2DSAA

Ternary complex of bphk, a bacterial gst
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
MKLYYSPGACSLSPHIALREAGLNFELVQVDLASKKTASGQDYLEVNPAGYVPCLQLDDGRTLTEGPAIVQYVADQVPGKQLAPANGSFERYHLQQWLNFISSELHKSFSPLFNPASSDEWKNAVRQSLNTRLGQVARQLEHAPYLLGDQLSVADIYLFVVLGWSAYVNIDLSPWPSLQAFQGRVGGREAVQSALRAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Structures of ternary complexes of BphK, a bacterial glutathione S-transferase that reductively dechlorinates polychlorinated biphenyl metabolites
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Transferase
total genus 66
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2dsaA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dsaA01
1Z9HA 5KN2A 2HRFA 1BJXA 4KUNA 4LMWA 4MP4A 5DQSA 3M9KA 2VIMA 2GQMA 2YOIA 8GSSA 1SL2B 1HYUA 1UA5A 4MPGA 1Y6EA 4V1Ap 2R5GA 3ERWA 2R2JA 2R37A 2EIQA 1EV9A 1TOFA 3CSJA 3LG6A 4POKA 3GH9A 3DD3A 5A4WA 1JHBA 2PMTA 4FYBA 1BAYA 2H0IA 3VURA 2JU5A 5G31A 4EO3A 4ZXGA 3OR5A 2H6ZA 3FR9A 3L0HA 4PQHA 1TK0B 5GSSA 4TXOA 1GSFA 2JACA 4F82A 4O7HA 3F6DA 1WIKA 3RHCA 1KBNA 4OCFA 1Q98A 2P31A 4O32A 4PQ1A 2VCTA 2V1MA 4JE1A 2DMLA 1RQMA 3F4RA 4AF2A 2WB9A 2WZ9A 9GSSA 1ZYQB 4TR4A 1X0RA 3D6IA 1ZCPA 2YNXA 2PWJA 4I8BA 3WGEA 1B8XA 4HJMA 3RPPA 1YJ6A 3GURA 1GLQA 1W4VA 2K9FA 4G9HA 4D73B 2MBSA 2DIZA 4ZL7A 1YQ1A 3L78A 2YJ7A 4XIHA 1F2EA 3ZMLA 3KMOA 4BWQA 2HRAA 1PX7A 1PA3A 2HRKB 2VD1A 3TJGA 3P8WA 2VL2A 2JZTA 5G5EA 2L59A 4MZWA 3HVVA 1FHEA 5FT3A 2OADA 4PGTA 2HSNB 4TR3A 3UBKA 1K0BA 5ECNB 4WXTA 4L5OA 3E3EA 4WR5A 2GZYA 5AIVA 5JCUA 5ID2B 3CRTA 2XPEA 4IS0A 1R7HA 2FWFA 2G0FA 5ENUA 3C73A 3C8EA 1QMVA 1T7PB 4ML1A 3D22A 2WRTA 4G0IA 2YZUA 1THOA 1SD9A 3HDCA 5ECRB 5B6NA 1K0MA 4LMVA 2BTOT 1EOHA 1XWKA 2MMZA 3M9JA 2X99A 2FA4A 1OKTA 4PUFC 5H5SA 1IYIA 4N0VA 5ELGA 2H19A 3ISOA 1FB6A 1K0OA 3KIJA 3VWXA 3LEFA 1HNAA 3VFIA 1OKDA 5JWQB 1V57A 3QR6A 5AIXA 4YQVA 2CZ2A 2X8HA 4RI6A 2N5FA 5F07A 1SU9A 2B3SA 2VLUA 3G7JA 1EP7A 4PQIA 5H5RA 2WFCA 2RIIA 2IMFA 2EIRA 3IBHA 5ABRA 3ZVJD 1KTEA 4MF6A 1TU8A 2ALBA 2JZRA 4TXVA 2VL3A 2XBIA 4BVYA 3TDGA 4NPBA 3DIEA 2L6DA 4QL9A 2VCVA 4WEYA 3VWUA 1ERUA 3A5WA 1XIYA 4NXIA 4PX1A 2VM1A 3APSA 4ECBA 3GMFA 3TJJA 2LJRA 2MMAA 3IK9A 11GSA 1HD2A 1QK8A 3AY8A 3UAPA 5G5FA 3DEXA 3SBCA 3MWHA 2F8FA 5CREA 3VWWA 2ON7A 2O85A 1AQVA 2C0FA 1K0AA 2C80A 2CVBA 3ZYWA 6GSXA 1K0DA 5IMZA 7GSSA 3CSHA 1XFLA 2I1UA 4G0LA 1JLVA 1T1VA 3I9V2 2JZSA 5COHA 3EE2A 4YH2A 4RI7A 2PPTA 1USBA 3A3TA 5LD0A 3IAS2 4KDYA 3CYNA 6GSYA 1X5DA 1HNBA 4IP1A 2LV3A 2TRXA 2EC4A 2M46A 2L4CA 4GTUA 4ECJA 1FOVA 1O85A 3UIWA 3FRCA 3GKNA 3FEUA 3H79A 2YPMA 3U6VA 2C3NA 2PN8A 4POBA 5JWOB 1SD8A 2GVPA 4NV5A 5IOWA 1XWAA 3VPTA 3P2AA 4RUVA 4F0CA 5KN0A 4ML6A 5AGYA 5G2ZA 5CNWA 5KN1A 4OO5A 2LNSA 2H73A 3ZZXA 3IC8A 2FUG2 1DSBA 2YV7A 3GN3A 3F8UA 1A2JA 2JSYA 2IWTA 2CVDA 2OE0A 2VAFA 2HXKA 4BVYB 3PGTA 4I6XA 4K6XA 4Z7XA 5ECSA 2B1KA 3RDWA 3FHKA 1TI3A 4E8EA 3QDNA 4GSTA 2FWEA 1YZXA 4JU5A 4EUYA 3DWVA 2CT6A 1F37A 1ERVA 1IYHA 1W89A 1BG5A 3UBLA 1GL8A 1AIUA 4FQUA 2O8VB 5IMAA 5CRDA 5DJLA 3GFKA 2LSTA 3C7MA 1OC8A 3G7IA 2L6CA 2C3TA 2CA8A 3F0IA 4N0ZA 4MZCA 1DE2A 2WGRA 3TJFA 2H75A 5F06A 1JZRA 4XTSA 4BWSA 4Q5QA 1LJRA 4XCSA 5KEJA 3GIXA 4ID0A 2GQKA 4KB3A 1B48A 4MK3A 1WE0A 1U87A 4WETA 3TKRA 1BEDA 3BJ5A 1SK0A 2KHPA 5IOXA 5J9CA 3KM6A 5A4VA 2IFQA 2C3QA 1CQHA 3EMPA 1H4OA 5KN3A 1GUHA 1Z6NA 3DMLA 2K18A 3FR6A 2OA7A 1G6WA 3KTLA 1VGLA 5FWGA 1LU4A 4JZQA 4K2DA 1A2MA 1ZOFA 1BQ7A 4EC0A 1XVWA 2L4QA 2DIYA 5CYYA 5D9XA 1XPVA 6GSSA 5DAKA 3C71A 3IA1A 3UL3A 4ZB6A 1EP8A 1JZDA 1ERWA 4IELA 2H1DA 3F4TA 5INYA 2IIYA 5IPHA 4XS4A 1M99A 3KZQA 3GKXA 1JZOA 3HJMA 2YZHA 5DDLA 3QMXA 2LTKA 3LWAA 1K0NA 2HT9A 1Y25A 4LL4B 3ZLPA 1Q4JA 3BCKA 4HS1A 1NHYA 1GTIA 5J3RA 4IN0A 4CDOA 5J9BA 5DCGA 4IVFA 1B9YC 3DKSA 5IMFA 1M2AA 4MJAA 2F9SA 3M0FA 4EVMA 3MAKA 1URMA 5IMDA 1PMTA 2HSYA 4D73A 3BD2A 2N5BA 1WJKA 5GAPD 5ECPB 1VRSD 3RPNA 3E9JB 1XXUA 1FW1A 3GH6A 2H6YA 1T4YA 2HRKA 4OO4A 4AJ8A 2VCZA 1MEKA 1QFNA 2VUPA 1BYEA 3HVXA 3KMNA 3HYPA 2GSTA 1SENA 2A2RA 2IL3A 2CZ3A 3GUSA 4MF5A 2LUSA 5EL8A 3EURA 4XRAA 2DLXA 5ID2A 1M2DA 5J41A 2ON5A 4HU9A 1Z5YE 2B1LA 1KEBA 1JLWA 2GDRA 2FCHA 3WD6A 3TKSC 3QAWA 4J56E 5D96A 1OVNA 1DBYA 1O8XA 2I3YA 3KJYA 2OBIA 2L5LA 4OFMA 3F6FA 3GV1A 2HE3A 3APOA 4AJ7A 4HQSA 5DAKB 5G30A 12GSA 1MD3A 3QAGA 1OYJA 1S3DA 2K8VA 3FW2A 3CXGA 4LA1A 1RW1A 4HJ2A 2GTUA 1ACVA 3V1WA 4I5QA 2BJXA 3GRXA 2WCIA 1DE1A 2K8SA 3TOTA 4XS4B 3LQ7A 1PL1A 2HSHA 1SL0B 4L0WA 2J9HA 2M72A 1TKDB 2FWHA 4POMA 4EDYA 4KCAA 3GL5A 5BMUA 3J7Yk 1GP1A 3S9FA 1ZZYA 2GQLA 5GZZB 1M0UA 3KEBA 4WR4A 4GCIA 3ZIVA 4P3YB 1G6YA 4ZBDA 1AAZA 1GUMA 2L5OA 3DRNA 3ME7A 5DALA 3F3RA 2VD0A 4PNFA 3VLNA 5IIZA 3TKQA 1SJIA 2E0QA 2GT6A 4MA9A 3KP8A 5ECQB 2B7KA 1SJ6A 1ZMAA 3UVHA 2H8LA 4GRFA 2DSAA 3DVXA 1UN2A 4N10A 4WBJA 4NWYA 2AB6A 1R5PA 2PU9C 2F51A 3KTBA 2JSZA 3K8NA 2AAWA 5HFGA 1O6JA 1VF3A 2DC5A 4JEDA 3RAZA 2YANA 2HFDA 1A0FA 1OC9B 4NHZA 4KNDA 1A23A 3ERGA 2M80A 1MDJA 3HA9A 5EVOA 5IO0A 4KSOA 1O73A 4GXZA 3DGQA 1K3OA 5JCGA 3QOUA 5E59A 2H01A 4BVXA 4WBRD 4N11A 5ECIB 1PSQA 2VM2A 2CX4A 5GSTA 3CTGA 4IQAA 4PNGA 1N8JA 1EZKA 3ZTLA 5LNKe 2CAQA 4Q5NA 4WKWA 5IM9A 1V9WA 4KSMA 2TRCP 2V32A 2P0GA 3R2QA 2H1GA 3L4NA 4KGIA 3JCML 2IMIA 3TUEA 5EY6A 4NMUA 1R5AA 1OAZA 3GHAA 1M2BA 5ELAA 1B4PA 2GGTA 4YAVA 5J4UA 4F9ZA 5JCWA 3NIVA 3TKPA 4EKZA 2IMEA 5DALB 3EVIA 1U3AA 3EC3A 1SYRA 2OKAA 1TU7A 4QL7A 2GT5A 1A2LA 3KCMA 3H8QA 3FZAA 3TB2A 4DSQA 5D9TA 2D2ZA 2LNTA 5IQYA 4J2FA 3O3TA 2R6KA 1PX6A 3QAVA 3TGZA 2WDUA 2QSIA 4LL1B 3KD0A 4DEJA 1Z3EA 4PURA 5HR0A 3RBTA 3H4KA 3HVSA 4ZB9A 2DMMA 4MMMA 4DSSA 4XHMA 3VK9A 1QXHA 1YDKA 4IGJA 2WJUA 1NSWA 1TK8B 6GSVA 1YEPA 1X5CA 3TKSA 1XWCA 5DBQA 4OD7A 3FY7A 4WF5A 5JWRB 2CQ9A 4BVXB 1G0TA 3US3A 4IP6A 4EE0A 1MTCA 4Q5RA 4EXJA 2KP1A 2DJ3A 3QPMA 2DJKA 4K7IA 1MDIA 1J0FA 3IOSA 4NV2A 3MNGA 5B8BA 6GSUA 2NPBA 5IPGA 1G7OA 2VCXA 3P90A 2LEGA 1R26A 2C0GA 4TW5A 2R4VA 4V2LA 1PRXA 4EDZA 2I81A 4TRXA 2C0EA 2LS5A 1AUCA 5B7CA 4E8HA 20GSA 2OE1A 2YV9A 2ZNMA 4FO5A 4L0UA 4GQCA 22GSA 3FZ9A 2ZUPA 4TOPA 4H86A 4AJ6A 2H66A 3LXZA 2RLIA 4HEA2 3RHBA 4GSSA 3CRUA 4ISDA 3PH9A 5HFIA 1OC3A 4KF9A 2V41A 3GNJA 3GYKA 4WF4A 1YF1A 1PL2A 4YQMA 1GTUA 1YKCA 2I9HA 1NHOA 3A2VA 2LQOA 2YWMA 4L5LA 2NVLA 4MJBA 2DJ0A 3GSSA 2FLSA 4N30A 5ECOB 4DSSB 3VPQA 2TIRA 1SJZA 2VLTA 3ED3A 5EPFA 4ZIJA 1FB0A 3Q6OA 1Z6MA 3W6GA 1DUGA 3UARA 3VI7A 4LLRA 2KOKA 1ZL9A 1XVQA 1CQGA 1AQWA 3WT1A 3LYKA 3D0ZA 2PVQA 3GSTA 4OWYA 4FYCA 4OFTA 1J08A 3W8SA 2O89A 4OCEA 4IJ3A 1TRUA 4CHSA 4TR1B 2X8CA 4JBBA 1GSQA 1B9XC 2WS2A 1A0RP 1WRYA 2HYXA 1ZYEA 3J7Yb 4AGSA 3WYWA 1AC1A 1F9MA 2E2MA 5CP1A 3FZ5A 2BMXA 1ABAA 5G1KA 1V98A 4ECCA 3PINA 3UEMA 2LRTA 1NM3A 4F2IA 4I2UA 3HD5A 2E7PA 3N5OA 2V2GA 10GSA 3QD9A 4V2MA 1OE7A 1EV4A 2YN1A 1GTBA 3D4TA 3A2XA 1C72A 1WP0A 1O8WA 1WWJA 3TJKA 1R4WA 2LQQA 3HY2A 1E6BA 3HHVA 1SYXA 5D73A 4IJIA 2AV4A 3WT2A 2LRCA 1GULA 1QQ2A 3ZRDA 4K8MA 4J57E 3NZNA 2GSQA 4BL7A 1YKAA 3PPUA 2QGVA 1XCCA 1N2AA 5CO3A 3F3QA 1PD21 6GSTA 4GF0A 2O87A 2JL4A 3L9SA 1TXXA 3UMAA 2GSSA 2C1YA 1XWBA 4JRRA 4MH3A 3ME8A 1TTZA 3UVTA 5IMVA 6GSWA 3ZITA 2AJQB 2OBKA 2IN3A 2MMOA 4HOJA 2K6VA 2B6MA 1V2AA 3BCIA 2NDOA 5FHIA 1GSDA 3LGCA 1X9WB 5HR3A 2F8AA 2FGXA 3EU3A 3TRQA 2CX3A 2GZPA 1JFUA 1OC9A 3UOMA 2H0HA 5IO2A 4KE3A 1TRWA 4MABA 2GLRA 4TR0A 3IPZA 4IKHA 1ZGNA 3IDVA 3QFBC 4IQ1A 4ILFA 2EIOA 3P7XA 4ACSA 4HDEA 1AW9A 4QQ7A 1A8YA 3HKRA 1XW5A 2H30A 5CAXA 4BPYA 2AYTA 3CSIA 3TKSE 3GX8A 5F8BA 4RQRA 1GNEA 3HJPA 3W8JA 4X0XA 1SKWB 1M7TA 3BOAA 1EGRA 2IPAA 2G2QA 3M1GA 2KUCA 4ULXA 1YEXA 4F03A 2XBQA 3LORA 3WGXA 2H72A 3L9VA 1QGVA 4V2NA 2JADA 1TRSA 2VCQA 3GL3A 3C1SA 1XOAA 3F9UA 3IK7A 1ON4A 4MF7A 2YWOA 2GS3A 4XS1A 4EF0A 3IAM2 2LJAA 5HFKA 5DCHA 3PR8A 1GUKA 4FIWA 1WPIA 2OE3A 5CRGA 1YY7A 2REMA 1X9MB 4BL7B 2YCDA 3LFLA 2RM6A 1GSEA 2CV4A 3G9BA 1I9DA 2FY6A 2H70A 2H1BA 1T8EB 5D9VA 1ST9A 4MZBA 2MMNA 3TJBA 1FVKA 3ZVJA 2H6XA 2HRNA 3GX0A 3EINA 4NHWA 4MJCA 1TRVA 5D93A 2YJHA 1KNGA 2VL9A 5B6MA 2NTOA 4X43A 5IMCA 3LXTA 1AXDA 4OMVA 3KXOA 4MLYA 2LRNA 4TKYA 3FYGA 2RUFA 2MBTA 1F3AA 1T00A 5A5KA 4IBPA 5F05A 3IXRA 2HSMA 2N5AA 3ZIJA 2PBJA 1TK5B 1J9BA 1S3CA 1TJDA 1LBKA 3FK8A 1WMJA 5ECHB 2QC7A 4DVCA 3TRPA 4XS6A 4I97A 5CRWA 2FD3A 3UJ1A 1JZWA 3F63A 3KP9A 2HZEA 2FA8A 4XRDA 17GSA 2DBCA 5HR2A 2FHEA 4TN8A 5ECKB 3M8NA 4K0GA 4HZ4A 1PN9A 3NOFA 2PVOC 2X8GA 2XC2A 5HQPA 1PKWA 3DVWA 3EYTA 4TXOB 4O5RA 3QCPA 1O81A 3I6AA 4KCEA 4FH8A 1X9SB 2CAIA 3Q74A 2V6OA 3FZ4A 4OFNA 1XW9A 4X1UA 2VCWA 2HLSA 3H93A 4YQUA 3I43A 3H1NA 3O76A 1F6MC 1A8LA 2B7JA 4O92A 1X5EA 4IW9A 1ERTA 2H1AA 2VO4A 5AN1A 2VLVA 2HNLA 3FKFA 4USSA 1FVJA 3IHQA 2YWNA 5C04A 1BX9A 1O7UA 3IE3A 1H75A 3G7YA 3F4SA 3EU4A 3A2WA 3L9UA 1TP9A 4I2TA 3CBUA 4GWRA 1HNCA 5A4UA 4G2EA 5J5NA 3WGDA 1THXA 1K3LA 2PERA 3Q18A 2UZ8A 1TI1A 3KH9A 1AQXA 2PUKC 1E2YA 2VOCA 1NW2A 3D4MA 2FWGA 3R3EA 2MYGA 3E0UA 3GKMA 1EEMA 2HSMB 4GSNA 3KGKA 1Z7PA 2HI7A 2QKEA 1VF4A 2LJKA 1GH2A 1V58A 4MCUA 1U6TA 1XW6A 3MDKA 4HQZA 2J23A 2HZEB 5DQYA 4JR6A 4MJEA 4TR1A 4K1FA 1SK2A 1GLPA 2FNOA 2C4JA 2IMKA 1OE8A 2PGTA 5B8AA 1MD4A 4G19A 3CMIA 5F0GA 4F0BA 3KH7A 1VF2A 4K7OA 3SWLA 1K3YA 4ZB8A 1G7EA 16GSA 4JR4A 2H71A 4PUAA 2XPDA 4ZL8A 5E4WA 3LJRA 3TOUA 4RQXA 2DJ1A 5D8IA 3GTUA 2E2GA 2AHEA 1GTAA 2O7KA 1EWXA 3U5RE 4MH2A 3VWVA 5G1LA 4V1Ag 2C0DA 2H76A 2GZZA 3HZ4A 1TDIA 3IV4A 4K7NA 2I4AA 2OJLA 1I5GA 5D9WA 5HR1A 3ERFA 2NBSA 1V40A 2HZFA 3ZFBA 4G0KA 2H0GA 2B5XA 5ECLB 2ZCTA 2X64A 1GSUA 1EEJA 1TW9A 3IC4A 1VF1A 1GSYA 3APQA 3EWLA 2LKUA 3N9JA 3D21A 1FO5A 3FR3A 2AUVA 2F3MA 1K0CA 1XWGA 4YAPA 2RM5A 5AISA 2P5RA 1PKZA 3EMXA 2B5EA 5LCZA 1PGTA 2C8UA 1XZOA 13GSA 2L57A 3ZL5A 3HCZA 3ZFLA 4MPFA 2XHFA 4BA7A 4HU7A 4CW9A 3ZMKA 2IMDA 2VL2C 1GRXA 3IR4A 1QUWA 2GSRA 4L8EA 1XOBA 4ZBAA 3QFAC 1SKRB 4K0NA 3Q19A 1MDKA 4KA0A 1XBSA 2KLXA 3TRXA 4ZILA 3GKKA 1U88A 3MSZA 2B5YA 2YWIA 4KAEA 1HQOA 2CVKA 4GQFA 1SL1B 3GTUB 1SK1A 4G10A 5C00A 4PTSA 5CRHA 3TCOA 4KDXA 1U3IA 3O6TA 1M9AA 5DVBA 4IHUA 5L71A 2A4VA 3HJOA 3M3MA 2DJ2A 4EL1A 1F3BA 3ZREA 4FYUA 1PQNA 3DXBA 3LYPA 4TVEA 5DJMA 2A2SA 4HI7A 3DYRA 3I69A 4NAXA 2H74A 2V6KA 4ZBBA 1UVZA 2MZCA 1Z7RA 3CTFA 1S3AA 3IRAA 2Z9SA 18GSA 1ILOA 2WULA 1A24A 4K9ZA 14GSA 1WOUA 4Q5FA 2HQTA 3BBYA 2DJJA 1GSSA 1ML6A 1GWCA 2RUEA 4ZL9A 3HZ8A 2KP2A 2P5QA 5ECMB 4MDCA 4PXOA 4POLA 3D5JA 4KDUA 1RK4A 19GSA 4KW6A 3C1RA 2OACA 2YP6A 1FAAA 2ES7A 2IJYA 5H5QA 3HXSA 1EOGA 3GA4A 1B4QA 1YF0A 4HUAA 4GLTA 1FG4A 1T4ZA 1M9BA 4DSRA 1UC7A 4HZ2A 1T3BA 3LSZA 4ECIA 4KH7A 4KX4A 5GAND 1SKSB 2IFQB 2R3XA 3VI5A 1EGOA 1GNWA
chains in the Genus database with same CATH superfamily
1Z9HA 5KN2A 2HRFA 1BJXA 4KUNA 4LMWA 1TXUA 4MP4A 5DQSA 3M9KA 2VIMA 2GQMA 2YOIA 8GSSA 1SL2B 1HYUA 1UA5A 4MPGA 1Y6EA 4V1Ap 2R5GA 3ERWA 2R2JA 2R37A 2EIQA 1EV9A 1TOFA 3CSJA 3LG6A 4POKA 3GH9A 3DD3A 5A4WA 1JHBA 2PMTA 4FYBA 1BAYA 2H0IA 3VURA 2JU5A 5G31A 4EO3A 4ZXGA 3OR5A 2H6ZA 3FR9A 3L0HA 4PQHA 1TK0B 5GSSA 4TXOA 1GSFA 2JACA 4F82A 4O7HA 3F6DA 1WIKA 3RHCA 2O3EA 1KBNA 4OCFA 1Q98A 2P31A 4O32A 4PQ1A 2VCTA 2V1MA 4JE1A 2DMLA 1M3JA 1RQMA 3F4RA 4AF2A 2WB9A 2WZ9A 9GSSA 1ZYQB 4TR4A 1X0RA 3D6IA 1ZCPA 2YNXA 4Z2TA 2PWJA 4I8BA 3WGEA 1B8XA 4HJMA 4PI0C 3RPPA 1YJ6A 3GURA 1GLQA 1W4VA 2K9FA 4PHZC 4G9HA 4D73B 2MBSA 2DIZA 4ZL7A 1YQ1A 3L78A 2YJ7A 4XIHA 1F2EA 3ZMLA 3KMOA 4BWQA 2HRAA 1PX7A 1PA3A 2HRKB 2VD1A 3TJGA 3P8WA 2VL2A 2JZTA 5G5EA 2L59A 4MZWA 3HVVA 1FHEA 5FT3A 2OADA 4PGTA 2HSNB 4TR3A 3UBKA 1K0BA 5ECNB 4WXTA 4L5OA 3E3EA 4WR5A 2GZYA 5AIVA 5JCUA 5ID2B 3CRTA 2XPEA 4IS0A 3CQFA 1R7HA 2FWFA 2G0FA 5ENUA 3C73A 3C8EA 1QMVA 1T7PB 2DKIA 4ML1A 3D22A 2WRTA 4G0IA 2YZUA 5A5HB 1THOA 1PN0A 1SD9A 3HDCA 5ECRB 5B6NA 1K0MA 4LMVA 2BTOT 1EOHA 1XWKA 2MMZA 3M9JA 2X99A 2FA4A 1OKTA 4PUFC 5H5SA 1IYIA 4N0VA 5ELGA 2H19A 3ISOA 1FB6A 1K0OA 3KIJA 3VWXA 3LEFA 1HNAA 3VFIA 1OKDA 5JWQB 1V57A 3QR6A 5AIXA 4YQVA 2CZ2A 2X8HA 1XG8A 4RI6A 2N5FA 2WW2A 5F07A 1SU9A 2B3SA 2VLUA 3G7JA 4Z2UA 1EP7A 4PQIA 5H5RA 2WFCA 2RIIA 2IMFA 2EIRA 3IBHA 5ABRA 3ZVJD 1KTEA 3RFRC 4MF6A 1TU8A 2ALBA 2JZRA 4TXVA 2VL3A 2XBIA 4BVYA 3TDGA 4NPBA 3DIEA 2L6DA 4QL9A 2VCVA 4WEYA 2R0PA 3VWUA 1ERUA 3A5WA 1XIYA 4NXIA 4PX1A 2VM1A 3APSA 4ECBA 4AKGA 3GMFA 3TJJA 2LJRA 2MMAA 3IK9A 11GSA 1HD2A 1QK8A 3AY8A 3UAPA 5G5FA 3DEXA 3SBCA 3MWHA 2F8FA 5CREA 3VWWA 2ON7A 2O85A 1AQVA 2C0FA 1K0AA 2C80A 2CVBA 3ZYWA 6GSXA 1K0DA 5IMZA 7GSSA 2WW0A 3CSHA 1XFLA 2I1UA 4G0LA 1JLVA 1T1VA 3I9V2 2JZSA 5COHA 3EE2A 4YH2A 4RI7A 2PPTA 1USBA 3A3TA 3FMWA 5LD0A 3IAS2 4KDYA 3CYNA 6GSYA 1X5DA 1HNBA 4IP1A 2LV3A 2TRXA 2EC4A 2M46A 2L4CA 4GTUA 4ECJA 1FOVA 1O85A 3UIWA 3FRCA 3GKNA 3FEUA 3H79A 2YPMA 3U6VA 2C3NA 4K2XA 2PN8A 4POBA 1ZYNA 5JWOB 1SD8A 2GVPA 4NV5A 5IOWA 1XWAA 3VPTA 3P2AA 4RUVA 4F0CA 5KN0A 4ML6A 5AGYA 5G2ZA 5CNWA 5KN1A 4OO5A 2LNSA 2H73A 3ZZXA 3IC8A 2FUG2 1DSBA 2YV7A 3GN3A 3F8UA 1A2JA 2JSYA 2IWTA 2CVDA 2OE0A 2VAFA 2HXKA 4BVYB 3PGTA 4I6XA 4K6XA 4Z7XA 5ECSA 2B1KA 3RDWA 3FHKA 1TI3A 4E8EA 2EFDA 3QDNA 4GSTA 2FWEA 3HVNA 1YZXA 4JU5A 4EUYA 3DWVA 2CT6A 1F37A 1ERVA 1IYHA 1W89A 1BG5A 3UBLA 1GL8A 1AIUA 4FQUA 2O8VB 5IMAA 5CRDA 5DJLA 3GFKA 2LSTA 3C7MA 1OC8A 3G7IA 2L6CA 2C3TA 2CA8A 3F0IA 4N0ZA 4MZCA 1DE2A 1ZYPA 2WGRA 3TJFA 3EPTA 2H75A 5F06A 1JZRA 4XTSA 4BWSA 4Q5QA 1LJRA 4XCSA 5KEJA 3GIXA 4ID0A 2GQKA 4KB3A 1B48A 4MK3A 1WE0A 1U87A 4WETA 3TKRA 1BEDA 1SVOA 3BJ5A 1SK0A 2KHPA 5IOXA 5J9CA 3KM6A 5A4VA 2IFQA 2C3QA 1CQHA 3EMPA 1H4OA 5KN3A 1GUHA 1Z6NA 3DMLA 2K18A 3FR6A 2OA7A 1G6WA 3KTLA 1VGLA 5FWGA 3A5IA 1LU4A 4JZQA 4K2DA 1A2MA 1ZOFA 1BQ7A 4EC0A 1XVWA 2L4QA 2DIYA 5CYYA 5D9XA 1XPVA 6GSSA 5DAKA 3C71A 3IA1A 3UL3A 4ZB6A 1EP8A 1JZDA 3TU3B 1ERWA 4IELA 2H1DA 3F4TA 5INYA 2IIYA 5IPHA 4XS4A 1M99A 3KZQA 3GKXA 1JZOA 3HJMA 2YZHA 5DDLA 3QMXA 2LTKA 2QA1A 3LWAA 1K0NA 2HT9A 1Y25A 3IHGA 4LL4B 3ZLPA 1Q4JA 3BCKA 4HS1A 1NHYA 3HMJG 1GTIA 5J3RA 4IN0A 4CDOA 5J9BA 5DCGA 4IVFA 1B9YC 3DKSA 5IMFA 1M2AA 4MJAA 2F9SA 3M0FA 4EVMA 3MAKA 1URMA 5IMDA 1PMTA 2HSYA 4D73A 3BD2A 2N5BA 1WJKA 5GAPD 5ECPB 1VRSD 3RPNA 3E9JB 1XXUA 1FW1A 3GH6A 2H6YA 1T4YA 2HRKA 4OO4A 1YVLA 2WVXB 4AJ8A 2VCZA 1MEKA 1QFNA 2VUPA 1BYEA 3HVXA 3KMNA 3HYPA 2GSTA 1SENA 2HSNA 2A2RA 2IL3A 4ZB7A 2CZ3A 3GUSA 2WW1A 4MF5A 2LUSA 5EL8A 3EURA 4XRAA 2DLXA 5ID2A 1M2DA 5J41A 2ON5A 5J47A 4HU9A 1Z5YE 2B1LA 1KEBA 1JLWA 2GDRA 2FCHA 3MIXA 3WD6A 3TKSC 3QAWA 4J56E 4N3ZA 1OVNA 5D96A 1DBYA 1O8XA 2I3YA 3KJYA 2OBIA 4OFMA 3F6FA 5A5HA 2L5LA 3GV1A 2HE3A 3APOA 4AJ7A 4HQSA 5DAKB 5G30A 12GSA 1MD3A 3QAGA 1OYJA 1S3DA 2K8VA 2WW3A 3FW2A 3CXGA 4LA1A 1RW1A 4HJ2A 2GTUA 1ACVA 3V1WA 4I5QA 1BG1A 2BJXA 3GRXA 2WCIA 1DE1A 2K8SA 3TOTA 4XS4B 3LQ7A 1PL1A 2HSHA 1SL0B 4L0WA 2J9HA 2M72A 1TKDB 2FWHA 4POMA 4EDYA 5J4VA 4QMKA 4KCAA 3GL5A 5BMUA 3J7Yk 1GP1A 3S9FA 1ZZYA 2GQLA 5GZZB 4MNNA 1M0UA 3KEBA 4WR4A 4GCIA 3ZIVA 4P3YB 1G6YA 4ZBDA 1AAZA 1GUMA 2L5OA 3DRNA 3ME7A 5DALA 3F3RA 2VD0A 4PNFA 3VLNA 5A34B 5IIZA 3TKQA 1SJIA 2E0QA 2GT6A 4MA9A 3KP8A 5ECQB 2B7KA 1SJ6A 1ZMAA 3UVHA 2X49A 2H8LA 4GRFA 2DSAA 3DVXA 1UN2A 4N10A 4WBJA 4NWYA 2AB6A 1R5PA 2PU9C 2F51A 3KTBA 2JSZA 2UV8G 3K8NA 2AAWA 5HFGA 1O6JA 1VF3A 2DC5A 4JEDA 3RAZA 2YANA 2HFDA 1A0FA 1OC9B 1Y1UA 4NHZA 4KNDA 1A23A 3ERGA 2M80A 1MDJA 2WZSA 3HA9A 5EVOA 5IO0A 5J4YA 4KSOA 1O73A 4GXZA 3DGQA 1K3OA 5JCGA 3QOUA 5E59A 2H01A 4BVXA 4WBRD 4N11A 5ECIB 1PSQA 2VM2A 2CX4A 5GSTA 3CTGA 4FXYP 4IQAA 2O5VA 4PNGA 1N8JA 1EZKA 3ZTLA 5LNKe 2CAQA 4Q5NA 4WKWA 5IM9A 1V9WA 4KSMA 2TRCP 2V32A 2P0GA 3R2QA 2H1GA 2QA2A 3L4NA 4KGIA 3JCML 2IMIA 5BMUB 3TUEA 5EY6A 4NMUA 1R5AA 1OAZA 3GHAA 4AKHA 1M2BA 5ELAA 1B4PA 2GGTA 4YAVA 5J4UA 4F9ZA 5JCWA 3NIVA 1PFOA 3TKPA 4EKZA 2IMEA 5DALB 3EVIA 1U3AA 3EC3A 1SYRA 2OKAA 1TU7A 4QL7A 2GT5A 1A2LA 3KCMA 4CY8A 3H8QA 3FZAA 3TB2A 4DSQA 5D9TA 2D2ZA 3RGBC 2LNTA 5IQYA 4J2FA 3O3TA 2R6KA 1PX6A 3QAVA 3TGZA 2WDUA 2QSIA 4LL1B 3KD0A 4DEJA 1Z3EA 2O36A 4PURA 5HR0A 3RBTA 3H4KA 3HVSA 4ZB9A 2DMMA 4MMMA 4DSSA 2OT3A 4XHMA 3VK9A 1QXHA 1YDKA 4IGJA 2WJUA 1NSWA 1TK8B 6GSVA 1YEPA 1X5CA 3TKSA 1XWCA 5DBQA 4OD7A 3FY7A 4WF5A 5JWRB 5A1NB 2CQ9A 4BVXB 1G0TA 3US3A 4IP6A 4EE0A 1MTCA 4Q5RA 4EXJA 2KP1A 2DJ3A 3QPMA 1I1IP 4PI2C 2DJKA 4K7IA 1MDIA 1J0FA 3IOSA 4NV2A 3MNGA 5B8BA 6GSUA 2NPBA 5IPGA 1G7OA 2VCXA 3P90A 2LEGA 1R26A 2C0GA 4TW5A 2R4VA 4V2LA 1PRXA 4EDZA 2I81A 4TRXA 2C0EA 2LS5A 1AUCA 5B7CA 4E8HA 20GSA 2OE1A 2YV9A 2ZNMA 4FO5A 4L0UA 4GQCA 22GSA 3FZ9A 2ZUPA 4TOPA 4H86A 4EIPA 4AJ6A 2H66A 3LXZA 2RLIA 4HEA2 3RHBA 4GSSA 3CRUA 4AKXB 4ISDA 3PH9A 5HFIA 1OC3A 4KF9A 2V41A 3GNJA 3GYKA 4WF4A 1YF1A 1PL2A 4YQMA 1GTUA 1YKCA 2I9HA 1NHOA 3A2VA 2LQOA 2YWMA 4L5LA 2NVLA 2EFEA 4MJBA 2DJ0A 3GSSA 2FLSA 4N30A 5ECOB 4DSSB 3VPQA 2TIRA 1SJZA 2VLTA 3ED3A 5EPFA 2EFCA 4ZIJA 1FB0A 3Q6OA 1Z6MA 3W6GA 1DUGA 3UARA 3VI7A 4LLRA 2KOKA 1ZL9A 1XVQA 1CQGA 2WVXA 1AQWA 3WT1A 3LYKA 3D0ZA 2PVQA 3GSTA 4OWYA 4FYCA 4OFTA 1J08A 3W8SA 2O89A 4OCEA 4IJ3A 1TRUA 4CHSA 4TR1B 2X8CA 4CY6A 4JBBA 1GSQA 1B9XC 2WS2A 1A0RP 1WRYA 2HYXA 1ZYEA 3J7Yb 1SVMA 4AGSA 3WYWA 1AC1A 1F9MA 2E2MA 5CP1A 3FZ5A 2BMXA 1ABAA 5G1KA 1V98A 4ECCA 3PINA 3UEMA 2LRTA 1NM3A 4F2IA 4I2UA 3HD5A 3LW9A 2E7PA 3N5OA 2V2GA 10GSA 3QD9A 4V2MA 1OE7A 1EV4A 2YN1A 1GTBA 3D4TA 3A2XA 1C72A 1WP0A 1O8WA 1WWJA 3TJKA 4O5QA 4YKGA 1R4WA 2LQQA 3HY2A 1E6BA 3HHVA 1SYXA 5D73A 4IJIA 2AV4A 3WT2A 2LRCA 1GULA 1QQ2A 3ZRDA 4K8MA 4J57E 3NZNA 2GSQA 4BL7A 1YKAA 5A34A 3PPUA 2QGVA 1XCCA 1N2AA 5CO3A 3F3QA 1PD21 6GSTA 4GF0A 2O87A 2JL4A 3L9SA 1TXXA 3UMAA 2GSSA 2C1YA 1XWBA 4JRRA 4MH3A 3ME8A 1TTZA 3UVTA 5IMVA 6GSWA 2A2PA 3ZITA 2AJQB 2OBKA 2IN3A 2MMOA 4HOJA 2K6VA 2B6MA 1YEWC 1V2AA 3BCIA 2NDOA 2H1LA 5FHIA 1GSDA 3LGCA 1X9WB 5HR3A 2F8AA 2FGXA 3EU3A 3TRQA 2CX3A 2GZPA 1JFUA 1OC9A 3UOMA 2H0HA 5IO2A 4KE3A 1TRWA 4MABA 2GLRA 4TR0A 3IPZA 4IKHA 1ZGNA 3IDVA 3QFBC 4IQ1A 4ILFA 2EIOA 3P7XA 4ACSA 4HDEA 1AW9A 4QQ7A 1A8YA 3HKRA 1XW5A 2H30A 5CAXA 4BPYA 2AYTA 3CSIA 3TKSE 3GX8A 5F8BA 4RQRA 1GNEA 3HJPA 3CWGA 3W8JA 4X4JA 4X0XA 1SKWB 1M7TA 3BOAA 3CHXC 1EGRA 1FOHA 2IPAA 2G2QA 3M1GA 2KUCA 4ULXA 5KOXA 1YEXA 4F03A 2XBQA 3LORA 3WGXA 2H72A 3L9VA 1QGVA 4V2NA 2JADA 1TRSA 2VCQA 3GL3A 3C1SA 5KOWA 1XOAA 3F9UA 3IK7A 1ON4A 4MF7A 2YWOA 2GS3A 4XS1A 4EF0A 3IAM2 2LJAA 5HFKA 5DCHA 3PR8A 1GUKA 4FIWA 1WPIA 2OE3A 5CRGA 1YY7A 2REMA 1X9MB 4BL7B 2YCDA 4AKIA 3LFLA 2RM6A 4AI6A 1GSEA 2CV4A 3G9BA 1I9DA 2FY6A 2H70A 2H1BA 1T8EB 5D9VA 1ST9A 4MZBA 2MMNA 3TJBA 1FVKA 3ZVJA 2H6XA 2HRNA 3GX0A 4K5RA 3EINA 4NHWA 4HSCX 4MJCA 1TRVA 5D93A 2YJHA 1KNGA 2VL9A 5B6MA 2NTOA 4X43A 5IMCA 5BRTA 3LXTA 1AXDA 4OMVA 3KXOA 4MLYA 2LRNA 4TKYA 3FYGA 2RUFA 2MBTA 1F3AA 1T00A 5A5KA 4IBPA 5F05A 3IXRA 5A1NA 2HSMA 2N5AA 3ZIJA 4YKFA 2PBJA 1TK5B 2WVZA 1J9BA 1S3CA 1TJDA 1LBKA 3FK8A 1WMJA 5ECHB 2QC7A 4DVCA 3TRPA 4XS6A 4I97A 5CRWA 2FD3A 3UJ1A 1JZWA 3F63A 3KP9A 2HZEA 2FA8A 4XRDA 17GSA 2DBCA 5HR2A 2FHEA 4TN8A 5ECKB 3M8NA 4K0GA 4HZ4A 3MYDA 1PN9A 3NOFA 2PVOC 2X8GA 2XC2A 2X4AA 5HQPA 1PKWA 3DVWA 3EYTA 4TXOB 4O5RA 4GDFA 3QCPA 1O81A 3I6AA 4KCEA 4FH8A 1X9SB 2CAIA 3Q74A 2V6OA 3FZ4A 4OFNA 1XW9A 4X1UA 2VCWA 2HLSA 3H93A 4YQUA 1S3RA 3I43A 3H1NA 3O76A 1F6MC 1A8LA 2B7JA 4O92A 1X5EA 4IW9A 1ERTA 2H1AA 2VO4A 5AN1A 2VLVA 2HNLA 3FKFA 4BIKA 4USSA 1FVJA 3IHQA 2YWNA 5C04A 1BX9A 1O7UA 3IE3A 1H75A 3G7YA 3F4SA 3EU4A 3A2WA 3L9UA 1TP9A 4I2TA 3CBUA 4GWRA 1HNCA 5A4UA 4G2EA 5J5NA 3WGDA 1THXA 1K3LA 2PERA 3Q18A 2UZ8A 1TI1A 3KH9A 1AQXA 2PUKC 1E2YA 2VOCA 1NW2A 3D4MA 2EFHA 2FWGA 3R3EA 2MYGA 3E0UA 3GKMA 1EEMA 2HSMB 4GSNA 3KGKA 1Z7PA 2HI7A 2QKEA 1VF4A 4W66A 2A4HA 2LJKA 1GH2A 1V58A 4MCUA 1U6TA 1XW6A 3MDKA 4HQZA 2J23A 2HZEB 5DQYA 4JR6A 4MJEA 4TR1A 2R0GA 4K1FA 1SK2A 1GLPA 2FNOA 2C4JA 5J40A 2IMKA 4O5UA 1OE8A 2PGTA 5B8AA 1MD4A 4G19A 3CMIA 5F0GA 4F0BA 3KH7A 1VF2A 4K7OA 3SWLA 1K3YA 4ZB8A 1G7EA 16GSA 4JR4A 2H71A 4PUAA 2XPDA 4ZL8A 5E4WA 3LJRA 3TOUA 4RQXA 2DJ1A 5D8IA 3GTUA 2E2GA 1SVLA 2AHEA 1GTAA 2O7KA 1EWXA 4ICYA 3U5RE 4MH2A 3VWVA 5G1LA 4V1Ag 1M3IA 2C0DA 2H76A 2GZZA 3HZ4A 1TDIA 3IV4A 4K7NA 2I4AA 2OJLA 1I5GA 5D9WA 5HR1A 3ERFA 2NBSA 1V40A 2HZFA 3ZFBA 4G0KA 2H0GA 2B5XA 5ECLB 2ZCTA 2X64A 1GSUA 1EEJA 1TW9A 3IC4A 1VF1A 1GSYA 3APQA 3EWLA 2LKUA 3N9JA 3D21A 1FO5A 3FR3A 2AUVA 2F3MA 1K0CA 1XWGA 4YAPA 2RM5A 5AISA 2P5RA 1PKZA 3EMXA 2B5EA 5LCZA 1PGTA 2C8UA 1XZOA 13GSA 2L57A 3ZL5A 3HCZA 3ZFLA 4MPFA 2XHFA 4BA7A 4HU7A 4CW9A 3ZMKA 2IMDA 2VL2C 1GRXA 3IR4A 1QUWA 2GSRA 4L8EA 1XOBA 4ZBAA 3QFAC 1SKRB 4K0NA 3Q19A 1MDKA 4K5SA 4KA0A 1XBSA 2KLXA 3TRXA 4ZILA 3GKKA 2WVYA 1U88A 3MSZA 2B5YA 2YWIA 4KAEA 4G01A 1HQOA 2CVKA 4GQFA 1SL1B 3GTUB 1SK1A 4G10A 5C00A 4PTSA 5CRHA 3TCOA 4KDXA 1BF5A 1U3IA 3O6TA 1M9AA 5DVBA 4IHUA 5L71A 2A4VA 3HJOA 3M3MA 2DJ2A 4E68A 4EL1A 1F3BA 3ZREA 4FYUA 1PQNA 3DXBA 3LYPA 4TVEA 5DJMA 2A2SA 4HI7A 3DYRA 3I69A 4NAXA 2H74A 2V6KA 1S4BP 4ZBBA 1UVZA 2MZCA 2DKHA 2R0CA 1Z7RA 3CTFA 1S3AA 3IRAA 2Z9SA 1N25A 18GSA 1ILOA 2WULA 1A24A 4K9ZA 14GSA 1WOUA 4Q5FA 2HQTA 3BBYA 2DJJA 1GSSA 1ML6A 1GWCA 2RUEA 4Z2RA 4ZL9A 3HZ8A 2KP2A 2P5QA 5ECMB 4MDCA 4PXOA 4POLA 3D5JA 4KDUA 1RK4A 19GSA 4KW6A 3C1RA 2OACA 2YP6A 1FAAA 4EIQA 2ES7A 2IJYA 5H5QA 3HXSA 1EOGA 3GA4A 1B4QA 2VKZG 1YF0A 4HUAA 4GLTA 1FG4A 1T4ZA 1M9BA 4DSRA 1UC7A 4HZ2A 1T3BA 3LSZA 4ECIA 4KH7A 4KX4A 5GAND 1SKSB 4A5PA 2IFQB 2R3XA 3VI5A 1EGOA 1GNWA
chains in the Genus database with same CATH topology
1Z9HA 5KN2A 2HRFA 1BJXA 4KUNA 4LMWA 1TXUA 4MP4A 5DQSA 3M9KA 2VIMA 2GQMA 2YOIA 8GSSA 1SL2B 1HYUA 1UA5A 4MPGA 1Y6EA 4V1Ap 2R5GA 3ERWA 2R2JA 2R37A 2EIQA 1EV9A 1TOFA 3CSJA 3LG6A 4POKA 3GH9A 3DD3A 5A4WA 1JHBA 2PMTA 4FYBA 1BAYA 2H0IA 3VURA 2JU5A 5G31A 4EO3A 4ZXGA 3OR5A 2H6ZA 3FR9A 3L0HA 4PQHA 1TK0B 5GSSA 4TXOA 1GSFA 2JACA 4F82A 4O7HA 3F6DA 1WIKA 3RHCA 1KBNA 4OCFA 1Q98A 2P31A 4O32A 4PQ1A 2VCTA 2V1MA 4JE1A 2DMLA 1RQMA 3F4RA 4AF2A 2WB9A 2WZ9A 9GSSA 1ZYQB 4TR4A 1X0RA 3D6IA 1ZCPA 2YNXA 4Z2TA 2PWJA 4I8BA 3WGEA 1B8XA 4HJMA 3RPPA 1YJ6A 3GURA 1GLQA 1W4VA 2K9FA 4G9HA 4D73B 2MBSA 2DIZA 4ZL7A 1YQ1A 3L78A 2YJ7A 4XIHA 1F2EA 3ZMLA 3KMOA 4BWQA 2HRAA 1PX7A 1PA3A 2HRKB 2VD1A 3TJGA 3P8WA 2VL2A 2JZTA 5G5EA 2L59A 4MZWA 3HVVA 1FHEA 5FT3A 2OADA 4PGTA 2HSNB 4TR3A 3UBKA 1K0BA 5ECNB 4WXTA 4L5OA 3E3EA 4WR5A 2GZYA 5AIVA 5JCUA 5ID2B 3CRTA 2XPEA 4IS0A 1R7HA 2FWFA 2G0FA 5ENUA 3C73A 3C8EA 1QMVA 1T7PB 2DKIA 4ML1A 3D22A 2WRTA 4G0IA 2YZUA 5A5HB 1THOA 1PN0A 1SD9A 3HDCA 5ECRB 5B6NA 1K0MA 4LMVA 2BTOT 1EOHA 1XWKA 2MMZA 3M9JA 2X99A 2FA4A 1OKTA 4PUFC 5H5SA 1IYIA 4N0VA 5ELGA 2H19A 3ISOA 1FB6A 1K0OA 3KIJA 3VWXA 3LEFA 1HNAA 3VFIA 1OKDA 5JWQB 1V57A 3QR6A 5AIXA 4YQVA 2CZ2A 2X8HA 4RI6A 2N5FA 5F07A 1SU9A 2B3SA 2VLUA 3G7JA 4Z2UA 1EP7A 4PQIA 5H5RA 2WFCA 2RIIA 2IMFA 2EIRA 3IBHA 5ABRA 3ZVJD 1KTEA 4MF6A 1TU8A 2ALBA 2JZRA 4TXVA 2VL3A 2XBIA 4BVYA 3TDGA 4NPBA 3DIEA 2L6DA 4QL9A 2VCVA 4WEYA 2R0PA 3VWUA 1ERUA 3A5WA 1XIYA 4NXIA 4PX1A 2VM1A 3APSA 4ECBA 4AKGA 3GMFA 3TJJA 2LJRA 2MMAA 3IK9A 11GSA 1HD2A 1QK8A 3AY8A 3UAPA 5G5FA 3DEXA 3SBCA 3MWHA 2F8FA 5CREA 3VWWA 2ON7A 2O85A 1AQVA 2C0FA 1K0AA 2C80A 2CVBA 3ZYWA 6GSXA 1K0DA 5IMZA 7GSSA 3CSHA 1XFLA 2I1UA 4G0LA 1JLVA 1T1VA 3I9V2 2JZSA 5COHA 3EE2A 4YH2A 4RI7A 2PPTA 1USBA 3A3TA 3FMWA 5LD0A 3IAS2 4KDYA 3CYNA 6GSYA 1X5DA 1HNBA 4IP1A 2LV3A 2TRXA 2EC4A 2M46A 2L4CA 4GTUA 4ECJA 1FOVA 1O85A 3UIWA 3FRCA 3GKNA 3FEUA 3H79A 2YPMA 3U6VA 2C3NA 4K2XA 2PN8A 4POBA 1ZYNA 5JWOB 1SD8A 2GVPA 4NV5A 5IOWA 1XWAA 3VPTA 3P2AA 4RUVA 4F0CA 5KN0A 4ML6A 5AGYA 5G2ZA 5CNWA 5KN1A 4OO5A 2LNSA 2H73A 3ZZXA 3IC8A 2FUG2 1DSBA 2YV7A 3GN3A 3F8UA 1A2JA 2JSYA 2IWTA 2CVDA 2OE0A 2VAFA 2HXKA 4BVYB 3PGTA 4I6XA 4K6XA 4Z7XA 5ECSA 2B1KA 3RDWA 3FHKA 1TI3A 4E8EA 2EFDA 3QDNA 4GSTA 2FWEA 1YZXA 4JU5A 4EUYA 3DWVA 2CT6A 1F37A 1ERVA 1IYHA 1W89A 1BG5A 3UBLA 1GL8A 1AIUA 4FQUA 2O8VB 5IMAA 5CRDA 5DJLA 3GFKA 2LSTA 3C7MA 1OC8A 3G7IA 2L6CA 2C3TA 2CA8A 3F0IA 4N0ZA 4MZCA 1DE2A 1ZYPA 2WGRA 3TJFA 3EPTA 2H75A 5F06A 1JZRA 4XTSA 4BWSA 4Q5QA 1LJRA 4XCSA 5KEJA 3GIXA 4ID0A 2GQKA 4KB3A 1B48A 4MK3A 1WE0A 1U87A 4WETA 3TKRA 1BEDA 1SVOA 3BJ5A 1SK0A 2KHPA 5IOXA 5J9CA 3KM6A 5A4VA 2IFQA 2C3QA 1CQHA 3EMPA 1H4OA 5KN3A 1GUHA 1Z6NA 3DMLA 2K18A 3FR6A 2OA7A 1G6WA 3KTLA 1VGLA 5FWGA 3A5IA 1LU4A 4JZQA 4K2DA 1A2MA 1ZOFA 1BQ7A 4EC0A 1XVWA 2L4QA 2DIYA 5CYYA 5D9XA 1XPVA 6GSSA 5DAKA 3C71A 3IA1A 3UL3A 4ZB6A 1EP8A 1JZDA 3TU3B 1ERWA 4IELA 2H1DA 3F4TA 5INYA 2IIYA 5IPHA 4XS4A 1M99A 3KZQA 3GKXA 1JZOA 3HJMA 2YZHA 5DDLA 3QMXA 2LTKA 2QA1A 3LWAA 1K0NA 2HT9A 1Y25A 3IHGA 4LL4B 3ZLPA 1Q4JA 3BCKA 4HS1A 1NHYA 3HMJG 1GTIA 5J3RA 4IN0A 4CDOA 5J9BA 5DCGA 4IVFA 1B9YC 3DKSA 5IMFA 1M2AA 4MJAA 2F9SA 3M0FA 4EVMA 3MAKA 1URMA 5IMDA 1PMTA 2HSYA 4D73A 3BD2A 2N5BA 1WJKA 5GAPD 5ECPB 1VRSD 3RPNA 3E9JB 1XXUA 1FW1A 3GH6A 2H6YA 1T4YA 2HRKA 4OO4A 1YVLA 4AJ8A 2VCZA 1MEKA 1QFNA 2VUPA 1BYEA 3HVXA 3KMNA 3HYPA 2GSTA 1SENA 2HSNA 2A2RA 2IL3A 4ZB7A 2CZ3A 3GUSA 4MF5A 2LUSA 5EL8A 3EURA 4XRAA 2DLXA 5ID2A 1M2DA 5J41A 2ON5A 5J47A 4HU9A 1Z5YE 2B1LA 1KEBA 1JLWA 2GDRA 2FCHA 3MIXA 3WD6A 3TKSC 3QAWA 4J56E 4N3ZA 1OVNA 5D96A 1DBYA 1O8XA 2I3YA 3KJYA 2OBIA 4OFMA 3F6FA 5A5HA 2L5LA 3GV1A 2HE3A 3APOA 4AJ7A 4HQSA 5DAKB 5G30A 12GSA 1MD3A 3QAGA 1OYJA 1S3DA 2K8VA 3FW2A 3CXGA 4LA1A 1RW1A 4HJ2A 2GTUA 1ACVA 3V1WA 4I5QA 1BG1A 2BJXA 3GRXA 2WCIA 1DE1A 2K8SA 3TOTA 4XS4B 3LQ7A 1PL1A 2HSHA 1SL0B 4L0WA 2J9HA 2M72A 1TKDB 2FWHA 4POMA 4EDYA 5J4VA 4QMKA 4KCAA 3GL5A 5BMUA 3J7Yk 1GP1A 3S9FA 1ZZYA 2GQLA 5GZZB 4MNNA 1M0UA 3KEBA 4WR4A 4GCIA 3ZIVA 4P3YB 1G6YA 4ZBDA 1AAZA 1GUMA 2L5OA 3DRNA 3ME7A 5DALA 3F3RA 2VD0A 4PNFA 3VLNA 5A34B 5IIZA 3TKQA 1SJIA 2E0QA 2GT6A 4MA9A 3KP8A 5ECQB 2B7KA 1SJ6A 1ZMAA 3UVHA 2X49A 2H8LA 4GRFA 2DSAA 3DVXA 1UN2A 4N10A 4WBJA 4NWYA 2AB6A 1R5PA 2PU9C 2F51A 3KTBA 2JSZA 2UV8G 3K8NA 2AAWA 5HFGA 1O6JA 1VF3A 2DC5A 4JEDA 3RAZA 2YANA 2HFDA 1A0FA 1OC9B 1Y1UA 4NHZA 4KNDA 1A23A 3ERGA 2M80A 1MDJA 3HA9A 5EVOA 5IO0A 5J4YA 4KSOA 1O73A 4GXZA 3DGQA 1K3OA 5JCGA 3QOUA 5E59A 2H01A 4BVXA 4WBRD 4N11A 5ECIB 1PSQA 2VM2A 2CX4A 5GSTA 3CTGA 4IQAA 2O5VA 4PNGA 1N8JA 1EZKA 3ZTLA 5LNKe 2CAQA 4Q5NA 4WKWA 5IM9A 1V9WA 4KSMA 2TRCP 2V32A 2P0GA 3R2QA 2H1GA 2QA2A 3L4NA 4KGIA 3JCML 2IMIA 5BMUB 3TUEA 5EY6A 4NMUA 1R5AA 1OAZA 3GHAA 4AKHA 1M2BA 5ELAA 1B4PA 2GGTA 4YAVA 5J4UA 4F9ZA 5JCWA 3NIVA 3TKPA 4EKZA 2IMEA 5DALB 3EVIA 1U3AA 3EC3A 1SYRA 2OKAA 1TU7A 4QL7A 2GT5A 1A2LA 3KCMA 4CY8A 3H8QA 3FZAA 3TB2A 4DSQA 5D9TA 2D2ZA 2LNTA 5IQYA 4J2FA 3O3TA 2R6KA 1PX6A 3QAVA 3TGZA 2WDUA 2QSIA 4LL1B 3KD0A 4DEJA 1Z3EA 4PURA 5HR0A 3RBTA 3H4KA 3HVSA 4ZB9A 2DMMA 4MMMA 4DSSA 2OT3A 4XHMA 3VK9A 1QXHA 1YDKA 4IGJA 2WJUA 1NSWA 1TK8B 6GSVA 1YEPA 1X5CA 3TKSA 1XWCA 5DBQA 4OD7A 3FY7A 4WF5A 5JWRB 5A1NB 2CQ9A 4BVXB 1G0TA 3US3A 4IP6A 4EE0A 1MTCA 4Q5RA 4EXJA 2KP1A 2DJ3A 3QPMA 2DJKA 4K7IA 1MDIA 1J0FA 3IOSA 4NV2A 3MNGA 5B8BA 6GSUA 2NPBA 5IPGA 1G7OA 2VCXA 3P90A 2LEGA 1R26A 2C0GA 4TW5A 2R4VA 4V2LA 1PRXA 4EDZA 2I81A 4TRXA 2C0EA 2LS5A 1AUCA 5B7CA 4E8HA 20GSA 2OE1A 2YV9A 2ZNMA 4FO5A 4L0UA 4GQCA 22GSA 3FZ9A 2ZUPA 4TOPA 4H86A 4EIPA 4AJ6A 2H66A 3LXZA 2RLIA 4HEA2 3RHBA 4GSSA 3CRUA 4AKXB 4ISDA 3PH9A 5HFIA 1OC3A 4KF9A 2V41A 3GNJA 3GYKA 4WF4A 1YF1A 1PL2A 4YQMA 1GTUA 1YKCA 2I9HA 1NHOA 3A2VA 2LQOA 2YWMA 4L5LA 2NVLA 2EFEA 4MJBA 2DJ0A 3GSSA 2FLSA 4N30A 5ECOB 4DSSB 3VPQA 2TIRA 1SJZA 2VLTA 3ED3A 5EPFA 2EFCA 4ZIJA 1FB0A 3Q6OA 1Z6MA 3W6GA 1DUGA 3UARA 3VI7A 4LLRA 2KOKA 1ZL9A 1XVQA 1CQGA 1AQWA 3WT1A 3LYKA 3D0ZA 2PVQA 3GSTA 4OWYA 4FYCA 4OFTA 1J08A 3W8SA 2O89A 4OCEA 4IJ3A 1TRUA 4CHSA 4TR1B 2X8CA 4CY6A 4JBBA 1GSQA 1B9XC 2WS2A 1A0RP 1WRYA 2HYXA 1ZYEA 3J7Yb 1SVMA 4AGSA 3WYWA 1AC1A 1F9MA 2E2MA 5CP1A 3FZ5A 2BMXA 1ABAA 5G1KA 1V98A 4ECCA 3PINA 3UEMA 2LRTA 1NM3A 4F2IA 4I2UA 3HD5A 3LW9A 2E7PA 3N5OA 2V2GA 10GSA 3QD9A 4V2MA 1OE7A 1EV4A 2YN1A 1GTBA 3D4TA 3A2XA 1C72A 1WP0A 1O8WA 1WWJA 3TJKA 4O5QA 4YKGA 1R4WA 2LQQA 3HY2A 1E6BA 3HHVA 1SYXA 5D73A 4IJIA 2AV4A 3WT2A 2LRCA 1GULA 1QQ2A 3ZRDA 4K8MA 4J57E 3NZNA 2GSQA 4BL7A 1YKAA 5A34A 3PPUA 2QGVA 1XCCA 1N2AA 5CO3A 3F3QA 1PD21 6GSTA 4GF0A 2O87A 2JL4A 3L9SA 1TXXA 3UMAA 2GSSA 2C1YA 1XWBA 4JRRA 4MH3A 3ME8A 1TTZA 3UVTA 5IMVA 6GSWA 2A2PA 3ZITA 2AJQB 2OBKA 2IN3A 2MMOA 4HOJA 2K6VA 2B6MA 1V2AA 3BCIA 2NDOA 2H1LA 5FHIA 1GSDA 3LGCA 1X9WB 5HR3A 2F8AA 2FGXA 3EU3A 3TRQA 2CX3A 2GZPA 1JFUA 1OC9A 3UOMA 2H0HA 5IO2A 4KE3A 1TRWA 4MABA 2GLRA 4TR0A 3IPZA 4IKHA 1ZGNA 3IDVA 3QFBC 4IQ1A 4ILFA 2EIOA 3P7XA 4ACSA 4HDEA 1AW9A 4QQ7A 1A8YA 3HKRA 1XW5A 2H30A 5CAXA 4BPYA 2AYTA 3CSIA 3TKSE 3GX8A 5F8BA 4RQRA 1GNEA 3HJPA 3CWGA 3W8JA 4X4JA 4X0XA 1SKWB 1M7TA 3BOAA 1EGRA 1FOHA 2IPAA 2G2QA 3M1GA 2KUCA 4ULXA 5KOXA 1YEXA 4F03A 2XBQA 3LORA 3WGXA 2H72A 3L9VA 1QGVA 4V2NA 2JADA 1TRSA 2VCQA 3GL3A 3C1SA 5KOWA 1XOAA 3F9UA 3IK7A 1ON4A 4MF7A 2YWOA 2GS3A 4XS1A 4EF0A 3IAM2 2LJAA 5HFKA 5DCHA 3PR8A 1GUKA 4FIWA 1WPIA 2OE3A 5CRGA 1YY7A 2REMA 1X9MB 4BL7B 2YCDA 4AKIA 3LFLA 2RM6A 4AI6A 1GSEA 2CV4A 3G9BA 1I9DA 2FY6A 2H70A 2H1BA 1T8EB 5D9VA 1ST9A 4MZBA 2MMNA 3TJBA 1FVKA 3ZVJA 2H6XA 2HRNA 3GX0A 4K5RA 3EINA 4NHWA 4MJCA 1TRVA 5D93A 2YJHA 1KNGA 2VL9A 5B6MA 2NTOA 4X43A 5IMCA 5BRTA 3LXTA 1AXDA 4OMVA 3KXOA 4MLYA 2LRNA 4TKYA 3FYGA 2RUFA 2MBTA 1F3AA 1T00A 5A5KA 4IBPA 5F05A 3IXRA 5A1NA 2HSMA 2N5AA 3ZIJA 4YKFA 2PBJA 1TK5B 1J9BA 1S3CA 1TJDA 1LBKA 3FK8A 1WMJA 5ECHB 2QC7A 4DVCA 3TRPA 4XS6A 4I97A 5CRWA 2FD3A 3UJ1A 1JZWA 3F63A 3KP9A 2HZEA 2FA8A 4XRDA 17GSA 2DBCA 5HR2A 2FHEA 4TN8A 5ECKB 3M8NA 4K0GA 4HZ4A 3MYDA 1PN9A 3NOFA 2PVOC 2X8GA 2XC2A 2X4AA 5HQPA 1PKWA 3DVWA 3EYTA 4TXOB 4O5RA 4GDFA 3QCPA 1O81A 3I6AA 4KCEA 4FH8A 1X9SB 2CAIA 3Q74A 2V6OA 3FZ4A 4OFNA 1XW9A 4X1UA 2VCWA 2HLSA 3H93A 4YQUA 3I43A 3H1NA 3O76A 1F6MC 1A8LA 2B7JA 4O92A 1X5EA 4IW9A 1ERTA 2H1AA 2VO4A 5AN1A 2VLVA 2HNLA 3FKFA 4USSA 1FVJA 3IHQA 2YWNA 5C04A 1BX9A 1O7UA 3IE3A 1H75A 3G7YA 3F4SA 3EU4A 3A2WA 3L9UA 1TP9A 4I2TA 3CBUA 4GWRA 1HNCA 5A4UA 4G2EA 5J5NA 3WGDA 1THXA 1K3LA 2PERA 3Q18A 2UZ8A 1TI1A 3KH9A 1AQXA 2PUKC 1E2YA 2VOCA 1NW2A 3D4MA 2EFHA 2FWGA 3R3EA 2MYGA 3E0UA 3GKMA 1EEMA 2HSMB 4GSNA 3KGKA 1Z7PA 2HI7A 2QKEA 1VF4A 4W66A 2A4HA 2LJKA 1GH2A 1V58A 4MCUA 1U6TA 1XW6A 3MDKA 4HQZA 2J23A 2HZEB 5DQYA 4JR6A 4MJEA 4TR1A 2R0GA 4K1FA 1SK2A 1GLPA 2FNOA 2C4JA 5J40A 2IMKA 4O5UA 1OE8A 2PGTA 5B8AA 1MD4A 4G19A 3CMIA 5F0GA 4F0BA 3KH7A 1VF2A 4K7OA 3SWLA 1K3YA 4ZB8A 1G7EA 16GSA 4JR4A 2H71A 4PUAA 2XPDA 4ZL8A 5E4WA 3LJRA 3TOUA 4RQXA 2DJ1A 5D8IA 3GTUA 2E2GA 1SVLA 2AHEA 1GTAA 2O7KA 1EWXA 4ICYA 3U5RE 4MH2A 3VWVA 5G1LA 4V1Ag 2C0DA 2H76A 2GZZA 3HZ4A 1TDIA 3IV4A 4K7NA 2I4AA 2OJLA 1I5GA 5D9WA 5HR1A 3ERFA 2NBSA 1V40A 2HZFA 3ZFBA 4G0KA 2H0GA 2B5XA 5ECLB 2ZCTA 2X64A 1GSUA 1EEJA 1TW9A 3IC4A 1VF1A 1GSYA 3APQA 3EWLA 2LKUA 3N9JA 3D21A 1FO5A 3FR3A 2AUVA 2F3MA 1K0CA 1XWGA 4YAPA 2RM5A 5AISA 2P5RA 1PKZA 3EMXA 2B5EA 5LCZA 1PGTA 2C8UA 1XZOA 13GSA 2L57A 3ZL5A 3HCZA 3ZFLA 4MPFA 2XHFA 4BA7A 4HU7A 4CW9A 3ZMKA 2IMDA 2VL2C 1GRXA 3IR4A 1QUWA 2GSRA 4L8EA 1XOBA 4ZBAA 3QFAC 1SKRB 4K0NA 3Q19A 1MDKA 4K5SA 4KA0A 1XBSA 2KLXA 3TRXA 4ZILA 3GKKA 1U88A 3MSZA 2B5YA 2YWIA 4KAEA 4G01A 1HQOA 2CVKA 4GQFA 1SL1B 3GTUB 1SK1A 4G10A 5C00A 4PTSA 5CRHA 3TCOA 4KDXA 1BF5A 1U3IA 3O6TA 1M9AA 5DVBA 4IHUA 5L71A 2A4VA 3HJOA 3M3MA 2DJ2A 4E68A 4EL1A 1F3BA 3ZREA 4FYUA 1PQNA 3DXBA 3LYPA 4TVEA 5DJMA 2A2SA 4HI7A 3DYRA 3I69A 4NAXA 2H74A 2V6KA 4ZBBA 1UVZA 2MZCA 2DKHA 2R0CA 1Z7RA 3CTFA 1S3AA 3IRAA 2Z9SA 1N25A 18GSA 1ILOA 2WULA 1A24A 4K9ZA 14GSA 1WOUA 4Q5FA 2HQTA 3BBYA 2DJJA 1GSSA 1ML6A 1GWCA 2RUEA 4Z2RA 4ZL9A 3HZ8A 2KP2A 2P5QA 5ECMB 4MDCA 4PXOA 4POLA 3D5JA 4KDUA 1RK4A 19GSA 4KW6A 3C1RA 2OACA 2YP6A 1FAAA 4EIQA 2ES7A 2IJYA 5H5QA 3HXSA 1EOGA 3GA4A 1B4QA 2VKZG 1YF0A 4HUAA 4GLTA 1FG4A 1T4ZA 1M9BA 4DSRA 1UC7A 4HZ2A 1T3BA 3LSZA 4ECIA 4KH7A 4KX4A 5GAND 1SKSB 4A5PA 2IFQB 2R3XA 3VI5A 1EGOA 1GNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9H A;  5KN2 A;  2HRF A;  1BJX A;  4KUN A;  4LMW A;  4MP4 A;  5DQS A;  3M9K A;  2VIM A;  2GQM A;  2YOI A;  8GSS A;  1SL2 B;  1HYU A;  1UA5 A;  4MPG A;  1Y6E A;  4V1A p;  2R5G A;  3ERW A;  2R2J A;  2R37 A;  2EIQ A;  1EV9 A;  1TOF A;  3CSJ A;  3LG6 A;  4POK A;  3GH9 A;  3DD3 A;  5A4W A;  1JHB A;  2PMT A;  4FYB A;  1BAY A;  2H0I A;  3VUR A;  2JU5 A;  5G31 A;  4EO3 A;  4ZXG A;  3OR5 A;  2H6Z A;  3FR9 A;  3L0H A;  4PQH A;  1TK0 B;  5GSS A;  4TXO A;  1GSF A;  2JAC A;  4F82 A;  4O7H A;  3F6D A;  1WIK A;  3RHC A;  1KBN A;  4OCF A;  1Q98 A;  2P31 A;  4O32 A;  4PQ1 A;  2VCT A;  2V1M A;  4JE1 A;  2DML A;  1RQM A;  3F4R A;  4AF2 A;  2WB9 A;  2WZ9 A;  9GSS A;  1ZYQ B;  4TR4 A;  1X0R A;  3D6I A;  1ZCP A;  2YNX A;  2PWJ A;  4I8B A;  3WGE A;  1B8X A;  4HJM A;  3RPP A;  1YJ6 A;  3GUR A;  1GLQ A;  1W4V A;  2K9F A;  4G9H A;  4D73 B;  2MBS A;  2DIZ A;  4ZL7 A;  1YQ1 A;  3L78 A;  2YJ7 A;  4XIH A;  1F2E A;  3ZML A;  3KMO A;  4BWQ A;  2HRA A;  1PX7 A;  1PA3 A;  2HRK B;  2VD1 A;  3TJG A;  3P8W A;  2VL2 A;  2JZT A;  5G5E A;  2L59 A;  4MZW A;  3HVV A;  1FHE A;  5FT3 A;  2OAD A;  4PGT A;  2HSN B;  4TR3 A;  3UBK A;  1K0B A;  5ECN B;  4WXT A;  4L5O A;  3E3E A;  4WR5 A;  2GZY A;  5AIV A;  5JCU A;  5ID2 B;  3CRT A;  2XPE A;  4IS0 A;  1R7H A;  2FWF A;  2G0F A;  5ENU A;  3C73 A;  3C8E A;  1QMV A;  1T7P B;  4ML1 A;  3D22 A;  2WRT A;  4G0I A;  2YZU A;  1THO A;  1SD9 A;  3HDC A;  5ECR B;  5B6N A;  1K0M A;  4LMV A;  2BTO T;  1EOH A;  1XWK A;  2MMZ A;  3M9J A;  2X99 A;  2FA4 A;  1OKT A;  4PUF C;  5H5S A;  1IYI A;  4N0V A;  5ELG A;  2H19 A;  3ISO A;  1FB6 A;  1K0O A;  3KIJ A;  3VWX A;  3LEF A;  1HNA A;  3VFI A;  1OKD A;  5JWQ B;  1V57 A;  3QR6 A;  5AIX A;  4YQV A;  2CZ2 A;  2X8H A;  4RI6 A;  2N5F A;  5F07 A;  1SU9 A;  2B3S A;  2VLU A;  3G7J A;  1EP7 A;  4PQI A;  5H5R A;  2WFC A;  2RII A;  2IMF A;  2EIR A;  3IBH A;  5ABR A;  3ZVJ D;  1KTE A;  4MF6 A;  1TU8 A;  2ALB A;  2JZR A;  4TXV A;  2VL3 A;  2XBI A;  4BVY A;  3TDG A;  4NPB A;  3DIE A;  2L6D A;  4QL9 A;  2VCV A;  4WEY A;  3VWU A;  1ERU A;  3A5W A;  1XIY A;  4NXI A;  4PX1 A;  2VM1 A;  3APS A;  4ECB A;  3GMF A;  3TJJ A;  2LJR A;  2MMA A;  3IK9 A;  11GS A;  1HD2 A;  1QK8 A;  3AY8 A;  3UAP A;  5G5F A;  3DEX A;  3SBC A;  3MWH A;  2F8F A;  5CRE A;  3VWW A;  2ON7 A;  2O85 A;  1AQV A;  2C0F A;  1K0A A;  2C80 A;  2CVB A;  3ZYW A;  6GSX A;  1K0D A;  5IMZ A;  7GSS A;  3CSH A;  1XFL A;  2I1U A;  4G0L A;  1JLV A;  1T1V A;  3I9V 2;  2JZS A;  5COH A;  3EE2 A;  4YH2 A;  4RI7 A;  2PPT A;  1USB A;  3A3T A;  5LD0 A;  3IAS 2;  4KDY A;  3CYN A;  6GSY A;  1X5D A;  1HNB A;  4IP1 A;  2LV3 A;  2TRX A;  2EC4 A;  2M46 A;  2L4C A;  4GTU A;  4ECJ A;  1FOV A;  1O85 A;  3UIW A;  3FRC A;  3GKN A;  3FEU A;  3H79 A;  2YPM A;  3U6V A;  2C3N A;  2PN8 A;  4POB A;  5JWO B;  1SD8 A;  2GVP A;  4NV5 A;  5IOW A;  1XWA A;  3VPT A;  3P2A A;  4RUV A;  4F0C A;  5KN0 A;  4ML6 A;  5AGY A;  5G2Z A;  5CNW A;  5KN1 A;  4OO5 A;  2LNS A;  2H73 A;  3ZZX A;  3IC8 A;  2FUG 2;  1DSB A;  2YV7 A;  3GN3 A;  3F8U A;  1A2J A;  2JSY A;  2IWT A;  2CVD A;  2OE0 A;  2VAF A;  2HXK A;  4BVY B;  3PGT A;  4I6X A;  4K6X A;  4Z7X A;  5ECS A;  2B1K A;  3RDW A;  3FHK A;  1TI3 A;  4E8E A;  3QDN A;  4GST A;  2FWE A;  1YZX A;  4JU5 A;  4EUY A;  3DWV A;  2CT6 A;  1F37 A;  1ERV A;  1IYH A;  1W89 A;  1BG5 A;  3UBL A;  1GL8 A;  1AIU A;  4FQU A;  2O8V B;  5IMA A;  5CRD A;  5DJL A;  3GFK A;  2LST A;  3C7M A;  1OC8 A;  3G7I A;  2L6C A;  2C3T A;  2CA8 A;  3F0I A;  4N0Z A;  4MZC A;  1DE2 A;  2WGR A;  3TJF A;  2H75 A;  5F06 A;  1JZR A;  4XTS A;  4BWS A;  4Q5Q A;  1LJR A;  4XCS A;  5KEJ A;  3GIX A;  4ID0 A;  2GQK A;  4KB3 A;  1B48 A;  4MK3 A;  1WE0 A;  1U87 A;  4WET A;  3TKR A;  1BED A;  3BJ5 A;  1SK0 A;  2KHP A;  5IOX A;  5J9C A;  3KM6 A;  5A4V A;  2IFQ A;  2C3Q A;  1CQH A;  3EMP A;  1H4O A;  5KN3 A;  1GUH A;  1Z6N A;  3DML A;  2K18 A;  3FR6 A;  2OA7 A;  1G6W A;  3KTL A;  1VGL A;  5FWG A;  1LU4 A;  4JZQ A;  4K2D A;  1A2M A;  1ZOF A;  1BQ7 A;  4EC0 A;  1XVW A;  2L4Q A;  2DIY A;  5CYY A;  5D9X A;  1XPV A;  6GSS A;  5DAK A;  3C71 A;  3IA1 A;  3UL3 A;  4ZB6 A;  1EP8 A;  1JZD A;  1ERW A;  4IEL A;  2H1D A;  3F4T A;  5INY A;  2IIY A;  5IPH A;  4XS4 A;  1M99 A;  3KZQ A;  3GKX A;  1JZO A;  3HJM A;  2YZH A;  5DDL A;  3QMX A;  2LTK A;  3LWA A;  1K0N A;  2HT9 A;  1Y25 A;  4LL4 B;  3ZLP A;  1Q4J A;  3BCK A;  4HS1 A;  1NHY A;  1GTI A;  5J3R A;  4IN0 A;  4CDO A;  5J9B A;  5DCG A;  4IVF A;  1B9Y C;  3DKS A;  5IMF A;  1M2A A;  4MJA A;  2F9S A;  3M0F A;  4EVM A;  3MAK A;  1URM A;  5IMD A;  1PMT A;  2HSY A;  4D73 A;  3BD2 A;  2N5B A;  1WJK A;  5GAP D;  5ECP B;  1VRS D;  3RPN A;  3E9J B;  1XXU A;  1FW1 A;  3GH6 A;  2H6Y A;  1T4Y A;  2HRK A;  4OO4 A;  4AJ8 A;  2VCZ A;  1MEK A;  1QFN A;  2VUP A;  1BYE A;  3HVX A;  3KMN A;  3HYP A;  2GST A;  1SEN A;  2A2R A;  2IL3 A;  2CZ3 A;  3GUS A;  4MF5 A;  2LUS A;  5EL8 A;  3EUR A;  4XRA A;  2DLX A;  5ID2 A;  1M2D A;  5J41 A;  2ON5 A;  4HU9 A;  1Z5Y E;  2B1L A;  1KEB A;  1JLW A;  2GDR A;  2FCH A;  3WD6 A;  3TKS C;  3QAW A;  4J56 E;  5D96 A;  1OVN A;  1DBY A;  1O8X A;  2I3Y A;  3KJY A;  2OBI A;  2L5L A;  4OFM A;  3F6F A;  3GV1 A;  2HE3 A;  3APO A;  4AJ7 A;  4HQS A;  5DAK B;  5G30 A;  12GS A;  1MD3 A;  3QAG A;  1OYJ A;  1S3D A;  2K8V A;  3FW2 A;  3CXG A;  4LA1 A;  1RW1 A;  4HJ2 A;  2GTU A;  1ACV A;  3V1W A;  4I5Q A;  2BJX A;  3GRX A;  2WCI A;  1DE1 A;  2K8S A;  3TOT A;  4XS4 B;  3LQ7 A;  1PL1 A;  2HSH A;  1SL0 B;  4L0W A;  2J9H A;  2M72 A;  1TKD B;  2FWH A;  4POM A;  4EDY A;  4KCA A;  3GL5 A;  5BMU A;  3J7Y k;  1GP1 A;  3S9F A;  1ZZY A;  2GQL A;  5GZZ B;  1M0U A;  3KEB A;  4WR4 A;  4GCI A;  3ZIV A;  4P3Y B;  1G6Y A;  4ZBD A;  1AAZ A;  1GUM A;  2L5O A;  3DRN A;  3ME7 A;  5DAL A;  3F3R A;  2VD0 A;  4PNF A;  3VLN A;  5IIZ A;  3TKQ A;  1SJI A;  2E0Q A;  2GT6 A;  4MA9 A;  3KP8 A;  5ECQ B;  2B7K A;  1SJ6 A;  1ZMA A;  3UVH A;  2H8L A;  4GRF A;  2DSA A;  3DVX A;  1UN2 A;  4N10 A;  4WBJ A;  4NWY A;  2AB6 A;  1R5P A;  2PU9 C;  2F51 A;  3KTB A;  2JSZ A;  3K8N A;  2AAW A;  5HFG A;  1O6J A;  1VF3 A;  2DC5 A;  4JED A;  3RAZ A;  2YAN A;  2HFD A;  1A0F A;  1OC9 B;  4NHZ A;  4KND A;  1A23 A;  3ERG A;  2M80 A;  1MDJ A;  3HA9 A;  5EVO A;  5IO0 A;  4KSO A;  1O73 A;  4GXZ A;  3DGQ A;  1K3O A;  5JCG A;  3QOU A;  5E59 A;  2H01 A;  4BVX A;  4WBR D;  4N11 A;  5ECI B;  1PSQ A;  2VM2 A;  2CX4 A;  5GST A;  3CTG A;  4IQA A;  4PNG A;  1N8J A;  1EZK A;  3ZTL A;  5LNK e;  2CAQ A;  4Q5N A;  4WKW A;  5IM9 A;  1V9W A;  4KSM A;  2TRC P;  2V32 A;  2P0G A;  3R2Q A;  2H1G A;  3L4N A;  4KGI A;  3JCM L;  2IMI A;  3TUE A;  5EY6 A;  4NMU A;  1R5A A;  1OAZ A;  3GHA A;  1M2B A;  5ELA A;  1B4P A;  2GGT A;  4YAV A;  5J4U A;  4F9Z A;  5JCW A;  3NIV A;  3TKP A;  4EKZ A;  2IME A;  5DAL B;  3EVI A;  1U3A A;  3EC3 A;  1SYR A;  2OKA A;  1TU7 A;  4QL7 A;  2GT5 A;  1A2L A;  3KCM A;  3H8Q A;  3FZA A;  3TB2 A;  4DSQ A;  5D9T A;  2D2Z A;  2LNT A;  5IQY A;  4J2F A;  3O3T A;  2R6K A;  1PX6 A;  3QAV A;  3TGZ A;  2WDU A;  2QSI A;  4LL1 B;  3KD0 A;  4DEJ A;  1Z3E A;  4PUR A;  5HR0 A;  3RBT A;  3H4K A;  3HVS A;  4ZB9 A;  2DMM A;  4MMM A;  4DSS A;  4XHM A;  3VK9 A;  1QXH A;  1YDK A;  4IGJ A;  2WJU A;  1NSW A;  1TK8 B;  6GSV A;  1YEP A;  1X5C A;  3TKS A;  1XWC A;  5DBQ A;  4OD7 A;  3FY7 A;  4WF5 A;  5JWR B;  2CQ9 A;  4BVX B;  1G0T A;  3US3 A;  4IP6 A;  4EE0 A;  1MTC A;  4Q5R A;  4EXJ A;  2KP1 A;  2DJ3 A;  3QPM A;  2DJK A;  4K7I A;  1MDI A;  1J0F A;  3IOS A;  4NV2 A;  3MNG A;  5B8B A;  6GSU A;  2NPB A;  5IPG A;  1G7O A;  2VCX A;  3P90 A;  2LEG A;  1R26 A;  2C0G A;  4TW5 A;  2R4V A;  4V2L A;  1PRX A;  4EDZ A;  2I81 A;  4TRX A;  2C0E A;  2LS5 A;  1AUC A;  5B7C A;  4E8H A;  20GS A;  2OE1 A;  2YV9 A;  2ZNM A;  4FO5 A;  4L0U A;  4GQC A;  22GS A;  3FZ9 A;  2ZUP A;  4TOP A;  4H86 A;  4AJ6 A;  2H66 A;  3LXZ A;  2RLI A;  4HEA 2;  3RHB A;  4GSS A;  3CRU A;  4ISD A;  3PH9 A;  5HFI A;  1OC3 A;  4KF9 A;  2V41 A;  3GNJ A;  3GYK A;  4WF4 A;  1YF1 A;  1PL2 A;  4YQM A;  1GTU A;  1YKC A;  2I9H A;  1NHO A;  3A2V A;  2LQO A;  2YWM A;  4L5L A;  2NVL A;  4MJB A;  2DJ0 A;  3GSS A;  2FLS A;  4N30 A;  5ECO B;  4DSS B;  3VPQ A;  2TIR A;  1SJZ A;  2VLT A;  3ED3 A;  5EPF A;  4ZIJ A;  1FB0 A;  3Q6O A;  1Z6M A;  3W6G A;  1DUG A;  3UAR A;  3VI7 A;  4LLR A;  2KOK A;  1ZL9 A;  1XVQ A;  1CQG A;  1AQW A;  3WT1 A;  3LYK A;  3D0Z A;  2PVQ A;  3GST A;  4OWY A;  4FYC A;  4OFT A;  1J08 A;  3W8S A;  2O89 A;  4OCE A;  4IJ3 A;  1TRU A;  4CHS A;  4TR1 B;  2X8C A;  4JBB A;  1GSQ A;  1B9X C;  2WS2 A;  1A0R P;  1WRY A;  2HYX A;  1ZYE A;  3J7Y b;  4AGS A;  3WYW A;  1AC1 A;  1F9M A;  2E2M A;  5CP1 A;  3FZ5 A;  2BMX A;  1ABA A;  5G1K A;  1V98 A;  4ECC A;  3PIN A;  3UEM A;  2LRT A;  1NM3 A;  4F2I A;  4I2U A;  3HD5 A;  2E7P A;  3N5O A;  2V2G A;  10GS A;  3QD9 A;  4V2M A;  1OE7 A;  1EV4 A;  2YN1 A;  1GTB A;  3D4T A;  3A2X A;  1C72 A;  1WP0 A;  1O8W A;  1WWJ A;  3TJK A;  1R4W A;  2LQQ A;  3HY2 A;  1E6B A;  3HHV A;  1SYX A;  5D73 A;  4IJI A;  2AV4 A;  3WT2 A;  2LRC A;  1GUL A;  1QQ2 A;  3ZRD A;  4K8M A;  4J57 E;  3NZN A;  2GSQ A;  4BL7 A;  1YKA A;  3PPU A;  2QGV A;  1XCC A;  1N2A A;  5CO3 A;  3F3Q A;  1PD2 1;  6GST A;  4GF0 A;  2O87 A;  2JL4 A;  3L9S A;  1TXX A;  3UMA A;  2GSS A;  2C1Y A;  1XWB A;  4JRR A;  4MH3 A;  3ME8 A;  1TTZ A;  3UVT A;  5IMV A;  6GSW A;  3ZIT A;  2AJQ B;  2OBK A;  2IN3 A;  2MMO A;  4HOJ A;  2K6V A;  2B6M A;  1V2A A;  3BCI A;  2NDO A;  5FHI A;  1GSD A;  3LGC A;  1X9W B;  5HR3 A;  2F8A A;  2FGX A;  3EU3 A;  3TRQ A;  2CX3 A;  2GZP A;  1JFU A;  1OC9 A;  3UOM A;  2H0H A;  5IO2 A;  4KE3 A;  1TRW A;  4MAB A;  2GLR A;  4TR0 A;  3IPZ A;  4IKH A;  1ZGN A;  3IDV A;  3QFB C;  4IQ1 A;  4ILF A;  2EIO A;  3P7X A;  4ACS A;  4HDE A;  1AW9 A;  4QQ7 A;  1A8Y A;  3HKR A;  1XW5 A;  2H30 A;  5CAX A;  4BPY A;  2AYT A;  3CSI A;  3TKS E;  3GX8 A;  5F8B A;  4RQR A;  1GNE A;  3HJP A;  3W8J A;  4X0X A;  1SKW B;  1M7T A;  3BOA A;  1EGR A;  2IPA A;  2G2Q A;  3M1G A;  2KUC A;  4ULX A;  1YEX A;  4F03 A;  2XBQ A;  3LOR A;  3WGX A;  2H72 A;  3L9V A;  1QGV A;  4V2N A;  2JAD A;  1TRS A;  2VCQ A;  3GL3 A;  3C1S A;  1XOA A;  3F9U A;  3IK7 A;  1ON4 A;  4MF7 A;  2YWO A;  2GS3 A;  4XS1 A;  4EF0 A;  3IAM 2;  2LJA A;  5HFK A;  5DCH A;  3PR8 A;  1GUK A;  4FIW A;  1WPI A;  2OE3 A;  5CRG A;  1YY7 A;  2REM A;  1X9M B;  4BL7 B;  2YCD A;  3LFL A;  2RM6 A;  1GSE A;  2CV4 A;  3G9B A;  1I9D A;  2FY6 A;  2H70 A;  2H1B A;  1T8E B;  5D9V A;  1ST9 A;  4MZB A;  2MMN A;  3TJB A;  1FVK A;  3ZVJ A;  2H6X A;  2HRN A;  3GX0 A;  3EIN A;  4NHW A;  4MJC A;  1TRV A;  5D93 A;  2YJH A;  1KNG A;  2VL9 A;  5B6M A;  2NTO A;  4X43 A;  5IMC A;  3LXT A;  1AXD A;  4OMV A;  3KXO A;  4MLY A;  2LRN A;  4TKY A;  3FYG A;  2RUF A;  2MBT A;  1F3A A;  1T00 A;  5A5K A;  4IBP A;  5F05 A;  3IXR A;  2HSM A;  2N5A A;  3ZIJ A;  2PBJ A;  1TK5 B;  1J9B A;  1S3C A;  1TJD A;  1LBK A;  3FK8 A;  1WMJ A;  5ECH B;  2QC7 A;  4DVC A;  3TRP A;  4XS6 A;  4I97 A;  5CRW A;  2FD3 A;  3UJ1 A;  1JZW A;  3F63 A;  3KP9 A;  2HZE A;  2FA8 A;  4XRD A;  17GS A;  2DBC A;  5HR2 A;  2FHE A;  4TN8 A;  5ECK B;  3M8N A;  4K0G A;  4HZ4 A;  1PN9 A;  3NOF A;  2PVO C;  2X8G A;  2XC2 A;  5HQP A;  1PKW A;  3DVW A;  3EYT A;  4TXO B;  4O5R A;  3QCP A;  1O81 A;  3I6A A;  4KCE A;  4FH8 A;  1X9S B;  2CAI A;  3Q74 A;  2V6O A;  3FZ4 A;  4OFN A;  1XW9 A;  4X1U A;  2VCW A;  2HLS A;  3H93 A;  4YQU A;  3I43 A;  3H1N A;  3O76 A;  1F6M C;  1A8L A;  2B7J A;  4O92 A;  1X5E A;  4IW9 A;  1ERT A;  2H1A A;  2VO4 A;  5AN1 A;  2VLV A;  2HNL A;  3FKF A;  4USS A;  1FVJ A;  3IHQ A;  2YWN A;  5C04 A;  1BX9 A;  1O7U A;  3IE3 A;  1H75 A;  3G7Y A;  3F4S A;  3EU4 A;  3A2W A;  3L9U A;  1TP9 A;  4I2T A;  3CBU A;  4GWR A;  1HNC A;  5A4U A;  4G2E A;  5J5N A;  3WGD A;  1THX A;  1K3L A;  2PER A;  3Q18 A;  2UZ8 A;  1TI1 A;  3KH9 A;  1AQX A;  2PUK C;  1E2Y A;  2VOC A;  1NW2 A;  3D4M A;  2FWG A;  3R3E A;  2MYG A;  3E0U A;  3GKM A;  1EEM A;  2HSM B;  4GSN A;  3KGK A;  1Z7P A;  2HI7 A;  2QKE A;  1VF4 A;  2LJK A;  1GH2 A;  1V58 A;  4MCU A;  1U6T A;  1XW6 A;  3MDK A;  4HQZ A;  2J23 A;  2HZE B;  5DQY A;  4JR6 A;  4MJE A;  4TR1 A;  4K1F A;  1SK2 A;  1GLP A;  2FNO A;  2C4J A;  2IMK A;  1OE8 A;  2PGT A;  5B8A A;  1MD4 A;  4G19 A;  3CMI A;  5F0G A;  4F0B A;  3KH7 A;  1VF2 A;  4K7O A;  3SWL A;  1K3Y A;  4ZB8 A;  1G7E A;  16GS A;  4JR4 A;  2H71 A;  4PUA A;  2XPD A;  4ZL8 A;  5E4W A;  3LJR A;  3TOU A;  4RQX A;  2DJ1 A;  5D8I A;  3GTU A;  2E2G A;  2AHE A;  1GTA A;  2O7K A;  1EWX A;  3U5R E;  4MH2 A;  3VWV A;  5G1L A;  4V1A g;  2C0D A;  2H76 A;  2GZZ A;  3HZ4 A;  1TDI A;  3IV4 A;  4K7N A;  2I4A A;  2OJL A;  1I5G A;  5D9W A;  5HR1 A;  3ERF A;  2NBS A;  1V40 A;  2HZF A;  3ZFB A;  4G0K A;  2H0G A;  2B5X A;  5ECL B;  2ZCT A;  2X64 A;  1GSU A;  1EEJ A;  1TW9 A;  3IC4 A;  1VF1 A;  1GSY A;  3APQ A;  3EWL A;  2LKU A;  3N9J A;  3D21 A;  1FO5 A;  3FR3 A;  2AUV A;  2F3M A;  1K0C A;  1XWG A;  4YAP A;  2RM5 A;  5AIS A;  2P5R A;  1PKZ A;  3EMX A;  2B5E A;  5LCZ A;  1PGT A;  2C8U A;  1XZO A;  13GS A;  2L57 A;  3ZL5 A;  3HCZ A;  3ZFL A;  4MPF A;  2XHF A;  4BA7 A;  4HU7 A;  4CW9 A;  3ZMK A;  2IMD A;  2VL2 C;  1GRX A;  3IR4 A;  1QUW A;  2GSR A;  4L8E A;  1XOB A;  4ZBA A;  3QFA C;  1SKR B;  4K0N A;  3Q19 A;  1MDK A;  4KA0 A;  1XBS A;  2KLX A;  3TRX A;  4ZIL A;  3GKK A;  1U88 A;  3MSZ A;  2B5Y A;  2YWI A;  4KAE A;  1HQO A;  2CVK A;  4GQF A;  1SL1 B;  3GTU B;  1SK1 A;  4G10 A;  5C00 A;  4PTS A;  5CRH A;  3TCO A;  4KDX A;  1U3I A;  3O6T A;  1M9A A;  5DVB A;  4IHU A;  5L71 A;  2A4V A;  3HJO A;  3M3M A;  2DJ2 A;  4EL1 A;  1F3B A;  3ZRE A;  4FYU A;  1PQN A;  3DXB A;  3LYP A;  4TVE A;  5DJM A;  2A2S A;  4HI7 A;  3DYR A;  3I69 A;  4NAX A;  2H74 A;  2V6K A;  4ZBB A;  1UVZ A;  2MZC A;  1Z7R A;  3CTF A;  1S3A A;  3IRA A;  2Z9S A;  18GS A;  1ILO A;  2WUL A;  1A24 A;  4K9Z A;  14GS A;  1WOU A;  4Q5F A;  2HQT A;  3BBY A;  2DJJ A;  1GSS A;  1ML6 A;  1GWC A;  2RUE A;  4ZL9 A;  3HZ8 A;  2KP2 A;  2P5Q A;  5ECM B;  4MDC A;  4PXO A;  4POL A;  3D5J A;  4KDU A;  1RK4 A;  19GS A;  4KW6 A;  3C1R A;  2OAC A;  2YP6 A;  1FAA A;  2ES7 A;  2IJY A;  5H5Q A;  3HXS A;  1EOG A;  3GA4 A;  1B4Q A;  1YF0 A;  4HUA A;  4GLT A;  1FG4 A;  1T4Z A;  1M9B A;  4DSR A;  1UC7 A;  4HZ2 A;  1T3B A;  3LSZ A;  4ECI A;  4KH7 A;  4KX4 A;  5GAN D;  1SKS B;  2IFQ B;  2R3X A;  3VI5 A;  1EGO A;  1GNW A; 
#chains in the Genus database with same CATH topology
 1Z9H A;  5KN2 A;  2HRF A;  1BJX A;  4KUN A;  4LMW A;  1TXU A;  4MP4 A;  5DQS A;  3M9K A;  2VIM A;  2GQM A;  2YOI A;  8GSS A;  1SL2 B;  1HYU A;  1UA5 A;  4MPG A;  1Y6E A;  4V1A p;  2R5G A;  3ERW A;  2R2J A;  2R37 A;  2EIQ A;  1EV9 A;  1TOF A;  3CSJ A;  3LG6 A;  4POK A;  3GH9 A;  3DD3 A;  5A4W A;  1JHB A;  2PMT A;  4FYB A;  1BAY A;  2H0I A;  3VUR A;  2JU5 A;  5G31 A;  4EO3 A;  4ZXG A;  3OR5 A;  2H6Z A;  3FR9 A;  3L0H A;  4PQH A;  1TK0 B;  5GSS A;  4TXO A;  1GSF A;  2JAC A;  4F82 A;  4O7H A;  3F6D A;  1WIK A;  3RHC A;  2O3E A;  1KBN A;  4OCF A;  1Q98 A;  2P31 A;  4O32 A;  4PQ1 A;  2VCT A;  2V1M A;  4JE1 A;  2DML A;  1M3J A;  1RQM A;  3F4R A;  4AF2 A;  2WB9 A;  2WZ9 A;  9GSS A;  1ZYQ B;  4TR4 A;  1X0R A;  3D6I A;  1ZCP A;  2YNX A;  4Z2T A;  2PWJ A;  4I8B A;  3WGE A;  1B8X A;  4HJM A;  4PI0 C;  3RPP A;  1YJ6 A;  3GUR A;  1GLQ A;  1W4V A;  2K9F A;  4PHZ C;  4G9H A;  4D73 B;  2MBS A;  2DIZ A;  4ZL7 A;  1YQ1 A;  3L78 A;  2YJ7 A;  4XIH A;  1F2E A;  3ZML A;  3KMO A;  4BWQ A;  2HRA A;  1PX7 A;  1PA3 A;  2HRK B;  2VD1 A;  3TJG A;  3P8W A;  2VL2 A;  2JZT A;  5G5E A;  2L59 A;  4MZW A;  3HVV A;  1FHE A;  5FT3 A;  2OAD A;  4PGT A;  2HSN B;  4TR3 A;  3UBK A;  1K0B A;  5ECN B;  4WXT A;  4L5O A;  3E3E A;  4WR5 A;  2GZY A;  5AIV A;  5JCU A;  5ID2 B;  3CRT A;  2XPE A;  4IS0 A;  3CQF A;  1R7H A;  2FWF A;  2G0F A;  5ENU A;  3C73 A;  3C8E A;  1QMV A;  1T7P B;  2DKI A;  4ML1 A;  3D22 A;  2WRT A;  4G0I A;  2YZU A;  5A5H B;  1THO A;  1PN0 A;  1SD9 A;  3HDC A;  5ECR B;  5B6N A;  1K0M A;  4LMV A;  2BTO T;  1EOH A;  1XWK A;  2MMZ A;  3M9J A;  2X99 A;  2FA4 A;  1OKT A;  4PUF C;  5H5S A;  1IYI A;  4N0V A;  5ELG A;  2H19 A;  3ISO A;  1FB6 A;  1K0O A;  3KIJ A;  3VWX A;  3LEF A;  1HNA A;  3VFI A;  1OKD A;  5JWQ B;  1V57 A;  3QR6 A;  5AIX A;  4YQV A;  2CZ2 A;  2X8H A;  1XG8 A;  4RI6 A;  2N5F A;  2WW2 A;  5F07 A;  1SU9 A;  2B3S A;  2VLU A;  3G7J A;  4Z2U A;  1EP7 A;  4PQI A;  5H5R A;  2WFC A;  2RII A;  2IMF A;  2EIR A;  3IBH A;  5ABR A;  3ZVJ D;  1KTE A;  3RFR C;  4MF6 A;  1TU8 A;  2ALB A;  2JZR A;  4TXV A;  2VL3 A;  2XBI A;  4BVY A;  3TDG A;  4NPB A;  3DIE A;  2L6D A;  4QL9 A;  2VCV A;  4WEY A;  2R0P A;  3VWU A;  1ERU A;  3A5W A;  1XIY A;  4NXI A;  4PX1 A;  2VM1 A;  3APS A;  4ECB A;  4AKG A;  3GMF A;  3TJJ A;  2LJR A;  2MMA A;  3IK9 A;  11GS A;  1HD2 A;  1QK8 A;  3AY8 A;  3UAP A;  5G5F A;  3DEX A;  3SBC A;  3MWH A;  2F8F A;  5CRE A;  3VWW A;  2ON7 A;  2O85 A;  1AQV A;  2C0F A;  1K0A A;  2C80 A;  2CVB A;  3ZYW A;  6GSX A;  1K0D A;  5IMZ A;  7GSS A;  2WW0 A;  3CSH A;  1XFL A;  2I1U A;  4G0L A;  1JLV A;  1T1V A;  3I9V 2;  2JZS A;  5COH A;  3EE2 A;  4YH2 A;  4RI7 A;  2PPT A;  1USB A;  3A3T A;  3FMW A;  5LD0 A;  3IAS 2;  4KDY A;  3CYN A;  6GSY A;  1X5D A;  1HNB A;  4IP1 A;  2LV3 A;  2TRX A;  2EC4 A;  2M46 A;  2L4C A;  4GTU A;  4ECJ A;  1FOV A;  1O85 A;  3UIW A;  3FRC A;  3GKN A;  3FEU A;  3H79 A;  2YPM A;  3U6V A;  2C3N A;  4K2X A;  2PN8 A;  4POB A;  1ZYN A;  5JWO B;  1SD8 A;  2GVP A;  4NV5 A;  5IOW A;  1XWA A;  3VPT A;  3P2A A;  4RUV A;  4F0C A;  5KN0 A;  4ML6 A;  5AGY A;  5G2Z A;  5CNW A;  5KN1 A;  4OO5 A;  2LNS A;  2H73 A;  3ZZX A;  3IC8 A;  2FUG 2;  1DSB A;  2YV7 A;  3GN3 A;  3F8U A;  1A2J A;  2JSY A;  2IWT A;  2CVD A;  2OE0 A;  2VAF A;  2HXK A;  4BVY B;  3PGT A;  4I6X A;  4K6X A;  4Z7X A;  5ECS A;  2B1K A;  3RDW A;  3FHK A;  1TI3 A;  4E8E A;  2EFD A;  3QDN A;  4GST A;  2FWE A;  3HVN A;  1YZX A;  4JU5 A;  4EUY A;  3DWV A;  2CT6 A;  1F37 A;  1ERV A;  1IYH A;  1W89 A;  1BG5 A;  3UBL A;  1GL8 A;  1AIU A;  4FQU A;  2O8V B;  5IMA A;  5CRD A;  5DJL A;  3GFK A;  2LST A;  3C7M A;  1OC8 A;  3G7I A;  2L6C A;  2C3T A;  2CA8 A;  3F0I A;  4N0Z A;  4MZC A;  1DE2 A;  1ZYP A;  2WGR A;  3TJF A;  3EPT A;  2H75 A;  5F06 A;  1JZR A;  4XTS A;  4BWS A;  4Q5Q A;  1LJR A;  4XCS A;  5KEJ A;  3GIX A;  4ID0 A;  2GQK A;  4KB3 A;  1B48 A;  4MK3 A;  1WE0 A;  1U87 A;  4WET A;  3TKR A;  1BED A;  1SVO A;  3BJ5 A;  1SK0 A;  2KHP A;  5IOX A;  5J9C A;  3KM6 A;  5A4V A;  2IFQ A;  2C3Q A;  1CQH A;  3EMP A;  1H4O A;  5KN3 A;  1GUH A;  1Z6N A;  3DML A;  2K18 A;  3FR6 A;  2OA7 A;  1G6W A;  3KTL A;  1VGL A;  5FWG A;  3A5I A;  1LU4 A;  4JZQ A;  4K2D A;  1A2M A;  1ZOF A;  1BQ7 A;  4EC0 A;  1XVW A;  2L4Q A;  2DIY A;  5CYY A;  5D9X A;  1XPV A;  6GSS A;  5DAK A;  3C71 A;  3IA1 A;  3UL3 A;  4ZB6 A;  1EP8 A;  1JZD A;  3TU3 B;  1ERW A;  4IEL A;  2H1D A;  3F4T A;  5INY A;  2IIY A;  5IPH A;  4XS4 A;  1M99 A;  3KZQ A;  3GKX A;  1JZO A;  3HJM A;  2YZH A;  5DDL A;  3QMX A;  2LTK A;  2QA1 A;  3LWA A;  1K0N A;  2HT9 A;  1Y25 A;  3IHG A;  4LL4 B;  3ZLP A;  1Q4J A;  3BCK A;  4HS1 A;  1NHY A;  3HMJ G;  1GTI A;  5J3R A;  4IN0 A;  4CDO A;  5J9B A;  5DCG A;  4IVF A;  1B9Y C;  3DKS A;  5IMF A;  1M2A A;  4MJA A;  2F9S A;  3M0F A;  4EVM A;  3MAK A;  1URM A;  5IMD A;  1PMT A;  2HSY A;  4D73 A;  3BD2 A;  2N5B A;  1WJK A;  5GAP D;  5ECP B;  1VRS D;  3RPN A;  3E9J B;  1XXU A;  1FW1 A;  3GH6 A;  2H6Y A;  1T4Y A;  2HRK A;  4OO4 A;  1YVL A;  2WVX B;  4AJ8 A;  2VCZ A;  1MEK A;  1QFN A;  2VUP A;  1BYE A;  3HVX A;  3KMN A;  3HYP A;  2GST A;  1SEN A;  2HSN A;  2A2R A;  2IL3 A;  4ZB7 A;  2CZ3 A;  3GUS A;  2WW1 A;  4MF5 A;  2LUS A;  5EL8 A;  3EUR A;  4XRA A;  2DLX A;  5ID2 A;  1M2D A;  5J41 A;  2ON5 A;  5J47 A;  4HU9 A;  1Z5Y E;  2B1L A;  1KEB A;  1JLW A;  2GDR A;  2FCH A;  3MIX A;  3WD6 A;  3TKS C;  3QAW A;  4J56 E;  4N3Z A;  1OVN A;  5D96 A;  1DBY A;  1O8X A;  2I3Y A;  3KJY A;  2OBI A;  4OFM A;  3F6F A;  5A5H A;  2L5L A;  3GV1 A;  2HE3 A;  3APO A;  4AJ7 A;  4HQS A;  5DAK B;  5G30 A;  12GS A;  1MD3 A;  3QAG A;  1OYJ A;  1S3D A;  2K8V A;  2WW3 A;  3FW2 A;  3CXG A;  4LA1 A;  1RW1 A;  4HJ2 A;  2GTU A;  1ACV A;  3V1W A;  4I5Q A;  1BG1 A;  2BJX A;  3GRX A;  2WCI A;  1DE1 A;  2K8S A;  3TOT A;  4XS4 B;  3LQ7 A;  1PL1 A;  2HSH A;  1SL0 B;  4L0W A;  2J9H A;  2M72 A;  1TKD B;  2FWH A;  4POM A;  4EDY A;  5J4V A;  4QMK A;  4KCA A;  3GL5 A;  5BMU A;  3J7Y k;  1GP1 A;  3S9F A;  1ZZY A;  2GQL A;  5GZZ B;  4MNN A;  1M0U A;  3KEB A;  4WR4 A;  4GCI A;  3ZIV A;  4P3Y B;  1G6Y A;  4ZBD A;  1AAZ A;  1GUM A;  2L5O A;  3DRN A;  3ME7 A;  5DAL A;  3F3R A;  2VD0 A;  4PNF A;  3VLN A;  5A34 B;  5IIZ A;  3TKQ A;  1SJI A;  2E0Q A;  2GT6 A;  4MA9 A;  3KP8 A;  5ECQ B;  2B7K A;  1SJ6 A;  1ZMA A;  3UVH A;  2X49 A;  2H8L A;  4GRF A;  2DSA A;  3DVX A;  1UN2 A;  4N10 A;  4WBJ A;  4NWY A;  2AB6 A;  1R5P A;  2PU9 C;  2F51 A;  3KTB A;  2JSZ A;  2UV8 G;  3K8N A;  2AAW A;  5HFG A;  1O6J A;  1VF3 A;  2DC5 A;  4JED A;  3RAZ A;  2YAN A;  2HFD A;  1A0F A;  1OC9 B;  1Y1U A;  4NHZ A;  4KND A;  1A23 A;  3ERG A;  2M80 A;  1MDJ A;  2WZS A;  3HA9 A;  5EVO A;  5IO0 A;  5J4Y A;  4KSO A;  1O73 A;  4GXZ A;  3DGQ A;  1K3O A;  5JCG A;  3QOU A;  5E59 A;  2H01 A;  4BVX A;  4WBR D;  4N11 A;  5ECI B;  1PSQ A;  2VM2 A;  2CX4 A;  5GST A;  3CTG A;  4FXY P;  4IQA A;  2O5V A;  4PNG A;  1N8J A;  1EZK A;  3ZTL A;  5LNK e;  2CAQ A;  4Q5N A;  4WKW A;  5IM9 A;  1V9W A;  4KSM A;  2TRC P;  2V32 A;  2P0G A;  3R2Q A;  2H1G A;  2QA2 A;  3L4N A;  4KGI A;  3JCM L;  2IMI A;  5BMU B;  3TUE A;  5EY6 A;  4NMU A;  1R5A A;  1OAZ A;  3GHA A;  4AKH A;  1M2B A;  5ELA A;  1B4P A;  2GGT A;  4YAV A;  5J4U A;  4F9Z A;  5JCW A;  3NIV A;  1PFO A;  3TKP A;  4EKZ A;  2IME A;  5DAL B;  3EVI A;  1U3A A;  3EC3 A;  1SYR A;  2OKA A;  1TU7 A;  4QL7 A;  2GT5 A;  1A2L A;  3KCM A;  4CY8 A;  3H8Q A;  3FZA A;  3TB2 A;  4DSQ A;  5D9T A;  2D2Z A;  3RGB C;  2LNT A;  5IQY A;  4J2F A;  3O3T A;  2R6K A;  1PX6 A;  3QAV A;  3TGZ A;  2WDU A;  2QSI A;  4LL1 B;  3KD0 A;  4DEJ A;  1Z3E A;  2O36 A;  4PUR A;  5HR0 A;  3RBT A;  3H4K A;  3HVS A;  4ZB9 A;  2DMM A;  4MMM A;  4DSS A;  2OT3 A;  4XHM A;  3VK9 A;  1QXH A;  1YDK A;  4IGJ A;  2WJU A;  1NSW A;  1TK8 B;  6GSV A;  1YEP A;  1X5C A;  3TKS A;  1XWC A;  5DBQ A;  4OD7 A;  3FY7 A;  4WF5 A;  5JWR B;  5A1N B;  2CQ9 A;  4BVX B;  1G0T A;  3US3 A;  4IP6 A;  4EE0 A;  1MTC A;  4Q5R A;  4EXJ A;  2KP1 A;  2DJ3 A;  3QPM A;  1I1I P;  4PI2 C;  2DJK A;  4K7I A;  1MDI A;  1J0F A;  3IOS A;  4NV2 A;  3MNG A;  5B8B A;  6GSU A;  2NPB A;  5IPG A;  1G7O A;  2VCX A;  3P90 A;  2LEG A;  1R26 A;  2C0G A;  4TW5 A;  2R4V A;  4V2L A;  1PRX A;  4EDZ A;  2I81 A;  4TRX A;  2C0E A;  2LS5 A;  1AUC A;  5B7C A;  4E8H A;  20GS A;  2OE1 A;  2YV9 A;  2ZNM A;  4FO5 A;  4L0U A;  4GQC A;  22GS A;  3FZ9 A;  2ZUP A;  4TOP A;  4H86 A;  4EIP A;  4AJ6 A;  2H66 A;  3LXZ A;  2RLI A;  4HEA 2;  3RHB A;  4GSS A;  3CRU A;  4AKX B;  4ISD A;  3PH9 A;  5HFI A;  1OC3 A;  4KF9 A;  2V41 A;  3GNJ A;  3GYK A;  4WF4 A;  1YF1 A;  1PL2 A;  4YQM A;  1GTU A;  1YKC A;  2I9H A;  1NHO A;  3A2V A;  2LQO A;  2YWM A;  4L5L A;  2NVL A;  2EFE A;  4MJB A;  2DJ0 A;  3GSS A;  2FLS A;  4N30 A;  5ECO B;  4DSS B;  3VPQ A;  2TIR A;  1SJZ A;  2VLT A;  3ED3 A;  5EPF A;  2EFC A;  4ZIJ A;  1FB0 A;  3Q6O A;  1Z6M A;  3W6G A;  1DUG A;  3UAR A;  3VI7 A;  4LLR A;  2KOK A;  1ZL9 A;  1XVQ A;  1CQG A;  2WVX A;  1AQW A;  3WT1 A;  3LYK A;  3D0Z A;  2PVQ A;  3GST A;  4OWY A;  4FYC A;  4OFT A;  1J08 A;  3W8S A;  2O89 A;  4OCE A;  4IJ3 A;  1TRU A;  4CHS A;  4TR1 B;  2X8C A;  4CY6 A;  4JBB A;  1GSQ A;  1B9X C;  2WS2 A;  1A0R P;  1WRY A;  2HYX A;  1ZYE A;  3J7Y b;  1SVM A;  4AGS A;  3WYW A;  1AC1 A;  1F9M A;  2E2M A;  5CP1 A;  3FZ5 A;  2BMX A;  1ABA A;  5G1K A;  1V98 A;  4ECC A;  3PIN A;  3UEM A;  2LRT A;  1NM3 A;  4F2I A;  4I2U A;  3HD5 A;  3LW9 A;  2E7P A;  3N5O A;  2V2G A;  10GS A;  3QD9 A;  4V2M A;  1OE7 A;  1EV4 A;  2YN1 A;  1GTB A;  3D4T A;  3A2X A;  1C72 A;  1WP0 A;  1O8W A;  1WWJ A;  3TJK A;  4O5Q A;  4YKG A;  1R4W A;  2LQQ A;  3HY2 A;  1E6B A;  3HHV A;  1SYX A;  5D73 A;  4IJI A;  2AV4 A;  3WT2 A;  2LRC A;  1GUL A;  1QQ2 A;  3ZRD A;  4K8M A;  4J57 E;  3NZN A;  2GSQ A;  4BL7 A;  1YKA A;  5A34 A;  3PPU A;  2QGV A;  1XCC A;  1N2A A;  5CO3 A;  3F3Q A;  1PD2 1;  6GST A;  4GF0 A;  2O87 A;  2JL4 A;  3L9S A;  1TXX A;  3UMA A;  2GSS A;  2C1Y A;  1XWB A;  4JRR A;  4MH3 A;  3ME8 A;  1TTZ A;  3UVT A;  5IMV A;  6GSW A;  2A2P A;  3ZIT A;  2AJQ B;  2OBK A;  2IN3 A;  2MMO A;  4HOJ A;  2K6V A;  2B6M A;  1YEW C;  1V2A A;  3BCI A;  2NDO A;  2H1L A;  5FHI A;  1GSD A;  3LGC A;  1X9W B;  5HR3 A;  2F8A A;  2FGX A;  3EU3 A;  3TRQ A;  2CX3 A;  2GZP A;  1JFU A;  1OC9 A;  3UOM A;  2H0H A;  5IO2 A;  4KE3 A;  1TRW A;  4MAB A;  2GLR A;  4TR0 A;  3IPZ A;  4IKH A;  1ZGN A;  3IDV A;  3QFB C;  4IQ1 A;  4ILF A;  2EIO A;  3P7X A;  4ACS A;  4HDE A;  1AW9 A;  4QQ7 A;  1A8Y A;  3HKR A;  1XW5 A;  2H30 A;  5CAX A;  4BPY A;  2AYT A;  3CSI A;  3TKS E;  3GX8 A;  5F8B A;  4RQR A;  1GNE A;  3HJP A;  3CWG A;  3W8J A;  4X4J A;  4X0X A;  1SKW B;  1M7T A;  3BOA A;  3CHX C;  1EGR A;  1FOH A;  2IPA A;  2G2Q A;  3M1G A;  2KUC A;  4ULX A;  5KOX A;  1YEX A;  4F03 A;  2XBQ A;  3LOR A;  3WGX A;  2H72 A;  3L9V A;  1QGV A;  4V2N A;  2JAD A;  1TRS A;  2VCQ A;  3GL3 A;  3C1S A;  5KOW A;  1XOA A;  3F9U A;  3IK7 A;  1ON4 A;  4MF7 A;  2YWO A;  2GS3 A;  4XS1 A;  4EF0 A;  3IAM 2;  2LJA A;  5HFK A;  5DCH A;  3PR8 A;  1GUK A;  4FIW A;  1WPI A;  2OE3 A;  5CRG A;  1YY7 A;  2REM A;  1X9M B;  4BL7 B;  2YCD A;  4AKI A;  3LFL A;  2RM6 A;  4AI6 A;  1GSE A;  2CV4 A;  3G9B A;  1I9D A;  2FY6 A;  2H70 A;  2H1B A;  1T8E B;  5D9V A;  1ST9 A;  4MZB A;  2MMN A;  3TJB A;  1FVK A;  3ZVJ A;  2H6X A;  2HRN A;  3GX0 A;  4K5R A;  3EIN A;  4NHW A;  4HSC X;  4MJC A;  1TRV A;  5D93 A;  2YJH A;  1KNG A;  2VL9 A;  5B6M A;  2NTO A;  4X43 A;  5IMC A;  5BRT A;  3LXT A;  1AXD A;  4OMV A;  3KXO A;  4MLY A;  2LRN A;  4TKY A;  3FYG A;  2RUF A;  2MBT A;  1F3A A;  1T00 A;  5A5K A;  4IBP A;  5F05 A;  3IXR A;  5A1N A;  2HSM A;  2N5A A;  3ZIJ A;  4YKF A;  2PBJ A;  1TK5 B;  2WVZ A;  1J9B A;  1S3C A;  1TJD A;  1LBK A;  3FK8 A;  1WMJ A;  5ECH B;  2QC7 A;  4DVC A;  3TRP A;  4XS6 A;  4I97 A;  5CRW A;  2FD3 A;  3UJ1 A;  1JZW A;  3F63 A;  3KP9 A;  2HZE A;  2FA8 A;  4XRD A;  17GS A;  2DBC A;  5HR2 A;  2FHE A;  4TN8 A;  5ECK B;  3M8N A;  4K0G A;  4HZ4 A;  3MYD A;  1PN9 A;  3NOF A;  2PVO C;  2X8G A;  2XC2 A;  2X4A A;  5HQP A;  1PKW A;  3DVW A;  3EYT A;  4TXO B;  4O5R A;  4GDF A;  3QCP A;  1O81 A;  3I6A A;  4KCE A;  4FH8 A;  1X9S B;  2CAI A;  3Q74 A;  2V6O A;  3FZ4 A;  4OFN A;  1XW9 A;  4X1U A;  2VCW A;  2HLS A;  3H93 A;  4YQU A;  1S3R A;  3I43 A;  3H1N A;  3O76 A;  1F6M C;  1A8L A;  2B7J A;  4O92 A;  1X5E A;  4IW9 A;  1ERT A;  2H1A A;  2VO4 A;  5AN1 A;  2VLV A;  2HNL A;  3FKF A;  4BIK A;  4USS A;  1FVJ A;  3IHQ A;  2YWN A;  5C04 A;  1BX9 A;  1O7U A;  3IE3 A;  1H75 A;  3G7Y A;  3F4S A;  3EU4 A;  3A2W A;  3L9U A;  1TP9 A;  4I2T A;  3CBU A;  4GWR A;  1HNC A;  5A4U A;  4G2E A;  5J5N A;  3WGD A;  1THX A;  1K3L A;  2PER A;  3Q18 A;  2UZ8 A;  1TI1 A;  3KH9 A;  1AQX A;  2PUK C;  1E2Y A;  2VOC A;  1NW2 A;  3D4M A;  2EFH A;  2FWG A;  3R3E A;  2MYG A;  3E0U A;  3GKM A;  1EEM A;  2HSM B;  4GSN A;  3KGK A;  1Z7P A;  2HI7 A;  2QKE A;  1VF4 A;  4W66 A;  2A4H A;  2LJK A;  1GH2 A;  1V58 A;  4MCU A;  1U6T A;  1XW6 A;  3MDK A;  4HQZ A;  2J23 A;  2HZE B;  5DQY A;  4JR6 A;  4MJE A;  4TR1 A;  2R0G A;  4K1F A;  1SK2 A;  1GLP A;  2FNO A;  2C4J A;  5J40 A;  2IMK A;  4O5U A;  1OE8 A;  2PGT A;  5B8A A;  1MD4 A;  4G19 A;  3CMI A;  5F0G A;  4F0B A;  3KH7 A;  1VF2 A;  4K7O A;  3SWL A;  1K3Y A;  4ZB8 A;  1G7E A;  16GS A;  4JR4 A;  2H71 A;  4PUA A;  2XPD A;  4ZL8 A;  5E4W A;  3LJR A;  3TOU A;  4RQX A;  2DJ1 A;  5D8I A;  3GTU A;  2E2G A;  1SVL A;  2AHE A;  1GTA A;  2O7K A;  1EWX A;  4ICY A;  3U5R E;  4MH2 A;  3VWV A;  5G1L A;  4V1A g;  1M3I A;  2C0D A;  2H76 A;  2GZZ A;  3HZ4 A;  1TDI A;  3IV4 A;  4K7N A;  2I4A A;  2OJL A;  1I5G A;  5D9W A;  5HR1 A;  3ERF A;  2NBS A;  1V40 A;  2HZF A;  3ZFB A;  4G0K A;  2H0G A;  2B5X A;  5ECL B;  2ZCT A;  2X64 A;  1GSU A;  1EEJ A;  1TW9 A;  3IC4 A;  1VF1 A;  1GSY A;  3APQ A;  3EWL A;  2LKU A;  3N9J A;  3D21 A;  1FO5 A;  3FR3 A;  2AUV A;  2F3M A;  1K0C A;  1XWG A;  4YAP A;  2RM5 A;  5AIS A;  2P5R A;  1PKZ A;  3EMX A;  2B5E A;  5LCZ A;  1PGT A;  2C8U A;  1XZO A;  13GS A;  2L57 A;  3ZL5 A;  3HCZ A;  3ZFL A;  4MPF A;  2XHF A;  4BA7 A;  4HU7 A;  4CW9 A;  3ZMK A;  2IMD A;  2VL2 C;  1GRX A;  3IR4 A;  1QUW A;  2GSR A;  4L8E A;  1XOB A;  4ZBA A;  3QFA C;  1SKR B;  4K0N A;  3Q19 A;  1MDK A;  4K5S A;  4KA0 A;  1XBS A;  2KLX A;  3TRX A;  4ZIL A;  3GKK A;  2WVY A;  1U88 A;  3MSZ A;  2B5Y A;  2YWI A;  4KAE A;  4G01 A;  1HQO A;  2CVK A;  4GQF A;  1SL1 B;  3GTU B;  1SK1 A;  4G10 A;  5C00 A;  4PTS A;  5CRH A;  3TCO A;  4KDX A;  1BF5 A;  1U3I A;  3O6T A;  1M9A A;  5DVB A;  4IHU A;  5L71 A;  2A4V A;  3HJO A;  3M3M A;  2DJ2 A;  4E68 A;  4EL1 A;  1F3B A;  3ZRE A;  4FYU A;  1PQN A;  3DXB A;  3LYP A;  4TVE A;  5DJM A;  2A2S A;  4HI7 A;  3DYR A;  3I69 A;  4NAX A;  2H74 A;  2V6K A;  1S4B P;  4ZBB A;  1UVZ A;  2MZC A;  2DKH A;  2R0C A;  1Z7R A;  3CTF A;  1S3A A;  3IRA A;  2Z9S A;  1N25 A;  18GS A;  1ILO A;  2WUL A;  1A24 A;  4K9Z A;  14GS A;  1WOU A;  4Q5F A;  2HQT A;  3BBY A;  2DJJ A;  1GSS A;  1ML6 A;  1GWC A;  2RUE A;  4Z2R A;  4ZL9 A;  3HZ8 A;  2KP2 A;  2P5Q A;  5ECM B;  4MDC A;  4PXO A;  4POL A;  3D5J A;  4KDU A;  1RK4 A;  19GS A;  4KW6 A;  3C1R A;  2OAC A;  2YP6 A;  1FAA A;  4EIQ A;  2ES7 A;  2IJY A;  5H5Q A;  3HXS A;  1EOG A;  3GA4 A;  1B4Q A;  2VKZ G;  1YF0 A;  4HUA A;  4GLT A;  1FG4 A;  1T4Z A;  1M9B A;  4DSR A;  1UC7 A;  4HZ2 A;  1T3B A;  3LSZ A;  4ECI A;  4KH7 A;  4KX4 A;  5GAN D;  1SKS B;  4A5P A;  2IFQ B;  2R3X A;  3VI5 A;  1EGO A;  1GNW A; 
#chains in the Genus database with same CATH homology
 1Z9H A;  5KN2 A;  2HRF A;  1BJX A;  4KUN A;  4LMW A;  1TXU A;  4MP4 A;  5DQS A;  3M9K A;  2VIM A;  2GQM A;  2YOI A;  8GSS A;  1SL2 B;  1HYU A;  1UA5 A;  4MPG A;  1Y6E A;  4V1A p;  2R5G A;  3ERW A;  2R2J A;  2R37 A;  2EIQ A;  1EV9 A;  1TOF A;  3CSJ A;  3LG6 A;  4POK A;  3GH9 A;  3DD3 A;  5A4W A;  1JHB A;  2PMT A;  4FYB A;  1BAY A;  2H0I A;  3VUR A;  2JU5 A;  5G31 A;  4EO3 A;  4ZXG A;  3OR5 A;  2H6Z A;  3FR9 A;  3L0H A;  4PQH A;  1TK0 B;  5GSS A;  4TXO A;  1GSF A;  2JAC A;  4F82 A;  4O7H A;  3F6D A;  1WIK A;  3RHC A;  1KBN A;  4OCF A;  1Q98 A;  2P31 A;  4O32 A;  4PQ1 A;  2VCT A;  2V1M A;  4JE1 A;  2DML A;  1RQM A;  3F4R A;  4AF2 A;  2WB9 A;  2WZ9 A;  9GSS A;  1ZYQ B;  4TR4 A;  1X0R A;  3D6I A;  1ZCP A;  2YNX A;  4Z2T A;  2PWJ A;  4I8B A;  3WGE A;  1B8X A;  4HJM A;  3RPP A;  1YJ6 A;  3GUR A;  1GLQ A;  1W4V A;  2K9F A;  4G9H A;  4D73 B;  2MBS A;  2DIZ A;  4ZL7 A;  1YQ1 A;  3L78 A;  2YJ7 A;  4XIH A;  1F2E A;  3ZML A;  3KMO A;  4BWQ A;  2HRA A;  1PX7 A;  1PA3 A;  2HRK B;  2VD1 A;  3TJG A;  3P8W A;  2VL2 A;  2JZT A;  5G5E A;  2L59 A;  4MZW A;  3HVV A;  1FHE A;  5FT3 A;  2OAD A;  4PGT A;  2HSN B;  4TR3 A;  3UBK A;  1K0B A;  5ECN B;  4WXT A;  4L5O A;  3E3E A;  4WR5 A;  2GZY A;  5AIV A;  5JCU A;  5ID2 B;  3CRT A;  2XPE A;  4IS0 A;  1R7H A;  2FWF A;  2G0F A;  5ENU A;  3C73 A;  3C8E A;  1QMV A;  1T7P B;  2DKI A;  4ML1 A;  3D22 A;  2WRT A;  4G0I A;  2YZU A;  5A5H B;  1THO A;  1PN0 A;  1SD9 A;  3HDC A;  5ECR B;  5B6N A;  1K0M A;  4LMV A;  2BTO T;  1EOH A;  1XWK A;  2MMZ A;  3M9J A;  2X99 A;  2FA4 A;  1OKT A;  4PUF C;  5H5S A;  1IYI A;  4N0V A;  5ELG A;  2H19 A;  3ISO A;  1FB6 A;  1K0O A;  3KIJ A;  3VWX A;  3LEF A;  1HNA A;  3VFI A;  1OKD A;  5JWQ B;  1V57 A;  3QR6 A;  5AIX A;  4YQV A;  2CZ2 A;  2X8H A;  4RI6 A;  2N5F A;  5F07 A;  1SU9 A;  2B3S A;  2VLU A;  3G7J A;  4Z2U A;  1EP7 A;  4PQI A;  5H5R A;  2WFC A;  2RII A;  2IMF A;  2EIR A;  3IBH A;  5ABR A;  3ZVJ D;  1KTE A;  4MF6 A;  1TU8 A;  2ALB A;  2JZR A;  4TXV A;  2VL3 A;  2XBI A;  4BVY A;  3TDG A;  4NPB A;  3DIE A;  2L6D A;  4QL9 A;  2VCV A;  4WEY A;  2R0P A;  3VWU A;  1ERU A;  3A5W A;  1XIY A;  4NXI A;  4PX1 A;  2VM1 A;  3APS A;  4ECB A;  4AKG A;  3GMF A;  3TJJ A;  2LJR A;  2MMA A;  3IK9 A;  11GS A;  1HD2 A;  1QK8 A;  3AY8 A;  3UAP A;  5G5F A;  3DEX A;  3SBC A;  3MWH A;  2F8F A;  5CRE A;  3VWW A;  2ON7 A;  2O85 A;  1AQV A;  2C0F A;  1K0A A;  2C80 A;  2CVB A;  3ZYW A;  6GSX A;  1K0D A;  5IMZ A;  7GSS A;  3CSH A;  1XFL A;  2I1U A;  4G0L A;  1JLV A;  1T1V A;  3I9V 2;  2JZS A;  5COH A;  3EE2 A;  4YH2 A;  4RI7 A;  2PPT A;  1USB A;  3A3T A;  3FMW A;  5LD0 A;  3IAS 2;  4KDY A;  3CYN A;  6GSY A;  1X5D A;  1HNB A;  4IP1 A;  2LV3 A;  2TRX A;  2EC4 A;  2M46 A;  2L4C A;  4GTU A;  4ECJ A;  1FOV A;  1O85 A;  3UIW A;  3FRC A;  3GKN A;  3FEU A;  3H79 A;  2YPM A;  3U6V A;  2C3N A;  4K2X A;  2PN8 A;  4POB A;  1ZYN A;  5JWO B;  1SD8 A;  2GVP A;  4NV5 A;  5IOW A;  1XWA A;  3VPT A;  3P2A A;  4RUV A;  4F0C A;  5KN0 A;  4ML6 A;  5AGY A;  5G2Z A;  5CNW A;  5KN1 A;  4OO5 A;  2LNS A;  2H73 A;  3ZZX A;  3IC8 A;  2FUG 2;  1DSB A;  2YV7 A;  3GN3 A;  3F8U A;  1A2J A;  2JSY A;  2IWT A;  2CVD A;  2OE0 A;  2VAF A;  2HXK A;  4BVY B;  3PGT A;  4I6X A;  4K6X A;  4Z7X A;  5ECS A;  2B1K A;  3RDW A;  3FHK A;  1TI3 A;  4E8E A;  2EFD A;  3QDN A;  4GST A;  2FWE A;  1YZX A;  4JU5 A;  4EUY A;  3DWV A;  2CT6 A;  1F37 A;  1ERV A;  1IYH A;  1W89 A;  1BG5 A;  3UBL A;  1GL8 A;  1AIU A;  4FQU A;  2O8V B;  5IMA A;  5CRD A;  5DJL A;  3GFK A;  2LST A;  3C7M A;  1OC8 A;  3G7I A;  2L6C A;  2C3T A;  2CA8 A;  3F0I A;  4N0Z A;  4MZC A;  1DE2 A;  1ZYP A;  2WGR A;  3TJF A;  3EPT A;  2H75 A;  5F06 A;  1JZR A;  4XTS A;  4BWS A;  4Q5Q A;  1LJR A;  4XCS A;  5KEJ A;  3GIX A;  4ID0 A;  2GQK A;  4KB3 A;  1B48 A;  4MK3 A;  1WE0 A;  1U87 A;  4WET A;  3TKR A;  1BED A;  1SVO A;  3BJ5 A;  1SK0 A;  2KHP A;  5IOX A;  5J9C A;  3KM6 A;  5A4V A;  2IFQ A;  2C3Q A;  1CQH A;  3EMP A;  1H4O A;  5KN3 A;  1GUH A;  1Z6N A;  3DML A;  2K18 A;  3FR6 A;  2OA7 A;  1G6W A;  3KTL A;  1VGL A;  5FWG A;  3A5I A;  1LU4 A;  4JZQ A;  4K2D A;  1A2M A;  1ZOF A;  1BQ7 A;  4EC0 A;  1XVW A;  2L4Q A;  2DIY A;  5CYY A;  5D9X A;  1XPV A;  6GSS A;  5DAK A;  3C71 A;  3IA1 A;  3UL3 A;  4ZB6 A;  1EP8 A;  1JZD A;  3TU3 B;  1ERW A;  4IEL A;  2H1D A;  3F4T A;  5INY A;  2IIY A;  5IPH A;  4XS4 A;  1M99 A;  3KZQ A;  3GKX A;  1JZO A;  3HJM A;  2YZH A;  5DDL A;  3QMX A;  2LTK A;  2QA1 A;  3LWA A;  1K0N A;  2HT9 A;  1Y25 A;  3IHG A;  4LL4 B;  3ZLP A;  1Q4J A;  3BCK A;  4HS1 A;  1NHY A;  3HMJ G;  1GTI A;  5J3R A;  4IN0 A;  4CDO A;  5J9B A;  5DCG A;  4IVF A;  1B9Y C;  3DKS A;  5IMF A;  1M2A A;  4MJA A;  2F9S A;  3M0F A;  4EVM A;  3MAK A;  1URM A;  5IMD A;  1PMT A;  2HSY A;  4D73 A;  3BD2 A;  2N5B A;  1WJK A;  5GAP D;  5ECP B;  1VRS D;  3RPN A;  3E9J B;  1XXU A;  1FW1 A;  3GH6 A;  2H6Y A;  1T4Y A;  2HRK A;  4OO4 A;  1YVL A;  4AJ8 A;  2VCZ A;  1MEK A;  1QFN A;  2VUP A;  1BYE A;  3HVX A;  3KMN A;  3HYP A;  2GST A;  1SEN A;  2HSN A;  2A2R A;  2IL3 A;  4ZB7 A;  2CZ3 A;  3GUS A;  4MF5 A;  2LUS A;  5EL8 A;  3EUR A;  4XRA A;  2DLX A;  5ID2 A;  1M2D A;  5J41 A;  2ON5 A;  5J47 A;  4HU9 A;  1Z5Y E;  2B1L A;  1KEB A;  1JLW A;  2GDR A;  2FCH A;  3MIX A;  3WD6 A;  3TKS C;  3QAW A;  4J56 E;  4N3Z A;  1OVN A;  5D96 A;  1DBY A;  1O8X A;  2I3Y A;  3KJY A;  2OBI A;  4OFM A;  3F6F A;  5A5H A;  2L5L A;  3GV1 A;  2HE3 A;  3APO A;  4AJ7 A;  4HQS A;  5DAK B;  5G30 A;  12GS A;  1MD3 A;  3QAG A;  1OYJ A;  1S3D A;  2K8V A;  3FW2 A;  3CXG A;  4LA1 A;  1RW1 A;  4HJ2 A;  2GTU A;  1ACV A;  3V1W A;  4I5Q A;  1BG1 A;  2BJX A;  3GRX A;  2WCI A;  1DE1 A;  2K8S A;  3TOT A;  4XS4 B;  3LQ7 A;  1PL1 A;  2HSH A;  1SL0 B;  4L0W A;  2J9H A;  2M72 A;  1TKD B;  2FWH A;  4POM A;  4EDY A;  5J4V A;  4QMK A;  4KCA A;  3GL5 A;  5BMU A;  3J7Y k;  1GP1 A;  3S9F A;  1ZZY A;  2GQL A;  5GZZ B;  4MNN A;  1M0U A;  3KEB A;  4WR4 A;  4GCI A;  3ZIV A;  4P3Y B;  1G6Y A;  4ZBD A;  1AAZ A;  1GUM A;  2L5O A;  3DRN A;  3ME7 A;  5DAL A;  3F3R A;  2VD0 A;  4PNF A;  3VLN A;  5A34 B;  5IIZ A;  3TKQ A;  1SJI A;  2E0Q A;  2GT6 A;  4MA9 A;  3KP8 A;  5ECQ B;  2B7K A;  1SJ6 A;  1ZMA A;  3UVH A;  2X49 A;  2H8L A;  4GRF A;  2DSA A;  3DVX A;  1UN2 A;  4N10 A;  4WBJ A;  4NWY A;  2AB6 A;  1R5P A;  2PU9 C;  2F51 A;  3KTB A;  2JSZ A;  2UV8 G;  3K8N A;  2AAW A;  5HFG A;  1O6J A;  1VF3 A;  2DC5 A;  4JED A;  3RAZ A;  2YAN A;  2HFD A;  1A0F A;  1OC9 B;  1Y1U A;  4NHZ A;  4KND A;  1A23 A;  3ERG A;  2M80 A;  1MDJ A;  3HA9 A;  5EVO A;  5IO0 A;  5J4Y A;  4KSO A;  1O73 A;  4GXZ A;  3DGQ A;  1K3O A;  5JCG A;  3QOU A;  5E59 A;  2H01 A;  4BVX A;  4WBR D;  4N11 A;  5ECI B;  1PSQ A;  2VM2 A;  2CX4 A;  5GST A;  3CTG A;  4IQA A;  2O5V A;  4PNG A;  1N8J A;  1EZK A;  3ZTL A;  5LNK e;  2CAQ A;  4Q5N A;  4WKW A;  5IM9 A;  1V9W A;  4KSM A;  2TRC P;  2V32 A;  2P0G A;  3R2Q A;  2H1G A;  2QA2 A;  3L4N A;  4KGI A;  3JCM L;  2IMI A;  5BMU B;  3TUE A;  5EY6 A;  4NMU A;  1R5A A;  1OAZ A;  3GHA A;  4AKH A;  1M2B A;  5ELA A;  1B4P A;  2GGT A;  4YAV A;  5J4U A;  4F9Z A;  5JCW A;  3NIV A;  3TKP A;  4EKZ A;  2IME A;  5DAL B;  3EVI A;  1U3A A;  3EC3 A;  1SYR A;  2OKA A;  1TU7 A;  4QL7 A;  2GT5 A;  1A2L A;  3KCM A;  4CY8 A;  3H8Q A;  3FZA A;  3TB2 A;  4DSQ A;  5D9T A;  2D2Z A;  2LNT A;  5IQY A;  4J2F A;  3O3T A;  2R6K A;  1PX6 A;  3QAV A;  3TGZ A;  2WDU A;  2QSI A;  4LL1 B;  3KD0 A;  4DEJ A;  1Z3E A;  4PUR A;  5HR0 A;  3RBT A;  3H4K A;  3HVS A;  4ZB9 A;  2DMM A;  4MMM A;  4DSS A;  2OT3 A;  4XHM A;  3VK9 A;  1QXH A;  1YDK A;  4IGJ A;  2WJU A;  1NSW A;  1TK8 B;  6GSV A;  1YEP A;  1X5C A;  3TKS A;  1XWC A;  5DBQ A;  4OD7 A;  3FY7 A;  4WF5 A;  5JWR B;  5A1N B;  2CQ9 A;  4BVX B;  1G0T A;  3US3 A;  4IP6 A;  4EE0 A;  1MTC A;  4Q5R A;  4EXJ A;  2KP1 A;  2DJ3 A;  3QPM A;  2DJK A;  4K7I A;  1MDI A;  1J0F A;  3IOS A;  4NV2 A;  3MNG A;  5B8B A;  6GSU A;  2NPB A;  5IPG A;  1G7O A;  2VCX A;  3P90 A;  2LEG A;  1R26 A;  2C0G A;  4TW5 A;  2R4V A;  4V2L A;  1PRX A;  4EDZ A;  2I81 A;  4TRX A;  2C0E A;  2LS5 A;  1AUC A;  5B7C A;  4E8H A;  20GS A;  2OE1 A;  2YV9 A;  2ZNM A;  4FO5 A;  4L0U A;  4GQC A;  22GS A;  3FZ9 A;  2ZUP A;  4TOP A;  4H86 A;  4EIP A;  4AJ6 A;  2H66 A;  3LXZ A;  2RLI A;  4HEA 2;  3RHB A;  4GSS A;  3CRU A;  4AKX B;  4ISD A;  3PH9 A;  5HFI A;  1OC3 A;  4KF9 A;  2V41 A;  3GNJ A;  3GYK A;  4WF4 A;  1YF1 A;  1PL2 A;  4YQM A;  1GTU A;  1YKC A;  2I9H A;  1NHO A;  3A2V A;  2LQO A;  2YWM A;  4L5L A;  2NVL A;  2EFE A;  4MJB A;  2DJ0 A;  3GSS A;  2FLS A;  4N30 A;  5ECO B;  4DSS B;  3VPQ A;  2TIR A;  1SJZ A;  2VLT A;  3ED3 A;  5EPF A;  2EFC A;  4ZIJ A;  1FB0 A;  3Q6O A;  1Z6M A;  3W6G A;  1DUG A;  3UAR A;  3VI7 A;  4LLR A;  2KOK A;  1ZL9 A;  1XVQ A;  1CQG A;  1AQW A;  3WT1 A;  3LYK A;  3D0Z A;  2PVQ A;  3GST A;  4OWY A;  4FYC A;  4OFT A;  1J08 A;  3W8S A;  2O89 A;  4OCE A;  4IJ3 A;  1TRU A;  4CHS A;  4TR1 B;  2X8C A;  4CY6 A;  4JBB A;  1GSQ A;  1B9X C;  2WS2 A;  1A0R P;  1WRY A;  2HYX A;  1ZYE A;  3J7Y b;  1SVM A;  4AGS A;  3WYW A;  1AC1 A;  1F9M A;  2E2M A;  5CP1 A;  3FZ5 A;  2BMX A;  1ABA A;  5G1K A;  1V98 A;  4ECC A;  3PIN A;  3UEM A;  2LRT A;  1NM3 A;  4F2I A;  4I2U A;  3HD5 A;  3LW9 A;  2E7P A;  3N5O A;  2V2G A;  10GS A;  3QD9 A;  4V2M A;  1OE7 A;  1EV4 A;  2YN1 A;  1GTB A;  3D4T A;  3A2X A;  1C72 A;  1WP0 A;  1O8W A;  1WWJ A;  3TJK A;  4O5Q A;  4YKG A;  1R4W A;  2LQQ A;  3HY2 A;  1E6B A;  3HHV A;  1SYX A;  5D73 A;  4IJI A;  2AV4 A;  3WT2 A;  2LRC A;  1GUL A;  1QQ2 A;  3ZRD A;  4K8M A;  4J57 E;  3NZN A;  2GSQ A;  4BL7 A;  1YKA A;  5A34 A;  3PPU A;  2QGV A;  1XCC A;  1N2A A;  5CO3 A;  3F3Q A;  1PD2 1;  6GST A;  4GF0 A;  2O87 A;  2JL4 A;  3L9S A;  1TXX A;  3UMA A;  2GSS A;  2C1Y A;  1XWB A;  4JRR A;  4MH3 A;  3ME8 A;  1TTZ A;  3UVT A;  5IMV A;  6GSW A;  2A2P A;  3ZIT A;  2AJQ B;  2OBK A;  2IN3 A;  2MMO A;  4HOJ A;  2K6V A;  2B6M A;  1V2A A;  3BCI A;  2NDO A;  2H1L A;  5FHI A;  1GSD A;  3LGC A;  1X9W B;  5HR3 A;  2F8A A;  2FGX A;  3EU3 A;  3TRQ A;  2CX3 A;  2GZP A;  1JFU A;  1OC9 A;  3UOM A;  2H0H A;  5IO2 A;  4KE3 A;  1TRW A;  4MAB A;  2GLR A;  4TR0 A;  3IPZ A;  4IKH A;  1ZGN A;  3IDV A;  3QFB C;  4IQ1 A;  4ILF A;  2EIO A;  3P7X A;  4ACS A;  4HDE A;  1AW9 A;  4QQ7 A;  1A8Y A;  3HKR A;  1XW5 A;  2H30 A;  5CAX A;  4BPY A;  2AYT A;  3CSI A;  3TKS E;  3GX8 A;  5F8B A;  4RQR A;  1GNE A;  3HJP A;  3CWG A;  3W8J A;  4X4J A;  4X0X A;  1SKW B;  1M7T A;  3BOA A;  1EGR A;  1FOH A;  2IPA A;  2G2Q A;  3M1G A;  2KUC A;  4ULX A;  5KOX A;  1YEX A;  4F03 A;  2XBQ A;  3LOR A;  3WGX A;  2H72 A;  3L9V A;  1QGV A;  4V2N A;  2JAD A;  1TRS A;  2VCQ A;  3GL3 A;  3C1S A;  5KOW A;  1XOA A;  3F9U A;  3IK7 A;  1ON4 A;  4MF7 A;  2YWO A;  2GS3 A;  4XS1 A;  4EF0 A;  3IAM 2;  2LJA A;  5HFK A;  5DCH A;  3PR8 A;  1GUK A;  4FIW A;  1WPI A;  2OE3 A;  5CRG A;  1YY7 A;  2REM A;  1X9M B;  4BL7 B;  2YCD A;  4AKI A;  3LFL A;  2RM6 A;  4AI6 A;  1GSE A;  2CV4 A;  3G9B A;  1I9D A;  2FY6 A;  2H70 A;  2H1B A;  1T8E B;  5D9V A;  1ST9 A;  4MZB A;  2MMN A;  3TJB A;  1FVK A;  3ZVJ A;  2H6X A;  2HRN A;  3GX0 A;  4K5R A;  3EIN A;  4NHW A;  4MJC A;  1TRV A;  5D93 A;  2YJH A;  1KNG A;  2VL9 A;  5B6M A;  2NTO A;  4X43 A;  5IMC A;  5BRT A;  3LXT A;  1AXD A;  4OMV A;  3KXO A;  4MLY A;  2LRN A;  4TKY A;  3FYG A;  2RUF A;  2MBT A;  1F3A A;  1T00 A;  5A5K A;  4IBP A;  5F05 A;  3IXR A;  5A1N A;  2HSM A;  2N5A A;  3ZIJ A;  4YKF A;  2PBJ A;  1TK5 B;  1J9B A;  1S3C A;  1TJD A;  1LBK A;  3FK8 A;  1WMJ A;  5ECH B;  2QC7 A;  4DVC A;  3TRP A;  4XS6 A;  4I97 A;  5CRW A;  2FD3 A;  3UJ1 A;  1JZW A;  3F63 A;  3KP9 A;  2HZE A;  2FA8 A;  4XRD A;  17GS A;  2DBC A;  5HR2 A;  2FHE A;  4TN8 A;  5ECK B;  3M8N A;  4K0G A;  4HZ4 A;  3MYD A;  1PN9 A;  3NOF A;  2PVO C;  2X8G A;  2XC2 A;  2X4A A;  5HQP A;  1PKW A;  3DVW A;  3EYT A;  4TXO B;  4O5R A;  4GDF A;  3QCP A;  1O81 A;  3I6A A;  4KCE A;  4FH8 A;  1X9S B;  2CAI A;  3Q74 A;  2V6O A;  3FZ4 A;  4OFN A;  1XW9 A;  4X1U A;  2VCW A;  2HLS A;  3H93 A;  4YQU A;  3I43 A;  3H1N A;  3O76 A;  1F6M C;  1A8L A;  2B7J A;  4O92 A;  1X5E A;  4IW9 A;  1ERT A;  2H1A A;  2VO4 A;  5AN1 A;  2VLV A;  2HNL A;  3FKF A;  4USS A;  1FVJ A;  3IHQ A;  2YWN A;  5C04 A;  1BX9 A;  1O7U A;  3IE3 A;  1H75 A;  3G7Y A;  3F4S A;  3EU4 A;  3A2W A;  3L9U A;  1TP9 A;  4I2T A;  3CBU A;  4GWR A;  1HNC A;  5A4U A;  4G2E A;  5J5N A;  3WGD A;  1THX A;  1K3L A;  2PER A;  3Q18 A;  2UZ8 A;  1TI1 A;  3KH9 A;  1AQX A;  2PUK C;  1E2Y A;  2VOC A;  1NW2 A;  3D4M A;  2EFH A;  2FWG A;  3R3E A;  2MYG A;  3E0U A;  3GKM A;  1EEM A;  2HSM B;  4GSN A;  3KGK A;  1Z7P A;  2HI7 A;  2QKE A;  1VF4 A;  4W66 A;  2A4H A;  2LJK A;  1GH2 A;  1V58 A;  4MCU A;  1U6T A;  1XW6 A;  3MDK A;  4HQZ A;  2J23 A;  2HZE B;  5DQY A;  4JR6 A;  4MJE A;  4TR1 A;  2R0G A;  4K1F A;  1SK2 A;  1GLP A;  2FNO A;  2C4J A;  5J40 A;  2IMK A;  4O5U A;  1OE8 A;  2PGT A;  5B8A A;  1MD4 A;  4G19 A;  3CMI A;  5F0G A;  4F0B A;  3KH7 A;  1VF2 A;  4K7O A;  3SWL A;  1K3Y A;  4ZB8 A;  1G7E A;  16GS A;  4JR4 A;  2H71 A;  4PUA A;  2XPD A;  4ZL8 A;  5E4W A;  3LJR A;  3TOU A;  4RQX A;  2DJ1 A;  5D8I A;  3GTU A;  2E2G A;  1SVL A;  2AHE A;  1GTA A;  2O7K A;  1EWX A;  4ICY A;  3U5R E;  4MH2 A;  3VWV A;  5G1L A;  4V1A g;  2C0D A;  2H76 A;  2GZZ A;  3HZ4 A;  1TDI A;  3IV4 A;  4K7N A;  2I4A A;  2OJL A;  1I5G A;  5D9W A;  5HR1 A;  3ERF A;  2NBS A;  1V40 A;  2HZF A;  3ZFB A;  4G0K A;  2H0G A;  2B5X A;  5ECL B;  2ZCT A;  2X64 A;  1GSU A;  1EEJ A;  1TW9 A;  3IC4 A;  1VF1 A;  1GSY A;  3APQ A;  3EWL A;  2LKU A;  3N9J A;  3D21 A;  1FO5 A;  3FR3 A;  2AUV A;  2F3M A;  1K0C A;  1XWG A;  4YAP A;  2RM5 A;  5AIS A;  2P5R A;  1PKZ A;  3EMX A;  2B5E A;  5LCZ A;  1PGT A;  2C8U A;  1XZO A;  13GS A;  2L57 A;  3ZL5 A;  3HCZ A;  3ZFL A;  4MPF A;  2XHF A;  4BA7 A;  4HU7 A;  4CW9 A;  3ZMK A;  2IMD A;  2VL2 C;  1GRX A;  3IR4 A;  1QUW A;  2GSR A;  4L8E A;  1XOB A;  4ZBA A;  3QFA C;  1SKR B;  4K0N A;  3Q19 A;  1MDK A;  4K5S A;  4KA0 A;  1XBS A;  2KLX A;  3TRX A;  4ZIL A;  3GKK A;  1U88 A;  3MSZ A;  2B5Y A;  2YWI A;  4KAE A;  4G01 A;  1HQO A;  2CVK A;  4GQF A;  1SL1 B;  3GTU B;  1SK1 A;  4G10 A;  5C00 A;  4PTS A;  5CRH A;  3TCO A;  4KDX A;  1BF5 A;  1U3I A;  3O6T A;  1M9A A;  5DVB A;  4IHU A;  5L71 A;  2A4V A;  3HJO A;  3M3M A;  2DJ2 A;  4E68 A;  4EL1 A;  1F3B A;  3ZRE A;  4FYU A;  1PQN A;  3DXB A;  3LYP A;  4TVE A;  5DJM A;  2A2S A;  4HI7 A;  3DYR A;  3I69 A;  4NAX A;  2H74 A;  2V6K A;  4ZBB A;  1UVZ A;  2MZC A;  2DKH A;  2R0C A;  1Z7R A;  3CTF A;  1S3A A;  3IRA A;  2Z9S A;  1N25 A;  18GS A;  1ILO A;  2WUL A;  1A24 A;  4K9Z A;  14GS A;  1WOU A;  4Q5F A;  2HQT A;  3BBY A;  2DJJ A;  1GSS A;  1ML6 A;  1GWC A;  2RUE A;  4Z2R A;  4ZL9 A;  3HZ8 A;  2KP2 A;  2P5Q A;  5ECM B;  4MDC A;  4PXO A;  4POL A;  3D5J A;  4KDU A;  1RK4 A;  19GS A;  4KW6 A;  3C1R A;  2OAC A;  2YP6 A;  1FAA A;  4EIQ A;  2ES7 A;  2IJY A;  5H5Q A;  3HXS A;  1EOG A;  3GA4 A;  1B4Q A;  2VKZ G;  1YF0 A;  4HUA A;  4GLT A;  1FG4 A;  1T4Z A;  1M9B A;  4DSR A;  1UC7 A;  4HZ2 A;  1T3B A;  3LSZ A;  4ECI A;  4KH7 A;  4KX4 A;  5GAN D;  1SKS B;  4A5P A;  2IFQ B;  2R3X A;  3VI5 A;  1EGO A;  1GNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...