2DSCA

Crystal structure of human adp-ribose pyrophosphatase nudt5 in complex with magnesium and adp-ribose
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
195
Chain Sequence
KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-sugar pyrophosphatase
publication title Crystal Structures of Human NUDT5 Reveal Insights into the Structural Basis of the Substrate Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.7.96: ADP-D-ribose pyrophosphorylase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2dscA00
3N77A 5DDGA 1RRSA 3O6ZA 2O1CA 5GHMA 3O61A 2VNQA 3HYQA 5GHJA 4N1UA 2A8TA 4DYWA 1V8NA 2KDWA 2DSDA 3X0QA 3O69A 2DHOA 2I8UA 3HHJA 1RYAA 3X0IA 1PUSA 3SHDA 1X84A 3KVHA 5GHOA 3O52A 5DEQA 3A6SA 4C9XA 2Q9PA 5FSLA 3Q1PA 1PPVA 1K26A 3MCFA 1SZ3A 1PPXA 5FSKA 5CFIA 2A8RA 4S2VA 2B0VA 3P5TA 1U20A 1XSAA 1PUNA 1G9QA 2B2KA 1V8TA 2QJTA 3Q91A 1VHGA 3GWYA 5FSOA 2CL3A 1VIQA 1TUMA 2GT4A 5IW4A 2W4EA 3DKUA 3F6AA 3Q2TA 2I8TA 3BM4A 5CFJA 4S2WA 5DD4A 4YPHA 4KG4A 1G0SA 4JZSA 4C9WA 4YPRA 3I7VA 1PUQA 3P6YA 5BONA 1Q27A 1V8WA 3I7UA 3R03A 3QSJA 3X0KA 2A6TA 5DPKA 2B06A 2R5WA 4HVYA 1PVFA 2ICKA 1MQWA 2AZWA 2O5FA 1KHZA 3CNGA 5ANSA 1V8LA 4K6EA 4ILQA 1PPWA 2YVOA 1HX3A 2J8QA 1V8UA 1MUTA 2GB5A 3X0JA 1V8RA 3J7Ye 3RH7A 1V8IA 2YYHA 1F3YA 1HZTA 3GZ6A 1NQZA 2VNPA 1KTGA 1VIUA 3AC9A 3X0LA 3OGAA 2PQVA 3MDGA 3BAPA 2O5WA 5ISYA 1SU2A 4KTBA 1V8SA 4IJXA 1RRQA 5FSNA 1GA7A 1I9AA 1MQEA 2FKBA 1VC9A 1NFSA 1VHZA 1JKNA 3Q93A 3WHWA 3X0MA 5GHQA 1NFZA 3GG6A 5C8LA 5FSMA 5ANUA 1Q33A 2RRKA 4S2YA 1K2EA 5C7QA 2A8QA 4ZG0A 3Q4IA 2QKMB 3A6VA 5HZXA 5ANVA 4JZUA 5LPGA 3SONA 2PNYA 3O8SA 5I8UA 4KG3A 2DSCA 1MP2A 3ID9A 4JZTA 5GHPA 2QJOA 4HFQA 4V14A 5IW5A 1KT9A 3G0QA 1XSBA 2DSBA 4JZVA 2A8SA 3F13A 1X51A 3L85A 2G74A 3FSPA 1OW2A 2GT2A 3GZ8A 3Q2SA 1XSCA 2FVVA 3I9XA 2YVPA 1VK6A 2A8PA 2KDVA 4MPOA 1VC8A 3H95A 1IRYA 2YVMA 1NQYA 2ICJA 1VRLA 3U53A 3COUA 4N1TA 3X0RA 3MDIA 1SOIA 2I6KA 1JRKA 5BS6A 1MK1A 4S2XA 1X83A 5GHNA 3FFUA 3EEUA 3X0PA 3N9UA 5ANWA 3X0OA 5C7TA 5FSIA 2XSQA 4NFXA 3SMDA 3GRNA 3ACAA 3DUPA 3E57A 1V8MA 1MR2A 1VCDA 2JVBA 1QVJA 3FK9A 3MGMA 1R67A 1V8YA 2FMLA 4NFWA 3X0SA 4ICKA 3ZR1A 1SJYA 1Q54A 3X0NA 4YOQA 3A6UA 3FCMA 3BHOA 4KYXA 3ZR0A 2DUKA 3GZ5A 3FJYA 3EESA 3A6TA 3EXQA 2YVNA 5ANTA 5GHIA 1V8VA 3EF5A 2G73A
chains in the Genus database with same CATH superfamily
3N77A 5DDGA 1RRSA 3O6ZA 2O1CA 5GHMA 3O61A 2VNQA 3HYQA 5GHJA 4N1UA 2A8TA 4DYWA 1V8NA 2KDWA 2DSDA 3X0QA 3O69A 2DHOA 2I8UA 3HHJA 1RYAA 3X0IA 1PUSA 3SHDA 1X84A 3KVHA 5GHOA 3O52A 5DEQA 3A6SA 4C9XA 2Q9PA 5FSLA 3Q1PA 1PPVA 1K26A 3MCFA 1SZ3A 1PPXA 5FSKA 5CFIA 2A8RA 4S2VA 2B0VA 3P5TA 1U20A 1XSAA 1PUNA 1G9QA 2B2KA 1V8TA 2QJTA 3Q91A 1VHGA 3GWYA 5FSOA 4J7HA 2CL3A 1VIQA 1TUMA 2GT4A 5IW4A 2W4EA 3DKUA 3F6AA 3Q2TA 2I8TA 3BM4A 5CFJA 4S2WA 5DD4A 4YPHA 4KG4A 1G0SA 4JZSA 4C9WA 4YPRA 3I7VA 1PUQA 3P6YA 5BONA 1Q27A 1V8WA 3I7UA 2CZRA 3R03A 3QSJA 3X0KA 2A6TA 5DPKA 2B06A 2R5WA 4HVYA 1PVFA 2ICKA 1MQWA 2AZWA 2O5FA 1KHZA 3CNGA 5ANSA 1V8LA 4K6EA 4ILQA 1PPWA 2YVOA 1HX3A 2J8QA 1V8UA 1MUTA 2GB5A 3X0JA 1V8RA 3J7Ye 3RH7A 1V8IA 2YYHA 1F3YA 1HZTA 3GZ6A 1NQZA 2VNPA 1KTGA 1VIUA 3AC9A 3X0LA 3OGAA 2PQVA 4J7GA 3MDGA 3BAPA 2O5WA 5ISYA 1SU2A 4KTBA 1V8SA 4IJXA 1RRQA 5FSNA 1GA7A 1I9AA 1MQEA 2FKBA 1VC9A 1NFSA 1VHZA 1JKNA 3Q93A 3WHWA 3X0MA 5GHQA 1NFZA 3GG6A 5C8LA 5FSMA 5ANUA 1Q33A 2RRKA 4S2YA 1K2EA 5C7QA 2A8QA 4ZG0A 3Q4IA 2QKMB 3A6VA 5HZXA 5ANVA 4JZUA 5LPGA 3SONA 2PNYA 3O8SA 5I8UA 4KG3A 2DSCA 1MP2A 3ID9A 4JZTA 5GHPA 2QJOA 4HFQA 4V14A 5IW5A 1KT9A 3G0QA 1XSBA 2DSBA 4JZVA 2A8SA 3F13A 1X51A 3L85A 2G74A 3FSPA 1OW2A 2GT2A 3GZ8A 3Q2SA 1XSCA 2FVVA 3I9XA 2YVPA 1VK6A 2A8PA 2KDVA 4MPOA 1VC8A 3H95A 1IRYA 2YVMA 1NQYA 2ICJA 1VRLA 3U53A 3COUA 4N1TA 3X0RA 3MDIA 1SOIA 2I6KA 1JRKA 5BS6A 1MK1A 4S2XA 1X83A 5GHNA 3FFUA 3EEUA 3X0PA 3N9UA 5ANWA 3X0OA 5C7TA 5FSIA 2XSQA 4NFXA 3SMDA 3GRNA 3ACAA 3DUPA 3E57A 1V8MA 1MR2A 1VCDA 2JVBA 1QVJA 3FK9A 3MGMA 1R67A 1V8YA 2FMLA 4NFWA 3X0SA 4ICKA 3ZR1A 1SJYA 1Q54A 3X0NA 4YOQA 3A6UA 3FCMA 3BHOA 4KYXA 3ZR0A 2DUKA 3GZ5A 3FJYA 3EESA 3A6TA 3EXQA 2YVNA 5ANTA 5GHIA 1V8VA 3EF5A 2G73A
chains in the Genus database with same CATH topology
3N77A 5DDGA 1RRSA 3O6ZA 2O1CA 5GHMA 3O61A 2VNQA 3HYQA 5GHJA 4N1UA 2A8TA 4DYWA 1V8NA 2KDWA 2DSDA 3X0QA 3O69A 2DHOA 2I8UA 3HHJA 1RYAA 3X0IA 1PUSA 3SHDA 1X84A 3KVHA 5GHOA 3O52A 5DEQA 3A6SA 4C9XA 2Q9PA 5FSLA 3Q1PA 1PPVA 1K26A 3MCFA 1SZ3A 1PPXA 5FSKA 5CFIA 2A8RA 4S2VA 2B0VA 3P5TA 1U20A 1XSAA 1PUNA 1G9QA 2B2KA 1V8TA 2QJTA 3Q91A 1VHGA 3GWYA 5FSOA 4J7HA 2CL3A 1VIQA 1TUMA 2GT4A 5IW4A 2W4EA 3DKUA 3F6AA 3Q2TA 2I8TA 3BM4A 5CFJA 4S2WA 5DD4A 4YPHA 4KG4A 1G0SA 4JZSA 4C9WA 4YPRA 3I7VA 1PUQA 3P6YA 5BONA 1Q27A 1V8WA 3I7UA 2CZRA 3R03A 3QSJA 3X0KA 2A6TA 5DPKA 2B06A 2R5WA 4HVYA 1PVFA 2ICKA 1MQWA 2AZWA 2O5FA 1KHZA 3CNGA 5ANSA 1V8LA 4K6EA 4ILQA 1PPWA 2YVOA 1HX3A 2J8QA 1V8UA 1MUTA 2GB5A 3X0JA 1V8RA 3J7Ye 3RH7A 1V8IA 2YYHA 1F3YA 1HZTA 3GZ6A 1NQZA 2VNPA 1KTGA 1VIUA 3AC9A 3X0LA 3OGAA 2PQVA 4J7GA 3MDGA 3BAPA 2O5WA 5ISYA 1SU2A 4KTBA 1V8SA 4IJXA 1RRQA 5FSNA 1GA7A 1I9AA 1MQEA 2FKBA 1VC9A 1NFSA 1VHZA 1JKNA 3Q93A 3WHWA 3X0MA 5GHQA 1NFZA 3GG6A 5C8LA 5FSMA 5ANUA 1Q33A 2RRKA 4S2YA 1K2EA 5C7QA 2A8QA 4ZG0A 3Q4IA 2QKMB 3A6VA 5HZXA 5ANVA 4JZUA 5LPGA 3SONA 2PNYA 3O8SA 5I8UA 4KG3A 2DSCA 1MP2A 3ID9A 4JZTA 5GHPA 2QJOA 4HFQA 4V14A 5IW5A 1KT9A 3G0QA 1XSBA 2DSBA 4JZVA 2A8SA 3F13A 1X51A 3L85A 2G74A 3FSPA 1OW2A 2GT2A 3GZ8A 3Q2SA 1XSCA 2FVVA 3I9XA 2YVPA 1VK6A 2A8PA 2KDVA 4MPOA 1VC8A 3H95A 1IRYA 2YVMA 1NQYA 2ICJA 1VRLA 3U53A 3COUA 4N1TA 3X0RA 3MDIA 1SOIA 2I6KA 1JRKA 5BS6A 1MK1A 4S2XA 1X83A 5GHNA 3FFUA 3EEUA 3X0PA 3N9UA 5ANWA 3X0OA 5C7TA 5FSIA 2XSQA 4NFXA 3SMDA 3GRNA 3ACAA 3DUPA 3E57A 1V8MA 1MR2A 1VCDA 2JVBA 1QVJA 3FK9A 3MGMA 1R67A 1V8YA 2FMLA 4NFWA 3X0SA 4ICKA 3ZR1A 1SJYA 1Q54A 3X0NA 4YOQA 3A6UA 3FCMA 3BHOA 4KYXA 3ZR0A 2DUKA 3GZ5A 3FJYA 3EESA 3A6TA 3EXQA 2YVNA 5ANTA 5GHIA 1V8VA 3EF5A 2G73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N77 A;  5DDG A;  1RRS A;  3O6Z A;  2O1C A;  5GHM A;  3O61 A;  2VNQ A;  3HYQ A;  5GHJ A;  4N1U A;  2A8T A;  4DYW A;  1V8N A;  2KDW A;  2DSD A;  3X0Q A;  3O69 A;  2DHO A;  2I8U A;  3HHJ A;  1RYA A;  3X0I A;  1PUS A;  3SHD A;  1X84 A;  3KVH A;  5GHO A;  3O52 A;  5DEQ A;  3A6S A;  4C9X A;  2Q9P A;  5FSL A;  3Q1P A;  1PPV A;  1K26 A;  3MCF A;  1SZ3 A;  1PPX A;  5FSK A;  5CFI A;  2A8R A;  4S2V A;  2B0V A;  3P5T A;  1U20 A;  1XSA A;  1PUN A;  1G9Q A;  2B2K A;  1V8T A;  2QJT A;  3Q91 A;  1VHG A;  3GWY A;  5FSO A;  2CL3 A;  1VIQ A;  1TUM A;  2GT4 A;  5IW4 A;  2W4E A;  3DKU A;  3F6A A;  3Q2T A;  2I8T A;  3BM4 A;  5CFJ A;  4S2W A;  5DD4 A;  4YPH A;  4KG4 A;  1G0S A;  4JZS A;  4C9W A;  4YPR A;  3I7V A;  1PUQ A;  3P6Y A;  5BON A;  1Q27 A;  1V8W A;  3I7U A;  3R03 A;  3QSJ A;  3X0K A;  2A6T A;  5DPK A;  2B06 A;  2R5W A;  4HVY A;  1PVF A;  2ICK A;  1MQW A;  2AZW A;  2O5F A;  1KHZ A;  3CNG A;  5ANS A;  1V8L A;  4K6E A;  4ILQ A;  1PPW A;  2YVO A;  1HX3 A;  2J8Q A;  1V8U A;  1MUT A;  2GB5 A;  3X0J A;  1V8R A;  3J7Y e;  3RH7 A;  1V8I A;  2YYH A;  1F3Y A;  1HZT A;  3GZ6 A;  1NQZ A;  2VNP A;  1KTG A;  1VIU A;  3AC9 A;  3X0L A;  3OGA A;  2PQV A;  3MDG A;  3BAP A;  2O5W A;  5ISY A;  1SU2 A;  4KTB A;  1V8S A;  4IJX A;  1RRQ A;  5FSN A;  1GA7 A;  1I9A A;  1MQE A;  2FKB A;  1VC9 A;  1NFS A;  1VHZ A;  1JKN A;  3Q93 A;  3WHW A;  3X0M A;  5GHQ A;  1NFZ A;  3GG6 A;  5C8L A;  5FSM A;  5ANU A;  1Q33 A;  2RRK A;  4S2Y A;  1K2E A;  5C7Q A;  2A8Q A;  4ZG0 A;  3Q4I A;  2QKM B;  3A6V A;  5HZX A;  5ANV A;  4JZU A;  5LPG A;  3SON A;  2PNY A;  3O8S A;  5I8U A;  4KG3 A;  2DSC A;  1MP2 A;  3ID9 A;  4JZT A;  5GHP A;  2QJO A;  4HFQ A;  4V14 A;  5IW5 A;  1KT9 A;  3G0Q A;  1XSB A;  2DSB A;  4JZV A;  2A8S A;  3F13 A;  1X51 A;  3L85 A;  2G74 A;  3FSP A;  1OW2 A;  2GT2 A;  3GZ8 A;  3Q2S A;  1XSC A;  2FVV A;  3I9X A;  2YVP A;  1VK6 A;  2A8P A;  2KDV A;  4MPO A;  1VC8 A;  3H95 A;  1IRY A;  2YVM A;  1NQY A;  2ICJ A;  1VRL A;  3U53 A;  3COU A;  4N1T A;  3X0R A;  3MDI A;  1SOI A;  2I6K A;  1JRK A;  5BS6 A;  1MK1 A;  4S2X A;  1X83 A;  5GHN A;  3FFU A;  3EEU A;  3X0P A;  3N9U A;  5ANW A;  3X0O A;  5C7T A;  5FSI A;  2XSQ A;  4NFX A;  3SMD A;  3GRN A;  3ACA A;  3DUP A;  3E57 A;  1V8M A;  1MR2 A;  1VCD A;  2JVB A;  1QVJ A;  3FK9 A;  3MGM A;  1R67 A;  1V8Y A;  2FML A;  4NFW A;  3X0S A;  4ICK A;  3ZR1 A;  1SJY A;  1Q54 A;  3X0N A;  4YOQ A;  3A6U A;  3FCM A;  3BHO A;  4KYX A;  3ZR0 A;  2DUK A;  3GZ5 A;  3FJY A;  3EES A;  3A6T A;  3EXQ A;  2YVN A;  5ANT A;  5GHI A;  1V8V A;  3EF5 A;  2G73 A; 
#chains in the Genus database with same CATH topology
 3N77 A;  5DDG A;  1RRS A;  3O6Z A;  2O1C A;  5GHM A;  3O61 A;  2VNQ A;  3HYQ A;  5GHJ A;  4N1U A;  2A8T A;  4DYW A;  1V8N A;  2KDW A;  2DSD A;  3X0Q A;  3O69 A;  2DHO A;  2I8U A;  3HHJ A;  1RYA A;  3X0I A;  1PUS A;  3SHD A;  1X84 A;  3KVH A;  5GHO A;  3O52 A;  5DEQ A;  3A6S A;  4C9X A;  2Q9P A;  5FSL A;  3Q1P A;  1PPV A;  1K26 A;  3MCF A;  1SZ3 A;  1PPX A;  5FSK A;  5CFI A;  2A8R A;  4S2V A;  2B0V A;  3P5T A;  1U20 A;  1XSA A;  1PUN A;  1G9Q A;  2B2K A;  1V8T A;  2QJT A;  3Q91 A;  1VHG A;  3GWY A;  5FSO A;  4J7H A;  2CL3 A;  1VIQ A;  1TUM A;  2GT4 A;  5IW4 A;  2W4E A;  3DKU A;  3F6A A;  3Q2T A;  2I8T A;  3BM4 A;  5CFJ A;  4S2W A;  5DD4 A;  4YPH A;  4KG4 A;  1G0S A;  4JZS A;  4C9W A;  4YPR A;  3I7V A;  1PUQ A;  3P6Y A;  5BON A;  1Q27 A;  1V8W A;  3I7U A;  2CZR A;  3R03 A;  3QSJ A;  3X0K A;  2A6T A;  5DPK A;  2B06 A;  2R5W A;  4HVY A;  1PVF A;  2ICK A;  1MQW A;  2AZW A;  2O5F A;  1KHZ A;  3CNG A;  5ANS A;  1V8L A;  4K6E A;  4ILQ A;  1PPW A;  2YVO A;  1HX3 A;  2J8Q A;  1V8U A;  1MUT A;  2GB5 A;  3X0J A;  1V8R A;  3J7Y e;  3RH7 A;  1V8I A;  2YYH A;  1F3Y A;  1HZT A;  3GZ6 A;  1NQZ A;  2VNP A;  1KTG A;  1VIU A;  3AC9 A;  3X0L A;  3OGA A;  2PQV A;  4J7G A;  3MDG A;  3BAP A;  2O5W A;  5ISY A;  1SU2 A;  4KTB A;  1V8S A;  4IJX A;  1RRQ A;  5FSN A;  1GA7 A;  1I9A A;  1MQE A;  2FKB A;  1VC9 A;  1NFS A;  1VHZ A;  1JKN A;  3Q93 A;  3WHW A;  3X0M A;  5GHQ A;  1NFZ A;  3GG6 A;  5C8L A;  5FSM A;  5ANU A;  1Q33 A;  2RRK A;  4S2Y A;  1K2E A;  5C7Q A;  2A8Q A;  4ZG0 A;  3Q4I A;  2QKM B;  3A6V A;  5HZX A;  5ANV A;  4JZU A;  5LPG A;  3SON A;  2PNY A;  3O8S A;  5I8U A;  4KG3 A;  2DSC A;  1MP2 A;  3ID9 A;  4JZT A;  5GHP A;  2QJO A;  4HFQ A;  4V14 A;  5IW5 A;  1KT9 A;  3G0Q A;  1XSB A;  2DSB A;  4JZV A;  2A8S A;  3F13 A;  1X51 A;  3L85 A;  2G74 A;  3FSP A;  1OW2 A;  2GT2 A;  3GZ8 A;  3Q2S A;  1XSC A;  2FVV A;  3I9X A;  2YVP A;  1VK6 A;  2A8P A;  2KDV A;  4MPO A;  1VC8 A;  3H95 A;  1IRY A;  2YVM A;  1NQY A;  2ICJ A;  1VRL A;  3U53 A;  3COU A;  4N1T A;  3X0R A;  3MDI A;  1SOI A;  2I6K A;  1JRK A;  5BS6 A;  1MK1 A;  4S2X A;  1X83 A;  5GHN A;  3FFU A;  3EEU A;  3X0P A;  3N9U A;  5ANW A;  3X0O A;  5C7T A;  5FSI A;  2XSQ A;  4NFX A;  3SMD A;  3GRN A;  3ACA A;  3DUP A;  3E57 A;  1V8M A;  1MR2 A;  1VCD A;  2JVB A;  1QVJ A;  3FK9 A;  3MGM A;  1R67 A;  1V8Y A;  2FML A;  4NFW A;  3X0S A;  4ICK A;  3ZR1 A;  1SJY A;  1Q54 A;  3X0N A;  4YOQ A;  3A6U A;  3FCM A;  3BHO A;  4KYX A;  3ZR0 A;  2DUK A;  3GZ5 A;  3FJY A;  3EES A;  3A6T A;  3EXQ A;  2YVN A;  5ANT A;  5GHI A;  1V8V A;  3EF5 A;  2G73 A; 
#chains in the Genus database with same CATH homology
 3N77 A;  5DDG A;  1RRS A;  3O6Z A;  2O1C A;  5GHM A;  3O61 A;  2VNQ A;  3HYQ A;  5GHJ A;  4N1U A;  2A8T A;  4DYW A;  1V8N A;  2KDW A;  2DSD A;  3X0Q A;  3O69 A;  2DHO A;  2I8U A;  3HHJ A;  1RYA A;  3X0I A;  1PUS A;  3SHD A;  1X84 A;  3KVH A;  5GHO A;  3O52 A;  5DEQ A;  3A6S A;  4C9X A;  2Q9P A;  5FSL A;  3Q1P A;  1PPV A;  1K26 A;  3MCF A;  1SZ3 A;  1PPX A;  5FSK A;  5CFI A;  2A8R A;  4S2V A;  2B0V A;  3P5T A;  1U20 A;  1XSA A;  1PUN A;  1G9Q A;  2B2K A;  1V8T A;  2QJT A;  3Q91 A;  1VHG A;  3GWY A;  5FSO A;  4J7H A;  2CL3 A;  1VIQ A;  1TUM A;  2GT4 A;  5IW4 A;  2W4E A;  3DKU A;  3F6A A;  3Q2T A;  2I8T A;  3BM4 A;  5CFJ A;  4S2W A;  5DD4 A;  4YPH A;  4KG4 A;  1G0S A;  4JZS A;  4C9W A;  4YPR A;  3I7V A;  1PUQ A;  3P6Y A;  5BON A;  1Q27 A;  1V8W A;  3I7U A;  2CZR A;  3R03 A;  3QSJ A;  3X0K A;  2A6T A;  5DPK A;  2B06 A;  2R5W A;  4HVY A;  1PVF A;  2ICK A;  1MQW A;  2AZW A;  2O5F A;  1KHZ A;  3CNG A;  5ANS A;  1V8L A;  4K6E A;  4ILQ A;  1PPW A;  2YVO A;  1HX3 A;  2J8Q A;  1V8U A;  1MUT A;  2GB5 A;  3X0J A;  1V8R A;  3J7Y e;  3RH7 A;  1V8I A;  2YYH A;  1F3Y A;  1HZT A;  3GZ6 A;  1NQZ A;  2VNP A;  1KTG A;  1VIU A;  3AC9 A;  3X0L A;  3OGA A;  2PQV A;  4J7G A;  3MDG A;  3BAP A;  2O5W A;  5ISY A;  1SU2 A;  4KTB A;  1V8S A;  4IJX A;  1RRQ A;  5FSN A;  1GA7 A;  1I9A A;  1MQE A;  2FKB A;  1VC9 A;  1NFS A;  1VHZ A;  1JKN A;  3Q93 A;  3WHW A;  3X0M A;  5GHQ A;  1NFZ A;  3GG6 A;  5C8L A;  5FSM A;  5ANU A;  1Q33 A;  2RRK A;  4S2Y A;  1K2E A;  5C7Q A;  2A8Q A;  4ZG0 A;  3Q4I A;  2QKM B;  3A6V A;  5HZX A;  5ANV A;  4JZU A;  5LPG A;  3SON A;  2PNY A;  3O8S A;  5I8U A;  4KG3 A;  2DSC A;  1MP2 A;  3ID9 A;  4JZT A;  5GHP A;  2QJO A;  4HFQ A;  4V14 A;  5IW5 A;  1KT9 A;  3G0Q A;  1XSB A;  2DSB A;  4JZV A;  2A8S A;  3F13 A;  1X51 A;  3L85 A;  2G74 A;  3FSP A;  1OW2 A;  2GT2 A;  3GZ8 A;  3Q2S A;  1XSC A;  2FVV A;  3I9X A;  2YVP A;  1VK6 A;  2A8P A;  2KDV A;  4MPO A;  1VC8 A;  3H95 A;  1IRY A;  2YVM A;  1NQY A;  2ICJ A;  1VRL A;  3U53 A;  3COU A;  4N1T A;  3X0R A;  3MDI A;  1SOI A;  2I6K A;  1JRK A;  5BS6 A;  1MK1 A;  4S2X A;  1X83 A;  5GHN A;  3FFU A;  3EEU A;  3X0P A;  3N9U A;  5ANW A;  3X0O A;  5C7T A;  5FSI A;  2XSQ A;  4NFX A;  3SMD A;  3GRN A;  3ACA A;  3DUP A;  3E57 A;  1V8M A;  1MR2 A;  1VCD A;  2JVB A;  1QVJ A;  3FK9 A;  3MGM A;  1R67 A;  1V8Y A;  2FML A;  4NFW A;  3X0S A;  4ICK A;  3ZR1 A;  1SJY A;  1Q54 A;  3X0N A;  4YOQ A;  3A6U A;  3FCM A;  3BHO A;  4KYX A;  3ZR0 A;  2DUK A;  3GZ5 A;  3FJY A;  3EES A;  3A6T A;  3EXQ A;  2YVN A;  5ANT A;  5GHI A;  1V8V A;  3EF5 A;  2G73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...