2DSUA

Binding of chitin-like polysaccharide to protective signalling factor: crystal structure of the complex formed between signalling protein from sheep (sps-40) with a tetrasaccharide at 2.2 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule keywords Chitinase-3-like protein 1
molecule tags Signaling protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dsuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dsuA01
4JCLA 1JDCA 2V5CA 4MNMA 5I6SA 4HA3A 1N82A 1ZBKA 4Z2HA 2CKRA 2WPGA 2WK2A 1UKOA 4W7WA 2ZX9A 1Y7VA 1WB0A 3WEOA 3WDQA 1MW0A 5CPSA 4GI8A 3BXWA 1UH2A 3QHOA 2XWDA 4GXPA 2MANA 4GQRA 4HMCA 1GORA 2J7FA 4D1IA 4JFVA 4LQ1A 5HBFA 5I5RA 3VTRA 1G1YA 2OSYA 2DH3A 3MUAA 1GQIA 4KGJA 5AYIA 4NF7A 3NSNA 3OLGA 1PBGA 3SURA 1W9BM 1JF6A 4KGLA 3CBWA 2BXYA 4CD4A 4D71A 2UY2A 1TCMA 3BSHA 1DWHM 4JHZA 4PSPA 4ZFMA 3FNDA 2CERA 5BXRA 1LWJA 4PTVA 5DT5A 1XCWA 3CMJA 4M56A 1XSJA 3WBAA 4AIEA 2WB5A 4CD7A 1KCKA 1LQ0A 1HN1A 2ZIDA 3ZT5A 1G01A 2CHNA 1DWIM 1M7XA 2CBIA 3U5YA 1VJSA 4UFMA 1K6AA 3WDHA 2Q8XA 4PEEA 5JUVA 1WDSA 2ZXDA 3ZT7A 5GPRA 3WDRA 1V02E 2GDUA 5LYRA 1QOXA 2XVLA 5HOSA 2W66A 1GHRA 4AIUA 4CCCA 3BC9A 5KEZA 2VOTA 3OIHA 3A4AA 1K9DA 3WUFA 1JI2A 1XD1A 4Z2KA 2D0HA 1UUQA 4B16A 3VKKA 4XZWA 4V28A 1HF6A 4HPGA 2J4GA 2PWHA 1WDPA 5CPTA 3WY1A 2BV9A 3ARSA 1UKSA 1NH6A 3CHEA 4WIWA 2XVKA 4UQBA 4KRTA 3DHPA 1FFQA 3VIJA 1Q6FA 1E15A 4TTGA 4UOZA 1Q6EA 3PZTA 1TFVA 3VM5A 2WW5A 1J0HA 3MUIA 5JH8A 3LPOA 5A6SA 4CU6A 3AS3A 4AEEA 5IFPA 3N12A 1CGYA 1XC6A 1BYBA 1UD8A 1ZS2A 2AAAA 5ABGA 1V6UA 1B3ZA 1CNVA 2VMFA 4HMDA 4AD5A 7CGTA 5HPOA 1PX8A 1HP5A 1PZ2A 4IPNB 1K9TA 1JNEA 2CIPA 4OJYA 3WEZA 1UKPA 1W1YA 1KGXA 3OZPA 1F4AA 1CENA 2EPOA 1JF5A 3OGVA 1HXJA 2VZUA 2D3NA 2ZUWA 3ARZA 3CHFA 2DDXA 5IXEA 1GOKA 3UG5A 1CGWA 2XHYA 2BNJA 4PMZA 5AC4A 5FOOA 1ISYA 1ZL1A 2WSKA 4MJ4A 1KWGA 2W91A 1GCYA 1WZLA 4HTYA 1YHTA 5DF0A 4F8XA 1B9ZA 1GPFA 3HN3A 3EDEA 5GNYA 1E9LA 3AHXA 3N11A 5LA0A 1EO7A 1J12A 3ZJ7A 5D8ZA 2DSWA 4NI3A 3GXMA 2CBVA 2YA2A 4ATWA 4W7VA 3UG3A 4W86A 2ZUUA 4ZE5A 4JL1A 4LYPA 4MAZA 1PIGA 3WD4A 1W2VA 1FHDA 1ITXA 1JXJA 3AMGA 2W63A 2X09A 3AXXA 4L4PA 4P7NA 3UEQA 1V6WA 1FH8A 4LX4A 2YDSA 2JFEX 1ISXA 2WZIA 4ZENA 1G5AA 3W28A 3CZ8A 3U7BA 1WAWA 3WH9A 4ACYA 1B30A 3VILA 3VIFA 1BFNA 2D23A 5FD0A 1Q6DA 2YA1A 1R7AA 4C7DA 4EKJA 1JYWA 1G94A 3WF4A 8CGTA 3VGBA 1E4LA 1Q6GA 1H1NA 4AISA 2D20A 1C8QA 4J3TA 1QW8A 4BS0A 2XUCA 4MB4A 1L8NA 1U30A 3ZMRA 2QMKA 4PTMA 1CXEA 2O9TA 3GNRA 4AYSA 3AIUA 3BMVA 2WVTA 4TX6A 1BTCA 2O92A 1E40A 5IFTA 3EDFA 3KL5A 1Q6CA 4BQ2A 2EEXA 1MW1A 3BAXA 2PWEA 2BY3A 1KQYA 1PX3A 4QP0A 3W53A 1PZ3A 2DH2A 4X0VA 3WQVA 3TOPA 2WMHA 3VD4A 1EDGA 2W4XA 1J0JA 2WVVB 2WMGA 1IZJA 4TOQA 3VD9A 3RM4A 2ESCA 4HA4A 1X6NA 2YL5A 1I75A 2D0GA 2ZUNA 1E1EA 3MKKA 1W32A 3SCVA 2DT3A 1W3HA 2J8GA 3EYPA 3I3BA 3B9EA 2XM2A 2YDRA 1UH3A 3VIGA 2V3EA 2QHAA 1VFOA 4UFJA 4X9YA 5GNZA 3ARRA 3EDKA 1KWKA 4WKHA 3TTQA 1E6NA 1QNQA 4H7VA 4W89A 4ZEPA 1Q4NX 1XH1A 1W9UA 5A8QA 2ZX5A 4GI9A 3UETA 1W3JA 3WF1A 2WZEA 2NSXA 3IJ9A 2VUYA 1LLOA 3ZR5A 1O6IA 5CSYA 4BQ5A 2VCBA 4R27A 2Y4SA 3MS8A 4J3VA 4GQQA 3W38A 4TVUA 1J11A 3AIBA 3UR7A 1MVYA 3GXIA 3WL1A 5DMYA 1WE5A 3O2LA 3VO0A 4AXNA 3PTMA 5CLTA 5D8WA 2VR5A 4PUEA 1SR0A 4ZE4A 5KZ6A 2WWCA 2YBUA 1L0PA 3AXHA 1HVXA 4UZSA 3QR3A 2Y24A 3AHZA 5BXPA 4YPJA 1ZB5A 4DWSA 4QLLA 3SCWA 1MXGA 1UOKA 5BYWA 3K46A 5CGTA 2WZHA 1W1PA 2PBOA 2ZWYA 4KWUA 1W1VA 4AZ6A 5I24A 1G9HA 3NDZA 2WLZA 1R85A 2BHZA 5A6MA 4H41A 1W9PA 1KFWA 4MNLA 2WCGA 1CEOA 4F9JA 3S6TA 1U33A 2X0HA 4A3HA 1JAKA 1OIMA 1CXIA 2ZICA 8A3HA 1JD7A 1KR1A 1AQHA 4EE9A 2DT0A 2WMIA 4TVDA 2A3CA 4EK7A 2WMKA 1ITCA 4AWEA 3MU7A 4RL3A 3N18A 1MQRA 1HT6A 5I78A 1C7TA 1CPUA 1JFXA 3GNOA 4CN1A 1WZMA 4W8AA 4P7QA 1UR4A 1GQJA 2QF8A 1SMDA 2EXOA 2PI6A 4MDOA 2X1IA 1BG9A 1H4PA 3L4ZA 2RGMA 4H2CA 1V3IA 3PHAA 3MV01 4UCFA 1R87A 3WD1A 5I79A 2FHFA 3A4XA 5CSUA 1TZ7A 2A3AA 5JBFA 3VIHA 4W88A 4LYRA 5EFFA 4IUGA 4B3KA 1WNOA 3PTQA 2A3HA 3AZSA 3CO4A 4OOUA 1R7OA 4E8DA 4FLRA 1E6ZA 5DEZA 4IPLA 5EMYA 4UNIA 3WH7A 3WNOA 4F66A 5FL1A 2DSUA 4AMCA 1JZ2A 2EO7A 1SMAA 2DIJA 4BF7A 3OLDA 3OGSA 2HVMA 4AZIA 3N04A 3TP4A 1CECA 3K1DA 5A8OA 2WHJA 3THDA 2VRQA 3ARQA 3SCSA 4ZXLA 3OGRA 3BLPX 2GK1A 4U5IA 3WF0A 1KR0A 1E72M 3AOFA 3AMDA 1GOQA 2CYGA 5A2BA 2VX6A 3GBDA 4CVUA 3APGA 1E6XM 3AHVA 2YA0A 5A2AA 4JKMA 5D4YA 4W5UA 1QI0A 1UWTA 3AIWA 4N0RA 2VZTA 4L4OA 4D72A 1E4NA 2WLYA 5EB8A 2CESA 1GW1A 4RE4A 1B3YA 3A4WA 2E3ZA 2PB1A 1AQMA 4NRRA 1GOMA 2E4TA 2VTFA 1Z32X 3VDAA 3MO4A 3T2PA 1UR8A 3ALGA 1V0NA 3NSMA 4LGXA 2WCAA 2ZUSA 2NT0A 2E9BA 1EQCA 2G3NA 4ML4A 1B0IA 3CUHA 1JZ6A 3O6AA 4MAVA 3FAXA 3NCOA 1QI4A 2ZOXA 3RIKA 3SUWA 3AXIA 3IANA 1J0KA 4H8VA 1XRVA 2WWDA 2WM0A 4Y7EA 1JXKA 1H0GA 3BAKA 1UYQA 1VEMA 1ISVA 4A3YA 3B8SA 2GDVA 3M07A 3MMWA 4UFHA 2X0YA 2E9LA 3PZQA 1US3A 4CN4A 5A8NA 3B9AA 1OD8A 4MPKA 4YN5A 1DEDA 1F4HA 2EPMX 2FHBA 3QGVA 1D7FA 4UQEA 4WK9A 4CVWA 4FLOA 3CPUA 1ZJAA 3KE0A 1W3LA 2FHCA 2EBNA 2VVNA 4OUEA 3GZAA 5ECUA 1E3XA 4AZBA 1ESWA 1IZKA 4C7FA 4OBSA 4GZJA 2FGLA 3W4RA 2ZXQA 1DWGM 2ZX6A 3PZGA 3SCUA 1GNXA 2E0PA 4OKDA 2CBUA 1IV8A 1XH2A 5FCZA 3VIPA 2J75A 3QOMA 1E56A 4HU0A 4QLKA 3AROA 3WNKA 1MFVA 2EPKX 3WD2A 3L4TA 3AQUA 2J77A 4TX8A 1W9XA 3MSGA 3NYDA 3GM8A 5A2CA 3L4XA 1GOOA 3DYMA 5I3DA 2WMJA 3W27A 4D6CA 4CD8A 1CLXA 1CXFA 2IUZA 3RM9A 6CGTA 3NIYA 1JIBA 2BHUA 1H3GA 4H04A 1JD9A 1GOWA 5JBDA 1VRXA 4U3AA 1TMQA 3ARVA 4Z2LA 4DUVA 4MNJA 2XVPA 3EMZA 3U5UA 1E73M 5E6YA 5BRPA 1QPKA 3WBEA 3QHMA 1TR1A 3VUPA 2IXUA 2YL6A 1HJWA 2BVDA 3A47A 2J79A 2VURA 1UWUA 3W6MA 3SCQA 1GJWA 3CZGA 4W87A 3THCA 2J25A 1UD4A 4Z2JA 1H09A 2G8ZA 2VNCA 1E4IA 1DTUA 3GH5A 1R8LA 5AYBA 5I77A 1GZJA 4FF5A 3T08A 3IAPA 1X1NA 1EGZA 1ODUA 3FAWA 4AD2A 2FH8A 2EPLX 1GHSA 4PTXA 1QHZA 4JL2A 2VX7A 2WAGA 1HJXA 1OBAA 3GH4A 4ZXOA 3QOKA 1DP0A 1XHGA 3W6LA 3MSDA 4BA0A 3WUGA 1D2KA 2VX5A 1J10A 1JDAA 1UD2A 1MYRA 1UZ1A 3ZQ9A 2CETA 5ABFB 1UWRA 3AMCA 1P6WA 1KGUA 1CYGA 4H8UA 1WZKA 2DSVA 3N1AA 4W8BA 2YKKA 2WC4A 1DWAM 3WD3A 1JI1A 3BCDA 1OT2A 4WJXA 4FLSA 1RPKA 4W93A 2J7BA 1PX4A 2ZX7A 4EANA 3POHA 3BMWA 1KBBA 1TG7A 4V27A 4NZCA 2G3JA 3AI0A 1R86A 3CUJA 2WCSA 1W91A 3L2MA 3PZVA 1C8YA 2XJ7A 3ZJ8A 1FHLA 3ECQA 1UG6A 5A8MA 2PWFA 1PPIA 4RE2A 4J27A 1UR0A 4HA1A 4FLQA 2VJXA 4HZ8A 4LXFA 4PMDA 2VRKA 1CDGA 2GUYA 3SUTA 1K9FA 1PIFA 1OIFA 4WKAA 3L4VA 3CZJA 2QPUA 1C93A 1M53A 2DT2A 1GVYA 4PMRA 1B1YA 2JEPA 3VU2A 1LL7A 1V0MA 3WD0A 1HKJA 3W25A 2WKGA 2UY5A 1V02A 2XPKA 3DHUA 4W85A 2WXDM 4P8VA 3SCTA 3RDKA 3IJ8A 2W5FA 5CPQA 1NOWA 4AZCB 2W67A 4JIEA 3VD3A 3CUFA 1NOFA 3M7SA 1NARA 1BG4A 3CHCA 1AVAA 2Y5EA 3F4VA 3PZIA 2DPEA 1CXLA 5E09A 4QFUA 4HU8A 3AYSA 5BWFA 2X8RA 2OSXA 2WKLA 3OG2A 1CXKA 5BXTA 4TXEA 1QVBA 3SIMA 5A8PA 4GIAA 5AY7A 4ATLA 2VX4A 4D6EA 1KXQA 3AMKA 3AHTA 3ZIZA 3CHDA 1X6LA 3FHAA 1E5JA 1J0IA 1I1WA 3VDCA 1US2A 3GXDA 3AMLA 5E70A 4CKQA 1OGSA 5CJ5A 3CMGA 3MANA 3RO8A 3BAWA 3TTOA 4BQ3A 2VCCA 1FH7A 4HP5A 2Z1SA 3RMEA 3BAYA 1NM9A 3RJXA 2VI0A 5D9NA 1V3LA 5LA2A 4J3WA 5BRQA 4BCEA 1M03A 1W9DM 3MV11 4IM4A 4PUDA 1VAHA 3DYPA 2W62A 3WH6A 5BCAA 2V3GA 5I0DA 1UA3A 4AY1A 2WVVA 2G3IA 5ABHA 5I23A 2V5DA 3ZO9A 4PTWA 1RP9A 2JEQA 1MW2A 1UHVA 3MUY1 1H41A 1ZJBA 3WF2A 3ZM8A 2WANA 2VVSA 3PZMA 1FA2A 2GJXB 3IJ7A 1B3VA 1UA7A 1VFMA 4BZYA 4E4PA 1H2JA 1UR1A 1M01A 2YLLA 2Y8VA 1UH4A 3K8LA 4MTVA 5CZKA 1BAGA 5EBAA 4CU7A 2JF7A 1ECEA 5F7UA 1YQ2A 1HJVA 1UD5A 2WVSA 4Z2IA 4IISA 2QPSA 1V0KA 3J7HA 1JZ5A 1CGUA 3MUZ1 5A3HA 3CTTA 1A47A 3VD5A 3U57A 3WH5A 2XFRA 2NW0A 4M24A 1OSEA 3WFLA 2OYKA 4PSRA 3GBEA 1A3HA 2AOSA 2XGIA 1DHKA 3WH8A 4GI6A 4W7UA 2YDQA 1G0CA 5HNNA 2WNWA 4XB3A 1H11A 1UQZA 2WBKA 1EIBA 3BSGA 3G6MA 2WMFA 2F8QA 3T0BA 1WP6A 4RE3A 1E0XA 5A6JA 4QAWA 1J0YA 5HXMA 2XVNA 1EDQA 3TONA 2VQTA 5D9MA 4CCDA 1JZ8A 3AJ7A 3WDIA 5A6KA 1OINA 1W1TA 2ZUMA 4AD4A 2D3LA 3JUGA 1JZ3A 3II1A 3ALFA 2CKSA 4UTFA 3W24A 3T0AA 4YHEA 1VBRA 4QLJA 1W3KA 4FK9A 4WKFA 4URIA 2BXZA 3SEPA 2YIHA 2J47A 3UESA 3AS2A 3VGEA 3WQ8A 1VBUA 4UFKA 1GQKA 2V38A 1TA3B 1KB3A 3PZNA 2VQUA 1QHOA 1W9VA 3T09A 4DWSD 4CN6A 1M04A 5CGMA 3VOCA 3VNYA 5A95A 3W29A 1WO2A 4ACZB 1XYZA 3AS0A 2XYLA 3WFZA 3POCA 1J18A 1WKYA 3PBGA 1MFUA 4W5ZA 3CLWA 2GK1B 4K68A 2J62A 2DGAA 3CUGA 3DC0A 5ABEA 3SCOA 4OBRA 1NWRA 4TUFA 4N42A 1VIWA 4GPNA 3OLEA 1UD3A 1V6VA 1BQCA 4KMQA 2WC7A 1XGZA 4EAMA 3U7VA 1EOMA 4D6FA 1OGBA 1E0VA 1HKMA 3BH4A 4P7RA 4C7GA 3KZSA 3WEMA 1UR9A 1E6QM 9CGTA 1V6YA 3VIKA 1JZ7A 4JFTA 3WL0A 3FW6A 5A6AA 4LYQA 2BY2A 1JDDA 4PMNA 3WNPA 4AZGA 3GYCA 2ZXBA 3BLKA 1HKKA 4PYSA 4AEFA 1OB0A 3SUSA 4DUXA 3EBVA 2A3EA 3AZTA 4W8LA 3K4AA 2C0HA 1HX0A 1C3FA 1E6SM 1QBAA 1B90A 1QNRA 3OZOA 4D1JA 5LA1A 4TTUA 1V03A 2VR4A 4WSKA 3L4WA 1GQLA 1ISWA 1CIUA 4Z2GA 3W81A 4P8UA 3ARYA 3PN8A 2E8ZA 2PWGA 2FDMA 1EXPA 1DWJM 2ZE0A 4JKLA 5A1AA 3K4DA 1GJUA 3HMCA 3S2CA 3SUVA 3VVGA 2ZX8A 3WDPP 1FOBA 3CZLA 1LJYA 3SUUA 1QW9A 3F5KA 5M5DA 2EQDA 3VX0A 3L4YA 1D3CA 3CZEA 1HNYA 4F9DA 1FH9A 1BHGA 3VDBA 4PN2A 5FIPA 3T2OA 1E55A 2XIBA 4J28A 3N17A 2WYSA 4U3CA 3VNZA 3WQ4A 4CGTA 5JIPA 1HKIA 2IXVA 3HJEA 3WSUA 1NWTA 3ZSTA 1AMYA 1NWSA 1SYTA 3ARPA 4GO9A 3CIVA 2X05A 3ZSSA 4QDMA 3AYRA 2XM1A 4JHOA 2OWCA 4R5EA 2UWFA 3K8KA 5DFAA 5C71A 4PMVA 2VRJA 3ARTA 3CH9A 2OWXA 3EDDA 1BGGA 3UR8A 4BQ4A 4HOXA 3D3AA 2PC8A 2UY4A 3VGGA 1JNDA 1ZBVA 1EOKA 4PMOA 1JYVA 4V2XA 1OCQA 3I3DA 2D1ZA 4HMEA 2VZVA 3NUKA 1LL4A 3ZJ6A 1E3ZA 1GONA 2XIIA 4PMUA 2YBTA 2OLHA 1CZ1A 3M6DA 2RGLA 3TTYA 5A6BD 1GVIA 5I2UA 2XG9A 1E5NA 2JE8A 2X2YA 1QI5A 2GJPA 2G3MA 4AD3A 1JAEA 2VZOA 2XGBA 3BGAA 4HOZA 4J7RA 1CGTA 1MQQA 1NP0A 3WQ5A 1RD6A 2A3BA 3VINA 4JFWA 4CD5A 2DEPA 1QNPA 4GO8A 4GKLA 1H49A 4UQDA 1K9EA 1EH9A 1EHNA 4JFSA 3EMCA 3VMOA 5M3WA 2DT1A 2AMGA 2O9PA 1ZBCA 3AFBA 1NOUA 4DWSC 3OLIA 1UQYA 2VC9A 1H5VA 1WPCA 4PBGA 5IHSA 3D5HA 1QI2A 3N13A 2CHOA 1C90A 5E0FA 4E2OA 1JG9A 1KGWA 3PZOA 1V3JA 3LPPA 3VIOA 1I1XA 5HDRA 4AZ7A 4P7OA 5D9OA 4PCTA 3WDJA 4D6IA 3N15A 2QLYA 3SCRA 3VGFA 5ABFA 4UQCA 3WUBA 4QCEA 1OWQA 1UR2A 2DIEA 4M80A 1KQZA 3DYOA 3FHQA 5A69A 4WSJA 3CZKA 2PF0A 3T2QA 3IAQA 1FP8A 4D6JA 1XH0A 4B15A 4NSBA 4B3LA 3WIJA 1V3MA 1J0ZA 5IHRA 2V3DA 1CGXA 2PWDA 1UD6A 3CUIA 2NT1A 1B2YA 3FXYA 4U33A 1QHPA 2G41A 3ARWA 2YL9A 4KRUA 1EDTA 1RH9A 2FH6A 1HL9A 1V08A 4PRWA 7A3HA 3ZR6A 3G6LA 4HZ7A 1XSKA 4PMYA 3AICA 4Q22A 4FMVA 1UKQA 5TD4A 1TVPA 4MB5A 4M81A 2B31A 4CD6A 3VGHA 4PMQA 3VDHA 1ZBWA 1KXTA 3OBAA 5CXPA 2XVGA 4D6GA 2VL4A 3AIRA 2J7EA 1V0LA 1J9YA 3K8MA 3GH7A 3KL0A 1U2YA 2JALA 3RCNA 4JAWA 5FKYA 1V6XA 2JF6A 4UOQA 1B3WA 5JBEA 2E9MA 4J3SA 3SCNA 5CQ1A 1J01A 4ATDA 4DM1A 3BAJA 3CGTA 4HOWA 3ZJKA 2VO5A 2WHLA 3VMPA 4AZCA 4F79A 4YHGA 1VFUA 4CCEA 1ISZA 1EQPA 1IT0A 1KXVA 3EMQA 3WF3A 1GUVA 2CPUA 1W2PA 1MQPA 4NRSA 5D9PA 3DECA 1QBBA 3AZRA 1C7SA 4MB1A 2JIEA 1RP8A 5A94A 3WUEA 3VIIA 4AIOA 2W61A 4AD0A 3WN6A 1MW3A 4B9ZA 4UQ9A 1BVZA 4XX6A 4UZUA 1CBGA 4TVCA 1LG2A 1XD0A 2YJQA 2D0FA 1VFFA 2Y2WA 7TAAA 1B3XA 1ZU8A 4AZHA 1LF1A 2XSAA 1JZ4A 4HZ6A 3WQWA 2ZXAA 3VIMA 1QNOA 3WMBA 2VCAA 1UZ4A 4AD1A 1OT1A 3SCPA 1LL6A 4H8HA 2BVTA 3VM7A 2BS9A 4CU8A 2OYLA 4UR9A 3A3HA 3VMNA 1KCLA 1XCXA 1E0WA 2ZUVA 2GJRA 2G4FA 1TUXA 1CLVA 2O9RA 3FY1A 3NJ3A 2D2OA 2J7DA 2C7FA 4OIFA 1XV8A 3KEHA 5DT7A 5GNXA 1E71M 4XUYA 4D6DA 2WC3A 5AC5A 3PZUA 1AQ0A 3WQ6A 1E6PA 2YLAA 3RILA 3EDJA 3WMSA 2XSBA 1FP9A 2V3FA 4JFUA 3AISA 4P8XA 2GVYA 1H0IA 1BPLB 2PBGA 4MADA 4DWSB 1HJSA 3B9DA 4U2YA 2GJXA 1JGIA 4PMXA 2BFGA 5DO8A 2EPNA 3N9KA 1KBKA 3F5LA 2WVUA 1KXHA 3ZOAA 2YL8A 1E6RA 2XTKA 4CUCA 2VT0A 4M29A 4AC1X 1UWSA 1FFRA 2DSZA 1O7AA 1WDRA 3OA5A 2OSWA 1JYNA 4GZEA 3W0KA 4MNKA 4JKKA 4P8WA 4B9YA 4LPCA 2WMIB 3LMYA 4D6HA 4W84A 2QMJA 4UFLA 3T0DA 4GZIA 2GFTA 1CWYA 2BHYA 3MMDA 2UY3A 3UCQA 1HP4A 3ZT6A 4OZOA 3ARXA 4M82A 1VEPA 2DQXA 3WKZA 3AIEA 2W92A 3PTKA 3GTNA 1QNSA 5E0CA 1B31A 1NQ6A 1PEZA 2E40A 4MB3A 2CEQA 1EHAA 3L4UA 3GXFA 2JIWA 2OYMA 1VEOA 3FN9A 2EJ1A 3GNPA 1QI3A 1TE1A 4WLCA 1BYAA 5E6ZA 1CGVA 1MWOA 3KL3A 5M03A 1NP2A 1S46A 3MMUA 4J3XA 5BROA 1C8XA 1BSIA 4Q7NA 1BLIA 3A6OA 4XV0A 3W82A 3W26A 2WHMA 4A4AA 2J78A 4U5KA 1MXDA 3L2LA 2VZSA 1V3HA 1EO5A 3IK2A 1WDQA 2BY1A 1XYFA 4S3JA 3ARUA 3RM8A 4GINA 2E8YA 1TVNA 3RPMA 4X0NA 1HJQA 3BAIA 2J8FA 1V3KA 4J3UA 4AW7A 1LG1A 1HIZA 4JZ5A 2DSKA 1TA3A 5EFDA 3WNNA 1UKTA 3F5JA 4P7LA 3O9NA 6A3HA 2BY0A 5JIWA 1C91A 1OD0A 3AHYA 3WENA 2WBGA 2CCRA 3M46A 3TTSA 4DUWA 2D24A 4ACZA 1OM0A 5GQBA 3WNMA 3AS1A 3WNLA 1SFSA 2GSJA 1DWFM 2Y8KA 3LPFA 1EA9C 2J7CA 1JFHA 1VJZA 2F2HA 1WZAA 1BYDA 2C8NA 3VGDA 4PCSA 2XWEA 2Z1KA 1BYCA 3WELA 2D22A 4JCMA 3AIQA 3OB8A 2BVYA 4XZBA 1PJ9A 3UERA 2HISA 5BXSA 4AZ5A 2O9OA 2J7HA 4U2ZA 1UWIA 1CXHA 5FL0A 5CG0A 3RJYA 2CITA 4MDPA 5HPCA 1E70M 1XSIA 5E9AA 1VF8A 6TAAA 1VENA 3BCFA 3WMCA 1BVNP 4UOJA 1E43A 3AIVA 5C8BB 4E8CA 1BF2A 5M17A 1ODZA 4KH2A 4UFIA 3W37A 2ZWZA 1NWUA 4U31A 5CLWA 2XFYA 1JL8A 4M1RA 1HJUA 3PZ9A 1JYXA 1VB9A 1PAMA 1WCGA 2QV4A 3NDYA 3E1F1 4MJ2A 3QHNA 2FGZA 3GDBA 2J7GA 5A6LA 4M8UA 1E1FA 2XFFA 4DM2A 1OGGA 1HVQA 3NSXA 1E4MM 4QCFA 3I3EA 2ZUTA 2WHKA 3VPLA 2CXGA 5C70A 3HU7A 2WSPA 2TAAA 2CBJA 3LPGA 5A6BA 1HL8A 2CNCA 4UQAA 2F61A 3TA9A 4WF7A 2OWWA 3KWXA 1C92A 3UG4A 2J74A 1CTNA 3VX1A 1BGAA 3VD7A 1LWHA 4OOZA 1GOIA 4HPHA 5IDIA 1UWQA 4S3KA 2YOCA
chains in the Genus database with same CATH superfamily
2V5CA 4MNMA 4IGSA 1T5AA 1ME7A 1ZQ5A 2CKRA 4W7WA 2P88A 1HO4A 2KX9A 2WM1A 1MW0A 1VBGA 3BXWA 4MYAA 4IGMA 1XM3A 3H6OA 3GK0A 4HK7A 1RVKA 4HMCA 1O1HA 1L6GA 1GORA 2J7FA 4KEVA 3PR2A 1IE7C 3VTRA 2Q8ZA 1G1YA 1OFBA 2DH3A 3CV7A 2YYTA 1SO6A 1F61A 3OLGA 1W9BM 1JF6A 4KGLA 2GQ8A 1A5OC 3VNLA 3O16A 2BXYA 3UQIA 1Q6UA 4NAFB 2UY2A 3BSHA 1DWHM 3V4BA 3MI2A 3PUDA 4KCWA 4XKMA 5LNRA 2Y78A 2CERA 5BXRA 3DFYA 5DT5A 1XCWA 4FXFA 4L1WA 3M47A 1XSJA 1FWFC 1HN1A 4FZIA 1G01A 1DWIM 3LK6A 3WDHA 4PEEA 2HEJA 1WDSA 5JUVA 4NNCA 2H8ZA 3O6YX 4S1FA 5FSDC 3KBJA 4N6FA 4AIUA 3OIHA 3A4AA 3QZ6A 1NDZA 3MWAA 4ZCWA 3P80A 3CB8A 4X3ZA 6ALDA 2PDNA 2QQ6A 1HF6A 4HPGA 2WSYA 1VR6A 3NGJA 1MSSA 3W01A 1GG1A 3MI3A 3NM1A 4BWLA 3ARSA 3SRFA 1UKSA 4WIWA 2XH2A 1MDRA 2WPBA 1GG0A 1JCJA 4UQBA 3DHPA 1E15A 4XZMX 3BO9A 2J66A 3SRHA 2WW5A 1IR2A 1J0HA 3U3HA 2EGZA 3I6EA 4R7OA 4ZQRA 5A6SA 3AS3A 1KCZA 4AEEA 5IFPA 4FXSA 4PL1A 1M6JA 1UD8A 1A5NC 1ZS2A 2AAAA 2XGZA 1V6UA 4DJED 5D38A 4A2SA 1EKOA 1PZ2A 5FJPA 1JNEA 3W7GA 2Y70A 4G50A 2QNEA 3OGVA 3TYDA 3PRBA 2D3NA 2ZUWA 3UR2A 2DDXA 3OO2A 1KKOA 4BY3A 2YBVA 2Q8LA 3LOTA 3EWDA 1CGWA 1XYLA 2ZADA 4M6PA 4XD6A 4F2TA 5AC4A 5F2IA 4DYEA 1ISYA 5AVHA 4MJ4A 3N2BA 4PL2A 4F8XA 4POCA 3HN3A 5GNYA 1E9LA 3AHXA 3W7MA 4E8GA 2FPVA 4F0SA 2NLIA 5D8ZA 1Z8AA 4NI3A 3GXMA 3CNYA 3CWOX 4W86A 4XO7A 4JL1A 4LYPA 1JCTA 3G1SA 1W2VA 1UWAA 3R79A 2W63A 4L4PA 2OB3A 1V6WA 3SN4A 3W7NA 1EZ2A 3TSDA 3IIXA 3WLHA 1G5AA 3RITA 1OX4B 1VH7A 3WH9A 4JEJA 4UTJA 4HPJA 1B30A 3ABXA 3DG6A 5FD0A 1Q6DA 3JR2A 4TYOA 3LUOA 1J79A 4ITZA 3DFTA 4BK9A 3HQ1A 4NZJA 5BW6A 1VRDA 5FF3A 4Q3MA 4DRIA 1KRMA 1Q66A 2XUCA 4L9YA 2HVOA 1CXEA 3GNRA 4IT1A 3BMVA 3EAUA 1TR9A 1DJNA 2O92A 5IFTA 3AU2A 1Y0EA 1SU5A 2ISVA 3LU2A 2ISFA 2KO7A 2DH2A 2DIKA 4YNGA 1EDGA 4GX8A 3K30A 2WVVB 3R13A 4DJDC 1X6NA 2PZNA 4DNMA 1SZEA 3HGJA 5K9CA 5DIUA 2RUQA 5EU9A 3G1YA 1XIMA 2V3EA 2QHAA 4Q8TA 1CX9A 4PGLA 4X9YA 5GNZA 1X8FA 3TTQA 1QNQA 4ZEPA 1N8IA 1UUOA 1W9UA 4TV6A 3GDLA 3GR8A 1Q7MA 1LLOA 2CLPA 3UQAA 3ZR5A 1O6IA 2IPWA 2PP0A 4Q4SA 4K3ZA 3WX7A 4RDZA 4MUPA 3MS8A 4TVUA 3GG0A 3AIBA 1R5YA 3GXIA 4A29A 2YDAA 3UF9A 5CLTA 3HM7A 5AYZA 2VR5A 3VDGA 4ZE4A 2WWCA 2YBUA 3HGRA 3O0FA 3V0TA 2C15A 3B97A 4YPJA 2WNZA 4O19A 2P4VA 2B81A 1NMVA 4DWSA 4JTQA 3UF8A 4ERIA 3EOEA 4FNTA 5CC3A 4FP1A 1W1VA 4LAKA 3CEUA 5I24A 2GUBA 3NDZA 4Z08A 3VFCA 3PVFA 2WLZA 1W37A 2IQDA 1GJPA 5D04C 1Q6IA 2X0HA 4A3HA 1JAKA 1S2UA 4EXQA 3RGCA 2DT0A 4LVGA 3WLRA 4KT2A 2WMIA 3BJFA 4MZ1A 4K37A 3DH7A 4RL3A 1Z48A 1QCWA 3H55A 2PDUA 3L5LA 3LHZA 1HT6A 3SJNA 2CW6A 3W7DA 3GNOA 5CPMA 2ZRVA 1TJ1A 4W8AA 1UR4A 2VYOA 3R0UA 4C6IA 1WDDA 2EXOA 1IYXA 3W1TA 3S5SA 2PI6A 4MDOA 4DLFA 1O4UA 3L21A 4NJJA 3W83A 1VPQA 3PJUA 1V3IA 3LRKA 4NYYA 1R87A 3AXKA 3WD1A 4ZPWR 1TZ7A 2A3AA 2QUVA 3GG8A 4B3KA 4FAPA 3CO4A 4E8DA 3WYZA 1E6ZA 1SJDA 5C2XA 1F5ZA 5EMYA 4UNIA 4ZQMA 3WH7A 2DSUA 2NLYA 4AMCA 1JUBA 1TELA 4WRHA 5D2XA 2JBMA 3TZNA 3IIOA 2EHHA 3THDA 3SCSA 1QMLA 3N2CA 4ZXLA 3CK5A 3W2NA 1VIZA 5K9XA 3H21A 4U5IA 2DZBA 1E72M 3O5EA 3AMDA 4S3BA 2CYGA 4MOZA 4Z1CA 3APGA 1E6XM 3B40A 3UW6A 4JKMA 2VWSA 1QI0A 1TV2A 1HXVA 3W2UA 3LLDA 1NY1A 2BZNA 4FNPA 1E4NA 1GVQA 4RW3A 3AUOA 3IKDA 2WLYA 5EB8A 3WLPA 2P76A 2CESA 1GW1A 3P60A 1D3GA 2PB1A 4EWJA 3CUXA 4JTRA 2A0NA 2A79A 4JFLA 3VDAA 1XIJA 3M16A 4MPQA 3MP4A 1BEUA 4DRHA 3QV9A 4XZNX 4LGXA 1XRTA 3G1DA 2WCAA 2NT0A 4G1NA 2FZ8A 1SZNA 3G0XA 2CLIA 1YXCA 3CUHA 3MHUA 3H8AA 1JZ6A 4MAVA 4N2YA 3DC8A 1FWIC 1EJVC 3NCOA 2XP8A 3SUWA 4AC7C 1J0KA 1E51A 2BBFA 1W26A 5T9CE 2WM0A 4ODNA 3BAKA 1L6YA 2B7OA 3QQ0A 1ISVA 3GLCA 3M07A 1UW9A 3MMWA 4UFHA 1SFTA 3EKGA 2DU2A 2V6AA 2OZ3A 3DFOA 2W3ZA 2QJHA 2KZHA 3B9AA 1SW0A 1JPDX 2W27A 4YN5A 3QGVA 2EPMX 1CI1A 1XKJA 3Q2DA 4I5RA 1ZZMA 3TSMA 1Q4WA 4WK9A 3LCGA 2VHLA 1ZJAA 3KE0A 4C6BA 1DIOA 4I5XA 6REQA 1F05A 1PKMA 2VVNA 4OUEA 5ECUA 4DHGA 1ESWA 1IZKA 1OC5A 5RUBA 4MGVA 3EWUA 4ZS6A 1DWGM 3I6CA 2VOMA 2ZX6A 3PZGA 3NG3A 3SCUA 1GNXA 2E0PA 4OKDA 1E56A 3ABQA 1G4SA 3TQKA 1ML1A 1MFVA 1AZ1A 2HV5A 4G7EA 3Q58A 2OQHA 3D46A 1C9HA 2BX7A 1EEXA 5D09A 3GM8A 1GOOA 2TYSA 4ODKA 3DYMA 4NZ3A 2PWVA 3E9AA 4IJBA 1CLXA 4O1AA 1C9WA 4ALDA 2Z2AA 1NTHA 4QE4A 2HWGA 3G5EA 2Z25A 4H04A 4HNLA 2LPVA 2Q02A 4RV3A 3B8DA 4MNJA 1S5WA 4UMCA 3U5UA 1QPKA 1FCBA 1MUMA 1TR1A 1OFRA 1TQJA 2WZTA 1PIIA 1V77A 3W2JA 4ZSTA 1DIDA 3G1HA 4B4FA 3CQJA 5IDZA 1GJWA 3TJIA 1TQXA 5PTDA 1VCFA 2J25A 1KC7A 2G8ZA 1E4IA 5I77A 5K9DA 3T08A 4A05A 1QAPA 2V5LA 2C14A 4E3VA 4N4QA 1GHSA 1QHZA 3IVTA 2ACSA 1HJXA 4ZXOA 3PM6A 3GTHA 1D2KA 1YXYA 1UZ1A 3BANA 4KCVA 2CETA 4IQ2A 3N34A 4MKNA 3SFWA 1KGUA 4WDTA 3WLLA 4L1XA 3GU0A 2QDDA 4Z42C 4NILA 3BCDA 4W93A 2ZX7A 3EIPA 2BG5A 4EANA 3PWGA 2BWGA 3LGDA 3BMWA 1SW7A 4DVOA 4NZCA 2G3JA 1XIGA 2VFDA 5H8MA 1R86A 3CUJA 3L2MA 1C8YA 2X2GA 4JQ4A 2OMAA 2YX0A 3SQLA 3U0HA 3NEVA 3QV8A 2RDWA 3IVSA 2VJXA 5CGQA 1TRIA 1U1HA 1KLZA 3V1HA 1CDGA 1XGEA 3GHUA 1PIFA 3L4VA 1CB7B 1C93A 2DZUA 2DVUA 1EJTC 3NQBA 3E2RA 1X6UA 1TV3A 1HKJA 3W25A 1M5WA 2UY5A 4QNWA 2RKXA 3GS6A 5MHBA 1J4RA 3PUGA 1PZ1A 3PPHA 3SCTA 1NOWA 1BWKA 1RQBA 3VYLA 4AZCB 4JIEA 4RV8A 4DJFC 4H3DA 4GOAA 3W88A 3M7SA 4NL1A 2Y5EA 3LENA 2DPEA 5E09A 4DWDA 1ZNNA 1DHPA 3KOXA 2X8RA 2WKLA 4EIVA 4LNCA 4OV9A 1TWZA 1DQUA 4B2DD 1OF6A 2Z2UA 3DUGA 2V69A 3GU1A 3TW9A 3TC3A 4JTFA 3PB0A 4INFA 5JVLA 3O63A 5B80A 5LSMA 4KKXA 5HQMA 1E0TA 4CKQA 1J6PA 4KW2A 5CJ5A 3GIYA 3MANA 3W7JA 3RO8A 3TTOA 1QK0A 2P5NA 4HP5A 4DUOA 1Q65A 3KACA 1T11A 1VKFA 4FX7A 2VEPA 2VI0A 3URNA 1YTDA 1OFDA 4J3WA 1S2WA 1OJXA 2ZTKA 1KFBA 1D7HA 1FWTA 1E9YB 3KABA 4BCEA 1M03A 2BOFX 1EYEA 3DYPA 3TN5A 5F1UA 2W62A 3FYOA 4GGBA 4QZVB 5EMKA 3PAOA 1GW9A 2G3IA 4ERAA 3NQAA 1MW2A 4E6MA 4AG0A 3UXIA 2EAWA 5DELA 1J96A 2WOQA 4PC8A 3SBFA 4HT3A 1XYBA 2VVSA 1TTJA 3IJ7A 1IXQA 1UA7A 4E4PA 3APTA 3S8HA 1H2JA 1NDYA 2WO5A 1XLBA 3DFSA 2I5GA 1UH4A 3OJGA 5CZKA 3STEA 5EBAA 4CU7A 2JF7A 1EF3A 3UWUA 4LANA 3S1UA 1UMYA 2WVSA 3BQ6A 3W7RA 2MNRA 1V0KA 2CXEA 2WSRA 1DQWA 2R9RA 3TAKA 1P7TB 3WFLA 3ZVHA 1MUWA 3BWWA 2IPGA 4Q4KA 1PWLA 5REQB 1F3EA 4F4RA 1XFCA 1G0CA 5HNNA 4XB3A 1FKXA 1H11A 1UQZA 1AH3A 2WBKA 1EIBA 2PDBA 3VE9A 3G6MA 2WMFA 3NYZA 4XQ6A 3CAKA 8TIMA 3QH2A 3MBDA 4WVXA 1KRAC 2ZZ4A 1W5MA 1XFBA 2ACUA 1D8WA 3USZA 4AMAA 3HPSA 3TR2A 5CPOA 5D9MA 2PDIA 3JZEA 3LDVA 3O3RA 1S1PA 3BW4A 5A6KA 4OT7A 7ENLA 4C6LA 2P3ZA 2ZUMA 3DG3A 3B4UA 4EOUA 4AD4A 2INEA 2D3LA 1QNVA 2L2SA 4REQA 4WOQA 1IEWA 2NWSA 4ZB5A 3LGGA 4QLJA 3OQEA 4PR4A 3L65A 1RPXA 4FK9A 4K7VA 4WKFA 3KX6A 3GKAA 4URIA 4PTNA 3SEPA 3REQA 1H7XA 5D05A 3DI1A 3KM8A 3AS2A 3WQEA 4LSBA 2V38A 5CBJA 1TA3B 1RA5A 4CNNA 3OA3A 4TMBA 5T26A 4GVFA 4DWSD 4IFRA 4IX0A 2EKGA 2M08A 3C4UA 5CGMA 1ZPTA 3KCJA 1LWIA 3V5OA 3AS0A 5C9UA 3WFZA 5MKGA 3R0DA 1P5BA 4U4MA 1IXOA 2PURA 5HWNA 3E0VA 3CLWA 2GK1B 4R0XA 1UP3A 3QRHA 2J62A 2DGAA 1BWVA 5ABEA 4OBRA 1QOPA 2G50A 4N42A 1VIWA 4NX5A 2YB1A 4LW7A 4KMQA 4GISA 4JTTA 2FVMA 3U7VA 1EOMA 1Q3NA 4D6FA 1OGBA 1W3NA 2ANUA 2WSQA 1Q6QA 1UR9A 1V4YA 2X1SA 3V35A 8RUCA 3VIKA 2O55A 1J2BA 3PJTA 4GGHA 4K38A 1A5AA 3VNMA 2WJEA 4KBXA 2PTDA 1PWMA 2E25A 1TPUA 2FPYA 4AZGA 4B4HA 3G8EA 3GYCA 2E77A 2ZXBA 5LNVA 3W23A 1FWRA 3HFTA 2FDSA 2A3EA 3AZTA 1XGDA 1C3FA 1E6SM 4D1JA 4M7SA 4TR9A 1V03A 1YXDA 1REQB 3E2SA 4Z2GA 5TAOA 1BKHA 2E5CA 2C13A 1EF2A 2FDMA 3TC5A 3TX9A 3C86A 2ZE0A 3CHVA 5A1AA 1GJUA 4MWAC 2ZX8A 1HTIA 3CZLA 4HSOA 4CNUA 5HUAA 4WGHA 1Q2RA 3MDUA 3R10A 2CU0A 1DE6A 2ALRA 1PUDA 2YYUA 1D3CA 2ATSA 5D30A 1HNYA 1BXBA 2ICSA 1ZGDA 3T2OA 3XISA 4J28A 2WYSA 5HNRA 4DAIA 4XISA 4LC6A 3VNZA 4CGTA 4K2SA 1LQ2A 2IXVA 1P0KA 3HJEA 3WSUA 4B3ZA 2P3EA 5D02A 1AMYA 3V18A 1NWSA 4DPQA 4I9TA 3ARPA 3BGGA 3KS5A 4XBJA 3W70A 1PYFA 4GO9A 1VHCA 4L6DA 5CZJA 4KQNA 3RLHA 3SZ8A 5DFAA 3IARA 4FF7A 3BV4A 2VRJA 3ARTA 2RDXA 2OWXA 3UR8A 1Z42A 3O06A 3W7OA 3P5ZA 1GEHA 4HOXA 2R1LA 2PC8A 5BXJA 3LM3A 2UY4A 3VGGA 3EPMA 4I7UA 1JNDA 1F7BA 1JVNA 1TMHA 1SW3A 1FKRA 5CH9A 5AVNA 1LL4A 3W1XA 1ITUA 2XIIA 5A6BD 2YBTA 2QVNA 3BJTA 1YE4A 1VLWA 3HMJG 3IKGA 1L9WA 1QI5A 3VNIA 2XGBA 4GNVA 3WBWA 4J2MA 1VYSX 1RD6A 5U4NA 3MYPA 4IX2A 3IJDA 3T0TA 2DEPA 3R4IA 1TX0A 1BSLA 1XG4A 3P0XA 2NVDA 3M5VA 1SJCA 1OCBA 5IBXC 1FKGA 4O53A 1Y0OA 5I7GA 3VMOA 5C9XA 2PDHA 3UZYA 5FJOA 4CEUC 4WJEA 1K7XA 3U2OA 3EX3A 1JVWA 2FLIA 4Z0SA 3MB9A 2ZQSA 3UYIA 3P82A 4XAZA 3MDWA 4JQ2A 2ZRXA 5IHSA 4OQVA 3DEQA 3GVVA 1QI2A 5AHMA 3PF3A 4V33A 2VELA 3GB6A 4L9ZA 4ZQCA 5E0FA 1ZAIA 3M1ZA 4E2OA 3IS4A 1KGWA 3GIQA 3WLNA 4B5NA 5HDRA 1O60A 4RZ4A 4PCTA 4QSHA 4N9CA 3NAVA 3N15A 1RJPA 2YSWA 3W84A 4A2RA 4LEQA 4QCEA 2B4GA 3RX4A 1EEPA 3W1NA 4XIAA 3F7JA 2FTYA 1KQZA 2AL1A 5AYXA 4WSJA 1FKTA 4JXCA 4NSBA 3SQMA 3WIJA 4QTGA 4O52A 1J0ZA 3O5FA 5IHRA 3UT0A 2V3DA 4CQCA 4L64A 1RBOB 1UD6A 3GXPA 1J4IA 4XK2A 3V0SA 1U5HA 3FXYA 1GYNA 2D2HA 2BDQA 3L68A 2YL9A 1C29A 2WJFA 4DZAA 2A5HA 2QXWA 1HL9A 1V08A 4PRWA 2RDTA 3ISIX 1KTNA 5E93A 3O5RA 2HZGA 1I45A 5KETA 1PCKA 1FKSA 2A6LA 4KWVA 4N9BA 5AC6A 3LTYA 4PMQA 3UNTA 3S9IA 1ZBWA 3GDTA 5CXPA 2VL4A 3V3WA 2INZA 1U2YA 1QWKA 5LGZA 4Z1BA 2NV2A 3NDOA 3MHFA 5F2LA 4HGXA 1YBQA 4FHAA 1XYMA 3CGTA 4HOWA 3ZJKA 3PFMA 2VO5A 3U9IA 4YHGA 5H2ZA 2GLKA 4PZVA 1EQPA 4WCJA 1IT0A 2QUTA 4L72B 1GUVA 4QDPA 2IW0A 2BMBA 1MQPA 2XH0A 5D9PA 2HE8A 3DECA 1QBBA 3AZRA 2ZYFA 1TVLA 2JIEA 2BTMA 1EYWA 3GC4A 2GGHA 4JTLA 4AD0A 1LBMA 3NZGA 4UQ9A 4N6EA 4WXZA 4XX6A 1CBGA 1I4NA 1VFFA 2IPJA 3R2GA 5AYYA 4AZHA 1LF1A 2QDHA 2ZXAA 1K8ZA 1OZMA 1VFTA 4NVTA 2FFIA 3Q67A 2PPNA 3SCPA 4H8HA 3VM7A 5C2GA 4UR9A 3A3HA 3A13A 3R11A 3MZNA 4E2DA 3A22A 1U83A 2ZUVA 3W6YA 2RJGA 4IQJA 2FZ9A 1TUXA 3GFZA 1A53A 3CAQA 2D2OA 2C7FA 3KVLA 1RCOB 5AECA 2ATMA 3DDMA 3PZUA 1AQ0A 3WQ6A 5CG7A 2R1MA 3CWHA 1OC6A 3TXVA 4JNYA 3F4CA 1XXXA 3WMSA 4RX0A 4GYPA 4UTTC 3GU9A 2JK2A 4C6OA 2IKIA 5T8GA 4FB7A 3ES7A 4DWSB 3UG8A 1VCVA 4U2YA 3LZ3A 4D8LA 4I7WA 5CC5A 1YE6A 2OCZA 4FAMA 4FIQA 3TNBA 3GVGA 1AL8A 2NQLA 1VCGA 2VT0A 4Q4RA 1R47A 3QQWA 3W7QA 1WDRA 4LV9A 2OSWA 3BURA 4YLWA 4MNKA 1VFHA 4JKKA 4LPCA 4BJHA 2WMIB 1UOZA 5G4HC 4W84A 4UFLA 4GZIA 4FPSA 1FRBA 1TPB1 4HCLA 5I98A 4MY9A 4HPNA 3W22A 3WLKX 1KFJA 3CV6A 4QEEA 1VEPA 3ZLGA 1DYSA 3PTKA 1Q85A 1PEZA 4RNJA 1SVDA 3VZYA 4O2TA 2OYMA 3GNPA 4LOCA 3IJLA 3DFNA 1DJIA 4WLCA 5E6ZA 2OGJA 2LLEA 1MWOA 2Q71A 4MJMA 3PK7A 2RFGA 5BROA 1MEIA 1C8XA 1NFBA 4ZQPA 5G1YA 3ZS4A 2DQWA 2E67A 3CIXA 1I2OA 4A4AA 2J78A 4U5KA 3W7LA 3S42A 4LVFA 4NZ4A 3VOFA 2QW5A 4PUKA 5DITA 3BJSA 1I9CB 1QASA 3P8IA 4XTDA 1XYFA 4S3JA 2A7PA 3ARUA 1VGAA 1IR1A 2E8YA 4QJ1A 3BAIA 1EJSC 3W07A 3QN3A 2ODOA 4AW7A 1HIZA 1TMLA 5EFDA 3G1FA 4P7LA 4S2CA 3W7KA 2KE0A 4DH0A 4WDWA 4IT4A 4UUIA 1OD0A 3UJFA 2WBGA 2CCRA 4DUWA 3HTWA 3UPBA 3CLMA 3U48A 3AS1A 2DY3A 2I5QA 3QSRA 4XAYA 4F0LA 1DWFM 3WG6A 4IL0A 1VBJA 2VP8A 4HNUA 1BD0A 2J7CA 3HQNA 1JFHA 3RFAA 3HPFA 3HG2A 1WZAA 2C8NA 5KZMA 4FNUA 4ZFCA 1VS1A 1KM2A 2KFWA 4U2ZA 1UWIA 1CXHA 1BF6A 4HK5A 3ZLHA 3T05A 3CGNA 1RQHA 2DVXA 1E70M 4C6KA 5CC7A 3C0QA 1VENA 1T8XA 3WMCA 4GLEA 3MJMA 3AIVA 4E8CA 3UI5A 2GVEA 4UFIA 2P53A 1NWUA 5EKYA 1RLCL 1PAMA 3Q45A 4Z17A 1GVSA 4MVAA 2OZ0A 2FJKA 3ABRA 1SQ7A 1J2WA 4FNQA 2DG4A 3NSXA 4Y9PA 2CXGA 3HG5A 3NQMA 3WCZA 1DORA 2CBJA 3D0CA 2QCMA 4LB4A 6REQB 3HPXA 4S3AA 4IP4A 3TLLA 1HFBA 4LUIA 4IMGA 4JFMA 1GYLA 2DP3A 2EJAA 5IDIA 3EA2A 3BVJA 1IQ8A 1JDCA 3GRIA 1L1PA 4FX6M 2ZCGA 4EF9A 4HA3A 1N82A 1ZBKA 4Z2HA 2WK2A 1YIXA 2D9FA 3R12A 5EL1A 3WDQA 4ASTA 3BK0A 1GPWA 1YX1A 3G0UA 3NQ8A 2MANA 4G7EB 4LNYA 3RCYA 3QJAA 4LH8A 2ZQTA 2OSYA 3MUAA 4NF7A 1BVWA 3QFWA 2QT3A 3CBWA 2YXXA 1FKLA 2R91A 2ZZ7A 2PV1A 1F6PA 1LWJA 3LXBA 4DYJA 3CMJA 5DIVA 5TBOA 3WBAA 4AIEA 2WB5A 2G37A 4DELA 1KCKA 2E1WA 1NU5A 3ZT5A 4LS2A 1DJZA 4JTIA 3U5YA 1VJSA 1WBJA 4UFMA 4N4PA 2ZXDA 4JIQA 1E1CA 3BGJA 3MKVA 1VFLA 2GDUA 5LYRA 2C1GA 4LAMA 3I7QA 5HOSA 1KFCA 2ZFAA 1XIIA 3QY6A 3F03K 5KEZA 4HK6A 1ROTA 3WUFA 3CXOA 3UJ2A 4ZVJA 3CQIA 4Z2KA 4LEFA 3VKBA 2JKPA 3W74A 4R88A 3PPFA 4YS1A 1UUQA 1VD6A 2ZZ6A 5HMSA 4YYCA 4V28A 3TMLA 3PWIA 2J4GA 1Q8JA 1JQXA 2V67A 5CPTA 4IXHA 4QRNA 1XLAA 3SGZA 1G69A 4Y8FA 2HNEA 1FFQA 4C5YA 1Q6FA 5J6EA 1ADDA 4UOZA 1F9CA 1TFVA 1DE5A 1Y5VA 4L80A 4F3HA 2P8BA 3N12A 1CGYA 1QFEA 4WHBA 1ENUA 3GVQA 4DXKA 5AHNA 3LX9A 3Q94A 1W56A 5HPOA 1A5KC 1PX8A 4KFPA 4DBUA 1K9TA 2CIPA 3RG6A 4OJYA 4L5ZA 1ROUA 2FB2A 3VI2A 3IPWA 1CENA 2EPOA 1HXJA 4O1DA 2VZUA 1ONEA 1R3TA 3ARZA 1E9IA 2JZVA 5M1TA 5I09A 4B91A 3G2GA 4N9DA 4HBOA 2NXIA 3WQPA 1TKKA 2WSKA 3RRXA 1BKSA 3BMXA 4JTUA 4HTYA 1YHTA 1B9ZA 5LIXX 3RLVA 3STFA 3N11A 5LIUX 1EO7A 1J12A 1IEIA 2YZRA 2CBVA 2YA2A 1LOSA 3L5MA 4HBKA 4PMJA 4W7VA 3UG3A 4UC5A 4ZE5A 1PIGA 3WD4A 1TV7A 2X09A 3AXXA 4P7NA 3UEQA 5CBIA 3NFUA 4EVZA 4LX4A 2A3LA 3H2EA 3MVIA 3CZ8A 2DG9A 3L0NA 2D23A 3LBCA 1WDWA 4AHPA 1OYCA 3N2TA 1D9EA 2HPMA 3S1WA 4C7DA 1JYWA 1G94A 2CZ5A 4H01A 3WF4A 3W7PA 3TC7A 1S2AA 4QQ3A 1Q6GA 1RALA 3W7IA 3EXSA 4RXFA 2D20A 2VC5A 4AISA 3RX2A 3K13A 1QW8A 4BS0A 3T7VA 5IM51 3ZMRA 4GQ0A 2PCQA 3HV9A 4PTMA 3EKZA 5AOUA 4J4OA 2Q3OA 1E40A 1KFEA 3EDFA 4GD0A 4QQUA 3KL5A 4AH7A 4BQ2A 1ZENA 1MEWA 3A9IA 2ZRYA 3M4HA 4X61A 3BCJA 3WFAA 4QP0A 3W53A 5F4SA 4Q6XA 2W4XA 1MZHA 3RM4A 2ESCA 1JCHB 3I7RA 3LQLA 3A3WA 1E1EA 3MKKA 2PPPA 4XAPA 4NZFA 1FD9A 1W32A 1W3HA 3D6NA 3N29A 2J8GA 3EYPA 2XM2A 3L23A 1UH3A 1Z7AA 9XIAA 3KTCA 3F4NA 4UFJA 3TN6A 1WXZA 3ARRA 1KWKA 4WKHA 2HROA 2QIWA 5JU6A 4TNSA 2ZX5A 3PNZA 3WF1A 1HGYA 2WZEA 1ME9A 3IJ9A 4QITA 1XBZA 2NSXA 4UXDA 2VUYA 1R2SA 3FV9A 2R1KA 1OHLA 4F0MA 4MKSA 4R27A 3GC2A 4XBSA 4ZA0A 2GJLA 5DMYA 1KO0A 1WE5A 3O05A 3VO0A 1GZGA 4AXNA 3PTMA 2PDKA 1RCQA 4NASA 3TA6A 4PUEA 1EWEA 3N3MA 2ZQVA 2NQZA 3W85A 4UZSA 3L0GA 3NTPA 2YCLA 5FF2A 3KS6A 2QCHA 4A3UA 3TQVA 4DIPA 4O8RA 5T9BG 5HWCA 3T78A 4NP7A 1BWLA 1MXGA 3UU0A 5BYWA 5CGTA 4H6RA 4NNRA 4ZTYA 2PBOA 2JKAA 2ZWYA 5I07A 1TJ0A 4PUUA 3BLIA 1YRRA 3HIJA 4ADTA 3ZXWA 5A6MA 2H8XA 3KAIA 2EKCA 1BRLA 3E0LA 3S6TA 1U33A 2KI3A 3OYZA 3F2DA 2AKMA 1OIMA 1CXIA 4I6VA 4JY9A 1KFKA 4REQB 1A4LA 1ALDA 4AWEA 5DN1A 1XISA 2ZRZA 1DV7A 2VUNA 4KS0A 3REQB 4JY8A 1JFXA 5FF7A 4Q4MA 3STCA 1PTAA 5C54A 4ZL1A 1GGOA 4P7QA 3A64A 3JXVA 3M0MA 2FMNA 2X1IA 4MJZA 3OZMA 4AX6A 1BG9A 4NJGA 5HATA 3KOZA 1Z3NA 2QCDA 3L4ZA 4C6CA 2RGMA 4H2CA 4GBUA 1YPXA 1YYAA 5I79A 2FHFA 2R6OA 1X7IA 5EY5A 5JBFA 3T6CA 2PD5A 4W88A 4LYRA 5EFFA 3VIHA 4IUGA 4AUBA 5MKGB 3TWBA 3P74A 3H7UA 2A3HA 3AZSA 1DVJA 4E0CA 2RUCA 2XIOA 5HUPA 4FLRA 2V63A 5DEZA 4IPLA 2F38A 1X7FA 4LUJA 4S3GA 5I3KA 3ZYZA 3WNOA 4F66A 5FL1A 1HKWA 2EO7A 3SGGA 1SMAA 1SJBA 2DIJA 3ANYA 1IHIA 3BZGA 4GYFA 5C9ZA 2VRQA 3ARQA 2DW7A 2PUZA 4QX4A 2JGQA 3OU8A 2Y62A 2HK1A 4XVDA 3WF0A 2OQLA 3GW0A 1GOQA 1J6YA 2PLCA 4ZB0A 5A2BA 3IUHA 2WQPA 3AHVA 2YA0A 5A2AA 4X2PA 2XZ9A 3ZWTA 3E2VA 3EB2A 1EPXA 3O5OA 4N0RA 2ZR6A 4GC3A 1G67A 1XUZA 1XWYA 5CJMA 2HS6A 1B3YA 3AAMA 4DRQA 1RY0A 4LU0A 2IS7A 1Z32X 3UWZA 2GWGA 1PE1A 4XG1A 4NQ1A 3FVMA 1UR8A 4RPQA 2P50A 4IGNA 5HQLA 1K7FA 2WJDA 4B90A 2PDYA 2VXNA 3NSMA 2IKGA 1LORA 1FCUA 2B7NA 4KQZA 1AD1A 3FYPA 4XD5A 3PNUA 2G3NA 1OFPA 3CL6A 3WBXA 1SJAA 3G77A 3ES8A 2FAPA 4Q4OA 1B0IA 3RCMA 4PUNA 2PRHA 4K1GA 2PDXA 2MLYA 3GFXA 1QI4A 5BOFA 3AXIA 2L5HA 3IANA 4H8VA 1XRVA 2V2DA 1JJKA 4ZO8A 1VEMA 6XIMA 3GG7A 4MHBA 3VNKA 1KD0A 3E5BA 4CQAA 1W0MA 2QGYA 4NJKA 1FX6A 1A3WA 4XIMA 4IP5A 1OD8A 4UBPC 1JCXA 4IMAA 4HNOA 4OWGA 3QGKC 2XINA 1F74A 2FHBA 2ABBA 1KBIA 1V79A 3GDKA 1YNYA 3CPUA 4AWUA 4UNLA 3THQA 3ENLA 3RHGA 3IRDA 5I00A 4GI4A 2QS8A 4AZBA 5BOEA 1XDLA 1IIGA 3PG8A 1OYAA 1NDVA 4OGZA 3O5DA 2ZXQA 1QPQA 3RMJA 4D8AA 2E5BA 5FEWA 3ABOA 3KBNA 3SRKA 2V30A 2Y85A 1XUUA 4JDBA 5FCZA 1B6CA 3E3HA 3S3GA 3VFLA 1X97A 2J75A 2I1OA 3QOMA 1DJHA 4HU0A 3AROA 4GWEA 4JR5A 2WZMA 4DJDD 3PJWA 3WD2A 1R30A 4K8EA 4PUMA 5DY2A 4HHLA 5HW7A 3L4XA 4CD8A 1EJWC 1YDVA 3G1AA 4BI7A 2P8CA 3VUSA 1FWAC 3RM9A 3LBMA 2OX1A 4DJEA 1JD9A 2C6QA 3TYEA 3TYUA 5FJJA 1GOWA 4U3AA 1TMQA 4DUVA 4GCAA 2XVPA 1HW6A 2IMRA 3VNJA 5E6YA 5G2IA 3VUPA 2IXUA 3KCLA 1HJWA 1U5JA 4GQBA 2VURA 2Z1BA 3KBMA 5LKYA 4BF9A 2B0MA 3CZGA 4W87A 3SY8A 3D47A 2CLOA 2VNCA 3OBEA 3BZJA 2FZMA 1X1NA 1B5TA 1ODUA 3FAWA 3B7XA 5HK4A 2F2KA 1XLDA 3C61A 3GH4A 3BSMA 3NI6A 4BA0A 1GWJA 5CEWA 3P7YA 2VX5A 4LF1A 1J10A 5FJTA 2XSXA 1PKLA 1AW2A 3JYJA 1DIEA 3ZQ9A 1TYGA 1UWRA 3CM4A 2J88A 1G4EA 3T42A 4H8UA 1WZKA 3N1AA 1FWWA 4GUJA 4HHPA 3WD3A 1MI3A 2Y7GA 1OY0A 1EGMA 4FLSA 1RPKA 1W5OA 3C2FA 4DRSA 4JOMA 3POHA 3ABSA 2D2GA 3AYTA 3AI0A 5KZDA 3P81A 1W91A 3LCFA 2DZTA 1R38A 3TV8A 2XJ7A 1H7NA 1FHLA 3UNDA 2GWNA 4H4IA 7REQA 1TPWA 4C6MA 4H9MA 5DMMA 1MNSA 4FX8A 1TPEA 4J27A 3A4JA 3CT2A 3UA4A 3T1GA 3LLFA 1H7PA 1EPVA 2OJPA 4FLQA 4HZ8A 4PMDA 2YW3A 2G95A 2Y7DA 2PSNA 2IQTA 5D2YA 1LQAA 3IJIA 2QUUA 2XIJA 4YTRA 3CZJA 2QPUA 3OVGA 5EMUA 1R3QA 4MLJA 1D8CA 4PMRA 4UTKA 3VU2A 3WD0A 4IQEA 4OTKA 1H61A 4L56A 5EMLA 1A50A 3S4TA 4DO7A 1XR2A 1HZYA 2MUCA 4MSPA 1YBQB 3RDKA 1ZJHA 1UP2A 5CPQA 4I5UA 4MIMA 3KZPA 4DF2A 3VD3A 4PRRA 3VCRA 3CUFA 4ZR8A 1AVAA 1EB3A 1CXLA 4HU8A 2HQAA 4ZPTR 5BWFA 3GC5A 4QXIA 2OSXA 5J8LA 4XZIA 4TXEA 1QVBA 4JHMA 3GO2A 5H91A 3PFRA 4ATLA 2Z1XA 4D6EA 1BKFA 4X22A 1ZP3A 4Q4QA 3AHTA 3S5YA 3ZIZA 3CHDA 1X6LA 1YMYA 1E5JA 1J0IA 1W1B1 4LUSA 1H1YA 3KRSA 2POZA 2VFEA 3UPWA 4FR1A 1O1ZA 3WH0A 3BUVA 2YGYA 4C6EA 2PGFA 4DB7A 3BAYA 1W1ZA 1R2TA 3B06A 1EA0A 2O7SA 5EA9A 2O56A 1ZAJA 4JTGA 4HSNA 3GAKA 1TE6A 4PUDA 1VAHA 3G0SA 3O5IA 4KWOA 3R7MA 4KCUA 5ABHA 4UTWA 4LCRA 4L1GA 5FEXA 3MSYA 3N2XA 3M0LA 3IWPA 3S6OA 5CSRA 1A5UA 5I03A 1UHVA 1H41A 3L5AA 2G0WA 3VOIA 1ZJBA 2QEZA 1I2NA 5AHIA 3WF2A 4U86A 2JKEA 2WANA 2DZXA 1FA2A 4QROA 1B3VA 1VFMA 4BZYA 5HINA 3GW3A 1SGJA 1UR1A 4JTAA 5BU9A 1DJQA 4MTVA 1BAGA 5IBXA 1SFJA 3EGJA 4Z2IA 1X39A 4IISA 3JW7A 4DZIA 3J7HA 3W1MA 1JZ5A 1CGUA 3O15A 3VD5A 1K8XA 3WH5A 2XFRA 1Y8BA 1OSEA 1N8FA 1FWDC 3RYSA 3GBEA 1A3HA 4I9AA 3ODKA 4ODRA 5EYWA 5D2TA 4R34A 4MUZA 4GI6A 4W7UA 2GZXA 3XIMA 2QJNA 2Q3RA 3W72A 5B7YA 1P0EA 3GSMA 1AK5A 3QTPA 1Z9AA 3NEHA 5BWAA 1E0XA 4QIUA 1J6OA 2DUZA 4LAUA 3H2NA 3MA8A 4JQAA 3NGFA 4HZMA 4UCGA 4RNHA 3UXDA 3CAVA 1MRQA 3E2QA 3HV8A 1XQKA 3LLXA 4LAWA 4PBFA 4PODA 3USBA 3ALFA 2CKSA 4O15A 3M7WA 1V5XA 4YHEA 1W3KA 3WMLA 3AC0A 2X42A 2OOFA 1ZP4A 1XIBA 3LNPA 3NQCA 4A8LA 3VGEA 3AO0A 3F4WA 1VBUA 3GPKA 1GQKA 3TTEA 4BWLC 1KB3A 4Q8VA 4KCTA 5FSEC 1ZALA 2I7GA 4AIBA 3I7SA 1RAKA 3PJXA 4V1YA 3ZVIA 1M04A 1Y65A 4EPBC 1SPQA 4HJWA 1ITQA 5A95A 1WO2A 2ZE3A 3GNNA 2TSYA 4DRNA 1I0BA 4W9PA 1OK6A 1WKYA 2Q09A 4HB7A 4XSMA 3LHTA 4H9UA 2A7RA 4IH3A 2F6XA 3CUGA 3DC0A 3VKCA 2VGBA 2CZVA 3FSUA 4TUFA 1U79A 4GPNA 4H9VA 4FOJA 2ZC1A 1UD3A 2Z7GA 3T4CA 1UASA 1G7UA 4NHVA 1F07A 1QR7A 4DO5A 1E0VA 3BH4A 3OQ8A 2I9EA 4DO6A 1V6YA 4LBRA 5HKGA 4JFTA 1SZGA 3M64A 4DY1A 1EQ3A 1XIEA 4LYQA 5FJUA 2BY2A 4GFSA 1HL2A 1NVMA 1TSIA 1WXYA 2ZZ2A 4H6EA 3BLKA 1HKKA 4LS0A 4ODOA 2NQJA 3H24A 3SUSA 3T9PA 4Y9MA 1HX0A 1EGVA 1QBAA 2Z1WA 5LA1A 4TTUA 2VR4A 3GTYX 3UQBA 3FA5A 3W81A 4MY8A 3KAHA 3A5FA 4P8UA 1W6TA 3ARYA 3BTNA 1RZMA 1RLDA 4IIDA 3F2BA 1L8PA 3O5QA 2PWGA 3B8TA 5ENLA 4S3EA 3DCPA 4JKLA 3K4DA 3HMCA 1NELA 3VVGA 3KCEA 3WDPP 3FKRA 1M9HA 1QW9A 1O66A 2ZA1A 2HMCA 3F5KA 3CPGA 4ZTXA 2EQDA 4DBDA 4HA0A 5C0QA 1T99A 2XFWA 3OVQA 1F6YA 2FYMA 1K4GA 4PN2A 2EULA 5FIPA 2GQAA 3C2RA 4YVXA 2XIBA 4UTMA 4A8NA 3HO8A 4U3CA 3NURA 3QPZA 2PU0A 2RH9A 4GIRA 1HKIA 1SSGA 4HN8A 1NWTA 4F40A 5CAHA 1AA1B 4NZ1A 3BL3A 2D2JA 1SYTA 3B9NA 2HJPA 3PP7A 3AXMA 1NQKA 3CIVA 4O0QA 1VFSA 4JHOA 2OWCA 3QC3A 2UWFA 4GNJA 3U2CA 4PMVA 3HPAA 4H6KA 2HDJA 1BGGA 3VCNA 3KBVA 2Q5AA 1S39A 1YDOA 3IK4A 1ZBVA 1FKKA 1JYVA 2VZVA 4S3CA 1E1CB 1XQLA 1GTHA 5HMDA 4S38A 3PBUA 3RRAA 1E3ZA 2A2IA 1ZTVA 2AKZA 4HD5A 3CQ0A 1CZ1A 1OFAA 4PMUA 3M6DA 2RGLA 1XLLA 3EOUA 2JE8A 4F0RA 2G3MA 3LHVA 5D2VA 1JAEA 2VZOA 1EYMA 1PKYA 3SO7A 4J7RA 3NL3A 1CGTA 1MQQA 1NP0A 3WLTA 3WQ5A 1PXGA 3PAJA 4IP7A 3GNXA 2A3BA 1W3TA 2ZVRA 4MZ8A 3CYVA 4JFWA 1G4PA 3NQEA 4UR8A 5GJMA 2YR1A 2I17A 1H49A 3KVKA 4C6QA 1EXBA 1K9EA 4DBWA 1AFSA 1ICQA 4JFSA 4X9SA 3KZ7A 1T6MA 1LM1A 5M3WA 3ZWSA 1XLCA 7TIMA 4S2BA 3W73A 4Z1AA 4DWSC 3OLIA 4Y8EA 2B5UB 1VP5A 2VC9A 3UWEA 2Z26A 3WJZA 5HR6A 1H1ZA 1M7PA 1P4CA 5CZSA 3EPNA 1FKIA 4DIAA 5DANA 3QV7A 3VABA 4H9ZA 4KETA 4MGGA 4P7OA 4CNOA 5D9OA 1F8IA 4HU4A 1FWEC 4L65A 2BGQA 3WDJA 3K1GA 4AX7A 5ABFA 1H50A 3BMBA 2DIEA 1IEQA 4M80A 2J8TA 3DYOA 3FHQA 1H62A 5A69A 3T2QA 3IAQA 4D6JA 1XH0A 4B15A 4B2DA 4B3LA 4Z1YA 3U2ZA 3O1NA 4S23A 1NAL1 1OX5A 3W1LA 4U33A 1QHPA 3ARWA 4UTHA 4KRUA 4UB9A 5AC8A 1RH9A 4GYKA 4GXMA 3E74A 1F6KA 1W8GA 1JDFA 4FEZA 1N1AA 5HR7A 1FWHC 1TPH1 3S6DA 3FA3A 4Q22A 4YWSA 4FN2A 4IJCA 4MB5A 5C55A 1R9XA 4CD6A 3VGHA 3A3XA 3VDHA 3A21A 3OBAA 4NNBA 3NVDA 4NNAA 3BOFA 3K8MA 3KL0A 2QCEA 3M0JA 3R5EA 1OYBA 1XJBA 2JALA 3LV6A 1V6XA 4UOQA 3PUOA 5I3HA 4NJHA 2OODA 3RNDA 1OX4A 1Q13A 3E5PA 1PL9A 2BODX 4JN8A 1V7AA 3QF0A 3V5CA 4DM1A 3MP3A 4LYKA 1T40A 1K8YA 5LNSA 1JPIA 3A12A 1FCQA 4CCEA 2A6NA 3NZQA 1DKWA 1ICSA 1KXVA 5DBTA 3WF3A 1W2PA 4N02A 1GVEA 3ZLFA 1UCWA 3WUEA 3RPDA 1E44A 4YTSA 2W61A 1BQGA 3WN6A 5G2WA 4CQBA 4BEUA 3KFTA 3FKKA 4UDMA 1BVZA 2FKPA 3S2LA 4TVCA 1XD0A 3SQSA 3S9YA 2YJQA 4Q4PA 2Y2WA 7TAAA 1WBHA 2E5DA 1YNPA 1ZU8A 2Y7FA 2C1HA 2XSAA 3WQWA 3VIMA 2JGYA 4JQ3A 3EA3A 3NPXA 4C6FA 4NX0A 3THUA 1LL6A 2BVTA 2BS9A 3V0UA 3LS9A 2OYLA 5CZ0A 3LTPA 3MUCA 5LGXA 1KCLA 1XCXA 1E0WA 4MWAD 3UI6A 1V51A 4AY8A 3NJ3A 2Q6ZA 1AJ2A 4OIFA 1XV8A 4J35A 1TPDA 4OECA 5GNXA 5DMNA 4ZOBA 3E0FA 4KF1A 4D6DA 1XYCA 4IIEA 1FUYA 2ZQ0A 4S3FA 1K8CA 3EDJA 1V6TA 1WA3A 1RUSA 4AB4A 2GVYA 2E6FA 4JX6A 1H0IA 2VFFA 3AUJA 2PBGA 2YCLB 4A3QA 1XKYA 3KLKA 2XIMA 1HJSA 4O13A 5M2FX 2GJXA 1JGIA 1AUSL 1K77A 4L61A 1UB3A 4IGHA 3W1PA 1WKEA 5DO8A 2ADAA 4YVPA 5JXQA 2DZWA 1XBVA 2WVUA 2I56A 1PHWA 4QNEA 4PULA 3EX1A 3EWBX 1ONRA 2XTKA 3TYCA 1XI3A 1BRLB 3MHGA 4M29A 3K4WA 1FFRA 1O7AA 1JYNA 3RX3A 4P8WA 1TWSA 4NG3A 2QMJA 4YU1A 2BSLA 3GFYA 2EG8A 2ZZ3A 3H70A 3M0KA 4C1LA 2NUYA 5FAGA 4BEQA 4A6GA 4KR0B 3ZT6A 3IJ6A 4NZ5A 2DQXA 1FKWA 3DIPA 3M5XA 2W92A 3UGRA 1QNSA 5E0CA 2PC4A 3SDOA 3NWRA 2E40A 3UBPC 4MB3A 4I9MA 3GXFA 2JIWA 3RR1A 3FN9A 5T91A 2OT1A 3PA7A 4BHYA 2QCDB 3QVQA 3KL3A 1NP2A 3MMUA 4J3XA 2FTPA 4MY1A 3QQ1A 2PODA 2PZ0A 3R58A 5HQEA 4Q7NA 1BLIA 3A6OA 4XV0A 3W82A 1ZHAA 1MXDA 3L2LA 1KNWA 3P67A 1B54A 1EO5A 2Z1VA 1SR9A 3IK2A 1WDQA 1LROA 2BY1A 3OG3A 3DOPA 5J04A 4BR1A 2GSEA 3UJSA 1TVNA 4WXYA 3C2OA 2J8FA 1V3KA 4J3UA 3GNDA 2ZR5A 1LOQA 3PWAA 4YIWA 5XIMA 5K2ZA 2ASHA 3RF9A 3WNNA 4O16A 3NQFA 1L2UA 2VC7A 3O9NA 3N3TA 4Q6JA 3FX4A 3WENA 1GEQA 3AHYA 1PVNA 2O4MA 1IEVA 3O6CA 3T55A 1SFSA 2VFGA 2Y8KA 1EA9C 1VJZA 4J4KA 1QPNA 3MZ2A 1J5SA 2XWEA 2Z1KA 3WELA 4TX0A 3QKEA 3AIQA 2BVYA 4MFDA 2NUXA 5GJPA 4ADUA 3W7HA 1T0OA 3TQ0A 2OGYA 2J7HA 3DX5A 5FL0A 3FJ4A 4E4FA 3RAOA 3M0ZA 5HPCA 3WK1A 5CJNA 3DHFA 4NJIA 4LFYA 3W75A 3INPA 4B5XA 1VF8A 1NFPA 6TAAA 1BVNP 1XLFA 4UOJA 5K3VA 1XP3A 1BF2A 1H7OA 1ODZA 3AALA 4KH2A 5M17A 3KLLA 2ZWZA 4U31A 2XFYA 2FIQA 2XIQA 1S38A 1S5TA 1YW5A 4BFAA 2TRSA 4YWIA 3U4FA 4AFYA 3K5XA 1N55A 3E1F1 4GX9A 1AL7A 1XLMA 1X38A 3LCXA 2WJZA 4O11A 3UGVA 3BQ5A 2J7GA 4M8UA 4NIRA 2PTYA 4QCFA 2ZUTA 3I3EA 2WHKA 2MLZA 2VENA 3EOLA 4HPXA 4C90A 4XTIA 5C70A 5FF0A 3F4DA 2BP1A 5A6BA 1HL8A 2CNCA 3L2IA 3NA8A 2F61A 3ABZA 4WF7A 2ITKA 3L67A 1C92A 3R6IA 3UG4A 3LRMA 1CTNA 4IWWA 2C18A 4E3TA 4ERGA 1NF7A 4HPHA 3ATZA 2YOCA 1GVRA 2BGSA 4HU3A 3KDOA 4CLMA 3GG1A 3GTFA 2GVJA 4OBTA 2H3DA 2ZX9A 2TMDA 5CPSA 4IFOA 4GI8A 1UH2A 3QHOA 2XWDA 4WX2A 4GIVA 4GQRA 5FJIA 4D1IA 5DXYA 5I5RA 2J27A 3CB3A 5BU6A 1GQIA 1ONWA 2OLAA 4KGJA 4QR6A 2PAJA 4F48A 1PBGA 1WOBA 5E0KA 1JULA 1OF8A 3CU2A 5TNVA 5MF5A 1AW5A 2A1YA 3IVUA 4D71A 1TCMA 3B0PA 5LIKX 1NSJA 4PSPA 4ZFMA 1UP0A 3IIZA 3CYJA 4EPEC 5B8IC 5HNTA 4PTVA 5HJXA 1A49A 3T0CA 3U2EA 2GDQA 1P6CA 2GOKA 4CD7A 2WNQA 1LQ0A 2ZIDA 4QT3A 2CHNA 2OELA 4DN1A 3JYMA 5TF0A 3W1AA 3UYCA 1K6AA 1CCWB 2Q8XA 3R43A 3RLUA 2HSAA 2RUDA 4TU1A 3U4AA 2ISDA 3ZT7A 5GPRA 1H60A 3G18A 4B5SA 2Y61A 1QOXA 2XVLA 2X40A 4US6A 2W66A 3UWQA 4CCCA 1M5YA 2PU1A 1K9DA 3IV8A 3ID7A 1F8AB 1XD1A 3LCWA 1WUEA 1UJQA 4B16A 4XZWA 4HQVA 4C02B 2VC6A 2PWHA 1WDPA 1IIHA 2XP9A 1E0UA 1NH6A 3CHEA 1XLEA 4HARA 4D9PA 2H6RA 2X7WA 1CT5A 4KRTA 1GK8A 3LCHA 4TTGA 2YCIX 1M7OA 3TE9A 3PZTA 4JNZA 3VM5A 4R7WA 1TX2A 3IIPA 5JH8A 2ABAA 4CU6A 4DQWA 1DL3A 1BYBA 3O5LA 7REQB 5ABGA 1CNVA 4AD5A 3IGUA 7CGTA 1HP5A 4IPNB 3ERPA 4D8ZA 3G1RA 3VOHA 3WEZA 4DNHA 5C2CA 1UKPA 1KGXA 3OZPA 1FBAA 3E02A 1R3VA 2BOGX 4IMCA 2RQSA 3WLJA 4MMWA 1A7XA 1YDYA 1R3SA 1GOKA 3HBLA 1UC4A 5FOOA 3RU8X 2W91A 1GCYA 1WZLA 3VC5A 3LXAA 4MYXA 4G7FA 5LA0A 1ONXA 1PB0A 2F84A 3ZJ7A 4MSSA 2PDPA 4ATWA 4ML9A 2ZUUA 1OQFA 3LSBA 1FHDA 1W3IA 3CV2A 1QPFA 4R3UA 1ITXA 3AMGA 4YTQA 5L9FA 1FH8A 3S83A 5CCZA 3NPVA 3A9BA 3W28A 1WAWA 3BOXA 4G8TA 3EWXA 2NSOA 1A5SA 3VILA 3LBOA 2PDFA 1BFNA 4O50A 2C0AA 1O94A 4H7ZA 1R7AA 1POKA 3N2OA 3GHSA 4NAEA 3MQTA 4WQ6A 3CEPA 3VGBA 4ZOEA 5F4WA 3EZ4A 3R8GA 5C5YA 2HPIA 4LUSB 1H1NA 5HW6A 3PBVA 3N4FA 2XP4A 1C8QA 1O5KA 7ODCA 4H83A 2CWNA 4MB4A 1U30A 3TLQA 3RGTA 4C6JA 3N2MA 2O9TA 3WQDA 4AYSA 4O0ZA 2WVTA 3LTSA 3P0WA 1AODA 3EY6A 2G3FA 5HJLA 2EEXA 3QBUA 2PWEA 2V68A 1KQYA 3NO3A 2OTDA 3QZEA 2RURA 4X0VA 5AC7A 1N2VA 5LNWA 2WMHA 3VD4A 1J0JA 3F1QA 1IZJA 1FXPA 2DVTA 3VD9A 3TKFA 3VOGA 2D0GA 2QUMA 1UROA 5D33A 2B7QA 4AWSA 3SCVA 2DT3A 3B9EA 2YDRA 1LT8A 1M1BA 3VIGA 1B3OA 1VFOA 1JPMA 3WO8A 1TPFA 4PB5A 3IJQA 3CPRA 1E6NA 4W89A 4H7VA 4CNPA 1Q4NX 1XH1A 1IF2A 4LY4A 5A8QA 4GI9A 2NQ9A 2ZR4A 1ZCOA 1S2TA 5LNUA 9XIMA 2GL5A 3VAVA 3QV6A 4W9TA 3QYQA 4GIEA 5XINA 4BQ5A 3VOJA 2VCBA 4LRSA 2XDFA 4XKYA 2O0TA 3W38A 2J13A 1J11A 4AF0A 2QULA 2OLSA 3WL1A 3O2LA 4L6HA 3TXZA 1V93A 3MYOA 2FVKA 5D8WA 1F2JA 2NQ5A 3TCSA 3P84A 2OX4A 5KZ6A 4JDYA 2YXOA 1QO2A 1L0PA 2A85A 1DXEA 2Y24A 2PP3A 3N14A 4KIRA 1ZFJA 3U8GA 1S5NA 1A80A 4RZBA 1UOKA 1JUKA 4GQGA 3CH0A 4LUYA 4KWUA 4GIYA 4AZ6A 1G9HA 3W71A 3M41A 5DQPA 1W9PA 1KFWA 4JTJA 3WJWA 3WLMA 8A3HA 2ZICA 1JD7A 1KR1A 1RJRA 1AQHA 4IIFA 2HK0A 1W5PA 4IQCA 4TVDA 2A3CA 4EK7A 2WMKA 1ITCA 3QMRA 3MU7A 1A0DA 2Y5SA 1MQRA 1C7TA 4E4UA 2M1IA 3TMQA 4QJ3B 1JGMA 3KP1A 3B0YA 4U84A 1AZ2A 2J9ZA 3NXFA 3CS2A 1D6OA 4O28A 2GOUA 1TWDA 2V9DA 1D7KA 2ZRWA 3PHAA 3MV01 4RZ6A 4UCFA 3LHUA 4ZMGA 3A4XA 5CSUA 2AGTA 4K8HA 4PH6A 4OHQA 2GGIA 1WNOA 2G5WA 1GYMA 1R3RA 5EPDA 5KITA 4LB3A 3S47A 4O12A 4XD4A 6TIMA 1Z44A 3IUDA 5G2HA 2DFAA 1JZ2A 4BF7A 2R94A 4IMDA 4W4QA 1PDYA 3OGSA 3N04A 3GVWA 3TP4A 5A8OA 2REQA 4RDWA 2GK1A 3W2LA 3AOFA 3BG9A 3E6EA 4IMEA 2VX6A 4CVUA 2ZDRA 3N6HA 4UMAA 5D4YA 1SZFA 1UWTA 3AIWA 2P10A 4QBXA 2VZTA 4JYFA 4L4OA 3UZWA 4D72A 4V15A 6PTDA 1F40A 1AQMA 4GFIA 3Q4DA 4NRRA 4JPGA 2VTFA 4A22A 3MO4A 3OHMB 1UZDA 3ALGA 5HMEA 5H1WA 3TJLA 3G24A 4GE8A 4GUFA 1WUFA 3UZ5A 4DBEA 3LD5A 2CHRA 2ZUSA 5HULA 1EQCA 3C2VA 4NYUA 1FWCC 3OTRA 1TO3A 5BMWA 1IXNA 3FK4A 5AN7A 5G1MA 3BG5A 3LNMA 3FAXA 3ZZ1A 3KTSA 3UD6A 1M68A 2PLKA 2ZOXA 3H7VA 4XAFA 2GSHA 2NXGA 4C65A 2WWDA 1HUVA 1JXKA 1H0GA 5IOBA 1L6WA 2WQDA 4IPXA 2NV1A 1G4TA 4A3YA 3B8SA 2GDVA 4R9OA 2BLEA 4WR3A 4O8AA 1US3A 4Q7IA 3FDGA 4P2VA 4JEQA 4FOUA 4MPKA 5DBUA 5IRPA 2FGBA 4UQEA 5AZ1A 3IRSA 3UPMA 4FLOA 2ZDSA 1MZRA 3BG3A 4GJ1A 1S3HA 3BW3A 2P1FA 4R85A 2FHCA 2R1PA 4M1BA 3PBYA 4Q8WA 2VD9A 1E3XA 3URQA 4OBSA 4GZJA 3W4RA 1XRSA 3IUIA 2NWRA 4BI5A 5C7HA 1EUNA 4QS6A 2CBUA 4LRTA 3MWCA 1ME8A 4QGCA 2H3BA 1JQVA 4UTIA 2EPKX 3B8WA 1IT8A 3B03A 4JTDA 4AVOA 3H53A 3L4TA 3ANUA 3AQUA 5HT1A 4TX8A 1W9XA 3MSGA 4EF8A 2PTZA 2AMXA 3R1ZA 2XP3A 2GGGA 5A2CA 5I3DA 3W27A 4D6CA 3FLUA 3HPZA 2FZBA 2PDCA 3VK5A 2IUZA 3P61A 3M0IA 1W5QA 1YPIA 5EMJA 3NIYA 5K4XA 1JIBA 2BHUA 1JR1A 1H3GA 5LHEA 2I57A 4RW5A 1K03A 1C8VA 3UFYA 2NVAA 4GYPC 5JBDA 3ARVA 1L6FA 3KHJA 3EKLA 1E73M 2RDUA 5BRPA 5HJYA 1UIPA 2YL6A 1OCJA 4RNIA 1AH4A 2BVDA 3A47A 3DKJA 2J79A 1UWUA 3W6MA 3N4AA 4HCDA 3H4WA 4XZLX 3HG3A 5G5IA 3THCA 1GOXA 3MKCA 4Z2JA 3W02A 1H09A 1AD4A 5ECVA 1R8LA 3EWCA 3EXRA 1K02A 1X1OA 4FF5A 2QF7A 3GR7A 3UY7A 4H7CA 1EGZA 4WSHA 2FH8A 4AD2A 2EPLX 4PTXA 3IHZA 2WAGA 3DGBA 3RK8A 1I8JA 1OBAA 3QOKA 3G8RA 1XHGA 3W6LA 3MSDA 2TODA 3R8RA 3FIGA 3KOWA 1UD2A 3NNTA 2ETNA 2GQ3A 4Y9AA 5ABFB 3AMCA 4B5UA