A 4IY8A 4DCKC 3IM5A 3P6JA 1S0CA 4P6AA 1BFGA 4I4XA 2NM1A 1T9FA 3FFZA 4I4YA 4OWJA 1PWAA 3CA4A 5F8WA 4XFSA 4CJMA 3FJHA 2VXRA 3FGMA 4GOYA 2P39A 4D0TA 3JUTA 1G9AA 4ZOTA 4OW4A 1E0OA 2F2FC 1W3GA 3WO3A 1G82A 3VSFA 4GAFA 1S0DA 1S0LA 5GAQA 4P0JA 3V0BB 2HZ9A 2X2TA 5FZUA 1KNMA 2KH2A 1D0HA 3VT1A 4X39A 5D62A 1DLLA 3POKA 4XKIA 1BFFA 1V6XA 3N7JA 4R6UB 1F31A 1ONKB 1I1BA 3AJ6A 3RTJB 1ISXA 4EFRA
chains in the Genus database with same CATH topology
5EHAA 3N0KA 1MC9A 2RQ9A 2AAIB 3N7MA 1IRPA 1XYFA 3W9TA 1FWUA 1MD6A 3OGGA 1BFCA 1BFBA 3OJ2A 3ZC8A 4A7KA 2Q3NB 1QXMA 2VXTI 4I96A 1N4KA 3IM7A 1G9CA 2BFHA 1YTOA 3I2AA 1PUMB 1DFQA 3AZWA 3FJKA 4OWKA 3NBDA 4DEPA 2VSAA 3WINA 3FUQA 3MALA 2LIEA 3HN1A 4I0YA 3HSMA 2DRZA 5BXRA 2IWTB 4J2KA 1SR4C 3O49A 2VU9A 3D7WB 5BVPI 4KC3A 4I4UA 3BRGC 4WBCA 2ET2A 2WBCA 4TLPA 5BXTA 3AH1A 1TIEA 4OEGA 1R8NA 4G6JA 4EB2B 4J2SA 1ISWA 1FV3A 1HKNA 1DQGA 2R9KB 4I37A 4ENDA 3I2XA 4G9NA 3H6SE 1S0EA 4GOVA 5E24E 2K8RA 4EKXB 1IILA 3OBTA 1YXWA 2MLLB 2NP0A 4X37A 3C9ZA 4P0KA 3ZXDA 4EFQA 2GO2A 1CE7B 2HWAA 3HOMA 4AN7B 4GAIA 3UJ0A 4KEJA 2IHOA 1II4A 4IHZA 4I4VA 2D24A 4PC4A 2ZQNA 1M2TB 2KKIA 3HALA 1FMZA 1TFMB 5F90A 3CA0A 4LO1C 3ZC9A 3OBRA 1WD4A 3VSZA 2FGFA 1PUUB 1HWNB 4JQ0A 2D43A 9ILBA 3WMVA 1DJSB 3BAQA 2DS0A 4I1EA 4JKXB 3RMXA 4AN6A 3F1RA 5HPZA 4F83A 1AVXB 4I6IA 1PZZA 2D20A 4ZA3B 3UD7A 1EYLA 3FJJA 1HWPB 2LIQA 2NVHA 1HWMB 2HW9A 4QKSA 1P63A 4LO1A 3WO2A 2D7IA 3CA5A 4G9MA 1RMLA 3AZVA 4A7YA 3RMYA 1JT3A 3BAVA 5F8YA 3BAOA 3P53A 2D1ZA 1W3FA 3BB2A 3AKHA 4JP0A 1AF9A 1UPSA 7I1BA 4IYBA 1JQZA 2K43A 1J0SA 1HIBA 2Y9FA 4H04A 3QYDA 3BTAA 1PC8B 3FJDA 3BX1C 4I7IA 4I4SA 2P23A 3WINC 5G00A 3AKGA 1DFCA 1V6WA 1FN0A 1ISZA 4ZFYB 1EV2A 1NZKA 1TWMA 3SNVA 3CRHA 2D22A 2ZQOA 1DQOA 2DREA 3BA7A 3UDAA 4OWLA 1FWVA 3HBWA 4UY4A 5FNWA 1V6UA 2AXMA 4HA2A 4IY9A 1AXMA 1Q03A 4Q91A 3IIRA 2E4MA 4J2YA 4LO8B 1DIWA 2NS2A 4FGFA 3A22A 3PUBA 2M49A 2UUSA 2FFUA 3BA4A 4IZEA 3CU1B 1RZOB 4J2XA 3AJ5A 1M16A 4JRAA 2FDBM 1JLXA 2VSEA 1CVSA 2AQZA 2AFGA 3ZX7A 6I1BA 2DRYA 3T8SA 5BOWA 5D61A 2ERMA 3BADA 4Z9WB 3FUOA 5BP5A 3Q7YA 1JY0A 2D7RA 4ISQA 1FGAA 2ESUA 4P0LA 3TC2A 4G6MA 4L4IA 3CA1A 2KI6B 1A8DA 3N7LA 4MZFB 2Y9GA 4G1RA 1DZCA 2I1BA 3F62B 3BA5A 5BXSA 5DZUA 1I1EA 5BXPA 3WO4A 1JT5A 4QBVA 1HCEA 3CA6A 3FJCA 3H6RA 4I2SA 3VEQA 1L2HA 1TP0A 1WBAA 3O4BA 4QD2C 3WA1A 4LO0A 5FZZA 2RSTA 3Q7XA 4I4QA 4I3NA 3AKFA 1ISYA 4IQPA 1BA7A 3V0AA 5JLVA 1FV2A 3OGFA 4LO2A 3OJMA 3V79C 1QQKA 4H9WA 1IHKA 3E8LC 4LO7B 1NUNA 5I1BA 1QQLA 4X3AA 4IZXA 2L5XA 2Z48A 1Z2VA 2FO1A 3FJFA 1IRAX 4LO7C 2BEAA 2ZR1B 3IAGC 2J3PA 4IONA 2D44A 1K5VA 1IOBA 1XG6A 1BARA 4GP0A 4LO3A 1JTCA 4QBCA 4ZFUB 4I1BA 4FVVA 4EFPA 4OEFA 1HCDA 2MIBA 4QO3A 4I8MA 4DENA 3NBNA 2WRYA 3CRGA 1IJTA 1EVTA 5DSSB 1S0GA 3H6QA 4GP3A 3Q7WA 4QKRA 5D63A 1WBCA 3N7KA 3PG0A 5BQUA 4OEEA 1AVWB 3JRRA 1W3AA 5DUYA 1EPWA 1T4QA 3EF2A 4KEKA 3PHZA 4I4OA 1ITBA 1JLYA 1IT0A 1Q04A 3QR5A 4J23B 3O4DA 4F34A 2RG9B 3CA3A 8I1BA 1V6VA 3NBEA 3HMYA 3FJBA 3UD9A 3BRDA 2QYIB 2E4MC 2Y9XE 2Y9WC 4MZHA 4ISRA 1JT4A 3ZXGA 1AVUA 4USOA 2FFVA 2NZ9A 1YYNA 3PMEA 5EC5A 3NJ5A 2Q9XA 4ZBVB 4ZLBB 3BRFA 4XFTA 1AVAC 3R4UA 1FQ9A 2Z49A 1BLDA 3VT2A 1BASA 2X2SA 5BP5C 2F8XC 2VLCA 4XFUA 3R4SA 1TOOA 1XZZA 4ZKTB 1G9DA 3UD8A 4I4PA 2XOAA 1ABRB 3K1XA 3KMVA 1WD3A 2F2FA 3FJ9A 1VCLA 3H6RB 4YOLA 3FJIA 3NBCA 3O4OA 5DVHA 5FZYA 4HR6C 4QC4A 4JPZA 2NYYA 2D23A 3O44A 3V0AB 3AH4A 3O5WB 4LO0C 3V0BA 2KI4A 1R8OA 2MC2A 5JMCA 3FJAA 3O4CA 4LO2C 4L4HA 4JAWA 4A7ZA 1ISVA 3LLPA 3WMUA 3LTQA 1Z0HA 5FNXA 1K5UA 4Z8SB 41BIA 1S0BA 3OJVA 4QD2B 4ZFWB 2GZBA 3VUOA 4Q9GA 3BAHA 2K4AB 3IM6A 3S8JA 3I29B 3RSJA 4LO3C 4ZGRB 3FJEA 1XHBA 4QALA 21BIA 4H75A 3O3QA 1SZ6B 1S0FA 4II0A 1OQLB 3CAHA 1HWOB 2QN4A 3VWCA 3P6IA 4MZGB 3CQAA 1BLAA 1YF8B 4D8HA 1RG8A 3ILAA 1DZDA 5EG6C 3BAGA 3CRIA 3O4AA 5B2HA 1TTUA 2YUGA 3VT0A 2NTDA 31BIA 1GGPB 3AKIA 2BEBA 1YBIA 1G9BA 3S8KA 3A07A 1SR4A 1Z4SA 2VUAA 3B9UA 4HJJA 5BQUC 4USPA 4D0ZA 4X38A 1FMMS 1ILR1 1Q1UA 3BAUA 1RY7A 4Q9PA 5F8SA 4JKQA 4OUJA 1JT7A 3FJ8A 3A23A 4KEIA 2HWMA 3RTIB 2KLLA 3A21A 4EEEB 1AFCA 3UJ4A 3MPPG 4KBBA 4I4RA 1TWEA 3AH2A 4IY8A 4DCKC 3IM5A 3P6JA 1S0CA 4P6AA 1BFGA 4I4XA 2NM1A 1T9FA 3FFZA 4I4YA 4OWJA 1PWAA 3CA4A 5F8WA 4XFSA 4CJMA 3FJHA 2VXRA 3FGMA 4GOYA 2P39A 4D0TA 3JUTA 1G9AA 4ZOTA 4OW4A 1E0OA 2F2FC 1W3GA 3WO3A 1G82A 3VSFA 4GAFA 1S0DA 1S0LA 5GAQA 4P0JA 3V0BB 2HZ9A 2X2TA 5FZUA 1KNMA 2KH2A 1D0HA 3VT1A 4X39A 5D62A 1DLLA 3POKA 4XKIA 1BFFA 1V6XA 3N7JA 4R6UB 1F31A 1ONKB 1I1BA 3AJ6A 3RTJB 1ISXA 4EFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EHA A;  3N0K A;  1MC9 A;  2RQ9 A;  2AAI B;  3N7M A;  1IRP A;  1XYF A;  3W9T A;  1FWU A;  1MD6 A;  3OGG A;  1BFC A;  1BFB A;  3OJ2 A;  3ZC8 A;  4A7K A;  2Q3N B;  1QXM A;  2VXT I;  4I96 A;  1N4K A;  3IM7 A;  1G9C A;  2BFH A;  1YTO A;  3I2A A;  1PUM B;  1DFQ A;  3AZW A;  3FJK A;  4OWK A;  3NBD A;  4DEP A;  2VSA A;  3WIN A;  3FUQ A;  3MAL A;  2LIE A;  3HN1 A;  4I0Y A;  3HSM A;  2DRZ A;  5BXR A;  2IWT B;  4J2K A;  1SR4 C;  3O49 A;  2VU9 A;  3D7W B;  5BVP I;  4KC3 A;  4I4U A;  3BRG C;  4WBC A;  2ET2 A;  2WBC A;  4TLP A;  5BXT A;  3AH1 A;  1TIE A;  4OEG A;  1R8N A;  4G6J A;  4EB2 B;  4J2S A;  1ISW A;  1FV3 A;  1HKN A;  1DQG A;  2R9K B;  4I37 A;  4END A;  3I2X A;  4G9N A;  3H6S E;  1S0E A;  4GOV A;  5E24 E;  2K8R A;  4EKX B;  1IIL A;  3OBT A;  1YXW A;  2MLL B;  2NP0 A;  4X37 A;  3C9Z A;  4P0K A;  3ZXD A;  4EFQ A;  2GO2 A;  1CE7 B;  2HWA A;  3HOM A;  4AN7 B;  4GAI A;  3UJ0 A;  4KEJ A;  2IHO A;  1II4 A;  4IHZ A;  4I4V A;  2D24 A;  4PC4 A;  2ZQN A;  1M2T B;  2KKI A;  3HAL A;  1FMZ A;  1TFM B;  5F90 A;  3CA0 A;  4LO1 C;  3ZC9 A;  3OBR A;  1WD4 A;  3VSZ A;  2FGF A;  1PUU B;  1HWN B;  4JQ0 A;  2D43 A;  9ILB A;  3WMV A;  1DJS B;  3BAQ A;  2DS0 A;  4I1E A;  4JKX B;  3RMX A;  4AN6 A;  3F1R A;  5HPZ A;  4F83 A;  1AVX B;  4I6I A;  1PZZ A;  2D20 A;  4ZA3 B;  3UD7 A;  1EYL A;  3FJJ A;  1HWP B;  2LIQ A;  2NVH A;  1HWM B;  2HW9 A;  4QKS A;  1P63 A;  4LO1 A;  3WO2 A;  2D7I A;  3CA5 A;  4G9M A;  1RML A;  3AZV A;  4A7Y A;  3RMY A;  1JT3 A;  3BAV A;  5F8Y A;  3BAO A;  3P53 A;  2D1Z A;  1W3F A;  3BB2 A;  3AKH A;  4JP0 A;  1AF9 A;  1UPS A;  7I1B A;  4IYB A;  1JQZ A;  2K43 A;  1J0S A;  1HIB A;  2Y9F A;  4H04 A;  3QYD A;  3BTA A;  1PC8 B;  3FJD A;  3BX1 C;  4I7I A;  4I4S A;  2P23 A;  3WIN C;  5G00 A;  3AKG A;  1DFC A;  1V6W A;  1FN0 A;  1ISZ A;  4ZFY B;  1EV2 A;  1NZK A;  1TWM A;  3SNV A;  3CRH A;  2D22 A;  2ZQO A;  1DQO A;  2DRE A;  3BA7 A;  3UDA A;  4OWL A;  1FWV A;  3HBW A;  5FNW A;  1V6U A;  2AXM A;  4HA2 A;  4IY9 A;  1AXM A;  1Q03 A;  4Q91 A;  3IIR A;  2E4M A;  4J2Y A;  4LO8 B;  1DIW A;  4FGF A;  3A22 A;  3PUB A;  2M49 A;  2UUS A;  2FFU A;  3BA4 A;  4IZE A;  3CU1 B;  1RZO B;  4J2X A;  3AJ5 A;  1M16 A;  4JRA A;  2FDB M;  1JLX A;  2VSE A;  1CVS A;  2AQZ A;  2AFG A;  3ZX7 A;  6I1B A;  2DRY A;  3T8S A;  5BOW A;  5D61 A;  2ERM A;  3BAD A;  4Z9W B;  3FUO A;  5BP5 A;  3Q7Y A;  1JY0 A;  2D7R A;  4ISQ A;  1FGA A;  2ESU A;  4P0L A;  3TC2 A;  4G6M A;  4L4I A;  3CA1 A;  2KI6 B;  1A8D A;  3N7L A;  2Y9G A;  4G1R A;  1DZC A;  2I1B A;  3F62 B;  3BA5 A;  5BXS A;  5DZU A;  1I1E A;  5BXP A;  3WO4 A;  1JT5 A;  4QBV A;  1HCE A;  3CA6 A;  3FJC A;  3H6R A;  4I2S A;  3VEQ A;  1L2H A;  1TP0 A;  1WBA A;  3O4B A;  4QD2 C;  3WA1 A;  4LO0 A;  5FZZ A;  2RST A;  3Q7X A;  4I4Q A;  4I3N A;  3AKF A;  1ISY A;  4IQP A;  1BA7 A;  3V0A A;  5JLV A;  1FV2 A;  3OGF A;  4LO2 A;  3OJM A;  3V79 C;  1QQK A;  4H9W A;  1IHK A;  3E8L C;  4LO7 B;  1NUN A;  5I1B A;  1QQL A;  4X3A A;  4IZX A;  2L5X A;  2Z48 A;  1Z2V A;  2FO1 A;  3FJF A;  1IRA X;  4LO7 C;  2BEA A;  2ZR1 B;  3IAG C;  2J3P A;  4ION A;  2D44 A;  1K5V A;  1IOB A;  1XG6 A;  1BAR A;  4GP0 A;  4LO3 A;  1JTC A;  4QBC A;  4ZFU B;  4I1B A;  4FVV A;  4EFP A;  4OEF A;  1HCD A;  2MIB A;  4QO3 A;  4I8M A;  4DEN A;  3NBN A;  2WRY A;  3CRG A;  1IJT A;  1EVT A;  5DSS B;  1S0G A;  3H6Q A;  4GP3 A;  3Q7W A;  4QKR A;  5D63 A;  1WBC A;  3N7K A;  3PG0 A;  5BQU A;  4OEE A;  1AVW B;  3JRR A;  1W3A A;  5DUY A;  1EPW A;  1T4Q A;  3EF2 A;  4KEK A;  3PHZ A;  4I4O A;  1ITB A;  1JLY A;  1IT0 A;  1Q04 A;  3QR5 A;  4J23 B;  3O4D A;  4F34 A;  2RG9 B;  3CA3 A;  8I1B A;  1V6V A;  3NBE A;  3HMY A;  3FJB A;  3UD9 A;  3BRD A;  2QYI B;  2E4M C;  2Y9X E;  2Y9W C;  4ISR A;  1JT4 A;  3ZXG A;  1AVU A;  4USO A;  2FFV A;  2NZ9 A;  1YYN A;  3PME A;  5EC5 A;  3NJ5 A;  2Q9X A;  4ZBV B;  4ZLB B;  3BRF A;  4XFT A;  1AVA C;  3R4U A;  1FQ9 A;  2Z49 A;  1BLD A;  3VT2 A;  1BAS A;  2X2S A;  5BP5 C;  2F8X C;  2VLC A;  4XFU A;  3R4S A;  1TOO A;  1XZZ A;  4ZKT B;  1G9D A;  3UD8 A;  4I4P A;  2XOA A;  1ABR B;  3K1X A;  3KMV A;  1WD3 A;  2F2F A;  3FJ9 A;  1VCL A;  3H6R B;  4YOL A;  3FJI A;  3NBC A;  3O4O A;  5DVH A;  5FZY A;  4HR6 C;  4QC4 A;  4JPZ A;  2NYY A;  2D23 A;  3O44 A;  3V0A B;  3AH4 A;  3O5W B;  4LO0 C;  3V0B A;  2KI4 A;  1R8O A;  2MC2 A;  5JMC A;  3FJA A;  3O4C A;  4LO2 C;  4L4H A;  4JAW A;  4A7Z A;  1ISV A;  3LLP A;  3WMU A;  3LTQ A;  1Z0H A;  5FNX A;  1K5U A;  4Z8S B;  41BI A;  1S0B A;  3OJV A;  4QD2 B;  4ZFW B;  2GZB A;  3VUO A;  4Q9G A;  3BAH A;  2K4A B;  3IM6 A;  3S8J A;  3I29 B;  3RSJ A;  4LO3 C;  4ZGR B;  3FJE A;  1XHB A;  4QAL A;  21BI A;  3O3Q A;  1SZ6 B;  1S0F A;  4II0 A;  1OQL B;  3CAH A;  1HWO B;  2QN4 A;  3VWC A;  3P6I A;  3CQA A;  1BLA A;  1YF8 B;  4D8H A;  1RG8 A;  3ILA A;  1DZD A;  5EG6 C;  3BAG A;  3CRI A;  3O4A A;  5B2H A;  1TTU A;  2YUG A;  3VT0 A;  2NTD A;  31BI A;  1GGP B;  3AKI A;  2BEB A;  1YBI A;  1G9B A;  3S8K A;  3A07 A;  1SR4 A;  1Z4S A;  2VUA A;  3B9U A;  4HJJ A;  5BQU C;  4USP A;  4D0Z A;  4X38 A;  1FMM S;  1ILR 1;  1Q1U A;  3BAU A;  1RY7 A;  4Q9P A;  5F8S A;  4JKQ A;  4OUJ A;  1JT7 A;  3FJ8 A;  3A23 A;  4KEI A;  2HWM A;  3RTI B;  2KLL A;  3A21 A;  4EEE B;  1AFC A;  3UJ4 A;  3MPP G;  4KBB A;  4I4R A;  1TWE A;  3AH2 A;  4IY8 A;  4DCK C;  3IM5 A;  3P6J A;  1S0C A;  4P6A A;  1BFG A;  4I4X A;  2NM1 A;  1T9F A;  3FFZ A;  4I4Y A;  4OWJ A;  1PWA A;  3CA4 A;  5F8W A;  4XFS A;  4CJM A;  3FJH A;  2VXR A;  3FGM A;  4GOY A;  2P39 A;  4D0T A;  3JUT A;  1G9A A;  4ZOT A;  4OW4 A;  1E0O A;  2F2F C;  1W3G A;  3WO3 A;  1G82 A;  3VSF A;  4GAF A;  1S0D A;  1S0L A;  5GAQ A;  4P0J A;  3V0B B;  2HZ9 A;  2X2T A;  5FZU A;  1KNM A;  2KH2 A;  1D0H A;  3VT1 A;  4X39 A;  5D62 A;  1DLL A;  3POK A;  4XKI A;  1BFF A;  1V6X A;  3N7J A;  4R6U B;  1F31 A;  1ONK B;  1I1B A;  3AJ6 A;  3RTJ B;  1ISX A;  4EFR A; 
#chains in the Genus database with same CATH topology
 5EHA A;  3N0K A;  1MC9 A;  2RQ9 A;  2AAI B;  3N7M A;  1IRP A;  1XYF A;  3W9T A;  1FWU A;  1MD6 A;  3OGG A;  1BFC A;  1BFB A;  3OJ2 A;  3ZC8 A;  4A7K A;  2Q3N B;  1QXM A;  2VXT I;  4I96 A;  1N4K A;  3IM7 A;  1G9C A;  2BFH A;  1YTO A;  3I2A A;  1PUM B;  1DFQ A;  3AZW A;  3FJK A;  4OWK A;  3NBD A;  4DEP A;  2VSA A;  3WIN A;  3FUQ A;  3MAL A;  2LIE A;  3HN1 A;  4I0Y A;  3HSM A;  2DRZ A;  5BXR A;  2IWT B;  4J2K A;  1SR4 C;  3O49 A;  2VU9 A;  3D7W B;  5BVP I;  4KC3 A;  4I4U A;  3BRG C;  4WBC A;  2ET2 A;  2WBC A;  4TLP A;  5BXT A;  3AH1 A;  1TIE A;  4OEG A;  1R8N A;  4G6J A;  4EB2 B;  4J2S A;  1ISW A;  1FV3 A;  1HKN A;  1DQG A;  2R9K B;  4I37 A;  4END A;  3I2X A;  4G9N A;  3H6S E;  1S0E A;  4GOV A;  5E24 E;  2K8R A;  4EKX B;  1IIL A;  3OBT A;  1YXW A;  2MLL B;  2NP0 A;  4X37 A;  3C9Z A;  4P0K A;  3ZXD A;  4EFQ A;  2GO2 A;  1CE7 B;  2HWA A;  3HOM A;  4AN7 B;  4GAI A;  3UJ0 A;  4KEJ A;  2IHO A;  1II4 A;  4IHZ A;  4I4V A;  2D24 A;  4PC4 A;  2ZQN A;  1M2T B;  2KKI A;  3HAL A;  1FMZ A;  1TFM B;  5F90 A;  3CA0 A;  4LO1 C;  3ZC9 A;  3OBR A;  1WD4 A;  3VSZ A;  2FGF A;  1PUU B;  1HWN B;  4JQ0 A;  2D43 A;  9ILB A;  3WMV A;  1DJS B;  3BAQ A;  2DS0 A;  4I1E A;  4JKX B;  3RMX A;  4AN6 A;  3F1R A;  5HPZ A;  4F83 A;  1AVX B;  4I6I A;  1PZZ A;  2D20 A;  4ZA3 B;  3UD7 A;  1EYL A;  3FJJ A;  1HWP B;  2LIQ A;  2NVH A;  1HWM B;  2HW9 A;  4QKS A;  1P63 A;  4LO1 A;  3WO2 A;  2D7I A;  3CA5 A;  4G9M A;  1RML A;  3AZV A;  4A7Y A;  3RMY A;  1JT3 A;  3BAV A;  5F8Y A;  3BAO A;  3P53 A;  2D1Z A;  1W3F A;  3BB2 A;  3AKH A;  4JP0 A;  1AF9 A;  1UPS A;  7I1B A;  4IYB A;  1JQZ A;  2K43 A;  1J0S A;  1HIB A;  2Y9F A;  4H04 A;  3QYD A;  3BTA A;  1PC8 B;  3FJD A;  3BX1 C;  4I7I A;  4I4S A;  2P23 A;  3WIN C;  5G00 A;  3AKG A;  1DFC A;  1V6W A;  1FN0 A;  1ISZ A;  4ZFY B;  1EV2 A;  1NZK A;  1TWM A;  3SNV A;  3CRH A;  2D22 A;  2ZQO A;  1DQO A;  2DRE A;  3BA7 A;  3UDA A;  4OWL A;  1FWV A;  3HBW A;  4UY4 A;  5FNW A;  1V6U A;  2AXM A;  4HA2 A;  4IY9 A;  1AXM A;  1Q03 A;  4Q91 A;  3IIR A;  2E4M A;  4J2Y A;  4LO8 B;  1DIW A;  2NS2 A;  4FGF A;  3A22 A;  3PUB A;  2M49 A;  2UUS A;  2FFU A;  3BA4 A;  4IZE A;  3CU1 B;  1RZO B;  4J2X A;  3AJ5 A;  1M16 A;  4JRA A;  2FDB M;  1JLX A;  2VSE A;  1CVS A;  2AQZ A;  2AFG A;  3ZX7 A;  6I1B A;  2DRY A;  3T8S A;  5BOW A;  5D61 A;  2ERM A;  3BAD A;  4Z9W B;  3FUO A;  5BP5 A;  3Q7Y A;  1JY0 A;  2D7R A;  4ISQ A;  1FGA A;  2ESU A;  4P0L A;  3TC2 A;  4G6M A;  4L4I A;  3CA1 A;  2KI6 B;  1A8D A;  3N7L A;  4MZF B;  2Y9G A;  4G1R A;  1DZC A;  2I1B A;  3F62 B;  3BA5 A;  5BXS A;  5DZU A;  1I1E A;  5BXP A;  3WO4 A;  1JT5 A;  4QBV A;  1HCE A;  3CA6 A;  3FJC A;  3H6R A;  4I2S A;  3VEQ A;  1L2H A;  1TP0 A;  1WBA A;  3O4B A;  4QD2 C;  3WA1 A;  4LO0 A;  5FZZ A;  2RST A;  3Q7X A;  4I4Q A;  4I3N A;  3AKF A;  1ISY A;  4IQP A;  1BA7 A;  3V0A A;  5JLV A;  1FV2 A;  3OGF A;  4LO2 A;  3OJM A;  3V79 C;  1QQK A;  4H9W A;  1IHK A;  3E8L C;  4LO7 B;  1NUN A;  5I1B A;  1QQL A;  4X3A A;  4IZX A;  2L5X A;  2Z48 A;  1Z2V A;  2FO1 A;  3FJF A;  1IRA X;  4LO7 C;  2BEA A;  2ZR1 B;  3IAG C;  2J3P A;  4ION A;  2D44 A;  1K5V A;  1IOB A;  1XG6 A;  1BAR A;  4GP0 A;  4LO3 A;  1JTC A;  4QBC A;  4ZFU B;  4I1B A;  4FVV A;  4EFP A;  4OEF A;  1HCD A;  2MIB A;  4QO3 A;  4I8M A;  4DEN A;  3NBN A;  2WRY A;  3CRG A;  1IJT A;  1EVT A;  5DSS B;  1S0G A;  3H6Q A;  4GP3 A;  3Q7W A;  4QKR A;  5D63 A;  1WBC A;  3N7K A;  3PG0 A;  5BQU A;  4OEE A;  1AVW B;  3JRR A;  1W3A A;  5DUY A;  1EPW A;  1T4Q A;  3EF2 A;  4KEK A;  3PHZ A;  4I4O A;  1ITB A;  1JLY A;  1IT0 A;  1Q04 A;  3QR5 A;  4J23 B;  3O4D A;  4F34 A;  2RG9 B;  3CA3 A;  8I1B A;  1V6V A;  3NBE A;  3HMY A;  3FJB A;  3UD9 A;  3BRD A;  2QYI B;  2E4M C;  2Y9X E;  2Y9W C;  4MZH A;  4ISR A;  1JT4 A;  3ZXG A;  1AVU A;  4USO A;  2FFV A;  2NZ9 A;  1YYN A;  3PME A;  5EC5 A;  3NJ5 A;  2Q9X A;  4ZBV B;  4ZLB B;  3BRF A;  4XFT A;  1AVA C;  3R4U A;  1FQ9 A;  2Z49 A;  1BLD A;  3VT2 A;  1BAS A;  2X2S A;  5BP5 C;  2F8X C;  2VLC A;  4XFU A;  3R4S A;  1TOO A;  1XZZ A;  4ZKT B;  1G9D A;  3UD8 A;  4I4P A;  2XOA A;  1ABR B;  3K1X A;  3KMV A;  1WD3 A;  2F2F A;  3FJ9 A;  1VCL A;  3H6R B;  4YOL A;  3FJI A;  3NBC A;  3O4O A;  5DVH A;  5FZY A;  4HR6 C;  4QC4 A;  4JPZ A;  2NYY A;  2D23 A;  3O44 A;  3V0A B;  3AH4 A;  3O5W B;  4LO0 C;  3V0B A;  2KI4 A;  1R8O A;  2MC2 A;  5JMC A;  3FJA A;  3O4C A;  4LO2 C;  4L4H A;  4JAW A;  4A7Z A;  1ISV A;  3LLP A;  3WMU A;  3LTQ A;  1Z0H A;  5FNX A;  1K5U A;  4Z8S B;  41BI A;  1S0B A;  3OJV A;  4QD2 B;  4ZFW B;  2GZB A;  3VUO A;  4Q9G A;  3BAH A;  2K4A B;  3IM6 A;  3S8J A;  3I29 B;  3RSJ A;  4LO3 C;  4ZGR B;  3FJE A;  1XHB A;  4QAL A;  21BI A;  4H75 A;  3O3Q A;  1SZ6 B;  1S0F A;  4II0 A;  1OQL B;  3CAH A;  1HWO B;  2QN4 A;  3VWC A;  3P6I A;  4MZG B;  3CQA A;  1BLA A;  1YF8 B;  4D8H A;  1RG8 A;  3ILA A;  1DZD A;  5EG6 C;  3BAG A;  3CRI A;  3O4A A;  5B2H A;  1TTU A;  2YUG A;  3VT0 A;  2NTD A;  31BI A;  1GGP B;  3AKI A;  2BEB A;  1YBI A;  1G9B A;  3S8K A;  3A07 A;  1SR4 A;  1Z4S A;  2VUA A;  3B9U A;  4HJJ A;  5BQU C;  4USP A;  4D0Z A;  4X38 A;  1FMM S;  1ILR 1;  1Q1U A;  3BAU A;  1RY7 A;  4Q9P A;  5F8S A;  4JKQ A;  4OUJ A;  1JT7 A;  3FJ8 A;  3A23 A;  4KEI A;  2HWM A;  3RTI B;  2KLL A;  3A21 A;  4EEE B;  1AFC A;  3UJ4 A;  3MPP G;  4KBB A;  4I4R A;  1TWE A;  3AH2 A;  4IY8 A;  4DCK C;  3IM5 A;  3P6J A;  1S0C A;  4P6A A;  1BFG A;  4I4X A;  2NM1 A;  1T9F A;  3FFZ A;  4I4Y A;  4OWJ A;  1PWA A;  3CA4 A;  5F8W A;  4XFS A;  4CJM A;  3FJH A;  2VXR A;  3FGM A;  4GOY A;  2P39 A;  4D0T A;  3JUT A;  1G9A A;  4ZOT A;  4OW4 A;  1E0O A;  2F2F C;  1W3G A;  3WO3 A;  1G82 A;  3VSF A;  4GAF A;  1S0D A;  1S0L A;  5GAQ A;  4P0J A;  3V0B B;  2HZ9 A;  2X2T A;  5FZU A;  1KNM A;  2KH2 A;  1D0H A;  3VT1 A;  4X39 A;  5D62 A;  1DLL A;  3POK A;  4XKI A;  1BFF A;  1V6X A;  3N7J A;  4R6U B;  1F31 A;  1ONK B;  1I1B A;  3AJ6 A;  3RTJ B;  1ISX A;  4EFR A; 
#chains in the Genus database with same CATH homology
 5EHA A;  3N0K A;  1MC9 A;  2RQ9 A;  2AAI B;  3N7M A;  1IRP A;  1XYF A;  3W9T A;  1FWU A;  1MD6 A;  3OGG A;  1BFC A;  1BFB A;  3OJ2 A;  3ZC8 A;  4A7K A;  2Q3N B;  1QXM A;  2VXT I;  4I96 A;  1N4K A;  3IM7 A;  1G9C A;  2BFH A;  1YTO A;  3I2A A;  1PUM B;  1DFQ A;  3AZW A;  3FJK A;  4OWK A;  3NBD A;  4DEP A;  2VSA A;  3WIN A;  3FUQ A;  3MAL A;  2LIE A;  3HN1 A;  4I0Y A;  3HSM A;  2DRZ A;  5BXR A;  2IWT B;  4J2K A;  1SR4 C;  3O49 A;  2VU9 A;  3D7W B;  5BVP I;  4KC3 A;  4I4U A;  3BRG C;  4WBC A;  2ET2 A;  2WBC A;  4TLP A;  5BXT A;  3AH1 A;  1TIE A;  4OEG A;  1R8N A;  4G6J A;  4EB2 B;  4J2S A;  1ISW A;  1FV3 A;  1HKN A;  1DQG A;  2R9K B;  4I37 A;  4END A;  3I2X A;  4G9N A;  3H6S E;  1S0E A;  4GOV A;  5E24 E;  2K8R A;  4EKX B;  1IIL A;  3OBT A;  1YXW A;  2MLL B;  2NP0 A;  4X37 A;  3C9Z A;  4P0K A;  3ZXD A;  4EFQ A;  2GO2 A;  1CE7 B;  2HWA A;  3HOM A;  4AN7 B;  4GAI A;  3UJ0 A;  4KEJ A;  2IHO A;  1II4 A;  4IHZ A;  4I4V A;  2D24 A;  4PC4 A;  2ZQN A;  1M2T B;  2KKI A;  3HAL A;  1FMZ A;  1TFM B;  5F90 A;  3CA0 A;  4LO1 C;  3ZC9 A;  3OBR A;  1WD4 A;  3VSZ A;  2FGF A;  1PUU B;  1HWN B;  4JQ0 A;  2D43 A;  9ILB A;  3WMV A;  1DJS B;  3BAQ A;  2DS0 A;  4I1E A;  4JKX B;  3RMX A;  4AN6 A;  3F1R A;  5HPZ A;  4F83 A;  1AVX B;  4I6I A;  1PZZ A;  2D20 A;  4ZA3 B;  3UD7 A;  1EYL A;  3FJJ A;  1HWP B;  2LIQ A;  2NVH A;  1HWM B;  2HW9 A;  4QKS A;  1P63 A;  4LO1 A;  3WO2 A;  2D7I A;  3CA5 A;  4G9M A;  1RML A;  3AZV A;  4A7Y A;  3RMY A;  1JT3 A;  3BAV A;  5F8Y A;  3BAO A;  3P53 A;  2D1Z A;  1W3F A;  3BB2 A;  3AKH A;  4JP0 A;  1AF9 A;  1UPS A;  7I1B A;  4IYB A;  1JQZ A;  2K43 A;  1J0S A;  1HIB A;  2Y9F A;  4H04 A;  3QYD A;  3BTA A;  1PC8 B;  3FJD A;  3BX1 C;  4I7I A;  4I4S A;  2P23 A;  3WIN C;  5G00 A;  3AKG A;  1DFC A;  1V6W A;  1FN0 A;  1ISZ A;  4ZFY B;  1EV2 A;  1NZK A;  1TWM A;  3SNV A;  3CRH A;  2D22 A;  2ZQO A;  1DQO A;  2DRE A;  3BA7 A;  3UDA A;  4OWL A;  1FWV A;  3HBW A;  4UY4 A;  5FNW A;  1V6U A;  2AXM A;  4HA2 A;  4IY9 A;  1AXM A;  1Q03 A;  4Q91 A;  3IIR A;  2E4M A;  4J2Y A;  4LO8 B;  1DIW A;  2NS2 A;  4FGF A;  3A22 A;  3PUB A;  2M49 A;  2UUS A;  2FFU A;  3BA4 A;  4IZE A;  3CU1 B;  1RZO B;  4J2X A;  3AJ5 A;  1M16 A;  4JRA A;  2FDB M;  1JLX A;  2VSE A;  1CVS A;  2AQZ A;  2AFG A;  3ZX7 A;  6I1B A;  2DRY A;  3T8S A;  5BOW A;  5D61 A;  2ERM A;  3BAD A;  4Z9W B;  3FUO A;  5BP5 A;  3Q7Y A;  1JY0 A;  2D7R A;  4ISQ A;  1FGA A;  2ESU A;  4P0L A;  3TC2 A;  4G6M A;  4L4I A;  3CA1 A;  2KI6 B;  1A8D A;  3N7L A;  4MZF B;  2Y9G A;  4G1R A;  1DZC A;  2I1B A;  3F62 B;  3BA5 A;  5BXS A;  5DZU A;  1I1E A;  5BXP A;  3WO4 A;  1JT5 A;  4QBV A;  1HCE A;  3CA6 A;  3FJC A;  3H6R A;  4I2S A;  3VEQ A;  1L2H A;  1TP0 A;  1WBA A;  3O4B A;  4QD2 C;  3WA1 A;  4LO0 A;  5FZZ A;  2RST A;  3Q7X A;  4I4Q A;  4I3N A;  3AKF A;  1ISY A;  4IQP A;  1BA7 A;  3V0A A;  5JLV A;  1FV2 A;  3OGF A;  4LO2 A;  3OJM A;  3V79 C;  1QQK A;  4H9W A;  1IHK A;  3E8L C;  4LO7 B;  1NUN A;  5I1B A;  1QQL A;  4X3A A;  4IZX A;  2L5X A;  2Z48 A;  1Z2V A;  2FO1 A;  3FJF A;  1IRA X;  4LO7 C;  2BEA A;  2ZR1 B;  3IAG C;  2J3P A;  4ION A;  2D44 A;  1K5V A;  1IOB A;  1XG6 A;  1BAR A;  4GP0 A;  4LO3 A;  1JTC A;  4QBC A;  4ZFU B;  4I1B A;  4FVV A;  4EFP A;  4OEF A;  1HCD A;  2MIB A;  4QO3 A;  4I8M A;  4DEN A;  3NBN A;  2WRY A;  3CRG A;  1IJT A;  1EVT A;  5DSS B;  1S0G A;  3H6Q A;  4GP3 A;  3Q7W A;  4QKR A;  5D63 A;  1WBC A;  3N7K A;  3PG0 A;  5BQU A;  4OEE A;  1AVW B;  3JRR A;  1W3A A;  5DUY A;  1EPW A;  1T4Q A;  3EF2 A;  4KEK A;  3PHZ A;  4I4O A;  1ITB A;  1JLY A;  1IT0 A;  1Q04 A;  3QR5 A;  4J23 B;  3O4D A;  4F34 A;  2RG9 B;  3CA3 A;  8I1B A;  1V6V A;  3NBE A;  3HMY A;  3FJB A;  3UD9 A;  3BRD A;  2QYI B;  2E4M C;  2Y9X E;  2Y9W C;  4MZH A;  4ISR A;  1JT4 A;  3ZXG A;  1AVU A;  4USO A;  2FFV A;  2NZ9 A;  1YYN A;  3PME A;  5EC5 A;  3NJ5 A;  2Q9X A;  4ZBV B;  4ZLB B;  3BRF A;  4XFT A;  1AVA C;  3R4U A;  1FQ9 A;  2Z49 A;  1BLD A;  3VT2 A;  1BAS A;  2X2S A;  5BP5 C;  2F8X C;  2VLC A;  4XFU A;  3R4S A;  1TOO A;  1XZZ A;  4ZKT B;  1G9D A;  3UD8 A;  4I4P A;  2XOA A;  1ABR B;  3K1X A;  3KMV A;  1WD3 A;  2F2F A;  3FJ9 A;  1VCL A;  3H6R B;  4YOL A;  3FJI A;  3NBC A;  3O4O A;  5DVH A;  5FZY A;  4HR6 C;  4QC4 A;  4JPZ A;  2NYY A;  2D23 A;  3O44 A;  3V0A B;  3AH4 A;  3O5W B;  4LO0 C;  3V0B A;  2KI4 A;  1R8O A;  2MC2 A;  5JMC A;  3FJA A;  3O4C A;  4LO2 C;  4L4H A;  4JAW A;  4A7Z A;  1ISV A;  3LLP A;  3WMU A;  3LTQ A;  1Z0H A;  5FNX A;  1K5U A;  4Z8S B;  41BI A;  1S0B A;  3OJV A;  4QD2 B;  4ZFW B;  2GZB A;  3VUO A;  4Q9G A;  3BAH A;  2K4A B;  3IM6 A;  3S8J A;  3I29 B;  3RSJ A;  4LO3 C;  4ZGR B;  3FJE A;  1XHB A;  4QAL A;  21BI A;  4H75 A;  3O3Q A;  1SZ6 B;  1S0F A;  4II0 A;  1OQL B;  3CAH A;  1HWO B;  2QN4 A;  3VWC A;  3P6I A;  4MZG B;  3CQA A;  1BLA A;  1YF8 B;  4D8H A;  1RG8 A;  3ILA A;  1DZD A;  5EG6 C;  3BAG A;  3CRI A;  3O4A A;  5B2H A;  1TTU A;  2YUG A;  3VT0 A;  2NTD A;  31BI A;  1GGP B;  3AKI A;  2BEB A;  1YBI A;  1G9B A;  3S8K A;  3A07 A;  1SR4 A;  1Z4S A;  2VUA A;  3B9U A;  4HJJ A;  5BQU C;  4USP A;  4D0Z A;  4X38 A;  1FMM S;  1ILR 1;  1Q1U A;  3BAU A;  1RY7 A;  4Q9P A;  5F8S A;  4JKQ A;  4OUJ A;  1JT7 A;  3FJ8 A;  3A23 A;  4KEI A;  2HWM A;  3RTI B;  2KLL A;  3A21 A;  4EEE B;  1AFC A;  3UJ4 A;  3MPP G;  4KBB A;  4I4R A;  1TWE A;  3AH2 A;  4IY8 A;  4DCK C;  3IM5 A;  3P6J A;  1S0C A;  4P6A A;  1BFG A;  4I4X A;  2NM1 A;  1T9F A;  3FFZ A;  4I4Y A;  4OWJ A;  1PWA A;  3CA4 A;  5F8W A;  4XFS A;  4CJM A;  3FJH A;  2VXR A;  3FGM A;  4GOY A;  2P39 A;  4D0T A;  3JUT A;  1G9A A;  4ZOT A;  4OW4 A;  1E0O A;  2F2F C;  1W3G A;  3WO3 A;  1G82 A;  3VSF A;  4GAF A;  1S0D A;  1S0L A;  5GAQ A;  4P0J A;  3V0B B;  2HZ9 A;  2X2T A;  5FZU A;  1KNM A;  2KH2 A;  1D0H A;  3VT1 A;  4X39 A;  5D62 A;  1DLL A;  3POK A;  4XKI A;  1BFF A;  1V6X A;  3N7J A;  4R6U B;  1F31 A;  1ONK B;  1I1B A;  3AJ6 A;  3RTJ B;  1ISX A;  4EFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...