2DROA

Crystal structure of reducing-end-xylose releasing exo-oligoxylanase d263c mutant
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
376
structure length
376
Chain Sequence
EGAFYTREYRNLFKEFGYSEAEIQERVKDTWEQLFGDNPETKIYYEVGDDLGYLLDTGNLDVRTEGMSYGMMMAVQMDRKDIFDRIWNWTMKNMYMTEGVHAGYFAWSCQPDGTKNSWGPAPDGEEYFALALFFASHRWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGHFFSCSYRVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDGPYAKANVDLFWNTPVRTGNRRYYDNCLYLFAMLALSGNFKIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase Y
publication title Structural explanation for the acquisition of glycosynthase activity
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 150
structure length 376
sequence length 376
ec nomenclature ec 3.2.1.156: Oligosaccharide reducing-end xylanase.
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2droA01
1FAEA 3S4BA 1DOGA 5GW7A 1G87A 5CD2A 2FV1A 1FCEA 1RQ5A 2WYNA 3K11A 4AYPA 3GT5A 4CJ0A 2FUZA 3PMMA 4WVAA 1LF9A 4Q2BA 3T33A 1KRFA 2Z07A 4TF4A 3H7LA 3D3IA 4WVCA 1GA2A 2AHGA 2DRRA 1V5CA 1UG9A 5DGQA 1H12A 1WU5A 1KREA 3QSPA 3QXFA 3QT3A 2JJBA 3W7SA 1GAHA 5E2JA 5GY3A 2RI8A 2VN4A 4ZG8A 1KSDA 3W7XA 2D8LA 1H14A 1L1YA 3WIQA 3EQAA 1AGMA 1KWFA 3W7WA 2F6DA 3WKIA 2DROA 3QFZA 2CQTA 1KSCA 3S4CA 3AFJA 3ACSA 1G9JA 1KKTA 1JS4A 2ZBLA 1WU6A 1V7XA 1HCUA 3H3KA 1TF4A 4AYRA 1CLCA 4AYQA 3GZKA 1NXCA 3ANIA 3ANJA 1WZZA 1XWTA 2EABA 3A3VA 3S4AA 1X9DA 2D5JA 4WU0A 5M7YA 1L2AA 3WUXA 3ON6A 4JJJA 3WKGA 3W5NA 1FP3A 3WKFA 2DRQA 3EZ8A 1AYXA 3TF4A 1ULVA 1LF6A 4L0GA 3RRSA 5DGRA 3H2WA 1V7VA 3WKHA 3RX8A 1UT9A 2GZ6A 1KS8A 2RI9A 2EADA 3CIHA 2JG0A 5CZLA 2RGKA 1IA7A 1XWQA 4ZH5A 2ZZRA 3W5MA 1FO3A 3WIWA 1FMIA 3P2CA 1XW2A 2B4FA 1DL2A 2GH4A 3QDEA 1IA6A 2NVPA 3RX5A 4WVBA 2OKXA 3VW5A 3WIRA 2XFGA 5KKBA 2JF4A 4J5TA 2VN7A 3ANKA 3RX7A 5MEHA 2AHFA 2FV0A 4CJ1A 3QPFA 3ACTA 3X17A 4Q88A 3QG0A 1F9DA 3GLYA 4KTPA 4FUSA 1V7WA 1GAIA 1G9GA 3S4DA 1FO2A 3QFYA 5CA3A 3RENA 4CE7A 3QXQA 1IS9A 1FBWA 1H54A 1KFGA 2AFAA 4KTRA 4Z4JA 4Z4LA 1NC5A 1WU4A 3E6UA 4XUVA 1F9OA 4AYOA 1VD5A 2FBAA 2EACA 2CQSA 5M7IA 4EL8A 1V5DA 1K72A 4L6XA 2P0VA 1GLMA 2QNOA 1FBOA 1G6IA 3QT9A 3QWTA 4TXTA 1CEMA 4DOEA 3W7TA 2A8ZA 3VXDA 2YIKA 4DODA 3E73A 1H13A 3QRYA 3WC3A 2EAEA 3W7UA 2DRSA 3RSYA
chains in the Genus database with same CATH superfamily
1DOGA 5GW7A 4LIXA 2BB6A 2FV1A 3M7BA 2ONHA 1X81B 1N1BA 4CJ0A 3PMMA 4D4DA 1HMWA 1KRFA 3Q78B 5JMFA 1GA2A 3NFVA 1S64B 3QSPA 3QXFA 2JJBA 3N0FA 2R2LB 5E2JA 5GY3A 4OZVA 1RWFA 2FUTA 3W7XA 2D8LA 1H14A 1JCQB 3A0OA 4OK4A 1OJMA 2F6DA 5ILDA 3M71A 1O6QA 1HX9A 1TNUB 3ACSA 3M7LA 4FJQA 1N1ZA 1KKTA 3PZ2B 3D5SA 3H3KA 1HV6A 2V3PA 3M7CA 4AYRA 4V1SA 3DSTB 1FPPB 3S4AA 1N95B 4D4CA 1I8QA 4MBGB 1ULVA 4L0GA 3EU8A 5DGRA 2SQCA 1V7VA 3M72A 3WKHA 1UT9A 2GZ6A 5FO7B 2EADA 2JG0A 1SA4B 5FO9B 1O1SB 1GXOA 5FOBB 3M02A 3G4FA 1FMIA 3P2CA 1OJNA 3SDRA 4EHMB 2NVPA 2ZISB 1O5MB 5IL8A 2FV0A 1N4PB 4CJ1A 5AGDA 4D4BA 1N9AB 3HXCB 4Q88A 1LTXB 1HM2A 1N23A 1DCEB 3GLYA 4KTPA 4CE7A 3QXQA 2B39A 1IS9A 1FBWA 1LD8B 1N7RA 3Q75B 2ZIRB 2WDAA 4KKJA 2CQSA 3SDVA 4EL8A 5M7IA 5JPMB 1K72A 5FO8B 3G6JB 2P0VA 2QNOA 1FBOA 3QT9A 4DOEA 4TXTA 3W7TA 2A8ZA 1J0MA 1X1IA 3DSWB 3SDUA 4GTVB 5DHIA 1HXCA 2V8JA 3WC3A 1LOHA 2DRSA 5ILJA 1FAEA 3S4BA 3G4DA 1G87A 5CD2A 1O79A 3E32B 2WYNA 1JCSB 4GAXA 3M00A 4AYPA 1H39A 3E7JA 1LF9A 2Z07A 5EASA 2AHGA 5ILZA 1H3AA 1V5CA 1WU5A 1KREA 1C3DA 3QT3A 3W7SA 3DSXB 2IEJB 2VN4A 1O1TB 4YDOB 1KSDA 1R76A 3Q79B 3EUVB 1F1SA 3EQAA 1EGUA 1KWFA 3W7WA 1W6KA 2CQTA 1HMUA 3PZ1B 4OK2A 1LD7B 5C05A 1HCUA 4AYQA 1HZFA 3LZ9A 3ANJA 3N0GA 1FT2B 3NNBA 3SDTA 1MZCB 1X9DA 5IL3A 3WUXA 3ON6A 4BOJA 2FUQA 3WKGA 3M01A 1RW9A 1LF6A 3H2WA 3M74A 4NEIA 3KSLB 4ZRPA 2Q1FA 1KS8A 4FXGB 2H6GB 4OJZA 3C72B 1SA5B 3CIHA 3M77A 4ZH5A 1QBQB 1FO3A 2B4FA 3E80A 2GH4A 3QDEA 3PYAA 3OXUA 1OJPA 2XFGA 3RJ3A 1N24A 4C1SA 5KKBA 3ANKA 1JCRB 4D4AA 3X17A 4GTRB 4FUSA 1V7WA 1FO2A 1RWCA 1N21A 5IK0A 4Z4JA 1H54A 1KFGA 1RWGA 1N7NA 4KKIA 5JMDA 4D94A 2WY8A 1VD5A 3SAEA 1S63B 3S9VA 1NI1B 1GLMA 1KZPB 1G6IA 3QWTA 3E37B 4E1YA 2YIKA 3E73A 1N4RB 4YCRA 5IK9A 3QRYA 2WIIB 4F13A 2EAEA 3W7UA 1TNYB 4GTSB 3RSYA 3M78A 1HN0A 2V8KA 3P5RA 1N4QB 1FCEA 1RQ5A 5DHKA 3SQCA 3K11A 3M7EA 3SFXB 1LXMA 5ILHA 4Q2BA 3T33A 4TF4A 4GTOB 3H7LA 3D3IA 4WVCA 3VSMA 1TNBB 5DGQA 1H12A 4L9PB 2BRVX 1FT1B 3D5RA 3KQ4A 1TN8B 1GAHA 1H37A 3AFLA 2RI8A 4ZG8A 4YDEB 5GZKA 1L1YA 2BBCA 2A73B 1AGMA 4LNBB 2DROA 1KSCA 3AFJA 1NL4B 2ZBLA 2F0YB 1V7XA 1TF4A 4GTMB 1C82A 1NXCA 1OJOA 1XWTA 2EABA 3A3VA 5IKHA 3E34B 2E24A 1N94B 4WU0A 1RWHA 2GOXA 1GXNA 3M73A 4JJJA 1D8EB 1H3CA 3WKFA 2DRQA 1D8DB 3TF4A 4M76A 3E33B 4ZH1A 3KLSA 3M76A 1J0NA 2WINB 1HM3A 3RX8A 5JPNB 1CB8A 3CU7A 1N4SB 3DRAB 1UMPA 3HXBB 2ZZRA 3EU5B 2XQWA 3W5MA 3WIWA 1XW2A 1DL2A 1HXGA 3OEDA 1IA6A 3RX5A 2PN5A 2WY7A 4WVBA 3VW5A 3WIRA 2JF4A 4J5TA 1N20A 1QQFA 5MEHA 2AHFA 1QAZA 3ACTA 4RNQA 3PZ4B 1F9DA 4DI5A 1GAIA 1G9GA 4GTQB 5CA3A 1GSZA 2AFAA 4KTRA 3Q73B 3SFYB 1NC5A 3E6UA 3P5PA 4AYOA 2FBAA 4GL3A 1V5DA 2OKXA 4L6XA 3W5NA 2H6HB 4MMHA 4V1RA 4OZWA 1SQCA 1H13A 2I07B 3DPYB 2V8IA 1W6JA 1N7PA 1W3YA 4GTTB 4ONTA 3DSSB 2XWJB 2J5CA 4LNGB 1GHQA 3GT5A 1X1JA 2FUZA 5IK6A 4WVAA 2DRRA 2BRWA 4ZRQA 1UG9A 1TNZB 2BRPA 3VSNA 1TNOB 4MMIA 3E30B 3Q7FB 3KSQB 3WIQA 5ILKA 1H36A 3WKIA 1QSJA 3QFZA 3S4CA 3HXFB 1G9JA 1H35A 5IKAA 1JS4A 1WU6A 3PYBA 4MU9A 1KZOB 1CLCA 3GZKA 3HXDB 3ANIA 5ILYA 1WZZA 1N22A 3DSUB 1HXAA 4BOKA 2H6IB 3M75A 2D5JA 5M7YA 1L2AA 4QT9A 1N7QA 1RWAA 1FP3A 2NOJA 3EZ8A 1AYXA 3RRSA 3Q7AB 1O1RB 1N7OA 3K7XA 1X1HA 1TN7B 2RI9A 2H6FB 5CZLA 3SDQA 2RGKA 5ILIA 1IA7A 1XWQA 1O6RA 3DSVB 2G02A 3RX7A 2VN7A 5EATA 3QPFA 5IM1A 3QG0A 1GXMA 2XWBB 4F10A 2G0DA 2V3NA 3S4DA 1TN6B 3QFYA 2BEDB 3RENA 4FXKB 1F9GA 4Z4LA 2ONGA 1WU4A 2PMVA 4XUVA 1F9OA 2E22A 4LNVA 4GTPB 2X03A 5EAUA 2EACA 3HXEB 4FNVA 2BB5A 1LXKA 1CEMA 3PZ3B 2WCOA 3VXDA 4DODA 1O6HA 1H3BA
chains in the Genus database with same CATH topology
1DOGA 5GW7A 4LIXA 2BB6A 2FV1A 3M7BA 1H3BA 1X81B 4CJ0A 3PMMA 4D4DA 1KRFA 3Q78B 1GA2A 1S64B 3QSPA 3QXFA 2JJBA 2R2LB 5E2JA 5GY3A 3W7XA 2D8LA 1H14A 1JCQB 2F6DA 3M71A 1O6QA 1TNUB 3ACSA 3M7LA 1KKTA 3PZ2B 3D5SA 3H3KA 2V3PA 3M7CA 4AYRA 4V1SA 3DSTB 1FPPB 3S4AA 1N95B 4D4CA 4MBGB 1ULVA 4L0GA 3EU8A 5DGRA 2SQCA 1V7VA 3M72A 3WKHA 1UT9A 2GZ6A 5FO7B 2EADA 2JG0A 1SA4B 5FO9B 1O1SB 1GXOA 5FOBB 1FMIA 3P2CA 3SDRA 4EHMB 2NVPA 2ZISB 1O5MB 2FV0A 1N4PB 4CJ1A 5AGDA 4D4BA 1N9AB 3HXCB 4Q88A 1LTXB 1DCEB 3GLYA 4KTPA 4CE7A 3QXQA 1IS9A 1FBWA 1LD8B 2B39A 3Q75B 2ZIRB 4KKJA 2CQSA 3SDVA 4EL8A 5M7IA 5JPMB 1K72A 5FO8B 3G6JB 2P0VA 2QNOA 1FBOA 3QT9A 4DOEA 4TXTA 3W7TA 2A8ZA 3DSWB 3SDUA 4GTVB 2V8JA 3WC3A 2DRSA 1FAEA 3S4BA 1G87A 5CD2A 1O79A 3E32B 2WYNA 1JCSB 4AYPA 1H39A 1LF9A 2Z07A 2AHGA 1H3AA 1V5CA 1WU5A 1KREA 1C3DA 3QT3A 3W7SA 3DSXB 2IEJB 2VN4A 1O1TB 4YDOB 1KSDA 1R76A 3Q79B 3EUVB 3EQAA 1KWFA 3W7WA 1W6KA 2CQTA 3PZ1B 1LD7B 1HCUA 4AYQA 1HZFA 3ANJA 1FT2B 3SDTA 1MZCB 1X9DA 3WUXA 3ON6A 4BOJA 3WKGA 1LF6A 3H2WA 3M74A 3KSLB 4ZRPA 1KS8A 4FXGB 2H6GB 3C72B 1SA5B 3CIHA 3M77A 4ZH5A 1QBQB 1FO3A 2B4FA 3QDEA 2GH4A 3PYAA 3OXUA 2XFGA 4C1SA 3RJ3A 5KKBA 3ANKA 1JCRB 4D4AA 3X17A 4GTRB 4FUSA 1V7WA 1FO2A 4Z4JA 1H54A 1KFGA 4KKIA 4D94A 2WY8A 1VD5A 3SAEA 1S63B 3S9VA 1NI1B 1GLMA 3QWTA 1G6IA 1KZPB 3E37B 2YIKA 3E73A 1N4RB 4YCRA 3QRYA 2WIIB 2EAEA 3W7UA 1TNYB 4GTSB 3RSYA 3M78A 3P5RA 2V8KA 1N4QB 1FCEA 1RQ5A 3SQCA 3K11A 3M7EA 3SFXB 4Q2BA 3T33A 4TF4A 4GTOB 3H7LA 3D3IA 4WVCA 1TNBB 5DGQA 1H12A 4L9PB 1FT1B 3D5RA 3KQ4A 1TN8B 1GAHA 1H37A 2RI8A 4ZG8A 4YDEB 5GZKA 1L1YA 2BBCA 2A73B 1AGMA 4LNBB 2DROA 1KSCA 3AFJA 1NL4B 2ZBLA 2F0YB 1V7XA 1TF4A 4GTMB 1NXCA 1XWTA 2EABA 3A3VA 3E34B 1N94B 4WU0A 2GOXA 1GXNA 3M73A 4JJJA 1D8EB 1H3CA 3WKFA 2DRQA 1D8DB 3TF4A 4M76A 3E33B 4ZH1A 3KLSA 3M76A 2WINB 3RX8A 5JPNB 3CU7A 1N4SB 3DRAB 1UMPA 3HXBB 2ZZRA 3EU5B 2XQWA 3W5MA 3WIWA 1XW2A 1DL2A 1IA6A 3RX5A 2PN5A 2WY7A 4WVBA 3VW5A 3WIRA 2JF4A 4J5TA 1QQFA 5MEHA 2AHFA 3ACTA 3PZ4B 1F9DA 1GAIA 1G9GA 4GTQB 5CA3A 1GSZA 2AFAA 4KTRA 3Q73B 3SFYB 1NC5A 3E6UA 3P5PA 4AYOA 2FBAA 4GL3A 1V5DA 2OKXA 4L6XA 3W5NA 2H6HB 4V1RA 1SQCA 1H13A 2I07B 3DPYB 2V8IA 1W6JA 4GTTB 4ONTA 3DSSB 2XWJB 4LNGB 1GHQA 3GT5A 2FUZA 4WVAA 2DRRA 4ZRQA 1UG9A 1TNZB 1TNOB 3E30B 3Q7FB 3KSQB 3WIQA 1H36A 3WKIA 1QSJA 3QFZA 3S4CA 3HXFB 1G9JA 1H35A 1JS4A 1WU6A 3PYBA 4MU9A 1KZOB 1CLCA 3GZKA 3HXDB 3ANIA 1WZZA 3DSUB 4BOKA 2H6IB 3M75A 2D5JA 5M7YA 1L2AA 4QT9A 1FP3A 2NOJA 3EZ8A 1AYXA 3RRSA 3Q7AB 1O1RB 3K7XA 2RI9A 1TN7B 2H6FB 5CZLA 3SDQA 2RGKA 1IA7A 1XWQA 1O6RA 3DSVB 2G02A 3RX7A 2VN7A 3QPFA 3QG0A 1GXMA 2XWBB 2G0DA 2V3NA 3S4DA 1TN6B 3QFYA 2BEDB 3RENA 4FXKB 4Z4LA 1WU4A 2PMVA 4XUVA 1F9OA 4LNVA 4GTPB 2EACA 3HXEB 2BB5A 1CEMA 3PZ3B 3VXDA 4DODA 1O6HA 3OEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAE A;  3S4B A;  1DOG A;  5GW7 A;  1G87 A;  5CD2 A;  2FV1 A;  1FCE A;  1RQ5 A;  2WYN A;  3K11 A;  4AYP A;  3GT5 A;  4CJ0 A;  2FUZ A;  3PMM A;  4WVA A;  1LF9 A;  4Q2B A;  3T33 A;  1KRF A;  2Z07 A;  4TF4 A;  3H7L A;  3D3I A;  4WVC A;  1GA2 A;  2AHG A;  2DRR A;  1V5C A;  1UG9 A;  5DGQ A;  1H12 A;  1WU5 A;  1KRE A;  3QSP A;  3QXF A;  3QT3 A;  2JJB A;  3W7S A;  1GAH A;  5E2J A;  5GY3 A;  2RI8 A;  2VN4 A;  4ZG8 A;  1KSD A;  3W7X A;  2D8L A;  1H14 A;  1L1Y A;  3WIQ A;  3EQA A;  1AGM A;  1KWF A;  3W7W A;  2F6D A;  3WKI A;  2DRO A;  3QFZ A;  2CQT A;  1KSC A;  3S4C A;  3AFJ A;  3ACS A;  1G9J A;  1KKT A;  1JS4 A;  2ZBL A;  1WU6 A;  1V7X A;  1HCU A;  3H3K A;  1TF4 A;  4AYR A;  1CLC A;  4AYQ A;  3GZK A;  1NXC A;  3ANI A;  3ANJ A;  1WZZ A;  1XWT A;  2EAB A;  3A3V A;  3S4A A;  1X9D A;  2D5J A;  4WU0 A;  5M7Y A;  1L2A A;  3WUX A;  3ON6 A;  4JJJ A;  3WKG A;  3W5N A;  1FP3 A;  3WKF A;  2DRQ A;  3EZ8 A;  1AYX A;  3TF4 A;  1ULV A;  1LF6 A;  4L0G A;  3RRS A;  5DGR A;  3H2W A;  1V7V A;  3WKH A;  3RX8 A;  1UT9 A;  2GZ6 A;  1KS8 A;  2RI9 A;  2EAD A;  3CIH A;  2JG0 A;  5CZL A;  2RGK A;  1IA7 A;  1XWQ A;  4ZH5 A;  2ZZR A;  3W5M A;  1FO3 A;  3WIW A;  1FMI A;  3P2C A;  1XW2 A;  2B4F A;  1DL2 A;  2GH4 A;  3QDE A;  1IA6 A;  2NVP A;  3RX5 A;  4WVB A;  2OKX A;  3VW5 A;  3WIR A;  2XFG A;  5KKB A;  2JF4 A;  4J5T A;  2VN7 A;  3ANK A;  3RX7 A;  5MEH A;  2AHF A;  2FV0 A;  4CJ1 A;  3QPF A;  3ACT A;  3X17 A;  4Q88 A;  3QG0 A;  1F9D A;  3GLY A;  4KTP A;  4FUS A;  1V7W A;  1GAI A;  1G9G A;  3S4D A;  1FO2 A;  3QFY A;  5CA3 A;  3REN A;  4CE7 A;  3QXQ A;  1IS9 A;  1FBW A;  1H54 A;  1KFG A;  2AFA A;  4KTR A;  4Z4J A;  4Z4L A;  1NC5 A;  1WU4 A;  3E6U A;  4XUV A;  1F9O A;  4AYO A;  1VD5 A;  2FBA A;  2EAC A;  2CQS A;  5M7I A;  4EL8 A;  1V5D A;  1K72 A;  4L6X A;  2P0V A;  1GLM A;  2QNO A;  1FBO A;  1G6I A;  3QT9 A;  3QWT A;  4TXT A;  1CEM A;  4DOE A;  3W7T A;  2A8Z A;  3VXD A;  2YIK A;  4DOD A;  3E73 A;  1H13 A;  3QRY A;  3WC3 A;  2EAE A;  3W7U A;  2DRS A;  3RSY A; 
#chains in the Genus database with same CATH topology
 1DOG A;  5GW7 A;  4LIX A;  2BB6 A;  2FV1 A;  3M7B A;  2ONH A;  1X81 B;  1N1B A;  4CJ0 A;  3PMM A;  4D4D A;  1HMW A;  1KRF A;  3Q78 B;  5JMF A;  1GA2 A;  3NFV A;  1S64 B;  3QSP A;  3QXF A;  2JJB A;  3N0F A;  2R2L B;  5E2J A;  5GY3 A;  4OZV A;  1RWF A;  2FUT A;  3W7X A;  2D8L A;  1H14 A;  1JCQ B;  3A0O A;  4OK4 A;  1OJM A;  2F6D A;  5ILD A;  3M71 A;  1O6Q A;  1HX9 A;  1TNU B;  3ACS A;  3M7L A;  4FJQ A;  1N1Z A;  1KKT A;  3PZ2 B;  3D5S A;  3H3K A;  1HV6 A;  2V3P A;  3M7C A;  4AYR A;  4V1S A;  3DST B;  1FPP B;  3S4A A;  1N95 B;  4D4C A;  1I8Q A;  4MBG B;  1ULV A;  4L0G A;  3EU8 A;  5DGR A;  2SQC A;  1V7V A;  3M72 A;  3WKH A;  1UT9 A;  2GZ6 A;  5FO7 B;  2EAD A;  2JG0 A;  1SA4 B;  5FO9 B;  1O1S B;  1GXO A;  5FOB B;  3M02 A;  3G4F A;  1FMI A;  3P2C A;  1OJN A;  3SDR A;  4EHM B;  2NVP A;  2ZIS B;  1O5M B;  5IL8 A;  2FV0 A;  1N4P B;  4CJ1 A;  5AGD A;  4D4B A;  1N9A B;  3HXC B;  4Q88 A;  1LTX B;  1HM2 A;  1N23 A;  1DCE B;  3GLY A;  4KTP A;  4CE7 A;  3QXQ A;  2B39 A;  1IS9 A;  1FBW A;  1LD8 B;  1N7R A;  3Q75 B;  2ZIR B;  2WDA A;  4KKJ A;  2CQS A;  3SDV A;  4EL8 A;  5M7I A;  5JPM B;  1K72 A;  5FO8 B;  3G6J B;  2P0V A;  2QNO A;  1FBO A;  3QT9 A;  4DOE A;  4TXT A;  3W7T A;  2A8Z A;  1J0M A;  1X1I A;  3DSW B;  3SDU A;  4GTV B;  5DHI A;  1HXC A;  2V8J A;  3WC3 A;  1LOH A;  2DRS A;  5ILJ A;  1FAE A;  3S4B A;  3G4D A;  1G87 A;  5CD2 A;  1O79 A;  3E32 B;  2WYN A;  1JCS B;  4GAX A;  3M00 A;  4AYP A;  1H39 A;  3E7J A;  1LF9 A;  2Z07 A;  5EAS A;  2AHG A;  5ILZ A;  1H3A A;  1V5C A;  1WU5 A;  1KRE A;  1C3D A;  3QT3 A;  3W7S A;  3DSX B;  2IEJ B;  2VN4 A;  1O1T B;  4YDO B;  1KSD A;  1R76 A;  3Q79 B;  3EUV B;  1F1S A;  3EQA A;  1EGU A;  1KWF A;  3W7W A;  1W6K A;  2CQT A;  1HMU A;  3PZ1 B;  4OK2 A;  1LD7 B;  5C05 A;  1HCU A;  4AYQ A;  1HZF A;  3LZ9 A;  3ANJ A;  3N0G A;  1FT2 B;  3NNB A;  3SDT A;  1MZC B;  1X9D A;  5IL3 A;  3WUX A;  3ON6 A;  4BOJ A;  2FUQ A;  3WKG A;  3M01 A;  1RW9 A;  1LF6 A;  3H2W A;  3M74 A;  4NEI A;  3KSL B;  4ZRP A;  2Q1F A;  1KS8 A;  4FXG B;  2H6G B;  4OJZ A;  3C72 B;  1SA5 B;  3CIH A;  3M77 A;  4ZH5 A;  1QBQ B;  1FO3 A;  2B4F A;  3E80 A;  2GH4 A;  3QDE A;  3PYA A;  3OXU A;  1OJP A;  2XFG A;  3RJ3 A;  1N24 A;  4C1S A;  5KKB A;  3ANK A;  1JCR B;  4D4A A;  3X17 A;  4GTR B;  4FUS A;  1V7W A;  1FO2 A;  1RWC A;  1N21 A;  5IK0 A;  4Z4J A;  1H54 A;  1KFG A;  1RWG A;  1N7N A;  4KKI A;  5JMD A;  4D94 A;  2WY8 A;  1VD5 A;  3SAE A;  1S63 B;  3S9V A;  1NI1 B;  1GLM A;  1KZP B;  1G6I A;  3QWT A;  3E37 B;  4E1Y A;  2YIK A;  3E73 A;  1N4R B;  4YCR A;  5IK9 A;  3QRY A;  2WII B;  4F13 A;  2EAE A;  3W7U A;  1TNY B;  4GTS B;  3RSY A;  3M78 A;  1HN0 A;  2V8K A;  3P5R A;  1N4Q B;  1FCE A;  1RQ5 A;  5DHK A;  3SQC A;  3K11 A;  3M7E A;  3SFX B;  1LXM A;  5ILH A;  4Q2B A;  3T33 A;  4TF4 A;  4GTO B;  3H7L A;  3D3I A;  4WVC A;  3VSM A;  1TNB B;  5DGQ A;  1H12 A;  4L9P B;  2BRV X;  1FT1 B;  3D5R A;  3KQ4 A;  1TN8 B;  1GAH A;  1H37 A;  3AFL A;  2RI8 A;  4ZG8 A;  4YDE B;  5GZK A;  1L1Y A;  2BBC A;  2A73 B;  1AGM A;  4LNB B;  2DRO A;  1KSC A;  3AFJ A;  1NL4 B;  2ZBL A;  2F0Y B;  1V7X A;  1TF4 A;  4GTM B;  1C82 A;  1NXC A;  1OJO A;  1XWT A;  2EAB A;  3A3V A;  5IKH A;  3E34 B;  2E24 A;  1N94 B;  4WU0 A;  1RWH A;  2GOX A;  1GXN A;  3M73 A;  4JJJ A;  1D8E B;  1H3C A;  3WKF A;  2DRQ A;  1D8D B;  3TF4 A;  4M76 A;  3E33 B;  4ZH1 A;  3KLS A;  3M76 A;  1J0N A;  2WIN B;  1HM3 A;  3RX8 A;  5JPN B;  1CB8 A;  3CU7 A;  1N4S B;  3DRA B;  1UMP A;  3HXB B;  2ZZR A;  3EU5 B;  2XQW A;  3W5M A;  3WIW A;  1XW2 A;  1DL2 A;  1HXG A;  3OED A;  1IA6 A;  3RX5 A;  2PN5 A;  2WY7 A;  4WVB A;  3VW5 A;  3WIR A;  2JF4 A;  4J5T A;  1N20 A;  1QQF A;  5MEH A;  2AHF A;  1QAZ A;  3ACT A;  4RNQ A;  3PZ4 B;  1F9D A;  4DI5 A;  1GAI A;  1G9G A;  4GTQ B;  5CA3 A;  1GSZ A;  2AFA A;  4KTR A;  3Q73 B;  3SFY B;  1NC5 A;  3E6U A;  3P5P A;  4AYO A;  2FBA A;  4GL3 A;  1V5D A;  2OKX A;  4L6X A;  3W5N A;  2H6H B;  4MMH A;  4V1R A;  4OZW A;  1SQC A;  1H13 A;  2I07 B;  3DPY B;  2V8I A;  1W6J A;  1N7P A;  1W3Y A;  4GTT B;  4ONT A;  3DSS B;  2XWJ B;  2J5C A;  4LNG B;  1GHQ A;  3GT5 A;  1X1J A;  2FUZ A;  5IK6 A;  4WVA A;  2DRR A;  2BRW A;  4ZRQ A;  1UG9 A;  1TNZ B;  2BRP A;  3VSN A;  1TNO B;  4MMI A;  3E30 B;  3Q7F B;  3KSQ B;  3WIQ A;  5ILK A;  1H36 A;  3WKI A;  1QSJ A;  3QFZ A;  3S4C A;  3HXF B;  1G9J A;  1H35 A;  5IKA A;  1JS4 A;  1WU6 A;  3PYB A;  4MU9 A;  1KZO B;  1CLC A;  3GZK A;  3HXD B;  3ANI A;  5ILY A;  1WZZ A;  1N22 A;  3DSU B;  1HXA A;  4BOK A;  2H6I B;  3M75 A;  2D5J A;  5M7Y A;  1L2A A;  4QT9 A;  1N7Q A;  1RWA A;  1FP3 A;  2NOJ A;  3EZ8 A;  1AYX A;  3RRS A;  3Q7A B;  1O1R B;  1N7O A;  3K7X A;  1X1H A;  1TN7 B;  2RI9 A;  2H6F B;  5CZL A;  3SDQ A;  2RGK A;  5ILI A;  1IA7 A;  1XWQ A;  1O6R A;  3DSV B;  2G02 A;  3RX7 A;  2VN7 A;  5EAT A;  3QPF A;  5IM1 A;  3QG0 A;  1GXM A;  2XWB B;  4F10 A;  2G0D A;  2V3N A;  3S4D A;  1TN6 B;  3QFY A;  2BED B;  3REN A;  4FXK B;  1F9G A;  4Z4L A;  2ONG A;  1WU4 A;  2PMV A;  4XUV A;  1F9O A;  2E22 A;  4LNV A;  4GTP B;  2X03 A;  5EAU A;  2EAC A;  3HXE B;  4FNV A;  2BB5 A;  1LXK A;  1CEM A;  3PZ3 B;  2WCO A;  3VXD A;  4DOD A;  1O6H A;  1H3B A; 
#chains in the Genus database with same CATH homology
 1DOG A;  5GW7 A;  4LIX A;  2BB6 A;  2FV1 A;  3M7B A;  1H3B A;  1X81 B;  4CJ0 A;  3PMM A;  4D4D A;  1KRF A;  3Q78 B;  1GA2 A;  1S64 B;  3QSP A;  3QXF A;  2JJB A;  2R2L B;  5E2J A;  5GY3 A;  3W7X A;  2D8L A;  1H14 A;  1JCQ B;  2F6D A;  3M71 A;  1O6Q A;  1TNU B;  3ACS A;  3M7L A;  1KKT A;  3PZ2 B;  3D5S A;  3H3K A;  2V3P A;  3M7C A;  4AYR A;  4V1S A;  3DST B;  1FPP B;  3S4A A;  1N95 B;  4D4C A;  4MBG B;  1ULV A;  4L0G A;  3EU8 A;  5DGR A;  2SQC A;  1V7V A;  3M72 A;  3WKH A;  1UT9 A;  2GZ6 A;  5FO7 B;  2EAD A;  2JG0 A;  1SA4 B;  5FO9 B;  1O1S B;  1GXO A;  5FOB B;  1FMI A;  3P2C A;  3SDR A;  4EHM B;  2NVP A;  2ZIS B;  1O5M B;  2FV0 A;  1N4P B;  4CJ1 A;  5AGD A;  4D4B A;  1N9A B;  3HXC B;  4Q88 A;  1LTX B;  1DCE B;  3GLY A;  4KTP A;  4CE7 A;  3QXQ A;  1IS9 A;  1FBW A;  1LD8 B;  2B39 A;  3Q75 B;  2ZIR B;  4KKJ A;  2CQS A;  3SDV A;  4EL8 A;  5M7I A;  5JPM B;  1K72 A;  5FO8 B;  3G6J B;  2P0V A;  2QNO A;  1FBO A;  3QT9 A;  4DOE A;  4TXT A;  3W7T A;  2A8Z A;  3DSW B;  3SDU A;  4GTV B;  2V8J A;  3WC3 A;  2DRS A;  1FAE A;  3S4B A;  1G87 A;  5CD2 A;  1O79 A;  3E32 B;  2WYN A;  1JCS B;  4AYP A;  1H39 A;  1LF9 A;  2Z07 A;  2AHG A;  1H3A A;  1V5C A;  1WU5 A;  1KRE A;  1C3D A;  3QT3 A;  3W7S A;  3DSX B;  2IEJ B;  2VN4 A;  1O1T B;  4YDO B;  1KSD A;  1R76 A;  3Q79 B;  3EUV B;  3EQA A;  1KWF A;  3W7W A;  1W6K A;  2CQT A;  3PZ1 B;  1LD7 B;  1HCU A;  4AYQ A;  1HZF A;  3ANJ A;  1FT2 B;  3SDT A;  1MZC B;  1X9D A;  3WUX A;  3ON6 A;  4BOJ A;  3WKG A;  1LF6 A;  3H2W A;  3M74 A;  3KSL B;  4ZRP A;  1KS8 A;  4FXG B;  2H6G B;  3C72 B;  1SA5 B;  3CIH A;  3M77 A;  4ZH5 A;  1QBQ B;  1FO3 A;  2B4F A;  3QDE A;  2GH4 A;  3PYA A;  3OXU A;  2XFG A;  4C1S A;  3RJ3 A;  5KKB A;  3ANK A;  1JCR B;  4D4A A;  3X17 A;  4GTR B;  4FUS A;  1V7W A;  1FO2 A;  4Z4J A;  1H54 A;  1KFG A;  4KKI A;  4D94 A;  2WY8 A;  1VD5 A;  3SAE A;  1S63 B;  3S9V A;  1NI1 B;  1GLM A;  3QWT A;  1G6I A;  1KZP B;  3E37 B;  2YIK A;  3E73 A;  1N4R B;  4YCR A;  3QRY A;  2WII B;  2EAE A;  3W7U A;  1TNY B;  4GTS B;  3RSY A;  3M78 A;  3P5R A;  2V8K A;  1N4Q B;  1FCE A;  1RQ5 A;  3SQC A;  3K11 A;  3M7E A;  3SFX B;  4Q2B A;  3T33 A;  4TF4 A;  4GTO B;  3H7L A;  3D3I A;  4WVC A;  1TNB B;  5DGQ A;  1H12 A;  4L9P B;  1FT1 B;  3D5R A;  3KQ4 A;  1TN8 B;  1GAH A;  1H37 A;  2RI8 A;  4ZG8 A;  4YDE B;  5GZK A;  1L1Y A;  2BBC A;  2A73 B;  1AGM A;  4LNB B;  2DRO A;  1KSC A;  3AFJ A;  1NL4 B;  2ZBL A;  2F0Y B;  1V7X A;  1TF4 A;  4GTM B;  1NXC A;  1XWT A;  2EAB A;  3A3V A;  3E34 B;  1N94 B;  4WU0 A;  2GOX A;  1GXN A;  3M73 A;  4JJJ A;  1D8E B;  1H3C A;  3WKF A;  2DRQ A;  1D8D B;  3TF4 A;  4M76 A;  3E33 B;  4ZH1 A;  3KLS A;  3M76 A;  2WIN B;  3RX8 A;  5JPN B;  3CU7 A;  1N4S B;  3DRA B;  1UMP A;  3HXB B;  2ZZR A;  3EU5 B;  2XQW A;  3W5M A;  3WIW A;  1XW2 A;  1DL2 A;  1IA6 A;  3RX5 A;  2PN5 A;  2WY7 A;  4WVB A;  3VW5 A;  3WIR A;  2JF4 A;  4J5T A;  1QQF A;  5MEH A;  2AHF A;  3ACT A;  3PZ4 B;  1F9D A;  1GAI A;  1G9G A;  4GTQ B;  5CA3 A;  1GSZ A;  2AFA A;  4KTR A;  3Q73 B;  3SFY B;  1NC5 A;  3E6U A;  3P5P A;  4AYO A;  2FBA A;  4GL3 A;  1V5D A;  2OKX A;  4L6X A;  3W5N A;  2H6H B;  4V1R A;  1SQC A;  1H13 A;  2I07 B;  3DPY B;  2V8I A;  1W6J A;  4GTT B;  4ONT A;  3DSS B;  2XWJ B;  4LNG B;  1GHQ A;  3GT5 A;  2FUZ A;  4WVA A;  2DRR A;  4ZRQ A;  1UG9 A;  1TNZ B;  1TNO B;  3E30 B;  3Q7F B;  3KSQ B;  3WIQ A;  1H36 A;  3WKI A;  1QSJ A;  3QFZ A;  3S4C A;  3HXF B;  1G9J A;  1H35 A;  1JS4 A;  1WU6 A;  3PYB A;  4MU9 A;  1KZO B;  1CLC A;  3GZK A;  3HXD B;  3ANI A;  1WZZ A;  3DSU B;  4BOK A;  2H6I B;  3M75 A;  2D5J A;  5M7Y A;  1L2A A;  4QT9 A;  1FP3 A;  2NOJ A;  3EZ8 A;  1AYX A;  3RRS A;  3Q7A B;  1O1R B;  3K7X A;  2RI9 A;  1TN7 B;  2H6F B;  5CZL A;  3SDQ A;  2RGK A;  1IA7 A;  1XWQ A;  1O6R A;  3DSV B;  2G02 A;  3RX7 A;  2VN7 A;  3QPF A;  3QG0 A;  1GXM A;  2XWB B;  2G0D A;  2V3N A;  3S4D A;  1TN6 B;  3QFY A;  2BED B;  3REN A;  4FXK B;  4Z4L A;  1WU4 A;  2PMV A;  4XUV A;  1F9O A;  4LNV A;  4GTP B;  2EAC A;  3HXE B;  2BB5 A;  1CEM A;  3PZ3 B;  3VXD A;  4DOD A;  1O6H A;  3OED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...