2DSDA

Crystal structure of human adp-ribose pyrophosphatase nudt5 in complex with magnesium and amp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
195
structure length
195
Chain Sequence
b'KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-sugar pyrophosphatase
publication title Crystal Structures of Human NUDT5 Reveal Insights into the Structural Basis of the Substrate Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.7.96: ADP-D-ribose pyrophosphorylase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2dsdA00
1Q54A 2DSBA 1G9QA 2W4EA 5FSOA 1V8LA 1VK6A 4IJXA 1K26A 2XSQA 3Q4IA 5GHMA 2VNPA 5IW5A 3X0MA 3GZ5A 3QSJA 5FSKA 3EESA 1VC9A 2FKBA 5DPKA 2A8PA 2Q9PA 3A6VA 2DSDA 3BM4A 5FSLA 2O5FA 1PUNA 1X51A 4KYXA 5DDGA 1PPWA 3O69A 5BONA 2PNYA 1X84A 3EEUA 3R03A 5IW4A 5ANUA 3G0QA 3Q2SA 1GA7A 1KT9A 3X0KA 5CFJA 4YPHA 1V8TA 4KG3A 1V8SA 3MCFA 1V8IA 5DD4A 3Q91A 2A8RA 1MQEA 5I8UA 1G0SA 2JVBA 1MUTA 2RRKA 1R67A 1VHZA 3O52A 4S2VA 3ZR1A 1V8RA 1V8NA 3ACAA 3FJYA 2B2KA 3GRNA 3HYQA 2GT2A 4MPOA 3X0OA 3O61A 4HVYA 4N1UA 3WHWA 3X0QA 4S2XA 5C8LA 1VHGA 3EXQA 3SONA 1XSAA 2KDVA 3CNGA 3I7UA 2DHOA 3MGMA 3FCMA 1PPVA 5GHNA 3OGAA 2YVOA 4K6EA 4KG4A 2GB5A 2B0VA 1U20A 2A6TA 5DEQA 1RRSA 4JZSA 5ISYA 3MDGA 2A8TA 1JKNA 2A8QA 1VIUA 1Q27A 3EF5A 3H95A 1Q33A 3X0SA 3X0IA 2I6KA 2R5WA 3ZR0A 5ANSA 2DUKA 1V8MA 5FSIA 2QKMB 3X0PA 5C7QA 2O5WA 3X0NA 1SJYA 1XSBA 5ANTA 1XSCA 1PUQA 1K2EA 2J8QA 2FMLA 2G73A 4S2WA 5ANWA 3X0LA 3F6AA 3E57A 1RYAA 3Q1PA 3COUA 1HZTA 1MQWA 4ZG0A 3J7Ye 3P6YA 2YVNA 2DSCA 4C9XA 1OW2A 4YOQA 3Q93A 2ICKA 4S2YA 1MP2A 2ICJA 1RRQA 1SZ3A 2GT4A 2I8TA 1TUMA 2YVPA 4NFWA 3SHDA 5C7TA 1SU2A 2B06A 1VC8A 5LPGA 1VIQA 2PQVA 5GHIA 4ILQA 1SOIA 1I9AA 3I9XA 1HX3A 2A8SA 1NQZA 1JRKA 1MK1A 2QJOA 3X0JA 5CFIA 5BS6A 1NQYA 2YVMA 1PVFA 2QJTA 4JZVA 4V14A 3N77A 3Q2TA 4JZTA 3FSPA 3N9UA 3RH7A 5GHJA 1QVJA 2CL3A 3KVHA 4HFQA 4YPRA 2FVVA 2VNQA 3A6SA 3ID9A 5FSMA 5GHQA 3A6UA 3O8SA 1NFZA 4JZUA 1V8UA 1V8VA 2G74A 3BHOA 4DYWA 4C9WA 3U53A 3FFUA 5ANVA 1IRYA 1V8WA 3F13A 3GZ8A 3P5TA 3GG6A 3HHJA 4KTBA 3SMDA 5HZXA 3MDIA 2KDWA 1PPXA 1PUSA 1VCDA 3GWYA 5FSNA 3AC9A 3L85A 4N1TA 2AZWA 3FK9A 1NFSA 4ICKA 2O1CA 3GZ6A 5GHPA 3DKUA 3X0RA 4NFXA 5GHOA 1KHZA 3BAPA 3A6TA 2I8UA 1MR2A 3DUPA 1F3YA 3O6ZA 1VRLA 2YYHA 1X83A 3I7VA 1KTGA 1V8YA
chains in the Genus database with same CATH superfamily
1Q54A 2DSBA 1G9QA 2W4EA 5FSOA 1V8LA 1VK6A 4IJXA 1K26A 2XSQA 3Q4IA 4J7GA 2VNPA 5GHMA 3X0MA 3GZ5A 3QSJA 5FSKA 5IW5A 3EESA 1VC9A 2FKBA 5DPKA 2A8PA 2Q9PA 3A6VA 2DSDA 3BM4A 5FSLA 2O5FA 1PUNA 1X51A 4KYXA 5DDGA 1PPWA 3O69A 5BONA 2PNYA 1X84A 3EEUA 3R03A 5IW4A 5ANUA 3G0QA 3Q2SA 1GA7A 1KT9A 3X0KA 5CFJA 4YPHA 1V8TA 4KG3A 1V8SA 3MCFA 1V8IA 5DD4A 3Q91A 2A8RA 1MQEA 5I8UA 1G0SA 2JVBA 1MUTA 2RRKA 1R67A 1VHZA 3O52A 4J7HA 4S2VA 1V8RA 1V8NA 3ACAA 3ZR1A 3FJYA 2B2KA 3GRNA 3HYQA 2GT2A 4MPOA 3X0OA 3O61A 4HVYA 4N1UA 3WHWA 3X0QA 4S2XA 5C8LA 1VHGA 3EXQA 3SONA 1XSAA 2KDVA 3CNGA 3I7UA 2DHOA 3MGMA 3FCMA 1PPVA 5GHNA 3OGAA 2YVOA 4K6EA 4KG4A 2GB5A 2B0VA 1U20A 2A6TA 5DEQA 1RRSA 4JZSA 5ISYA 3MDGA 2A8TA 1JKNA 2A8QA 1VIUA 1Q27A 3EF5A 3H95A 1Q33A 3X0SA 3X0IA 2I6KA 2R5WA 3ZR0A 5ANSA 2DUKA 1V8MA 5FSIA 2QKMB 3X0PA 5C7QA 2O5WA 3X0NA 1SJYA 1XSBA 5ANTA 1XSCA 1PUQA 1K2EA 2J8QA 2FMLA 2G73A 4S2WA 5ANWA 3X0LA 3F6AA 3E57A 1RYAA 3Q1PA 3COUA 1HZTA 1MQWA 4ZG0A 3J7Ye 3P6YA 2YVNA 2DSCA 4C9XA 1OW2A 4YOQA 3Q93A 2ICKA 4S2YA 1MP2A 2ICJA 1RRQA 1SZ3A 2GT4A 2I8TA 1TUMA 2YVPA 4NFWA 3SHDA 5C7TA 1SU2A 2B06A 1VC8A 5LPGA 1VIQA 2PQVA 5GHIA 4ILQA 1SOIA 1I9AA 3I9XA 1HX3A 2A8SA 1NQZA 1JRKA 1MK1A 2QJOA 3X0JA 5CFIA 5BS6A 1NQYA 2YVMA 1PVFA 2QJTA 4JZVA 4V14A 3N77A 3Q2TA 4JZTA 3FSPA 3N9UA 3RH7A 5GHJA 1QVJA 2CL3A 3KVHA 4HFQA 4YPRA 2FVVA 2VNQA 3A6SA 3ID9A 5FSMA 5GHQA 3A6UA 3O8SA 1NFZA 4JZUA 1V8UA 1V8VA 2G74A 3BHOA 4DYWA 4C9WA 3U53A 3FFUA 5ANVA 1IRYA 1V8WA 3F13A 3GZ8A 3P5TA 3GG6A 3HHJA 4KTBA 3SMDA 5HZXA 3MDIA 2KDWA 1PPXA 1PUSA 1VCDA 3GWYA 5FSNA 3AC9A 3L85A 4N1TA 2AZWA 3FK9A 1NFSA 4ICKA 2O1CA 3GZ6A 5GHPA 3DKUA 3X0RA 4NFXA 5GHOA 1KHZA 3BAPA 3A6TA 2I8UA 1MR2A 3DUPA 1F3YA 3O6ZA 2CZRA 1VRLA 2YYHA 1X83A 3I7VA 1KTGA 1V8YA
chains in the Genus database with same CATH topology
1Q54A 2DSBA 1G9QA 2W4EA 5FSOA 1V8LA 1VK6A 4IJXA 1K26A 2XSQA 3Q4IA 4J7GA 2VNPA 5GHMA 3X0MA 3GZ5A 3QSJA 5FSKA 5IW5A 3EESA 1VC9A 2FKBA 5DPKA 2A8PA 2Q9PA 3A6VA 2DSDA 3BM4A 5FSLA 2O5FA 1PUNA 1X51A 4KYXA 5DDGA 1PPWA 3O69A 5BONA 2PNYA 1X84A 3EEUA 3R03A 5IW4A 5ANUA 3G0QA 3Q2SA 1GA7A 1KT9A 3X0KA 5CFJA 4YPHA 1V8TA 4KG3A 1V8SA 3MCFA 1V8IA 5DD4A 3Q91A 2A8RA 1MQEA 5I8UA 1G0SA 2JVBA 1MUTA 2RRKA 1R67A 1VHZA 3O52A 4J7HA 4S2VA 1V8RA 1V8NA 3ACAA 3ZR1A 3FJYA 2B2KA 3GRNA 3HYQA 2GT2A 4MPOA 3X0OA 3O61A 4HVYA 4N1UA 3WHWA 3X0QA 4S2XA 5C8LA 1VHGA 3EXQA 3SONA 1XSAA 2KDVA 3CNGA 3I7UA 2DHOA 3MGMA 3FCMA 1PPVA 5GHNA 3OGAA 2YVOA 4K6EA 4KG4A 2GB5A 2B0VA 1U20A 2A6TA 5DEQA 1RRSA 4JZSA 5ISYA 3MDGA 2A8TA 1JKNA 2A8QA 1VIUA 1Q27A 3EF5A 3H95A 1Q33A 3X0SA 3X0IA 2I6KA 2R5WA 3ZR0A 5ANSA 2DUKA 1V8MA 5FSIA 2QKMB 3X0PA 5C7QA 2O5WA 3X0NA 1SJYA 1XSBA 5ANTA 1XSCA 1PUQA 1K2EA 2J8QA 2FMLA 2G73A 4S2WA 5ANWA 3X0LA 3F6AA 3E57A 1RYAA 3Q1PA 3COUA 1HZTA 1MQWA 4ZG0A 3J7Ye 3P6YA 2YVNA 2DSCA 4C9XA 1OW2A 4YOQA 3Q93A 2ICKA 4S2YA 1MP2A 2ICJA 1RRQA 1SZ3A 2GT4A 2I8TA 1TUMA 2YVPA 4NFWA 3SHDA 5C7TA 1SU2A 2B06A 1VC8A 5LPGA 1VIQA 2PQVA 5GHIA 4ILQA 1SOIA 1I9AA 3I9XA 1HX3A 2A8SA 1NQZA 1JRKA 1MK1A 2QJOA 3X0JA 5CFIA 5BS6A 1NQYA 2YVMA 1PVFA 2QJTA 4JZVA 4V14A 3N77A 3Q2TA 4JZTA 3FSPA 3N9UA 3RH7A 5GHJA 1QVJA 2CL3A 3KVHA 4HFQA 4YPRA 2FVVA 2VNQA 3A6SA 3ID9A 5FSMA 5GHQA 3A6UA 3O8SA 1NFZA 4JZUA 1V8UA 1V8VA 2G74A 3BHOA 4DYWA 4C9WA 3U53A 3FFUA 5ANVA 1IRYA 1V8WA 3F13A 3GZ8A 3P5TA 3GG6A 3HHJA 4KTBA 3SMDA 5HZXA 3MDIA 2KDWA 1PPXA 1PUSA 1VCDA 3GWYA 5FSNA 3AC9A 3L85A 4N1TA 2AZWA 3FK9A 1NFSA 4ICKA 2O1CA 3GZ6A 5GHPA 3DKUA 3X0RA 4NFXA 5GHOA 1KHZA 3BAPA 3A6TA 2I8UA 1MR2A 3DUPA 1F3YA 3O6ZA 2CZRA 1VRLA 2YYHA 1X83A 3I7VA 1KTGA 1V8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q54 A;  2DSB A;  1G9Q A;  2W4E A;  5FSO A;  1V8L A;  1VK6 A;  4IJX A;  1K26 A;  2XSQ A;  3Q4I A;  5GHM A;  2VNP A;  5IW5 A;  3X0M A;  3GZ5 A;  3QSJ A;  5FSK A;  3EES A;  1VC9 A;  2FKB A;  5DPK A;  2A8P A;  2Q9P A;  3A6V A;  2DSD A;  3BM4 A;  5FSL A;  2O5F A;  1PUN A;  1X51 A;  4KYX A;  5DDG A;  1PPW A;  3O69 A;  5BON A;  2PNY A;  1X84 A;  3EEU A;  3R03 A;  5IW4 A;  5ANU A;  3G0Q A;  3Q2S A;  1GA7 A;  1KT9 A;  3X0K A;  5CFJ A;  4YPH A;  1V8T A;  4KG3 A;  1V8S A;  3MCF A;  1V8I A;  5DD4 A;  3Q91 A;  2A8R A;  1MQE A;  5I8U A;  1G0S A;  2JVB A;  1MUT A;  2RRK A;  1R67 A;  1VHZ A;  3O52 A;  4S2V A;  3ZR1 A;  1V8R A;  1V8N A;  3ACA A;  3FJY A;  2B2K A;  3GRN A;  3HYQ A;  2GT2 A;  4MPO A;  3X0O A;  3O61 A;  4HVY A;  4N1U A;  3WHW A;  3X0Q A;  4S2X A;  5C8L A;  1VHG A;  3EXQ A;  3SON A;  1XSA A;  2KDV A;  3CNG A;  3I7U A;  2DHO A;  3MGM A;  3FCM A;  1PPV A;  5GHN A;  3OGA A;  2YVO A;  4K6E A;  4KG4 A;  2GB5 A;  2B0V A;  1U20 A;  2A6T A;  5DEQ A;  1RRS A;  4JZS A;  5ISY A;  3MDG A;  2A8T A;  1JKN A;  2A8Q A;  1VIU A;  1Q27 A;  3EF5 A;  3H95 A;  1Q33 A;  3X0S A;  3X0I A;  2I6K A;  2R5W A;  3ZR0 A;  5ANS A;  2DUK A;  1V8M A;  5FSI A;  2QKM B;  3X0P A;  5C7Q A;  2O5W A;  3X0N A;  1SJY A;  1XSB A;  5ANT A;  1XSC A;  1PUQ A;  1K2E A;  2J8Q A;  2FML A;  2G73 A;  4S2W A;  5ANW A;  3X0L A;  3F6A A;  3E57 A;  1RYA A;  3Q1P A;  3COU A;  1HZT A;  1MQW A;  4ZG0 A;  3J7Y e;  3P6Y A;  2YVN A;  2DSC A;  4C9X A;  1OW2 A;  4YOQ A;  3Q93 A;  2ICK A;  4S2Y A;  1MP2 A;  2ICJ A;  1RRQ A;  1SZ3 A;  2GT4 A;  2I8T A;  1TUM A;  2YVP A;  4NFW A;  3SHD A;  5C7T A;  1SU2 A;  2B06 A;  1VC8 A;  5LPG A;  1VIQ A;  2PQV A;  5GHI A;  4ILQ A;  1SOI A;  1I9A A;  3I9X A;  1HX3 A;  2A8S A;  1NQZ A;  1JRK A;  1MK1 A;  2QJO A;  3X0J A;  5CFI A;  5BS6 A;  1NQY A;  2YVM A;  1PVF A;  2QJT A;  4JZV A;  4V14 A;  3N77 A;  3Q2T A;  4JZT A;  3FSP A;  3N9U A;  3RH7 A;  5GHJ A;  1QVJ A;  2CL3 A;  3KVH A;  4HFQ A;  4YPR A;  2FVV A;  2VNQ A;  3A6S A;  3ID9 A;  5FSM A;  5GHQ A;  3A6U A;  3O8S A;  1NFZ A;  4JZU A;  1V8U A;  1V8V A;  2G74 A;  3BHO A;  4DYW A;  4C9W A;  3U53 A;  3FFU A;  5ANV A;  1IRY A;  1V8W A;  3F13 A;  3GZ8 A;  3P5T A;  3GG6 A;  3HHJ A;  4KTB A;  3SMD A;  5HZX A;  3MDI A;  2KDW A;  1PPX A;  1PUS A;  1VCD A;  3GWY A;  5FSN A;  3AC9 A;  3L85 A;  4N1T A;  2AZW A;  3FK9 A;  1NFS A;  4ICK A;  2O1C A;  3GZ6 A;  5GHP A;  3DKU A;  3X0R A;  4NFX A;  5GHO A;  1KHZ A;  3BAP A;  3A6T A;  2I8U A;  1MR2 A;  3DUP A;  1F3Y A;  3O6Z A;  1VRL A;  2YYH A;  1X83 A;  3I7V A;  1KTG A;  1V8Y A; 
#chains in the Genus database with same CATH topology
 1Q54 A;  2DSB A;  1G9Q A;  2W4E A;  5FSO A;  1V8L A;  1VK6 A;  4IJX A;  1K26 A;  2XSQ A;  3Q4I A;  4J7G A;  2VNP A;  5GHM A;  3X0M A;  3GZ5 A;  3QSJ A;  5FSK A;  5IW5 A;  3EES A;  1VC9 A;  2FKB A;  5DPK A;  2A8P A;  2Q9P A;  3A6V A;  2DSD A;  3BM4 A;  5FSL A;  2O5F A;  1PUN A;  1X51 A;  4KYX A;  5DDG A;  1PPW A;  3O69 A;  5BON A;  2PNY A;  1X84 A;  3EEU A;  3R03 A;  5IW4 A;  5ANU A;  3G0Q A;  3Q2S A;  1GA7 A;  1KT9 A;  3X0K A;  5CFJ A;  4YPH A;  1V8T A;  4KG3 A;  1V8S A;  3MCF A;  1V8I A;  5DD4 A;  3Q91 A;  2A8R A;  1MQE A;  5I8U A;  1G0S A;  2JVB A;  1MUT A;  2RRK A;  1R67 A;  1VHZ A;  3O52 A;  4J7H A;  4S2V A;  1V8R A;  1V8N A;  3ACA A;  3ZR1 A;  3FJY A;  2B2K A;  3GRN A;  3HYQ A;  2GT2 A;  4MPO A;  3X0O A;  3O61 A;  4HVY A;  4N1U A;  3WHW A;  3X0Q A;  4S2X A;  5C8L A;  1VHG A;  3EXQ A;  3SON A;  1XSA A;  2KDV A;  3CNG A;  3I7U A;  2DHO A;  3MGM A;  3FCM A;  1PPV A;  5GHN A;  3OGA A;  2YVO A;  4K6E A;  4KG4 A;  2GB5 A;  2B0V A;  1U20 A;  2A6T A;  5DEQ A;  1RRS A;  4JZS A;  5ISY A;  3MDG A;  2A8T A;  1JKN A;  2A8Q A;  1VIU A;  1Q27 A;  3EF5 A;  3H95 A;  1Q33 A;  3X0S A;  3X0I A;  2I6K A;  2R5W A;  3ZR0 A;  5ANS A;  2DUK A;  1V8M A;  5FSI A;  2QKM B;  3X0P A;  5C7Q A;  2O5W A;  3X0N A;  1SJY A;  1XSB A;  5ANT A;  1XSC A;  1PUQ A;  1K2E A;  2J8Q A;  2FML A;  2G73 A;  4S2W A;  5ANW A;  3X0L A;  3F6A A;  3E57 A;  1RYA A;  3Q1P A;  3COU A;  1HZT A;  1MQW A;  4ZG0 A;  3J7Y e;  3P6Y A;  2YVN A;  2DSC A;  4C9X A;  1OW2 A;  4YOQ A;  3Q93 A;  2ICK A;  4S2Y A;  1MP2 A;  2ICJ A;  1RRQ A;  1SZ3 A;  2GT4 A;  2I8T A;  1TUM A;  2YVP A;  4NFW A;  3SHD A;  5C7T A;  1SU2 A;  2B06 A;  1VC8 A;  5LPG A;  1VIQ A;  2PQV A;  5GHI A;  4ILQ A;  1SOI A;  1I9A A;  3I9X A;  1HX3 A;  2A8S A;  1NQZ A;  1JRK A;  1MK1 A;  2QJO A;  3X0J A;  5CFI A;  5BS6 A;  1NQY A;  2YVM A;  1PVF A;  2QJT A;  4JZV A;  4V14 A;  3N77 A;  3Q2T A;  4JZT A;  3FSP A;  3N9U A;  3RH7 A;  5GHJ A;  1QVJ A;  2CL3 A;  3KVH A;  4HFQ A;  4YPR A;  2FVV A;  2VNQ A;  3A6S A;  3ID9 A;  5FSM A;  5GHQ A;  3A6U A;  3O8S A;  1NFZ A;  4JZU A;  1V8U A;  1V8V A;  2G74 A;  3BHO A;  4DYW A;  4C9W A;  3U53 A;  3FFU A;  5ANV A;  1IRY A;  1V8W A;  3F13 A;  3GZ8 A;  3P5T A;  3GG6 A;  3HHJ A;  4KTB A;  3SMD A;  5HZX A;  3MDI A;  2KDW A;  1PPX A;  1PUS A;  1VCD A;  3GWY A;  5FSN A;  3AC9 A;  3L85 A;  4N1T A;  2AZW A;  3FK9 A;  1NFS A;  4ICK A;  2O1C A;  3GZ6 A;  5GHP A;  3DKU A;  3X0R A;  4NFX A;  5GHO A;  1KHZ A;  3BAP A;  3A6T A;  2I8U A;  1MR2 A;  3DUP A;  1F3Y A;  3O6Z A;  2CZR A;  1VRL A;  2YYH A;  1X83 A;  3I7V A;  1KTG A;  1V8Y A; 
#chains in the Genus database with same CATH homology
 1Q54 A;  2DSB A;  1G9Q A;  2W4E A;  5FSO A;  1V8L A;  1VK6 A;  4IJX A;  1K26 A;  2XSQ A;  3Q4I A;  4J7G A;  2VNP A;  5GHM A;  3X0M A;  3GZ5 A;  3QSJ A;  5FSK A;  5IW5 A;  3EES A;  1VC9 A;  2FKB A;  5DPK A;  2A8P A;  2Q9P A;  3A6V A;  2DSD A;  3BM4 A;  5FSL A;  2O5F A;  1PUN A;  1X51 A;  4KYX A;  5DDG A;  1PPW A;  3O69 A;  5BON A;  2PNY A;  1X84 A;  3EEU A;  3R03 A;  5IW4 A;  5ANU A;  3G0Q A;  3Q2S A;  1GA7 A;  1KT9 A;  3X0K A;  5CFJ A;  4YPH A;  1V8T A;  4KG3 A;  1V8S A;  3MCF A;  1V8I A;  5DD4 A;  3Q91 A;  2A8R A;  1MQE A;  5I8U A;  1G0S A;  2JVB A;  1MUT A;  2RRK A;  1R67 A;  1VHZ A;  3O52 A;  4J7H A;  4S2V A;  1V8R A;  1V8N A;  3ACA A;  3ZR1 A;  3FJY A;  2B2K A;  3GRN A;  3HYQ A;  2GT2 A;  4MPO A;  3X0O A;  3O61 A;  4HVY A;  4N1U A;  3WHW A;  3X0Q A;  4S2X A;  5C8L A;  1VHG A;  3EXQ A;  3SON A;  1XSA A;  2KDV A;  3CNG A;  3I7U A;  2DHO A;  3MGM A;  3FCM A;  1PPV A;  5GHN A;  3OGA A;  2YVO A;  4K6E A;  4KG4 A;  2GB5 A;  2B0V A;  1U20 A;  2A6T A;  5DEQ A;  1RRS A;  4JZS A;  5ISY A;  3MDG A;  2A8T A;  1JKN A;  2A8Q A;  1VIU A;  1Q27 A;  3EF5 A;  3H95 A;  1Q33 A;  3X0S A;  3X0I A;  2I6K A;  2R5W A;  3ZR0 A;  5ANS A;  2DUK A;  1V8M A;  5FSI A;  2QKM B;  3X0P A;  5C7Q A;  2O5W A;  3X0N A;  1SJY A;  1XSB A;  5ANT A;  1XSC A;  1PUQ A;  1K2E A;  2J8Q A;  2FML A;  2G73 A;  4S2W A;  5ANW A;  3X0L A;  3F6A A;  3E57 A;  1RYA A;  3Q1P A;  3COU A;  1HZT A;  1MQW A;  4ZG0 A;  3J7Y e;  3P6Y A;  2YVN A;  2DSC A;  4C9X A;  1OW2 A;  4YOQ A;  3Q93 A;  2ICK A;  4S2Y A;  1MP2 A;  2ICJ A;  1RRQ A;  1SZ3 A;  2GT4 A;  2I8T A;  1TUM A;  2YVP A;  4NFW A;  3SHD A;  5C7T A;  1SU2 A;  2B06 A;  1VC8 A;  5LPG A;  1VIQ A;  2PQV A;  5GHI A;  4ILQ A;  1SOI A;  1I9A A;  3I9X A;  1HX3 A;  2A8S A;  1NQZ A;  1JRK A;  1MK1 A;  2QJO A;  3X0J A;  5CFI A;  5BS6 A;  1NQY A;  2YVM A;  1PVF A;  2QJT A;  4JZV A;  4V14 A;  3N77 A;  3Q2T A;  4JZT A;  3FSP A;  3N9U A;  3RH7 A;  5GHJ A;  1QVJ A;  2CL3 A;  3KVH A;  4HFQ A;  4YPR A;  2FVV A;  2VNQ A;  3A6S A;  3ID9 A;  5FSM A;  5GHQ A;  3A6U A;  3O8S A;  1NFZ A;  4JZU A;  1V8U A;  1V8V A;  2G74 A;  3BHO A;  4DYW A;  4C9W A;  3U53 A;  3FFU A;  5ANV A;  1IRY A;  1V8W A;  3F13 A;  3GZ8 A;  3P5T A;  3GG6 A;  3HHJ A;  4KTB A;  3SMD A;  5HZX A;  3MDI A;  2KDW A;  1PPX A;  1PUS A;  1VCD A;  3GWY A;  5FSN A;  3AC9 A;  3L85 A;  4N1T A;  2AZW A;  3FK9 A;  1NFS A;  4ICK A;  2O1C A;  3GZ6 A;  5GHP A;  3DKU A;  3X0R A;  4NFX A;  5GHO A;  1KHZ A;  3BAP A;  3A6T A;  2I8U A;  1MR2 A;  3DUP A;  1F3Y A;  3O6Z A;  2CZR A;  1VRL A;  2YYH A;  1X83 A;  3I7V A;  1KTG A;  1V8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...