2DSUA

Binding of chitin-like polysaccharide to protective signalling factor: crystal structure of the complex formed between signalling protein from sheep (sps-40) with a tetrasaccharide at 2.2 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dsuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dsuA01
2G3NA 1VENA 1CGUA 3ARUA 3ARWA 4OOUA 3PBGA 5HOSA 3DECA 3WDQA 3CHDA 3RDKA 1I1XA 1DWAM 1H11A 3WFLA 1UR2A 4ZFMA 2E8YA 1E9LA 1H09A 2C0HA 4ACZB 1W32A 3ZJKA 2WKLA 5CLTA 3B9EA 2EBNA 4AC1X 3A47A 1E6XM 4Q7NA 3T2OA 2WHKA 2WNWA 2BY3A 4YN5A 2GJXB 3UERA 1PZ3A 2Z1SA 1Q6DA 3WNNA 3WH5A 2WC7A 3ARRA 3DC0A 3LPGA 1J0IA 4JFUA 3WUGA 3I3BA 3AIQA 3VGHA 1IZJA 4UFJA 3VX1A 1SMDA 1BTCA 2ZOXA 4FLOA 4AZIA 4UOZA 4RE2A 4X9YA 3SCUA 4QLLA 2ZE0A 2F61A 4S3JA 5M3WA 3ZR6A 4TUFA 4N42A 1EH9A 5FL0A 3ARTA 1W2VA 1HXJA 3W38A 3CUGA 2DT2A 2J74A 2EPNA 1OT2A 1WDRA 2ZUMA 2ZXQA 3VDHA 5D9MA 5I23A 3CPUA 2VCBA 1XD1A 3N9KA 3PZUA 1GOQA 1UD6A 2VX6A 1MVYA 2BFGA 3EDDA 1UR1A 4YHGA 1XCXA 2VOTA 1J18A 4WF7A 3THDA 4MAZA 5EFFA 2WMJA 3TOPA 2XIIA 1JI1A 3ALGA 1DWJM 2E40A 1NP2A 1H0IA 1WZAA 2GJRA 2VO5A 3CMGA 1ZJBA 1UWUA 1TE1A 4W84A 3W6MA 1HJSA 3VD9A 1EQPA 8A3HA 3W25A 1W2PA 3GXIA 3QOMA 2WW5A 3PZVA 4PTVA 1BYDA 4W88A 4UFIA 5A94A 1EXPA 4ZENA 4IUGA 2WBKA 2CYGA 3B9DA 1UD2A 3UG4A 1UG6A 1NWSA 4UR9A 3PTKA 4DM1A 3CHFA 2VJXA 1QHZA 1SMAA 3SCQA 4AD0A 3WNPA 2WC3A 4H8HA 1BGAA 1UHVA 3AHVA 4PMYA 4PTXA 3TA9A 1NOUA 2DEPA 2X05A 1CGTA 3F5KA 3SCOA 1XSJA 1IV8A 2C7FA 1W1VA 5E70A 5AY7A 3WD3A 3J7HA 1ISYA 3L4XA 3AOFA 1CDGA 4MDPA 3KWXA 1MQPA 2YJQA 2A3CA 2X1IA 4DWSB 3UG5A 1V0NA 2Y24A 1UKTA 1JIBA 2YL5A 2JF7A 4TVUA 1KCLA 4L4OA 1XRVA 3A4AA 1JZ3A 4M80A 1XC6A 1Y7VA 4IPNB 3FY1A 3I3DA 3O9NA 5DEZA 2BY1A 1J0ZA 1R7AA 2CEQA 2ZUUA 3BAYA 1ODUA 4H2CA 1XH2A 3WEOA 1LJYA 3AXHA 4JFSA 1SYTA 3POCA 1LWHA 4BA0A 1UR9A 1H5VA 4GQQA 4W87A 4BF7A 5FL1A 2J25A 5A8PA 1C91A 3CUJA 2HISA 2WHMA 2WVSA 2X09A 1RP8A 2GK1B 4PTMA 3MV11 1W9BM 2VVSA 1WZKA 3WH7A 1J0JA 4GPNA 1JYXA 4ZXLA 1OGBA 4F66A 1OD8A 2F8QA 4J28A 1P6WA 4AZBA 2WCGA 3GNRA 4BQ5A 2DT3A 4GIAA 4WJXA 1BG9A 4WKHA 4RL3A 3SCNA 5I77A 2WK2A 1CGWA 1XSIA 3RIKA 5M5DA 2DH2A 1FOBA 4Q22A 2ZX7A 1BYBA 7TAAA 4B3LA 2DSKA 2DSWA 1OWQA 1V02A 3SCSA 4FK9A 5BWFA 1E4MM 1E72M 2CESA 3HMCA 3NUKA 3AS0A 4HOXA 4JIEA 4P7QA 2XM2A 1JDCA 1KB3A 1UA3A 1KWGA 2XFFA 4HU8A 5E6ZA 1JG9A 3SUTA 2VC9A 5IXEA 3VNYA 2ZUVA 3L4VA 2WCSA 5GNYA 1WB0A 3NSMA 2D3LA 1FHDA 1QPKA 5FKYA 1GQJA 4PSPA 1EOKA 4CUCA 1H0GA 2PI6A 1FH7A 3SUVA 4CN6A 1EDGA 2CBIA 2WKGA 1HKIA 5A6MA 4S3KA 4UZUA 3OZOA 4KWUA 1W1TA 1AVAA 1MXDA 4M24A 1LL7A 3SCRA 1TUXA 2CETA 1FP9A 3PZQA 2O9TA 3MUAA 5BXPA 4LYPA 1XH1A 4D6DA 5FCZA 3UESA 1UD3A 1TG7A 3AIWA 4AZ5A 1I1WA 3ZO9A 1W3HA 1XGZA 2PWGA 1PX3A 2FGZA 2XGIA 2QLYA 1EO5A 3L4TA 4E4PA 2VCCA 3MV01 3VIKA 1ZBVA 4AZHA 4JL2A 1W3KA 3FNDA 1JD9A 3WD2A 3ZR5A 1ZBWA 5A3HA 1RPKA 2G3IA 1X6NA 4P7RA 2V3FA 4JAWA 4FLRA 2G8ZA 4UFLA 1EGZA 1W3JA 4CD6A 5FOOA 1HVQA 1V02E 3AI0A 3UEQA 3M07A 4GZEA 3I3EA 4PMQA 3VGFA 4BCEA 5JIPA 3F5LA 2CBJA 2W5FA 1M03A 4PSRA 3EDEA 3A6OA 4OUEA 4OKDA 4AZ7A 1VFOA 2VUYA 2BV9A 2WXDM 3AMKA 3GBEA 1L8NA 2FH8A 3WDJA 1MQRA 2FHFA 4UQCA 2FHCA 4GZJA 3OIHA 1JAEA 3RPMA 4W8LA 4A3YA 1ZB5A 4H7VA 2B31A 2O9RA 3N04A 1V6WA 3RM8A 1JF6A 3AZTA 3MKKA 4PBGA 2FHBA 3PZOA 1J10A 1V6YA 2EEXA 1UKSA 2PBOA 1JXJA 3AIEA 3AHZA 4J3WA 3ZOAA 1CXFA 2XFYA 1JNEA 4KGLA 2J75A 7A3HA 3ARQA 2XWEA 2CXGA 2X8RA 5A2CA 2XGBA 1C7SA 1AQMA 3N15A 3BAWA 4CN4A 3A4WA 2UY2A 1ZL1A 2BVYA 3BAJA 5M03A 1HT6A 2ZICA 1BLIA 1O6IA 3VIFA 3GM8A 4A4AA 1V6XA 3W37A 4N0RA 4PYSA 1Q6GA 1HKMA 2JFEX 4MB1A 3VIMA 1FH9A 2CHNA 4UCFA 5E0FA 5LA2A 2YOCA 4H04A 3K46A 4OZOA 2YA2A 3WENA 4PMRA 4JFTA 2ZUTA 4B15A 1QI4A 2UY3A 3QHMA 3GBDA 4AZCB 2DIEA 1K6AA 3RJYA 1HL8A 2AMGA 5HBFA 1JFHA 3OLGA 4QP0A 5CSYA 3THCA 4NRRA 5I2UA 1GVIA 4HOZA 3NDZA 4JL1A 4PUEA 1H3GA 1TA3B 1WP6A 2GUYA 1HJVA 3PTMA 1Z32X 3PZIA 1HN1A 3DHPA 1BSIA 3DYPA 3LMYA 1GQKA 3HJEA 1C8QA 1VFFA 2Y5EA 1BPLB 1CWYA 3VPLA 2NSXA 3AZSA 5E9AA 2F2HA 1JFXA 1PZ2A 4CCDA 3WSUA 3KE0A 1NH6A 4ATWA 4CU7A 3WL1A 3N12A 1OGGA 4AYSA 1QNSA 4HPHA 1GNXA 1MW3A 4EAMA 3L4WA 3OLEA 1WDPA 3WMCA 1WZMA 3PZNA 3PZMA 4H8VA 4J3VA 3OGVA 1HJQA 2RGMA 3CO4A 1WZLA 1CPUA 1B3ZA 2MANA 4W8AA 2WANA 1E1EA 1VFMA 4W93A 1W9VA 5A6AA 1E56A 4QLJA 3U7VA 3WD4A 3HU7A 2PWEA 3K4AA 2VZOA 4PMUA 4LGXA 3FHQA 1RP9A 1CEOA 1Q6EA 4QCEA 4JHZA 3IJ7A 2WMIB 1VBRA 5HNNA 3KZSA 2J7EA 1W9DM 2OSYA 4QFUA 1W1PA 2ZX5A 4BQ2A 2VCAA 3AMGA 1UQZA 1VJSA 3AIRA 2XVLA 1E5JA 3N13A 4MAVA 4TVCA 5A2BA 6A3HA 1BFNA 2OYLA 3UETA 3BAKA 1QNOA 4JCMA 3WBAA 4E8CA 2EPMX 4FF5A 5JH8A 1KGXA 1QI2A 3TTYA 1DEDA 1OCQA 5D8ZA 3CIVA 3PHAA 4A3HA 5CPQA 5ABGA 4H8UA 2YDRA 2VZTA 2WVVB 1TR1A 2W67A 3SCPA 1HJUA 3WF2A 2D0HA 4C7GA 3ZT7A 1LL6A 1C8YA 1DHKA 1LG2A 4UOQA 1FP8A 3ZMRA 3D3AA 1V6VA 3G6LA 3AS1A 3K1DA 1ZJAA 4HMCA 3W26A 2O92A 3PZ9A 3PZGA 1CTNA 1D3CA 2DQXA 4W5ZA 3TTSA 1JXKA 4PMXA 4IM4A 4CU6A 8CGTA 4C7FA 5HPCA 2GJPA 3VDCA 1UKQA 1B0IA 2OSXA 1V3JA 2DT1A 2JALA 3T2QA 1JDDA 1BYCA 2X0YA 3KL3A 1H49A 5A6KA 5AYIA 2WC4A 3GXMA 3CZ8A 1UWSA 4DWSD 5EFDA 3QHNA 2ZX8A 5IHSA 1JYNA 5I0DA 3MO4A 1I75A 3BMWA 1CZ1A 4NRSA 2YDSA 1PIGA 4W86A 2WLZA 3KL5A 3PZTA 4JZ5A 3CUHA 2E0PA 4RE3A 1U2YA 2OWXA 2J7FA 4PMNA 1NM9A 1QOXA 1HJXA 1E4IA 1FHLA 1RH9A 1XYZA 4PCSA 1NOWA 1O7AA 1KBKA 3L4YA 3WEMA 3WN6A 4W7UA 1B9ZA 2BXZA 1GPFA 4MPKA 2Y8VA 4M29A 3NDYA 1JYWA 1A3HA 4WIWA 3AFBA 2IXVA 2V38A 2D2OA 2WCAA 3NIYA 3L4UA 1R87A 4U33A 2UWFA 1JZ2A 2UY4A 3ZJ7A 3U57A 3CLWA 4ML4A 3IJ9A 2AAAA 1GORA 3DHUA 1K9TA 4B16A 1IT0A 4D6EA 1E0VA 2YL9A 3VO0A 3CZLA 2Q8XA 4ACZA 1GHRA 5EB8A 4PMZA 2QF8A 1OIMA 2GJXA 1UZ4A 1UD4A 3QGVA 1J12A 2VL4A 3CZGA 4CGTA 3AMDA 1OINA 5ABHA 4GQRA 3EBVA 2D20A 2DDXA 1EHNA 1DWHM 2PWFA 3MUIA 3FHAA 1GOMA 1C8XA 4U3AA 3OGRA 3OLIA 5C71A 4LYQA 1YHTA 1F4HA 1UUQA 3WKZA 2DPEA 3WBEA 1H2JA 4ZXOA 3IK2A 4W7VA 1GQIA 3TTOA 1B3WA 1VEMA 2TAAA 3D5HA 3O6AA 4HZ6A 4MB3A 1B3VA 1V3LA 1UR4A 3K8LA 1BGGA 3BSGA 2OSWA 1AMYA 1BVZA 1GUVA 1QHPA 1MFVA 2AOSA 3DYOA 2EQDA 4UQBA 4PRWA 3WNKA 3EMCA 2JIWA 4Z2JA 1LG1A 2WWDA 4J27A 1Q4NX 1VIWA 4JKKA 3FXYA 3WELA 2JF6A 1R8LA 2VZVA 1J11A 2BY0A 3T09A 3T2PA 2J78A 3VX0A 3WL0A 1XCWA 3VD3A 2XVNA 3VM5A 3W24A 4LX4A 4K68A 3CH9A 4Z2IA 3GTNA 1CBGA 1D7FA 2DT0A 2VQUA 3NSNA 1NWRA 1UKOA 3AIVA 3IAQA 1V3IA 1DTUA 1W9UA 4PMVA 2DGAA 3SCVA 1QHOA 3RJXA 4M82A 2FDMA 3K4DA 4ATDA 4P7LA 1E4LA 4MDOA 4X0NA 3BXWA 4D6IA 1AQ0A 5I6SA 1E55A 3II1A 1JI2A 4UOJA 1DWIM 1VF8A 4D6GA 3BGAA 2DIJA 1UA7A 2W63A 2ZUWA 4AZ6A 3VOCA 5DF0A 3VGGA 3AICA 2PF0A 2EO7A 1XV8A 3VIOA 2WSPA 3FAXA 5BRQA 1GVYA 4J7RA 7CGTA 1ISXA 1CXKA 3WD1A 4KH2A 1E73M 4WK9A 3WNMA 1GJWA 1WKYA 4UFKA 2E9BA 5GQBA 1TFVA 2J47A 4DWSA 6TAAA 3VKKA 3GNOA 2YL8A 4AD2A 1IZKA 4P7NA 2G3JA 4R5EA 2DSZA 1B3XA 4XV0A 5IHRA 1J0HA 3K8MA 1LWJA 3AZRA 3ECQA 4PN2A 5JBDA 3O2LA 4ZE5A 1KCKA 3ZM8A 2CBUA 2UY5A 1JZ5A 4GKLA 1LF1A 1US3A 4U5KA 2GFTA 3IAPA 1ISVA 1KQYA 2Z1KA 1E3XA 5CLWA 1HKKA 4LYRA 3OG2A 3ZSTA 1BYAA 2VURA 4WSKA 5BRPA 2EPOA 5D4YA 1FH8A 2XWDA 4AD4A 1C90A 4QAWA 1CYGA 4YPJA 3ARSA 4HZ8A 1GOOA 1MQQA 4DUXA 4TTUA 1W1YA 5CG0A 1V0KA 4MB5A 1WDQA 5ABFB 4J3SA 1E70M 1VFUA 4MTVA 5CPTA 1H41A 3GDBA 4PTWA 3OB8A 1QVBA 1BF2A 3WMBA 1PBGA 1K9FA 1OM0A 4HA1A 3TONA 3AJ7A 3NJ3A 5A6BD 1VBUA 2BVTA 1ZBKA 2CITA 1Q6CA 2G3MA 4XUYA 4AZGA 4MNKA 3UR8A 2WMFA 5KEZA 4CVUA 4F79A 4D72A 1MFUA 2J62A 3QHOA 2WB5A 3W4RA 4GI8A 1E40A 3WF4A 2D22A 1VAHA 2CNCA 4QCFA 3LPPA 4F9JA 1E1FA 3EYPA 3MS8A 3B9AA 4D6HA 1R86A 3M7SA 1G1YA 3IANA 4HP5A 4GO9A 4OBSA 2BS9A 5A95A 4JHOA 2ZX9A 2V5CA 2RGLA 4ACYA 3VTRA 1G9HA 5ABEA 3WQ8A 1VB9A 3N17A 4TX8A 4NZCA 4AD1A 3N11A 4KGJA 4PMDA 3WY1A 3CMJA 3WF3A 2J7CA 3BLPX 4TX6A 2J77A 2IXUA 2VMFA 3WD0A 3OLDA 1CXLA 3VD5A 3VD4A 4MB4A 4ATLA 2WAGA 1SR0A 2WPGA 4AXNA 1KFWA 1QNQA 1WDSA 1LL4A 5A8QA 4M56A 1M01A 1ITXA 1KGUA 4CN1A 1J9YA 1HP5A 4IPLA 1BG4A 3WDHA 2V3GA 2VRJA 3WUFA 4JKMA 4V2XA 3W0KA 1G01A 5DT5A 3BAXA 1JZ8A 2BHZA 1UYQA 2YIHA 1H4PA 4U31A 4CD7A 3VM7A 3WUEA 3CUFA 2A3BA 5DT7A 5TD4A 3TP4A 3RO8A 3GH5A 3UCQA 4TOQA 5D9NA 3T08A 1OIFA 2EJ1A 1G5AA 3AHXA 1JZ7A 1GJUA 2XVKA 3VIPA 2VX7A 4X0VA 4CKQA 2ZUSA 3MMWA 2XPKA 3POHA 4ZEPA 3WNLA 1PIFA 5E09A 4D6JA 1W3LA 4UFHA 1OSEA 2ZXAA 1EQCA 4D71A 4HMEA 2EPLX 4NF7A 1QBAA 3EMZA 1UWRA 3OGSA 4BS0A 3SCTA 1JYVA 2EXOA 3A3HA 4B3KA 4D1JA 4AIEA 1S46A 4D6FA 4XZWA 1V6UA 2JIEA 1FFQA 3ARPA 3ZIZA 5E6YA 3OBAA 1CXEA 1FA2A 1NP0A 3RMEA 2PC8A 5CPSA 1TCMA 4Z2KA 2ZUNA 1E6SM 3A4XA 3RILA 1KQZA 4RE4A 3M6DA 5F7UA 2J4GA 2VQTA 2VX4A 3WMSA 5BXSA 1PAMA 2J8GA 4GZIA 1QI5A 2BVDA 4W89A 1WE5A 4F8XA 1MW0A 3WQ6A 4UQ9A 4AY1A 2WMGA 2EPKX 2VNCA 2BHYA 1EIBA 1KWKA 4FMVA 4LQ1A 3CBWA 2XHYA 3WDRA 2WZIA 4HU0A 3LPOA 1B90A 2VR4A 1UD8A 1NOFA 3BLKA 2DSVA 1L0PA 1N82A 4UTFA 2CERA 1UR0A 4F9DA 1A47A 3VIJA 3GYCA 1CGYA 1CENA 2ZWZA 1FFRA 3OZPA 3PTQA 1NWTA 2FGLA 2E9MA 1XHGA 1K9EA 2VZUA 1EDQA 5DMYA 2WM0A 3W27A 3WUBA 4AZCA 3KL0A 1HP4A 3OA5A 2OYMA 1VRXA 3GZAA 4LPCA 5HPOA 1V0LA 1UWTA 1GHSA 3S6TA 2JEPA 5A6BA 1NQ6A 4FLSA 3WH8A 3SIMA 5A8NA 1M53A 2W92A 1BHGA 5D8WA 2ZX6A 1HL9A 2XUCA 1TA3A 4BQ4A 4IISA 1KGWA 2J79A 4HA4A 4ZE4A 2YDQA 2BY2A 3WFZA 2D23A 1C93A 1OBAA 5CGMA 2WVUA 5D9PA 1MW1A 5I78A 2XG9A 3CZEA 3ZQ9A 2ESCA 1J0KA 2GSJA 4UNIA 4LXFA 4W5UA 1BVNP 5LYRA 4UFMA 3VUPA 1CXIA 3N1AA 5CXPA 3WNOA 3VINA 3AIUA 1GOIA 1JL8A 4U2YA 2E3ZA 3VDBA 2YLLA 4E2OA 4XB3A 5CZKA 5C70A 3VDAA 1KBBA 2YA0A 4KRTA 4BZYA 3G6MA 4CD4A 1E5NA 5HDRA 2WHJA 2C8NA 1V0MA 4P8UA 4HA3A 1EDTA 2A3AA 4HOWA 1G94A 4W8BA 3GXFA 4DUVA 4MNMA 2XFRA 1HKJA 2CCRA 4CU8A 3GH7A 2IUZA 4CCEA 1GCYA 2QPSA 4AEEA 3VILA 2YKKA 5IDIA 2YBTA 1DWFM 3WF1A 4CCCA 1KXQA 5DO8A 2ZXBA 3U7BA 2PWDA 3MANA 1GOKA 2YA1A 1QI3A 2WMIA 4JKLA 2CIPA 5HXMA 3WH9A 3MMDA 1E43A 1GQLA 2D0FA 3NYDA 1W9XA 3UR7A 1BQCA 2PB1A 2XSAA 1B2YA 1ODZA 4DWSC 1K9DA 2BNJA 1KR0A 5CSUA 3JUGA 4AD5A 1NARA 1CGXA 1ITCA 2A3HA 1C7TA 2GDUA 4AISA 5LA1A 2V3EA 4MJ2A 3T0BA 1QW8A 4GINA 3MUZ1 2WZHA 1WO2A 1M04A 3WQVA 1KXVA 3AQUA 2J7DA 3MSDA 4B9YA 3L4ZA 1QNPA 4FLQA 3WQWA 4WKAA 3FW6A 3VIIA 4M81A 2WVVA 1GOWA 2VR5A 5EMYA 5BROA 2QPUA 3ZSSA 2Y4SA 4P8VA 3AYSA 2BHUA 1UH3A 1UWIA 4GI6A 3VNZA 4V27A 4MJ4A 3W28A 5BXTA 2XJ7A 1GZJA 4OIFA 1HNYA 4QDMA 2OYKA 5AYBA 4J3UA 4YHEA 1CLXA 4GI9A 4W7WA 5BYWA 1B1YA 1QBBA 2A3EA 2VX5A 3IJ8A 2ZXDA 5GNZA 1ZU8A 2DH3A 2G4FA 1UR8A 1ISZA 5JBEA 3BCDA 2D24A 1PEZA 3CGTA 3BH4A 2XIBA 1ESWA 4PCTA 4MNJA 1PPIA 3CZKA 2JEQA 1B31A 3PN8A 3EDKA 1E0XA 3T0AA 3NSXA 1KXHA 1MYRA 4DM2A 5IFPA 1PX8A 1QI0A 1TMQA 1PJ9A 4PUDA 2XTKA 4WLCA 5A8MA 1WCGA 5A8OA 1EOMA 3AXXA 2V3DA 4TVDA 2E4TA 1JNDA 2WVTA 4E8DA 5JIWA 1XD0A 1EA9C 1US2A 1C3FA 2WLYA 5A6SA 2D1ZA 4XX6A 1UH2A 5A6LA 3SCWA 4B9ZA 1CLVA 2E8ZA 4UQAA 3T0DA 3QOKA 4PMOA 3VGDA 2V5DA 2W61A 1YQ2A 3S2CA 3VVGA 1V08A 3WEZA 2CBVA 3VGBA 2OWWA 2VRKA 1B3YA 1U33A 2ZIDA 1UZ1A 2VZSA 4TXEA 1B30A 1MXGA 4Z2HA 1KXTA 4D6CA 1X1NA 1EHAA 2WWCA 1U30A 1XH0A 1TVNA 4P7OA 1JF5A 3BSHA 1E71M 1HF6A 3RCNA 3W6LA 1X6LA 2J7HA 1OB0A 4PEEA 4CD5A 3ARZA 3FAWA 1AQHA 3VIHA 3B8SA 4MADA 1GONA 4UQEA 3U5YA 1ZBCA 4JFWA 3CZJA 5BCAA 1XYFA 1V3HA 3AS3A 1CNVA 3GXDA 1E0WA 1D2KA 3W82A 3EDFA 3TTQA 2Y8KA 3BC9A 3AXIA 3SURA 2E9LA 5A6JA 3ALFA 1HX0A 3WH6A 2XM1A 3F4VA 1E6QM 3CHCA 1MWOA 4UQDA 3CHEA 1V3KA 2QMKA 3ARXA 3N18A 3F5JA 5BXRA 4JCLA 3U5UA 1WPCA 4EKJA 4D1IA 2O9OA 4AMCA 4XZBA 2CKRA 2GK1A 4KMQA 3WDPP 5EBAA 3GH4A 3ZJ6A 5DFAA 5IFTA 4AIUA 1VJZA 3VMOA 3VIGA 3AMCA 5ECUA 2WYSA 2ZWYA 3VU2A 2XYLA 4U2ZA 2BXYA 1PX4A 1VEOA 4EK7A 3WDIA 4U5IA 2QHAA 3W29A 1J01A 3LPFA 3ZT5A 2PBGA 2QV4A 4AWEA 3L2MA 1V3MA 2VTFA 1RD6A 1E15A 2CHOA 3WIJA 2GVYA 1BAGA 2WMHA 3EDJA 5AC4A 2WBGA 4TTGA 1VEPA 5JUVA 5E0CA 3AMLA 5CGTA 4Y7EA 2VVNA 2WMKA 5A2AA 2NW0A 1J0YA 3W81A 2YL6A 4W85A 1TVPA 1UD5A 5I5RA 3AHYA 4L4PA 3BMVA 3AHTA 4J3TA 3WQ4A 2WZEA 1GW1A 3AS2A 4GO8A 1LLOA 3CTTA 3HN3A 3VGEA 2YBUA 2XVGA 4AIOA 5FIPA 2QMJA 4U3CA 1LQ0A 1MW2A 4NI3A 4V28A 5JBFA 3BAIA 3MU7A 2VRQA 6CGTA 1Q6FA 3ZJ8A 3RM4A 2W66A 2NT0A 2O9PA 2DSUA 1G0CA 1DWGM 3M46A 1E6PA 2WSKA 1UKPA 1XSKA 1OD0A 5A69A 1UOKA 4EANA 1DP0A 1JZ6A 5GPRA 1JGIA 2J7GA 1E6RA 2D0GA 3VMPA 2GDVA 3W53A 3APGA 3MUY1 5AC5A 1JZ4A 1W91A 2VT0A 3VMNA 1OGSA 4URIA 1W9PA 4P8WA 3DYMA 4AW7A 2HVMA 4HZ7A 1CECA 1WAWA 1TZ7A 2W4XA 3KEHA 3RM9A 4UZSA 3SUSA 4CVWA 2X0HA 1ZS2A 1JD7A 3AISA 1EO7A 4Z2GA 2XSBA 4AD3A 4R27A 9CGTA 3GNPA 4HPGA 1V03A 2G41A 1OT1A 4H41A 2VI0A 1NWUA 2OLHA 4P8XA 5KZ6A 2NT1A 4EE9A 1JDAA 5D9OA 5CJ5A 1UH4A 5GNXA 3K8KA 3UG3A 3ARYA 1R7OA 3FN9A 4M1RA 3WF0A 5ABFA 5I24A 3CUIA 4OOZA 2J8FA 2PWHA 1R85A 1E6ZA 5I3DA 4MNLA 3VD7A 3AROA 3E1F1 3L2LA 4WSJA 3WQ5A 4C7DA 2FH6A 3MMUA 1QW9A 1CIUA 2OWCA 2X2YA 3NCOA 1ECEA 4GXPA 5LA0A 1UQYA 2Y2WA 1HVXA 2JE8A 1H1NA 5C8BB 2CPUA 3AYRA 3AIBA 4Z2LA 5CQ1A 3MSGA 4KRUA 4HMDA 2XVPA 5M17A 1CXHA 2J7BA 1HJWA 1HIZA 5FD0A 4WKFA 4HTYA 4J3XA 3BCFA 1E3ZA 2YLAA 3SEPA 4BQ3A 1E6NA 4OJYA 2WHLA 3ZT6A 4CD8A 1E4NA 1C92A 4DUWA 1SFSA 3EMQA 3QR3A 4AEFA 5I79A 2D3NA 2W62A 1F4AA 5A1AA 1UWQA 4OBRA 3SUWA 1CGVA 4NSBA 4QLKA 4M8UA 3SUUA 1M7XA 1KR1A 1JAKA 3ARVA 1QNRA 2W91A 1WNOA 1ISWA 4JFVA 2CKSA
chains in the Genus database with same CATH superfamily
2WSYA 1KTBA 1CGUA 3O0KA 3W1PA 3PBGA 3DECA 3WDQA 1I1XA 1REQA 3LZ3A 1H11A 4H6KA 3JZEA 3WBXA 4I8YA 3WJXA 3VCCA 1UR2A 3DKLA 4ZFMA 1R3YA 2C0HA 5CLTA 1AZ1A 4GMEA 1E6XM 1YPFA 4C5YA 2BY3A 1JDEA 2QGYA 4N9CA 3UERA 4LCQA 4LS1A 1RD5A 2FMOA 2Z1SA 4HK5A 5E1QA 1XLKA 2GJLA 3WH5A 5BOFA 2OX1A 2D2JA 3STPA 3ARRA 1R3SA 1YRRA 1J0IA 2PDFA 4JFUA 3WUGA 3VGHA 5D04C 1IZJA 3M64A 3VX1A 3ZR4A 1WX0A 2ZOXA 3MB9A 4ONVA 2RUDA 3S9YA 3EB4A 4AZIA 4UOZA 3H24A 3M0IA 2F61A 3T44A 1UP0A 3ZR6A 4TUFA 4BEUA 4N42A 1T96A 3LCFA 1W2VA 1HXJA 1TJ1A 3AO0A 1UUOA 3LXAA 2J74A 1RA0A 1EZWA 2EF9A 3RMJA 4BFAA 3LTSA 3VAWA 1WDRA 3VDHA 2FGBA 5D9MA 5I23A 2VCBA 1GOQA 2OR2A 4ODKA 3VE7A 1TSIA 2EG8A 4YHGA 2QCDB 2KI3A 3EX1A 4WF7A 1VJIA 3EKZA 2XU2A 2WMJA 1AD4A 4NZFA 1Q2RA 1N8IA 3QPYA 1JI1A 4FZIA 1WZAA 2GJRA 2VO5A 4AWSA 3A9IA 3LV6A 2LKNA 1HJSA 1TPFA 3H12A 4OV4A 1DIKA 2XIJA 4BF8A 1O1HA 4ODQA 1JCXA 5BWAA 2YYUA 1BYDA 4UFIA 3FKRA 3E0WA 1JCJA 2WBKA 3TNOA 1NDWA 2DZSA 1UG6A 3UXAA 4R9OA 3O3RA 4DM1A 2VJXA 2AKZA 1EGMA 2CWXA 1UHVA 4XAYA 4MKNA 1I2OA 3GG0A 3WZ0E 3DDMA 3BLEA 2X05A 3D0CA 4DO4A 5FI8A 5DELA 5C6MA 3SCOA 3C8NA 2C7FA 1W1VA 5AY7A 1EJRC 4KWVA 4KESA 1PS9A 2YGYA 3KWXA 2A3CA 4TW7A 4JTCA 1AQFA 4DWSB 1V0NA 2Y24A 2ISSA 7XIMA 2YL5A 3BZGA 2JF7A 3VE9A 4HTBA 5I98A 4L4OA 1TX0A 1EIXA 2EPHA 1J0ZA 2HEJA 2ZUUA 3NXFA 2J27A 4Y9AA 5CGQA 3MKVA 2WO5A 3R5EA 1XP3A 4JTHA 1ZENA 4ECLA 3UJSA 3POCA 3O16A 3APTA 3VOFA 3R11A 2Z29A 1H5VA 4GQQA 4BF7A 2J25A 5A8PA 4DNMA 2R91A 1C91A 3CUJA 3WLMA 3LUTA 4OQVA 3MP5A 2J24A 2OEMA 1R5YA 2GK1B 2X30A 3MV11 1WZKA 2ZZ7A 4PC8A 4ZXLA 2Q09A 3MVIA 3SJNA 1OD8A 2F8QA 3SZ8A 4HT3A 2Q6ZA 2WCGA 1EWEA 1JVNA 4WJXA 1BG9A 4GIAA 3EOUA 3SCNA 4IQ2A 4F2TA 2EULA 2WK2A 2ZC1A 2HNHA 4JDYA 3W7KA 3RIKA 5M5DA 1XLLA 2J6XA 4B3LA 2DSKA 4OV9A 4Q6XA 4LUTA 3SCSA 1Q6QA 2PP3A 4FK9A 3C2YA 4YVXA 3V0UA 4HOXA 3TQ0A 4PUKA 1JDCA 3BPWA 1R2TA 4NX0A 2CLPA 1UA3A 2XFFA 1Q8AA 1JG9A 4H83A 2VC9A 4K3ZA 1V93A 2H3DA 4ZQRA 3P5ZA 1R9ZA 4QE4A 1OJXA 2WCSA 2ALDA 4BKNA 1IIGA 2LGOA 1GQJA 3OZMA 4J9JA 1JQXA 4PSPA 4Z08A 3OTRA 3FJLA 2PI6A 1FH7A 5HT1A 3SUVA 4G50A 4CN6A 3TKFA 4WXZA 4S3KA 4UZUA 1IF2A 4JEJA 2OO0A 1PWMA 1WUEA 4M24A 1FP9A 3UWZA 3PZQA 2E7FA 3MUAA 1XH1A 3M0ZA 5FCZA 2QW5A 2WJDA 1S5WA 2QJNA 1VBGA 2E6FA 2V63A 3N3TA 3FK4A 5C9WA 4O50A 2ACRA 2FVKA 2WJZA 4QR6A 1N7KA 3UWUA 3LERA 2P50A 5AHFA 1W3KA 3FNDA 3FCPA 2BOGX 3FSUA 3ATYA 3QY8A 4GCXA 1X6NA 2EGZA 2V3FA 4JAWA 4DZ5A 2G8ZA 2DUZA 4CD6A 1HVQA 1V02E 3AI0A 3FA3A 4H2HA 3I3EA 3VGFA 5JIPA 4I5XA 4HHLA 3F5LA 4FXFA 4O2TA 2CBJA 3IJLA 5HJXA 4OUEA 4OKDA 5DMLA 2ZR5A 3PBUA 3KOZA 2WXDM 5HNUA 3W7EA 3BGGA 3HQ1A 2FHCA 2HDJA 3LRMA 1W5MA 1Q6LA 2NWSA 4HYRA 3I6RA 2AAMA 3RLVA 1JF6A 4JIQA 4PB3A 1A5CA 1S2CA 4JQ3A 2OKOA 3F2DA 1JXJA 2E6YA 4KGLA 4AWTA 3ARQA 4QRNA 3F7JA 3GTYX 3BAWA 4CN4A 4GISA 2BVYA 1I0DA 1VHNA 1RV8A 2ZICA 3KAIA 3GM8A 3GUGA 1V6XA 1YBQA 1HKMA 4MB1A 1F8IA 4IT1A 1FH9A 2PPGA 7REQB 4PUMA 2CHNA 2P3EA 4EX4A 5E0FA 5LA2A 3SY5A 5DLCA 3CQ0A 3DG7A 4GFSA 4Q4KA 3JYJA 3ZWTA 4B15A 1S5NA 3B8VA 1MSSA 3NWRA 3RJYA 1HL8A 3JZUA 4QP0A 3THCA 5I2UA 2DU2A 3DGBA 3NDZA 3KOYA 4PUEA 4UR7A 1Z32X 4DPPA 3PZIA 2W3ZA 3DHPA 1BSIA 2YFNA 4H9ZA 3T40A 3HJEA 1M41A 3N6QA 4JTLA 3W73A 1CB7B 3TYEA 1TUFA 3QZAA 3IWPA 2C0AA 4JTSA 3AZSA 4CCDA 4DIPA 4HN4A 4FEZA 2ALRA 5F2MA 4ATWA 4CU7A 2VDIA 4R33A 3WL1A 3N12A 4HSOA 1AW1A 3STFA 1QNSA 1GNXA 5KETA 2BMBA 1MW3A 3L4WA 3OLEA 1WDPA 2HBVA 2C6QA 2F84A 3PAJA 2PTDA 1HJQA 4JQ4A 4ADSA 1B3ZA 3USBA 4KERA 3DX5A 2M08A 1AD1A 3EA1A 5FF2A 5LIUX 4W93A 4IMGA 2PWEA 3HB9A 1SJDA 2Y7EA 4IF2A 3B0XA 3EOEA 1Q6EA 4G1NA 4JHZA 3KRBA 4JFKA 5HNNA 3L12A 2XP3A 3RXZA 2PGEA 4R0XA 1XXXA 4J40A 4M1BA 3OVPA 5FSDC 1TZZA 4MWAD 1FKWA 2GVLA 1ITQA 2ZX5A 4BQ2A 2VCAA 3R8HA 4NZ3A 2ONEA 4LWWA 4HSNA 2XVLA 3S6OA 1RY8A 4JNYA 4TVCA 4DXVA 1AJ2A 1T99A 3GXNA 2IQTA 5JH8A 2X41A 1JQVA 3PR9A 1QI2A 2GUUA 3TTYA 2FPVA 5D8ZA 3CIVA 5ABGA 3KVLA 2YDRA 4H3DA 3EPMA 3PPFA 2WVVB 1TR1A 3BOLA 2XIQA 3WF2A 3W2LA 3ZT7A 1DHKA 3NYZA 1FKHA 3GTIA 5FAGA 3MQTA 3W26A 3LBMA 3WK1A 4Q4PA 2J6VA 3GVRA 5C7HA 2MF9A 2PC4A 1CB2A 3INPA 4MWAC 8CGTA 3UI6A 4R7JA 4KF1A 4HGXA 1BYCA 3BE7A 5AYIA 2NQJA 2ZX8A 3NQ2A 1TKKA 4LC6A 4KCVA 5I0DA 1EJSC 1UB3A 2RURA 1I75A 2VP8A 2YDSA 3O5IA 1PIGA 2L2SA 5C2GA 4IIBA 2I5IA 1BQGA 3UWYA 2VEPA 3H2EA 3KCEA 2J7FA 3GDRA 4IXXA 2X2GA 3KVKA 3WEMA 2DIKA 1P4CA 3R1ZA 3V16A 3Q58A 4QITA 3T4CA 4DRQA 1OQFA 4QTGA 2F6XA 3LS9A 1A3HA 3IS4A 4JX4A 2AWGA 4WIWA 2CZVA 2V38A 2JZVA 1VYPX 1R87A 2OZ8A 2UWFA 4S3FA 1JZ2A 3ZJ7A 2ZDSA 5C7VA 3LCXA 2AAAA 1GORA 1SZEA 1IT0A 1E0VA 2OVLA 4V33A 1XLBA 4AYGA 4LSBA 3TZNA 3XINA 4NJJA 2QF8A 3DBNA 1KBLA 1OIMA 1J6OA 3QTPA 4L72B 1E0TA 3R58A 4GQRA 1I2PA 3I4EA 4IMEA 2V82A 1ADDA 2D20A 2Y5SA 1Q4WA 1EHNA 1FKJA 3MUIA 4GJJA 2XZ9A 1C8XA 2DY3A 1M1BA 1A3WA 3CC1A 2PDQA 4ZXOA 3ITYA 2RKXA 4W7VA 2VFDA 4F3HA 3D5HA 1B3VA 1W3TA 2HSAA 3VAVA 3H4WA 4AQLA 1ICPA 1L1PA 3IIXA 1AMYA 3EB2A 1NMWA 3AYVA 3S2LA 3ITXA 3UR5A 2VEFA 3QV9A 5F2LA 4UQBA 3EMCA 3TYBA 1LG1A 2WWDA 1TPDA 4MWAA 2QT3A 3WELA 3E96A 1LBFA 5CZTA 3LLDA 3IJIA 3DFSA 4DB7A 1J11A 5EYWA 3T2PA 1EF3A 4FA3A 4M7SA 1XISA 2J78A 4L6OA 3W24A 4LX4A 1FVPA 2FB2A 2V5JA 1A5BA 4Z2IA 3ZVHA 2ZRXA 3GTNA 3PAOA 1UBPC 4GOAA 1DTUA 3LNPA 4Q8NA 1KM2A 2FDMA 5C54A 2QZRA 1FCVA 3VZYA 1DJYA 2HRWA 1JI2A 3S8HA 2VEMA 3KBMA 5EMKA 4CQDA 3R13A 3WQFA 2W63A 2ZUWA 4S23A 1XFCA 3VGGA 4W4QA 6PTDA 1X97A 2ZRWA 3OG3A 4PODA 5IRPA 3BW3A 3W07A 1DVJA 3VIOA 3O07A 3WK2A 2MNRA 3NGJA 3H2NA 3N2XA 1T7LA 3PSWA 4B92A 1RCOB 3ABZA 3M7WA 1WKYA 5GQBA 4O1EA 3TW6A 4Q7IA 1IZKA 4R5EA 2DSZA 1B3XA 3NDOA 3NFUA 3LM3A 4CEUC 1DXEA 4FXJA 3ECQA 3TCZA 5C55A 1ZCCA 3S2JA 4U5KA 3LLXA 1P1MA 3R8GA 1U83A 3LGGA 4M19A 3GZ3A 2H9AB 4LF2A 2Z1KA 3EZ4A 3U3HA 2ANUA 1HKKA 1P7TB 3OG2A 5GJMA 1TMHA 3DG3A 2R1MA 5D32A 3CYVA 5I3FA 2VEIA 2YSWA 4XZIA 5D4YA 1S3HA 4OE7A 2XWDA 4AD4A 3M0KA 1G7VA 5G1TA 4GVFA 2BLEA 5CG0A 1WDQA 3KLLA 2ABBA 4K2SA 1GVSA 1P43A 4D8ZA 3GDBA 3WLPA 1PBGA 3F1QA 1K9FA 1KM6A 2Y78A 1POJA 2BVTA 3IIPA 2QVNA 2G3MA 3I7SA 3UR8A 4JQ2A 1QU4A 2NUWA 5KEZA 3VUSA 1IXPA 3H2CA 3QHOA 2WB5A 1XBYA 4C6FA 4FOKA 2CNCA 1P1XA 4QCFA 3W70A 4C6DA 3MS8A 2TPSA 1OADA 3R7MA 1LRNA 1J4HA 1QRQA 3OVRA 2V5CA 1YIXA 3IPWA 1BD0A 4CNNA 1G9HA 1AW5A 3R12A 4IH3A 1X1ZA 4DYKA 3DOPA 4JTGA 4IWWA 4PMDA 4UXDA 3CMJA 4EPKA 3W7MA 2KGJA 1SVDA 2J9YA 3D3FA 2YCKX 2NQ9A 4Z0SA 3BARA 4O14A 3VD5A 4GVIA 5T9CE 3N29A 1Q7QA 2WAGA 2WPGA 3G1DA 4AXNA 1KFWA 1WDSA 1MXSA 3F4CA 4M56A 4HZMA 1KGUA 1UROA 1AW2A 4LAZA 1HP5A 4E3VA 4JPGA 1OYBA 1BG4A 3WDHA 5HMEA 2VRJA 2OX4A 3WUFA 1DTNA 4V2XA 2F2DA 2Y5JA 3ABSA 5DMMA 2BHZA 3QQ0A 1UYQA 3EIPA 2BB0A 2AQWA 2R1KA 3CUFA 2A3BA 4H7CA 2Z28A 3TP4A 3E02A 3GH5A 3TA6A 3C0LA 3W2JA 5I3KA 1GQNA 3GHSA 3QMRA 3AHXA 4E5TA 3KTSA 1XGEA 3WLIA 1U5VA 3GNNA 3M44A 1OG0A 3WYZA 4CKQA 2XN0A 1GOXA 3WNLA 2BSLA 1U5HA 1VCFA 1W3LA 1YXCA 4D71A 4HMEA 1AMKA 3BLDA 1QBAA 2VWSA 2AGKA 3OGSA 5H91A 1LOQA 2EXOA 4YJ5A 1S46A 2JKEA 1GYLA 3C3UA 3UFYA 3SQSA 2QJJA 4UCGA 3ARPA 3P61A 4Y96A 3OBAA 3B0VC 1B3OA 3GTFA 4S2BA 4A2SA 1D6OA 2ZUNA 1E6SM 2DZWA 3COTA 3RNDA 5F7UA 2J4GA 3N2BA 2R24A 1XLMA 2VQTA 1ZP4A 2J8GA 4WHBA 3M0YA 4XAZA 4F8XA 1MW0A 4AY8A 1QWGA 4UQ9A 1KFKA 3H9RB 2EPKX 2VNCA 4IGMA 2YR1A 4ICMA 1LM1A 3WQEA 4LQ1A 1PTGA 2C18A 3B97A 3M43A 1GVEA 1X1OA 3ITOA 1Z69A 1R3TA 1D7HA 4N02A 3OBEA 3Q65A 1BRLB 1UR0A 4F9DA 5G2IA 1CGYA 1CENA 2ZWZA 3S1GA 1K77A 5B7ZA 1ME7A 3OZPA 2PLJA 1XHGA 1K9EA 3MKCA 3PBYA 4EXQA 1H7XA 4AZCA 2IMRA 5F1VA 4HCLA 2L5HA 1VRXA 5HPOA 1BWKA 1DQWA 2YB1A 3S6TA 4NKCA 2IPFA 2JEPA 4IFKA 1K8YA 3HBLA 1NQ6A 3WG6A 3WLOA 1M53A 3EPOA 2XUCA 3NL2A 4GY7A 1F05A 5AYYA 1SZRA 3IUDA 4HARA 1C93A 4MYXA 3NO5A 1OBAA 4IPIA 2WVUA 4LV9A 5HUPA 1K7FA 3S83A 5XIAA 4JD4A 1J0KA 1DQXA 1G6CA 3CMFA 1PZ0A 3P84A 2WSRA 2YLLA 5T26A 2XP9A 1QUMA 4BZYA 4Z1YA 1WXJA 4GHRA 4LF1A 2VFFA 2WHJA 2FZMA 1V0MA 5DITA 4ZB5A 4HA3A 4HOWA 3GXFA 4Q4SA 4MNMA 4ZL1A 1HKJA 4GIRA 4JEQA 4GYKA 4AEEA 4GUFA 3NZPA 3VILA 2NLIA 1A80A 5IDIA 1DWFM 4KQNA 1KXQA 4YTTA 1A0EA 1IEQA 3EEZA 3DI1A 4JKLA 1UOZA 5G4WA 1B57A 3IKGA 2OJPA 3W22A 3ES7A 2W6RA 1GQLA 3RHGA 1BQCA 1OG6A 3W72A 4DWSC 3EEGA 5CSUA 5LZLA 1NARA 4KCWA 1CGXA 1ITCA 2XP7A 2A3HA 5AN7A 1EQ3A 2V2HA 5LA1A 3T0BA 3MUZ1 4J4KA 4O10A 2DZUA 4IG2A 4DT4A 5I02A 2G3FA 1M04A 4A29A 3UQAA 4TU1A 3AQUA 4C1KA 4QT3A 3L4ZA 4IP7A 2C1GA 2PDNA 4G6CA 2Z00A 5HATA 2OGJA 3FW6A 3VIIA 4IQLA 1GOWA 2VR5A 1P0DA 3K2GA 5BROA 2QPUA 4L64A 2E25A 3XIMA 1EL3A 2D9FA 2YFOA 4IP4A 4Q8PA 3A5VA 1FWGC 1O1ZA 1GZJA 3HPFA 1HTIA 4OIFA 1LRQA 4IPXA 3PB2A 4YHEA 1FKIA 4KEVA 1I45A 3RR1A 1VCVA 4FI4A 1CCWB 1ML1A 5BYWA 2HS6A 1XI3A 2DQWA 4FP1A 4E4UA 1SUXA 4O53A 2DH3A 2PDUA 5PTDA 1F6KA 2QCLA 5JBEA 4NT0A 7ODCA 2YCLB 5FF0A 3M0LA 2DFAA 3ANYA 2V0TA 4MLJA 4LNYA 4XKYA 3R43A 4MNJA 3WQOA 7TIMA 1TPUA 3N2TA 3AJXA 1KXHA 2RHGA 4NHVA 4S3DA 4DM2A 4G56A 8TIMA 1HO4A 5K9XA 1QI0A 1IEIA 3WQDA 1OCBA 5D2YA 3AUJA 1AG1O 1I60A 1FDJA 1A5KC 3QV6A 1KFCA 3QVQA 4PCPA 1XD0A 2CLEA 1EA9C 4DIAA 1AL7A 2OPJA 1QPNA 4GYJA 4O1AA 4A8RA 1O4UA 2R1PA 4JIIX 1S5TA 3P80A 4XAFA 5CZSA 3T0DA 3C56A 5FEPA 2PTYA 2W61A 2WSQA 1H60A 1KRAC 4C6EA 4FN2A 2CBVA 4X2PA 3DU0A 1EXBA 2W0UA 2WNNA 1EUNA 2VZSA 4TXEA 1B30A 1MXGA 2QJHA 1KXTA 1PCWA 4D6CA 1X1NA 3DXIA 3W2UA 2CLLA 1XH0A 3HQOA 4P7OA 1KD0A 1JF5A 3PRAA 2ADAA 3N9RA 4RDVA 3EXRA 1VPQA 4ZQNA 3CL6A 2X16A 4QJ5B 1OB0A 1YADA 4CD5A 4GBDA 1AQHA 1GONA 1OC6A 3BW4A 4E3TA 1XYFA 4FOUA 5DANA 4H6QA 3GVWA 3KVJA 1MNSA 1E0WA 3WLHA 2KE0A 1R38A 2FLIA 3GDMA 2Y8KA 3BC9A 3AXIA 4Q8UA 4ZTXA 2E9LA 3ALFA 1HX0A 1F6PA 2XM1A 3LTYA 3LI1A 2PDXA 1MWOA 1V3KA 1XIBA 2QMKA 2OODA 4DRIA 3SQLA 3UF9A 2E67A 2PWUA 1DJNA 1PKNA 4EKJA 4FOJA 4D1IA 1RJQA 4WUIA 1D3GA 2GK1A 4KMQA 5H8UA 1HGWA 5BNKA 5DFAA 3R25A 4ALDA 1FX6A 3BUVA 4XUGA 4AIUA 1VJZA 1QR7A 4IMDA 5ECUA 1XLHA 4EF8A 2E09A 3VU2A 2V8ZA 2XYLA 4A8NA 2BXYA 3N4EA 3RITA 1VEOA 3WDIA 4PRRA 1YX1A 1ADSA 3UR2A 3O5GA 3U48A 4AUBA 1RK6A 1A5SA 3W29A 3LPFA 4A8IA 2PDPA 2QV4A 4DJFD 1A49A 3CPRA 1QW7A 5E0CA 3KCLA 3AMLA 4E0CA 5CGTA 1QK2A 3RF9A 3V3WA 1YW1A 4D2JA 3E2SA 5A2AA 5KMYA 2PWVA 2YL6A 3S5NA 3TYAA 4PB4A 4XIMA 1UD5A 3RLHA 3AHTA 4BI5A 4J3TA 3WQ4A 3VKAA 3AWOA 1SR9A 2XVGA 2QMJA 2PP0A 3G1AA 5FEWA 2WV8A 5JBFA 1UJQA 2W66A 4M5PA 4UDMA 3P93A 1ZNNA 1JGIA 3LCGA 1E6RA 3W53A 3APGA 4IXHA 1JZ4A 4YTRA 2GLKA 3VMNA 4MUZA 4V1YA 4L9ZA 3DYMA 1TV8A 3V4BA 4MZ8A 4PUNA 4HZ7A 1TZ7A 1LZOA 4RK8A 1IEVA 4LVGA 1OX5A 3B03A 4H9YA 4CVWA 4HK7A 3IACA 3UYCA 1Q8JA 1IWBA 4UB9A 5REQA 4CQCA 3NL3A 4MFEA 4AD3A 3UF8A 3OHMB 2QJGA 3VNLA 4RZ5A 4HPJA 1V03A 3TX9A 4FAMA 1NWUA 2OLHA 1EYWA 3G1YA 1EEXA 2FMNA 5GNXA 4A21A 1P5QA 2VUNA 3UG3A 3ARYA 1R7OA 3FN9A 4BK9A 3WF0A 1IXNA 4JFLA 2J8FA 1R85A 1E6ZA 5I3DA 1ONRA 1B9BA 5T9BG 3WQ5A 3BWWA 4A8LA 2IPJA 1UR3M 1NFPA 1VBJA 3FDGA 3TW7A 3VK5A 2PGRA 3TLLA 5C8BB 2Z7GA 4Z2LA 5CQ1A 4HMDA 5M17A 3MCOA 2JQXA 2X1RA 3KDOA 1HIZA 4WKFA 4J3XA 3BCFA 1N2VA 3WCZA 1ZJHA 3AALA 5AYZA 1E4NA 4TQTA 2RDTA 3I4KA 4YS1A 1VLIA 4DUWA 3QR3A 4AEFA 2E77A 5HWNA 1T6MA 2V6AA 4EWJA 4RXGA 5HMDA 3LSBA 4FB7A 2OFNA 4PB5A 1M7XA 2VFEA 3U2EA 3IIOA 1YDYA 1TJ0A 2Z1WA 2W91A 1DIOA 2CKSA 4ORIA 4RDYA 2CZ5A 1VENA 3ARUA 3UJEA 3KACA 4DBUA 3ATZA 1QPFA 4WY0B 3M16A 3R0DA 5DXXA 3LCWA 2E8YA 3H7UA 3ZJKA 4AC1X 3B9EA 6REQB 3A47A 2QDEA 3E74A 3UJFA 3C61A 3T2OA 5E9XA 1Q13A 1K70A 1L6WA 1J5SA 1EB3A 3T0TA 5DQPA 1PO9A 3DC0A 3LPGA 1KFJA 2H6RA 2FZDA 3I3BA 2FKEA 2PN0A 1OABA 5B7YA 4FLOA 2XH0A 4K1GA 4RE2A 3SCUA 2Z4GA 1FXQA 3OA3A 3LRLA 3HGOA 4GCAA 5M3WA 1EH9A 1IEXA 4DJFA 2IF4A 4LVBA 3CUGA 1KLYA 3HQPA 2EPNA 1OK6A 3O15A 1OT2A 1P0EA 3E5BA 1W0MA 3GDTA 3BURA 4L3NA 3BMBA 2P88A 3PZUA 3OEXA 1UD6A 3RU6A 2A4AA 1Z7AA 3S3GA 1UR1A 3KBSA 4FXRA 3C5QA 1YE6A 4R88A 2F7FA 3S1UA 5JXQA 5EFFA 2PDCA 2XIIA 3KP1A 3ALGA 4C6LA 2FYMA 2VCDA 1TE1A 2PURA 1A5NC 3W25A 5K4ZA 2WW5A 4V15A 1QZ2A 3PZVA 1XPYA 4W88A 1EXPA 5T8GA 4NL1A 4PTNA 2CYGA 1LYXA 1UD2A 5B8IC 4ZOEA 3CHFA 3I7RA 4ZPTR 1QHZA 4O19A 1GKRA 4CCZA 1EJUC 3KRUA 4FX7A 3IJ6A 4RJEA 2VHLA 2GOUA 1BGAA 3TA9A 1FKRA 1CGTA 4DQWA 3S47A 3R79A 1HGYA 3EAUA 4GJ1A 5A5WA 1WOBA 1O12A 1OFAA 5D2VA 1HKWA 3S6DA 3SIZA 1MQPA 2YJQA 2QIWA 1W1IE 4N9EA 1FBAA 4JYEA 3F4DA 4QX4A 4X22A 3N19B 3E38A 3UG5A 3C2OA 1F74A 2PUZA 5FEZA 3LB0A 4M0XA 3UGRA 4L9XA 1JZ3A 4ENLA 2HCVA 4M80A 3TJIA 1XIIA 1Y7VA 5DEZA 2BY1A 3BAYA 1TX2A 4ZZ9A 2VGBA 1HW6A 3WEOA 4Q3MA 1LJYA 3AXHA 4NJGA 4JFSA 2VGIA 1XRTA 1V79A 2OT1A 3STCA 2GQ3A 3HGJA 1LWHA 4DBEA 1RCXB 5FL1A 1W1ZA 2YZRA 1DORA 2HISA 2WHMA 2WVSA 3G1RA 4F2BA 4M6QA 1YTDA 2X09A 1RP8A 1UJPA 3LUOA 1JYXA 2HQAA 1AUSL 2WOQA 1IE7C 4J28A 4C90A 2GVJA 3QQWA 1OZQA 3HFYA 2DT3A 2TRSA 3PS7A 2QAFA 4JDBA 5CZ0A 2PF8A 5I77A 1IEWA 1EA0A 1CGWA 1GVOA 3T4WA 4DF0A 4AIBA 2FKPA 1FOBA 4ZMGA 1BYBA 4K37A 1S2TA 1DJWA 2DSWA 1OWQA 1ZY9A 1YPXA 3MZNA 4FS9A 1A50A 1E4MM 3WLRA 1E72M 2CESA 3AS0A 1FKDA 5U7SA 2WJFA 4AHOA 4JIEA 4P7QA 3TAKA 2OLSA 3UZJA 3VNMA 1KB3A 1W6TA 3LCIA 4LOCA 3SUTA 1LROA 4LAUA 1UPPA 3VNYA 2NVAA 1TV3A 5HJLA 3L4VA 3PNZA 4DZ3A 4X61A 3NSMA 4BF5A 1DXFA 1QPKA 4JNMA 3E2VA 1TWWA 3NTYA 1QTWA 3T9PA 3EWBX 1MEWA 2CBIA 3OZOA 4K7VA 4KWUA 5LNWA 1VC4A 1VD6A 5FACA 1XYBA 1AVAA 3SCRA 4ZS6A 3MT1A 2DJLA 1OY0A 5BXPA 2LJ4A 3NAVA 3UZYA 3FVDA 3UESA 1UD3A 1Y5WA 4BI6A 3C0SA 3S5YA 1OFEA 4AZ5A 1FWBC 1JCLA 3W7OA 1W3HA 1X96A 5DCDA 1SSGA 3WJZA 1BEUA 2X1SA 4E6MA 3VIKA 1ZBVA 4AZHA 1TWDA 1IX5A 5I09A 1JD9A 1FCUA 3ZR5A 4HNLA 5A3HA 3RN6A 1RPKA 2G3IA 2V69A 1G67A 1IHIA 2ZA3A 5G2HA 1O95A 4I90A 2A3LA 1T5AA 3U8GA 2PCEA 1XF0A 4E4FA 2O7SA 1RSCA 4GZEA 5IOBA 4PMQA 3G22A 4JTEA 2W5FA 5E93A 1VPYA 1F9CA 2CLOA 3LLFA 2VUYA 3AMKA 1PSCA 1UASA 2FH8A 3WDJA 3V35A 4DO7A 4R53A 2ZCGA 3GFXA 2CLKA 3KX6A 4RX0A 4GZJA 3OIHA 4W8LA 1K6WA 1ZB5A 1MEIA 2QUUA 2FB3A 4LUSA 3KBJA 3AZTA 3MKKA 1TV4A 3E0FA 2GGGA 5DCEA 1OX4A 1UKSA 5C9XA 4DRNA 3LBOA 3I65A 4J3WA 2Q3OA 3IGXA 4AMAA 2J75A 4L61A 4I7VA 5C2XA 2XWEA 3Q2DA 4PUJA 1W3IA 5A2CA 2WZTA 3THUA 3LY0A 3TOYA 1JCTA 4Z42C 2PEVA 1HT6A 1BLIA 3UQNA 1O6IA 2P76A 1N1AA 5FF3A 3EKGA 4PYSA 5CBBA 5BOEA 2QYGA 1DJIA 3PG9A 4L7ZA 4OU1A 1OK4A 3PUDA 3N4AA 3CK5A 2YOCA 4H04A 3SGGA 2YA2A 3DFQA 4JTJA 1T11A 4JFTA 2ZUTA 3KDNA 4AHPA 5LXXA 3I10A 4XVEA 1QI4A 2NLYA 2VFHA 3QHMA 5AYXA 3LU2A 4Q8TA 4REQB 1DXIA 2V67A 3N4FA 4UTJA 5HW8A 3OLGA 3MPGA 3DG6A 1HQTA 5C9UA 1E51A 3THAA 1TA3B 4QDWA 1WP6A 2GUYA 6ENLA 4F0RA 4F0MA 5K4XA 3DYPA 1GQKA 1C8QA 4FNTA 1VFFA 2Y5EA 1KBJA 3TFCA 2QCCA 2NSXA 2F2HA 5D03A 4ZSTA 2CU0A 3WSUA 5G5IA 5CSSA 3NZGA 3ITTA 1NH6A 3GDKA 3SW6A 2H3BA 4HNUA 2HVNA 3ZFHA 3EPNA 4N4QA 3ZLHA 3RPDA 4EAMA 1LTDA 5FJIA 3QXBA 4J3VA 3OGVA 4NAEB 2RGMA 3WMLA 1HFBA 1WZLA 1SW7A 2MANA 4W8AA 1LUCA 3AU6A 1E1EA 2UZ9A 2WJEA 1W9VA 1LORA 2CWNA 3K4AA 4PMUA 1GVQA 4HSHA 1A4LA 3M0XA 2QV5A 3IJ7A 3W1QA 3QN3A 3KZSA 1S2WA 4AVOA 2OSYA 1FKTA 1W1PA 2F6KA 3GYEA 3V1HA 3O8AA 3G3DA 2A6LA 3VNKA 1XIGA 3PVFA 1VJSA 4TV5A 2Z25A 1E5JA 3N13A 3M41A 1TO3A 1L6SA 2A2IA 2DJXA 1J4RA 2OYLA 3BAKA 3R0KA 3O7UA 4JCMA 3WBAA 1ALDA 4FIQA 3L9CA 2YW4A 4EAYA 2ZZ1A 1SO3A 1WV2A 4H8UA 2VZTA 3S5ZA 5DO2A 2W67A 3LG3A 3SCPA 2RH9A 3F2CA 3UPWA 1OFDA 1TPB1 1C8YA 3O06A 1LG2A 4GJIA 3ZMRA 4NI8A 3AS1A 4GIYA 3GQYA 1J2BA 2P10A 3TK7A 3PZ9A 4ERIA 4RNHA 4UIOA 2QJIA 3ABRA 2YCEA 4H01A 1JXKA 3UPMA 4PMXA 3UXDA 4KCTA 4CU6A 1H7RA 4YMZA 4OFCA 1J79A 2GJPA 4HNOA 3VDCA 2OSXA 2DT1A 3T2QA 3HV8A 3KL3A 3VNDA 4C1NA 4DRJA 3H4GA 4MGVA 2X0SA 3GXMA 2ZC8A 3CZ8A 4GA8A 5IHSA 3QHNA 3MHUA 4JN8A 4K1WA 4Y8EA 5MKGB 3C52A 4FNUA 2JK2A 4NRSA 2PDHA 2XISA 4E2VA 1BVWA 3KAGA 4JZ5A 3W74A 5AB3A 4C6BA 4HNNA 4PMNA 4HN8A 1QOXA 4UUIA 1DV7A 1HJXA 1E4IA 3WLLA 4UMAA 3Q94A 4MVAA 1XYZA 5XINA 1NOWA 1RY0A 1XIMA 5D05A 1O7AA 3L4YA 2R14A 3W1XA 4MSSA 4IGHA 3W7PA 1VFSA 3PJUA 1YEYA 3I6CA 1NTHA 5M1TA 3T07A 3KM8A 4OWGA 4YWSA 1DJQA 2WCAA 3NIYA 4K36A 5AC7A 4YTQA 3CEUA 3L4UA 5AHMA 2PDWA 1G4SA 2UY4A 3U57A 3KFTA 4ML4A 1YDVA 4HHPA 3IJ9A 3WH0A 3UWVA 4G2PA 1VRDA 3O6YX 3E2QA 3PBMA 2Q8XA 4ACZA 1W1B1 1ZAJA 1XYCA 1GHRA 1QT1A 3BG9A 5EB8A 3G1HA 4DBSA 1RPXA 4MF4A 2QVHA 4J4OA 2GJXA 4FIRA 4ICNA 4CGTA 4NXSA 3B8WA 4AG0A 2R1NA 3AMDA 1JPKA 4RNIA 5ABHA 4GK8A 1XM3A 2NV2A 1DWHM 2PWFA 3CUZA 3FHAA 1PKMA 3MDUA 3QEZA 1W17A 2Z2UA 3OGRA 2W27A 5C71A 4NX5A 1F4HA 4O57A 5EMJA 3PANA 4IPJA 2ISDA 3VDGA 3AXMA 3O6AA 4GLEA 4HZ6A 1XLEA 1LLWA 1V3LA 2CLFA 1GJPA 1Q5MA 3K8LA 2OSWA 2Y8UA 1U1HA 3G8EA 1QHPA 1MFVA 3KW3A 3DYOA 3WLNA 1BKHA 3P3BA 2GVGA 1RBOB 2JIWA 4Z2JA 2J13A 2QCEA 1O66A 3AU2A 4J27A 4JKKA 1VIWA 1R8LA 2E5DA 4IIHA 5I06A 1TRDA 3C2EA 1XCWA 1US0A 1LBLA 5EL1A 3VM5A 3R8RA 2YZ5A 4H9MA 4K68A 1FWWA 5LSMA 1E1CB 1XIFA 5E0KA 1H5YA 3S5SA 1CBGA 1D7FA 2DT0A 2VQUA 1VH7A 1W9UA 5AC8A 5CPLA 4LVDA 1FWHC 3K4DA 4P7LA 4UTIA 1E4LA 1BXBA 5I6SA 5KZMA 1E55A 1RBAA 5HAOA 3DCPA 2SFPA 1L9WA 1H7WA 2OQHA 4RW3A 1DWIM 1PV8A 5MF5A 1W3NA 5DF0A 4IX0A 3AICA 4JBRA 3USZA 2Y89A 1W1A1 2J9XA 2I56A 4U4MA 2V2DA 1XV8A 2WSPA 5LNVA 1GVYA 3VOHA 3GIPA 4J7RA 3H26A 3OOQA 2GJNA 3GHTA 3TN3A 4KH2A 1E73M 3KWSA 4WK9A 4L1GA 4RW5A 2Y62A 1GJWA 2E9BA 4S38A 1W5NA 4C6CA 4Y6GA 2J47A 3GNOA 4P7NA 1W54A 1J0HA 3JU2A 4I9AA 2REQB 2YCJA 1KM0A 1KRMA 4PN2A 1KCKA 1SW0A 3ZM8A 2UY5A 2VWTA 4GKLA 1US3A 2PDLA 3NZRA 4MWAE 1E3XA 2YXGA 5CLWA 3QZEA 4I9MA 2XP5A 1BYAA 2VURA 5BRPA 3AYTA 4XTDA 1OEPA 2HROA 1XQLA 2ATMA 2PZNA 4DI8A 3CWHA 1Y8BA 4YPJA 3ARSA 3C0JA 3UBPC 1EGVA 1W1YA 1OHLA 2NXGA 1V0KA 3MI2A 3PULA 4J3SA 1E70M 2A7NA 3LM7A 5CPTA 3B8IA 4MFDA 3OB8A 1XLFA 1Q65A 2QULA 3WMBA 3W88A 4EXBA 1LQ2A 4HA1A 4GIEA 3TONA 1X7FA 1NFBA 4ZB0A 3DKJA 3NJ3A 1VBUA 1ZBKA 2CITA 5HUAA 2PU1A 3DUGA 3O5DA 4F79A 1MFUA 1GVFA 2YBVA 3NO1A 2WKJA 3W4RA 1GZGA 2LPVA 1B6CA 5HWMA 1A5LC 3DI0A 3MA8A 1E1FA 3EYPA 5B80A 1QATA 1A7XA 4D6HA 2V81A 3M7SA 3ICJA 1FD9A 3IANA 4O52A 4HP5A 4RV8A 1LT7A 5A95A 4LS2A 3VTRA 5ABEA 1RCQA 1CT5A 2E68A 3DFYA 4AD1A 4B4HA 4KGJA 4Q32A 4KRZA 4OHQA 4NASA 3UG8A 2DZBA 3GD6A 3OLDA 2A7RA 4EIVA 2V2CA 2PTXA 4QG6A 4LTSA 3UWEA 4EOUA 1REQB 2FDSA 5C2CA 4ATLA 1OVDA 1XFBA 1LL4A 1IYXA 1H1ZA 4JYDA 4CN1A 1AJZA 1J9YA 3SRFA 4MG4A 4YIWA 2V3GA 4PCNA 3GDLA 3P7YA 5AHIA 2I5GA 3ANVA 2GL5A 1G01A 2XH2A 4J5NA 5G2WA 3W0KA 3W7CA 5DT5A 1QK0A 1JZ8A 3HJZA 4TW8A 4U31A 4CD7A 3VM7A 1MDRA 3SGZA 5DT7A 5AZ1A 3KVMA 3RFAA 1UBSA 4MYAA 5JU6A 3UCQA 3T08A 5HANA 1OIFA 3CV2A 2XDFA 4GIVA 1JZ7A 1JDFA 2ODOA 3VIPA 2VX7A 3MMWA 2XPKA 4B5TA 4JQAA 2PTZA 4KWOA 1XJBA 4NF7A 4NYUA 1XGDA 4BHYA 1LBMA 2G5WA 5EY5A 4GQBA 1KTNA 3A3HA 4GNKB 2PV2A 4D6FA 4HHHA 4C60A 3FJNA 2VENA 5E6YA 1MUCA 5BU6A 2PC8A 4KR0B 1VYRA 2RJHA 1KQZA 3M6DA 3TWAA 3NTPA 3E49A 4D8LA 3BJSA 4FPSA 4G7FA 3I7QA 2NVCA 3WLKX 3DERA 4FX8A 5EMMA 1KT1A 2WMGA 3W2MA 3NG3A 1S2VA 2BHYA 4JFMA 3DFHA 4FMVA 3I68A 4LUYA 4QROA 3CBWA 3WDRA 2WZIA 4HU0A 1SGJA 3LPOA 4ZQPA 1UW9A 2O56A 2QKFA 3M5XA 2PV3A 1NOFA 4JXCA 2DZPA 1L0PA 2C15A 3T8LA 1X98A 3P62A 3A13A 2CERA 3CT7A 1A47A 3VIJA 3GYCA 4O12A 3ES8A 2QXWA 1XYLA 1WBHA 1GT8A 3L0GA 1NWTA 2E9MA 2VZUA 4US5D 1UIOA 1CX9A 1TWIA 2HPMA 3NPXA 1GEHA 3KL0A 1HP4A 4LPCA 4QEEA 4HVXA 1UWTA 3GTHA 3OBKA 3QM3A 4FLSA 3WH8A 1EF2A 4ZOBA 3SIMA 5A8NA 1ZLPA 2W92A 1N8WA 9RUBA 2QDGA 3QYSA 1PXGA 1HL9A 1TV2A 5SWUA 1KGWA 3FGCB 2J79A 1YXDA 2BY2A 5CSRA 1JCYA 2QCGA 5CGMA 4BWLC 2Q01A 5JH2A 1KA9F 3O63A 5I78A 2XG9A 3H7VA 3THQA 3I6EA 3W2KA 2ESCA 3GC5A 5CH9A 4V1XA 3VUPA 1VZWA 1CXIA 3IIZA 4O13A 2B0MA 2B7NA 1JL8A 4GZ7A 3VDBA 4XB3A 4CNPA 1H50A 2WNZA 3VDAA 1XKJA 5KSWA 2XPAA 3KABA 5KINA 4CD4A 4JIPA 2A6NA 1MZHA 3W7HA 5EA9A 1EDTA 2A3AA 5H6HA 4ODMA 3T81A 4DUVA 5ENLA 2CCRA 2C1IA 2IUZA 3HOJA 5K7JA 1Z89A 4CCCA 3WJYA 5DO8A 3E5PA 3LQGA 3TV8A 2ZXBA 1F7BA 1I0BA 5CEWA 3PJTA 1GOKA 2OXNA 3PK7A 1JGMA 2Q3RA 2WMIA 4LUTB 4DXXA 1OF6A 4NJHA 5HXMA 3WH9A 3MMDA 1O94A 4MGGA 4H00A 1QO2A 3GKAA 4Q6JA 2BNJA 1WUFA 1KR0A 1XG4A 5TNVA 1O5KA 4XO7A 4XZHA 3YPIA 3TCSA 2V3EA 4W9PA 3SRDA 4B2DD 1MI3A 3H7RA 1ONWA 1FRBA 2WZHA 1WO2A 4H9XA 4YTSA 1QDSA 1KXVA 4E8GA 2J7DA 3MSDA 4UR8A 3P8JA 1WXZA 2RDUA 1QOPA 4JTRA 2BX7A 2CC0A 3TC5A 3XISA 2Q71A 4M81A 5EMYA 4P8VA 3AYSA 4G7EA 4RDZA 2QPXA 3CAQA 1UWIA 4FF7A 2Z1VA 3TDFA 3R6IA 3W28A 1Q2SA 5HR6A 3VABA 3ZZ1A 2FVMA 4F0KA 4QDMA 4XD6A 5AYBA 2F4EA 2G95A 1CLXA 1PHWA 2PP1A 2C13A 2YYTA 4W7WA 4IGNA 3SI9A 4HB7A 1QBBA 4PUUA 1H7OA 5G4HC 4XAPA 2ZXDA 2QUTA 3QR1A 5I00A 3CB3A 4IP5A 2G4FA 2O55A 3VFCA 1FWSA 4IICA 4BI7A 5LKYA 2HMCA 3FA5A 4LBSA 1SSDA 3CGTA 3CIWA 1YDOA 2IW0A 1LQAA 4MHBA 4BWLA 4AFYA 4GQGA 4GUGA 1FCQA 3DH7A 2XH7A 3E6EA 3M9YA 3PN8A 3EDKA 1MUWA 4F0HA 2PDJA 3CV6A 5IFPA 3KADA 3QYQA 1PJ9A 5JH1A 3FEMA 3REQA 3VKDA 5BOOA 4B5VA 5A8MA 2OLAA 3S1WA 1TPVA 5TAOA 2V3DA 1UUMA 4F0LA 4E8DA 3QTGA 1US2A 2Z1BA 2D1ZA 4XX6A 1UH2A 4US5A 4HU4A 1IT7A 4IT6A 3SDOA 2BOEX 4B9ZA 1K1DA 2E8ZA 4UQAA 2PDIA 1RA5A 3LTPA 4R7WA 4HD5A 4PMOA 1GK8A 3VGDA 1W56A 1YQ2A 2OWWA 2VRKA 1B3YA 1U33A 4WOQA 2ZIDA 5DIVA 1E44A 3GR7A 3O1NA 2B7QA 3QKZA 4UTKA 3UZ5A 3RX2A 1YBQB 4DI9A 1EHAA 2WWCA 5EKYA 1TVNA 2OB3A 1X39A 4A22A 1V5XA 3IV3A 1CI1A 3SADA 3W6LA 3M5VA 4FX6M 1GVRA 4PEEA 3G1VA 3FAWA 3V36A 1F3EA 3VIHA 4UQEA 1R3RA 3GVQA 1ZBCA 1UC4A 4LB3A 1V3HA 4KW2A 1WDWA 3PR2A 3BJTA 3GXDA 2QDDA 1D2KA 1K4GA 1RK5A 5E5CA 3MUCA 2FZNA 2POZA 3GVGA 3SURA 1OCJA 2Z26A 3M5ZA 3O5OA 3PBWA 3WH6A 3UI5A 3W6YA 1E6QM 3CHEA 3ARXA 4NNCA 3F5JA 5BXRA 3N6HA 3OODA 2PSNA 2PLCA 1V7AA 4LALA 1EJWC 3A64A 4AMCA 2C14A 3NR0A 4GACA 3CT2A 4DJDC 3VCRA 4KKXA 1ADOA 3GH4A 3GW3A 3ZJ6A 3W75A 2BZNA 3UXIA 1RALA 3VIGA 3AMCA 4HCHA 1Q6OA 3HA1A 4TX9A 5H8MA 2HJPA 3HG4A 3EOSA 4UNLA 1F76A 2OQYA 3HO8A 1UIPA 1YW5A 3D47A 4B2DA 4U5IA 1UC5A 1Y5XA 2HXUA 1TCOC 1ONXA 3ZT5A 2PBGA 4LJ3A 4KIRA 3L2MA 3N2MA 4IIDA 5I03A 2VTFA 1E15A 2CHOA 1BAGA 2WMHA 3H2OA 3PPGA 3NL6A 4GXWA 4IIGA 5CKSA 5TF0A 4L65A 5JUVA 4WVXA 3B9NA 1PYMA 1W5PA 1U1UA 3DEQA 4IQJA 3UCDA 3MP4A 3GIYA 2WMKA 3DFTA 2H90A 3KZPA 1S38A 5LXEA 1QCWA 1MRQA 4UNKA 4GO8A 1LLOA 3CTTA 3PWAA 3GLCA 3QY7A 3VGEA 1Q7ZA 2OO6A 5FIPA 4DN1A 3ABQA 4U3CA 1MW2A 4NI3A 2TMDA 2ICSA 6CGTA 1Q6FA 3HQNA 2O9PA 3Q67A 3M46A 1E6PA 4K8EA 1UKPA 1UOKA 1DP0A 4W9OA 2VN1A 2FTPA 3RCYA 2BP1A 4DRKA 5AC5A 2VT0A 2OMAA 5K9CA 3MDWA 2R94A 4P8WA 4H9TA 3KAOA 1CLKA 1K8CA 1WAWA 4HPNA 3VYLA 2W4XA 4AX7A 3KEHA 4UZSA 2PDBA 5J8LA 1XKYA 1EO7A 2XSBA 3OVQA 4DZHA 9CGTA 2POTA 2PDYA 2HTMA 4P8XA 5KZ6A 3HPSA 3RUBL 4IIEA 4EE9A 1JDAA 2NXHA 3IJDA 1ELSA 3HPAA 4M1RA 3TMLA 5ABFA 4OOZA 1XYMA 1IIHA 3U0HA 1R2RA 3FIGA 3VD7A 4C7DA 1PTDA 3CO8A 1QW9A 2OWCA 3S4TA 3LGDA 5D30A 3EOOA 2Y2WA 3C86A 2NV1A 2VOMA 3AYRA 3AIBA 3W7LA 4DJDA 1EEPA 1IXOA 2Y7DA 1YE4A 4DZAA 5I3GA 1HJWA 5FD0A 5HQLA 3VA8A 1E6NA 3JR2A 5JQ9A 3AWNA 4XZLX 4MY8A 4C91A 1SFSA 3ITGA 3DHDA 3M4HA 2D3NA 2W62A 4PCFA 1R0MA 3GFZA 1KV8A 3IVSA 1UWQA 2HZGA 4F4RA 5K2ZA 1OC7A 4QLKA 3SUUA 3NQDA 3EX3A 4L5ZA 3BLOA 5I07A 2DV0A 3RLUA 1KR1A 2ACSA 1J96A 1JAKA 3HM7A 1QNRA 3T0AA 3CIXA 4JFVA 3QF0A 2PDMA 2QNEA 3PBVA 3HG5A 3T6CA 2HVOA 1Z8AA 4PBFA 4ZOAA 3CHDA 4Y9OA 3RDKA 2M2AA 4DLMA 3L5AA 1KV5A 3OOBA 2FJUB 3VC6A 3M0MA 4DZ2A 2Y88A 2WNWA 4YN5A 5AHLA 1Q6DA 3BOXA 5F2GA 5J04A 3PPHA 3WNNA 3FDKA 2GGEA 3V5OA 1DBTA 3AIQA 4UFJA 2BGNE 4N4PA 5FEXA 1SMDA 1VYSX 2ZZ5A 3MSYA 4B4FA 1FKGA 2DG9A 5GJPA 4A3QA 4XIAA 4H9UA 4YU1A 1NELA 4X60A 3NQMA 4QLLA 3E2RA 3CV1A 1P0NA 2RDXA 2FJKA 5FL0A 3K13A 4YCPA 1P6BA 3CQIA 1XLAA 2DT2A 1Z3NA 3QV7A 4IMCA 4O0QA 1C9DA 2Z2BA 3QPZA 2PRLA 4TNSA 3TUUA 1NF7A 3TFXA 3MHFA 3NQBA 2BOFX 2B81A 1H1YA 2ZXQA 4W9QA 3CPUA 3N9KA 4QS5A 3W1TA 1MVYA 1XIHA 1NVMA 3R10A 4RPPA 4MWAB 4X63A 3G3MA 3GC2A 1XCXA 4O0KA 1J18A 3FXGA 2XZ7A 1AA1B 3S1VA 1DWJM 1H0IA 2X1TA 3KP0A 3O0FA 3CMGA 1ZJBA 1UWUA 1T8QA 4W84A 3W6MA 3GU9A 1EQPA 8A3HA 1W2PA 2DUAA 1JPHA 1JPDX 1TWSA 4N9BA 4UC5A 1C9HA 5A94A 1TB3A 4O54A 3O05A 4ZENA 3G0XA 4IUGA 2GYIA 1GG0A 3PG8A 2BG5A 2Y61A 3IIVA 3B9DA 4ZTYA 3KOXA 1NWSA 4HMNA 1SPQA 2GWNA 1RJRA 3SCQA 3H54A 4AD0A 3CEPA 2WC3A 2TSYA 4H8HA 1K03A 2WQDA 3AHVA 4YVPA 3P5YA 1NMVA 3UVIA 5GJNA 3F5KA 1JPMA 3RRAA 1PKYA 4US6A 5E70A 4NQ1A 4AX6A 3WD3A 1XLDA 3L4XA 4H4IA 3AOFA 2Y63A 4RR4A 3M5YA 2X1IA 3M1ZA 3VXGA 4HBOA 1JIBA 2I9UA 4QJ1A 4LRSA 4TVUA 3V0SA 1KCLA 4GY1A 2JBMA 3B0YA 1XRVA 3A4AA 3UD6A 4S3AA 3TN5A 3TC3A 5L9FA 2DZXA 1XC6A 3GWQA 3ENLA 3FY1A 1KKOA 4IPNB 1E9ZB 3O9NA 3EA2A 2CEQA 1YTKA 3MSRA 5CPNA 1Q1CA 3DIPA 1I6NA 1JVWA 3OQ8A 5LHEA 2WQPA 3W9ZA 3CL8A 4KCUA 4H2CA 5GVJA 2VD8A 3HG3A 3W87A 2IKHA 2PGWA 3GXTA 1FKKA 1HL2A 3MJYA 1DOSA 3W2NA 1ZSXA 4BA0A 2F38A 1ONEA 2XFWA 1KM1A 4W87A 3TH6A 1XG3A 2PTWA 4GE8A 4PTMA 1W9BM 2VVSA 1NDZA 3WH7A 1J0JA 4GPNA 3TSDA 2MLZA 1OGBA 4QE1A 4F66A 3FEQA 1P6WA 4AZBA 3EWZA 3H2FA 4IPPA 4BQ5A 2GQAA 1ROUA 2C71A 2Q8ZA 5EGRA 5AVHA 4QIUA 3VOGA 3IARA 3SAZA 1FCBA 2ZX7A 4HKPA 2RJGA 4FR1A 1JCNA 1YMYA 5BWFA 3RO6A 3MCMA 3BLLA 4NG3A 3TQPA 1FWDC 1ZZMA 3W1RA 3EOLA 4WCJA 2XM2A 3NPVA 1XDLA 3CU2A 3CUXA 3S1XA 1KWGA 1JRBA 2ASHA 2NX3A 5E6ZA 4B91A 1IWPA 5IXEA 2ZUVA 3T55A 1WDDA 2ZZ3A 3UP8A 5GNYA 4NVTA 1Q3NA 4IQDA 1XYAA 1FHDA 5FKYA 4B5NA 1EOKA 1H0GA 1A0DA 4O11A 3G1XA 4ZPVR 3GVVA 4RNJA 4JTUA 5AVNA 5A6MA 1O5XA 3UYIA 3FYOA 4RPQA 1MXDA 1TUXA 4FALA 4Z1AA 2O9TA 2CZFA 4D6DA 3G2GA 3CS2A 1TG7A 3AIWA 2PMQA 3KBVA 1DE5A 3BV4A 4LVFA 1I1WA 2F6UA 1FWNA 1XGZA 3CGMA 1TTPA 1PX3A 2P8BA 1PHQA 3ISIX 1A53A 2QLYA 1EO5A 3L4TA 4E4PA 2VCCA 3AAMA 3B40A 3LCLA 4ZO7A 1KFLA 1SJCA 2V5KA 4DY1A 3PC0A 2WM1A 3WD2A 2NQ5A 4Z0JA 1F3TA 4JTTA 4ZR8A 1PB0A 1RQEA 4GC4A 2ZQUA 1W3JA 4DRSA 1QMLA 4WQ6A 3UEQA 3BMXA 3M07A 1M7OA 3H23A 3E12A 2X7WA 1D9EA 3QC3A 2I14A 1K8ZA 1WKEA 4GUJA 4L4MA 3KTXA 4UBPC 4DH0A 2PU0A 3EDEA 4AZ7A 1XC4A 2AL2A 1VFOA 4TR9A 1G7UA 1MQRA 2FHFA 4K38A 1EKOA 1RXOB 4A3YA 2IS7A 4AVNA 2B31A 1V6WA 4UTLA 5EU9A 1ENUA 1GEQA 3LHYA 4PBGA 4PTDA 4TYOA 4LAMA 2ACQA 2I17A 1SFTA 2PBOA 3V5FA 3NQCA 3AHZA 2GSHA 3ZOAA 1CXFA 2XFYA 1XICA 4A05A 3ANUA 7A3HA 4GX9A 2X8RA 3NQFA 3P14A 4YTUA 2ZR6A 3RGTA 4JY9A 3N15A 3A4WA 2UY2A 3LYEA 3L65A 1ZQ5A 5FAJA 4WR3A 2DUXA 4A4AA 3W37A 3L7RA 1VBHA 3VIMA 1QWKA 3SM0A 1EYMA 3MVTA 2D69A 4PMRA 3E3HA 1SFLA 3GHRA 3OPSA 4AZCB 4FAPA 1OC5A 2DIEA 4QQUA 1JNTA 5HBFA 1MEHA 4IFKB 2YCIX 2TYSA 4NRRA 3W1UA 1NF0A 4C6IA 3R94A 1HG3A 2FZBA 4QG9A 4HOZA 2ZA1A 1ZRQA 3STEA 1H3GA 5DBTA 3CV7A 4ODPA 1Y5VA 1HJVA 3PTMA 1DKWA 3IGUA 1MNZA 3LCHA 2GGHA 2YW3A 3LMYA 3P60A 1F5ZA 3ZYZA 1JPIA 4JN7A 3WLSA 3VPLA 4DROA 5G4EA 5E9AA 2I1OA 1HZYA 2P0OA 5J6EA 1PIIA 3KE0A 2QIIA 5CJNA 4HNVA 3GNDA 4AYSA 1R9YA 4HPHA 4LFYA 3RG6A 4NU7A 4L9YA 2XP6A 2XGZA 2XN2A 2PAJA 4LB4A 4H8VA 1LP6A 1JUEA 3W7JA 5D75A 3GR4A 3G8RA 3P6LA 3S2MA 1VFMA 4FNSA 1RBLA 1E56A 2C79A 2J8TA 4QLJA 1PE1A 1UP2A 3NPUA 4ILSA 4LGXA 2BTMA 3NL5A 3PFRA 4NJKA 5HINA 3FHQA 3EWXA 1RP9A 4NXKA 2RUQA 4QCEA 1IR2A 1R3VA 3LI0A 5CC3A 3VC5A 3MWCA 2J7EA 1SFJA 3PRDA 4QFUA 4P61A 1FKBA 3A9BA 1TWZA 3AMGA 4O1BA 2HV5A 4IHCA 1SJBA 1LT8A 3B04A 1RVKA 5HK4A 1TTIA 4U85A 5A2BA 6A3HA 3ABOA 3F4WA 4GUIA 3ID7A 4IG2B 1BFNA 3UETA 3ODKA 4QEHA 1QNOA 5D37A 5CC5A 4E8CA 4FF5A 2R6OA 3GU1A 1KGXA 3DC8A 3IKDA 1EC9A 1K7EA 4LS0A 1OCQA 1EC7A 3PHAA 5CPQA 4F40A 1HJUA 3LEPA 4C7GA 1SZNA 2JGYA 4IFRA 1FP8A 4KWSA 5FJJA 3G6LA 1TV7A 4HMCA 4O1CA 3PZGA 1CTNA 1P0KA 4W5ZA 3TTSA 4UMBA 5KITA 1QOQA 4IM4A 4GG9A 4C7FA 5HPCA 3MI6A 2RQSA 2JALA 4A35A 2BWGA 9XIAA 3C6CA 4DZIA 2Y6ZA 4PEKA 5A6KA 2VEKA 1UWSA 4DWSD 5EFDA 1JYNA 5HA7A 4I6KA 3NQ7A 1J2WA 1T41A 1RJPA 4IMFA 3CASA 3W83A 1Y65A 4XKYB 1PTAA 1KM5A 4W9TA 2ZADA 3KL5A 2CZEA 3TR9A 1TQJA 4QS6A 1U2YA 2OWXA 1M5YA 1NM9A 3GRIA 1KC7A 5AOUA 1RH9A 4TV6A 4KIEA 2BBFA 3W7GA 4PCSA 1OFBA 4NAFA 3EX6A 2RAGA 2HK0A 2PPOA 4JS3A 4PL1A 3SY8A 4DO5A 4ZQOA 4GNJA 4W7UA 1XR2A 2BXZA 2E6AA 7PTDA 3HFTA 3OIXA 1PINA 4MPKA 2Y8VA 4M29A 1P48A 4FSAA 3NDYA 2ISVA 1JYWA 5XIMA 3AFBA 2D2OA 3KHJA 2LLEA 1M7JA 3C2RA 4O8RA 5F1UA 3OVGA 1LRTA 2ITKA 3JRKA 3WBWA 2NUXA 4GVHA 2J9ZA 1K9TA 3FX4A 4B16A 4D6EA 5I3HA 2YL9A 3EX4A 1UMYA 2RUCA 3DZ1A 4MJMA 4PMZA 3WJSA 2ZKMX 4GWEA 2QEZA 4LCSA 3O5MA 3LV5A 3QGVA 5C9ZA 3LMZA 2VL4A 2VC5A 3UJRA 5AC6A 5TBOA 2ZRYA 2D2HA 1F40A 4AVFA 1OINA 4LUIA 3EBVA 3NEVA 2DDXA 3B4YA 5LHFA 4R9XA 1R47A 1FHVA 1JRCA 3G5EA 3FGCA 4WDUA 2Q02A 4U3AA 2OOGA 3IK4A 3OLIA 3PJWA 1UUQA 1FWIC 5I3JA