2DSDA

Crystal structure of human adp-ribose pyrophosphatase nudt5 in complex with magnesium and amp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
195
structure length
195
Chain Sequence
KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-sugar pyrophosphatase
publication title Crystal Structures of Human NUDT5 Reveal Insights into the Structural Basis of the Substrate Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.7.96: ADP-D-ribose pyrophosphorylase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2dsdA00
1V8IA 3EF5A 3EESA 3GZ8A 3Q2SA 1V8MA 2B2KA 3N77A 4ILQA 2A6TA 2A8QA 2I8TA 3X0JA 3O8SA 1HZTA 5C7QA 1NQYA 1KT9A 4JZVA 5ISYA 1VHGA 3H95A 3X0MA 1SOIA 1PVFA 3GZ5A 5FSKA 5IW5A 3FSPA 5FSOA 3Q1PA 2QJOA 5C7TA 2YYHA 2QKMB 3I7VA 4KYXA 3BM4A 5ANWA 3P5TA 2DSCA 3R03A 5GHIA 1MUTA 3SONA 1JRKA 2A8TA 2AZWA 2G74A 5FSMA 2G73A 1V8SA 1V8UA 1NQZA 3X0SA 3X0LA 2GT2A 4S2YA 3P6YA 4JZTA 3MDIA 1JKNA 4S2XA 1R67A 3X0QA 5C8LA 3Q4IA 1XSBA 3MDGA 3X0PA 1I9AA 5LPGA 3O61A 2A8SA 5IW4A 3A6UA 3I7UA 3A6SA 4JZUA 1IRYA 3F13A 3OGAA 2DUKA 3ACAA 3X0NA 4YPHA 1GA7A 3SHDA 5HZXA 1V8VA 5FSLA 3AC9A 1XSAA 1VC8A 2CL3A 2FMLA 1PPVA 2GT4A 1G0SA 3ID9A 3QSJA 4JZSA 2YVPA 3E57A 1VC9A 2VNQA 1VIQA 1HX3A 5DPKA 1OW2A 2I6KA 4IJXA 3X0IA 2GB5A 3EEUA 4N1UA 3FK9A 3BAPA 1QVJA 1V8WA 4S2VA 2VNPA 5GHOA 1XSCA 3A6VA 3BHOA 1VCDA 3FCMA 3FJYA 3L85A 1MQWA 3X0RA 1PUSA 2A8PA 2KDWA 1NFSA 1VHZA 2YVOA 3MCFA 5BS6A 1RRSA 1K2EA 3DUPA 2B0VA 3MGMA 1RRQA 3Q91A 2DSBA 2O5WA 3DKUA 4ZG0A 3GRNA 1V8RA 1X83A 1SZ3A 2PNYA 3A6TA 4MPOA 1VK6A 3O6ZA 4V14A 1V8NA 2YVMA 5DDGA 1Q27A 3U53A 4HFQA 3ZR0A 1V8TA 3F6AA 4NFXA 2J8QA 3N9UA 3J7Ye 3X0KA 1MR2A 2O1CA 4S2WA 1VIUA 5CFJA 4KG3A 2DSDA 1TUMA 3COUA 2PQVA 4KG4A 3WHWA 1SJYA 2ICJA 5I8UA 2XSQA 2O5FA 1PPWA 4C9XA 1VRLA 5GHJA 2JVBA 2YVNA 5ANUA 3GG6A 3KVHA 5GHNA 4YPRA 3Q93A 3SMDA 3X0OA 3Q2TA 2I8UA 2ICKA 1RYAA 4HVYA 2Q9PA 2RRKA 5BONA 4C9WA 2QJTA 3GZ6A 4NFWA 2B06A 5FSIA 1K26A 1MK1A 3FFUA 1NFZA 4KTBA 1PPXA 3HHJA 3O52A 4ICKA 2FKBA 3HYQA 5ANTA 3O69A 5GHPA 1MP2A 1PUQA 2FVVA 3EXQA 2W4EA 4YOQA 1U20A 1KTGA 1V8LA 4K6EA 1KHZA 2R5WA 4N1TA 2KDVA 1SU2A 5FSNA 3RH7A 5CFIA 3G0QA 5ANVA 1F3YA 3ZR1A 1X51A 1Q33A 2DHOA 1G9QA 1PUNA 5GHMA 5DD4A 1MQEA 3CNGA 4DYWA 5DEQA 5GHQA 2A8RA 1Q54A 1V8YA 3GWYA 3I9XA 5ANSA 1X84A
chains in the Genus database with same CATH superfamily
1V8IA 3EF5A 4J7HA 3EESA 3GZ8A 3Q2SA 1V8MA 2B2KA 3N77A 4ILQA 2A6TA 2A8QA 2I8TA 3X0JA 3O8SA 1HZTA 5C7QA 1NQYA 1KT9A 4JZVA 5ISYA 1VHGA 3H95A 3X0MA 1SOIA 1PVFA 3GZ5A 5FSKA 5IW5A 3FSPA 5FSOA 3Q1PA 2QJOA 5C7TA 2YYHA 2QKMB 3I7VA 4KYXA 3BM4A 5ANWA 3P5TA 2DSCA 3R03A 5GHIA 1MUTA 3SONA 1JRKA 2A8TA 2AZWA 2G74A 5FSMA 2G73A 1V8SA 1V8UA 1NQZA 3X0SA 3X0LA 2GT2A 4S2YA 3P6YA 4JZTA 3MDIA 1JKNA 4S2XA 1R67A 3X0QA 5C8LA 3Q4IA 1XSBA 3MDGA 3X0PA 4J7GA 1I9AA 5LPGA 3O61A 2A8SA 5IW4A 3A6UA 3I7UA 3A6SA 4JZUA 1IRYA 2CZRA 3F13A 3OGAA 2DUKA 3ACAA 3X0NA 4YPHA 1GA7A 3SHDA 5HZXA 1V8VA 5FSLA 3AC9A 1XSAA 1VC8A 2CL3A 2FMLA 1PPVA 2GT4A 1G0SA 3ID9A 3QSJA 4JZSA 2YVPA 3E57A 1VC9A 2VNQA 1VIQA 1HX3A 5DPKA 1OW2A 2I6KA 4IJXA 3X0IA 2GB5A 3EEUA 4N1UA 3FK9A 3BAPA 1QVJA 1V8WA 4S2VA 2VNPA 5GHOA 1XSCA 3A6VA 3BHOA 1VCDA 3FCMA 3FJYA 3L85A 1MQWA 3X0RA 1PUSA 2A8PA 2KDWA 1NFSA 1VHZA 2YVOA 3MCFA 5BS6A 1RRSA 1K2EA 3DUPA 2B0VA 3MGMA 1RRQA 3Q91A 2DSBA 2O5WA 3DKUA 4ZG0A 3GRNA 1V8RA 1X83A 1SZ3A 2PNYA 3A6TA 4MPOA 1VK6A 3O6ZA 4V14A 1V8NA 2YVMA 5DDGA 1Q27A 3U53A 4HFQA 3ZR0A 1V8TA 3F6AA 4NFXA 2J8QA 3N9UA 3J7Ye 3X0KA 1MR2A 2O1CA 4S2WA 1VIUA 5CFJA 4KG3A 2DSDA 1TUMA 3COUA 2PQVA 4KG4A 3WHWA 1SJYA 2ICJA 5I8UA 2XSQA 2O5FA 1PPWA 4C9XA 1VRLA 5GHJA 2JVBA 2YVNA 5ANUA 3GG6A 3KVHA 5GHNA 4YPRA 3Q93A 3SMDA 3X0OA 3Q2TA 2I8UA 2ICKA 1RYAA 4HVYA 2Q9PA 2RRKA 5BONA 4C9WA 2QJTA 3GZ6A 4NFWA 2B06A 5FSIA 1K26A 1MK1A 3FFUA 1NFZA 4KTBA 1PPXA 3HHJA 3O52A 4ICKA 2FKBA 3HYQA 5ANTA 3O69A 5GHPA 1MP2A 1PUQA 2FVVA 3EXQA 2W4EA 4YOQA 1U20A 1KTGA 1V8LA 4K6EA 1KHZA 2R5WA 4N1TA 2KDVA 1SU2A 5FSNA 3RH7A 5CFIA 3G0QA 5ANVA 1F3YA 3ZR1A 1X51A 1Q33A 2DHOA 1G9QA 1PUNA 5GHMA 5DD4A 1MQEA 3CNGA 4DYWA 5DEQA 5GHQA 2A8RA 1Q54A 1V8YA 3GWYA 3I9XA 5ANSA 1X84A
chains in the Genus database with same CATH topology
1V8IA 3EF5A 4J7HA 3EESA 3GZ8A 3Q2SA 1V8MA 2B2KA 3N77A 4ILQA 2A6TA 2A8QA 2I8TA 3X0JA 3O8SA 1HZTA 5C7QA 1NQYA 1KT9A 4JZVA 5ISYA 1VHGA 3H95A 3X0MA 1SOIA 1PVFA 3GZ5A 5FSKA 5IW5A 3FSPA 5FSOA 3Q1PA 2QJOA 5C7TA 2YYHA 2QKMB 3I7VA 4KYXA 3BM4A 5ANWA 3P5TA 2DSCA 3R03A 5GHIA 1MUTA 3SONA 1JRKA 2A8TA 2AZWA 2G74A 5FSMA 2G73A 1V8SA 1V8UA 1NQZA 3X0SA 3X0LA 2GT2A 4S2YA 3P6YA 4JZTA 3MDIA 1JKNA 4S2XA 1R67A 3X0QA 5C8LA 3Q4IA 1XSBA 3MDGA 3X0PA 4J7GA 1I9AA 5LPGA 3O61A 2A8SA 5IW4A 3A6UA 3I7UA 3A6SA 4JZUA 1IRYA 2CZRA 3F13A 3OGAA 2DUKA 3ACAA 3X0NA 4YPHA 1GA7A 3SHDA 5HZXA 1V8VA 5FSLA 3AC9A 1XSAA 1VC8A 2CL3A 2FMLA 1PPVA 2GT4A 1G0SA 3ID9A 3QSJA 4JZSA 2YVPA 3E57A 1VC9A 2VNQA 1VIQA 1HX3A 5DPKA 1OW2A 2I6KA 4IJXA 3X0IA 2GB5A 3EEUA 4N1UA 3FK9A 3BAPA 1QVJA 1V8WA 4S2VA 2VNPA 5GHOA 1XSCA 3A6VA 3BHOA 1VCDA 3FCMA 3FJYA 3L85A 1MQWA 3X0RA 1PUSA 2A8PA 2KDWA 1NFSA 1VHZA 2YVOA 3MCFA 5BS6A 1RRSA 1K2EA 3DUPA 2B0VA 3MGMA 1RRQA 3Q91A 2DSBA 2O5WA 3DKUA 4ZG0A 3GRNA 1V8RA 1X83A 1SZ3A 2PNYA 3A6TA 4MPOA 1VK6A 3O6ZA 4V14A 1V8NA 2YVMA 5DDGA 1Q27A 3U53A 4HFQA 3ZR0A 1V8TA 3F6AA 4NFXA 2J8QA 3N9UA 3J7Ye 3X0KA 1MR2A 2O1CA 4S2WA 1VIUA 5CFJA 4KG3A 2DSDA 1TUMA 3COUA 2PQVA 4KG4A 3WHWA 1SJYA 2ICJA 5I8UA 2XSQA 2O5FA 1PPWA 4C9XA 1VRLA 5GHJA 2JVBA 2YVNA 5ANUA 3GG6A 3KVHA 5GHNA 4YPRA 3Q93A 3SMDA 3X0OA 3Q2TA 2I8UA 2ICKA 1RYAA 4HVYA 2Q9PA 2RRKA 5BONA 4C9WA 2QJTA 3GZ6A 4NFWA 2B06A 5FSIA 1K26A 1MK1A 3FFUA 1NFZA 4KTBA 1PPXA 3HHJA 3O52A 4ICKA 2FKBA 3HYQA 5ANTA 3O69A 5GHPA 1MP2A 1PUQA 2FVVA 3EXQA 2W4EA 4YOQA 1U20A 1KTGA 1V8LA 4K6EA 1KHZA 2R5WA 4N1TA 2KDVA 1SU2A 5FSNA 3RH7A 5CFIA 3G0QA 5ANVA 1F3YA 3ZR1A 1X51A 1Q33A 2DHOA 1G9QA 1PUNA 5GHMA 5DD4A 1MQEA 3CNGA 4DYWA 5DEQA 5GHQA 2A8RA 1Q54A 1V8YA 3GWYA 3I9XA 5ANSA 1X84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V8I A;  3EF5 A;  3EES A;  3GZ8 A;  3Q2S A;  1V8M A;  2B2K A;  3N77 A;  4ILQ A;  2A6T A;  2A8Q A;  2I8T A;  3X0J A;  3O8S A;  1HZT A;  5C7Q A;  1NQY A;  1KT9 A;  4JZV A;  5ISY A;  1VHG A;  3H95 A;  3X0M A;  1SOI A;  1PVF A;  3GZ5 A;  5FSK A;  5IW5 A;  3FSP A;  5FSO A;  3Q1P A;  2QJO A;  5C7T A;  2YYH A;  2QKM B;  3I7V A;  4KYX A;  3BM4 A;  5ANW A;  3P5T A;  2DSC A;  3R03 A;  5GHI A;  1MUT A;  3SON A;  1JRK A;  2A8T A;  2AZW A;  2G74 A;  5FSM A;  2G73 A;  1V8S A;  1V8U A;  1NQZ A;  3X0S A;  3X0L A;  2GT2 A;  4S2Y A;  3P6Y A;  4JZT A;  3MDI A;  1JKN A;  4S2X A;  1R67 A;  3X0Q A;  5C8L A;  3Q4I A;  1XSB A;  3MDG A;  3X0P A;  1I9A A;  5LPG A;  3O61 A;  2A8S A;  5IW4 A;  3A6U A;  3I7U A;  3A6S A;  4JZU A;  1IRY A;  3F13 A;  3OGA A;  2DUK A;  3ACA A;  3X0N A;  4YPH A;  1GA7 A;  3SHD A;  5HZX A;  1V8V A;  5FSL A;  3AC9 A;  1XSA A;  1VC8 A;  2CL3 A;  2FML A;  1PPV A;  2GT4 A;  1G0S A;  3ID9 A;  3QSJ A;  4JZS A;  2YVP A;  3E57 A;  1VC9 A;  2VNQ A;  1VIQ A;  1HX3 A;  5DPK A;  1OW2 A;  2I6K A;  4IJX A;  3X0I A;  2GB5 A;  3EEU A;  4N1U A;  3FK9 A;  3BAP A;  1QVJ A;  1V8W A;  4S2V A;  2VNP A;  5GHO A;  1XSC A;  3A6V A;  3BHO A;  1VCD A;  3FCM A;  3FJY A;  3L85 A;  1MQW A;  3X0R A;  1PUS A;  2A8P A;  2KDW A;  1NFS A;  1VHZ A;  2YVO A;  3MCF A;  5BS6 A;  1RRS A;  1K2E A;  3DUP A;  2B0V A;  3MGM A;  1RRQ A;  3Q91 A;  2DSB A;  2O5W A;  3DKU A;  4ZG0 A;  3GRN A;  1V8R A;  1X83 A;  1SZ3 A;  2PNY A;  3A6T A;  4MPO A;  1VK6 A;  3O6Z A;  4V14 A;  1V8N A;  2YVM A;  5DDG A;  1Q27 A;  3U53 A;  4HFQ A;  3ZR0 A;  1V8T A;  3F6A A;  4NFX A;  2J8Q A;  3N9U A;  3J7Y e;  3X0K A;  1MR2 A;  2O1C A;  4S2W A;  1VIU A;  5CFJ A;  4KG3 A;  2DSD A;  1TUM A;  3COU A;  2PQV A;  4KG4 A;  3WHW A;  1SJY A;  2ICJ A;  5I8U A;  2XSQ A;  2O5F A;  1PPW A;  4C9X A;  1VRL A;  5GHJ A;  2JVB A;  2YVN A;  5ANU A;  3GG6 A;  3KVH A;  5GHN A;  4YPR A;  3Q93 A;  3SMD A;  3X0O A;  3Q2T A;  2I8U A;  2ICK A;  1RYA A;  4HVY A;  2Q9P A;  2RRK A;  5BON A;  4C9W A;  2QJT A;  3GZ6 A;  4NFW A;  2B06 A;  5FSI A;  1K26 A;  1MK1 A;  3FFU A;  1NFZ A;  4KTB A;  1PPX A;  3HHJ A;  3O52 A;  4ICK A;  2FKB A;  3HYQ A;  5ANT A;  3O69 A;  5GHP A;  1MP2 A;  1PUQ A;  2FVV A;  3EXQ A;  2W4E A;  4YOQ A;  1U20 A;  1KTG A;  1V8L A;  4K6E A;  1KHZ A;  2R5W A;  4N1T A;  2KDV A;  1SU2 A;  5FSN A;  3RH7 A;  5CFI A;  3G0Q A;  5ANV A;  1F3Y A;  3ZR1 A;  1X51 A;  1Q33 A;  2DHO A;  1G9Q A;  1PUN A;  5GHM A;  5DD4 A;  1MQE A;  3CNG A;  4DYW A;  5DEQ A;  5GHQ A;  2A8R A;  1Q54 A;  1V8Y A;  3GWY A;  3I9X A;  5ANS A;  1X84 A; 
#chains in the Genus database with same CATH topology
 1V8I A;  3EF5 A;  4J7H A;  3EES A;  3GZ8 A;  3Q2S A;  1V8M A;  2B2K A;  3N77 A;  4ILQ A;  2A6T A;  2A8Q A;  2I8T A;  3X0J A;  3O8S A;  1HZT A;  5C7Q A;  1NQY A;  1KT9 A;  4JZV A;  5ISY A;  1VHG A;  3H95 A;  3X0M A;  1SOI A;  1PVF A;  3GZ5 A;  5FSK A;  5IW5 A;  3FSP A;  5FSO A;  3Q1P A;  2QJO A;  5C7T A;  2YYH A;  2QKM B;  3I7V A;  4KYX A;  3BM4 A;  5ANW A;  3P5T A;  2DSC A;  3R03 A;  5GHI A;  1MUT A;  3SON A;  1JRK A;  2A8T A;  2AZW A;  2G74 A;  5FSM A;  2G73 A;  1V8S A;  1V8U A;  1NQZ A;  3X0S A;  3X0L A;  2GT2 A;  4S2Y A;  3P6Y A;  4JZT A;  3MDI A;  1JKN A;  4S2X A;  1R67 A;  3X0Q A;  5C8L A;  3Q4I A;  1XSB A;  3MDG A;  3X0P A;  4J7G A;  1I9A A;  5LPG A;  3O61 A;  2A8S A;  5IW4 A;  3A6U A;  3I7U A;  3A6S A;  4JZU A;  1IRY A;  2CZR A;  3F13 A;  3OGA A;  2DUK A;  3ACA A;  3X0N A;  4YPH A;  1GA7 A;  3SHD A;  5HZX A;  1V8V A;  5FSL A;  3AC9 A;  1XSA A;  1VC8 A;  2CL3 A;  2FML A;  1PPV A;  2GT4 A;  1G0S A;  3ID9 A;  3QSJ A;  4JZS A;  2YVP A;  3E57 A;  1VC9 A;  2VNQ A;  1VIQ A;  1HX3 A;  5DPK A;  1OW2 A;  2I6K A;  4IJX A;  3X0I A;  2GB5 A;  3EEU A;  4N1U A;  3FK9 A;  3BAP A;  1QVJ A;  1V8W A;  4S2V A;  2VNP A;  5GHO A;  1XSC A;  3A6V A;  3BHO A;  1VCD A;  3FCM A;  3FJY A;  3L85 A;  1MQW A;  3X0R A;  1PUS A;  2A8P A;  2KDW A;  1NFS A;  1VHZ A;  2YVO A;  3MCF A;  5BS6 A;  1RRS A;  1K2E A;  3DUP A;  2B0V A;  3MGM A;  1RRQ A;  3Q91 A;  2DSB A;  2O5W A;  3DKU A;  4ZG0 A;  3GRN A;  1V8R A;  1X83 A;  1SZ3 A;  2PNY A;  3A6T A;  4MPO A;  1VK6 A;  3O6Z A;  4V14 A;  1V8N A;  2YVM A;  5DDG A;  1Q27 A;  3U53 A;  4HFQ A;  3ZR0 A;  1V8T A;  3F6A A;  4NFX A;  2J8Q A;  3N9U A;  3J7Y e;  3X0K A;  1MR2 A;  2O1C A;  4S2W A;  1VIU A;  5CFJ A;  4KG3 A;  2DSD A;  1TUM A;  3COU A;  2PQV A;  4KG4 A;  3WHW A;  1SJY A;  2ICJ A;  5I8U A;  2XSQ A;  2O5F A;  1PPW A;  4C9X A;  1VRL A;  5GHJ A;  2JVB A;  2YVN A;  5ANU A;  3GG6 A;  3KVH A;  5GHN A;  4YPR A;  3Q93 A;  3SMD A;  3X0O A;  3Q2T A;  2I8U A;  2ICK A;  1RYA A;  4HVY A;  2Q9P A;  2RRK A;  5BON A;  4C9W A;  2QJT A;  3GZ6 A;  4NFW A;  2B06 A;  5FSI A;  1K26 A;  1MK1 A;  3FFU A;  1NFZ A;  4KTB A;  1PPX A;  3HHJ A;  3O52 A;  4ICK A;  2FKB A;  3HYQ A;  5ANT A;  3O69 A;  5GHP A;  1MP2 A;  1PUQ A;  2FVV A;  3EXQ A;  2W4E A;  4YOQ A;  1U20 A;  1KTG A;  1V8L A;  4K6E A;  1KHZ A;  2R5W A;  4N1T A;  2KDV A;  1SU2 A;  5FSN A;  3RH7 A;  5CFI A;  3G0Q A;  5ANV A;  1F3Y A;  3ZR1 A;  1X51 A;  1Q33 A;  2DHO A;  1G9Q A;  1PUN A;  5GHM A;  5DD4 A;  1MQE A;  3CNG A;  4DYW A;  5DEQ A;  5GHQ A;  2A8R A;  1Q54 A;  1V8Y A;  3GWY A;  3I9X A;  5ANS A;  1X84 A; 
#chains in the Genus database with same CATH homology
 1V8I A;  3EF5 A;  4J7H A;  3EES A;  3GZ8 A;  3Q2S A;  1V8M A;  2B2K A;  3N77 A;  4ILQ A;  2A6T A;  2A8Q A;  2I8T A;  3X0J A;  3O8S A;  1HZT A;  5C7Q A;  1NQY A;  1KT9 A;  4JZV A;  5ISY A;  1VHG A;  3H95 A;  3X0M A;  1SOI A;  1PVF A;  3GZ5 A;  5FSK A;  5IW5 A;  3FSP A;  5FSO A;  3Q1P A;  2QJO A;  5C7T A;  2YYH A;  2QKM B;  3I7V A;  4KYX A;  3BM4 A;  5ANW A;  3P5T A;  2DSC A;  3R03 A;  5GHI A;  1MUT A;  3SON A;  1JRK A;  2A8T A;  2AZW A;  2G74 A;  5FSM A;  2G73 A;  1V8S A;  1V8U A;  1NQZ A;  3X0S A;  3X0L A;  2GT2 A;  4S2Y A;  3P6Y A;  4JZT A;  3MDI A;  1JKN A;  4S2X A;  1R67 A;  3X0Q A;  5C8L A;  3Q4I A;  1XSB A;  3MDG A;  3X0P A;  4J7G A;  1I9A A;  5LPG A;  3O61 A;  2A8S A;  5IW4 A;  3A6U A;  3I7U A;  3A6S A;  4JZU A;  1IRY A;  2CZR A;  3F13 A;  3OGA A;  2DUK A;  3ACA A;  3X0N A;  4YPH A;  1GA7 A;  3SHD A;  5HZX A;  1V8V A;  5FSL A;  3AC9 A;  1XSA A;  1VC8 A;  2CL3 A;  2FML A;  1PPV A;  2GT4 A;  1G0S A;  3ID9 A;  3QSJ A;  4JZS A;  2YVP A;  3E57 A;  1VC9 A;  2VNQ A;  1VIQ A;  1HX3 A;  5DPK A;  1OW2 A;  2I6K A;  4IJX A;  3X0I A;  2GB5 A;  3EEU A;  4N1U A;  3FK9 A;  3BAP A;  1QVJ A;  1V8W A;  4S2V A;  2VNP A;  5GHO A;  1XSC A;  3A6V A;  3BHO A;  1VCD A;  3FCM A;  3FJY A;  3L85 A;  1MQW A;  3X0R A;  1PUS A;  2A8P A;  2KDW A;  1NFS A;  1VHZ A;  2YVO A;  3MCF A;  5BS6 A;  1RRS A;  1K2E A;  3DUP A;  2B0V A;  3MGM A;  1RRQ A;  3Q91 A;  2DSB A;  2O5W A;  3DKU A;  4ZG0 A;  3GRN A;  1V8R A;  1X83 A;  1SZ3 A;  2PNY A;  3A6T A;  4MPO A;  1VK6 A;  3O6Z A;  4V14 A;  1V8N A;  2YVM A;  5DDG A;  1Q27 A;  3U53 A;  4HFQ A;  3ZR0 A;  1V8T A;  3F6A A;  4NFX A;  2J8Q A;  3N9U A;  3J7Y e;  3X0K A;  1MR2 A;  2O1C A;  4S2W A;  1VIU A;  5CFJ A;  4KG3 A;  2DSD A;  1TUM A;  3COU A;  2PQV A;  4KG4 A;  3WHW A;  1SJY A;  2ICJ A;  5I8U A;  2XSQ A;  2O5F A;  1PPW A;  4C9X A;  1VRL A;  5GHJ A;  2JVB A;  2YVN A;  5ANU A;  3GG6 A;  3KVH A;  5GHN A;  4YPR A;  3Q93 A;  3SMD A;  3X0O A;  3Q2T A;  2I8U A;  2ICK A;  1RYA A;  4HVY A;  2Q9P A;  2RRK A;  5BON A;  4C9W A;  2QJT A;  3GZ6 A;  4NFW A;  2B06 A;  5FSI A;  1K26 A;  1MK1 A;  3FFU A;  1NFZ A;  4KTB A;  1PPX A;  3HHJ A;  3O52 A;  4ICK A;  2FKB A;  3HYQ A;  5ANT A;  3O69 A;  5GHP A;  1MP2 A;  1PUQ A;  2FVV A;  3EXQ A;  2W4E A;  4YOQ A;  1U20 A;  1KTG A;  1V8L A;  4K6E A;  1KHZ A;  2R5W A;  4N1T A;  2KDV A;  1SU2 A;  5FSN A;  3RH7 A;  5CFI A;  3G0Q A;  5ANV A;  1F3Y A;  3ZR1 A;  1X51 A;  1Q33 A;  2DHO A;  1G9Q A;  1PUN A;  5GHM A;  5DD4 A;  1MQE A;  3CNG A;  4DYW A;  5DEQ A;  5GHQ A;  2A8R A;  1Q54 A;  1V8Y A;  3GWY A;  3I9X A;  5ANS A;  1X84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...