2DSUA

Binding of chitin-like polysaccharide to protective signalling factor: crystal structure of the complex formed between signalling protein from sheep (sps-40) with a tetrasaccharide at 2.2 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dsuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dsuA01
2O9RA 3L4TA 3UCQA 1R86A 2AOSA 1VEOA 4D71A 1V6YA 3PBGA 1ZBVA 2XSBA 4PMRA 1OB0A 3UETA 4NSBA 5I79A 2Y8KA 2AMGA 2OLHA 1UD2A 4BA0A 1NOFA 7TAAA 2DT0A 1HKIA 3W53A 1Q4NX 4ZXOA 2QV4A 3OGVA 3L4ZA 1WCGA 2FH8A 1FH9A 4JZ5A 2BV9A 2BY0A 1VRXA 1HF6A 3IANA 3ZIZA 4HOWA 1B3WA 3AHXA 1GW1A 3WUBA 2QPSA 3BAJA 4W8LA 4GI8A 4A4AA 5CSYA 3VUPA 4CD4A 5KEZA 1NWRA 3U7BA 1JYNA 4HOZA 2X8RA 4ZFMA 3WD3A 4H2CA 3WL1A 3GH5A 1EHNA 2YDQA 3WELA 1B9ZA 2WMIB 3N04A 3WL0A 3VPLA 4LQ1A 2W61A 3ALGA 9CGTA 2E40A 1LWJA 2WKGA 2NSXA 1RPKA 1UKSA 2XFYA 3II1A 1GHSA 1L0PA 2V3FA 2J47A 4XV0A 5A6KA 2JEQA 2OSYA 2XTKA 5EB8A 3CUHA 2VRJA 2ZICA 2EXOA 4UFHA 4M1RA 2Z1SA 1UR2A 4EKJA 6TAAA 2ZWZA 2VQTA 3M46A 4P7RA 1VEMA 1WKYA 4P8UA 1GHRA 1JZ3A 1H1NA 1EDQA 2DPEA 3ZT6A 5IFTA 4MDOA 3QHMA 3F5KA 5CG0A 5EFDA 4ZE5A 1R8LA 1ZU8A 3POHA 2J7DA 1E71M 3ZMRA 3ARPA 1BHGA 1G5AA 1WB0A 4AEFA 4FLOA 4UQBA 3W0KA 2E4TA 3ZO9A 4Z2LA 1NP0A 1JZ6A 4GZEA 1H41A 1J0ZA 2EPLX 3MV11 1JYXA 1KXQA 1WE5A 4W87A 1XD0A 3ZR6A 3I3BA 2YIHA 1WDRA 2DH3A 3TTQA 4H8HA 3ZR5A 2BVDA 4CU8A 2J4GA 2ESCA 2ZX5A 1KR1A 5A6JA 4AIEA 4AY1A 1EDGA 3PZ9A 1J18A 1CXIA 4UOQA 3IAQA 3ZT5A 1BPLB 3L4XA 2VZVA 1W9VA 1W1VA 3EBVA 1V3HA 1X6NA 5A8PA 4TUFA 3CPUA 4FLRA 1E72M 1B90A 1CYGA 1KBKA 2A3CA 1QPKA 1UZ1A 3L4WA 3GXDA 2BY1A 1DWFM 1HJSA 3KL0A 1MFVA 1R7OA 3EMQA 5ABEA 5E6YA 3W6LA 3ZJKA 1Q6EA 3EYPA 4MAZA 4H8VA 1B3XA 2W92A 4GPNA 4HMCA 4YHEA 1V08A 2O9PA 4JFTA 2VX6A 5AYBA 3AS1A 1GOMA 4D6CA 2WPGA 4XB3A 4AZ7A 4CKQA 2WMIA 4B15A 2WKLA 4MPKA 1K6AA 4CN1A 3CMGA 2W4XA 1NWTA 2DSZA 2VZSA 3AICA 1NH6A 4J3TA 1MQQA 3MMUA 4P7QA 4HU0A 1J0IA 1HP4A 2BY3A 2MANA 2YKKA 2VCBA 2UWFA 4CN4A 3AXHA 3ZSSA 4P7OA 1E6ZA 1NQ6A 3VGHA 4W5UA 3FHAA 4PEEA 1ODZA 2J8FA 5GNZA 5I3DA 3CZLA 3TONA 2DH2A 5C8BB 2WAGA 4MB4A 2YL9A 2DSKA 1TVNA 3RM4A 1LG2A 1J11A 4EK7A 1XSIA 5LA0A 3CUFA 3K4AA 1FHLA 1US2A 3VGDA 3ARYA 1BVZA 2HISA 4W85A 3TOPA 3I3DA 3WNNA 1A47A 3BAXA 4DM1A 5BXRA 1XSKA 3D3AA 3AOFA 4OKDA 2VUYA 1C3FA 3VD9A 1QNOA 1C91A 1H09A 1TFVA 5DF0A 1BG9A 2ZUUA 1M03A 3HMCA 2J7HA 1WDPA 3BAWA 3GBDA 4LYRA 4TVUA 2J8GA 1E73M 3PTQA 3NYDA 3MU7A 2WLZA 1JG9A 2WCGA 4TTUA 2WNWA 3WMSA 3VU2A 1VEPA 5D8WA 4HA3A 5A6BA 2GJPA 1EHAA 5I77A 2X0HA 3OGRA 1MFUA 1XCWA 3AIRA 2WMGA 2WYSA 5ECUA 4BZYA 3AIBA 3NIYA 1E6NA 1MW0A 4JCMA 1HVXA 4J3XA 3UG5A 1GUVA 3A4WA 1HJWA 1OBAA 1CTNA 3KL3A 3PZOA 5FOOA 1E6RA 3WF1A 5GNYA 2G3JA 4XZWA 2AAAA 2G3MA 4UQEA 4PTMA 2X1IA 4K68A 4F9DA 3OGSA 3BMVA 1AMYA 5F7UA 4HU8A 1UA7A 3WQ6A 3BMWA 1F4HA 4H8UA 1UR0A 4GO9A 3WBAA 1CGTA 3CMJA 4YHGA 3VX1A 2FGZA 4MNKA 1RH9A 5BCAA 1UUQA 3CBWA 5CPSA 3UERA 3WDJA 2GVYA 2DIEA 3W81A 4MDPA 3HJEA 5BRQA 3VVGA 1GZJA 1XC6A 1KR0A 4TXEA 1W1YA 2HVMA 1QBAA 3MUZ1 4IISA 2DEPA 1E0VA 1ZS2A 1HIZA 2FHBA 4PCSA 2J7EA 3AHVA 4JKKA 1QNSA 3DC0A 4B9ZA 2X2YA 3CHEA 1CGYA 1CXHA 4H7VA 4TOQA 4FMVA 5AY7A 1MQRA 2NW0A 1OIMA 1EO5A 5HDRA 3VILA 3UESA 4BS0A 1FH8A 1EXPA 4A3HA 5ABHA 4JHZA 2WWDA 3EDDA 3B9AA 3VNYA 3SIMA 3SURA 1BYBA 3POCA 2GUYA 1JYVA 3WF0A 1CXFA 1NOWA 5I24A 2J7BA 1V0KA 1K9TA 2WVUA 3AROA 2YA2A 1H4PA 2WK2A 3AXIA 5A3HA 3GZAA 1WZMA 4L4OA 4ML4A 4AEEA 1P6WA 2YLLA 5CQ1A 1W91A 1UZ4A 3WF4A 3T2OA 2WMHA 3VIIA 4CD8A 1B30A 2IXVA 5DT5A 2OWCA 2OYMA 1MQPA 2PWEA 2XVLA 1G1YA 2FHFA 1RP9A 4D72A 2IXUA 2Y4SA 1NP2A 3K4DA 3K46A 3DYOA 1JFHA 1JNDA 1VJZA 3LPGA 5I2UA 4BCEA 5JH8A 4F9JA 1W3HA 4AZ5A 4S3KA 2E0PA 3CUIA 1U33A 2ZXBA 2D22A 2W62A 1FA2A 3CLWA 2X09A 1FHDA 1PZ3A 2YL6A 1TE1A 4AWEA 1IT0A 4MNJA 2J78A 4OIFA 1JZ5A 1OINA 1TUXA 5HPCA 1UH3A 5GQBA 3A4XA 4L4PA 3CZKA 2VR4A 3T08A 1K9EA 2TAAA 4CD5A 3OLDA 1HL9A 5HOSA 1HN1A 4D1JA 2J7CA 2WBKA 2JIWA 1GQIA 3N15A 4WKAA 4HA4A 1CGUA 3W38A 5I78A 2YDRA 4XUYA 3N13A 4P7LA 4WJXA 1U2YA 4PMNA 2JALA 3L2LA 3S2CA 4GI9A 1HKKA 1CXLA 1UYQA 2E8ZA 1KCLA 5E09A 1ZB5A 3NJ3A 1VFFA 1CXEA 3W29A 1IV8A 3FAWA 1J0JA 4M24A 3M07A 1W2PA 1J12A 4FLQA 4CU7A 5IDIA 4Q22A 3VDCA 1Q6CA 1LWHA 1BQCA 2ZX7A 3MUY1 2WC7A 1GVIA 1EA9C 1UKOA 2ZWYA 5FL1A 1KXTA 5M5DA 1UR8A 2J74A 4AZBA 4CCCA 3VIOA 3WD4A 3HU7A 3VD3A 1V0NA 3DECA 4PMYA 3VIFA 3THCA 2GDUA 1N82A 4AZCA 3GM8A 3EDKA 1UHVA 2WW5A 2CETA 3WDQA 5I6SA 1V3KA 1CEOA 1K9DA 2EPOA 2WZHA 4AD1A 2UY2A 1OT2A 4PSPA 6CGTA 1JZ7A 3PZMA 2WC3A 4ZEPA 2XGBA 5JBEA 5A6AA 1J10A 3VM7A 2C8NA 1BYCA 2JE8A 3N11A 3PHAA 3WF3A 5LA2A 2Y24A 1VIWA 3U5UA 3AIWA 3N18A 1QI2A 5A69A 2V3EA 4W8BA 2VURA 5M17A 1QNRA 2F8QA 3QOKA 1VJSA 1DEDA 3ZQ9A 1HJXA 1CPUA 2VJXA 2VZTA 1EDTA 5JUVA 1ISYA 1XV8A 2XWDA 4DWSD 1UR4A 4JFSA 1LG1A 2G8ZA 1HT6A 3T0BA 5FIPA 2VX4A 1E43A 2F2HA 2PBOA 2YBUA 3SEPA 1GQKA 2YA0A 4W7UA 1UD6A 1G94A 2CERA 3SUSA 2G3NA 3PZVA 1XCXA 3AMDA 3ZJ7A 4WK9A 2E9LA 2QLYA 3AS0A 4AZIA 3W37A 1JF6A 3WNPA 2XM2A 3GNPA 2CYGA 5I5RA 5I0DA 4QFUA 4LYPA 4CCDA 4PN2A 4PMXA 1G0CA 2W67A 1CNVA 3MKKA 1KQYA 1HKJA 4PMQA 3K8MA 4QCEA 1MW2A 3T09A 1UD8A 3SCTA 1Z32X 1UD3A 1TR1A 3SCUA 5FCZA 5IFPA 1W9UA 2D20A 1C90A 3AIUA 1V6UA 1HXJA 2XG9A 2W66A 2EPMX 2A3HA 2YL8A 4GQRA 2J7GA 3WSUA 2WANA 4PCTA 3RMEA 1BTCA 4HP5A 2JF6A 5AYIA 3VIPA 4KWUA 4E2OA 4B3LA 4V28A 1PEZA 1W3JA 1I1XA 2VZUA 2YBTA 4MTVA 4UFIA 1WDQA 4P8WA 4AD5A 4KGLA 1E6PA 2EPKX 4PTXA 3U57A 3SCVA 4URIA 1LJYA 1BYDA 1PX4A 4F8XA 4J3SA 3PZNA 4W84A 2GK1A 1H11A 3U5YA 2Y8VA 2OWWA 1KGWA 2EBNA 2CXGA 5D9NA 3L4VA 4D6HA 1V3MA 3QHNA 2PWFA 3WQ5A 2WSPA 4AD0A 4JFUA 5EMYA 1GCYA 3VIMA 1BYAA 4U5IA 1UWRA 1XSJA 3SUTA 1VFUA 3WH8A 1B31A 2DDXA 4UFKA 4LPCA 4UZSA 3AZRA 4DUVA 4X0VA 5DMYA 3OA5A 2DIJA 1AQMA 3SCQA 1BGGA 1BGAA 4AD4A 2XJ7A 3WDPP 1ECEA 1FOBA 5E70A 1SFSA 1EOMA 4CD6A 2EQDA 1UR9A 3ALFA 3CTTA 1CWYA 5JBFA 4UFJA 1VFOA 2WMFA 1BVNP 3CUJA 2WC4A 3VMOA 4TTGA 4AC1X 1KGUA 3RJYA 3FN9A 3WQ4A 4NRSA 2XVNA 1QI3A 2XPKA 3ZM8A 4W5ZA 3ZJ8A 4U5KA 1JIBA 3NSNA 3OLGA 6A3HA 3ZOAA 3AZTA 3CHFA 2FDMA 4UTFA 1GOWA 1E1FA 2V5DA 3VD4A 3VDHA 3BAKA 4J7RA 2UY5A 4UNIA 2PWHA 2WB5A 3ZT7A 3AHTA 5C70A 5CJ5A 4M81A 3A4AA 1XYZA 5CLWA 2WVSA 1E6SM 2ZX6A 2YDSA 1M01A 2XVGA 5CLTA 4CD7A 4UFLA 4KRTA 4IPNB 1W1TA 3K8LA 5CZKA 2DSVA 2BVTA 1E6QM 1H49A 3WNOA 4UOZA 4AZGA 1ZBCA 1SR0A 1ZL1A 3VD5A 3WEZA 4JKLA 1F4AA 2CKSA 2VMFA 2O92A 4NZCA 1UWUA 1C93A 4AXNA 4D6EA 4PMZA 3BCDA 5A8OA 2DT2A 1B3VA 3PTKA 2YOCA 3N9KA 5JIWA 3FY1A 2EJ1A 1J0KA 2BS9A 4W86A 1L8NA 1W1PA 5BXTA 2VT0A 3ZJ6A 4J28A 4IM4A 3G6LA 1KCKA 1E3ZA 3VGEA 4S3JA 1VF8A 1HJUA 2WHKA 4U3CA 5EBAA 4KH2A 4EAMA 4AIOA 3LMYA 5JIPA 1BG4A 3WBEA 3N12A 4MJ4A 2CNCA 1I75A 3WQ8A 3EMZA 2RGMA 3SCSA 3WEMA 4MNLA 2NT1A 2X0YA 1GOKA 1UWSA 4PSRA 3THDA 5IHRA 4D6GA 5A6BD 4HZ7A 1UWIA 2VRKA 3WMCA 4OUEA 1Q6GA 3SUWA 1B0IA 3BLPX 3D5HA 3KEHA 3ARZA 1KBBA 4MJ2A 3FAXA 2J79A 3GNRA 4PMOA 4UQDA 1E4MM 3CH9A 1ITCA 1DHKA 1V6WA 4CUCA 1CGXA 1FFRA 1C8QA 3NSMA 3W27A 3O6AA 1OGGA 2ZOXA 2XM1A 3BCFA 2DGAA 3SUUA 3ARSA 1ZJAA 4N42A 2E8YA 2WBGA 3T0AA 4H04A 3IJ7A 1JF5A 2WXDM 1GJWA 4KGJA 2V38A 3WEOA 3EMCA 4AISA 1EH9A 4QLLA 4YPJA 1DWGM 3ZSTA 4OBSA 1XGZA 1E4LA 1E15A 1VAHA 4WKFA 4DUXA 1HKMA 3OIHA 1WZAA 1TVPA 3CZEA 1WO2A 5E6ZA 1QW9A 1E40A 3GTNA 1NOUA 4QP0A 4P7NA 4GI6A 1H3GA 1G9HA 4GINA 3K8KA 3AZSA 2WWCA 4UQCA 8CGTA 5FD0A 1LL7A 4AMCA 3AMCA 3W28A 3AIVA 1JL8A 2G41A 1XHGA 3WFZA 4GIAA 1E0WA 4CU6A 5CSUA 2D23A 3PTMA 3L2MA 1PIFA 3F5LA 3O2LA 4M80A 2XIIA 5E0CA 3BGAA 3MSGA 4HPHA 4M82A 2XWEA 5EFFA 2Q8XA 1G01A 3BLKA 1XH0A 4Z2IA 2PC8A 4XZBA 2ZIDA 3AHYA 3GDBA 2VCAA 2J7FA 3TA9A 1ITXA 4AZCB 4BQ4A 5DT7A 2ZUTA 4NRRA 2WCAA 2EO7A 4M56A 2J75A 3WDHA 4PMDA 4GQQA 3M6DA 2D3LA 4D6FA 1LQ0A 3QR3A 3ARTA 3U7VA 5I23A 1JGIA 2BHZA 2ZUMA 2WVVB 5HBFA 2VOTA 4UQAA 4JCLA 5HNNA 5IXEA 4J3VA 4B16A 1MXGA 3HN3A 1W9DM 5GNXA 1OIFA 4MAVA 2QPUA 1BSIA 1A3HA 1D3CA 3ECQA 3RCNA 3VIJA 2D2OA 3F4VA 2BY2A 2D1ZA 1V0MA 3F5JA 1CXKA 4OJYA 5FL0A 1CIUA 1YHTA 4RE4A 3VX0A 4HTYA 3QHOA 5C71A 5CPTA 2C0HA 1FH7A 3WNKA 4F66A 2JF7A 1H0GA 4C7GA 2FGLA 3VTRA 4UQ9A 4WSJA 1JI1A 4LX4A 2ZUSA 3WIJA 4W8AA 3EDEA 3SCRA 3WN6A 3RM9A 2A3BA 3AFBA 1MW1A 3DHUA 2V5CA 2DT3A 1V6XA 1OGSA 2CBIA 3VNZA 4V27A 1AQ0A 3AS3A 1O6IA 4BQ5A 2Z1KA 2ZXDA 3GXMA 1PX3A 1MWOA 3VD7A 3KZSA 3MUIA 3PZGA 3KE0A 2PI6A 1HNYA 4ACYA 4UCFA 3ARVA 1I1WA 3S6TA 2XVKA 3T2PA 2ZE0A 5A1AA 4H41A 4WIWA 4JL1A 2O9TA 1C7TA 3FNDA 2WLYA 3T0DA 3B9EA 4Z2HA 1VB9A 2YJQA 2PB1A 1DP0A 4LGXA 3OZPA 5DO8A 2JIEA 3WH7A 3CO4A 2QMJA 5HPOA 3IJ8A 1PJ9A 2V3GA 4EANA 1R7AA 1GONA 1OT1A 3RDKA 5D9MA 5BXPA 3AQUA 4LYQA 1JYWA 2NT0A 4KRUA 2J62A 3W25A 3UG3A 3GXFA 3LPPA 4PTWA 1UKQA 4ZENA 5AC5A 1TA3A 1FP9A 1QBBA 3WQWA 1C8XA 2WVVA 2CHOA 1TCMA 4J3UA 2GK1B 2W63A 4QAWA 1GPFA 1JZ2A 3WDRA 1W3KA 2GSJA 2PWGA 5A8MA 4FK9A 1RP8A 3RIKA 1BF2A 4HPGA 1TMQA 2G3IA 4CCEA 3SCOA 5GPRA 5AC4A 3WF2A 1NWUA 1JZ8A 3W82A 1JNEA 1LLOA 1UA3A 4HZ8A 1LL4A 2WM0A 3OLIA 2CBVA 4DWSA 2G4FA 5CPQA 4W7WA 1U30A 2WMJA 2VX7A 1US3A 3PZUA 2GFTA 1IZJA 4N0RA 3QGVA 3CZJA 1NWSA 2XGIA 2VR5A 3JUGA 4TVCA 2E3ZA 1C7SA 3BAYA 2ZUVA 3B9DA 2CEQA 5A8NA 1B3YA 1GQJA 3UR7A 4JAWA 2OWXA 1VENA 2WHMA 3APGA 1OCQA 2QF8A 4U33A 1OD8A 3VGGA 4Z2GA 3ARXA 4MB3A 1UD5A 1ISVA 2DT1A 5BXSA 4JFVA 5D9OA 1CLXA 3GYCA 2CITA 1M7XA 3MANA 1UWQA 4AYSA 5BRPA 2EPNA 1SMDA 3LPFA 3VGFA 4PYSA 2ZUNA 1JXJA 1QHPA 3N17A 1JD7A 2UY3A 3MSDA 3SCNA 3TP4A 3OLEA 5A2CA 4RE2A 1X1NA 2XFRA 4WLCA 5CGTA 3PZTA 3G6MA 4PTVA 4KMQA 3WENA 1BLIA 1ISZA 1E3XA 3MMWA 1UH2A 1PBGA 5D4YA 3EDJA 4WKHA 1CGWA 2VZOA 1UG6A 2WVTA 4PMVA 4UOJA 2WHJA 4ZE4A 5BYWA 3CIVA 1WZLA 2VVNA 4LXFA 1MVYA 4ACZB 4X0NA 1J0YA 3MO4A 4TX6A 4MB1A 3TTOA 1MW3A 3T2QA 5HXMA 1TZ7A 3IAPA 1QI5A 1UH4A 1OM0A 2O9OA 2WSKA 1O7AA 4AZHA 3NSXA 1QOXA 1MXDA 2B31A 3WH9A 2BVYA 4D6DA 5A8QA 2BHYA 2VNCA 2ZXAA 2CBJA 2XIBA 4UFMA 2CHNA 3L4UA 3WNLA 4Z2JA 5FKYA 4E8CA 3BC9A 1XRVA 4Y7EA 1V3LA 1ZBWA 3DHPA 1UKPA 2WZIA 3BH4A 1UQZA 4QCFA 1HJQA 1XYFA 2OSXA 4P8XA 5E0FA 1E70M 1OGBA 1M04A 2YLAA 5IHSA 3MS8A 3B8SA 1GVYA 5A94A 2ZX8A 4HMDA 4ATWA 1EQCA 1SMAA 4HMEA 4FLSA 5DEZA 1E4IA 1ESWA 1KXHA 4Z2KA 2CPUA 3PZIA 1LL6A 5A95A 4MNMA 5A6SA 1OWQA 4E4PA 4R5EA 1B1YA 3AS2A 3VINA 1JAKA 4D1IA 2PWDA 1Q6DA 1QNPA 4UR9A 4AW7A 3VMNA 5BWFA 3RM8A 2RGLA 1HP5A 1OD0A 1ODUA 2PF0A 1B2YA 1HL8A 3O9NA 4CN6A 1WP6A 4W7VA 4D6IA 1E5JA 1BFNA 2DSWA 5A6MA 2XVPA 1FFQA 3VMPA 1E56A 5A6LA 1JI2A 2A3AA 3VOCA 1KB3A 2J25A 2CCRA 2UY4A 1MYRA 3PZQA 1V03A 4WSKA 2OSWA 4GKLA 1JDAA 1V0LA 3WUGA 1NM9A 3VDBA 1KWGA 1QHOA 1DTUA 2E9MA 1CECA 2PBGA 4E8DA 1QW8A 2ZUWA 2QMKA 4QDMA 4DUWA 1DWHM 3I3EA 4OZOA 3QOMA 4D6JA 4GXPA 1JAEA 4TVDA 2DSUA 3WFLA 3UEQA 2W5FA 4BQ2A 4ACZA 3AMLA 5ABFB 4PRWA 1CBGA 1PAMA 2E9BA 1W32A 3IJ9A 4J27A 3VKKA 3VDAA 3UG4A 3WD1A 3VO0A 2A3EA 2Y5EA 2BHUA 1OSEA 4B3KA 3W4RA 1IZKA 2C7FA 3WQVA 4HA1A 5A2AA 4U2ZA 1C8YA 2CESA 1W3LA 3W24A 1WZKA 4ATDA 1S46A 3WH5A 2DQXA 4ATLA 3A47A 5LYRA 1KQZA 2BFGA 3A3HA 4A3YA 5CGMA 1GORA 2VO5A 2XHYA 4RE3A 2ZXQA 1QI4A 3CGTA 4BQ3A 2EEXA 2F61A 1D7FA 3AIQA 4JIEA 1V02A 4OOZA 4W89A 1DWJM 1VBUA 3GBEA 5JBDA 3GH4A 4AD2A 1J9YA 1XH1A 3NDYA 4UZUA 7A3HA 3WH6A 3OBAA 4CVUA 1H5VA 2VCCA 4WF7A 4X9YA 3OG2A 1YQ2A 4DM2A 4CVWA 3AISA 3W6MA 4J3WA 3BAIA 3BSGA 4RL3A 3WD2A 1K9FA 3OZOA 1B3ZA 4DWSC 4GZJA 1BAGA 1H2JA 5M3WA 1LF1A 1XH2A 3FHQA 1DWAM 2FHCA 3WD0A 2XYLA 3GH7A 2D0HA 4PMUA 4PUDA 2Y2WA 2GJXB 3VIGA 5A2BA 3CZGA 4AD3A 1UD4A 1UKTA 1KFWA 4PBGA 1EOKA 1QVBA 3WY1A 3WUEA 3FW6A 1GNXA 3AJ7A 1E4NA 4OOUA 2VRQA 3ARRA 3NUKA 2WHLA 4CGTA 3AHZA 1WAWA 2CIPA 2VC9A 4AZ6A 4V2XA 3A6OA 3EDFA 1CENA 3WUFA 5DFAA 1UOKA 1KGXA 3DYPA 3CZ8A 3IK2A 1V3IA 4IUGA 8A3HA 5ABFA 2JEPA 1E5NA 1AQHA 2OYKA 1WNOA 1UWTA 3VIHA 4BF7A 1AVAA 2D24A 2VTFA 1TG7A 2XUCA 1JXKA 3AYRA 3NCOA 1NARA 4U3AA 2GDVA 3FXYA 2WMKA 3N1AA 1C92A 1WPCA 1E0XA 1V6VA 4W93A 3RPMA 5CXPA 4MB5A 1FP8A 2QHAA 5M03A 4YN5A 2VL4A 4GZIA 1KXVA 4FF5A 1ISWA 1Q6FA 4P8VA 5LA1A 1TA3B 1EO7A 2FH6A 2XFFA 2XSAA 4W88A 1X6LA 3OB8A 1HX0A 3VM5A 4EE9A 3GNOA 3CHCA 1D2KA 1UQYA 1ZBKA 1VFMA 1EGZA 1R87A 5TD4A 5ABGA 3TTYA 1JDCA 2CKRA 2GJRA 4U2YA 4JL2A 4AIUA 4HZ6A 4HOXA 3WKZA 1J0HA 4U31A 3E1F1 2BXYA 1R85A 1CGVA 2WCSA 4GO8A 4DWSB 2D0GA 3VGBA 1PIGA 3CUGA 3SCWA 4TX8A 1ISXA 2IUZA 1E55A 2VVSA 3L4YA 1JDDA 4NI3A 3W26A 4QLKA 3GXIA 2VI0A 3WNMA 4ZXLA 1XD1A 5D9PA 1PPIA 1HJVA 4JFWA 1QNQA 1CLVA 4M29A 2GJXA 4NF7A 1GJUA 1GQLA 4JHOA 1PX8A 4PUEA 3LPOA 3PN8A 2J77A 3BXWA 1VBRA 3AIEA 1WDSA 1RD6A 2D3NA 4Q7NA 3RJXA 4R27A 2X05A 1JZ4A 4JKMA 1SYTA 3AMKA 1W9PA 2VX5A 1ZJBA 5KZ6A 3SUVA 1JD9A 1W9BM 2W91A 2D0FA 4IPLA 4XX6A 1UR1A 4QLJA 3K1DA 1E9LA 1CZ1A 1Y7VA 3DYMA 3TTSA 3MMDA 3RO8A 3NDZA 4B9YA 2OYLA 1J01A 1QI0A 3AYSA 3MV01 3KWXA 3KL5A 2ZX9A 2JFEX 4M8UA 1CDGA 3ARQA 1V02E 3WDIA 5D8ZA 2WZEA 2BNJA 2YA1A 2VQUA 3AMGA 7CGTA 4MADA 1M53A 3ARUA 3SCPA 1V3JA 3RILA 1GOIA 1EQPA 1EIBA 2BXZA 3MUAA 4C7DA 4C7FA 4F79A 3BSHA 3WMBA 3ARWA 2CBUA 1JFXA 3CHDA 1GOQA 5E9AA 5BROA 1E1EA 1W2VA 3J7HA 1H0IA 1E6XM 1QHZA 3AI0A 3VIKA 1DWIM 1HVQA 1W9XA 2V3DA 4OBRA 1KWKA 3AXXA 3UR8A 1GOOA 2YL5A 3M7SA 1PZ2A
chains in the Genus database with same CATH superfamily
2AWGA 4KT2A 1R86A 2Q6ZA 4GC4A 3PBGA 2V82A 1ZBVA 4QDWA 3C0SA 3IGXA 1TV7A 2Y8KA 2OGYA 2AMGA 2OLHA 4BA0A 3CAKA 1NOFA 4S39A 1FDYA 1C29A 4QM1A 4RR4A 5CC7A 1FH9A 4Q4OA 2BV9A 3TMQA 2HZGA 4JTJA 3R12A 4IT6A 1OX6A 2OCZA 3AHXA 4GI8A 4A4AA 3VUPA 2CLMA 3I6EA 4HOZA 1NIUA 3H4GA 2X8RA 3H2FA 3WL1A 1FWBC 3GH5A 1EHNA 2YDQA 4ERGA 3MCOA 1NDYA 2W61A 1EFZA 3ALGA 1UBSA 2GWNA 2GL5A 2OQHA 4YU1A 5BOEA 1P6CA 3V1HA 1K8XA 3II1A 4EXAA 2ZQTA 1GVSA 2J47A 1I8JA 4DH0A 1KD0A 1J8VA 3AU2A 3EAUA 3ERPA 3QZAA 4GIRA 3TAKA 2DUAA 6TAAA 4KPLA 2HK0A 1VEMA 1KRAC 1JZ3A 1H1NA 4WQ6A 3DIPA 4MDOA 4LF2A 5EFDA 2PP0A 3POHA 3FDKA 5FJJA 3EA1A 3QM3A 4PCNA 3L2IA 1KM5A 4FLOA 3ZO9A 2FVMA 3PG9A 2Z7GA 2R1MA 4IGMA 1TQJA 3RHGA 4FALA 1GG1A 2EPLX 4FAMA 3MV11 1KXQA 1WE5A 3HPSA 1XD0A 3LXCA 1WDRA 3TTQA 2VCDA 4KRZA 3NG3A 2FZBA 2GDQA 1PBKA 5D2VA 3UNTA 3PZ9A 2VEPA 1CXIA 4DI9A 3L4XA 1K77A 1EP1A 3UVIA 1PWMA 4RCXA 3SRDA 5K9DA 1E72M 1N8FA 2HVNA 3IVTA 1F8AB 3L4WA 3GIQA 3GXDA 3ZXWA 1S1PA 1FXPA 1HJSA 3KL0A 1MFVA 3P93A 3EMQA 3V5CA 4KF1A 3M44A 5G1TA 3V5FA 4DELA 4IGHA 1P6BA 1RXOB 1GYLA 4JN8A 4LFYA 1V08A 4JFTA 5AYBA 4KCUA 3W1LA 3AS1A 2ZZ5A 2WPGA 2CLPA 1FWHC 3GTHA 4S3BA 5EMLA 2UZ5A 1B4EA 2W4XA 3SJNA 2OZ3A 2FVLA 4PFMA 2E6DA 1Q1CA 2W0UA 3TTEA 5K3VA 1PTGA 3D0CA 2F4EA 4CN4A 1FHUA 5GJMA 3NQCA 4FNUA 2ETNA 5D02A 5LNWA 1L6WA 5I3DA 3O8AA 4LU0A 3NURA 3PPHA 2DH2A 1GKPA 4KCTA 5EU9A 4R7OA 1SJCA 5FAGA 2DSKA 4EK7A 3HM7A 2XGZA 1N8IA 3WLKX 3MA8A 4HTBA 5LA0A 3SQSA 3K4AA 3E5BA 4LCSA 3ARYA 1BVZA 2HISA 3NL3A 3UWWA 3O5LA 1AJZA 3N2CA 2PV3A 2C1GA 3WQGA 1TELA 3N6HA 2VUYA 4JIHA 1XCFA 3V0UA 3VD9A 1DJQA 5DF0A 1TRDA 3HMCA 2J7HA 3GBDA 4TVUA 2Z1VA 2NUYA 4Q4PA 1E73M 1DKWA 1BRLA 3PTQA 2RAGA 3MU7A 1ZFJA 2WCGA 2WNWA 3WMSA 4TW6A 1VEPA 5D8WA 4HA3A 4C02B 4GD0A 2PURA 2GGHA 1NELA 2QEZA 2PDYA 1MFUA 1TO3A 4PEKA 4IT1A 3PSVA 2DU2A 1KM2A 1KTBA 7TIMA 3AIBA 3R8HA 3C3NA 4JQAA 1IHIA 4JCMA 5T9BG 4RZ6A 3W1RA 1ONEA 3MYPA 5E0KA 4O13A 4PH6A 1HJWA 3W02A 4DBWA 1CTNA 3KL3A 4B5TA 3VYLA 2G3JA 3W74A 1PSCA 3O6DA 3UZXA 4HN4A 1GOXA 1AMYA 4L5ZA 3NZGA 2M2AA 1UA7A 2V81A 4H8UA 4GO9A 3TDBA 1FKKA 4YHGA 5FJUA 1BWLA 3R58A 4ZCWA 3OW1A 1P43A 3HQNA 1RH9A 1EJVC 4C1NB 1JPDX 1TUFA 2OU4A 4LVBA 5BCAA 4HPNA 2YXGA 1TTJA 1KV8A 4MDPA 5DXXA 2HXUA 4IMEA 5BRQA 1GZJA 1XC6A 2J8TA 2HVMA 3S2MA 3QR1A 1MEIA 3H2AA 4B5VA 2DEPA 4PCSA 1T11A 4ZQOA 1DXEA 3N29A 3KDNA 2X2YA 2A5HA 4H7VA 4FMVA 5AY7A 3L23A 4PE8A 5FF2A 5U4NA 3ZLHA 3UESA 1FD9A 1K1DA 4A3HA 2B4GA 4JHZA 1FWFC 4MLJA 4NAFA 1Q6QA 2ZZ1A 3NQEA 3SURA 5DMNA 3G8RA 1KM4A 1BYBA 2KZHA 1JYVA 3NQDA 3EB3A 1D7KA 2J7BA 1V0KA 2O56A 3DENA 3AROA 2YA2A 3AXIA 2C91A 1GKQA 5C9XA 4NAEA 4ML4A 3S42A 1H7WA 3KADA 1P6WA 3BLOA 1W91A 1UZ4A 3WF4A 3UWZA 3T2OA 2DORA 4GH3A 2PWEA 2H9AA 1UR3M 4DBSA 4YTRA 2XVLA 2FHFA 1RP9A 4DRSA 2YPIA 3K46A 4ES4A 3LPGA 4BCEA 1A5KC 4C65A 2E0PA 1FKJA 2NQLA 4M6PA 4EPBC 2TRSA 2PD9A 1FA2A 3BGGA 1YW1A 1KV5A 2X09A 4ADSA 2YL6A 1JPKA 2YW4A 3UZWA 2OLAA 1LRNA 1OINA 3P67A 3NPVA 1TUXA 1A0CA 1WXYA 4L4PA 2JGYA 3MC5A 4UNLA 3GTXA 1E51A 1HL9A 3UZZA 4MLRA 3BLEA 2FIQA 1OFEA 2JIWA 3JXVA 3JU2A 3EB2A 3WK0A 3W7PA 5I78A 3PPCA 4MGVA 4PMNA 5CZSA 1FQ0A 3NR0A 1UZDA 3CAWA 3N9RA 4GI9A 1QFEA 1HKKA 3WLRA 3SQLA 2BLEA 5C7HA 3NJ3A 1VFFA 1O1HA 1WBHA 1IV8A 1G6CA 4FF7A 4NY2A 4C6EA 3BANA 2Z2UA 4GUHA 2ZC8A 4FLQA 5GJNA 1VHNA 3UA4A 4Q22A 5CPLA 2QCDB 3UWEA 4F3HA 2WC7A 5FEWA 1SW3A 3M0YA 4HYVA 1SFLA 3HU7A 3UXIA 4TMCA 1V0NA 3DECA 1L6FA 1LLZA 1FX6A 3SW6A 1N82A 4AZCA 3GM8A 1UHVA 1YXDA 2GQ3A 1Q6IA 1RBAA 2YGYA 2PDMA 2QVNA 2P8CA 1IZCA 2OX1A 3B0XA 1XS2A 4AD1A 1TPEA 4O1AA 3MT1A 3F2CA 2XGBA 3E96A 5JBEA 1V51A 2HVOA 2QJMA 2JE8A 4IICA 3T7VA 4YYFA 2Y24A 3B7XA 1BWKA 1QI2A 2D69A 4W8BA 5H6HA 3QOKA 1VJSA 3DKJA 2ABBA 1H7PA 1J6OA 4QJ3B 1KRMA 1JPMA 3W2MA 1HG3A 4FSAA 3DAQA 1PKYA 1FWSA 4JFSA 4LVAA 3MYOA 4ZQRA 3BO9A 1HT6A 4DZ2A 3T0BA 4ZBCA 3SN4A 2PBOA 5TQLA 2FJKA 3BG9A 1GQKA 3IK4A 2DUZA 1X97A 3B06A 3SUSA 1XCXA 2E9LA 5CAKA 4F0SA 3MDYB 1KTNA 3UWYA 3GNPA 4OU1A 3EEZA 1TREA 5I0DA 2QJNA 1W1IE 1A53A 3SRKA 3N14A 4PN2A 2NVAA 1WXJA 1TZZA 3MKKA 1JCHB 4N9CA 3O5PA 3SECA 2WKJA 5K2ZA 1MW2A 3GXNA 3T09A 1V6TA 1TV3A 2GYIA 4HPJA 2ZFAA 4KFOA 2XH4A 1ZSXA 4L1GA 1VKFA 3AU6A 4G7FA 5FCZA 1GKRA 1C90A 3K4WA 4D2JA 2A3HA 4GQRA 4RZ5A 2XP8A 2NLIA 3BJFA 4JFMA 1KFBA 4PCTA 3GLCA 2PLJA 1NY1A 2Z0IA 3HQ1A 4O1EA 3TC7A 5JH1A 4TQTA 2XP7A 4E2OA 4B3LA 5B8IC 1EQ3A 3PBMA 3TOYA 1R47A 1GYMA 3NQ8A 1BF6A 1PEZA 3VNIA 1LTDA 4GIYA 5M1TA 1TTPA 4P8WA 3GIPA 4KGLA 3PWIA 2EPKX 3FGCA 3GFZA 4C60A 4X60A 3PZNA 1BRLB 1H11A 5KETA 2VC7A 1EP2A 2EBNA 3ATZA 2E6YA 3BL3A 3PUOA 1HQTA 1JRBA 1JVNA 2E5BA 2WSPA 1GCYA 4YLWA 1BQGA 1JDFA 3KOWA 5HAOA 3L0KA 1GW9A 4LAXA 3WH8A 4WDUA 4JTEA 1DXIA 4MSPA 2CLEA 2DUXA 4ONVA 3UWUA 2LGOA 4UZSA 4ZPWR 2DIJA 1KC7A 4WX2A 3CYJA 5KSWA 1BGGA 3ZLFA 3RITA 4LAZA 4AD4A 4H00A 1W17A 3MCMA 3QTGA 4GKTA 3L7RA 1ECEA 4YVVA 1OG0A 5HWBA 5E70A 3CQHA 1UR9A 4LJ3A 3ALFA 3N73A 1JPHA 5JBFA 1YDYA 2WMFA 1XLJA 4WDTA 4I8YA 3WQ4A 4EF9A 2BSLA 3F7JA 3MJYA 4W5ZA 1NQKA 3UY8A 4QJ4B 3H24A 3WLSA 3NSNA 3C0QA 1OZQA 4WJ8A 2FB3A 3FYPA 3E6EA 3OLGA 3ZOAA 5CC3A 4JTLA 4TNSA 1E1FA 4Z1CA 3IK8A 3BAKA 4J7RA 2OPJA 3KVJA 4UNIA 4A8RA 4QRNA 3CB8A 4JNYA 3CIXA 5I00A 4LV4A 2C13A 1ME8A 3T1GA 1XYZA 4LC8A 2ZX6A 3THAA 4HB7A 3GE7A 1M01A 3ES7A 3K13A 4CD7A 4L9ZA 4KRTA 3E74A 3QQWA 1OFBA 5CZKA 2BVTA 1WKFA 1TV2A 1J96A 4G56A 4UOZA 4AZGA 1TV8A 1F61A 2OZTA 4NAFB 3BOXA 2JKAA 5AHNA 2DZVA 2O92A 4I7WA 3TYEA 3O5FA 4RXGA 3H2EA 4PMZA 3BCDA 2GUBA 3N9KA 2FQIA 4MZYA 1PHWA 4FO4A 2PS2A 4JTDA 3NL6A 2E28A 4JTQA 1J0KA 2BS9A 2ZC1A 4JDYA 2Q8ZA 1QZ2A 2DG4A 4R9XA 2OZ8A 1D9EA 1I2RA 1TVLA 1KCKA 4N6FA 1Q7QA 3TYAA 4DIPA 8RUCA 1JCJA 2WHKA 3WLMA 4KH2A 1EJXC 5JIPA 5RUBA 1OY0A 4LEQA 3WO8A 4WHBA 4N19A 4C6FA 1KRCC 4RDYA 2RGMA 3PWGA 3SCSA 4PSRA 3THDA 3B4UA 3U0HA 2C79A 1UWIA 1XG3A 2VRKA 4C6IA 2AQOA 4OUEA 3FJLA 5HJYA 2ACSA 1XIMA 1TIWA 1UZHA 4GGHA 2R9RA 3NFUA 5LNRA 3S6OA 3FAXA 6PTDA 3GNRA 3DFTA 5H2ZA 2ZR4A 4HNUA 1ITCA 1H61A 4DYKA 2O0TA 5G2IA 4DWDA 5CJNA 4O1DA 4GRSA 3GPKA 1OGGA 2ZOXA 4WVXA 1ZJAA 2Z6JA 2E8YA 3RU6A 4Q8WA 1Q5MA 3IJ7A 1KT1A 1GJWA 1YPFA 3WEOA 4YPJA 1DQWA 3ZSTA 3A3WA 2B7QA 5C2CA 1VAHA 4WKFA 1AD4A 1XBZA 2VEGA 1WZAA 4JYDA 3SADA 3DG6A 1E40A 4AB4A 4NZFA 3SSZA 4GI6A 3GO2A 1UMLA 4GINA 4HSOA 3PJUA 1UPPA 5BWAA 2ZE3A 5FD0A 4AMCA 5CZJA 4TIMA 3SR7A 3MDWA 4HVXA 2ZRXA 3DG3A 3KBMA 4HNCA 3HO8A 1UW9A 3PTMA 1Q63A 3L2MA 3VABA 3MHFA 1DJZA 4DPPA 3KVLA 5EGRA 5F2LA 5EFFA 2Q8XA 1G01A 2HQAA 2GWGA 3BLKA 1XH0A 4Z2IA 3AHYA 2VCAA 4HYWA 3RPDA 3TA9A 2VFHA 4WRHA 4AZCB 3PR9A 2A1YA 4R3UA 4AU0A 3NQAA 3V3WA 2EO7A 3P81A 1LZOA 4TX9A 1ZK6A 4R7JA 3P0WA 2D3LA 3HG2A 5H91A 3QR3A 3ARTA 1NDZA 3U7VA 1XRFA 4GUGA 3KHDA 3URAA 4ECLA 1OC6A 4NVTA 4UQAA 5REQB 5HNNA 3S9ZA 5DBUA 3KAHA 4B5SA 4PUKA 4DF0A 1W9DM 5C6MA 1OABA 4RJEA 4BKNA 3CL8A 3A12A 2FZMA 1A3HA 1V79A 1GRJA 2D2OA 2D1ZA 3PTDA 4OJYA 1EYEA 2C6QA 5C71A 3PBYA 1EPVA 2Q02A 1H0GA 2IMRA 3PK7A 3MMTA 5CH9A 3TNOA 3WIJA 1U5JA 1B54A 3JS3A 1VIZA 3W88A 4J4KA 4GXMA 1MW1A 4NXSA 3M5XA 2DT3A 1V6XA 5D30A 1OGSA 3THQA 3NVTA 1F74A 3TSDA 4TU1A 1VHCA 1O6IA 2BGNE 4DROA 3GX9A 5C2GA 4DRQA 1V77A 2ZXDA 3GXMA 1AW1A 1PX3A 3D46A 1WKDA 3MUIA 5DY2A 3W7EA 5TAOA 1HNYA 4ACYA 4MGGA 3NGJA 4UCFA 4YL2A 1I1WA 3VKBA 3W71A 5A1AA 4H41A 2R91A 3FNDA 2WLYA 3LTSA 3BUVA 4JOMA 3C0LA 4DHGA 1XJBA 4IL2A 3CO4A 3C2YA 1I2PA 1PJ9A 5FF4A 1OT1A 4LT9A 3EX2A 3O6CA 3AQUA 2HWGA 7XIMA 2C1HA 1JYWA 4QR6A 2PDFA 3UG3A 3GXFA 4O4WA 4F2TA 3S9YA 4UMAA 3TYZA 3LRKA 3W85A 1X8CA 1TA3A 1XLLA 3LQGA 3RPTA 3H2MA 2CHOA 3M1ZA 3DUGA 1XRSA 4QAWA 3DHFA 1JZ2A 2GSJA 2ISVA 2HPMA 4JTKA 1EC9A 3W82A 1JNEA 3IJDA 2WM0A 3KCJA 3OLIA 1EGMA 2G4FA 5CPQA 4G2PA 3EPOA 2FTYA 2VX7A 3L12A 4DRMA 3W23A 2GFTA 4R9OA 3D6NA 3QGVA 3DX5A 3PB2A 4IPXA 2XGIA 2VR5A 3JUGA 4LUJA 1M65A 2NV2A 1C7SA 3BAYA 1TMHA 2CEQA 3DFQA 2RDWA 2WHMA 3S83A 1OCQA 1OD8A 3VGGA 4Z2GA 1W5OA 1ISVA 3L5LA 3ITOA 3FLUA 1E9IA 3U2CA 4JFVA 5G2HA 3GYCA 1M7XA 5DIVA 2AL2A 5BRPA 4Y8FA 2TYSA 2EPNA 2PPPA 2X30A 3LPFA 4Q4QA 3HFTA 1T5AA 4JQ1A 1JXJA 4AY7A 3MSDA 4CNUA 4F2BA 4LCRA 2X7WA 5H8MA 2QGYA 4G5DA 5A2CA 4RE2A 2NVDA 1R38A 5C54A 3NQ2A 1A4LA 4WGXA 4LRSA 1GK8A 2Q3RA 1LLWA 4KMQA 2ZRVA 1BLIA 3BMBA 1XICA 4MWAE 3WBXA 3N2MA 4CQBA 1CGWA 2WVTA 5HW7A 2W6RA 5JH2A 3S0CA 3P62A 2AGKA 3CIVA 2C71A 4YWIA 4Q33A 1MVYA 4ICMA 5AHMA 2DW6A 3O5MA 1TTIA 2M08A 3M0KA 1J0YA 3CUXA 3FEMA 3TIMA 3AWNA 3JYJA 3IAPA 4BEQA 1QI5A 1UH4A 2E68A 1QOXA 3WJXA 1MXDA 2B31A 4XD3A 1RJQA 3AUJA 3BDKA 2CHNA 3IV8A 4UFMA 3T07A 3L4UA 3WNLA 1KBIA 1N2VA 1J5SA 5DCDA 3Q2DA 4QCFA 1E70M 5C9RA 4GGBA 3PFMA 1YXYA 5EY5A 3ANYA 3MSYA 5FJPA 1HKVA 2RDTA 2ZX8A 4HMDA 4TV5A 1T8QA 5DEZA 3LV6A 5J6EA 1Q65A 4O1BA 1ESWA 1Y0OA 3UF8A 2CPUA 2PE4A 1S2WA 1TWSA 4AH7A 3ITXA 3OHMB 1B1YA 4IMDA 5TNVA 3NZRA 1Q6DA 4PB3A 1QNPA 4UR9A 3TJLA 4KEZA 2XPBA 4LAYA 1C9WA 3FSTA 4R34A 4W7VA 1E5JA 1BFNA 5A6MA 2DZPA 3VMPA 2VGIA 1WDWA 1PIIA 1J4EA 3RUBL 4J2MA 1LDCA 4WSKA 2OSWA 3GDKA 3OQEA 4I7UA 1JDAA 3QLLA 5AYXA 3NQVA 4GISA 2BMBA 1ZP4A 1CT5A 1YTEA 4DF1A 2PBGA 1Z48A 2ZUWA 1TTQA 5DLCA 5HJLA 1XFCA 3WLNA 4OZOA 1D6OA 1RD5A 1L6YA 3QF0A 5M2FX 4IQJA 1A80A 3W7KA 1H7RA 4GVIA 1R2SA 3RN6A 4IIDA 4ICCX 4PRWA 4ZQCA 1I9CB 5F2MA 1KCZA 3VCCA 3AALA 3M7WA 4V33A 2OTDA 3VDAA 1JUEA 4DXKA 3H23A 4B3KA 4HKPA 3W4RA 1T8XA 1SZEA 1FAPA 1C8YA 3TMLA 3TEVA 4QGCA 2V2CA 3WH5A 2DQXA 2JBMA 4ATLA 4YNGA 1CX9A 3PG8A 4A3YA 2VO5A 3MPGA 4Q4MA 1NTHA 1TZ9A 4BQ3A 3B04A 2F61A 1AW2A 3AIQA 5AHFA 1XLKA 4GNVA 1LQAA 4YTUA 1S3HA 3QPZA 4K1GA 5JBDA 2PRHA 2XDFA 4IH3A 3C52A 3QMTA 4C6MA 4I9AA 3HV9A 4ZSTA 3WH6A 4YCPA 1NFGA 1VZWA 5XIMA 1H5VA 4NNCA 4A2RA 3W2LA 2G50A 1VC4A 1W1ZA 3S1VA 1OC7A 2ZRUA 2PPGA 4B3ZA 2DQWA 4CVWA 2ANUA 4DO6A 1BKSA 3AISA 5HATA 1P48A 4Q6JA 1QTWA 2DZTA 3TQ0A 4ALDA 1B3ZA 1UMYA 4GOAA 4CLMA 3P74A 4ZTXA 2PBCA 2FHCA 3A9BA 5LKYA 2YCIX 4LF1A 4IMAA 3KHJA 2PDWA 3AC0A 2GJXB 4PBGA 1ROTA 3GK0A 3MTWA 3JZEA 1VCGA 3AJ7A 3M0VA 3RYSA 2A85A 4LAUA 2HMCA 1Y5WA 1H5YA 4IJRA 5JMUA 3QTPA 1DJYA 1VYPX 2WHLA 3AHZA 1WAWA 4L65A 2MNTA 3UWQA 1IIGA 2DP3A 3DYPA 4IUGA 3GTYX 4LAOA 2VN1A 4TO8A 5MKGA 3VIHA 5DBTA 1T6MA 5XINA 1AVAA 3G1AA 5HW6A 2PMQA 1JXKA 3QFEA 4KEVA 1RV8A 3P14A 2GDVA 4C90A 3FXYA 2HS6A 3E49A 4U10A 1C92A 4QQUA 4W93A 3QPYA 1LP6A 1M5WA 5G4WA 5JVLA 3TC3A 4H6RA 4L6DA 5M03A 1OX5A 3VOHA 5HUOA 1KXVA 4FF5A 4I5UA 4RDZA 4DXXA 4PUWA 1J5TA 3OVQA 3MZNA 1TA3B 4Y6GA 1C8VA 1O5KA 2XFFA 4RXFA 4EE9A 3GNOA 4DQWA 4E2VA 3CV7A 2UBPC 4U28A 3P60A 1AH4A 1KW1A 4B2DA 4JTIA 2I7GA 4JYFA 4JL2A 4HZ6A 4U31A 3E1F1 4JTHA 1CGVA 2WCSA 3QW3A 3VGBA 1FWIC 1PIGA 3CUGA 4RLIA 1ISXA 3RLUA 1QR7A 3I4KA 3L4YA 5BOFA 4RZBA 4NI3A 2NUXA 4J4NA 4ZXLA 2VFEA 4JICA 1NF0A 3F4NA 2KAUC 4H3DA 4GUIA 1TWZA 3G1VA 3FOKA 3N2OA 2NVCA 4DY1A 1GQLA 1O4UA 3UXDA 4KETA 4HCHA 1SR9A 4XBSA 1IR1A 3MB9A 1O60A 3PN8A 3GR7A 3EWBX 2VKZG 2R1NA 1RD6A 2VD8A 2EGZA 4ADUA 3UYIA 3DU0A 1SYTA 4GC3A 3U8GA 4GYKA 2VX5A 3NZQA 1JD9A 1A49A 2ZZ3A 2W91A 4IPLA 4XX6A 4XO7A 4QLJA 1E9LA 1J2WA 5AZ1A 3DYMA 3MMDA 2JKPA 2OYLA 1S2TA 1IXNA 3KWXA 3KL5A 2ZX9A 1AG1O 1CDGA 3PNUA 4XBJA 5D8ZA 2WZEA 2BNJA 4XVDA 2X1SA 3PS7A 2YFOA 3M9YA 3SCPA 1V3JA 3B0UX 1EQPA 4IIBA 3O15A 4HA0A 1X1ZA 5K9XA 4C7FA 4AMAA 4YTSA 3OP2A 2F2KA 2ZCGA 3ABXA 3ARWA 1V93A 1JFXA 1GOQA 1JUBA 3J7HA 3FJ4A 2A6NA 3GVQA 3AI0A 1W9XA 4A22A 2V3DA 3DFPA 1KWKA 2FZNA 1W3NA 2YL5A 1MZHA 1UUMA 1NDWA 1WUEA 1P7TB 4GIVA 1PZ2A 3DI1A 3L4TA 3O5KA 1OX4A 4NZJA 2AOSA 1I2OA 5BOOA 4D71A 3EXSA 4NSBA 1FKGA 4ZZ9A 1X6UA 3GVRA 5D03A 3BE7A 3A21A 3I6RA 1RA0A 3KRUA 3CUZA 3OYXA 4DZHA 1P0NA 3MO7A 3BTNA 1LRQA 3I4EA 3P61A 1GW1A 3P2VA 1TPVA 4OFCA 4PULA 1MUMA 4CD4A 3ZVHA 3U7BA 4XZIA 1JYNA 4DO5A 2FFCA 3OOQA 1P0DA 4H2CA 3M43A 2V5BA 3CV2A 2Y62A 2WMIB 4AX6A 3HPFA 2E67A 1S2VA 4LQ1A 3VPLA 9CGTA 4L6HA 1LWJA 2GJNA 1GZ1A 4IMGA 4RZ4A 3UGRA 4E5TA 1UKSA 1GHSA 1L0PA 4XV0A 3W01A 5A6KA 4F4RA 2JEQA 2XTKA 3GVVA 4AFYA 3LQLA 4GFSA 2VRJA 5I03A 4M1RA 1UR2A 4NL1A 3W3OA 1D8WA 4EKJA 1VJIA 4XQ6A 2VQTA 3RXZA 2FTPA 3M46A 3EKZA 2DPEA 1EJUC 1VPYA 1DPMA 3F5KA 1R8LA 3E5PA 3THUA 4IZGA 4ORMA 2J7DA 1EIXA 4S3CA 4NZ5A 4AEFA 1XG4A 5CZTA 1YNYA 3IGSA 4UTUA 1NP0A 3VZZA 3T4WA 3HV8A 4GZEA 4AWTA 1J0ZA 4QG9A 1PZ1A 3ZR6A 3S2JA 1RZMA 4WUIA 3C2EA 3K30A 3ES8A 4CU8A 3PANA 1YNQA 1A5AA 5A6JA 2PU0A 1W5MA 4YVPA 4BF9A 1IQ8A 4XO6A 6TIMA 4YMZA 1VS1A 3LNPA 6XIMA 2Z6IA 3PPFA 4QNEA 3QPEA 4C91A 2D2GA 4N6EA 3DERA 1W1VA 1LOLA 4JIIX 4EAYA 3IJIA 3MVTA 1TJ0A 1QT1A 3CPUA 4FLRA 3GKFA 1XGDA 2PTZA 2HPIA 3UP8A 2ZBTA 1CYGA 3MW7A 1UZ1A 3CTLA 1FWTA 4S38A 1R7OA 5ABEA 1Y5XA 3B0PA 4MAZA 1B3XA 4GH1A 4GPNA 4IX2A 3LCIA 3LCLA 4D6CA 3G1DA 3TNBA 3UZYA 1PB0A 3LCGA 4CKQA 3KAOA 1JVWA 2XN1A 4F2UA 2WKLA 4OBTA 1K6AA 2DZSA 2FPVA 2REQA 1K8ZA 4CN1A 2G5WA 3VOFA 2GJLA 1LOSA 1MQQA 2VHLA 1TWWA 4HNTA 4HU0A 1A7XA 4BI6A 3G24A 4IGNA 1HP4A 5BZAA 1GVQA 1YBQA 1OFDA 2VCBA 4LAMA 2R1LA 3ZSSA 4HD5A 3H22A 3O5DA 5B7YA 1E6ZA 1X39A 3VGHA 1F6PA 4QXIA 4PEEA 3UW6A 3A64A 3H70A 1WDDA 2BGQA 5DXYA 1ZZMA 3NO1A 4FI4A 1D7HA 3S1XA 3TONA 2DW7A 5C8BB 2WAGA 5I07A 2WNQA 1TVNA 5MKGB 5AC8A 3NI6A 3KTCA 4XKYA 2Z27A 1VP5A 3VGDA 4W85A 3TOPA 3I3DA 1A47A 2OKTA 3D3AA 4B5NA 4LSBA 1F3XA 3AOFA 3QV6A 3CWOX 3GNDA 1YXCA 1C3FA 4OV4A 1C91A 1H09A 1V7AA 1TFVA 4UR7A 1M03A 4B5UA 3BAWA 3G1RA 2E6FA 3NEVA 1LUCB 1BKFA 3EEGA 1GPWA 1XGEA 3H7VA 2P53A 5AFDA 2PDUA 2RJHA 2WLZA 2PRLA 2GJPA 2PLKA 5I77A 1ME7A 2P10A 3TXVA 3FAPA 1OADA 4EF8A 2WMGA 1ECQA 4BZYA 1EF2A 2KGJA 3FKKA 3NIYA 1E6NA 3UGVA 1E1CA 4PL2A 3UG5A 4O1CA 1GUVA 4EPKA 5CEWA 2OQLA 3WF1A 1EKOA 5GNYA 2CFFA 4DAIA 2G3MA 4NASA 4K68A 3OGSA 4FXFA 2Z1WA 3WQ6A 5CBIA 1UR0A 3WBAA 4DXVA 4WDWA 2GGJA 3VX1A 1Q8JA 1JNTA 5LGXA 1YDNA 3CLMA 3RGTA 4C5ZA 3VOJA 4DEFA 2QCFA 2P0OA 5J5DA 3UERA 5T8GA 1D7JA 4H9ZA 3PWAA 2BB0A 4MSSA 3LI1A 4TXEA 2OLSA 1XBYA 2SFPA 4NZ4A 4LNYA 3G1FA 3LS9A 1E0VA 3M16A 3PB0A 2FHBA 3EWZA 2Y7DA 2J7EA 4S3AA 2DZWA 3DC0A 4B9ZA 3CHEA 1CXHA 2QYGA 4O11A 2MLYA 2VENA 2NW0A 2QZRA 1OIMA 4ZS6A 3BZGA 3AUOA 1S2AA 1R6WA 2XH7A 3FV9A 3B9AA 4HU4A 2J24A 2ZRZA 3CT7A 4OECA 4QDPA 1QOPA 3M47A 2MPHA 1LT8A 3EX6A 1F76A 4AVFA 4J40A 4IGSA 4L4OA 4JY8A 4PCPA 1RLCL 2YLLA 5CQ1A 3CNYA 3UD6A 2DVUA 1ALDA 2WMHA 3VIIA 1FUYA 1PUDA 3UYCA 2OWCA 2OYMA 4M3PA 1VGAA 3RFWA 3H12A 4ODKA 1ZLPA 1JNDA 5I2UA 5JH8A 1OX4B 1W3HA 4RPQA 1J79A 1FCQA 3CUIA 4I9TA 4KS0A 1PL9A 2W62A 4KBXA 5AHEA 1JPIA 4KWOA 2R14A 4QE5A 2H90A 4H6EA 4AWEA 4MNJA 4OIFA 1JZ5A 3CM4A 1QO5A 5HPCA 4AVOA 2Y5SA 5GQBA 3A4XA 3R0DA 1Y5VA 3T08A 3OLDA 4E6MA 5HOSA 1OG6A 4D1JA 4AHOA 4B4HA 2VFFA 3SFWA 3N15A 4WKAA 3C86A 1CGUA 3ZZ1A 2HBVA 2YDRA 4JIQA 4XTDA 1K03A 1J4IA 4H9TA 3OVRA 3VI2A 3L2LA 4HPXA 4HHMA 3WBWA 3UJSA 1XRTA 1CXLA 3TH6A 1UYQA 2ISFA 8XIMA 2ZYFA 2KE0A 1J2BA 1ZB5A 1TMLA 3W7DA 1Q4WA 4FHAA 3MDUA 2X2GA 5HKGA 4MOZA 4MG4A 2R82A 3C8FA 1GYNA 3RGCA 3TWBA 4R7WA 4ZB0A 3IEBA 3WLTA 3SZ8A 3ABSA 2F84A 4PCFA 2QDHA 2ZWYA 2OEKA 7PTDA 1WV2A 2H6RA 1TCOC 1SSGA 5F1UA 2GDUA 1WAUA 2ZQSA 2QIWA 2XP5A 4GGQA 5HR7A 3GU2A 3EDKA 3PPGA 4FS9A 4QG6A 4JTSA 5I6SA 3PBVA 3LBCA 1K9DA 2EPOA 1EPXA 4FEZA 5C5YA 1OT2A 6CGTA 2WC3A 2D9FA 1KNWA 2F6XA 4DJFD 1HO4A 4C6LA 4ODLA 1JJKA 2W27A 4G2DA 5LA2A 3UCDA 3U5UA 1Q45A 1VIWA 3AIWA 3U2EA 4AHPA 1EF3A 1JQVA 1QNRA 2F8QA 2GSHA 4H01A 5PTDA 1HJXA 3EB4A 3NAVA 5JUVA 5FJTA 1XV8A 1F3EA 1OFQA 4DJED 6XIAA 4CNPA 2R8WA 2G8ZA 4DJDD 4K7VA 3LB0A 4JIRA 2ISWA 1EZWA 2P4VA 3IVUA 2YBUA 4O17A 3VZYA 5BXJA 3SEPA 3FA4A 2YA0A 3DEQA 1UD6A 1G94A 2CERA 2OZ0A 4LVGA 2QULA 3WK1A 3AMDA 3ZJ7A 3W37A 1JF6A 3MHUA 1OFPA 3B8IA 5I5RA 3E2QA 4ZO8A 5AC7A 1G0CA 2W67A 1CNVA 4Q8OA 1ONWA 3LN3A 1TYGA 4Y96A 1L2UA 4JN7A 3OTRA 4HCLA 4I3GA 1UD3A 1TR1A 2VGFA 9XIAA 3SCUA 2PGEA 5IFPA 5HWJA 3RNDA 3ATYA 3M4HA 1HXJA 4ERIA 5HK4A 2YL8A 4XD5A 5GPGA 3IUIA 4GY7A 1NMWA 4S3DA 3RMEA 4JX5A 4XKYB 5AYIA 3VIPA 4IQLA 3WFAA 1VRDA 5HMSA 2OFNA 4K8GA 3S3GA 3H21A 4ZPTR 1W3JA 5CSSA 1I1XA 5CSRA 3EKGA 3WLQA 4GQBA 3TQPA 4MTVA 1VR6A 4J1OA 5FAJA 1E9YB 3BLFA 1E6PA 4PTXA 3GG7A 3SCVA 4URIA 1OFAA 5CGQA 4Z0JA 4J3SA 1R3YA 3P5YA 5F4SA 4W84A 1EGVA 4US6A 3U5YA 4NNBA 2I57A 2Y8VA 3W2NA 1VCFA 2CXGA 3UF9A 2XN0A 3L4VA 1V3MA 1ZQ5A 4C6NA 4PL1A 2PWFA 2ON3A 2XIMA 3T42A 1BYAA 4U5IA 2FDSA 4IL0A 3G0XA 1B31A 1OK4A 4PZVA 1E1CB 3MP5A 4GYJA 3VE7A 4H9UA 1AUSL 4X0VA 5DMYA 3R4IA 3SCQA 3TN3A 3V4BA 3BARA 1SFJA 3FS2A 1FOBA 4IFKA 4O54A 4G7EB 4XKMA 1SFSA 4CD6A 2EQDA 3CTTA 2VC5A 4GQGA 3O63A 3B0VC 4UFJA 1VFOA 3KFTA 1RAKA 3DFNA 1BVNP 3CUJA 4TTGA 1KGUA 3TFCA 4I5XA 1ZAHA 4NRSA 2MNRA 1QI3A 4QZVB 3ZM8A 3ZJ8A 4U5KA 1FKBA 1PV8A 1JIBA 4CNNA 1FDJA 1NSGA 2BXVA 1JCYA 5EYWA 3E2VA 3DFSA 3CHFA 2FDMA 2V5DA 3GY1A 3VD4A 3VDHA 5AVHA 1PKMA 1XFBA 1XF0A 5KZDA 1TPC1 2PWHA 1V7YA 3AHTA 5C70A 8XIAA 1Z89A 3GWQA 3A22A 4ODNA 4M81A 3A4AA 1E6SM 2ACQA 2YDSA 1FKRA 1LWIA 4QISA 3V35A 4UFLA 3KVMA 1HW6A 2PP1A 2MLXA 1E6QM 5HINA 4E4FA 4BK9A 1SR0A 3VC6A 4FNSA 4S2BA 4K36A 3UA3A 2EF9A 1DIDA 4NZCA 4AXNA 1GVEA 4O19A 4DBEA 2DT2A 3VKAA 2LLEA 3LHWA 4INFA 1XR2A 3T81A 1TRIA 1XIIA 3U9IA 4JBRA 4W86A 1L8NA 3QV8A 4J28A 2ZTKA 1E3ZA 1RA5A 2IPWA 1VF8A 1GGOA 2I9UA 3GG1A 3SY1A 1Z8AA 4U3CA 2ZZ6A 3EIPA 4AIOA 3LMYA 3FYYA 3WBEA 4OWGA 4MJ4A 1M1BA 2CNCA 1I75A 3EMZA 4A05A 4LNCA 2OGJA 1YATA 2NT1A 2PDIA 4D6GA 2HROA 3M41A 4ZVJA 1DYSA 3SUWA 1FKTA 2QUMA 3WJZA 6REQA 3ZLGA 3ARZA 4JYEA 5F2IA 3W75A 4UQDA 1E4MM 1DHKA 1TSIA 3TCSA 1MI3A 4LWWA 1CGXA 4A29A 3GU9A 2CLIA 4NT0A 4DZ3A 3NSMA 3MBDA 2XM1A 3BCFA 1LOQA 5LNSA 2IKJA 4Q8NA 1ZALA 4H04A 1SSDA 5C7VA 2WV8A 1Y65A 4DRPA 1K7XA 1JF5A 2WXDM 1XIJA 3JR2A 1TPWA 4AISA 4WJEA 4QLLA 4FIRA 1DWGM 1WKEA 3W7LA 3AXKA 3QC3A 2HK1A 1FKLA 1XGZA 1E4LA 3SDOA 4K37A 5C9WA 3S6DA 3OIHA 2BP1A 1TVPA 3CZEA 3P8JA 4D8AA 4P7NA 1Q6RA 3ORWA 1YTKA 3L0GA 2AAMA 2HV5A 1MEWA 4FX7A 3G8EA 1LL7A 1Q7MA 3AIVA 3SGGA 2Y78A 3NL5A 3O1NA 3WFZA 4GIAA 1E0WA 5CSUA 2D23A 3PRAA 4MHBA 3O5OA 1PIFA 2V67A 3O2LA 5A8GA 4M80A 2G95A 4ZB5A 4HPHA 1RK6A 2XWEA 2JGQA 1R9YA 3TX9A 1T40A 2LPVA 1XLHA 4H9XA 3F2BA 1ZGDA 2TODA 1OF8A 4O0KA 2ZUTA 4W9QA 3ID7A 2WCAA 1QK0A 3DCPA 3EOUA 4IQEA 4AWSA 3GTIA 3M6DA 4D6FA 4Q8UA 1ML1A 2GOUA 3DBPA 5I23A 2V2HA 1JGIA 4MWAA 3S5OA 2ZUMA 1DOSA 2VOTA 4JCLA 1F3TA 4REQA 3O16A 1BXBA 1W3IA 3H2CA 1MXGA 4C1KA 2NV1A 3P6LA 1S5NA 3W2UA 3MI3A 1OIFA 4UTMA 2QPUA 4HSNA 1XDLA 4UTKA 3RCNA 2ABAA 3F4VA 3REQB 3H7RA 1V0MA 4XAYA 5FEPA 1V4YA 3CAQA 1F05A 3LTPA 4XG1A 1M3UA 3MSRA 5CPTA 2C0HA 3WNKA 4K7YA 3SI9A 1SJBA 2JF7A 2UV8G 4IMFA 4UQ9A 2Y6ZA 3NOEA 4WSJA 3SGZA 2VUNA 1VBJA 4W8AA 3TZNA 2O7QA 3ZWTA 4S2CA 4AUBA 3DHUA 3UWVA 4JNZA 3IIVA 3VNZA 1AQ0A 3O5RA 1F7BA 2YCLB 4BQ5A 4QE1A 3O7UA 2NQJA 3SSJA 3QVQA 4IUOA 1MWOA 2TPSA 3QGAC 1AZ2A 1G7UA 2HEJA 3EZ4A 3CXOA 4AQLA 3WQDA 3T2PA 3TSMA 3GXTA 3UT0A 1RY8A 4JL1A 3VNDA 2O9TA 1PKNA 3B9EA 4Z2HA 4U84A 3E02A 2PZNA 3I7QA 2GUUA 3N4EA 2PB1A 5E93A 4JNMA 1BXNA 3WH7A 2QMJA 2H3DA 5HPOA 2CLFA 4JIPA 4EWND 2Z1BA 1R7AA 5FSDC 2RUQA 4DPQA 4LYQA 4JQ4A 3HPAA 4DF2A 3WLJA 4WXZA 1XYCA 4PTWA 4XAKA 1LBFA 3T55A 2BASA 4MVAA 2WVVA 2X0SA 3F03K 1A5NC 1Q6OA 2W63A 2VGBA 3LRLA 4DJFA 1BD0A 1L6GA 2QJJA 3BW4A 3WDRA 4FK9A 3W1NA 1BF2A 2XIOA 2FB2A 3IIXA 2G3IA 5FJOA 3SCOA 4CCEA 4YIWA 5GPRA 3FYOA 5AC4A 1NWUA 3D47A 3R43A 1K8YA 4BY3A 5K7JA 1J93A 2JQXA 2WJEA 1XYLA 4DJEA 4W7WA 4Q4RA 1S2CA 1U30A 4DJDA 3MUXA 1IZJA 3C4UA 3CZJA 4EWJA 1NWSA 3W1MA 1F9CA 1QWKA 3CC1A 2E3ZA 2Z24A 1M6JA 3B9DA 3NO5A 3UR7A 1UOZA 1KFJA 3APGA 4UTIA 3ARXA 4GIEA 1UD5A 4H9MA 3BURA 3STEA 5BXSA 3SJ3A 2CITA 4AYSA 3VGFA 4DZIA 1XUZA 3ME3A 3TYBA 3N17A 3RF9A 5FF0A 4K38A 4AF0A 5G4HC 3MVIA 2QUNA 4NYUA 1NF7A 4WLCA 5CGTA 3NYZA 4X63A 3PZTA 3G6MA 5B7ZA 5I3FA 4H6QA 3WENA 3HF3A 1LBMA 3W1XA 1TPB1 1W6TA 1E3XA 3A4JA 1B6CA 1PBGA 2QIIA 3EDJA 4WKHA 1KO0A 2NUWA 1SZFA 4PMVA 3MP4A 4ZE4A 5C2XA 1QXLA 5AZ0A 4LXFA 1TJRA 4ACZB 2QJHA 1Z3NA 4ODRA 2Y1HA 1C9DA 3MO4A 4TX6A 3VAVA 3W83A 3OQ8A 4X22A 1MW3A 3B40A 5HXMA 1TZ7A 3EWUA 1F5ZA 3NEHA 1RQBA 4WXYA 1OM0A 5A8QA 2VNCA 4IWWA 2BVWA 2F9RA 3QSRA 4Z2JA 3NNTA 1PTAA 1ZHAA 3BC9A 1O5QA 4Y7EA 4K3ZA 1C9HA 4KFPA 1V3LA 1ZBWA 2Y0FA 3N3MA 1UQZA 4QBXA 4ENLA 2OSXA 1OGBA 1KM3A 1M04A 2QJIA 2ZQ0A 3WLOA 2PDKA 5IHSA 1TPH1 1PDYA 1GVYA 3E0VA 1HGYA 2ACUA 4MWAC 5LZLA 1SMAA 5EMUA 4IJBA 4NX0A 5HTGA 4HJWA 4BF5A 1KXHA 3T40A 1LL6A 4A3RA 3W76A 4E4PA 3ITGA 4I6KA 4ZTYA 1WOBA 5EMKA 3AS2A 3VINA 4D8LA 3MWCA 4D1IA 4E3TA 5BWFA 1IXOA 1OD0A 4HSHA 2PN0A 1R5YA 4CN6A 3SM0A 4RPPA 5CPOA 2DSWA 4N2YA 3DH7A 3ELFA 5A6LA 1JI2A 4H7CA 2PGWA 1MYRA 3PZQA 4NJHA 4F0HA 1GQNA 3G5EA 1IR2A 3M5VA 3GFYA 1NM9A 3T6CA 1KWGA 4WZHA 2E9MA 5KZMA 4JDBA 3NPUA 4QEEA 2ZRWA 4CNSA 2QMKA 4QDMA 1DWHM 3QOMA 1YE4A 3HTWA 3FIGA 4D6JA 4GXPA 2J6VA 4C6PA 3TC5A 4TVDA 5D04C 3WFLA 1F3WA 1RBLA 4A35A 4DLFA 3LUOA 3UCCA 1CBGA 1W32A 2VC6A 4J27A 2Q3OA 4GMEA 1P0KA 3UG4A 3WD1A 3EOEA 4Q7BA 3VO0A 4QROA 4RUBA 2EG6A 4A3QA 3NPXA 3DESA 5A2AA 4U2ZA 1BSLA 2CESA 4K2SA 1W3LA 3UPBA 4ATDA 3QBUA 3ZVIA 3A47A 4PRRA 1KQZA 3EPMA 4FX8A 4G6CA 3A3HA 5CGMA 3RLVA 1UB3A 4RE3A 1E0UA 1QI4A 4X61A 4QIUA 4HMNA 4JIEA 2QCHA 2DG9A 2IPJA 1DWJM 3STCA 4XSMA 2E77A 2RDUA 3ONCA 3SFKA 1ZRQA 3W7GA 2QDDA 4XVEA 4DJFC 3GH4A 4AD2A 1XH1A 3NDYA 1ICQA 1F8MA 1XLBA 3H9RB 2KFWA 5BU9A 2Z25A 4DM2A 2QR6A 2W9MA 3O0KA 4F48A 3W6MA 4J3WA 4HARA 3WH0A 4FX6M 3OZOA 1PCKA 1BAGA 4DJEC 3CMFA 1H2JA 5D2WA 5M3WA 2VGGA 1XH2A 3NRKA 4QNWA 3LHTA 4DJDC 3CU2A 2XYLA 4O57A 4C1LA 3GH7A 2PTXA 4PMUA 4PUDA 2Y2WA 4MZ8A 4AD3A 5HNTA 1UKTA 1K3UA 1KFWA 2C14A 2QCCA 4UR8A 4MKVA 4TR9A 3WY1A 2BODX 3FW6A 3C3UA 4OOUA 5D09A 2BDQA 4X3ZA 3QXBA 1UPMB 1GEQA 1HL2A 4CQ8A 3FA5A 3NUKA 4PFHA 1A5LC 3S9IA 3TLQA 2VC9A 3A6OA 3EDFA 1O5RA 5DFAA 1UOKA 1KGXA 4N7QA 4O2TA 1EX5A 1ZUAX 3C5QA 1V3IA 4G1NA 5ABFA 4PBEA 2JEPA 3DI0A 4WR3A 4HK5A 1WNOA 3M64A 2VWTA 4TYOA 3ITVA 4KEUA 4GHRA 3AYRA 4LUIA 2AQVA 3VNMA 3BGJA 4FNPA 2WMKA 3RCMA 1NDVA 4JGDA 1E0XA 1EL3A 3RPMA 3H26A 3QKZA 2QHAA 4YN5A 2VL4A 4GZIA 2XFWA 3OZYA 5LA1A 2HNHA 2FH6A 2XSAA 4W88A 3QKEA 1HX0A 5HULA 1Q2RA 2C18A 4NUWA 3VM5A 1XBXA 1QO2A 1D2KA 1UQYA 4MUZA 3STFA 1EGZA 4DYEA 3APTA 5TD4A 1JDCA 4U2YA 2GJRA 3KACA 3A3XA 4HOXA 1J0HA 1MDRA 3KTXA 1R85A 4XSLA 5FACA 2D73A 4C6DA 2D0GA 3GXPA 2RKXA 3UZ5A 2V5KA 2VVSA 3SGUA 5F4WA 4HIBA 2Z29A 1JDDA 4LBSA 3WNMA 1K02A 1UJPA 3GNNA 2I9EA 2XH0A 2NZLA 4TMBA 1IYXA 4NF7A 4O12A 2PDLA 3FJNA 1PX8A 4GCXA 3BXWA 1XLIA 3AIEA 5EPDA 4D8ZA 2RJGA 2QT3A 4J9JA 4R33A 4Q7NA 2WNZA 4HT3A 3RJXA 4R27A 1JZ4A 4XBKA 1MO0A 4G8TA 3JW7A 3M0XA 5G1YA 2DVXA 4AF0B 2P8BA 3RR4A 3UPWA 2D0FA 2I16A 2FPTA 3EX1A 1XPGA 2GZXA 3RO8A 5HQEA 3AYSA 1XQLA 1NEYA 1H7XA 1AODA 4YS1A 3R6IA 4M8UA 4KCVA 1XX1A 5HUPA 3VK5A 3PFRA 1V02E 2Z7KA 5CBJA 4RE0A 4B90A 1RY0A 3LNMA 2AMXA 4MADA 1M53A 1I6NA 1G4SA 1O66A 3M0LA 2BXZA 3GC2A 4IP7A 1XKJA 1KM0A 3B0YA 3WMBA 4UCGA 5DANA 2G4JA 2GSEA 1E1EA 4DUOA 3KDOA 2R6OA 4P2VA 1H0IA 1W1B1 3VC5A 2F2DA 3OVGA 3BV4A 3W7MA 4OBRA 3UFYA 1H63A 4IP4A 1H1YA 1ZCOA 5I98A 3BCJA 2E5CA 1GOOA 4GE8A 1ZAIA 3KOYA 5HNRA 2IKIA 2O9RA 5LHEA 1A5CA 3EOLA 4KR0B 1V6YA 2XSBA 5JXQA 2VEIA 1YYAA 4Q4SA 1JCNA 1UD2A 1SM9A 3O3RA 2DT0A 1HKIA 4TV6A 3KABA 4N02A 4ZXOA 1J6YA 2QV4A 4RK8A 3IARA 1UWAA 4JZ5A 2F6UA 4MYAA 3IANA 3ZIZA 3EX3A 1B3WA 5T26A 4Z1BA 1A3WA 4FAPA 3C2OA 3BAJA 3CAVA 5KEZA 1F8IA 4PR4A 1XL9A 4OV9A 3WELA 1Y8BA 3IKDA 1B9ZA 3N04A 2YXXA 3G0UA 1X38A 4IG2A 2WKGA 4H9YA 4LANA 1DIOA 1AL7A 4ZO6A 1RPKA 2V3FA 3I6TA 4JQ3A 5ECVA 3GW0A 5EB8A 3CUHA 2ZICA 3LRMA 1Y0EA 4UFHA 1VCVA 3IIOA 4P7RA 1XC4A 1CB2A 1GHRA 2NWSA 3TLLA 1X8FA 1EBGA 1EDQA 3ZT6A 5IFTA 3B8TA 4ZE5A 4L61A 1ZU8A 5HWCA 2YZRA 4DNHA 4RW3A 3ZMRA 3ARPA 3GYEA 3LSBA 2ODOA 3I7SA 3P3BA 3ZYZA 1MNZA 1U5HA 1JZ6A 4BF8A 1H41A 3QZEA 5LXXA 1U1UA 4L4LA 4NI8A 1JYXA 4NKCA 3WLHA 3S2LA 1TQXA 3ZR5A 2BVDA 2ZX5A 4LUTA 3T4CA 3WQOA 1NSJA 3OIXA 1AH3A 4QEHA 3ZFHA 8TIMA 1S5MA 4AY1A 1AD1A 1R46A 1J18A 2R94A 1PKLA 4QS5A 4UOQA 3U4FA 3IAQA 2RDXA 4PRTA 4R85A 1BPLB 3NQ7A 2VEKA 2VZVA 2Y63A 3EBVA 1V3HA 3MI2A 4EPEC 4KIEA 1B90A 2YB4A 3MI6A 4Q8QA 3GG8A 2A3CA 3ITCA 2HS8A 2BOEX 5E6YA 3W6LA 3R13A 4XISA 4YHEA 2OX4A 4FNQA 2QCMA 2VX6A 1Z44A 1W0MA 3KTSA 3F1QA 4AZ7A 3C56A 3TYCA 3OBKA 1KKOA 1S39A 1QMLA 4QTGA 3ABOA 1FKSA 2VEMA 3AICA 1NH6A 2ZQUA 4J3TA 4P7QA 2FZ8A 4O16A 5HQLA 3LM3A 2BY3A 2MANA 2YKKA 3B97A 1FWDC 2UWFA 5IBXA 3CQIA 4RV3A 1NQ6A 4NJIA 1YLVA 3FFSA 1W5PA 3RX3A 1PYFA 3TWAA 3CZLA 4DRIA 1XDMA 3UXKA 4FN2A 4AY8A 3A5VA 4U85A 3E9AA 4UUIA 1YE6A 4DNMA 4EIVA 3VFLA 4GVHA 3BAXA 4DM1A 5BXRA 1XSKA 3TW6A 2VXNA 1EJWC 3WQPA 1PWLA 2F21A 1THFD 2XZ7A 3PAOA 4FNRA 2ZUUA 1BG9A 2X41A 2O7SA 3WG6A 1TIMA 4LYRA 4NAEB 3GDRA 2RHGA 4HK7A 4O8AA 3NYDA 1W3TA 2QNEA 3SBFA 4TTUA 1JG9A 5FI8A 5A6BA 2J66A 3OGRA 4O18A 2H9AB 2WYSA 5ECUA 5JU6A 2IF4A 1MW0A 1HVXA 4J3XA 2CZDA 1O5XA 4UMBA 3PZOA 5FOOA 1E6RA 4XZWA 4Z1YA 2YB1A 4UQEA 2PA6A 2X1IA 4DT4A 1SVDA 3W70A 3BMVA 3QFWA 3WJSA 3H4WA 5CC6A 3QYQA 4HU8A 3BMWA 1F4HA 2FZ9A 5CC5A 1PXGA 1XISA 3CMJA 3QV7A 3EX4A 2HBXA 3M0ZA 3TQKA 3NQMA 3W7IA 4MNKA 3GW3A 1P0EA 3EOOA 4RNJA 3LYEA 5CPSA 2OXNA 3WDJA 3O6YX 2GVYA 2GGIA 3S1UA 3VVGA 5HT1A 1W1YA 1DV7A 2CWNA 3MUZ1 3V18A 3O5IA 2L5HA 1HIZA 3QZ6A 3I68A 4LW7A 2ZKMX 3LHYA 4M5PA 3AHVA 4JKKA 1QNSA 2TSYA 1SZGA 3G3DA 4LBRA 2MF9A 3EWYA 1ZNNA 4ODMA 3C6CA 1MQRA 4O50A 1F2JA 1EO5A 5HDRA 3VILA 2EULA 5MF5A 1FH8A 1SQ7A 5ABHA 2WWDA 3VNYA 5I3IA 3KP0A 5B80A 4H19A 2V5LA 4L6OA 3LHZA 3URNA 2GUYA 1CXFA 1NOWA 2OEMA 5I24A 3DC8A 2ZA2A 2A3LA 1K9TA 2WVUA 4AVNA 3TQVA 3TC6A 3E0IA 2WK2A 1GJPA 1YDVA 5CG7A 3GZAA 1WZMA 4RX0A 3BK0A 3IIZA 4N9EA 3QR0A 2HCVA 1XLMA 4P5UA 1WA3A 3WQCA 1PO9A 4HNNA 5TIMA 5DT5A 3TFXA 4J2PA 1W5QA 1G1YA 4D72A 1UIOA 2C15A 2IXUA 1NP2A 3HGOA 3DYOA 2B81A 1VJZA 2IPFA 2PZ0A 4GLEA 4ODQA 2F7FA 4M7SA 4CEUC 2C19A 4F9JA 1H7OA 1U33A 2ZXBA 2Q09A 1H7NA 2VR2A 3W1PA 1S2UA 3CLWA 4B2DD 1ONXA 1FHDA 1PZ3A 1TE1A 1R9XA 1QNVA 1IT0A 3NDOA 4EXQA 3TR9A 1SO4A 1TV4A 4DX3A 3IHZA 1BKHA 2O4QA 1UH3A 3HOJA 2QJGA 3FKRA 2DFAA 2VR4A 1K9EA 3W2KA 4LS1A 4CD5A 5D33A 1HN1A 1OZMA 2G3FA 2PV1A 1ADSA 5D32A 2J7CA 2RH9A 1F07A 1R3WA 4ASTA 1GQIA 4HA4A 2NXHA 1K4GA 1A0EA 4GNJA 3IJQA 3B8UA 3GUGA 1Z42A 4WJXA 1U2YA 3V16A 2IQTA 1ZCNA 5E09A 3C8NA 1FWCC 4DZ5A 3W29A 1AQFA 1J0JA 4M24A 5KTLA 3G3MA 3M07A 1W2PA 4CNTA 1J12A 3OYZA 4O52A 3CPGA 3VFCA 4W9OA 4CU7A 5IDIA 3KZ7A 3C61A 2MLZA 3BW2A 1BTMA 3ITYA 1Q6CA 1BQCA 3EWCA 3MUY1 4ZR8A 3LY0A 5ABTA 5IBXC 2B7PA 1UKOA 5CAHA 5FL1A 2J74A 4PUJA 2QXWA 3WLPA 4AZBA 3BPWA 4CCCA 3VD3A 1M9HA 4PMYA 1T41A 5H8PA 4YWSA 2OO6A 4N9DA 1G7VA 1PTDA 3VIFA 3G1HA 4V1YA 3W72A 3HMJG 2QUTA 2WW5A 1I2QA 2CETA 3JRKA 3WDQA 2FGBA 1EUAA 4M6VA 1CEOA 2WZHA 2YSWA 1TJPA 3TJXA 1WUFA 2UY2A 4PSPA 4ZB2A 5FESA 4DZAA 4ZEPA 1QPNA 3QEZA 3FGCB 1TWDA 3P0XA 1J10A 1GTEA 4LUTB 2IQ0A 7REQA 1BYCA 4QSHA 1QOQA 3PHAA 3WF3A 2J6XA 3NVDA 2FAPA 3E0LA 5A69A 2VURA 3LX9A 1XYBA 2VP8A 4GZ7A 1DEDA 4FR6A 3QRHA 2VZTA 1EDTA 4Q8PA 2W79A 5D2TA 3IS4A 1FKXA 4IPIA 4GI4A 3A23A 4JN6A 2XWDA 2QW5A 3STPA 4DWSD 1UR4A 3W7HA 4JFJA 4LAVA 1RJRA 4LVFA 2CLHA 3RK8A 3EGJA 1EEPA 4FXSA 3W7QA 5FIPA 3JVAA 2QCEA 2XU2A 3IJ6A 4BI7A 4H83A 1YMYA 4Y9AA 4UXDA 3LLXA 3PJXA 4GVGA 4AZIA 4WK9A 2WQDA 1FCBA 5L9FA 1AW5A 3WNPA 3NPWA 5DRCA 1GVRA 1NU5A 2XM2A 2CYGA 4IOTA 2FKPA 1CLKA 4QFUA 1XW8A 4CCDA 3STGA 2TMDA 4PMXA 1N55A 3MHGA 1KQYA 1HKJA 1XIFA 1IWPA 4PMQA 2BGSA 4IIHA 4QCEA 2M1IA 3AWOA 3SCTA 3CPRA 3BICA 3G18A 1Z32X 2GVLA 3O5QA 4FA3A 4BJHA 2QCDA 1N7KA 1UCWA 3ONBA 4A8NA 3T05A 2FMNA 1V6UA 3GVWA 1QPRA 2EKGA 2W66A 5HJXA 2EPMX 1BXCA 2OKOA 3IRSA 2J7GA 4BR1A 4OGZA 4MJZA 3IUHA 3WSUA 4HHPA 5D05A 1ZENA 2RQSA 2JF6A 1YTDA 4FB7A 4IF2A 3ZS4A 5CPNA 5EKYA 4FNTA 5AC6A 2VZUA 3CWHA 2Y89A 3GVGA 4JFKA 5MHBA 4AD5A 1WOAA 1XPYA 1BYDA 1PX4A 4ODOA 1OCNA 2O4MA 3QY7A 3VA8A 3MJMA 1Q66A 3EY6A 4JY9A 2OWWA 3QV9A 4D6HA 2VM8A 4NXKA 3WQ5A 2MUCA 4NNRA 4JFUA 2DIKA 1UWRA 3A9IA 2PUZA 1POKA 4XWUA 2YZ5A 4LPCA 1FCVA 3AZRA 4QJ5B 1Q7ZA 3PUDA 3OA5A 2WZTA 2XP3A 2VDHA 3W7RA 1BGAA 1EZ2A 3VZXA 2YYUA 3BLLA 2A0NA 1EOMA 3KX6A 4XD4A 3TXZA 3MUCA 4HCDA 1FXQA 5J04A 4ZO9A 4NJJA 4YTTA 1CCWB 1FWWA 4C6JA 1YX1A 1JQXA 5EA9A 3TKFA 2JKEA 3RJYA 2AL1A