2DSAA

Ternary complex of bphk, a bacterial gst
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
b'MKLYYSPGACSLSPHIALREAGLNFELVQVDLASKKTASGQDYLEVNPAGYVPCLQLDDGRTLTEGPAIVQYVADQVPGKQLAPANGSFERYHLQQWLNFISSELHKSFSPLFNPASSDEWKNAVRQSLNTRLGQVARQLEHAPYLLGDQLSVADIYLFVVLGWSAYVNIDLSPWPSLQAFQGRVGGREAVQSALRAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Structures of ternary complexes of BphK, a bacterial glutathione S-transferase that reductively dechlorinates polychlorinated biphenyl metabolites
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Transferase
total genus 66
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2dsaA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dsaA01
1WP0A 1NM3A 5ECPB 1G0TA 2VL9A 4F0BA 2V1MA 5ID2A 5ELAA 2DMLA 3QD9A 4LMVA 5J4UA 5ECHB 4HU7A 3KP8A 2I4AA 3G7JA 5E4WA 2E0QA 3CBUA 4G0IA 3IRAA 3LEFA 4TRXA 1BAYA 4I97A 4O5RA 4ZB9A 3TOUA 3LFLA 1BG5A 2X64A 1YKAA 3VWUA 1DUGA 4IJIA 4K7IA 2DIZA 3KJYA 2JZSA 5EPFA 4XRAA 2IIYA 1OC9B 2K6VA 5FWGA 5CYYA 3HVSA 3LYPA 2B6MA 1KBNA 1UA5A 4X0XA 2H19A 2HSHA 1A2JA 1XBSA 2G0FA 4IS0A 2ZCTA 5G1KA 1VF1A 3KD0A 2YCDA 2DJJA 3L9SA 5DALB 1XVQA 1R5AA 1O6JA 2XHFA 2VCTA 2L4QA 1K0DA 2L6DA 5CO3A 2NTOA 3KTBA 5HQPA 1K3LA 3D6IA 3P7XA 2KOKA 5J9CA 3US3A 2OA7A 5AIXA 2H6ZA 2GQLA 3IE3A 4MABA 3DKSA 3FHKA 3FRCA 3QDNA 2EIRA 4EL1A 1WJKA 5HFIA 3C1SA 4NHWA 2BTOT 4KB3A 3TKSA 2C3NA 5ECQB 5CAXA 5ECLB 5C00A 2L6CA 1ZOFA 1Q4JA 1GSUA 4HOJA 1MDIA 1TJDA 5G30A 5J3RA 1UVZA 4RI6A 4YQVA 3LYKA 4PNFA 4KAEA 6GSYA 1G6WA 1V98A 2QKEA 4KGIA 3G9BA 1SU9A 3LSZA 4DVCA 4KE3A 1KTEA 3EURA 2YANA 3UBKA 1OYJA 4PXOA 1FAAA 4F03A 1EP8A 3HA9A 2HRKB 3KTLA 2M72A 2X8GA 1QK8A 3EE2A 5COHA 4GQCA 1PQNA 4MJEA 1T4ZA 3L4NA 3IPZA 4G2EA 3PH9A 16GSA 5CP1A 1IYIA 3Q19A 2B3SA 3IC8A 1YDKA 3ERGA 3ZFLA 4D73B 2YV7A 1SL0B 2YJ7A 3EMPA 1DBYA 4XIHA 5G1LA 1DE1A 3ZVJD 1FB6A 5C04A 3D0ZA 1O8XA 3VK9A 1QQ2A 1MTCA 4OFMA 1GTIA 3ZTLA 3ZIJA 4JRRA 4TR1B 5CRWA 1OVNA 2LS5A 3TJKA 1ACVA 1U88A 4K0NA 1PX6A 5JWQB 4IQ1A 4MJCA 3RPNA 2M46A 4N0ZA 1T8EB 3ZYWA 2L5LA 4HI7A 1MD4A 4USSA 3TKQA 3BOAA 5IIZA 5GAND 3E3EA 1SK0A 2OBIA 3GKNA 1GRXA 1TRSA 4BL7A 1BJXA 2I9HA 4MF6A 3ED3A 1EWXA 1ILOA 5KN0A 3ZFBA 1KNGA 2IWTA 1SL1B 1ZZYA 1V58A 1F2EA 1EP7A 3TJFA 1PKWA 3QAVA 2H6XA 2H1GA 5KN3A 3Q18A 1AQXA 1R26A 3H93A 3QAWA 4PQ1A 1EZKA 3M9JA 1TU8A 2VAFA 3LXZA 1TTZA 3N5OA 2HLSA 1PX7A 2MZCA 4ZL7A 2YZHA 5KEJA 1T3BA 2F8FA 2I1UA 10GSA 3PPUA 5IMCA 1VF3A 2A2RA 2CA8A 1MD3A 1XOBA 2NVLA 3FR6A 4HQSA 4P3YB 2FD3A 2AB6A 3MAKA 1B9XC 3F4SA 2RUFA 4L0WA 3SBCA 2AHEA 4KF9A 3KEBA 3MDKA 1M2BA 2NPBA 4ZL8A 3L0HA 4BWSA 2YOIA 1M0UA 1GNEA 4FQUA 2X8CA 1JZOA 4TR0A 5JCGA 1A2MA 2R5GA 1AXDA 4G0LA 3ZREA 1SKRB 3GHAA 1LBKA 3F4RA 2R2JA 2H76A 3CMIA 1AQVA 4PURA 4F9ZA 1DSBA 1URMA 1B4QA 1X0RA 4DSRA 1M99A 1IYHA 4NMUA 3UVHA 2HZEA 2BMXA 1HNAA 4DSSB 2O89A 4LA1A 5IM9A 2VL3A 3BJ5A 4ZL9A 4JR6A 1EEJA 2CAIA 4MZBA 4IGJA 2IMDA 1TRUA 1HD2A 3M9KA 3MWHA 2LUSA 4O7HA 3APQA 4KDYA 5HFGA 2X8HA 2KP1A 5KN1A 4J2FA 4GSTA 1SJ6A 5AN1A 1YJ6A 2MMZA 2YN1A 3RDWA 3SWLA 4MZCA 2M80A 2PPTA 3IXRA 4G19A 2O87A 4LL4B 2ZNMA 2HQTA 3EU3A 3D21A 4OCEA 2N5FA 1WIKA 1USBA 3Q74A 3A3TA 2F8AA 5IOXA 3VWWA 4XS4B 4V1Ap 1GSEA 5ECOB 2CQ9A 3F6FA 5B6NA 2IPAA 1M9BA 3IA1A 5IMAA 3IAM2 4OWYA 3ERFA 1O8WA 3WYWA 2H66A 4NWYA 3IBHA 2RM6A 1PA3A 2JZRA 5FHIA 2PWJA 3TCOA 1PN9A 3GFKA 4O32A 5IOWA 3VPQA 2VD0A 4X1UA 1WPIA 1WRYA 4L5OA 4ML1A 4EO3A 5G5EA 2RUEA 2E2MA 2L5OA 1WMJA 4PQIA 1ERWA 4KCEA 4GCIA 2K18A 3K8NA 3FY7A 2H1DA 1E6BA 4IELA 2H6YA 4IP1A 2KUCA 4XHMA 3TOTA 2HNLA 4PNGA 2O85A 4YH2A 1ERUA 2HT9A 2MYGA 1HYUA 3C71A 3U6VA 2GS3A 2AYTA 3QOUA 2WB9A 4ULXA 3WT1A 5F8BA 2JACA 3BBYA 2VCXA 2GT6A 4OFNA 3GX8A 3RHCA 2AAWA 4JR4A 4F0CA 4KW6A 5D9VA 2P5QA 2GT5A 2QC7A 3GURA 2LRNA 3FZ5A 3VI5A 4CHSA 3C1RA 3O6TA 1X9SB 3TJJA 4TXVA 2B5XA 2LV3A 5A5KA 1XVWA 3F8UA 4EC0A 4NXIA 4BPYA 3KMNA 1TK5B 4IP6A 2LEGA 2FCHA 1FVKA 1K3OA 2DC5A 4K2DA 3M3MA 5D73A 2FY6A 3GTUA 4RI7A 5HR0A 2DJ3A 3IR4A 4JE1A 3IAS2 1UC7A 1K0BA 1GTUA 4WR5A 4QQ7A 4ZB6A 1B4PA 2N5AA 3RHBA 4K1FA 4XTSA 22GSA 3I9V2 4WF4A 4MH2A 1Z7PA 1KEBA 3C8EA 4ECCA 1XWGA 4HZ4A 2YP6A 5GZZB 1AW9A 4BVYA 2VIMA 1Z6MA 1XWKA 4IJ3A 4LMWA 2OACA 4AJ8A 1JFUA 17GSA 4V2LA 4MPFA 5ELGA 3KGKA 2CAQA 4HU9A 5ECKB 4V1Ag 3A2WA 4IBPA 1SK2A 2VCZA 5H5RA 1K0AA 2H71A 3TKRA 4ZBAA 1OAZA 5DJMA 6GSWA 1X5DA 1DE2A 1PMTA 1SK1A 2LRCA 5G5FA 3CRTA 5F0GA 3CXGA 2VCVA 3M8NA 5JWRB 3ZIVA 2LSTA 3TKSC 2GLRA 2F9SA 2K8SA 4TR4A 3APOA 5JCWA 1SJIA 4GRFA 2H72A 3UJ1A 1K3YA 2C3QA 4JZQA 1EGOA 1RW1A 4NV5A 1J08A 4CW9A 2GGTA 1SYRA 3WGDA 4EXJA 2G2QA 2C3TA 5HFKA 1VF2A 3R3EA 2YJHA 4FYBA 1OC9A 4KA0A 4BVXA 1FOVA 1MDJA 1C72A 3TRPA 5A4WA 3IC4A 2J23A 3FZ9A 4ISDA 1T00A 4XS6A 5D9WA 2E7PA 2GSRA 1EOGA 3ISOA 3BCIA 4POBA 4GWRA 1SD9A 3LJRA 2HSMA 5DALA 2DIYA 1JZDA 3F4TA 2GSSA 2OADA 5JWOB 2C8UA 3OR5A 5HR1A 2FGXA 2V41A 5ECSA 1XWAA 3DIEA 3MSZA 1GSDA 1FVJA 5KN2A 3IK9A 2ES7A 1AC1A 5IQYA 5J41A 4YQUA 1A2LA 4LLRA 2GVPA 3VWXA 5B7CA 2VL2A 1N2AA 5AIVA 2HRNA 5LD0A 1TI3A 4ECJA 1FHEA 2BJXA 3FKFA 4J57E 2ZUPA 5F07A 2FWEA 5DBQA 5F06A 1PD21 2KLXA 2CV4A 5H5SA 4HUAA 4EKZA 5B6MA 1GNWA 3KH7A 2DJ1A 5CNWA 1X5EA 3DVWA 4WKWA 3I69A 5ECNB 1O85A 3L9VA 1GTBA 1SJZA 1SKSB 1V40A 3TGZA 2NDOA 1NHYA 1EV4A 1M2DA 4MZWA 2R37A 1GP1A 1T1VA 3FW2A 3TKSE 4FIWA 4E8HA 1GLPA 1O73A 1ZYQB 2IMEA 5D9TA 4IKHA 4GTUA 1LJRA 1B48A 1X5CA 5DQYA 2JU5A 1R4WA 4HZ2A 3CSJA 11GSA 1Q98A 3APSA 4MPGA 3W8SA 2H01A 1GSQA 6GSVA 3GV1A 3GX0A 4K0GA 3W6GA 2HRKA 4XS1A 3GL5A 4TKYA 3TB2A 3UMAA 2B1LA 2H0IA 1CQGA 2LJAA 2P31A 2HYXA 2MMNA 18GSA 3QCPA 5G2ZA 3NOFA 4IVFA 2GQKA 4D73A 4RUVA 3C7MA 2IMFA 1GULA 1TRVA 4JU5A 4TOPA 3HHVA 5A4UA 1Z9HA 1Y25A 3KH9A 19GSA 1PSQA 4ILFA 2R3XA 1HNBA 4TR1A 2A2SA 1K0CA 3F6DA 1ERVA 3TKPA 2IMKA 3HCZA 3NIVA 1XCCA 2R4VA 1N8JA 4ZBBA 3DVXA 2P5RA 4N10A 4NV2A 3ERWA 1QFNA 2E2GA 5IO0A 1A23A 2CX3A 2B5YA 1YY7A 3F9UA 1I5GA 2HI7A 3PR8A 3H79A 3RBTA 2FUG2 1TU7A 3H8QA 2VD1A 4FYCA 5DCHA 1THXA 3ZMLA 1H75A 4FH8A 2FWGA 1O81A 3HDCA 3ZRDA 1Z6NA 1AQWA 2RIIA 2HZEB 2EIOA 4PX1A 1GLQA 3UVTA 3GUSA 3A2XA 3ZMKA 3GKXA 2H75A 14GSA 1PRXA 1XFLA 1GL8A 1EGRA 4ID0A 2MMAA 1PGTA 3I43A 4OD7A 2VLTA 1J9BA 5HR3A 1UN2A 1U87A 2VLUA 3F0IA 3EYTA 5INYA 1XW5A 2PN8A 3O76A 3LORA 1X9MB 1Y6EA 2YZUA 1M9AA 1A8YA 3F63A 5DQSA 5L71A 3QR6A 2IN3A 4EUYA 5FT3A 1ST9A 2CZ2A 3HKRA 2J9HA 2DLXA 2XPDA 2LKUA 4QL7A 1RK4A 2VUPA 5ECRB 2JZTA 4POLA 2O7KA 4OO4A 1F6MC 4POMA 5CRHA 2ON5A 5A4VA 4MA9A 1K0OA 2H73A 1EEMA 4Z7XA 4MF5A 4IW9A 3TJBA 2AV4A 2KHPA 3C73A 5CRGA 1XOAA 4KCAA 3F3QA 3GKMA 2DMMA 3GL3A 2PVQA 1Z5YE 5ECIB 2HZFA 5LNKe 4I8BA 2GZYA 2YWOA 2VM2A 1HNCA 4ZXGA 3E0UA 5DAKB 2VLVA 2IL3A 4N30A 4NHZA 2RM5A 3AY8A 1PL2A 1EOHA 3PGTA 1Z7RA 1QGVA 5IPHA 4MF7A 4KUNA 2GQMA 3U5RE 2DJKA 2IFQB 2LNTA 3DMLA 3CRUA 1MDKA 1TW9A 1OKDA 1K0NA 2H1AA 3QFBC 3V1WA 12GSA 4YQMA 2YV9A 3EMXA 2PERA 2EIQA 1J0FA 2I3YA 4HQZA 3ZLPA 3IV4A 1SL2B 4RQXA 3TJGA 3VFIA 2IMIA 2WGRA 2PVOC 3FK8A 2REMA 5DDLA 2LTKA 1GSYA 2WS2A 1W4VA 4V2NA 4MK3A 4TXOB 1S3DA 2WCIA 2DSAA 1JHBA 4FYUA 6GSUA 2VCQA 3WGEA 1YEPA 1M2AA 2V6KA 1TP9A 1F3BA 1YQ1A 3WGXA 5ID2B 4PUFC 1TKDB 3GSSA 5B8BA 1YF1A 3HJPA 4PGTA 1BX9A 2Z9SA 4BVYB 6GSTA 1HQOA 6GSXA 3HXSA 2CZ3A 2YPMA 2CX4A 1TDIA 3J7Yk 1BYEA 5CREA 1ZCPA 1GH2A 4K9ZA 5ABRA 3P8WA 2B5EA 5EY6A 1BQ7A 1OC3A 1LU4A 3GIXA 4HEA2 4IN0A 2DJ2A 2XBIA 1SKWB 2WFCA 5ECMB 5GSTA 5J9BA 1X9WB 1SENA 3CTGA 2MBSA 1PKZA 2PU9C 2OE0A 2PUKC 2XC2A 4L0UA 4ACSA 4K8MA 2LNSA 2FWFA 4KSOA 3ZL5A 4JEDA 3ZVJA 2FLSA 2L59A 3VI7A 2OKAA 4DEJA 4G0KA 2TIRA 2H0HA 3UOMA 3TDGA 2P0GA 3UL3A 2D2ZA 1OE7A 4KNDA 1NSWA 2FA8A 3HYPA 1SYXA 4ML6A 1TXXA 2QSIA 1Z3EA 4YAPA 4BVXB 2MBTA 1XW6A 8GSSA 2IJYA 4POKA 3VWVA 4K7NA 3UARA 1ZYEA 3EU4A 5DJLA 4G9HA 4L5LA 1F3AA 2H30A 3GRXA 4XCSA 4AF2A 3QPMA 3LG6A 4Q5NA 4OO5A 2VL2C 3LXTA 2H1BA 5F05A 2HSMB 2HRFA 5D96A 2C4JA 4GQFA 5DVBA 3EC3A 1TOFA 1F9MA 3GYKA 3HJMA 5IMZA 3TRXA 3D4TA 2OE3A 2CVDA 3HVVA 3FZAA 3D4MA 2WZ9A 4ECIA 1XZOA 3PINA 1A8LA 4MP4A 3FEUA 1V9WA 3HZ4A 3KIJA 4N11A 4QL9A 4YAVA 3KZQA 4WBRD 4EVMA 3IK7A 2V32A 3CYNA 1VGLA 3EWLA 2LJKA 3HY2A 3FR9A 1ON4A 4EF0A 3W8JA 3GN3A 1T4YA 4IHUA 1YEXA 3UBLA 2V2GA 2H70A 2JSYA 4TVEA 1ZGNA 5GSSA 3M1GA 1JZWA 1EV9A 2LRTA 4GXZA 4Q5FA 4BA7A 5HR2A 1XXUA 2DJ0A 2LJRA 4Q5QA 1FO5A 4E8EA 4I5QA 1JLWA 3HD5A 2C1YA 1WOUA 4GLTA 1H4OA 4KDUA 1YZXA 2C0DA 4KDXA 2LQOA 2O8VB 2YWNA 5DCGA 1R5PA 3EVIA 13GSA 1ABAA 3QFAC 2C0EA 3FR3A 3H4KA 2FNOA 3UIWA 2HE3A 3VURA 1G7OA 3IOSA 2GSTA 2OE1A 3BD2A 1K0MA 4AGSA 5G31A 4I2TA 4KH7A 1OC8A 3IDVA 4ECBA 3LGCA 2JL4A 3KXOA 2L57A 1W89A 1XWBA 2C0FA 2YWIA 4DSQA 1XWCA 2VM1A 2B7JA 2K9FA 1ZMAA 2HRAA 3LWAA 4OMVA 4HJ2A 2I81A 4V2MA 3QAGA 5JCUA 2A4VA 2FHEA 5EVOA 3P2AA 1CQHA 2CVBA 3DEXA 1XIYA 1GUHA 4BL7B 1S3CA 3TRQA 3NZNA 4RQRA 2QGVA 2TRXA 4ZB8A 4EDYA 2HSNB 5IMFA 1ERTA 1NW2A 1U3AA 4ZILA 2MMOA 4ZIJA 1A0RP 3GNJA 4LL1B 3M0FA 1FB0A 3LQ7A 4NAXA 2HSYA 2VO4A 1RQMA 4WF5A 5IMVA 4GSSA 3A5WA 3VPTA 5EL8A 4OCFA 3UEMA 3G7YA 3L78A 1QUWA 1M7TA 1QXHA 1V57A 3QMXA 1U3IA 3TUEA 3J7Yb 4NPBA 2YNXA 4WR4A 2CT6A 2FA4A 4KSMA 3GMFA 3Q6OA 4CDOA 4F82A 3F3RA 4TW5A 2F3MA 3KMOA 2RLIA 2KP2A 2EC4A 1V2AA 4G10A 2OJLA 1OKTA 3GH9A 5H5QA 2HXKA 4GF0A 2H74A 2JSZA 2GZZA 1BEDA 4FO5A 3DD3A 2AJQB 3HVXA 5LCZA 4K6XA 1WWJA 2X99A 5E59A 3I6AA 3FYGA 4H86A 3G7IA 1F37A 2FWHA 1GSSA 2YWMA 3DGQA 20GSA 2GSQA 6GSSA 5IMDA 2HFDA 1O7UA 3GSTA 5AISA 2OBKA 4BWQA 1GSFA 3GKKA 1ZL9A 2TRCP 1AUCA 2F51A 3P90A 4MCUA 4MJBA 2DBCA 3E9JB 1XW9A 1G7EA 3KCMA 1B8XA 5BMUA 3S9FA 4HS1A 1TRWA 3CSIA 3JCML 1E2YA 1GUKA 4IQAA 4Q5RA 4MLYA 4MDCA 3WT2A 3UAPA 3HJOA 4MH3A 1S3AA 1YF0A 3CTFA 4DSSA 1PL1A 5ENUA 4KX4A 2NBSA 1FG4A 1TK0B 5J5NA 2B1KA 5GAPD 1TK8B 5D9XA 2ON7A 4GSNA 3L9UA 3KM6A 1WE0A 2VCWA 4I2UA 4TN8A 2GTUA 1ML6A 4WETA 2V6OA 3ME8A 5IO2A 1AIUA 3RAZA 3HZ8A 2WDUA 1QMVA 3WD6A 4F2IA 2K8VA 4HJMA 3N9JA 4WXTA 2H0GA 2PBJA 4AJ6A 5D8IA 3DRNA 1VRSD 3VLNA 4AJ7A 4X43A 2XPEA 2VOCA 4XS4A 3ZZXA 1YKCA 2CVKA 2L4CA 2GDRA 1JLVA 9GSSA 1OE8A 4PTSA 3FZ4A 1T7PB 4J56E 4I6XA 3O3TA 1R7HA 1GUMA 3GH6A 4PUAA 3DWVA 1FW1A 1NHOA 3DYRA 5DAKA 4K7OA 3DXBA 1I9DA 3ZITA 5IPGA 4O92A 3IHQA 2XBQA 4MJAA 4HDEA 2C80A 4JBBA 4WEYA 4TR3A 2UZ8A 3MNGA 3RPPA 4WBJA 1THOA 1A0FA 3A2VA 2GZPA 5CRDA 1U6TA 2IFQA 3D5JA 1XPVA 3GA4A 3GTUB 2WJUA 2ALBA 2WRTA 4PQHA 2H8LA 1B9YC 3H1NA 2LQQA 1TI1A 2JADA 2B7KA 3R2QA 3CSHA 4ZBDA 2PGTA 1G6YA 2WULA 4N0VA 5B8AA 1MEKA 1VF4A 3D22A 1AAZA 1SD8A 3BCKA 1A24A 4OFTA 2C0GA 3EINA 1GWCA 5D93A 3KP9A 2AUVA 4L8EA 3ME7A 4XRDA 2R6KA 5AGYA 7GSSA 2N5BA 4TXOA 1GTAA 4EE0A 1JZRA 2PMTA 4EDZA 4MMMA
chains in the Genus database with same CATH superfamily
1WP0A 1NM3A 5ECPB 1G0TA 2VL9A 4F0BA 2V1MA 5ID2A 5ELAA 2DMLA 3QD9A 4LMVA 5J4UA 5ECHB 4HU7A 3KP8A 2I4AA 3G7JA 5E4WA 2E0QA 3CBUA 4G0IA 3IRAA 3LEFA 4TRXA 1BAYA 4I97A 4O5RA 4ZB9A 3TOUA 3LFLA 1BG5A 2X64A 1YKAA 3VWUA 1DUGA 4IJIA 4K7IA 2DIZA 3KJYA 2JZSA 5EPFA 4XRAA 2IIYA 1OC9B 2K6VA 5FWGA 5CYYA 3HVSA 5A34A 3LYPA 3IHGA 2B6MA 1KBNA 1UA5A 5A1NB 4X0XA 2H19A 2HSHA 1A2JA 1XBSA 2G0FA 4IS0A 2ZCTA 5G1KA 1VF1A 3KD0A 2YCDA 2DJJA 3L9SA 5DALB 3CHXC 1XVQA 1R5AA 1O6JA 2XHFA 2VCTA 2L4QA 1K0DA 2L6DA 5CO3A 3MYDA 2WW3A 2NTOA 3KTBA 5HQPA 1K3LA 3D6IA 3P7XA 2KOKA 5J9CA 3US3A 2OA7A 5AIXA 2H6ZA 2GQLA 3IE3A 4MABA 3DKSA 3FHKA 3FRCA 3QDNA 2EIRA 4EL1A 1WJKA 5HFIA 3C1SA 4NHWA 2BTOT 4KB3A 3TKSA 2C3NA 5ECQB 5CAXA 5ECLB 1PN0A 5C00A 2L6CA 1ZOFA 1Q4JA 1GSUA 4HOJA 1MDIA 1TJDA 1BG1A 5G30A 5J3RA 1UVZA 4RI6A 4YQVA 3LYKA 4PNFA 4KAEA 6GSYA 1G6WA 1V98A 2QKEA 4KGIA 3G9BA 1SU9A 3LSZA 4DVCA 4KE3A 4AI6A 1KTEA 3EURA 2YANA 3UBKA 1OYJA 4PXOA 1FAAA 4F03A 1EP8A 3HA9A 2HRKB 3KTLA 2M72A 2X8GA 1QK8A 4YKGA 3EE2A 5COHA 4GQCA 1PQNA 4MJEA 1T4ZA 3L4NA 3IPZA 4G2EA 3PH9A 16GSA 5CP1A 1IYIA 3Q19A 2B3SA 5KOXA 3IC8A 1YDKA 3ERGA 3ZFLA 4D73B 2YV7A 1SL0B 2YJ7A 3EMPA 1DBYA 4XIHA 5G1LA 1DE1A 3ZVJD 1FB6A 5C04A 3D0ZA 1O8XA 3VK9A 1QQ2A 1MTCA 4K2XA 4OFMA 1GTIA 3ZTLA 3ZIJA 4JRRA 4TR1B 5CRWA 1OVNA 2LS5A 4QMKA 2EFCA 3TJKA 1ACVA 1U88A 4K0NA 1PX6A 5JWQB 4IQ1A 4MJCA 3RPNA 2M46A 4N0ZA 1T8EB 3ZYWA 2L5LA 4HI7A 1MD4A 4USSA 3TKQA 3BOAA 5IIZA 5GAND 3E3EA 1SK0A 2OBIA 3GKNA 1GRXA 1TRSA 4BL7A 1BJXA 2I9HA 4MF6A 3ED3A 1EWXA 1ILOA 5KN0A 3ZFBA 1KNGA 2IWTA 2HSNA 1SL1B 1ZZYA 1V58A 1F2EA 1EP7A 3TJFA 1PKWA 3QAVA 2H6XA 2H1GA 5KN3A 3Q18A 1AQXA 1R26A 3H93A 3QAWA 4PQ1A 4EIQA 1EZKA 3M9JA 1TU8A 2VAFA 3LXZA 1TTZA 3N5OA 2HLSA 1PX7A 2MZCA 4ZL7A 2YZHA 5KEJA 1T3BA 2F8FA 2I1UA 10GSA 3PPUA 5IMCA 1VF3A 2A2RA 2CA8A 1MD3A 1XOBA 2VKZG 2NVLA 3FR6A 4HQSA 4P3YB 2FD3A 2AB6A 3MAKA 1B9XC 3F4SA 2RUFA 4L0WA 3SBCA 2AHEA 4KF9A 3KEBA 3MDKA 1M2BA 2NPBA 4ZL8A 3L0HA 4BWSA 2YOIA 1M0UA 1GNEA 4FQUA 2X8CA 1JZOA 2EFHA 4TR0A 5JCGA 1A2MA 2R5GA 1AXDA 4G0LA 3ZREA 1SKRB 4E68A 3GHAA 1LBKA 3F4RA 2R2JA 2H76A 3CMIA 1AQVA 4PURA 4F9ZA 1DSBA 1URMA 1B4QA 1X0RA 4DSRA 1M99A 1IYHA 4NMUA 3UVHA 2HZEA 2BMXA 1HNAA 4DSSB 2O89A 4LA1A 5IM9A 2VL3A 3BJ5A 4ZL9A 4JR6A 1EEJA 2CAIA 4MZBA 4IGJA 2IMDA 1TRUA 1HD2A 3M9KA 3MWHA 2LUSA 4O7HA 3APQA 4KDYA 5HFGA 2X8HA 2KP1A 5KN1A 4J2FA 4GSTA 1SJ6A 5AN1A 1YJ6A 2MMZA 2YN1A 3RDWA 3SWLA 4MZCA 2M80A 2PPTA 3IXRA 4G19A 2O87A 4LL4B 2ZNMA 2HQTA 3EU3A 3D21A 4OCEA 2N5FA 2WW0A 1WIKA 1USBA 3Q74A 3A3TA 2F8AA 2DKIA 5IOXA 3VWWA 4XS4B 4V1Ap 1GSEA 5ECOB 2CQ9A 3F6FA 5B6NA 2IPAA 1M9BA 3IA1A 5IMAA 3IAM2 4OWYA 3ERFA 1O8WA 3WYWA 2H66A 4NWYA 3IBHA 3A5IA 2RM6A 1ZYPA 1PA3A 2JZRA 5FHIA 2PWJA 3TCOA 1PN9A 3GFKA 2OT3A 4O32A 5IOWA 3VPQA 2VD0A 4X1UA 1WPIA 1WRYA 1FOHA 4L5OA 4ML1A 4EO3A 5G5EA 2RUEA 2E2MA 2L5OA 1WMJA 4PQIA 1ERWA 4KCEA 4GCIA 2K18A 3K8NA 3FY7A 2H1DA 1E6BA 4IELA 2H6YA 4IP1A 2KUCA 4XHMA 3TOTA 2HNLA 4PNGA 2O85A 4YH2A 1ERUA 2HT9A 2MYGA 1HYUA 3C71A 3U6VA 2GS3A 2AYTA 3QOUA 2WB9A 4ULXA 3WT1A 5F8BA 2JACA 3BBYA 2VCXA 4AKGA 2GT6A 4OFNA 3GX8A 3RHCA 2AAWA 4JR4A 4F0CA 4KW6A 5D9VA 2P5QA 2GT5A 2QC7A 3GURA 2LRNA 3FZ5A 3VI5A 4CHSA 3C1RA 3O6TA 1X9SB 3TJJA 4TXVA 1XG8A 2B5XA 2LV3A 5A5KA 1XVWA 3F8UA 4EC0A 4NXIA 4A5PA 4BPYA 3KMNA 1TK5B 4IP6A 2LEGA 2FCHA 4MNNA 1FVKA 2X49A 1K3OA 2DC5A 4K2DA 3M3MA 5D73A 2FY6A 3GTUA 4RI7A 5HR0A 2DJ3A 2DKHA 4YKFA 3IR4A 4JE1A 3IAS2 1UC7A 1K0BA 1GTUA 4WR5A 4QQ7A 4ZB6A 1B4PA 2N5AA 3RHBA 4K1FA 4XTSA 22GSA 3I9V2 4WF4A 4MH2A 1Z7PA 1KEBA 3C8EA 4ECCA 1XWGA 4HZ4A 2YP6A 5GZZB 1AW9A 4BVYA 2VIMA 1Z6MA 1XWKA 2QA2A 4IJ3A 4LMWA 2OACA 4AJ8A 1JFUA 4AKIA 17GSA 4BIKA 4V2LA 4MPFA 5ELGA 3KGKA 2CAQA 4HU9A 5ECKB 2O5VA 4V1Ag 3A2WA 4IBPA 1SK2A 2VCZA 5H5RA 1K0AA 2H71A 3TKRA 4ZBAA 1OAZA 5DJMA 6GSWA 1X5DA 1DE2A 1PMTA 1SK1A 1PFOA 1SVMA 2LRCA 5G5FA 3CRTA 5BRTA 5F0GA 3CXGA 2VCVA 3M8NA 5JWRB 3ZIVA 2LSTA 3TKSC 2GLRA 2F9SA 2K8SA 4TR4A 3APOA 5JCWA 1SJIA 4GRFA 2H72A 3UJ1A 1K3YA 2C3QA 4JZQA 1EGOA 1S4BP 1RW1A 4NV5A 1J08A 4CW9A 2GGTA 1SYRA 3WGDA 4EXJA 2G2QA 2C3TA 5HFKA 1VF2A 3R3EA 2YJHA 4FYBA 1OC9A 4KA0A 4BVXA 1FOVA 1MDJA 1C72A 4PI0C 3TRPA 4G01A 2X4AA 5A4WA 5A1NA 3IC4A 2J23A 3FZ9A 4ISDA 1T00A 4XS6A 5D9WA 2E7PA 2GSRA 1EOGA 3ISOA 3BCIA 4POBA 4GWRA 2WW1A 1SD9A 3LJRA 2HSMA 5DALA 2DIYA 1JZDA 3F4TA 2GSSA 2OADA 5JWOB 2C8UA 3OR5A 5HR1A 4EIPA 2FGXA 2V41A 5ECSA 1XWAA 3DIEA 3MSZA 1GSDA 1FVJA 5KN2A 3IK9A 2ES7A 1AC1A 5IQYA 5J41A 4YQUA 1A2LA 4LLRA 2GVPA 3VWXA 1YVLA 5B7CA 2VL2A 1N2AA 5AIVA 2HRNA 5LD0A 1TI3A 4ECJA 1FHEA 2BJXA 3FKFA 4J57E 2ZUPA 5F07A 2FWEA 5DBQA 5F06A 1PD21 2KLXA 4Z2TA 2CV4A 1SVOA 5H5SA 4HUAA 4EKZA 5B6MA 1GNWA 3KH7A 2DJ1A 5CNWA 1X5EA 3DVWA 4WKWA 3I69A 5ECNB 1O85A 3L9VA 1GTBA 1SJZA 1SKSB 1V40A 3TGZA 2NDOA 1NHYA 1EV4A 1M2DA 4MZWA 2R37A 1GP1A 1T1VA 3FW2A 3TKSE 4FIWA 4E8HA 1GLPA 1O73A 1ZYQB 2IMEA 5D9TA 4IKHA 4GTUA 1LJRA 1B48A 1X5CA 5DQYA 2JU5A 1R4WA 4HZ2A 3CSJA 11GSA 1Q98A 3APSA 4MPGA 3W8SA 2H01A 1GSQA 6GSVA 3GV1A 3GX0A 4K0GA 3W6GA 2HRKA 4XS1A 3GL5A 4TKYA 3TB2A 3UMAA 2B1LA 2H0IA 1CQGA 2LJAA 2P31A 2QA1A 2HYXA 2MMNA 18GSA 3QCPA 5G2ZA 2WVZA 3NOFA 4IVFA 2GQKA 4D73A 4RUVA 3C7MA 2IMFA 1GULA 1TRVA 4JU5A 3EPTA 4TOPA 3HHVA 5A4UA 1Z9HA 1Y25A 3KH9A 19GSA 1PSQA 4ILFA 2R3XA 1HNBA 4TR1A 2A2SA 1K0CA 3F6DA 1ERVA 3TKPA 2IMKA 3HCZA 3NIVA 1XCCA 2R4VA 1N8JA 4ZBBA 3DVXA 2P5RA 4N10A 4NV2A 3ERWA 1QFNA 2E2GA 2WVXB 3LW9A 5IO0A 1A23A 2CX3A 2B5YA 1YY7A 3F9UA 1I5GA 2HI7A 3PR8A 3H79A 3RBTA 2FUG2 1TU7A 3H8QA 2VD1A 4FYCA 5DCHA 1THXA 3CWGA 3ZMLA 1H75A 4FH8A 2FWGA 1O81A 3HDCA 3ZRDA 1Z6NA 1AQWA 2RIIA 4CY8A 2HZEB 2EIOA 4PX1A 1GLQA 3UVTA 2O36A 3GUSA 3A2XA 3ZMKA 3GKXA 2H75A 14GSA 1PRXA 1XFLA 5BMUB 1GL8A 1Y1UA 1EGRA 4ID0A 2MMAA 5A5HA 1PGTA 3I43A 4OD7A 2VLTA 1J9BA 5J47A 5HR3A 1UN2A 1U87A 2VLUA 3F0IA 3EYTA 5INYA 1XW5A 2PN8A 3O76A 3LORA 1X9MB 1Y6EA 2YZUA 1M9AA 1A8YA 3F63A 5DQSA 5L71A 3QR6A 2IN3A 4EUYA 3TU3B 5FT3A 1ST9A 2CZ2A 3HKRA 1BF5A 2J9HA 4PHZC 2DLXA 2XPDA 2LKUA 4QL7A 1RK4A 2VUPA 5ECRB 2JZTA 4POLA 1M3JA 2O7KA 4OO4A 1F6MC 4POMA 5CRHA 3MIXA 2ON5A 5A4VA 4MA9A 1K0OA 2H73A 1EEMA 4Z7XA 4MF5A 4IW9A 3TJBA 2AV4A 2KHPA 3C73A 5CRGA 1XOAA 4KCAA 3F3QA 3GKMA 4ZB7A 2DMMA 4FXYP 3GL3A 2PVQA 1Z5YE 5ECIB 2HZFA 5LNKe 4I8BA 2GZYA 2YWOA 2VM2A 1HNCA 4ZXGA 2EFEA 3E0UA 4O5UA 5DAKB 2VLVA 2IL3A 4N30A 4NHZA 2RM5A 3AY8A 1PL2A 1EOHA 3PGTA 1Z7RA 1QGVA 5IPHA 4MF7A 4KUNA 2GQMA 3U5RE 2DJKA 2IFQB 2LNTA 3DMLA 3CRUA 1MDKA 1TW9A 1OKDA 1K0NA 2A2PA 2H1AA 3QFBC 3V1WA 12GSA 4YQMA 4X4JA 2YV9A 3EMXA 4AKHA 2PERA 2EIQA 1J0FA 2I3YA 4HQZA 3ZLPA 2WVYA 3IV4A 1SL2B 4RQXA 3TJGA 3VFIA 2IMIA 2WGRA 2PVOC 3FK8A 2REMA 5DDLA 2LTKA 1GSYA 2WS2A 1W4VA 4V2NA 4MK3A 4K5SA 4TXOB 1S3DA 2WCIA 2DSAA 1JHBA 4FYUA 6GSUA 2EFDA 2VCQA 3WGEA 1YEPA 1M2AA 2V6KA 1TP9A 1F3BA 1YQ1A 3WGXA 5ID2B 4PUFC 1TKDB 3GSSA 5B8BA 1YF1A 2UV8G 3HJPA 4PGTA 1BX9A 2Z9SA 4BVYB 6GSTA 1HQOA 6GSXA 3HXSA 2CZ3A 2YPMA 2CX4A 1TDIA 2WZSA 3J7Yk 1BYEA 5CREA 1ZCPA 1GH2A 4K9ZA 5ABRA 3P8WA 2B5EA 5EY6A 1BQ7A 1OC3A 1LU4A 3GIXA 4HEA2 4IN0A 2DJ2A 2XBIA 1SKWB 2WFCA 1ZYNA 5ECMB 5GSTA 5J9BA 1X9WB 1SENA 3CTGA 2MBSA 5A34B 1PKZA 1YEWC 2PU9C 2OE0A 3CQFA 2PUKC 2XC2A 4L0UA 4ACSA 4K8MA 2LNSA 2FWFA 4KSOA 3ZL5A 4JEDA 3ZVJA 5J4YA 2FLSA 2L59A 3VI7A 2OKAA 4DEJA 4G0KA 2TIRA 2H0HA 3UOMA 3TDGA 2P0GA 3UL3A 2D2ZA 1OE7A 4KNDA 1NSWA 1M3IA 2FA8A 3HYPA 1SYXA 4ML6A 1TXXA 2QSIA 1Z3EA 4YAPA 4BVXB 2MBTA 4Z2UA 1XW6A 8GSSA 2IJYA 4POKA 3VWVA 3FMWA 4K7NA 3UARA 1ZYEA 3EU4A 5DJLA 4G9HA 4L5LA 1F3AA 2H30A 3GRXA 4XCSA 4AF2A 3QPMA 3LG6A 4Q5NA 4OO5A 2VL2C 3LXTA 2H1BA 5F05A 2HSMB 2HRFA 5J4VA 5D96A 2C4JA 4GQFA 5DVBA 3EC3A 1TOFA 1F9MA 3GYKA 3HJMA 5IMZA 3TRXA 3D4TA 2OE3A 2CVDA 3HVVA 3FZAA 3D4MA 2WZ9A 4ECIA 1XZOA 3PINA 1A8LA 4MP4A 3FEUA 1I1IP 1V9WA 2A4HA 3HZ4A 3KIJA 4N11A 4QL9A 4YAVA 3KZQA 4WBRD 4EVMA 3IK7A 2V32A 3CYNA 2O3EA 1VGLA 3EWLA 2LJKA 3HY2A 3FR9A 1ON4A 4EF0A 3W8JA 3GN3A 1T4YA 4IHUA 1YEXA 3UBLA 2V2GA 2H70A 2JSYA 4TVEA 1ZGNA 5GSSA 3M1GA 1JZWA 1EV9A 2LRTA 4GXZA 4Q5FA 4BA7A 5HR2A 1XXUA 2DJ0A 2LJRA 4Q5QA 1FO5A 4E8EA 4I5QA 1JLWA 3HD5A 2C1YA 1WOUA 4GLTA 1H4OA 4KDUA 1YZXA 2C0DA 4KDXA 2LQOA 2O8VB 2H1LA 1TXUA 2YWNA 5DCGA 1R5PA 3EVIA 13GSA 1ABAA 3QFAC 2C0EA 3FR3A 3H4KA 1SVLA 2FNOA 3UIWA 2HE3A 3VURA 1G7OA 3IOSA 2GSTA 2OE1A 3BD2A 2WW2A 1K0MA 4AGSA 5G31A 4I2TA 4KH7A 1OC8A 3IDVA 4ECBA 3LGCA 2JL4A 3KXOA 2L57A 1W89A 1XWBA 2C0FA 2YWIA 4DSQA 1XWCA 2VM1A 2B7JA 2K9FA 1ZMAA 2HRAA 3LWAA 4OMVA 4HJ2A 2I81A 4V2MA 3QAGA 5JCUA 2A4VA 2FHEA 5EVOA 3P2AA 1CQHA 2CVBA 3DEXA 1XIYA 1GUHA 4BL7B 1S3CA 3TRQA 3NZNA 4RQRA 2QGVA 2TRXA 4ZB8A 4EDYA 4ICYA 2HSNB 5IMFA 1ERTA 1NW2A 1U3AA 4ZILA 2MMOA 4ZIJA 1A0RP 5KOWA 3GNJA 4LL1B 3M0FA 1FB0A 3LQ7A 4NAXA 2HSYA 2VO4A 1RQMA 4WF5A 5IMVA 4GSSA 3A5WA 4N3ZA 4PI2C 3VPTA 5EL8A 4OCFA 3UEMA 5J40A 3G7YA 3L78A 1QUWA 1M7TA 1QXHA 1V57A 3QMXA 1U3IA 3TUEA 3J7Yb 4NPBA 2YNXA 4WR4A 2CT6A 2FA4A 4KSMA 3GMFA 3Q6OA 4CDOA 4F82A 3F3RA 4TW5A 2F3MA 3KMOA 2RLIA 2KP2A 2EC4A 1V2AA 4G10A 2OJLA 1OKTA 3GH9A 5H5QA 2HXKA 4GF0A 5A5HB 2H74A 4GDFA 2JSZA 2GZZA 2R0CA 1BEDA 4FO5A 3DD3A 2AJQB 3HVXA 2WVXA 5LCZA 3HMJG 4K6XA 1WWJA 2X99A 5E59A 3I6AA 3RGBC 3FYGA 4H86A 3G7IA 1F37A 2FWHA 1GSSA 2YWMA 3DGQA 20GSA 2R0PA 2GSQA 6GSSA 5IMDA 2HFDA 1O7UA 3GSTA 5AISA 2OBKA 4BWQA 1GSFA 3GKKA 1ZL9A 2TRCP 1AUCA 2F51A 3P90A 4MCUA 4MJBA 2DBCA 3RFRC 3E9JB 1XW9A 1G7EA 3KCMA 1B8XA 5BMUA 3S9FA 4HS1A 1TRWA 3CSIA 1S3RA 3JCML 1E2YA 1GUKA 4IQAA 4Q5RA 4MLYA 4O5QA 4MDCA 3WT2A 3UAPA 3HJOA 4MH3A 1S3AA 1YF0A 3CTFA 4DSSA 4W66A 1PL1A 5ENUA 4KX4A 2NBSA 1FG4A 1TK0B 5J5NA 2B1KA 5GAPD 1TK8B 5D9XA 2ON7A 4GSNA 3L9UA 3KM6A 1WE0A 2VCWA 4I2UA 4TN8A 2GTUA 1ML6A 4WETA 2V6OA 3ME8A 5IO2A 1AIUA 3RAZA 4AKXB 3HZ8A 2WDUA 1QMVA 3WD6A 4F2IA 2K8VA 4HJMA 3N9JA 4WXTA 2H0GA 2PBJA 4AJ6A 5D8IA 3DRNA 4CY6A 1VRSD 3VLNA 4AJ7A 4X43A 2XPEA 2VOCA 4XS4A 3ZZXA 1YKCA 2CVKA 2L4CA 2GDRA 1JLVA 9GSSA 1OE8A 4PTSA 3FZ4A 1T7PB 4J56E 4I6XA 3O3TA 1R7HA 1GUMA 3GH6A 4PUAA 3DWVA 1FW1A 1NHOA 3DYRA 5DAKA 4K7OA 3DXBA 1I9DA 3ZITA 4K5RA 3HVNA 5IPGA 2R0GA 4O92A 3IHQA 2XBQA 4MJAA 4HDEA 2C80A 4JBBA 4WEYA 4TR3A 2UZ8A 3MNGA 3RPPA 4WBJA 1THOA 1A0FA 3A2VA 2GZPA 5CRDA 1U6TA 2IFQA 3D5JA 1XPVA 3GA4A 3GTUB 2WJUA 2ALBA 2WRTA 4PQHA 2H8LA 1B9YC 3H1NA 2LQQA 1TI1A 2JADA 2B7KA 3R2QA 3CSHA 4ZBDA 2PGTA 1G6YA 2WULA 4N0VA 4Z2RA 5B8AA 1MEKA 1VF4A 4HSCX 3D22A 1AAZA 1N25A 1SD8A 3BCKA 1A24A 4OFTA 2C0GA 3EINA 1GWCA 5D93A 3KP9A 2AUVA 4L8EA 3ME7A 4XRDA 2R6KA 5AGYA 7GSSA 2N5BA 4TXOA 1GTAA 4EE0A 1JZRA 2PMTA 4EDZA 4MMMA
chains in the Genus database with same CATH topology
1WP0A 1NM3A 5ECPB 1G0TA 2VL9A 4F0BA 2V1MA 5ID2A 5ELAA 2DMLA 3QD9A 4LMVA 5J4UA 5ECHB 4HU7A 3KP8A 2I4AA 3G7JA 5E4WA 2E0QA 3CBUA 4G0IA 3IRAA 3LEFA 4TRXA 1BAYA 4I97A 4O5RA 4ZB9A 3TOUA 3LFLA 1BG5A 2X64A 1YKAA 3VWUA 1DUGA 4IJIA 4K7IA 2DIZA 3KJYA 2JZSA 5EPFA 4XRAA 2IIYA 1OC9B 2K6VA 5FWGA 5CYYA 3HVSA 5A34A 3LYPA 3IHGA 2B6MA 1KBNA 1UA5A 5A1NB 4X0XA 2H19A 2HSHA 1A2JA 1XBSA 2G0FA 4IS0A 2ZCTA 5G1KA 1VF1A 3KD0A 2YCDA 2DJJA 3L9SA 5DALB 1XVQA 1R5AA 1O6JA 2XHFA 2VCTA 2L4QA 1K0DA 2L6DA 5CO3A 3MYDA 2NTOA 3KTBA 5HQPA 1K3LA 3D6IA 3P7XA 2KOKA 5J9CA 3US3A 2OA7A 5AIXA 2H6ZA 2GQLA 3IE3A 4MABA 3DKSA 3FHKA 3FRCA 3QDNA 2EIRA 4EL1A 1WJKA 5HFIA 3C1SA 4NHWA 2BTOT 4KB3A 3TKSA 2C3NA 5ECQB 5CAXA 5ECLB 1PN0A 5C00A 2L6CA 1ZOFA 1Q4JA 1GSUA 4HOJA 1MDIA 1TJDA 1BG1A 5G30A 5J3RA 1UVZA 4RI6A 4YQVA 3LYKA 4PNFA 4KAEA 6GSYA 1G6WA 1V98A 2QKEA 4KGIA 3G9BA 1SU9A 3LSZA 4DVCA 4KE3A 4AI6A 1KTEA 3EURA 2YANA 3UBKA 1OYJA 4PXOA 1FAAA 4F03A 1EP8A 3HA9A 2HRKB 3KTLA 2M72A 2X8GA 1QK8A 4YKGA 3EE2A 5COHA 4GQCA 1PQNA 4MJEA 1T4ZA 3L4NA 3IPZA 4G2EA 3PH9A 16GSA 5CP1A 1IYIA 3Q19A 2B3SA 5KOXA 3IC8A 1YDKA 3ERGA 3ZFLA 4D73B 2YV7A 1SL0B 2YJ7A 3EMPA 1DBYA 4XIHA 5G1LA 1DE1A 3ZVJD 1FB6A 5C04A 3D0ZA 1O8XA 3VK9A 1QQ2A 1MTCA 4K2XA 4OFMA 1GTIA 3ZTLA 3ZIJA 4JRRA 4TR1B 5CRWA 1OVNA 2LS5A 4QMKA 2EFCA 3TJKA 1ACVA 1U88A 4K0NA 1PX6A 5JWQB 4IQ1A 4MJCA 3RPNA 2M46A 4N0ZA 1T8EB 3ZYWA 2L5LA 4HI7A 1MD4A 4USSA 3TKQA 3BOAA 5IIZA 5GAND 3E3EA 1SK0A 2OBIA 3GKNA 1GRXA 1TRSA 4BL7A 1BJXA 2I9HA 4MF6A 3ED3A 1EWXA 1ILOA 5KN0A 3ZFBA 1KNGA 2IWTA 2HSNA 1SL1B 1ZZYA 1V58A 1F2EA 1EP7A 3TJFA 1PKWA 3QAVA 2H6XA 2H1GA 5KN3A 3Q18A 1AQXA 1R26A 3H93A 3QAWA 4PQ1A 4EIQA 1EZKA 3M9JA 1TU8A 2VAFA 3LXZA 1TTZA 3N5OA 2HLSA 1PX7A 2MZCA 4ZL7A 2YZHA 5KEJA 1T3BA 2F8FA 2I1UA 10GSA 3PPUA 5IMCA 1VF3A 2A2RA 2CA8A 1MD3A 1XOBA 2VKZG 2NVLA 3FR6A 4HQSA 4P3YB 2FD3A 2AB6A 3MAKA 1B9XC 3F4SA 2RUFA 4L0WA 3SBCA 2AHEA 4KF9A 3KEBA 3MDKA 1M2BA 2NPBA 4ZL8A 3L0HA 4BWSA 2YOIA 1M0UA 1GNEA 4FQUA 2X8CA 1JZOA 2EFHA 4TR0A 5JCGA 1A2MA 2R5GA 1AXDA 4G0LA 3ZREA 1SKRB 4E68A 3GHAA 1LBKA 3F4RA 2R2JA 2H76A 3CMIA 1AQVA 4PURA 4F9ZA 1DSBA 1URMA 1B4QA 1X0RA 4DSRA 1M99A 1IYHA 4NMUA 3UVHA 2HZEA 2BMXA 1HNAA 4DSSB 2O89A 4LA1A 5IM9A 2VL3A 3BJ5A 4ZL9A 4JR6A 1EEJA 2CAIA 4MZBA 4IGJA 2IMDA 1TRUA 1HD2A 3M9KA 3MWHA 2LUSA 4O7HA 3APQA 4KDYA 5HFGA 2X8HA 2KP1A 5KN1A 4J2FA 4GSTA 1SJ6A 5AN1A 1YJ6A 2MMZA 2YN1A 3RDWA 3SWLA 4MZCA 2M80A 2PPTA 3IXRA 4G19A 2O87A 4LL4B 2ZNMA 2HQTA 3EU3A 3D21A 4OCEA 2N5FA 1WIKA 1USBA 3Q74A 3A3TA 2F8AA 2DKIA 5IOXA 3VWWA 4XS4B 4V1Ap 1GSEA 5ECOB 2CQ9A 3F6FA 5B6NA 2IPAA 1M9BA 3IA1A 5IMAA 3IAM2 4OWYA 3ERFA 1O8WA 3WYWA 2H66A 4NWYA 3IBHA 3A5IA 2RM6A 1ZYPA 1PA3A 2JZRA 5FHIA 2PWJA 3TCOA 1PN9A 3GFKA 2OT3A 4O32A 5IOWA 3VPQA 2VD0A 4X1UA 1WPIA 1WRYA 1FOHA 4L5OA 4ML1A 4EO3A 5G5EA 2RUEA 2E2MA 2L5OA 1WMJA 4PQIA 1ERWA 4KCEA 4GCIA 2K18A 3K8NA 3FY7A 2H1DA 1E6BA 4IELA 2H6YA 4IP1A 2KUCA 4XHMA 3TOTA 2HNLA 4PNGA 2O85A 4YH2A 1ERUA 2HT9A 2MYGA 1HYUA 3C71A 3U6VA 2GS3A 2AYTA 3QOUA 2WB9A 4ULXA 3WT1A 5F8BA 2JACA 3BBYA 2VCXA 4AKGA 2GT6A 4OFNA 3GX8A 3RHCA 2AAWA 4JR4A 4F0CA 4KW6A 5D9VA 2P5QA 2GT5A 2QC7A 3GURA 2LRNA 3FZ5A 3VI5A 4CHSA 3C1RA 3O6TA 1X9SB 3TJJA 4TXVA 2B5XA 2LV3A 5A5KA 1XVWA 3F8UA 4EC0A 4NXIA 4A5PA 4BPYA 3KMNA 1TK5B 4IP6A 2LEGA 2FCHA 4MNNA 1FVKA 2X49A 1K3OA 2DC5A 4K2DA 3M3MA 5D73A 2FY6A 3GTUA 4RI7A 5HR0A 2DJ3A 2DKHA 4YKFA 3IR4A 4JE1A 3IAS2 1UC7A 1K0BA 1GTUA 4WR5A 4QQ7A 4ZB6A 1B4PA 2N5AA 3RHBA 4K1FA 4XTSA 22GSA 3I9V2 4WF4A 4MH2A 1Z7PA 1KEBA 3C8EA 4ECCA 1XWGA 4HZ4A 2YP6A 5GZZB 1AW9A 4BVYA 2VIMA 1Z6MA 1XWKA 2QA2A 4IJ3A 4LMWA 2OACA 4AJ8A 1JFUA 4AKIA 17GSA 4V2LA 4MPFA 5ELGA 3KGKA 2CAQA 4HU9A 5ECKB 2O5VA 4V1Ag 3A2WA 4IBPA 1SK2A 2VCZA 5H5RA 1K0AA 2H71A 3TKRA 4ZBAA 1OAZA 5DJMA 6GSWA 1X5DA 1DE2A 1PMTA 1SK1A 1SVMA 2LRCA 5G5FA 3CRTA 5BRTA 5F0GA 3CXGA 2VCVA 3M8NA 5JWRB 3ZIVA 2LSTA 3TKSC 2GLRA 2F9SA 2K8SA 4TR4A 3APOA 5JCWA 1SJIA 4GRFA 2H72A 3UJ1A 1K3YA 2C3QA 4JZQA 1EGOA 1RW1A 4NV5A 1J08A 4CW9A 2GGTA 1SYRA 3WGDA 4EXJA 2G2QA 2C3TA 5HFKA 1VF2A 3R3EA 2YJHA 4FYBA 1OC9A 4KA0A 4BVXA 1FOVA 1MDJA 1C72A 3TRPA 4G01A 2X4AA 5A4WA 5A1NA 3IC4A 2J23A 3FZ9A 4ISDA 1T00A 4XS6A 5D9WA 2E7PA 2GSRA 1EOGA 3ISOA 3BCIA 4POBA 4GWRA 1SD9A 3LJRA 2HSMA 5DALA 2DIYA 1JZDA 3F4TA 2GSSA 2OADA 5JWOB 2C8UA 3OR5A 5HR1A 4EIPA 2FGXA 2V41A 5ECSA 1XWAA 3DIEA 3MSZA 1GSDA 1FVJA 5KN2A 3IK9A 2ES7A 1AC1A 5IQYA 5J41A 4YQUA 1A2LA 4LLRA 2GVPA 3VWXA 1YVLA 5B7CA 2VL2A 1N2AA 5AIVA 2HRNA 5LD0A 1TI3A 4ECJA 1FHEA 2BJXA 3FKFA 4J57E 2ZUPA 5F07A 2FWEA 5DBQA 5F06A 1PD21 2KLXA 4Z2TA 2CV4A 1SVOA 5H5SA 4HUAA 4EKZA 5B6MA 1GNWA 3KH7A 2DJ1A 5CNWA 1X5EA 3DVWA 4WKWA 3I69A 5ECNB 1O85A 3L9VA 1GTBA 1SJZA 1SKSB 1V40A 3TGZA 2NDOA 1NHYA 1EV4A 1M2DA 4MZWA 2R37A 1GP1A 1T1VA 3FW2A 3TKSE 4FIWA 4E8HA 1GLPA 1O73A 1ZYQB 2IMEA 5D9TA 4IKHA 4GTUA 1LJRA 1B48A 1X5CA 5DQYA 2JU5A 1R4WA 4HZ2A 3CSJA 11GSA 1Q98A 3APSA 4MPGA 3W8SA 2H01A 1GSQA 6GSVA 3GV1A 3GX0A 4K0GA 3W6GA 2HRKA 4XS1A 3GL5A 4TKYA 3TB2A 3UMAA 2B1LA 2H0IA 1CQGA 2LJAA 2P31A 2QA1A 2HYXA 2MMNA 18GSA 3QCPA 5G2ZA 3NOFA 4IVFA 2GQKA 4D73A 4RUVA 3C7MA 2IMFA 1GULA 1TRVA 4JU5A 3EPTA 4TOPA 3HHVA 5A4UA 1Z9HA 1Y25A 3KH9A 19GSA 1PSQA 4ILFA 2R3XA 1HNBA 4TR1A 2A2SA 1K0CA 3F6DA 1ERVA 3TKPA 2IMKA 3HCZA 3NIVA 1XCCA 2R4VA 1N8JA 4ZBBA 3DVXA 2P5RA 4N10A 4NV2A 3ERWA 1QFNA 2E2GA 3LW9A 5IO0A 1A23A 2CX3A 2B5YA 1YY7A 3F9UA 1I5GA 2HI7A 3PR8A 3H79A 3RBTA 2FUG2 1TU7A 3H8QA 2VD1A 4FYCA 5DCHA 1THXA 3CWGA 3ZMLA 1H75A 4FH8A 2FWGA 1O81A 3HDCA 3ZRDA 1Z6NA 1AQWA 2RIIA 4CY8A 2HZEB 2EIOA 4PX1A 1GLQA 3UVTA 3GUSA 3A2XA 3ZMKA 3GKXA 2H75A 14GSA 1PRXA 1XFLA 5BMUB 1GL8A 1Y1UA 1EGRA 4ID0A 2MMAA 5A5HA 1PGTA 3I43A 4OD7A 2VLTA 1J9BA 5J47A 5HR3A 1UN2A 1U87A 2VLUA 3F0IA 3EYTA 5INYA 1XW5A 2PN8A 3O76A 3LORA 1X9MB 1Y6EA 2YZUA 1M9AA 1A8YA 3F63A 5DQSA 5L71A 3QR6A 2IN3A 4EUYA 3TU3B 5FT3A 1ST9A 2CZ2A 3HKRA 1BF5A 2J9HA 2DLXA 2XPDA 2LKUA 4QL7A 1RK4A 2VUPA 5ECRB 2JZTA 4POLA 2O7KA 4OO4A 1F6MC 4POMA 5CRHA 3MIXA 2ON5A 5A4VA 4MA9A 1K0OA 2H73A 1EEMA 4Z7XA 4MF5A 4IW9A 3TJBA 2AV4A 2KHPA 3C73A 5CRGA 1XOAA 4KCAA 3F3QA 3GKMA 4ZB7A 2DMMA 3GL3A 2PVQA 1Z5YE 5ECIB 2HZFA 5LNKe 4I8BA 2GZYA 2YWOA 2VM2A 1HNCA 4ZXGA 2EFEA 3E0UA 4O5UA 5DAKB 2VLVA 2IL3A 4N30A 4NHZA 2RM5A 3AY8A 1PL2A 1EOHA 3PGTA 1Z7RA 1QGVA 5IPHA 4MF7A 4KUNA 2GQMA 3U5RE 2DJKA 2IFQB 2LNTA 3DMLA 3CRUA 1MDKA 1TW9A 1OKDA 1K0NA 2A2PA 2H1AA 3QFBC 3V1WA 12GSA 4YQMA 4X4JA 2YV9A 3EMXA 4AKHA 2PERA 2EIQA 1J0FA 2I3YA 4HQZA 3ZLPA 3IV4A 1SL2B 4RQXA 3TJGA 3VFIA 2IMIA 2WGRA 2PVOC 3FK8A 2REMA 5DDLA 2LTKA 1GSYA 2WS2A 1W4VA 4V2NA 4MK3A 4K5SA 4TXOB 1S3DA 2WCIA 2DSAA 1JHBA 4FYUA 6GSUA 2EFDA 2VCQA 3WGEA 1YEPA 1M2AA 2V6KA 1TP9A 1F3BA 1YQ1A 3WGXA 5ID2B 4PUFC 1TKDB 3GSSA 5B8BA 1YF1A 2UV8G 3HJPA 4PGTA 1BX9A 2Z9SA 4BVYB 6GSTA 1HQOA 6GSXA 3HXSA 2CZ3A 2YPMA 2CX4A 1TDIA 3J7Yk 1BYEA 5CREA 1ZCPA 1GH2A 4K9ZA 5ABRA 3P8WA 2B5EA 5EY6A 1BQ7A 1OC3A 1LU4A 3GIXA 4HEA2 4IN0A 2DJ2A 2XBIA 1SKWB 2WFCA 1ZYNA 5ECMB 5GSTA 5J9BA 1X9WB 1SENA 3CTGA 2MBSA 5A34B 1PKZA 2PU9C 2OE0A 2PUKC 2XC2A 4L0UA 4ACSA 4K8MA 2LNSA 2FWFA 4KSOA 3ZL5A 4JEDA 3ZVJA 5J4YA 2FLSA 2L59A 3VI7A 2OKAA 4DEJA 4G0KA 2TIRA 2H0HA 3UOMA 3TDGA 2P0GA 3UL3A 2D2ZA 1OE7A 4KNDA 1NSWA 2FA8A 3HYPA 1SYXA 4ML6A 1TXXA 2QSIA 1Z3EA 4YAPA 4BVXB 2MBTA 4Z2UA 1XW6A 8GSSA 2IJYA 4POKA 3VWVA 3FMWA 4K7NA 3UARA 1ZYEA 3EU4A 5DJLA 4G9HA 4L5LA 1F3AA 2H30A 3GRXA 4XCSA 4AF2A 3QPMA 3LG6A 4Q5NA 4OO5A 2VL2C 3LXTA 2H1BA 5F05A 2HSMB 2HRFA 5J4VA 5D96A 2C4JA 4GQFA 5DVBA 3EC3A 1TOFA 1F9MA 3GYKA 3HJMA 5IMZA 3TRXA 3D4TA 2OE3A 2CVDA 3HVVA 3FZAA 3D4MA 2WZ9A 4ECIA 1XZOA 3PINA 1A8LA 4MP4A 3FEUA 2A4HA 1V9WA 3HZ4A 3KIJA 4N11A 4QL9A 4YAVA 3KZQA 4WBRD 4EVMA 3IK7A 2V32A 3CYNA 1VGLA 3EWLA 2LJKA 3HY2A 3FR9A 1ON4A 4EF0A 3W8JA 3GN3A 1T4YA 4IHUA 1YEXA 3UBLA 2V2GA 2H70A 2JSYA 4TVEA 1ZGNA 5GSSA 3M1GA 1JZWA 1EV9A 2LRTA 4GXZA 4Q5FA 4BA7A 5HR2A 1XXUA 2DJ0A 2LJRA 4Q5QA 1FO5A 4E8EA 4I5QA 1JLWA 3HD5A 2C1YA 1WOUA 4GLTA 1H4OA 4KDUA 1YZXA 2C0DA 4KDXA 2LQOA 2O8VB 2H1LA 1TXUA 2YWNA 5DCGA 1R5PA 3EVIA 13GSA 1ABAA 3QFAC 2C0EA 3FR3A 3H4KA 1SVLA 2FNOA 3UIWA 2HE3A 3VURA 1G7OA 3IOSA 2GSTA 2OE1A 3BD2A 1K0MA 4AGSA 5G31A 4I2TA 4KH7A 1OC8A 3IDVA 4ECBA 3LGCA 2JL4A 3KXOA 2L57A 1W89A 1XWBA 2C0FA 2YWIA 4DSQA 1XWCA 2VM1A 2B7JA 2K9FA 1ZMAA 2HRAA 3LWAA 4OMVA 4HJ2A 2I81A 4V2MA 3QAGA 5JCUA 2A4VA 2FHEA 5EVOA 3P2AA 1CQHA 2CVBA 3DEXA 1XIYA 1GUHA 4BL7B 1S3CA 3TRQA 3NZNA 4RQRA 2QGVA 2TRXA 4ZB8A 4EDYA 4ICYA 2HSNB 5IMFA 1ERTA 1NW2A 1U3AA 4ZILA 2MMOA 4ZIJA 1A0RP 5KOWA 3GNJA 4LL1B 3M0FA 1FB0A 3LQ7A 4NAXA 2HSYA 2VO4A 1RQMA 4WF5A 5IMVA 4GSSA 3A5WA 4N3ZA 3VPTA 5EL8A 4OCFA 3UEMA 5J40A 3G7YA 3L78A 1QUWA 1M7TA 1QXHA 1V57A 3QMXA 1U3IA 3TUEA 3J7Yb 4NPBA 2YNXA 4WR4A 2CT6A 2FA4A 4KSMA 3GMFA 3Q6OA 4CDOA 4F82A 3F3RA 4TW5A 2F3MA 3KMOA 2RLIA 2KP2A 2EC4A 1V2AA 4G10A 2OJLA 1OKTA 3GH9A 5H5QA 2HXKA 4GF0A 5A5HB 2H74A 4GDFA 2JSZA 2GZZA 2R0CA 1BEDA 4FO5A 3DD3A 2AJQB 3HVXA 5LCZA 3HMJG 4K6XA 1WWJA 2X99A 5E59A 3I6AA 3FYGA 4H86A 3G7IA 1F37A 2FWHA 1GSSA 2YWMA 3DGQA 20GSA 2R0PA 2GSQA 6GSSA 5IMDA 2HFDA 1O7UA 3GSTA 5AISA 2OBKA 4BWQA 1GSFA 3GKKA 1ZL9A 2TRCP 1AUCA 2F51A 3P90A 4MCUA 4MJBA 2DBCA 3E9JB 1XW9A 1G7EA 3KCMA 1B8XA 5BMUA 3S9FA 4HS1A 1TRWA 3CSIA 3JCML 1E2YA 1GUKA 4IQAA 4Q5RA 4MLYA 4O5QA 4MDCA 3WT2A 3UAPA 3HJOA 4MH3A 1S3AA 1YF0A 3CTFA 4DSSA 4W66A 1PL1A 5ENUA 4KX4A 2NBSA 1FG4A 1TK0B 5J5NA 2B1KA 5GAPD 1TK8B 5D9XA 2ON7A 4GSNA 3L9UA 3KM6A 1WE0A 2VCWA 4I2UA 4TN8A 2GTUA 1ML6A 4WETA 2V6OA 3ME8A 5IO2A 1AIUA 3RAZA 4AKXB 3HZ8A 2WDUA 1QMVA 3WD6A 4F2IA 2K8VA 4HJMA 3N9JA 4WXTA 2H0GA 2PBJA 4AJ6A 5D8IA 3DRNA 4CY6A 1VRSD 3VLNA 4AJ7A 4X43A 2XPEA 2VOCA 4XS4A 3ZZXA 1YKCA 2CVKA 2L4CA 2GDRA 1JLVA 9GSSA 1OE8A 4PTSA 3FZ4A 1T7PB 4J56E 4I6XA 3O3TA 1R7HA 1GUMA 3GH6A 4PUAA 3DWVA 1FW1A 1NHOA 3DYRA 5DAKA 4K7OA 3DXBA 1I9DA 3ZITA 4K5RA 5IPGA 2R0GA 4O92A 3IHQA 2XBQA 4MJAA 4HDEA 2C80A 4JBBA 4WEYA 4TR3A 2UZ8A 3MNGA 3RPPA 4WBJA 1THOA 1A0FA 3A2VA 2GZPA 5CRDA 1U6TA 2IFQA 3D5JA 1XPVA 3GA4A 3GTUB 2WJUA 2ALBA 2WRTA 4PQHA 2H8LA 1B9YC 3H1NA 2LQQA 1TI1A 2JADA 2B7KA 3R2QA 3CSHA 4ZBDA 2PGTA 1G6YA 2WULA 4N0VA 4Z2RA 5B8AA 1MEKA 1VF4A 3D22A 1AAZA 1N25A 1SD8A 3BCKA 1A24A 4OFTA 2C0GA 3EINA 1GWCA 5D93A 3KP9A 2AUVA 4L8EA 3ME7A 4XRDA 2R6KA 5AGYA 7GSSA 2N5BA 4TXOA 1GTAA 4EE0A 1JZRA 2PMTA 4EDZA 4MMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP0 A;  1NM3 A;  5ECP B;  1G0T A;  2VL9 A;  4F0B A;  2V1M A;  5ID2 A;  5ELA A;  2DML A;  3QD9 A;  4LMV A;  5J4U A;  5ECH B;  4HU7 A;  3KP8 A;  2I4A A;  3G7J A;  5E4W A;  2E0Q A;  3CBU A;  4G0I A;  3IRA A;  3LEF A;  4TRX A;  1BAY A;  4I97 A;  4O5R A;  4ZB9 A;  3TOU A;  3LFL A;  1BG5 A;  2X64 A;  1YKA A;  3VWU A;  1DUG A;  4IJI A;  4K7I A;  2DIZ A;  3KJY A;  2JZS A;  5EPF A;  4XRA A;  2IIY A;  1OC9 B;  2K6V A;  5FWG A;  5CYY A;  3HVS A;  3LYP A;  2B6M A;  1KBN A;  1UA5 A;  4X0X A;  2H19 A;  2HSH A;  1A2J A;  1XBS A;  2G0F A;  4IS0 A;  2ZCT A;  5G1K A;  1VF1 A;  3KD0 A;  2YCD A;  2DJJ A;  3L9S A;  5DAL B;  1XVQ A;  1R5A A;  1O6J A;  2XHF A;  2VCT A;  2L4Q A;  1K0D A;  2L6D A;  5CO3 A;  2NTO A;  3KTB A;  5HQP A;  1K3L A;  3D6I A;  3P7X A;  2KOK A;  5J9C A;  3US3 A;  2OA7 A;  5AIX A;  2H6Z A;  2GQL A;  3IE3 A;  4MAB A;  3DKS A;  3FHK A;  3FRC A;  3QDN A;  2EIR A;  4EL1 A;  1WJK A;  5HFI A;  3C1S A;  4NHW A;  2BTO T;  4KB3 A;  3TKS A;  2C3N A;  5ECQ B;  5CAX A;  5ECL B;  5C00 A;  2L6C A;  1ZOF A;  1Q4J A;  1GSU A;  4HOJ A;  1MDI A;  1TJD A;  5G30 A;  5J3R A;  1UVZ A;  4RI6 A;  4YQV A;  3LYK A;  4PNF A;  4KAE A;  6GSY A;  1G6W A;  1V98 A;  2QKE A;  4KGI A;  3G9B A;  1SU9 A;  3LSZ A;  4DVC A;  4KE3 A;  1KTE A;  3EUR A;  2YAN A;  3UBK A;  1OYJ A;  4PXO A;  1FAA A;  4F03 A;  1EP8 A;  3HA9 A;  2HRK B;  3KTL A;  2M72 A;  2X8G A;  1QK8 A;  3EE2 A;  5COH A;  4GQC A;  1PQN A;  4MJE A;  1T4Z A;  3L4N A;  3IPZ A;  4G2E A;  3PH9 A;  16GS A;  5CP1 A;  1IYI A;  3Q19 A;  2B3S A;  3IC8 A;  1YDK A;  3ERG A;  3ZFL A;  4D73 B;  2YV7 A;  1SL0 B;  2YJ7 A;  3EMP A;  1DBY A;  4XIH A;  5G1L A;  1DE1 A;  3ZVJ D;  1FB6 A;  5C04 A;  3D0Z A;  1O8X A;  3VK9 A;  1QQ2 A;  1MTC A;  4OFM A;  1GTI A;  3ZTL A;  3ZIJ A;  4JRR A;  4TR1 B;  5CRW A;  1OVN A;  2LS5 A;  3TJK A;  1ACV A;  1U88 A;  4K0N A;  1PX6 A;  5JWQ B;  4IQ1 A;  4MJC A;  3RPN A;  2M46 A;  4N0Z A;  1T8E B;  3ZYW A;  2L5L A;  4HI7 A;  1MD4 A;  4USS A;  3TKQ A;  3BOA A;  5IIZ A;  5GAN D;  3E3E A;  1SK0 A;  2OBI A;  3GKN A;  1GRX A;  1TRS A;  4BL7 A;  1BJX A;  2I9H A;  4MF6 A;  3ED3 A;  1EWX A;  1ILO A;  5KN0 A;  3ZFB A;  1KNG A;  2IWT A;  1SL1 B;  1ZZY A;  1V58 A;  1F2E A;  1EP7 A;  3TJF A;  1PKW A;  3QAV A;  2H6X A;  2H1G A;  5KN3 A;  3Q18 A;  1AQX A;  1R26 A;  3H93 A;  3QAW A;  4PQ1 A;  1EZK A;  3M9J A;  1TU8 A;  2VAF A;  3LXZ A;  1TTZ A;  3N5O A;  2HLS A;  1PX7 A;  2MZC A;  4ZL7 A;  2YZH A;  5KEJ A;  1T3B A;  2F8F A;  2I1U A;  10GS A;  3PPU A;  5IMC A;  1VF3 A;  2A2R A;  2CA8 A;  1MD3 A;  1XOB A;  2NVL A;  3FR6 A;  4HQS A;  4P3Y B;  2FD3 A;  2AB6 A;  3MAK A;  1B9X C;  3F4S A;  2RUF A;  4L0W A;  3SBC A;  2AHE A;  4KF9 A;  3KEB A;  3MDK A;  1M2B A;  2NPB A;  4ZL8 A;  3L0H A;  4BWS A;  2YOI A;  1M0U A;  1GNE A;  4FQU A;  2X8C A;  1JZO A;  4TR0 A;  5JCG A;  1A2M A;  2R5G A;  1AXD A;  4G0L A;  3ZRE A;  1SKR B;  3GHA A;  1LBK A;  3F4R A;  2R2J A;  2H76 A;  3CMI A;  1AQV A;  4PUR A;  4F9Z A;  1DSB A;  1URM A;  1B4Q A;  1X0R A;  4DSR A;  1M99 A;  1IYH A;  4NMU A;  3UVH A;  2HZE A;  2BMX A;  1HNA A;  4DSS B;  2O89 A;  4LA1 A;  5IM9 A;  2VL3 A;  3BJ5 A;  4ZL9 A;  4JR6 A;  1EEJ A;  2CAI A;  4MZB A;  4IGJ A;  2IMD A;  1TRU A;  1HD2 A;  3M9K A;  3MWH A;  2LUS A;  4O7H A;  3APQ A;  4KDY A;  5HFG A;  2X8H A;  2KP1 A;  5KN1 A;  4J2F A;  4GST A;  1SJ6 A;  5AN1 A;  1YJ6 A;  2MMZ A;  2YN1 A;  3RDW A;  3SWL A;  4MZC A;  2M80 A;  2PPT A;  3IXR A;  4G19 A;  2O87 A;  4LL4 B;  2ZNM A;  2HQT A;  3EU3 A;  3D21 A;  4OCE A;  2N5F A;  1WIK A;  1USB A;  3Q74 A;  3A3T A;  2F8A A;  5IOX A;  3VWW A;  4XS4 B;  4V1A p;  1GSE A;  5ECO B;  2CQ9 A;  3F6F A;  5B6N A;  2IPA A;  1M9B A;  3IA1 A;  5IMA A;  3IAM 2;  4OWY A;  3ERF A;  1O8W A;  3WYW A;  2H66 A;  4NWY A;  3IBH A;  2RM6 A;  1PA3 A;  2JZR A;  5FHI A;  2PWJ A;  3TCO A;  1PN9 A;  3GFK A;  4O32 A;  5IOW A;  3VPQ A;  2VD0 A;  4X1U A;  1WPI A;  1WRY A;  4L5O A;  4ML1 A;  4EO3 A;  5G5E A;  2RUE A;  2E2M A;  2L5O A;  1WMJ A;  4PQI A;  1ERW A;  4KCE A;  4GCI A;  2K18 A;  3K8N A;  3FY7 A;  2H1D A;  1E6B A;  4IEL A;  2H6Y A;  4IP1 A;  2KUC A;  4XHM A;  3TOT A;  2HNL A;  4PNG A;  2O85 A;  4YH2 A;  1ERU A;  2HT9 A;  2MYG A;  1HYU A;  3C71 A;  3U6V A;  2GS3 A;  2AYT A;  3QOU A;  2WB9 A;  4ULX A;  3WT1 A;  5F8B A;  2JAC A;  3BBY A;  2VCX A;  2GT6 A;  4OFN A;  3GX8 A;  3RHC A;  2AAW A;  4JR4 A;  4F0C A;  4KW6 A;  5D9V A;  2P5Q A;  2GT5 A;  2QC7 A;  3GUR A;  2LRN A;  3FZ5 A;  3VI5 A;  4CHS A;  3C1R A;  3O6T A;  1X9S B;  3TJJ A;  4TXV A;  2B5X A;  2LV3 A;  5A5K A;  1XVW A;  3F8U A;  4EC0 A;  4NXI A;  4BPY A;  3KMN A;  1TK5 B;  4IP6 A;  2LEG A;  2FCH A;  1FVK A;  1K3O A;  2DC5 A;  4K2D A;  3M3M A;  5D73 A;  2FY6 A;  3GTU A;  4RI7 A;  5HR0 A;  2DJ3 A;  3IR4 A;  4JE1 A;  3IAS 2;  1UC7 A;  1K0B A;  1GTU A;  4WR5 A;  4QQ7 A;  4ZB6 A;  1B4P A;  2N5A A;  3RHB A;  4K1F A;  4XTS A;  22GS A;  3I9V 2;  4WF4 A;  4MH2 A;  1Z7P A;  1KEB A;  3C8E A;  4ECC A;  1XWG A;  4HZ4 A;  2YP6 A;  5GZZ B;  1AW9 A;  4BVY A;  2VIM A;  1Z6M A;  1XWK A;  4IJ3 A;  4LMW A;  2OAC A;  4AJ8 A;  1JFU A;  17GS A;  4V2L A;  4MPF A;  5ELG A;  3KGK A;  2CAQ A;  4HU9 A;  5ECK B;  4V1A g;  3A2W A;  4IBP A;  1SK2 A;  2VCZ A;  5H5R A;  1K0A A;  2H71 A;  3TKR A;  4ZBA A;  1OAZ A;  5DJM A;  6GSW A;  1X5D A;  1DE2 A;  1PMT A;  1SK1 A;  2LRC A;  5G5F A;  3CRT A;  5F0G A;  3CXG A;  2VCV A;  3M8N A;  5JWR B;  3ZIV A;  2LST A;  3TKS C;  2GLR A;  2F9S A;  2K8S A;  4TR4 A;  3APO A;  5JCW A;  1SJI A;  4GRF A;  2H72 A;  3UJ1 A;  1K3Y A;  2C3Q A;  4JZQ A;  1EGO A;  1RW1 A;  4NV5 A;  1J08 A;  4CW9 A;  2GGT A;  1SYR A;  3WGD A;  4EXJ A;  2G2Q A;  2C3T A;  5HFK A;  1VF2 A;  3R3E A;  2YJH A;  4FYB A;  1OC9 A;  4KA0 A;  4BVX A;  1FOV A;  1MDJ A;  1C72 A;  3TRP A;  5A4W A;  3IC4 A;  2J23 A;  3FZ9 A;  4ISD A;  1T00 A;  4XS6 A;  5D9W A;  2E7P A;  2GSR A;  1EOG A;  3ISO A;  3BCI A;  4POB A;  4GWR A;  1SD9 A;  3LJR A;  2HSM A;  5DAL A;  2DIY A;  1JZD A;  3F4T A;  2GSS A;  2OAD A;  5JWO B;  2C8U A;  3OR5 A;  5HR1 A;  2FGX A;  2V41 A;  5ECS A;  1XWA A;  3DIE A;  3MSZ A;  1GSD A;  1FVJ A;  5KN2 A;  3IK9 A;  2ES7 A;  1AC1 A;  5IQY A;  5J41 A;  4YQU A;  1A2L A;  4LLR A;  2GVP A;  3VWX A;  5B7C A;  2VL2 A;  1N2A A;  5AIV A;  2HRN A;  5LD0 A;  1TI3 A;  4ECJ A;  1FHE A;  2BJX A;  3FKF A;  4J57 E;  2ZUP A;  5F07 A;  2FWE A;  5DBQ A;  5F06 A;  1PD2 1;  2KLX A;  2CV4 A;  5H5S A;  4HUA A;  4EKZ A;  5B6M A;  1GNW A;  3KH7 A;  2DJ1 A;  5CNW A;  1X5E A;  3DVW A;  4WKW A;  3I69 A;  5ECN B;  1O85 A;  3L9V A;  1GTB A;  1SJZ A;  1SKS B;  1V40 A;  3TGZ A;  2NDO A;  1NHY A;  1EV4 A;  1M2D A;  4MZW A;  2R37 A;  1GP1 A;  1T1V A;  3FW2 A;  3TKS E;  4FIW A;  4E8H A;  1GLP A;  1O73 A;  1ZYQ B;  2IME A;  5D9T A;  4IKH A;  4GTU A;  1LJR A;  1B48 A;  1X5C A;  5DQY A;  2JU5 A;  1R4W A;  4HZ2 A;  3CSJ A;  11GS A;  1Q98 A;  3APS A;  4MPG A;  3W8S A;  2H01 A;  1GSQ A;  6GSV A;  3GV1 A;  3GX0 A;  4K0G A;  3W6G A;  2HRK A;  4XS1 A;  3GL5 A;  4TKY A;  3TB2 A;  3UMA A;  2B1L A;  2H0I A;  1CQG A;  2LJA A;  2P31 A;  2HYX A;  2MMN A;  18GS A;  3QCP A;  5G2Z A;  3NOF A;  4IVF A;  2GQK A;  4D73 A;  4RUV A;  3C7M A;  2IMF A;  1GUL A;  1TRV A;  4JU5 A;  4TOP A;  3HHV A;  5A4U A;  1Z9H A;  1Y25 A;  3KH9 A;  19GS A;  1PSQ A;  4ILF A;  2R3X A;  1HNB A;  4TR1 A;  2A2S A;  1K0C A;  3F6D A;  1ERV A;  3TKP A;  2IMK A;  3HCZ A;  3NIV A;  1XCC A;  2R4V A;  1N8J A;  4ZBB A;  3DVX A;  2P5R A;  4N10 A;  4NV2 A;  3ERW A;  1QFN A;  2E2G A;  5IO0 A;  1A23 A;  2CX3 A;  2B5Y A;  1YY7 A;  3F9U A;  1I5G A;  2HI7 A;  3PR8 A;  3H79 A;  3RBT A;  2FUG 2;  1TU7 A;  3H8Q A;  2VD1 A;  4FYC A;  5DCH A;  1THX A;  3ZML A;  1H75 A;  4FH8 A;  2FWG A;  1O81 A;  3HDC A;  3ZRD A;  1Z6N A;  1AQW A;  2RII A;  2HZE B;  2EIO A;  4PX1 A;  1GLQ A;  3UVT A;  3GUS A;  3A2X A;  3ZMK A;  3GKX A;  2H75 A;  14GS A;  1PRX A;  1XFL A;  1GL8 A;  1EGR A;  4ID0 A;  2MMA A;  1PGT A;  3I43 A;  4OD7 A;  2VLT A;  1J9B A;  5HR3 A;  1UN2 A;  1U87 A;  2VLU A;  3F0I A;  3EYT A;  5INY A;  1XW5 A;  2PN8 A;  3O76 A;  3LOR A;  1X9M B;  1Y6E A;  2YZU A;  1M9A A;  1A8Y A;  3F63 A;  5DQS A;  5L71 A;  3QR6 A;  2IN3 A;  4EUY A;  5FT3 A;  1ST9 A;  2CZ2 A;  3HKR A;  2J9H A;  2DLX A;  2XPD A;  2LKU A;  4QL7 A;  1RK4 A;  2VUP A;  5ECR B;  2JZT A;  4POL A;  2O7K A;  4OO4 A;  1F6M C;  4POM A;  5CRH A;  2ON5 A;  5A4V A;  4MA9 A;  1K0O A;  2H73 A;  1EEM A;  4Z7X A;  4MF5 A;  4IW9 A;  3TJB A;  2AV4 A;  2KHP A;  3C73 A;  5CRG A;  1XOA A;  4KCA A;  3F3Q A;  3GKM A;  2DMM A;  3GL3 A;  2PVQ A;  1Z5Y E;  5ECI B;  2HZF A;  5LNK e;  4I8B A;  2GZY A;  2YWO A;  2VM2 A;  1HNC A;  4ZXG A;  3E0U A;  5DAK B;  2VLV A;  2IL3 A;  4N30 A;  4NHZ A;  2RM5 A;  3AY8 A;  1PL2 A;  1EOH A;  3PGT A;  1Z7R A;  1QGV A;  5IPH A;  4MF7 A;  4KUN A;  2GQM A;  3U5R E;  2DJK A;  2IFQ B;  2LNT A;  3DML A;  3CRU A;  1MDK A;  1TW9 A;  1OKD A;  1K0N A;  2H1A A;  3QFB C;  3V1W A;  12GS A;  4YQM A;  2YV9 A;  3EMX A;  2PER A;  2EIQ A;  1J0F A;  2I3Y A;  4HQZ A;  3ZLP A;  3IV4 A;  1SL2 B;  4RQX A;  3TJG A;  3VFI A;  2IMI A;  2WGR A;  2PVO C;  3FK8 A;  2REM A;  5DDL A;  2LTK A;  1GSY A;  2WS2 A;  1W4V A;  4V2N A;  4MK3 A;  4TXO B;  1S3D A;  2WCI A;  2DSA A;  1JHB A;  4FYU A;  6GSU A;  2VCQ A;  3WGE A;  1YEP A;  1M2A A;  2V6K A;  1TP9 A;  1F3B A;  1YQ1 A;  3WGX A;  5ID2 B;  4PUF C;  1TKD B;  3GSS A;  5B8B A;  1YF1 A;  3HJP A;  4PGT A;  1BX9 A;  2Z9S A;  4BVY B;  6GST A;  1HQO A;  6GSX A;  3HXS A;  2CZ3 A;  2YPM A;  2CX4 A;  1TDI A;  3J7Y k;  1BYE A;  5CRE A;  1ZCP A;  1GH2 A;  4K9Z A;  5ABR A;  3P8W A;  2B5E A;  5EY6 A;  1BQ7 A;  1OC3 A;  1LU4 A;  3GIX A;  4HEA 2;  4IN0 A;  2DJ2 A;  2XBI A;  1SKW B;  2WFC A;  5ECM B;  5GST A;  5J9B A;  1X9W B;  1SEN A;  3CTG A;  2MBS A;  1PKZ A;  2PU9 C;  2OE0 A;  2PUK C;  2XC2 A;  4L0U A;  4ACS A;  4K8M A;  2LNS A;  2FWF A;  4KSO A;  3ZL5 A;  4JED A;  3ZVJ A;  2FLS A;  2L59 A;  3VI7 A;  2OKA A;  4DEJ A;  4G0K A;  2TIR A;  2H0H A;  3UOM A;  3TDG A;  2P0G A;  3UL3 A;  2D2Z A;  1OE7 A;  4KND A;  1NSW A;  2FA8 A;  3HYP A;  1SYX A;  4ML6 A;  1TXX A;  2QSI A;  1Z3E A;  4YAP A;  4BVX B;  2MBT A;  1XW6 A;  8GSS A;  2IJY A;  4POK A;  3VWV A;  4K7N A;  3UAR A;  1ZYE A;  3EU4 A;  5DJL A;  4G9H A;  4L5L A;  1F3A A;  2H30 A;  3GRX A;  4XCS A;  4AF2 A;  3QPM A;  3LG6 A;  4Q5N A;  4OO5 A;  2VL2 C;  3LXT A;  2H1B A;  5F05 A;  2HSM B;  2HRF A;  5D96 A;  2C4J A;  4GQF A;  5DVB A;  3EC3 A;  1TOF A;  1F9M A;  3GYK A;  3HJM A;  5IMZ A;  3TRX A;  3D4T A;  2OE3 A;  2CVD A;  3HVV A;  3FZA A;  3D4M A;  2WZ9 A;  4ECI A;  1XZO A;  3PIN A;  1A8L A;  4MP4 A;  3FEU A;  1V9W A;  3HZ4 A;  3KIJ A;  4N11 A;  4QL9 A;  4YAV A;  3KZQ A;  4WBR D;  4EVM A;  3IK7 A;  2V32 A;  3CYN A;  1VGL A;  3EWL A;  2LJK A;  3HY2 A;  3FR9 A;  1ON4 A;  4EF0 A;  3W8J A;  3GN3 A;  1T4Y A;  4IHU A;  1YEX A;  3UBL A;  2V2G A;  2H70 A;  2JSY A;  4TVE A;  1ZGN A;  5GSS A;  3M1G A;  1JZW A;  1EV9 A;  2LRT A;  4GXZ A;  4Q5F A;  4BA7 A;  5HR2 A;  1XXU A;  2DJ0 A;  2LJR A;  4Q5Q A;  1FO5 A;  4E8E A;  4I5Q A;  1JLW A;  3HD5 A;  2C1Y A;  1WOU A;  4GLT A;  1H4O A;  4KDU A;  1YZX A;  2C0D A;  4KDX A;  2LQO A;  2O8V B;  2YWN A;  5DCG A;  1R5P A;  3EVI A;  13GS A;  1ABA A;  3QFA C;  2C0E A;  3FR3 A;  3H4K A;  2FNO A;  3UIW A;  2HE3 A;  3VUR A;  1G7O A;  3IOS A;  2GST A;  2OE1 A;  3BD2 A;  1K0M A;  4AGS A;  5G31 A;  4I2T A;  4KH7 A;  1OC8 A;  3IDV A;  4ECB A;  3LGC A;  2JL4 A;  3KXO A;  2L57 A;  1W89 A;  1XWB A;  2C0F A;  2YWI A;  4DSQ A;  1XWC A;  2VM1 A;  2B7J A;  2K9F A;  1ZMA A;  2HRA A;  3LWA A;  4OMV A;  4HJ2 A;  2I81 A;  4V2M A;  3QAG A;  5JCU A;  2A4V A;  2FHE A;  5EVO A;  3P2A A;  1CQH A;  2CVB A;  3DEX A;  1XIY A;  1GUH A;  4BL7 B;  1S3C A;  3TRQ A;  3NZN A;  4RQR A;  2QGV A;  2TRX A;  4ZB8 A;  4EDY A;  2HSN B;  5IMF A;  1ERT A;  1NW2 A;  1U3A A;  4ZIL A;  2MMO A;  4ZIJ A;  1A0R P;  3GNJ A;  4LL1 B;  3M0F A;  1FB0 A;  3LQ7 A;  4NAX A;  2HSY A;  2VO4 A;  1RQM A;  4WF5 A;  5IMV A;  4GSS A;  3A5W A;  3VPT A;  5EL8 A;  4OCF A;  3UEM A;  3G7Y A;  3L78 A;  1QUW A;  1M7T A;  1QXH A;  1V57 A;  3QMX A;  1U3I A;  3TUE A;  3J7Y b;  4NPB A;  2YNX A;  4WR4 A;  2CT6 A;  2FA4 A;  4KSM A;  3GMF A;  3Q6O A;  4CDO A;  4F82 A;  3F3R A;  4TW5 A;  2F3M A;  3KMO A;  2RLI A;  2KP2 A;  2EC4 A;  1V2A A;  4G10 A;  2OJL A;  1OKT A;  3GH9 A;  5H5Q A;  2HXK A;  4GF0 A;  2H74 A;  2JSZ A;  2GZZ A;  1BED A;  4FO5 A;  3DD3 A;  2AJQ B;  3HVX A;  5LCZ A;  4K6X A;  1WWJ A;  2X99 A;  5E59 A;  3I6A A;  3FYG A;  4H86 A;  3G7I A;  1F37 A;  2FWH A;  1GSS A;  2YWM A;  3DGQ A;  20GS A;  2GSQ A;  6GSS A;  5IMD A;  2HFD A;  1O7U A;  3GST A;  5AIS A;  2OBK A;  4BWQ A;  1GSF A;  3GKK A;  1ZL9 A;  2TRC P;  1AUC A;  2F51 A;  3P90 A;  4MCU A;  4MJB A;  2DBC A;  3E9J B;  1XW9 A;  1G7E A;  3KCM A;  1B8X A;  5BMU A;  3S9F A;  4HS1 A;  1TRW A;  3CSI A;  3JCM L;  1E2Y A;  1GUK A;  4IQA A;  4Q5R A;  4MLY A;  4MDC A;  3WT2 A;  3UAP A;  3HJO A;  4MH3 A;  1S3A A;  1YF0 A;  3CTF A;  4DSS A;  1PL1 A;  5ENU A;  4KX4 A;  2NBS A;  1FG4 A;  1TK0 B;  5J5N A;  2B1K A;  5GAP D;  1TK8 B;  5D9X A;  2ON7 A;  4GSN A;  3L9U A;  3KM6 A;  1WE0 A;  2VCW A;  4I2U A;  4TN8 A;  2GTU A;  1ML6 A;  4WET A;  2V6O A;  3ME8 A;  5IO2 A;  1AIU A;  3RAZ A;  3HZ8 A;  2WDU A;  1QMV A;  3WD6 A;  4F2I A;  2K8V A;  4HJM A;  3N9J A;  4WXT A;  2H0G A;  2PBJ A;  4AJ6 A;  5D8I A;  3DRN A;  1VRS D;  3VLN A;  4AJ7 A;  4X43 A;  2XPE A;  2VOC A;  4XS4 A;  3ZZX A;  1YKC A;  2CVK A;  2L4C A;  2GDR A;  1JLV A;  9GSS A;  1OE8 A;  4PTS A;  3FZ4 A;  1T7P B;  4J56 E;  4I6X A;  3O3T A;  1R7H A;  1GUM A;  3GH6 A;  4PUA A;  3DWV A;  1FW1 A;  1NHO A;  3DYR A;  5DAK A;  4K7O A;  3DXB A;  1I9D A;  3ZIT A;  5IPG A;  4O92 A;  3IHQ A;  2XBQ A;  4MJA A;  4HDE A;  2C80 A;  4JBB A;  4WEY A;  4TR3 A;  2UZ8 A;  3MNG A;  3RPP A;  4WBJ A;  1THO A;  1A0F A;  3A2V A;  2GZP A;  5CRD A;  1U6T A;  2IFQ A;  3D5J A;  1XPV A;  3GA4 A;  3GTU B;  2WJU A;  2ALB A;  2WRT A;  4PQH A;  2H8L A;  1B9Y C;  3H1N A;  2LQQ A;  1TI1 A;  2JAD A;  2B7K A;  3R2Q A;  3CSH A;  4ZBD A;  2PGT A;  1G6Y A;  2WUL A;  4N0V A;  5B8A A;  1MEK A;  1VF4 A;  3D22 A;  1AAZ A;  1SD8 A;  3BCK A;  1A24 A;  4OFT A;  2C0G A;  3EIN A;  1GWC A;  5D93 A;  3KP9 A;  2AUV A;  4L8E A;  3ME7 A;  4XRD A;  2R6K A;  5AGY A;  7GSS A;  2N5B A;  4TXO A;  1GTA A;  4EE0 A;  1JZR A;  2PMT A;  4EDZ A;  4MMM A; 
#chains in the Genus database with same CATH topology
 1WP0 A;  1NM3 A;  5ECP B;  1G0T A;  2VL9 A;  4F0B A;  2V1M A;  5ID2 A;  5ELA A;  2DML A;  3QD9 A;  4LMV A;  5J4U A;  5ECH B;  4HU7 A;  3KP8 A;  2I4A A;  3G7J A;  5E4W A;  2E0Q A;  3CBU A;  4G0I A;  3IRA A;  3LEF A;  4TRX A;  1BAY A;  4I97 A;  4O5R A;  4ZB9 A;  3TOU A;  3LFL A;  1BG5 A;  2X64 A;  1YKA A;  3VWU A;  1DUG A;  4IJI A;  4K7I A;  2DIZ A;  3KJY A;  2JZS A;  5EPF A;  4XRA A;  2IIY A;  1OC9 B;  2K6V A;  5FWG A;  5CYY A;  3HVS A;  5A34 A;  3LYP A;  3IHG A;  2B6M A;  1KBN A;  1UA5 A;  5A1N B;  4X0X A;  2H19 A;  2HSH A;  1A2J A;  1XBS A;  2G0F A;  4IS0 A;  2ZCT A;  5G1K A;  1VF1 A;  3KD0 A;  2YCD A;  2DJJ A;  3L9S A;  5DAL B;  3CHX C;  1XVQ A;  1R5A A;  1O6J A;  2XHF A;  2VCT A;  2L4Q A;  1K0D A;  2L6D A;  5CO3 A;  3MYD A;  2WW3 A;  2NTO A;  3KTB A;  5HQP A;  1K3L A;  3D6I A;  3P7X A;  2KOK A;  5J9C A;  3US3 A;  2OA7 A;  5AIX A;  2H6Z A;  2GQL A;  3IE3 A;  4MAB A;  3DKS A;  3FHK A;  3FRC A;  3QDN A;  2EIR A;  4EL1 A;  1WJK A;  5HFI A;  3C1S A;  4NHW A;  2BTO T;  4KB3 A;  3TKS A;  2C3N A;  5ECQ B;  5CAX A;  5ECL B;  1PN0 A;  5C00 A;  2L6C A;  1ZOF A;  1Q4J A;  1GSU A;  4HOJ A;  1MDI A;  1TJD A;  1BG1 A;  5G30 A;  5J3R A;  1UVZ A;  4RI6 A;  4YQV A;  3LYK A;  4PNF A;  4KAE A;  6GSY A;  1G6W A;  1V98 A;  2QKE A;  4KGI A;  3G9B A;  1SU9 A;  3LSZ A;  4DVC A;  4KE3 A;  4AI6 A;  1KTE A;  3EUR A;  2YAN A;  3UBK A;  1OYJ A;  4PXO A;  1FAA A;  4F03 A;  1EP8 A;  3HA9 A;  2HRK B;  3KTL A;  2M72 A;  2X8G A;  1QK8 A;  4YKG A;  3EE2 A;  5COH A;  4GQC A;  1PQN A;  4MJE A;  1T4Z A;  3L4N A;  3IPZ A;  4G2E A;  3PH9 A;  16GS A;  5CP1 A;  1IYI A;  3Q19 A;  2B3S A;  5KOX A;  3IC8 A;  1YDK A;  3ERG A;  3ZFL A;  4D73 B;  2YV7 A;  1SL0 B;  2YJ7 A;  3EMP A;  1DBY A;  4XIH A;  5G1L A;  1DE1 A;  3ZVJ D;  1FB6 A;  5C04 A;  3D0Z A;  1O8X A;  3VK9 A;  1QQ2 A;  1MTC A;  4K2X A;  4OFM A;  1GTI A;  3ZTL A;  3ZIJ A;  4JRR A;  4TR1 B;  5CRW A;  1OVN A;  2LS5 A;  4QMK A;  2EFC A;  3TJK A;  1ACV A;  1U88 A;  4K0N A;  1PX6 A;  5JWQ B;  4IQ1 A;  4MJC A;  3RPN A;  2M46 A;  4N0Z A;  1T8E B;  3ZYW A;  2L5L A;  4HI7 A;  1MD4 A;  4USS A;  3TKQ A;  3BOA A;  5IIZ A;  5GAN D;  3E3E A;  1SK0 A;  2OBI A;  3GKN A;  1GRX A;  1TRS A;  4BL7 A;  1BJX A;  2I9H A;  4MF6 A;  3ED3 A;  1EWX A;  1ILO A;  5KN0 A;  3ZFB A;  1KNG A;  2IWT A;  2HSN A;  1SL1 B;  1ZZY A;  1V58 A;  1F2E A;  1EP7 A;  3TJF A;  1PKW A;  3QAV A;  2H6X A;  2H1G A;  5KN3 A;  3Q18 A;  1AQX A;  1R26 A;  3H93 A;  3QAW A;  4PQ1 A;  4EIQ A;  1EZK A;  3M9J A;  1TU8 A;  2VAF A;  3LXZ A;  1TTZ A;  3N5O A;  2HLS A;  1PX7 A;  2MZC A;  4ZL7 A;  2YZH A;  5KEJ A;  1T3B A;  2F8F A;  2I1U A;  10GS A;  3PPU A;  5IMC A;  1VF3 A;  2A2R A;  2CA8 A;  1MD3 A;  1XOB A;  2VKZ G;  2NVL A;  3FR6 A;  4HQS A;  4P3Y B;  2FD3 A;  2AB6 A;  3MAK A;  1B9X C;  3F4S A;  2RUF A;  4L0W A;  3SBC A;  2AHE A;  4KF9 A;  3KEB A;  3MDK A;  1M2B A;  2NPB A;  4ZL8 A;  3L0H A;  4BWS A;  2YOI A;  1M0U A;  1GNE A;  4FQU A;  2X8C A;  1JZO A;  2EFH A;  4TR0 A;  5JCG A;  1A2M A;  2R5G A;  1AXD A;  4G0L A;  3ZRE A;  1SKR B;  4E68 A;  3GHA A;  1LBK A;  3F4R A;  2R2J A;  2H76 A;  3CMI A;  1AQV A;  4PUR A;  4F9Z A;  1DSB A;  1URM A;  1B4Q A;  1X0R A;  4DSR A;  1M99 A;  1IYH A;  4NMU A;  3UVH A;  2HZE A;  2BMX A;  1HNA A;  4DSS B;  2O89 A;  4LA1 A;  5IM9 A;  2VL3 A;  3BJ5 A;  4ZL9 A;  4JR6 A;  1EEJ A;  2CAI A;  4MZB A;  4IGJ A;  2IMD A;  1TRU A;  1HD2 A;  3M9K A;  3MWH A;  2LUS A;  4O7H A;  3APQ A;  4KDY A;  5HFG A;  2X8H A;  2KP1 A;  5KN1 A;  4J2F A;  4GST A;  1SJ6 A;  5AN1 A;  1YJ6 A;  2MMZ A;  2YN1 A;  3RDW A;  3SWL A;  4MZC A;  2M80 A;  2PPT A;  3IXR A;  4G19 A;  2O87 A;  4LL4 B;  2ZNM A;  2HQT A;  3EU3 A;  3D21 A;  4OCE A;  2N5F A;  2WW0 A;  1WIK A;  1USB A;  3Q74 A;  3A3T A;  2F8A A;  2DKI A;  5IOX A;  3VWW A;  4XS4 B;  4V1A p;  1GSE A;  5ECO B;  2CQ9 A;  3F6F A;  5B6N A;  2IPA A;  1M9B A;  3IA1 A;  5IMA A;  3IAM 2;  4OWY A;  3ERF A;  1O8W A;  3WYW A;  2H66 A;  4NWY A;  3IBH A;  3A5I A;  2RM6 A;  1ZYP A;  1PA3 A;  2JZR A;  5FHI A;  2PWJ A;  3TCO A;  1PN9 A;  3GFK A;  2OT3 A;  4O32 A;  5IOW A;  3VPQ A;  2VD0 A;  4X1U A;  1WPI A;  1WRY A;  1FOH A;  4L5O A;  4ML1 A;  4EO3 A;  5G5E A;  2RUE A;  2E2M A;  2L5O A;  1WMJ A;  4PQI A;  1ERW A;  4KCE A;  4GCI A;  2K18 A;  3K8N A;  3FY7 A;  2H1D A;  1E6B A;  4IEL A;  2H6Y A;  4IP1 A;  2KUC A;  4XHM A;  3TOT A;  2HNL A;  4PNG A;  2O85 A;  4YH2 A;  1ERU A;  2HT9 A;  2MYG A;  1HYU A;  3C71 A;  3U6V A;  2GS3 A;  2AYT A;  3QOU A;  2WB9 A;  4ULX A;  3WT1 A;  5F8B A;  2JAC A;  3BBY A;  2VCX A;  4AKG A;  2GT6 A;  4OFN A;  3GX8 A;  3RHC A;  2AAW A;  4JR4 A;  4F0C A;  4KW6 A;  5D9V A;  2P5Q A;  2GT5 A;  2QC7 A;  3GUR A;  2LRN A;  3FZ5 A;  3VI5 A;  4CHS A;  3C1R A;  3O6T A;  1X9S B;  3TJJ A;  4TXV A;  1XG8 A;  2B5X A;  2LV3 A;  5A5K A;  1XVW A;  3F8U A;  4EC0 A;  4NXI A;  4A5P A;  4BPY A;  3KMN A;  1TK5 B;  4IP6 A;  2LEG A;  2FCH A;  4MNN A;  1FVK A;  2X49 A;  1K3O A;  2DC5 A;  4K2D A;  3M3M A;  5D73 A;  2FY6 A;  3GTU A;  4RI7 A;  5HR0 A;  2DJ3 A;  2DKH A;  4YKF A;  3IR4 A;  4JE1 A;  3IAS 2;  1UC7 A;  1K0B A;  1GTU A;  4WR5 A;  4QQ7 A;  4ZB6 A;  1B4P A;  2N5A A;  3RHB A;  4K1F A;  4XTS A;  22GS A;  3I9V 2;  4WF4 A;  4MH2 A;  1Z7P A;  1KEB A;  3C8E A;  4ECC A;  1XWG A;  4HZ4 A;  2YP6 A;  5GZZ B;  1AW9 A;  4BVY A;  2VIM A;  1Z6M A;  1XWK A;  2QA2 A;  4IJ3 A;  4LMW A;  2OAC A;  4AJ8 A;  1JFU A;  4AKI A;  17GS A;  4BIK A;  4V2L A;  4MPF A;  5ELG A;  3KGK A;  2CAQ A;  4HU9 A;  5ECK B;  2O5V A;  4V1A g;  3A2W A;  4IBP A;  1SK2 A;  2VCZ A;  5H5R A;  1K0A A;  2H71 A;  3TKR A;  4ZBA A;  1OAZ A;  5DJM A;  6GSW A;  1X5D A;  1DE2 A;  1PMT A;  1SK1 A;  1PFO A;  1SVM A;  2LRC A;  5G5F A;  3CRT A;  5BRT A;  5F0G A;  3CXG A;  2VCV A;  3M8N A;  5JWR B;  3ZIV A;  2LST A;  3TKS C;  2GLR A;  2F9S A;  2K8S A;  4TR4 A;  3APO A;  5JCW A;  1SJI A;  4GRF A;  2H72 A;  3UJ1 A;  1K3Y A;  2C3Q A;  4JZQ A;  1EGO A;  1S4B P;  1RW1 A;  4NV5 A;  1J08 A;  4CW9 A;  2GGT A;  1SYR A;  3WGD A;  4EXJ A;  2G2Q A;  2C3T A;  5HFK A;  1VF2 A;  3R3E A;  2YJH A;  4FYB A;  1OC9 A;  4KA0 A;  4BVX A;  1FOV A;  1MDJ A;  1C72 A;  4PI0 C;  3TRP A;  4G01 A;  2X4A A;  5A4W A;  5A1N A;  3IC4 A;  2J23 A;  3FZ9 A;  4ISD A;  1T00 A;  4XS6 A;  5D9W A;  2E7P A;  2GSR A;  1EOG A;  3ISO A;  3BCI A;  4POB A;  4GWR A;  2WW1 A;  1SD9 A;  3LJR A;  2HSM A;  5DAL A;  2DIY A;  1JZD A;  3F4T A;  2GSS A;  2OAD A;  5JWO B;  2C8U A;  3OR5 A;  5HR1 A;  4EIP A;  2FGX A;  2V41 A;  5ECS A;  1XWA A;  3DIE A;  3MSZ A;  1GSD A;  1FVJ A;  5KN2 A;  3IK9 A;  2ES7 A;  1AC1 A;  5IQY A;  5J41 A;  4YQU A;  1A2L A;  4LLR A;  2GVP A;  3VWX A;  1YVL A;  5B7C A;  2VL2 A;  1N2A A;  5AIV A;  2HRN A;  5LD0 A;  1TI3 A;  4ECJ A;  1FHE A;  2BJX A;  3FKF A;  4J57 E;  2ZUP A;  5F07 A;  2FWE A;  5DBQ A;  5F06 A;  1PD2 1;  2KLX A;  4Z2T A;  2CV4 A;  1SVO A;  5H5S A;  4HUA A;  4EKZ A;  5B6M A;  1GNW A;  3KH7 A;  2DJ1 A;  5CNW A;  1X5E A;  3DVW A;  4WKW A;  3I69 A;  5ECN B;  1O85 A;  3L9V A;  1GTB A;  1SJZ A;  1SKS B;  1V40 A;  3TGZ A;  2NDO A;  1NHY A;  1EV4 A;  1M2D A;  4MZW A;  2R37 A;  1GP1 A;  1T1V A;  3FW2 A;  3TKS E;  4FIW A;  4E8H A;  1GLP A;  1O73 A;  1ZYQ B;  2IME A;  5D9T A;  4IKH A;  4GTU A;  1LJR A;  1B48 A;  1X5C A;  5DQY A;  2JU5 A;  1R4W A;  4HZ2 A;  3CSJ A;  11GS A;  1Q98 A;  3APS A;  4MPG A;  3W8S A;  2H01 A;  1GSQ A;  6GSV A;  3GV1 A;  3GX0 A;  4K0G A;  3W6G A;  2HRK A;  4XS1 A;  3GL5 A;  4TKY A;  3TB2 A;  3UMA A;  2B1L A;  2H0I A;  1CQG A;  2LJA A;  2P31 A;  2QA1 A;  2HYX A;  2MMN A;  18GS A;  3QCP A;  5G2Z A;  2WVZ A;  3NOF A;  4IVF A;  2GQK A;  4D73 A;  4RUV A;  3C7M A;  2IMF A;  1GUL A;  1TRV A;  4JU5 A;  3EPT A;  4TOP A;  3HHV A;  5A4U A;  1Z9H A;  1Y25 A;  3KH9 A;  19GS A;  1PSQ A;  4ILF A;  2R3X A;  1HNB A;  4TR1 A;  2A2S A;  1K0C A;  3F6D A;  1ERV A;  3TKP A;  2IMK A;  3HCZ A;  3NIV A;  1XCC A;  2R4V A;  1N8J A;  4ZBB A;  3DVX A;  2P5R A;  4N10 A;  4NV2 A;  3ERW A;  1QFN A;  2E2G A;  2WVX B;  3LW9 A;  5IO0 A;  1A23 A;  2CX3 A;  2B5Y A;  1YY7 A;  3F9U A;  1I5G A;  2HI7 A;  3PR8 A;  3H79 A;  3RBT A;  2FUG 2;  1TU7 A;  3H8Q A;  2VD1 A;  4FYC A;  5DCH A;  1THX A;  3CWG A;  3ZML A;  1H75 A;  4FH8 A;  2FWG A;  1O81 A;  3HDC A;  3ZRD A;  1Z6N A;  1AQW A;  2RII A;  4CY8 A;  2HZE B;  2EIO A;  4PX1 A;  1GLQ A;  3UVT A;  2O36 A;  3GUS A;  3A2X A;  3ZMK A;  3GKX A;  2H75 A;  14GS A;  1PRX A;  1XFL A;  5BMU B;  1GL8 A;  1Y1U A;  1EGR A;  4ID0 A;  2MMA A;  5A5H A;  1PGT A;  3I43 A;  4OD7 A;  2VLT A;  1J9B A;  5J47 A;  5HR3 A;  1UN2 A;  1U87 A;  2VLU A;  3F0I A;  3EYT A;  5INY A;  1XW5 A;  2PN8 A;  3O76 A;  3LOR A;  1X9M B;  1Y6E A;  2YZU A;  1M9A A;  1A8Y A;  3F63 A;  5DQS A;  5L71 A;  3QR6 A;  2IN3 A;  4EUY A;  3TU3 B;  5FT3 A;  1ST9 A;  2CZ2 A;  3HKR A;  1BF5 A;  2J9H A;  4PHZ C;  2DLX A;  2XPD A;  2LKU A;  4QL7 A;  1RK4 A;  2VUP A;  5ECR B;  2JZT A;  4POL A;  1M3J A;  2O7K A;  4OO4 A;  1F6M C;  4POM A;  5CRH A;  3MIX A;  2ON5 A;  5A4V A;  4MA9 A;  1K0O A;  2H73 A;  1EEM A;  4Z7X A;  4MF5 A;  4IW9 A;  3TJB A;  2AV4 A;  2KHP A;  3C73 A;  5CRG A;  1XOA A;  4KCA A;  3F3Q A;  3GKM A;  4ZB7 A;  2DMM A;  4FXY P;  3GL3 A;  2PVQ A;  1Z5Y E;  5ECI B;  2HZF A;  5LNK e;  4I8B A;  2GZY A;  2YWO A;  2VM2 A;  1HNC A;  4ZXG A;  2EFE A;  3E0U A;  4O5U A;  5DAK B;  2VLV A;  2IL3 A;  4N30 A;  4NHZ A;  2RM5 A;  3AY8 A;  1PL2 A;  1EOH A;  3PGT A;  1Z7R A;  1QGV A;  5IPH A;  4MF7 A;  4KUN A;  2GQM A;  3U5R E;  2DJK A;  2IFQ B;  2LNT A;  3DML A;  3CRU A;  1MDK A;  1TW9 A;  1OKD A;  1K0N A;  2A2P A;  2H1A A;  3QFB C;  3V1W A;  12GS A;  4YQM A;  4X4J A;  2YV9 A;  3EMX A;  4AKH A;  2PER A;  2EIQ A;  1J0F A;  2I3Y A;  4HQZ A;  3ZLP A;  2WVY A;  3IV4 A;  1SL2 B;  4RQX A;  3TJG A;  3VFI A;  2IMI A;  2WGR A;  2PVO C;  3FK8 A;  2REM A;  5DDL A;  2LTK A;  1GSY A;  2WS2 A;  1W4V A;  4V2N A;  4MK3 A;  4K5S A;  4TXO B;  1S3D A;  2WCI A;  2DSA A;  1JHB A;  4FYU A;  6GSU A;  2EFD A;  2VCQ A;  3WGE A;  1YEP A;  1M2A A;  2V6K A;  1TP9 A;  1F3B A;  1YQ1 A;  3WGX A;  5ID2 B;  4PUF C;  1TKD B;  3GSS A;  5B8B A;  1YF1 A;  2UV8 G;  3HJP A;  4PGT A;  1BX9 A;  2Z9S A;  4BVY B;  6GST A;  1HQO A;  6GSX A;  3HXS A;  2CZ3 A;  2YPM A;  2CX4 A;  1TDI A;  2WZS A;  3J7Y k;  1BYE A;  5CRE A;  1ZCP A;  1GH2 A;  4K9Z A;  5ABR A;  3P8W A;  2B5E A;  5EY6 A;  1BQ7 A;  1OC3 A;  1LU4 A;  3GIX A;  4HEA 2;  4IN0 A;  2DJ2 A;  2XBI A;  1SKW B;  2WFC A;  1ZYN A;  5ECM B;  5GST A;  5J9B A;  1X9W B;  1SEN A;  3CTG A;  2MBS A;  5A34 B;  1PKZ A;  1YEW C;  2PU9 C;  2OE0 A;  3CQF A;  2PUK C;  2XC2 A;  4L0U A;  4ACS A;  4K8M A;  2LNS A;  2FWF A;  4KSO A;  3ZL5 A;  4JED A;  3ZVJ A;  5J4Y A;  2FLS A;  2L59 A;  3VI7 A;  2OKA A;  4DEJ A;  4G0K A;  2TIR A;  2H0H A;  3UOM A;  3TDG A;  2P0G A;  3UL3 A;  2D2Z A;  1OE7 A;  4KND A;  1NSW A;  1M3I A;  2FA8 A;  3HYP A;  1SYX A;  4ML6 A;  1TXX A;  2QSI A;  1Z3E A;  4YAP A;  4BVX B;  2MBT A;  4Z2U A;  1XW6 A;  8GSS A;  2IJY A;  4POK A;  3VWV A;  3FMW A;  4K7N A;  3UAR A;  1ZYE A;  3EU4 A;  5DJL A;  4G9H A;  4L5L A;  1F3A A;  2H30 A;  3GRX A;  4XCS A;  4AF2 A;  3QPM A;  3LG6 A;  4Q5N A;  4OO5 A;  2VL2 C;  3LXT A;  2H1B A;  5F05 A;  2HSM B;  2HRF A;  5J4V A;  5D96 A;  2C4J A;  4GQF A;  5DVB A;  3EC3 A;  1TOF A;  1F9M A;  3GYK A;  3HJM A;  5IMZ A;  3TRX A;  3D4T A;  2OE3 A;  2CVD A;  3HVV A;  3FZA A;  3D4M A;  2WZ9 A;  4ECI A;  1XZO A;  3PIN A;  1A8L A;  4MP4 A;  3FEU A;  1I1I P;  1V9W A;  2A4H A;  3HZ4 A;  3KIJ A;  4N11 A;  4QL9 A;  4YAV A;  3KZQ A;  4WBR D;  4EVM A;  3IK7 A;  2V32 A;  3CYN A;  2O3E A;  1VGL A;  3EWL A;  2LJK A;  3HY2 A;  3FR9 A;  1ON4 A;  4EF0 A;  3W8J A;  3GN3 A;  1T4Y A;  4IHU A;  1YEX A;  3UBL A;  2V2G A;  2H70 A;  2JSY A;  4TVE A;  1ZGN A;  5GSS A;  3M1G A;  1JZW A;  1EV9 A;  2LRT A;  4GXZ A;  4Q5F A;  4BA7 A;  5HR2 A;  1XXU A;  2DJ0 A;  2LJR A;  4Q5Q A;  1FO5 A;  4E8E A;  4I5Q A;  1JLW A;  3HD5 A;  2C1Y A;  1WOU A;  4GLT A;  1H4O A;  4KDU A;  1YZX A;  2C0D A;  4KDX A;  2LQO A;  2O8V B;  2H1L A;  1TXU A;  2YWN A;  5DCG A;  1R5P A;  3EVI A;  13GS A;  1ABA A;  3QFA C;  2C0E A;  3FR3 A;  3H4K A;  1SVL A;  2FNO A;  3UIW A;  2HE3 A;  3VUR A;  1G7O A;  3IOS A;  2GST A;  2OE1 A;  3BD2 A;  2WW2 A;  1K0M A;  4AGS A;  5G31 A;  4I2T A;  4KH7 A;  1OC8 A;  3IDV A;  4ECB A;  3LGC A;  2JL4 A;  3KXO A;  2L57 A;  1W89 A;  1XWB A;  2C0F A;  2YWI A;  4DSQ A;  1XWC A;  2VM1 A;  2B7J A;  2K9F A;  1ZMA A;  2HRA A;  3LWA A;  4OMV A;  4HJ2 A;  2I81 A;  4V2M A;  3QAG A;  5JCU A;  2A4V A;  2FHE A;  5EVO A;  3P2A A;  1CQH A;  2CVB A;  3DEX A;  1XIY A;  1GUH A;  4BL7 B;  1S3C A;  3TRQ A;  3NZN A;  4RQR A;  2QGV A;  2TRX A;  4ZB8 A;  4EDY A;  4ICY A;  2HSN B;  5IMF A;  1ERT A;  1NW2 A;  1U3A A;  4ZIL A;  2MMO A;  4ZIJ A;  1A0R P;  5KOW A;  3GNJ A;  4LL1 B;  3M0F A;  1FB0 A;  3LQ7 A;  4NAX A;  2HSY A;  2VO4 A;  1RQM A;  4WF5 A;  5IMV A;  4GSS A;  3A5W A;  4N3Z A;  4PI2 C;  3VPT A;  5EL8 A;  4OCF A;  3UEM A;  5J40 A;  3G7Y A;  3L78 A;  1QUW A;  1M7T A;  1QXH A;  1V57 A;  3QMX A;  1U3I A;  3TUE A;  3J7Y b;  4NPB A;  2YNX A;  4WR4 A;  2CT6 A;  2FA4 A;  4KSM A;  3GMF A;  3Q6O A;  4CDO A;  4F82 A;  3F3R A;  4TW5 A;  2F3M A;  3KMO A;  2RLI A;  2KP2 A;  2EC4 A;  1V2A A;  4G10 A;  2OJL A;  1OKT A;  3GH9 A;  5H5Q A;  2HXK A;  4GF0 A;  5A5H B;  2H74 A;  4GDF A;  2JSZ A;  2GZZ A;  2R0C A;  1BED A;  4FO5 A;  3DD3 A;  2AJQ B;  3HVX A;  2WVX A;  5LCZ A;  3HMJ G;  4K6X A;  1WWJ A;  2X99 A;  5E59 A;  3I6A A;  3RGB C;  3FYG A;  4H86 A;  3G7I A;  1F37 A;  2FWH A;  1GSS A;  2YWM A;  3DGQ A;  20GS A;  2R0P A;  2GSQ A;  6GSS A;  5IMD A;  2HFD A;  1O7U A;  3GST A;  5AIS A;  2OBK A;  4BWQ A;  1GSF A;  3GKK A;  1ZL9 A;  2TRC P;  1AUC A;  2F51 A;  3P90 A;  4MCU A;  4MJB A;  2DBC A;  3RFR C;  3E9J B;  1XW9 A;  1G7E A;  3KCM A;  1B8X A;  5BMU A;  3S9F A;  4HS1 A;  1TRW A;  3CSI A;  1S3R A;  3JCM L;  1E2Y A;  1GUK A;  4IQA A;  4Q5R A;  4MLY A;  4O5Q A;  4MDC A;  3WT2 A;  3UAP A;  3HJO A;  4MH3 A;  1S3A A;  1YF0 A;  3CTF A;  4DSS A;  4W66 A;  1PL1 A;  5ENU A;  4KX4 A;  2NBS A;  1FG4 A;  1TK0 B;  5J5N A;  2B1K A;  5GAP D;  1TK8 B;  5D9X A;  2ON7 A;  4GSN A;  3L9U A;  3KM6 A;  1WE0 A;  2VCW A;  4I2U A;  4TN8 A;  2GTU A;  1ML6 A;  4WET A;  2V6O A;  3ME8 A;  5IO2 A;  1AIU A;  3RAZ A;  4AKX B;  3HZ8 A;  2WDU A;  1QMV A;  3WD6 A;  4F2I A;  2K8V A;  4HJM A;  3N9J A;  4WXT A;  2H0G A;  2PBJ A;  4AJ6 A;  5D8I A;  3DRN A;  4CY6 A;  1VRS D;  3VLN A;  4AJ7 A;  4X43 A;  2XPE A;  2VOC A;  4XS4 A;  3ZZX A;  1YKC A;  2CVK A;  2L4C A;  2GDR A;  1JLV A;  9GSS A;  1OE8 A;  4PTS A;  3FZ4 A;  1T7P B;  4J56 E;  4I6X A;  3O3T A;  1R7H A;  1GUM A;  3GH6 A;  4PUA A;  3DWV A;  1FW1 A;  1NHO A;  3DYR A;  5DAK A;  4K7O A;  3DXB A;  1I9D A;  3ZIT A;  4K5R A;  3HVN A;  5IPG A;  2R0G A;  4O92 A;  3IHQ A;  2XBQ A;  4MJA A;  4HDE A;  2C80 A;  4JBB A;  4WEY A;  4TR3 A;  2UZ8 A;  3MNG A;  3RPP A;  4WBJ A;  1THO A;  1A0F A;  3A2V A;  2GZP A;  5CRD A;  1U6T A;  2IFQ A;  3D5J A;  1XPV A;  3GA4 A;  3GTU B;  2WJU A;  2ALB A;  2WRT A;  4PQH A;  2H8L A;  1B9Y C;  3H1N A;  2LQQ A;  1TI1 A;  2JAD A;  2B7K A;  3R2Q A;  3CSH A;  4ZBD A;  2PGT A;  1G6Y A;  2WUL A;  4N0V A;  4Z2R A;  5B8A A;  1MEK A;  1VF4 A;  4HSC X;  3D22 A;  1AAZ A;  1N25 A;  1SD8 A;  3BCK A;  1A24 A;  4OFT A;  2C0G A;  3EIN A;  1GWC A;  5D93 A;  3KP9 A;  2AUV A;  4L8E A;  3ME7 A;  4XRD A;  2R6K A;  5AGY A;  7GSS A;  2N5B A;  4TXO A;  1GTA A;  4EE0 A;  1JZR A;  2PMT A;  4EDZ A;  4MMM A; 
#chains in the Genus database with same CATH homology
 1WP0 A;  1NM3 A;  5ECP B;  1G0T A;  2VL9 A;  4F0B A;  2V1M A;  5ID2 A;  5ELA A;  2DML A;  3QD9 A;  4LMV A;  5J4U A;  5ECH B;  4HU7 A;  3KP8 A;  2I4A A;  3G7J A;  5E4W A;  2E0Q A;  3CBU A;  4G0I A;  3IRA A;  3LEF A;  4TRX A;  1BAY A;  4I97 A;  4O5R A;  4ZB9 A;  3TOU A;  3LFL A;  1BG5 A;  2X64 A;  1YKA A;  3VWU A;  1DUG A;  4IJI A;  4K7I A;  2DIZ A;  3KJY A;  2JZS A;  5EPF A;  4XRA A;  2IIY A;  1OC9 B;  2K6V A;  5FWG A;  5CYY A;  3HVS A;  5A34 A;  3LYP A;  3IHG A;  2B6M A;  1KBN A;  1UA5 A;  5A1N B;  4X0X A;  2H19 A;  2HSH A;  1A2J A;  1XBS A;  2G0F A;  4IS0 A;  2ZCT A;  5G1K A;  1VF1 A;  3KD0 A;  2YCD A;  2DJJ A;  3L9S A;  5DAL B;  1XVQ A;  1R5A A;  1O6J A;  2XHF A;  2VCT A;  2L4Q A;  1K0D A;  2L6D A;  5CO3 A;  3MYD A;  2NTO A;  3KTB A;  5HQP A;  1K3L A;  3D6I A;  3P7X A;  2KOK A;  5J9C A;  3US3 A;  2OA7 A;  5AIX A;  2H6Z A;  2GQL A;  3IE3 A;  4MAB A;  3DKS A;  3FHK A;  3FRC A;  3QDN A;  2EIR A;  4EL1 A;  1WJK A;  5HFI A;  3C1S A;  4NHW A;  2BTO T;  4KB3 A;  3TKS A;  2C3N A;  5ECQ B;  5CAX A;  5ECL B;  1PN0 A;  5C00 A;  2L6C A;  1ZOF A;  1Q4J A;  1GSU A;  4HOJ A;  1MDI A;  1TJD A;  1BG1 A;  5G30 A;  5J3R A;  1UVZ A;  4RI6 A;  4YQV A;  3LYK A;  4PNF A;  4KAE A;  6GSY A;  1G6W A;  1V98 A;  2QKE A;  4KGI A;  3G9B A;  1SU9 A;  3LSZ A;  4DVC A;  4KE3 A;  4AI6 A;  1KTE A;  3EUR A;  2YAN A;  3UBK A;  1OYJ A;  4PXO A;  1FAA A;  4F03 A;  1EP8 A;  3HA9 A;  2HRK B;  3KTL A;  2M72 A;  2X8G A;  1QK8 A;  4YKG A;  3EE2 A;  5COH A;  4GQC A;  1PQN A;  4MJE A;  1T4Z A;  3L4N A;  3IPZ A;  4G2E A;  3PH9 A;  16GS A;  5CP1 A;  1IYI A;  3Q19 A;  2B3S A;  5KOX A;  3IC8 A;  1YDK A;  3ERG A;  3ZFL A;  4D73 B;  2YV7 A;  1SL0 B;  2YJ7 A;  3EMP A;  1DBY A;  4XIH A;  5G1L A;  1DE1 A;  3ZVJ D;  1FB6 A;  5C04 A;  3D0Z A;  1O8X A;  3VK9 A;  1QQ2 A;  1MTC A;  4K2X A;  4OFM A;  1GTI A;  3ZTL A;  3ZIJ A;  4JRR A;  4TR1 B;  5CRW A;  1OVN A;  2LS5 A;  4QMK A;  2EFC A;  3TJK A;  1ACV A;  1U88 A;  4K0N A;  1PX6 A;  5JWQ B;  4IQ1 A;  4MJC A;  3RPN A;  2M46 A;  4N0Z A;  1T8E B;  3ZYW A;  2L5L A;  4HI7 A;  1MD4 A;  4USS A;  3TKQ A;  3BOA A;  5IIZ A;  5GAN D;  3E3E A;  1SK0 A;  2OBI A;  3GKN A;  1GRX A;  1TRS A;  4BL7 A;  1BJX A;  2I9H A;  4MF6 A;  3ED3 A;  1EWX A;  1ILO A;  5KN0 A;  3ZFB A;  1KNG A;  2IWT A;  2HSN A;  1SL1 B;  1ZZY A;  1V58 A;  1F2E A;  1EP7 A;  3TJF A;  1PKW A;  3QAV A;  2H6X A;  2H1G A;  5KN3 A;  3Q18 A;  1AQX A;  1R26 A;  3H93 A;  3QAW A;  4PQ1 A;  4EIQ A;  1EZK A;  3M9J A;  1TU8 A;  2VAF A;  3LXZ A;  1TTZ A;  3N5O A;  2HLS A;  1PX7 A;  2MZC A;  4ZL7 A;  2YZH A;  5KEJ A;  1T3B A;  2F8F A;  2I1U A;  10GS A;  3PPU A;  5IMC A;  1VF3 A;  2A2R A;  2CA8 A;  1MD3 A;  1XOB A;  2VKZ G;  2NVL A;  3FR6 A;  4HQS A;  4P3Y B;  2FD3 A;  2AB6 A;  3MAK A;  1B9X C;  3F4S A;  2RUF A;  4L0W A;  3SBC A;  2AHE A;  4KF9 A;  3KEB A;  3MDK A;  1M2B A;  2NPB A;  4ZL8 A;  3L0H A;  4BWS A;  2YOI A;  1M0U A;  1GNE A;  4FQU A;  2X8C A;  1JZO A;  2EFH A;  4TR0 A;  5JCG A;  1A2M A;  2R5G A;  1AXD A;  4G0L A;  3ZRE A;  1SKR B;  4E68 A;  3GHA A;  1LBK A;  3F4R A;  2R2J A;  2H76 A;  3CMI A;  1AQV A;  4PUR A;  4F9Z A;  1DSB A;  1URM A;  1B4Q A;  1X0R A;  4DSR A;  1M99 A;  1IYH A;  4NMU A;  3UVH A;  2HZE A;  2BMX A;  1HNA A;  4DSS B;  2O89 A;  4LA1 A;  5IM9 A;  2VL3 A;  3BJ5 A;  4ZL9 A;  4JR6 A;  1EEJ A;  2CAI A;  4MZB A;  4IGJ A;  2IMD A;  1TRU A;  1HD2 A;  3M9K A;  3MWH A;  2LUS A;  4O7H A;  3APQ A;  4KDY A;  5HFG A;  2X8H A;  2KP1 A;  5KN1 A;  4J2F A;  4GST A;  1SJ6 A;  5AN1 A;  1YJ6 A;  2MMZ A;  2YN1 A;  3RDW A;  3SWL A;  4MZC A;  2M80 A;  2PPT A;  3IXR A;  4G19 A;  2O87 A;  4LL4 B;  2ZNM A;  2HQT A;  3EU3 A;  3D21 A;  4OCE A;  2N5F A;  1WIK A;  1USB A;  3Q74 A;  3A3T A;  2F8A A;  2DKI A;  5IOX A;  3VWW A;  4XS4 B;  4V1A p;  1GSE A;  5ECO B;  2CQ9 A;  3F6F A;  5B6N A;  2IPA A;  1M9B A;  3IA1 A;  5IMA A;  3IAM 2;  4OWY A;  3ERF A;  1O8W A;  3WYW A;  2H66 A;  4NWY A;  3IBH A;  3A5I A;  2RM6 A;  1ZYP A;  1PA3 A;  2JZR A;  5FHI A;  2PWJ A;  3TCO A;  1PN9 A;  3GFK A;  2OT3 A;  4O32 A;  5IOW A;  3VPQ A;  2VD0 A;  4X1U A;  1WPI A;  1WRY A;  1FOH A;  4L5O A;  4ML1 A;  4EO3 A;  5G5E A;  2RUE A;  2E2M A;  2L5O A;  1WMJ A;  4PQI A;  1ERW A;  4KCE A;  4GCI A;  2K18 A;  3K8N A;  3FY7 A;  2H1D A;  1E6B A;  4IEL A;  2H6Y A;  4IP1 A;  2KUC A;  4XHM A;  3TOT A;  2HNL A;  4PNG A;  2O85 A;  4YH2 A;  1ERU A;  2HT9 A;  2MYG A;  1HYU A;  3C71 A;  3U6V A;  2GS3 A;  2AYT A;  3QOU A;  2WB9 A;  4ULX A;  3WT1 A;  5F8B A;  2JAC A;  3BBY A;  2VCX A;  4AKG A;  2GT6 A;  4OFN A;  3GX8 A;  3RHC A;  2AAW A;  4JR4 A;  4F0C A;  4KW6 A;  5D9V A;  2P5Q A;  2GT5 A;  2QC7 A;  3GUR A;  2LRN A;  3FZ5 A;  3VI5 A;  4CHS A;  3C1R A;  3O6T A;  1X9S B;  3TJJ A;  4TXV A;  2B5X A;  2LV3 A;  5A5K A;  1XVW A;  3F8U A;  4EC0 A;  4NXI A;  4A5P A;  4BPY A;  3KMN A;  1TK5 B;  4IP6 A;  2LEG A;  2FCH A;  4MNN A;  1FVK A;  2X49 A;  1K3O A;  2DC5 A;  4K2D A;  3M3M A;  5D73 A;  2FY6 A;  3GTU A;  4RI7 A;  5HR0 A;  2DJ3 A;  2DKH A;  4YKF A;  3IR4 A;  4JE1 A;  3IAS 2;  1UC7 A;  1K0B A;  1GTU A;  4WR5 A;  4QQ7 A;  4ZB6 A;  1B4P A;  2N5A A;  3RHB A;  4K1F A;  4XTS A;  22GS A;  3I9V 2;  4WF4 A;  4MH2 A;  1Z7P A;  1KEB A;  3C8E A;  4ECC A;  1XWG A;  4HZ4 A;  2YP6 A;  5GZZ B;  1AW9 A;  4BVY A;  2VIM A;  1Z6M A;  1XWK A;  2QA2 A;  4IJ3 A;  4LMW A;  2OAC A;  4AJ8 A;  1JFU A;  4AKI A;  17GS A;  4V2L A;  4MPF A;  5ELG A;  3KGK A;  2CAQ A;  4HU9 A;  5ECK B;  2O5V A;  4V1A g;  3A2W A;  4IBP A;  1SK2 A;  2VCZ A;  5H5R A;  1K0A A;  2H71 A;  3TKR A;  4ZBA A;  1OAZ A;  5DJM A;  6GSW A;  1X5D A;  1DE2 A;  1PMT A;  1SK1 A;  1SVM A;  2LRC A;  5G5F A;  3CRT A;  5BRT A;  5F0G A;  3CXG A;  2VCV A;  3M8N A;  5JWR B;  3ZIV A;  2LST A;  3TKS C;  2GLR A;  2F9S A;  2K8S A;  4TR4 A;  3APO A;  5JCW A;  1SJI A;  4GRF A;  2H72 A;  3UJ1 A;  1K3Y A;  2C3Q A;  4JZQ A;  1EGO A;  1RW1 A;  4NV5 A;  1J08 A;  4CW9 A;  2GGT A;  1SYR A;  3WGD A;  4EXJ A;  2G2Q A;  2C3T A;  5HFK A;  1VF2 A;  3R3E A;  2YJH A;  4FYB A;  1OC9 A;  4KA0 A;  4BVX A;  1FOV A;  1MDJ A;  1C72 A;  3TRP A;  4G01 A;  2X4A A;  5A4W A;  5A1N A;  3IC4 A;  2J23 A;  3FZ9 A;  4ISD A;  1T00 A;  4XS6 A;  5D9W A;  2E7P A;  2GSR A;  1EOG A;  3ISO A;  3BCI A;  4POB A;  4GWR A;  1SD9 A;  3LJR A;  2HSM A;  5DAL A;  2DIY A;  1JZD A;  3F4T A;  2GSS A;  2OAD A;  5JWO B;  2C8U A;  3OR5 A;  5HR1 A;  4EIP A;  2FGX A;  2V41 A;  5ECS A;  1XWA A;  3DIE A;  3MSZ A;  1GSD A;  1FVJ A;  5KN2 A;  3IK9 A;  2ES7 A;  1AC1 A;  5IQY A;  5J41 A;  4YQU A;  1A2L A;  4LLR A;  2GVP A;  3VWX A;  1YVL A;  5B7C A;  2VL2 A;  1N2A A;  5AIV A;  2HRN A;  5LD0 A;  1TI3 A;  4ECJ A;  1FHE A;  2BJX A;  3FKF A;  4J57 E;  2ZUP A;  5F07 A;  2FWE A;  5DBQ A;  5F06 A;  1PD2 1;  2KLX A;  4Z2T A;  2CV4 A;  1SVO A;  5H5S A;  4HUA A;  4EKZ A;  5B6M A;  1GNW A;  3KH7 A;  2DJ1 A;  5CNW A;  1X5E A;  3DVW A;  4WKW A;  3I69 A;  5ECN B;  1O85 A;  3L9V A;  1GTB A;  1SJZ A;  1SKS B;  1V40 A;  3TGZ A;  2NDO A;  1NHY A;  1EV4 A;  1M2D A;  4MZW A;  2R37 A;  1GP1 A;  1T1V A;  3FW2 A;  3TKS E;  4FIW A;  4E8H A;  1GLP A;  1O73 A;  1ZYQ B;  2IME A;  5D9T A;  4IKH A;  4GTU A;  1LJR A;  1B48 A;  1X5C A;  5DQY A;  2JU5 A;  1R4W A;  4HZ2 A;  3CSJ A;  11GS A;  1Q98 A;  3APS A;  4MPG A;  3W8S A;  2H01 A;  1GSQ A;  6GSV A;  3GV1 A;  3GX0 A;  4K0G A;  3W6G A;  2HRK A;  4XS1 A;  3GL5 A;  4TKY A;  3TB2 A;  3UMA A;  2B1L A;  2H0I A;  1CQG A;  2LJA A;  2P31 A;  2QA1 A;  2HYX A;  2MMN A;  18GS A;  3QCP A;  5G2Z A;  3NOF A;  4IVF A;  2GQK A;  4D73 A;  4RUV A;  3C7M A;  2IMF A;  1GUL A;  1TRV A;  4JU5 A;  3EPT A;  4TOP A;  3HHV A;  5A4U A;  1Z9H A;  1Y25 A;  3KH9 A;  19GS A;  1PSQ A;  4ILF A;  2R3X A;  1HNB A;  4TR1 A;  2A2S A;  1K0C A;  3F6D A;  1ERV A;  3TKP A;  2IMK A;  3HCZ A;  3NIV A;  1XCC A;  2R4V A;  1N8J A;  4ZBB A;  3DVX A;  2P5R A;  4N10 A;  4NV2 A;  3ERW A;  1QFN A;  2E2G A;  3LW9 A;  5IO0 A;  1A23 A;  2CX3 A;  2B5Y A;  1YY7 A;  3F9U A;  1I5G A;  2HI7 A;  3PR8 A;  3H79 A;  3RBT A;  2FUG 2;  1TU7 A;  3H8Q A;  2VD1 A;  4FYC A;  5DCH A;  1THX A;  3CWG A;  3ZML A;  1H75 A;  4FH8 A;  2FWG A;  1O81 A;  3HDC A;  3ZRD A;  1Z6N A;  1AQW A;  2RII A;  4CY8 A;  2HZE B;  2EIO A;  4PX1 A;  1GLQ A;  3UVT A;  3GUS A;  3A2X A;  3ZMK A;  3GKX A;  2H75 A;  14GS A;  1PRX A;  1XFL A;  5BMU B;  1GL8 A;  1Y1U A;  1EGR A;  4ID0 A;  2MMA A;  5A5H A;  1PGT A;  3I43 A;  4OD7 A;  2VLT A;  1J9B A;  5J47 A;  5HR3 A;  1UN2 A;  1U87 A;  2VLU A;  3F0I A;  3EYT A;  5INY A;  1XW5 A;  2PN8 A;  3O76 A;  3LOR A;  1X9M B;  1Y6E A;  2YZU A;  1M9A A;  1A8Y A;  3F63 A;  5DQS A;  5L71 A;  3QR6 A;  2IN3 A;  4EUY A;  3TU3 B;  5FT3 A;  1ST9 A;  2CZ2 A;  3HKR A;  1BF5 A;  2J9H A;  2DLX A;  2XPD A;  2LKU A;  4QL7 A;  1RK4 A;  2VUP A;  5ECR B;  2JZT A;  4POL A;  2O7K A;  4OO4 A;  1F6M C;  4POM A;  5CRH A;  3MIX A;  2ON5 A;  5A4V A;  4MA9 A;  1K0O A;  2H73 A;  1EEM A;  4Z7X A;  4MF5 A;  4IW9 A;  3TJB A;  2AV4 A;  2KHP A;  3C73 A;  5CRG A;  1XOA A;  4KCA A;  3F3Q A;  3GKM A;  4ZB7 A;  2DMM A;  3GL3 A;  2PVQ A;  1Z5Y E;  5ECI B;  2HZF A;  5LNK e;  4I8B A;  2GZY A;  2YWO A;  2VM2 A;  1HNC A;  4ZXG A;  2EFE A;  3E0U A;  4O5U A;  5DAK B;  2VLV A;  2IL3 A;  4N30 A;  4NHZ A;  2RM5 A;  3AY8 A;  1PL2 A;  1EOH A;  3PGT A;  1Z7R A;  1QGV A;  5IPH A;  4MF7 A;  4KUN A;  2GQM A;  3U5R E;  2DJK A;  2IFQ B;  2LNT A;  3DML A;  3CRU A;  1MDK A;  1TW9 A;  1OKD A;  1K0N A;  2A2P A;  2H1A A;  3QFB C;  3V1W A;  12GS A;  4YQM A;  4X4J A;  2YV9 A;  3EMX A;  4AKH A;  2PER A;  2EIQ A;  1J0F A;  2I3Y A;  4HQZ A;  3ZLP A;  3IV4 A;  1SL2 B;  4RQX A;  3TJG A;  3VFI A;  2IMI A;  2WGR A;  2PVO C;  3FK8 A;  2REM A;  5DDL A;  2LTK A;  1GSY A;  2WS2 A;  1W4V A;  4V2N A;  4MK3 A;  4K5S A;  4TXO B;  1S3D A;  2WCI A;  2DSA A;  1JHB A;  4FYU A;  6GSU A;  2EFD A;  2VCQ A;  3WGE A;  1YEP A;  1M2A A;  2V6K A;  1TP9 A;  1F3B A;  1YQ1 A;  3WGX A;  5ID2 B;  4PUF C;  1TKD B;  3GSS A;  5B8B A;  1YF1 A;  2UV8 G;  3HJP A;  4PGT A;  1BX9 A;  2Z9S A;  4BVY B;  6GST A;  1HQO A;  6GSX A;  3HXS A;  2CZ3 A;  2YPM A;  2CX4 A;  1TDI A;  3J7Y k;  1BYE A;  5CRE A;  1ZCP A;  1GH2 A;  4K9Z A;  5ABR A;  3P8W A;  2B5E A;  5EY6 A;  1BQ7 A;  1OC3 A;  1LU4 A;  3GIX A;  4HEA 2;  4IN0 A;  2DJ2 A;  2XBI A;  1SKW B;  2WFC A;  1ZYN A;  5ECM B;  5GST A;  5J9B A;  1X9W B;  1SEN A;  3CTG A;  2MBS A;  5A34 B;  1PKZ A;  2PU9 C;  2OE0 A;  2PUK C;  2XC2 A;  4L0U A;  4ACS A;  4K8M A;  2LNS A;  2FWF A;  4KSO A;  3ZL5 A;  4JED A;  3ZVJ A;  5J4Y A;  2FLS A;  2L59 A;  3VI7 A;  2OKA A;  4DEJ A;  4G0K A;  2TIR A;  2H0H A;  3UOM A;  3TDG A;  2P0G A;  3UL3 A;  2D2Z A;  1OE7 A;  4KND A;  1NSW A;  2FA8 A;  3HYP A;  1SYX A;  4ML6 A;  1TXX A;  2QSI A;  1Z3E A;  4YAP A;  4BVX B;  2MBT A;  4Z2U A;  1XW6 A;  8GSS A;  2IJY A;  4POK A;  3VWV A;  3FMW A;  4K7N A;  3UAR A;  1ZYE A;  3EU4 A;  5DJL A;  4G9H A;  4L5L A;  1F3A A;  2H30 A;  3GRX A;  4XCS A;  4AF2 A;  3QPM A;  3LG6 A;  4Q5N A;  4OO5 A;  2VL2 C;  3LXT A;  2H1B A;  5F05 A;  2HSM B;  2HRF A;  5J4V A;  5D96 A;  2C4J A;  4GQF A;  5DVB A;  3EC3 A;  1TOF A;  1F9M A;  3GYK A;  3HJM A;  5IMZ A;  3TRX A;  3D4T A;  2OE3 A;  2CVD A;  3HVV A;  3FZA A;  3D4M A;  2WZ9 A;  4ECI A;  1XZO A;  3PIN A;  1A8L A;  4MP4 A;  3FEU A;  2A4H A;  1V9W A;  3HZ4 A;  3KIJ A;  4N11 A;  4QL9 A;  4YAV A;  3KZQ A;  4WBR D;  4EVM A;  3IK7 A;  2V32 A;  3CYN A;  1VGL A;  3EWL A;  2LJK A;  3HY2 A;  3FR9 A;  1ON4 A;  4EF0 A;  3W8J A;  3GN3 A;  1T4Y A;  4IHU A;  1YEX A;  3UBL A;  2V2G A;  2H70 A;  2JSY A;  4TVE A;  1ZGN A;  5GSS A;  3M1G A;  1JZW A;  1EV9 A;  2LRT A;  4GXZ A;  4Q5F A;  4BA7 A;  5HR2 A;  1XXU A;  2DJ0 A;  2LJR A;  4Q5Q A;  1FO5 A;  4E8E A;  4I5Q A;  1JLW A;  3HD5 A;  2C1Y A;  1WOU A;  4GLT A;  1H4O A;  4KDU A;  1YZX A;  2C0D A;  4KDX A;  2LQO A;  2O8V B;  2H1L A;  1TXU A;  2YWN A;  5DCG A;  1R5P A;  3EVI A;  13GS A;  1ABA A;  3QFA C;  2C0E A;  3FR3 A;  3H4K A;  1SVL A;  2FNO A;  3UIW A;  2HE3 A;  3VUR A;  1G7O A;  3IOS A;  2GST A;  2OE1 A;  3BD2 A;  1K0M A;  4AGS A;  5G31 A;  4I2T A;  4KH7 A;  1OC8 A;  3IDV A;  4ECB A;  3LGC A;  2JL4 A;  3KXO A;  2L57 A;  1W89 A;  1XWB A;  2C0F A;  2YWI A;  4DSQ A;  1XWC A;  2VM1 A;  2B7J A;  2K9F A;  1ZMA A;  2HRA A;  3LWA A;  4OMV A;  4HJ2 A;  2I81 A;  4V2M A;  3QAG A;  5JCU A;  2A4V A;  2FHE A;  5EVO A;  3P2A A;  1CQH A;  2CVB A;  3DEX A;  1XIY A;  1GUH A;  4BL7 B;  1S3C A;  3TRQ A;  3NZN A;  4RQR A;  2QGV A;  2TRX A;  4ZB8 A;  4EDY A;  4ICY A;  2HSN B;  5IMF A;  1ERT A;  1NW2 A;  1U3A A;  4ZIL A;  2MMO A;  4ZIJ A;  1A0R P;  5KOW A;  3GNJ A;  4LL1 B;  3M0F A;  1FB0 A;  3LQ7 A;  4NAX A;  2HSY A;  2VO4 A;  1RQM A;  4WF5 A;  5IMV A;  4GSS A;  3A5W A;  4N3Z A;  3VPT A;  5EL8 A;  4OCF A;  3UEM A;  5J40 A;  3G7Y A;  3L78 A;  1QUW A;  1M7T A;  1QXH A;  1V57 A;  3QMX A;  1U3I A;  3TUE A;  3J7Y b;  4NPB A;  2YNX A;  4WR4 A;  2CT6 A;  2FA4 A;  4KSM A;  3GMF A;  3Q6O A;  4CDO A;  4F82 A;  3F3R A;  4TW5 A;  2F3M A;  3KMO A;  2RLI A;  2KP2 A;  2EC4 A;  1V2A A;  4G10 A;  2OJL A;  1OKT A;  3GH9 A;  5H5Q A;  2HXK A;  4GF0 A;  5A5H B;  2H74 A;  4GDF A;  2JSZ A;  2GZZ A;  2R0C A;  1BED A;  4FO5 A;  3DD3 A;  2AJQ B;  3HVX A;  5LCZ A;  3HMJ G;  4K6X A;  1WWJ A;  2X99 A;  5E59 A;  3I6A A;  3FYG A;  4H86 A;  3G7I A;  1F37 A;  2FWH A;  1GSS A;  2YWM A;  3DGQ A;  20GS A;  2R0P A;  2GSQ A;  6GSS A;  5IMD A;  2HFD A;  1O7U A;  3GST A;  5AIS A;  2OBK A;  4BWQ A;  1GSF A;  3GKK A;  1ZL9 A;  2TRC P;  1AUC A;  2F51 A;  3P90 A;  4MCU A;  4MJB A;  2DBC A;  3E9J B;  1XW9 A;  1G7E A;  3KCM A;  1B8X A;  5BMU A;  3S9F A;  4HS1 A;  1TRW A;  3CSI A;  3JCM L;  1E2Y A;  1GUK A;  4IQA A;  4Q5R A;  4MLY A;  4O5Q A;  4MDC A;  3WT2 A;  3UAP A;  3HJO A;  4MH3 A;  1S3A A;  1YF0 A;  3CTF A;  4DSS A;  4W66 A;  1PL1 A;  5ENU A;  4KX4 A;  2NBS A;  1FG4 A;  1TK0 B;  5J5N A;  2B1K A;  5GAP D;  1TK8 B;  5D9X A;  2ON7 A;  4GSN A;  3L9U A;  3KM6 A;  1WE0 A;  2VCW A;  4I2U A;  4TN8 A;  2GTU A;  1ML6 A;  4WET A;  2V6O A;  3ME8 A;  5IO2 A;  1AIU A;  3RAZ A;  4AKX B;  3HZ8 A;  2WDU A;  1QMV A;  3WD6 A;  4F2I A;  2K8V A;  4HJM A;  3N9J A;  4WXT A;  2H0G A;  2PBJ A;  4AJ6 A;  5D8I A;  3DRN A;  4CY6 A;  1VRS D;  3VLN A;  4AJ7 A;  4X43 A;  2XPE A;  2VOC A;  4XS4 A;  3ZZX A;  1YKC A;  2CVK A;  2L4C A;  2GDR A;  1JLV A;  9GSS A;  1OE8 A;  4PTS A;  3FZ4 A;  1T7P B;  4J56 E;  4I6X A;  3O3T A;  1R7H A;  1GUM A;  3GH6 A;  4PUA A;  3DWV A;  1FW1 A;  1NHO A;  3DYR A;  5DAK A;  4K7O A;  3DXB A;  1I9D A;  3ZIT A;  4K5R A;  5IPG A;  2R0G A;  4O92 A;  3IHQ A;  2XBQ A;  4MJA A;  4HDE A;  2C80 A;  4JBB A;  4WEY A;  4TR3 A;  2UZ8 A;  3MNG A;  3RPP A;  4WBJ A;  1THO A;  1A0F A;  3A2V A;  2GZP A;  5CRD A;  1U6T A;  2IFQ A;  3D5J A;  1XPV A;  3GA4 A;  3GTU B;  2WJU A;  2ALB A;  2WRT A;  4PQH A;  2H8L A;  1B9Y C;  3H1N A;  2LQQ A;  1TI1 A;  2JAD A;  2B7K A;  3R2Q A;  3CSH A;  4ZBD A;  2PGT A;  1G6Y A;  2WUL A;  4N0V A;  4Z2R A;  5B8A A;  1MEK A;  1VF4 A;  3D22 A;  1AAZ A;  1N25 A;  1SD8 A;  3BCK A;  1A24 A;  4OFT A;  2C0G A;  3EIN A;  1GWC A;  5D93 A;  3KP9 A;  2AUV A;  4L8E A;  3ME7 A;  4XRD A;  2R6K A;  5AGY A;  7GSS A;  2N5B A;  4TXO A;  1GTA A;  4EE0 A;  1JZR A;  2PMT A;  4EDZ A;  4MMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...