2DROA

Crystal structure of reducing-end-xylose releasing exo-oligoxylanase d263c mutant
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
376
structure length
376
Chain Sequence
b'EGAFYTREYRNLFKEFGYSEAEIQERVKDTWEQLFGDNPETKIYYEVGDDLGYLLDTGNLDVRTEGMSYGMMMAVQMDRKDIFDRIWNWTMKNMYMTEGVHAGYFAWSCQPDGTKNSWGPAPDGEEYFALALFFASHRWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGHFFSCSYRVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDGPYAKANVDLFWNTPVRTGNRRYYDNCLYLFAMLALSGNFKIWFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase Y
publication title Structural explanation for the acquisition of glycosynthase activity
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 150
structure length 376
sequence length 376
ec nomenclature ec 3.2.1.156: Oligosaccharide reducing-end xylanase.
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2droA01
3WKHA 1F9OA 3E73A 4AYOA 3CIHA 3PMMA 1FO2A 1WU5A 4CE7A 3P2CA 1KRFA 3QWTA 2EADA 3K11A 3W5MA 3ANKA 1WU6A 3T33A 3QFZA 1L2AA 1FP3A 3WUXA 3GLYA 2WYNA 3GT5A 3W7UA 4CJ1A 1LF9A 4Q88A 1V7VA 3H7LA 1FAEA 4XUVA 1GA2A 1XW2A 2ZZRA 1TF4A 2D5JA 2EAEA 4Q2BA 1KSCA 5CD2A 3E6UA 2DRQA 3VW5A 2B4FA 2DRSA 3S4DA 2P0VA 2AHGA 1JS4A 1H12A 5GY3A 2FV0A 1KWFA 1DL2A 3ANJA 1VD5A 2RI9A 3RENA 2XFGA 2D8LA 3QG0A 2VN7A 1V5CA 3ACTA 3WIWA 2VN4A 1KKTA 1GAHA 3H2WA 4TXTA 1K72A 3TF4A 1F9DA 3QPFA 1FBOA 3WIRA 3W7XA 4L0GA 2DRRA 2GH4A 1KREA 2YIKA 3RX8A 2A8ZA 2ZBLA 3WIQA 2RI8A 2FV1A 3ACSA 3QDEA 1IA6A 2QNOA 5M7IA 2FUZA 1FBWA 1GAIA 2JG0A 3GZKA 3S4CA 2GZ6A 3EZ8A 3ON6A 3QSPA 1FO3A 2JF4A 1WZZA 4TF4A 2EACA 2NVPA 1FCEA 1G9JA 1NXCA 5KKBA 1DOGA 1XWQA 1UT9A 5MEHA 1ULVA 3ANIA 3QRYA 2DROA 3QT3A 4WVBA 3QXFA 1L1YA 3QFYA 4Z4LA 2OKXA 2JJBA 3W7WA 4WU0A 3RX5A 5DGRA 3S4AA 4ZH5A 4WVCA 2CQSA 4AYPA 1GLMA 3A3VA 1X9DA 5M7YA 3QXQA 4J5TA 3S4BA 4L6XA 5CZLA 4KTRA 1XWTA 3VXDA 3H3KA 4FUSA 1IS9A 4ZG8A 4EL8A 3AFJA 4DOEA 2F6DA 3RX7A 1G87A 2EABA 3W7SA 3WKGA 1V5DA 1CLCA 1FMIA 3WC3A 1AGMA 1IA7A 1KSDA 1V7XA 4JJJA 5GW7A 4AYRA 1UG9A 3RSYA 1LF6A 1AYXA 3RRSA 1H54A 1HCUA 1KFGA 4DODA 3W5NA 1KS8A 1CEMA 1RQ5A 4KTPA 1H13A 1G6IA 1V7WA 2AFAA 3WKIA 5CA3A 4Z4JA 1G9GA 3D3IA 2CQTA 5E2JA 2Z07A 1H14A 3W7TA 3X17A 1NC5A 3EQAA 1WU4A 4AYQA 4CJ0A 4WVAA 3WKFA 5DGQA 2AHFA 2FBAA 3QT9A 2RGKA
chains in the Genus database with same CATH superfamily
3E33B 1F9OA 4AYOA 1FO2A 1WU5A 1HN0A 3P2CA 4LNGB 1N7QA 1DCEB 3W5MA 2BEDB 5JMFA 1FP3A 2WY7A 3GLYA 2A73B 4GAXA 3GT5A 4OZWA 3D5RA 1V7VA 1GXMA 1TNUB 1GA2A 1W6JA 1GHQA 1GSZA 4Q2BA 5CD2A 3Q78B 1N95B 3M00A 2PMVA 1H36A 1H12A 4F10A 3PZ1B 1DL2A 3M71A 4ZRPA 2G02A 3D5SA 3E7JA 1GAHA 1H39A 3W7XA 1HMUA 4LNVA 3G6JB 4MMIA 4V1RA 3M77A 2A8ZA 2WY8A 3WIQA 1W6KA 2QNOA 5IM1A 1FBWA 3DSVB 3ON6A 1D8EB 3QSPA 5ILKA 5DHKA 3M7CA 4TF4A 2H6GB 1KZPB 1QQFA 1TN7B 2J5CA 2WIIB 1FCEA 2NVPA 1HMWA 1N23A 3M78A 1OJNA 5MEHA 1N4QB 3DPYB 2BRVX 3NNBA 2G0DA 2H6FB 2JJBA 1X1JA 2V8JA 1RWFA 3OEDA 5DGRA 3S4AA 4GTOB 1GLMA 3PZ2B 2BB6A 2ZISB 3HXDB 1XWTA 3H3KA 1IS9A 4DOEA 1LTXB 1AGMA 1KSDA 1V7XA 3CU7A 1UG9A 1FPPB 1HXAA 2FUQA 2WINB 1H35A 3RRSA 1H54A 4LNBB 4DODA 1RWCA 1R76A 4FXGB 4KTPA 1H13A 3P5PA 2WDAA 4Z4JA 1N7PA 4ONTA 3D3IA 3DSXB 1OJMA 1S63B 3VSMA 4YDEB 3X17A 4WVAA 3PZ3B 1N21A 2V3PA 2WCOA 1N1BA 3E73A 2I07B 3CIHA 3S9VA 3P5RA 1GXNA 2NOJA 1KRFA 3ANKA 3M73A 3M72A 3KQ4A 1L2AA 4QT9A 4EHMB 3W7UA 2BB5A 1LF9A 4Q88A 4GTSB 4XUVA 1FAEA 1XW2A 1TF4A 2D5JA 2EAEA 1OJPA 4D4AA 4L9PB 1SQCA 2DRSA 3DSTB 3DSSB 1JS4A 5FO9B 2FV0A 3PYBA 4MBGB 1VD5A 1CB8A 4RNQA 2X03A 1TNYB 2VN7A 3WIWA 3M75A 1KKTA 4TXTA 1FBOA 1MZCB 3EU8A 3WIRA 5GZKA 2V8IA 4L0GA 2DRRA 5AGDA 1QSJA 2GH4A 5FOBB 2YIKA 3RX8A 1O79A 3KSQB 2RI8A 2FV1A 3ACSA 2FUZA 3PYAA 5FO7B 5JMDA 2GZ6A 3EZ8A 1HZFA 1TNBB 1WZZA 1LXMA 1FT1B 4GTVB 5KKBA 1DOGA 1XWQA 4GTQB 3QT3A 4WVBA 3QXFA 1L1YA 4GL3A 5ILDA 3QFYA 3RX5A 2XWBB 2ZIRB 4WVCA 4FXKB 2CQSA 4AYPA 1OJOA 1JCSB 1X9DA 3G4FA 4L6XA 1UMPA 3E37B 4KTRA 5DHIA 4ZG8A 3Q75B 2XWJB 1O6RA 2F6DA 4YCRA 1G87A 2EABA 5GW7A 3SAEA 4NEIA 2R2LB 1KZOB 1AYXA 2PN5A 3SFXB 1KS8A 3RJ3A 1RQ5A 4V1SA 2AFAA 5ILYA 2CQTA 1J0MA 4GTPB 5ILIA 3SDVA 4CJ0A 5EASA 3WKFA 5DGQA 3SDQA 5ILZA 2FBAA 3QT9A 1W3YA 1SA5B 5FO8B 2EADA 3K11A 1WU6A 3QFZA 1HM2A 3WUXA 1C82A 2E24A 2WYNA 3DSWB 3H7LA 2ZZRA 4OK2A 3EUVB 1O1SB 2BRPA 3VSNA 1RWHA 1N94B 1RWGA 2IEJB 3M01A 2DRQA 4F13A 1SA4B 3M7BA 3DSUB 3S4DA 2AHGA 3RENA 3ANJA 1H3BA 1N4SB 1N4PB 3M7EA 3H2WA 3QPFA 1C3DA 3EU5B 1NL4B 2BBCA 1X81B 4D4CA 1I8QA 2Q1FA 5IK6A 2ZBLA 4YDOB 2JG0A 4BOJA 1LOHA 1FO3A 1TN8B 2JF4A 1N20A 2EACA 5IL8A 5IK9A 1LD7B 1NXCA 1N24A 4KKIA 1ULVA 2GOXA 3QRYA 1JCRB 4KKJA 3E80A 1N1ZA 1N7NA 3M76A 3W7WA 1TN6B 1QAZA 1F9GA 3OXUA 1TNZB 1FT2B 3M7LA 4MMHA 5EATA 4C1SA 3S4BA 3QXQA 3KSLB 1O1RB 1GXOA 1HX9A 1N4RB 3SFYB 3VXDA 3NFVA 4ZH1A 1HM3A 3WKGA 1V5DA 1CLCA 3WC3A 3M02A 1O6QA 2E22A 1IA7A 3KLSA 1HXGA 4AYRA 4JJJA 3SDRA 5JPNB 1LF6A 1HCUA 1KFGA 4D4DA 3AFLA 3SDUA 1G6IA 1V7WA 1G9GA 3LZ9A 5IKAA 2ONGA 4GTMB 2Z07A 3Q79B 3PZ4B 1NC5A 3EQAA 1WU4A 4ZRQA 2AHFA 2RGKA 3WKHA 1LXKA 3PMMA 1TNOB 4CE7A 4D4BA 3QWTA 2V3NA 3HXCB 1N9AB 5ILJA 4GTRB 3T33A 1F1SA 4CJ1A 3E34B 3Q73B 4M76A 4FJQA 5IKHA 4OJZA 1KSCA 2V8KA 4D94A 2FUTA 3E6UA 3VW5A 2B4FA 3E32B 2P0VA 2SQCA 1N22A 3SDTA 5GY3A 2B39A 3HXBB 1KWFA 1LD8B 2RI9A 5ILHA 2XFGA 5EAUA 2D8LA 1X1HA 3QG0A 3ACTA 1V5CA 3Q7AB 2VN4A 2H6HB 1K72A 3TF4A 4MU9A 1F9DA 1KREA 3QDEA 1QBQB 1IA6A 5M7IA 1GAIA 1O5MB 3GZKA 3S4CA 1NI1B 1EGUA 1H3AA 1D8DB 5JPMB 1S64B 1RWAA 2H6IB 1G9JA 1N7OA 5C05A 1UT9A 3C72B 3N0GA 3ANIA 3HXFB 3SQCA 3M74A 4LIXA 2DROA 3N0FA 4Z4LA 2OKXA 4WU0A 3HXEB 1RW9A 1H37A 4ZH5A 3A0OA 3A3VA 1HXCA 5M7YA 4J5TA 4E1YA 4BOKA 5CZLA 1X1IA 1O1TB 4FUSA 3E30B 4EL8A 3AFJA 1JCQB 3G4DA 2XQWA 3RX7A 3W7SA 5IL3A 1FMIA 1N7RA 4OK4A 4FNVA 3RSYA 4GTTB 2ONHA 1CEMA 2BRWA 1O6HA 1J0NA 3WKIA 1H3CA 5IK0A 5CA3A 3DRAB 4DI5A 5E2JA 1H14A 4OZVA 3W7TA 1HV6A 4AYQA 3K7XA 3Q7FB 3W5NA 2F0YB
chains in the Genus database with same CATH topology
3E33B 1F9OA 4AYOA 1FO2A 1WU5A 3P2CA 4LNGB 1DCEB 3W5MA 2BEDB 1FP3A 2WY7A 3GLYA 2A73B 3GT5A 3D5RA 1V7VA 1GXMA 1TNUB 1GA2A 1W6JA 1GHQA 1GSZA 4Q2BA 5CD2A 3Q78B 1N95B 2PMVA 1H36A 1H12A 3PZ1B 1DL2A 3M71A 4ZRPA 2G02A 3D5SA 1GAHA 1H39A 3W7XA 4LNVA 3G6JB 4V1RA 3M77A 2A8ZA 2WY8A 3WIQA 1W6KA 2QNOA 1FBWA 3DSVB 3ON6A 3QSPA 1D8EB 3M7CA 4TF4A 2H6GB 1KZPB 1QQFA 1TN7B 2WIIB 2NVPA 1FCEA 3M78A 5MEHA 1N4QB 3DPYB 2G0DA 2H6FB 2JJBA 5DGRA 2V8JA 3OEDA 3S4AA 4GTOB 1GLMA 3PZ2B 2BB6A 2ZISB 3HXDB 1XWTA 3H3KA 1IS9A 4DOEA 1LTXB 1AGMA 1KSDA 1V7XA 3CU7A 1UG9A 1FPPB 2WINB 1H35A 3RRSA 1H54A 4LNBB 4DODA 1R76A 4FXGB 4KTPA 1H13A 3P5PA 4Z4JA 4ONTA 3D3IA 3DSXB 1S63B 4YDEB 3X17A 4WVAA 3PZ3B 2V3PA 3E73A 2I07B 3CIHA 3S9VA 3P5RA 1GXNA 2NOJA 1KRFA 3ANKA 3M73A 3M72A 3KQ4A 1L2AA 4QT9A 4EHMB 3W7UA 2BB5A 1LF9A 4Q88A 4GTSB 4XUVA 1FAEA 1XW2A 1TF4A 2D5JA 2EAEA 4D4AA 4L9PB 1SQCA 2DRSA 3DSTB 3DSSB 1JS4A 5FO9B 2FV0A 3PYBA 4MBGB 1VD5A 1TNYB 2VN7A 3WIWA 3M75A 1KKTA 4TXTA 1FBOA 1MZCB 3EU8A 3WIRA 5GZKA 2V8IA 4L0GA 2DRRA 5AGDA 1QSJA 2GH4A 5FOBB 2YIKA 3RX8A 1O79A 3KSQB 2RI8A 2FV1A 3ACSA 2FUZA 3PYAA 5FO7B 2GZ6A 3EZ8A 1HZFA 1TNBB 1WZZA 1FT1B 4GTVB 5KKBA 1DOGA 1XWQA 4GTQB 3QT3A 4WVBA 3QXFA 1L1YA 4GL3A 3QFYA 3RX5A 2XWBB 2ZIRB 4WVCA 4FXKB 2CQSA 4AYPA 1JCSB 1X9DA 4L6XA 1UMPA 3E37B 4KTRA 4ZG8A 3Q75B 2XWJB 1O6RA 2F6DA 4YCRA 1G87A 2EABA 5GW7A 3SAEA 2R2LB 1KZOB 1AYXA 2PN5A 3SFXB 1KS8A 3RJ3A 1RQ5A 4V1SA 2AFAA 2CQTA 4GTPB 3SDVA 4CJ0A 3WKFA 5DGQA 3SDQA 2FBAA 3QT9A 1SA5B 5FO8B 2EADA 3K11A 1WU6A 3QFZA 3WUXA 2WYNA 3DSWB 3H7LA 2ZZRA 3EUVB 1O1SB 2IEJB 1N94B 2DRQA 1SA4B 3M7BA 3DSUB 3S4DA 2AHGA 3RENA 3ANJA 1H3BA 1N4SB 1N4PB 3M7EA 3H2WA 3QPFA 1C3DA 3EU5B 1NL4B 2BBCA 1X81B 4D4CA 2ZBLA 4YDOB 2JG0A 4BOJA 1FO3A 1TN8B 2JF4A 2EACA 1LD7B 1NXCA 4KKIA 1ULVA 2GOXA 3QRYA 1JCRB 4KKJA 3M76A 3W7WA 1TN6B 3OXUA 1TNZB 1FT2B 3M7LA 4C1SA 3S4BA 3QXQA 3KSLB 1O1RB 1GXOA 1N4RB 3SFYB 3VXDA 4ZH1A 3WKGA 1V5DA 1CLCA 3WC3A 1O6QA 3KLSA 1IA7A 4AYRA 4JJJA 3SDRA 5JPNB 1LF6A 1HCUA 1KFGA 4D4DA 3SDUA 1G6IA 1V7WA 1G9GA 4GTMB 2Z07A 3Q79B 3PZ4B 1NC5A 3EQAA 1WU4A 4ZRQA 2AHFA 2RGKA 3WKHA 3PMMA 1TNOB 4CE7A 4D4BA 3QWTA 2V3NA 3HXCB 1N9AB 4GTRB 3T33A 4CJ1A 3E34B 3Q73B 4M76A 1KSCA 2V8KA 4D94A 3E6UA 3VW5A 2B4FA 3E32B 2P0VA 2SQCA 3SDTA 5GY3A 2B39A 3HXBB 1KWFA 1LD8B 2RI9A 2XFGA 2D8LA 3QG0A 3ACTA 1V5CA 3Q7AB 2VN4A 2H6HB 1K72A 3TF4A 4MU9A 1F9DA 1KREA 3QDEA 1QBQB 1IA6A 5M7IA 1GAIA 1O5MB 3GZKA 3S4CA 1NI1B 1H3AA 1D8DB 5JPMB 1S64B 1G9JA 2H6IB 1UT9A 3C72B 3ANIA 3HXFB 3SQCA 3M74A 4LIXA 2DROA 4Z4LA 2OKXA 4WU0A 3HXEB 1H37A 4ZH5A 3A3VA 5M7YA 4J5TA 4BOKA 5CZLA 1O1TB 4FUSA 3E30B 4EL8A 3AFJA 1JCQB 2XQWA 3RX7A 3W7SA 1FMIA 3RSYA 4GTTB 1CEMA 1O6HA 3WKIA 1H3CA 5CA3A 3DRAB 5E2JA 1H14A 3W7TA 4AYQA 3K7XA 3Q7FB 3W5NA 2F0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKH A;  1F9O A;  3E73 A;  4AYO A;  3CIH A;  3PMM A;  1FO2 A;  1WU5 A;  4CE7 A;  3P2C A;  1KRF A;  3QWT A;  2EAD A;  3K11 A;  3W5M A;  3ANK A;  1WU6 A;  3T33 A;  3QFZ A;  1L2A A;  1FP3 A;  3WUX A;  3GLY A;  2WYN A;  3GT5 A;  3W7U A;  4CJ1 A;  1LF9 A;  4Q88 A;  1V7V A;  3H7L A;  1FAE A;  4XUV A;  1GA2 A;  1XW2 A;  2ZZR A;  1TF4 A;  2D5J A;  2EAE A;  4Q2B A;  1KSC A;  5CD2 A;  3E6U A;  2DRQ A;  3VW5 A;  2B4F A;  2DRS A;  3S4D A;  2P0V A;  2AHG A;  1JS4 A;  1H12 A;  5GY3 A;  2FV0 A;  1KWF A;  1DL2 A;  3ANJ A;  1VD5 A;  2RI9 A;  3REN A;  2XFG A;  2D8L A;  3QG0 A;  2VN7 A;  1V5C A;  3ACT A;  3WIW A;  2VN4 A;  1KKT A;  1GAH A;  3H2W A;  4TXT A;  1K72 A;  3TF4 A;  1F9D A;  3QPF A;  1FBO A;  3WIR A;  3W7X A;  4L0G A;  2DRR A;  2GH4 A;  1KRE A;  2YIK A;  3RX8 A;  2A8Z A;  2ZBL A;  3WIQ A;  2RI8 A;  2FV1 A;  3ACS A;  3QDE A;  1IA6 A;  2QNO A;  5M7I A;  2FUZ A;  1FBW A;  1GAI A;  2JG0 A;  3GZK A;  3S4C A;  2GZ6 A;  3EZ8 A;  3ON6 A;  3QSP A;  1FO3 A;  2JF4 A;  1WZZ A;  4TF4 A;  2EAC A;  2NVP A;  1FCE A;  1G9J A;  1NXC A;  5KKB A;  1DOG A;  1XWQ A;  1UT9 A;  5MEH A;  1ULV A;  3ANI A;  3QRY A;  2DRO A;  3QT3 A;  4WVB A;  3QXF A;  1L1Y A;  3QFY A;  4Z4L A;  2OKX A;  2JJB A;  3W7W A;  4WU0 A;  3RX5 A;  5DGR A;  3S4A A;  4ZH5 A;  4WVC A;  2CQS A;  4AYP A;  1GLM A;  3A3V A;  1X9D A;  5M7Y A;  3QXQ A;  4J5T A;  3S4B A;  4L6X A;  5CZL A;  4KTR A;  1XWT A;  3VXD A;  3H3K A;  4FUS A;  1IS9 A;  4ZG8 A;  4EL8 A;  3AFJ A;  4DOE A;  2F6D A;  3RX7 A;  1G87 A;  2EAB A;  3W7S A;  3WKG A;  1V5D A;  1CLC A;  1FMI A;  3WC3 A;  1AGM A;  1IA7 A;  1KSD A;  1V7X A;  4JJJ A;  5GW7 A;  4AYR A;  1UG9 A;  3RSY A;  1LF6 A;  1AYX A;  3RRS A;  1H54 A;  1HCU A;  1KFG A;  4DOD A;  3W5N A;  1KS8 A;  1CEM A;  1RQ5 A;  4KTP A;  1H13 A;  1G6I A;  1V7W A;  2AFA A;  3WKI A;  5CA3 A;  4Z4J A;  1G9G A;  3D3I A;  2CQT A;  5E2J A;  2Z07 A;  1H14 A;  3W7T A;  3X17 A;  1NC5 A;  3EQA A;  1WU4 A;  4AYQ A;  4CJ0 A;  4WVA A;  3WKF A;  5DGQ A;  2AHF A;  2FBA A;  3QT9 A;  2RGK A; 
#chains in the Genus database with same CATH topology
 3E33 B;  1F9O A;  4AYO A;  1FO2 A;  1WU5 A;  1HN0 A;  3P2C A;  4LNG B;  1N7Q A;  1DCE B;  3W5M A;  2BED B;  5JMF A;  1FP3 A;  2WY7 A;  3GLY A;  2A73 B;  4GAX A;  3GT5 A;  4OZW A;  3D5R A;  1V7V A;  1GXM A;  1TNU B;  1GA2 A;  1W6J A;  1GHQ A;  1GSZ A;  4Q2B A;  5CD2 A;  3Q78 B;  1N95 B;  3M00 A;  2PMV A;  1H36 A;  1H12 A;  4F10 A;  3PZ1 B;  1DL2 A;  3M71 A;  4ZRP A;  2G02 A;  3D5S A;  3E7J A;  1GAH A;  1H39 A;  3W7X A;  1HMU A;  4LNV A;  3G6J B;  4MMI A;  4V1R A;  3M77 A;  2A8Z A;  2WY8 A;  3WIQ A;  1W6K A;  2QNO A;  5IM1 A;  1FBW A;  3DSV B;  3ON6 A;  1D8E B;  3QSP A;  5ILK A;  5DHK A;  3M7C A;  4TF4 A;  2H6G B;  1KZP B;  1QQF A;  1TN7 B;  2J5C A;  2WII B;  1FCE A;  2NVP A;  1HMW A;  1N23 A;  3M78 A;  1OJN A;  5MEH A;  1N4Q B;  3DPY B;  2BRV X;  3NNB A;  2G0D A;  2H6F B;  2JJB A;  1X1J A;  2V8J A;  1RWF A;  3OED A;  5DGR A;  3S4A A;  4GTO B;  1GLM A;  3PZ2 B;  2BB6 A;  2ZIS B;  3HXD B;  1XWT A;  3H3K A;  1IS9 A;  4DOE A;  1LTX B;  1AGM A;  1KSD A;  1V7X A;  3CU7 A;  1UG9 A;  1FPP B;  1HXA A;  2FUQ A;  2WIN B;  1H35 A;  3RRS A;  1H54 A;  4LNB B;  4DOD A;  1RWC A;  1R76 A;  4FXG B;  4KTP A;  1H13 A;  3P5P A;  2WDA A;  4Z4J A;  1N7P A;  4ONT A;  3D3I A;  3DSX B;  1OJM A;  1S63 B;  3VSM A;  4YDE B;  3X17 A;  4WVA A;  3PZ3 B;  1N21 A;  2V3P A;  2WCO A;  1N1B A;  3E73 A;  2I07 B;  3CIH A;  3S9V A;  3P5R A;  1GXN A;  2NOJ A;  1KRF A;  3ANK A;  3M73 A;  3M72 A;  3KQ4 A;  1L2A A;  4QT9 A;  4EHM B;  3W7U A;  2BB5 A;  1LF9 A;  4Q88 A;  4GTS B;  4XUV A;  1FAE A;  1XW2 A;  1TF4 A;  2D5J A;  2EAE A;  1OJP A;  4D4A A;  4L9P B;  1SQC A;  2DRS A;  3DST B;  3DSS B;  1JS4 A;  5FO9 B;  2FV0 A;  3PYB A;  4MBG B;  1VD5 A;  1CB8 A;  4RNQ A;  2X03 A;  1TNY B;  2VN7 A;  3WIW A;  3M75 A;  1KKT A;  4TXT A;  1FBO A;  1MZC B;  3EU8 A;  3WIR A;  5GZK A;  2V8I A;  4L0G A;  2DRR A;  5AGD A;  1QSJ A;  2GH4 A;  5FOB B;  2YIK A;  3RX8 A;  1O79 A;  3KSQ B;  2RI8 A;  2FV1 A;  3ACS A;  2FUZ A;  3PYA A;  5FO7 B;  5JMD A;  2GZ6 A;  3EZ8 A;  1HZF A;  1TNB B;  1WZZ A;  1LXM A;  1FT1 B;  4GTV B;  5KKB A;  1DOG A;  1XWQ A;  4GTQ B;  3QT3 A;  4WVB A;  3QXF A;  1L1Y A;  4GL3 A;  5ILD A;  3QFY A;  3RX5 A;  2XWB B;  2ZIR B;  4WVC A;  4FXK B;  2CQS A;  4AYP A;  1OJO A;  1JCS B;  1X9D A;  3G4F A;  4L6X A;  1UMP A;  3E37 B;  4KTR A;  5DHI A;  4ZG8 A;  3Q75 B;  2XWJ B;  1O6R A;  2F6D A;  4YCR A;  1G87 A;  2EAB A;  5GW7 A;  3SAE A;  4NEI A;  2R2L B;  1KZO B;  1AYX A;  2PN5 A;  3SFX B;  1KS8 A;  3RJ3 A;  1RQ5 A;  4V1S A;  2AFA A;  5ILY A;  2CQT A;  1J0M A;  4GTP B;  5ILI A;  3SDV A;  4CJ0 A;  5EAS A;  3WKF A;  5DGQ A;  3SDQ A;  5ILZ A;  2FBA A;  3QT9 A;  1W3Y A;  1SA5 B;  5FO8 B;  2EAD A;  3K11 A;  1WU6 A;  3QFZ A;  1HM2 A;  3WUX A;  1C82 A;  2E24 A;  2WYN A;  3DSW B;  3H7L A;  2ZZR A;  4OK2 A;  3EUV B;  1O1S B;  2BRP A;  3VSN A;  1RWH A;  1N94 B;  1RWG A;  2IEJ B;  3M01 A;  2DRQ A;  4F13 A;  1SA4 B;  3M7B A;  3DSU B;  3S4D A;  2AHG A;  3REN A;  3ANJ A;  1H3B A;  1N4S B;  1N4P B;  3M7E A;  3H2W A;  3QPF A;  1C3D A;  3EU5 B;  1NL4 B;  2BBC A;  1X81 B;  4D4C A;  1I8Q A;  2Q1F A;  5IK6 A;  2ZBL A;  4YDO B;  2JG0 A;  4BOJ A;  1LOH A;  1FO3 A;  1TN8 B;  2JF4 A;  1N20 A;  2EAC A;  5IL8 A;  5IK9 A;  1LD7 B;  1NXC A;  1N24 A;  4KKI A;  1ULV A;  2GOX A;  3QRY A;  1JCR B;  4KKJ A;  3E80 A;  1N1Z A;  1N7N A;  3M76 A;  3W7W A;  1TN6 B;  1QAZ A;  1F9G A;  3OXU A;  1TNZ B;  1FT2 B;  3M7L A;  4MMH A;  5EAT A;  4C1S A;  3S4B A;  3QXQ A;  3KSL B;  1O1R B;  1GXO A;  1HX9 A;  1N4R B;  3SFY B;  3VXD A;  3NFV A;  4ZH1 A;  1HM3 A;  3WKG A;  1V5D A;  1CLC A;  3WC3 A;  3M02 A;  1O6Q A;  2E22 A;  1IA7 A;  3KLS A;  1HXG A;  4AYR A;  4JJJ A;  3SDR A;  5JPN B;  1LF6 A;  1HCU A;  1KFG A;  4D4D A;  3AFL A;  3SDU A;  1G6I A;  1V7W A;  1G9G A;  3LZ9 A;  5IKA A;  2ONG A;  4GTM B;  2Z07 A;  3Q79 B;  3PZ4 B;  1NC5 A;  3EQA A;  1WU4 A;  4ZRQ A;  2AHF A;  2RGK A;  3WKH A;  1LXK A;  3PMM A;  1TNO B;  4CE7 A;  4D4B A;  3QWT A;  2V3N A;  3HXC B;  1N9A B;  5ILJ A;  4GTR B;  3T33 A;  1F1S A;  4CJ1 A;  3E34 B;  3Q73 B;  4M76 A;  4FJQ A;  5IKH A;  4OJZ A;  1KSC A;  2V8K A;  4D94 A;  2FUT A;  3E6U A;  3VW5 A;  2B4F A;  3E32 B;  2P0V A;  2SQC A;  1N22 A;  3SDT A;  5GY3 A;  2B39 A;  3HXB B;  1KWF A;  1LD8 B;  2RI9 A;  5ILH A;  2XFG A;  5EAU A;  2D8L A;  1X1H A;  3QG0 A;  3ACT A;  1V5C A;  3Q7A B;  2VN4 A;  2H6H B;  1K72 A;  3TF4 A;  4MU9 A;  1F9D A;  1KRE A;  3QDE A;  1QBQ B;  1IA6 A;  5M7I A;  1GAI A;  1O5M B;  3GZK A;  3S4C A;  1NI1 B;  1EGU A;  1H3A A;  1D8D B;  5JPM B;  1S64 B;  1RWA A;  2H6I B;  1G9J A;  1N7O A;  5C05 A;  1UT9 A;  3C72 B;  3N0G A;  3ANI A;  3HXF B;  3SQC A;  3M74 A;  4LIX A;  2DRO A;  3N0F A;  4Z4L A;  2OKX A;  4WU0 A;  3HXE B;  1RW9 A;  1H37 A;  4ZH5 A;  3A0O A;  3A3V A;  1HXC A;  5M7Y A;  4J5T A;  4E1Y A;  4BOK A;  5CZL A;  1X1I A;  1O1T B;  4FUS A;  3E30 B;  4EL8 A;  3AFJ A;  1JCQ B;  3G4D A;  2XQW A;  3RX7 A;  3W7S A;  5IL3 A;  1FMI A;  1N7R A;  4OK4 A;  4FNV A;  3RSY A;  4GTT B;  2ONH A;  1CEM A;  2BRW A;  1O6H A;  1J0N A;  3WKI A;  1H3C A;  5IK0 A;  5CA3 A;  3DRA B;  4DI5 A;  5E2J A;  1H14 A;  4OZV A;  3W7T A;  1HV6 A;  4AYQ A;  3K7X A;  3Q7F B;  3W5N A;  2F0Y B; 
#chains in the Genus database with same CATH homology
 3E33 B;  1F9O A;  4AYO A;  1FO2 A;  1WU5 A;  3P2C A;  4LNG B;  1DCE B;  3W5M A;  2BED B;  1FP3 A;  2WY7 A;  3GLY A;  2A73 B;  3GT5 A;  3D5R A;  1V7V A;  1GXM A;  1TNU B;  1GA2 A;  1W6J A;  1GHQ A;  1GSZ A;  4Q2B A;  5CD2 A;  3Q78 B;  1N95 B;  2PMV A;  1H36 A;  1H12 A;  3PZ1 B;  1DL2 A;  3M71 A;  4ZRP A;  2G02 A;  3D5S A;  1GAH A;  1H39 A;  3W7X A;  4LNV A;  3G6J B;  4V1R A;  3M77 A;  2A8Z A;  2WY8 A;  3WIQ A;  1W6K A;  2QNO A;  1FBW A;  3DSV B;  3ON6 A;  3QSP A;  1D8E B;  3M7C A;  4TF4 A;  2H6G B;  1KZP B;  1QQF A;  1TN7 B;  2WII B;  2NVP A;  1FCE A;  3M78 A;  5MEH A;  1N4Q B;  3DPY B;  2G0D A;  2H6F B;  2JJB A;  5DGR A;  2V8J A;  3OED A;  3S4A A;  4GTO B;  1GLM A;  3PZ2 B;  2BB6 A;  2ZIS B;  3HXD B;  1XWT A;  3H3K A;  1IS9 A;  4DOE A;  1LTX B;  1AGM A;  1KSD A;  1V7X A;  3CU7 A;  1UG9 A;  1FPP B;  2WIN B;  1H35 A;  3RRS A;  1H54 A;  4LNB B;  4DOD A;  1R76 A;  4FXG B;  4KTP A;  1H13 A;  3P5P A;  4Z4J A;  4ONT A;  3D3I A;  3DSX B;  1S63 B;  4YDE B;  3X17 A;  4WVA A;  3PZ3 B;  2V3P A;  3E73 A;  2I07 B;  3CIH A;  3S9V A;  3P5R A;  1GXN A;  2NOJ A;  1KRF A;  3ANK A;  3M73 A;  3M72 A;  3KQ4 A;  1L2A A;  4QT9 A;  4EHM B;  3W7U A;  2BB5 A;  1LF9 A;  4Q88 A;  4GTS B;  4XUV A;  1FAE A;  1XW2 A;  1TF4 A;  2D5J A;  2EAE A;  4D4A A;  4L9P B;  1SQC A;  2DRS A;  3DST B;  3DSS B;  1JS4 A;  5FO9 B;  2FV0 A;  3PYB A;  4MBG B;  1VD5 A;  1TNY B;  2VN7 A;  3WIW A;  3M75 A;  1KKT A;  4TXT A;  1FBO A;  1MZC B;  3EU8 A;  3WIR A;  5GZK A;  2V8I A;  4L0G A;  2DRR A;  5AGD A;  1QSJ A;  2GH4 A;  5FOB B;  2YIK A;  3RX8 A;  1O79 A;  3KSQ B;  2RI8 A;  2FV1 A;  3ACS A;  2FUZ A;  3PYA A;  5FO7 B;  2GZ6 A;  3EZ8 A;  1HZF A;  1TNB B;  1WZZ A;  1FT1 B;  4GTV B;  5KKB A;  1DOG A;  1XWQ A;  4GTQ B;  3QT3 A;  4WVB A;  3QXF A;  1L1Y A;  4GL3 A;  3QFY A;  3RX5 A;  2XWB B;  2ZIR B;  4WVC A;  4FXK B;  2CQS A;  4AYP A;  1JCS B;  1X9D A;  4L6X A;  1UMP A;  3E37 B;  4KTR A;  4ZG8 A;  3Q75 B;  2XWJ B;  1O6R A;  2F6D A;  4YCR A;  1G87 A;  2EAB A;  5GW7 A;  3SAE A;  2R2L B;  1KZO B;  1AYX A;  2PN5 A;  3SFX B;  1KS8 A;  3RJ3 A;  1RQ5 A;  4V1S A;  2AFA A;  2CQT A;  4GTP B;  3SDV A;  4CJ0 A;  3WKF A;  5DGQ A;  3SDQ A;  2FBA A;  3QT9 A;  1SA5 B;  5FO8 B;  2EAD A;  3K11 A;  1WU6 A;  3QFZ A;  3WUX A;  2WYN A;  3DSW B;  3H7L A;  2ZZR A;  3EUV B;  1O1S B;  2IEJ B;  1N94 B;  2DRQ A;  1SA4 B;  3M7B A;  3DSU B;  3S4D A;  2AHG A;  3REN A;  3ANJ A;  1H3B A;  1N4S B;  1N4P B;  3M7E A;  3H2W A;  3QPF A;  1C3D A;  3EU5 B;  1NL4 B;  2BBC A;  1X81 B;  4D4C A;  2ZBL A;  4YDO B;  2JG0 A;  4BOJ A;  1FO3 A;  1TN8 B;  2JF4 A;  2EAC A;  1LD7 B;  1NXC A;  4KKI A;  1ULV A;  2GOX A;  3QRY A;  1JCR B;  4KKJ A;  3M76 A;  3W7W A;  1TN6 B;  3OXU A;  1TNZ B;  1FT2 B;  3M7L A;  4C1S A;  3S4B A;  3QXQ A;  3KSL B;  1O1R B;  1GXO A;  1N4R B;  3SFY B;  3VXD A;  4ZH1 A;  3WKG A;  1V5D A;  1CLC A;  3WC3 A;  1O6Q A;  3KLS A;  1IA7 A;  4AYR A;  4JJJ A;  3SDR A;  5JPN B;  1LF6 A;  1HCU A;  1KFG A;  4D4D A;  3SDU A;  1G6I A;  1V7W A;  1G9G A;  4GTM B;  2Z07 A;  3Q79 B;  3PZ4 B;  1NC5 A;  3EQA A;  1WU4 A;  4ZRQ A;  2AHF A;  2RGK A;  3WKH A;  3PMM A;  1TNO B;  4CE7 A;  4D4B A;  3QWT A;  2V3N A;  3HXC B;  1N9A B;  4GTR B;  3T33 A;  4CJ1 A;  3E34 B;  3Q73 B;  4M76 A;  1KSC A;  2V8K A;  4D94 A;  3E6U A;  3VW5 A;  2B4F A;  3E32 B;  2P0V A;  2SQC A;  3SDT A;  5GY3 A;  2B39 A;  3HXB B;  1KWF A;  1LD8 B;  2RI9 A;  2XFG A;  2D8L A;  3QG0 A;  3ACT A;  1V5C A;  3Q7A B;  2VN4 A;  2H6H B;  1K72 A;  3TF4 A;  4MU9 A;  1F9D A;  1KRE A;  3QDE A;  1QBQ B;  1IA6 A;  5M7I A;  1GAI A;  1O5M B;  3GZK A;  3S4C A;  1NI1 B;  1H3A A;  1D8D B;  5JPM B;  1S64 B;  1G9J A;  2H6I B;  1UT9 A;  3C72 B;  3ANI A;  3HXF B;  3SQC A;  3M74 A;  4LIX A;  2DRO A;  4Z4L A;  2OKX A;  4WU0 A;  3HXE B;  1H37 A;  4ZH5 A;  3A3V A;  5M7Y A;  4J5T A;  4BOK A;  5CZL A;  1O1T B;  4FUS A;  3E30 B;  4EL8 A;  3AFJ A;  1JCQ B;  2XQW A;  3RX7 A;  3W7S A;  1FMI A;  3RSY A;  4GTT B;  1CEM A;  1O6H A;  3WKI A;  1H3C A;  5CA3 A;  3DRA B;  5E2J A;  1H14 A;  3W7T A;  4AYQ A;  3K7X A;  3Q7F B;  3W5N A;  2F0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...