2DSWA

Binding of chitin-like polysaccharides to protective signalling factor: crystal structure of the complex of signalling protein from sheep (sps-40) with a pentasaccharide at 2.8 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dswA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dswA01
3WD4A 2D24A 3AMDA 1IV8A 3KE0A 2Y8VA 4PMZA 5FD0A 3GM8A 2D0GA 4UQBA 2X8RA 4WIWA 1UR1A 3NUKA 1HKKA 1QOXA 1UD2A 3MUZ1 3AIRA 2VZUA 2DH2A 2VO5A 3NCOA 1OBAA 4AD5A 3WUBA 1B9ZA 1GOIA 2VT0A 5DT5A 2D3LA 4W7WA 1V0NA 2CESA 5I79A 5A6AA 3AMCA 4J3XA 4UOQA 1UD5A 7A3HA 5A1AA 3GXIA 3CZLA 1W1YA 3AMGA 3WNOA 3AXXA 2CPUA 3ARXA 2PF0A 4U5IA 4GI9A 1F4HA 3MUIA 5KZ6A 3VIHA 1NP0A 1J01A 3AHYA 5A8PA 4CCCA 3F5JA 3RM8A 2WANA 1XGZA 3OZPA 1E40A 2Y5EA 2UY4A 4U3AA 4UFHA 1E4LA 1E0XA 1UD3A 5BXSA 1TCMA 4KWUA 1QI4A 4J3UA 1UH4A 2CYGA 2VI0A 2DSUA 3TTOA 1MW0A 4TXEA 3QHMA 1FH7A 4N42A 4MB3A 3CMGA 3B8SA 4ATWA 2Y8KA 1AQHA 5JIWA 1K9FA 4GO8A 2ZX5A 4LPCA 4QDMA 1LF1A 1CENA 1VEOA 3T2PA 3MANA 4W7UA 1CYGA 1DTUA 2NT0A 2OWCA 1QBAA 3N04A 1FFQA 2A3CA 1JZ2A 2RGMA 1HKMA 4BCEA 1MW1A 8A3HA 4NI3A 5CZKA 5FL1A 2FH8A 1PX8A 3TTYA 2NT1A 1GQKA 1VFMA 5ABFB 4WKFA 1MXGA 1Y7VA 2IXVA 3RIKA 1BLIA 2ZUTA 4W89A 5FIPA 4PMDA 2GJRA 1J0YA 1US3A 4S3JA 2V5CA 5A94A 2EQDA 3PZMA 1XH2A 1BG9A 4D6IA 3THDA 1CEOA 1K6AA 1J9YA 4HPHA 3L4ZA 1E1EA 3SUSA 1XV8A 2JFEX 3MUY1 3WF3A 1EDGA 2UY3A 1E5NA 3PZ9A 1W3KA 2XVKA 3WEOA 3EDEA 1DWIM 1E1FA 3WH6A 2ZXQA 3AIEA 2O92A 2G4FA 2W63A 4FLQA 3ZQ9A 1E6RA 1NOFA 2EXOA 4Q22A 3ZIZA 1V6WA 4BZYA 4CVUA 3WUFA 1YQ2A 5LYRA 5E6YA 3W38A 5I77A 2EPKX 4UQCA 3AMLA 3VX1A 3ZT7A 4TTGA 3QHOA 4M29A 1UD8A 1H3GA 1U2YA 3VO0A 2ZOXA 1MQRA 5EFFA 4UTFA 2E3ZA 1G5AA 1J11A 3W53A 5ABGA 4TX6A 1UWUA 4IISA 1UKOA 4RE4A 5JBEA 1JYNA 1J0ZA 3OGRA 1E3XA 5D9OA 4H41A 1VB9A 2ZUUA 3AIVA 4GPNA 2YA1A 4BF7A 1NARA 5DFAA 4OBRA 1GQIA 1E73M 3WF0A 2QLYA 4BS0A 1B0IA 3BAKA 4M8UA 2EEXA 3AS3A 3SUWA 5C8BB 2J7CA 1QNSA 3WQWA 3UG5A 1UR0A 3MUAA 3WH9A 3IJ7A 1FP9A 3BCDA 3ARYA 1WO2A 3TTQA 1NWSA 3TTSA 3FNDA 1JAEA 2VR4A 1Q4NX 2J74A 4WLCA 3AOFA 1WDPA 1WP6A 2WSPA 1NOWA 4QCFA 5A6BA 5FCZA 2DSWA 3T0BA 3EDFA 3MU7A 4GI8A 2XTKA 1VJSA 3IAQA 3WBAA 4AZCB 1UH2A 4R27A 2BS9A 4HA1A 4CN4A 1WB0A 2WCSA 4URIA 1PZ3A 4HMEA 3UEQA 5A3HA 4F9JA 3PZTA 4M80A 1ECEA 2YOCA 2WSKA 2V38A 4J27A 3FHAA 1C90A 1BQCA 5ABEA 3K8KA 5EFDA 3K46A 4UFKA 3N12A 3K4AA 1D7FA 1LJYA 1V0LA 2FDMA 1KBBA 1WDSA 3VINA 2G8ZA 6CGTA 1XSIA 2YIHA 2XJ7A 1GHRA 1TE1A 1CXHA 4DUVA 4PMNA 3WDPP 5DT7A 5CG0A 1V3LA 1A47A 7TAAA 1G94A 1HT6A 3J7HA 1ITCA 3WMSA 4ACZA 3UR7A 4AD0A 4W5UA 3PHAA 1B30A 3WQ6A 3W28A 2CBVA 5HBFA 3WQ8A 1VJZA 4E8CA 2AAAA 1MYRA 1Q6FA 3W4RA 4GKLA 1BYAA 4XZWA 5CQ1A 2WWCA 2PC8A 1CLVA 5D4YA 1VRXA 2AOSA 1TVPA 4X9YA 3VGHA 2DT2A 1G1YA 3GBDA 4ATDA 4TX8A 5I78A 3SEPA 4ZE4A 3CPUA 3BSGA 4GIAA 3VOCA 1E43A 4F66A 1JD9A 3ARRA 1KR1A 2CERA 3OB8A 2CBJA 3FY1A 2V3DA 3VMOA 1EQCA 3WH8A 3OBAA 4E2OA 4CN6A 1KB3A 2E0PA 5A6JA 1M01A 1XHGA 4N0RA 3CH9A 3BAIA 1OT2A 1V6YA 1UR8A 3IAPA 3PZQA 3E1F1 3BXWA 1HP4A 5GNXA 5BCAA 1J0KA 4C7GA 2D1ZA 4F8XA 5JBDA 3VM5A 1CXEA 1HXJA 4PCSA 2OYMA 4JHOA 1VEPA 4C7FA 1FHLA 2QV4A 4FF5A 1OGGA 3AZRA 4M24A 2ZX8A 3NSNA 4H7VA 1HJXA 4AIUA 1DWHM 5A6BD 4L4OA 4U2ZA 2E9LA 2PBGA 1B3XA 2VX4A 4P8VA 4U31A 1U33A 3A47A 3GDBA 1CDGA 3K8LA 3W37A 7CGTA 1CXKA 1V3JA 1UWQA 2ZE0A 3VILA 3VNZA 3MMUA 3MS8A 5DEZA 1ISWA 3VD9A 3DC0A 5AYBA 1JL8A 1B31A 2F61A 3VIJA 4CKQA 1HJVA 1C92A 4P7NA 1H4PA 5CSUA 1JXJA 3OIHA 5BXPA 1Q6EA 2EPNA 2QMKA 2WHKA 4M1RA 4PYSA 1XRVA 1GPFA 1DWGM 4S3KA 3U5UA 3VD7A 2XVLA 3UG4A 1E72M 2ZUMA 2VZOA 2W5FA 2XFYA 5HNNA 4AEFA 3WDHA 1PEZA 3I3EA 4FK9A 2WVVA 3AZTA 4NRRA 1LQ0A 4YN5A 3MO4A 5E0FA 3PZUA 3UR8A 4MJ2A 4ACYA 2WXDM 1IZJA 4AYSA 4PBGA 3ARPA 1A3HA 3OGVA 1H09A 2XIBA 3L4TA 2WZIA 2RGLA 1H11A 1E3ZA 2DT1A 2JALA 2VZSA 3DYOA 3TOPA 3VGDA 2BY3A 5D8WA 3L2MA 4AZ6A 3AIWA 3PZIA 4LXFA 1CGVA 3VGEA 2DSKA 2PWDA 3G6MA 4GQQA 1I1XA 3CLWA 3ARQA 3AI0A 4AXNA 3VUPA 4OZOA 3QOKA 4D1IA 2WKLA 4U5KA 3M07A 4UCFA 1FP8A 4DUXA 2O9PA 3A4AA 4JHZA 1GVIA 1LLOA 4JCMA 4JL1A 4MB1A 5LA2A 1KCKA 1LL6A 3VDCA 1EXPA 4W8BA 4ZXLA 4TVDA 2VOTA 2D2OA 5TD4A 2B31A 4MJ4A 3RJXA 2YJQA 4PEEA 1UWTA 4AIEA 2YLLA 2VRJA 2QHAA 1MFUA 3FW6A 1X1NA 3BAYA 4C7DA 5GNYA 2OLHA 3BC9A 1ODUA 3T09A 2FHFA 4GO9A 2GUYA 4HOWA 2ZX7A 3SCPA 1MQQA 1ZBVA 4B3KA 2W4XA 1JZ8A 2VX7A 2WMIA 4AD2A 1QHZA 1H0IA 4LYRA 2W62A 1QVBA 2GVYA 4HA4A 2PWGA 4QAWA 2BY2A 2EPOA 3VDBA 3WD2A 2G3JA 1SFSA 2VCCA 2WMFA 3ZO9A 1W32A 2PWEA 1KXVA 2YBTA 1QI3A 2WCGA 2XIIA 1HJQA 2D22A 4JFWA 1CECA 4ACZB 5M5DA 3KL0A 3WFLA 3WQ4A 2WK2A 2ZXAA 2E40A 1ZU8A 4GZEA 5CLWA 2EO7A 3W29A 3PN8A 3N17A 3SCSA 3WNMA 1W9VA 1G9HA 3SCRA 4ZE5A 3SCUA 4MPKA 1V3HA 1NP2A 5A8OA 1GZJA 5I2UA 1JZ5A 1E0WA 3CUIA 4MDPA 3BMVA 1E6NA 1F4AA 1W1VA 4JIEA 1D2KA 5CSYA 1XH1A 1UR4A 3CTTA 4GINA 2GDUA 4MDOA 4LGXA 3WUEA 2PI6A 4D72A 1LWHA 2VRQA 1FOBA 3VNYA 1DHKA 4UFJA 3KEHA 1W91A 3BAXA 3ZT5A 1BYCA 1QBBA 3QGVA 1GJWA 5E9AA 1EO7A 1SMDA 2QF8A 2A3HA 3CO4A 2VVNA 2WYSA 4UZUA 2V3EA 4UQ9A 2XM1A 2WWDA 3W24A 3I3DA 1EHNA 4YHEA 5E70A 3CHDA 1H49A 1R85A 1EGZA 2GFTA 5I23A 5GQBA 5LA0A 2JIWA 4QP0A 4CGTA 1ZBCA 4AC1X 3MV01 2G3NA 1P6WA 2FHBA 2CIPA 4WSJA 1G0CA 3CMJA 3MMDA 4BQ3A 2YA2A 4AZIA 3WFZA 1B90A 3MKKA 3VMPA 1W9DM 1XSJA 5A2BA 3ARWA 4DM1A 5C70A 4GQRA 1MW3A 2J7GA 2FGLA 2DDXA 1E5JA 4KGJA 4AD3A 2ZWYA 3WENA 1ESWA 3NDYA 1QHPA 3WH5A 3FAXA 1D3CA 4FMVA 2DT0A 3GNOA 3BH4A 3LPFA 2BHUA 1TMQA 1W9XA 1PZ2A 4ZXOA 3WDIA 2VQUA 3K4DA 4AEEA 1W9PA 2D3NA 1KQZA 5E0CA 4W84A 1BF2A 2XVNA 4V2XA 2HISA 3VGGA 3L4WA 4PMRA 2J7DA 1CIUA 2HVMA 1QI5A 1B3ZA 4H2CA 4PCTA 5BROA 1JGIA 4UQDA 5A2AA 1NM9A 1EDQA 4U3CA 1WDRA 1BHGA 4GI6A 3VTRA 1UG6A 1UQZA 1L0PA 2Q8XA 4HU0A 4JFTA 1PX4A 3VIKA 1WZKA 2YKKA 1B3WA 2C0HA 2WVVB 1JZ6A 3QOMA 3CUFA 3AZSA 1KBKA 1IT0A 5E6ZA 3RM9A 1UZ1A 2TAAA 1KCLA 4Z2HA 2IXUA 1EH9A 2JE8A 1W9BM 1JFHA 1PIGA 2CBIA 3BLKA 5A6KA 5I6SA 1TUXA 1M04A 1NQ6A 1C7TA 1E56A 2XHYA 1UKQA 4M56A 2DIEA 1TVNA 1AVAA 3U7BA 2ZUSA 4X0VA 1JDAA 3W6LA 1HIZA 3UERA 1J0HA 1E55A 1OGSA 3GXFA 3DHUA 1UA7A 2JF7A 4WF7A 5IHRA 4Z2IA 3N13A 4UQAA 1OSEA 1GUVA 3CZGA 2E9MA 2BNJA 1OINA 2WBGA 1O6IA 3AIBA 1VIWA 2J8FA 1ITXA 4CU8A 3SIMA 4F79A 2C8NA 3PTQA 1SMAA 2BHZA 1JDDA 4D1JA 4M82A 3OLGA 4CVWA 1OIFA 3NYDA 1CBGA 3WNPA 3GH7A 4QLKA 3ZOAA 3PTKA 3EYPA 3VU2A 2WLZA 3FXYA 4W93A 5JUVA 2VC9A 2WNWA 3NJ3A 4AZBA 2X09A 4HTYA 2VZTA 1OWQA 1LL7A 1KQYA 2WMIB 1CGXA 3WF1A 1QW8A 2YL9A 1UOKA 4EKJA 1WZAA 2J7EA 1CZ1A 1PIFA 3TONA 3B9AA 3ALFA 3L2LA 5ABHA 3N11A 2E8YA 1EA9C 1J0JA 1KGUA 4D6EA 4CUCA 4KRTA 2BXYA 2WC3A 5CPSA 2FHCA 2WHJA 1UQYA 5I0DA 5E09A 1BAGA 1EQPA 2YDSA 2J79A 3RMEA 2QPSA 2X0HA 4AZHA 3SCWA 4NF7A 5CJ5A 3AS2A 1GCYA 3U57A 4D6CA 4CD5A 1E9LA 4X0NA 5CPTA 3APGA 2XUCA 2V3GA 2A3EA 1JXKA 4B16A 1JYWA 1LG2A 4CD4A 2AMGA 2WMJA 4UOZA 4YHGA 4B3LA 5M03A 3N15A 2A3BA 4EK7A 2F2HA 1QNRA 2E8ZA 4B9YA 2YL6A 3CZJA 1BG4A 4WKHA 4Z2KA 1E71M 4W8LA 2BVYA 4E8DA 1BGGA 3RPMA 1PAMA 4IM4A 5EMYA 3SCQA 5IDIA 4AMCA 1VEMA 1XYFA 1XD1A 3BAJA 4OOZA 2ZXDA 2ZUWA 2OYKA 1CTNA 5A8NA 2XGIA 3LPOA 2J78A 2MANA 4WJXA 3VMNA 3VIFA 4W5ZA 3M7SA 3BMWA 4H8HA 3ZMRA 5F7UA 1SR0A 1TG7A 1GQLA 4CD8A 1HN1A 5A6SA 1TA3A 1MXDA 1HNYA 4MNJA 4W8AA 4ATLA 2BV9A 1ZS2A 1FH8A 2ESCA 1E4IA 1DWJM 4W7VA 1V6VA 1OIMA 2OWWA 4OOUA 3OLDA 3THCA 2YL5A 1HVXA 3W82A 4J3WA 2OWXA 2YLAA 3AYRA 1R86A 4L4PA 4AIOA 3FHQA 1ZL1A 2DIJA 2G3IA 4HZ6A 2DQXA 4UZSA 4PMYA 3SUUA 5A6MA 1HL9A 4PMQA 3OGSA 3EDKA 3CUGA 3U7VA 1JYVA 5M3WA 4HZ8A 4FLRA 4U2YA 3BAWA 1WCGA 4PMVA 3OLIA 5DF0A 5I3DA 3BCFA 2PB1A 4MNMA 2ZICA 4CCEA 2GK1A 3HMCA 1M53A 1HJWA 1V03A 5BXTA 1GHSA 1HKIA 1BVZA 1AQ0A 5I24A 2FH6A 3AHZA 3F5KA 2UY5A 2CXGA 1W1TA 3AFBA 3T0AA 3WNKA 3IJ8A 3CHCA 4UQEA 3ARZA 5DO8A 3DYPA 4DWSC 1KR0A 2ZWZA 4TVUA 4AD4A 1V3IA 2VL4A 3DYMA 4UFLA 4DUWA 4XUYA 2PBOA 1J12A 4MNKA 4P7RA 5D8ZA 1CPUA 1OD8A 2Y2WA 4UR9A 1EDTA 1VBRA 4PMUA 1BYBA 2VJXA 1VFOA 1BTCA 4W86A 3WQ5A 2YDRA 4RE3A 1EO5A 3WDRA 1E6ZA 4AWEA 1NWRA 4J3TA 1WZLA 3K1DA 3WDQA 2ZX9A 1UHVA 3VIOA 2VUYA 5BYWA 3IK2A 4HMDA 1XC6A 5FKYA 5IFTA 1MQPA 3UCQA 2GJXA 2OSXA 3MV11 4LQ1A 2DGAA 4DWSA 2CBUA 2WPGA 2WMHA 4WKAA 1ISYA 1ZJBA 2WLYA 4MADA 5A95A 3KZSA 4UFIA 3M46A 2JEQA 2BY1A 1RH9A 1M7XA 3ZJ7A 4HMCA 2X05A 1C3FA 2Y24A 5JH8A 3GH5A 4U33A 1C8QA 5D9PA 3LPGA 3SUVA 1E4NA 2VQTA 5JBFA 4M81A 1UD4A 4PTVA 4PTXA 1O7AA 2YA0A 1V6UA 3ALGA 2BXZA 4Z2LA 2J47A 3II1A 3HJEA 5D9MA 3WQVA 1QW9A 1R7AA 3L4UA 1RD6A 1JNEA 3PZGA 1NOUA 2YDQA 3AHXA 1J18A 1V3KA 4K68A 2WAGA 1UKTA 4KH2A 2CITA 3VD5A 1ZB5A 5HPOA 4J7RA 1BFNA 3EMQA 4XB3A 1GOMA 2D0FA 1WNOA 2WW5A 2DH3A 4F9DA 1KXQA 2YL8A 2XFFA 2YBUA 1H2JA 4QFUA 1MWOA 1FFRA 1VBUA 1ISVA 2W61A 1C93A 1DWAM 3LMYA 3ZR5A 5HXMA 2IUZA 3AHTA 2J8GA 4Z2JA 1HP5A 3BSHA 1V6XA 4OUEA 2QMJA 4RL3A 2VTFA 4A4AA 2OYLA 4BQ4A 2VVSA 3A3HA 3EBVA 2XGBA 3WELA 4PUDA 5AC5A 5A6LA 1ZBWA 1BVNP 1UWIA 5DMYA 4FLSA 4JKKA 4AY1A 1DWFM 1H1NA 1E6PA 3RDKA 2VCAA 1AQMA 3QR3A 1JZ4A 2XSBA 1H0GA 1KXHA 2G3MA 1X6LA 1QHOA 2CKRA 4MAZA 3AXIA 4W88A 3HN3A 3CIVA 2EPLX 1TA3B 5CGMA 2J7FA 1V3MA 2BVDA 1R87A 4GZIA 3ZSSA 3PTMA 3F4VA 2O9OA 9CGTA 2EPMX 1VAHA 1JZ7A 2D23A 2VZVA 4IPNB 4TVCA 3CHEA 2NW0A 3ZSTA 2JIEA 3WD0A 3VVGA 1QNPA 4ZENA 3B9DA 1UYQA 2CEQA 3BLPX 4D71A 1E4MM 2WBKA 3O6AA 5AY7A 3O9NA 2D20A 1E6XM 3G6LA 1KXTA 3NDZA 1HF6A 2WC4A 3S6TA 2WC7A 3KL5A 2XFRA 2PWHA 4J28A 4AISA 4DWSD 1TFVA 3AS1A 2WVUA 5CLTA 5IXEA 2BY0A 6TAAA 3ARUA 3GH4A 1JAKA 1GVYA 1UR2A 4P7OA 1J0IA 5CXPA 5A2CA 2J25A 2GK1B 1C8YA 1WKYA 1EOKA 3FN9A 3WDJA 2X2YA 2XG9A 1HL8A 2NSXA 3WKZA 4TOQA 4GZJA 4JKMA 3GTNA 2EBNA 4PMXA 4Z2GA 4A3HA 3WD3A 4WK9A 2UWFA 2WMGA 2XVGA 4H8UA 4JCLA 4CD7A 3GNRA 3PZVA 1JNDA 4P7LA 4JL2A 3GBEA 1V02A 3AISA 1MFVA 3L4XA 1PPIA 3VGBA 3RILA 4KGLA 4IUGA 3TA9A 4A3YA 4BA0A 3W27A 3GZAA 3NSXA 4B15A 1BPLB 1K9TA 5BXRA 3EMCA 5HOSA 2WVTA 4J3SA 4Y7EA 3ZJ6A 2WKGA 5AYIA 1C7SA 1OM0A 2W67A 5ECUA 3D3AA 5JIPA 5BWFA 5FL0A 3AHVA 4PTMA 2VMFA 1NH6A 2XVPA 3AYSA 2EJ1A 3SURA 3OZOA 3HU7A 1ISXA 5KEZA 5EB8A 4MTVA 4PTWA 1UWRA 2V5DA 4H04A 1V02E 4E4PA 2WM0A 1RPKA 2G41A 1KFWA 1XYZA 3QHNA 3WNNA 3WEZA 1GW1A 1J10A 1JI2A 1XH0A 3VD3A 1WZMA 1W2PA 3ZJKA 1UR9A 1OB0A 1HJUA 4YPJA 2C7FA 2WZHA 1I75A 2JEPA 1JYXA 4HP5A 4PSRA 4D6HA 2GJXB 3VKKA 1GQJA 3I3BA 4DWSB 4MB5A 4JAWA 4NZCA 3ARTA 3WIJA 1US2A 2BVTA 3NIYA 1FH9A 1CXIA 3AJ7A 3VIIA 5HDRA 2WZEA 4NSBA 1E0VA 3A6OA 1GOQA 4V27A 3W81A 4HPGA 3ECQA 1LWJA 1XD0A 2A3AA 1QI0A 2WB5A 1GOWA 3WD1A 5CPQA 4XZBA 2VURA 4WSKA 3KL3A 1B3VA 2UY2A 1B1YA 1BSIA 3VDAA 1UA3A 3N18A 3O2LA 4BQ5A 6A3HA 3WNLA 3WF4A 3WUGA 4PSPA 3FAWA 1TZ7A 4P8XA 1R7OA 1UKPA 2E9BA 1BGAA 2J62A 3VDHA 2ZUVA 1H5VA 2VRKA 3A4XA 1W2VA 1R8LA 1UUQA 4TUFA 3PZNA 1E70M 4EAMA 2J7BA 3SCVA 1GJUA 1HKJA 1JD7A 3K8MA 4NRSA 1UWSA 2XPKA 1CLXA 3N9KA 1KWGA 3OLEA 1NWTA 2X1IA 2WHLA 2DSZA 3RCNA 1EOMA 5BRPA 1K9DA 2CETA 2J7HA 2JF6A 4OBSA 4J3VA 3WMCA 1B3YA 3CZEA 1CGYA 4PUEA 1WE5A 1VFFA 4HA3A 1Q6DA 3M6DA 1OD0A 1W3HA 1U30A 3SUTA 1DP0A 1GNXA 4CU7A 1C8XA 1BYDA 1MVYA 1HJSA 4PRWA 3WBEA 1JG9A 4PMOA 1HVQA 1RP9A 3ZT6A 1LL4A 1OCQA 2QPUA 5FOOA 1N82A 4KMQA 4LX4A 1KGXA 3VM7A 5GNZA 1UH3A 4HOZA 3TP4A 1G01A 4W87A 2CHOA 2WMKA 1GOKA 1JIBA 4ZEPA 4D6JA 3POCA 2V3FA 3RJYA 1V08A 4PN2A 1OGBA 3PBGA 1UKSA 4JFVA 5AC4A 3VD4A 3SCTA 3ZM8A 4OJYA 3BGAA 3ARSA 3LPPA 1CXLA 2OSYA 4ZFMA 2VX6A 4EE9A 1QNQA 3WH7A 4HU8A 2PWFA 1PBGA 2XM2A 3DHPA 3VX0A 4ML4A 4CD6A 1X6NA 2XYLA 8CGTA 1FA2A 3CGTA 1FHDA 2GSJA 1V0MA 1LG1A 2BFGA 3EDJA 1XSKA 3UETA 2O9TA 3AIQA 2CKSA 3CBWA 3JUGA 2CHNA 2X0YA 2Z1KA 1AMYA 1VFUA 4AD1A 2ZX6A 3UESA 2J77A 3WL0A 1JDCA 2XSAA 2OSWA 1IZKA 3VIMA 3ARVA 1ODZA 4HZ7A 2O9RA 4JZ5A 5C71A 1JI1A 3ZR6A 4D6DA 3B9EA 2Y4SA 1W3LA 3U5YA 1WAWA 1CXFA 2WCAA 3SCNA 1TR1A 3WSUA 1I1WA 2XWEA 1QPKA 3AMKA 4QLLA 1UD6A 2Z1SA 1PX3A 3GYCA 3AICA 2CCRA 1EHAA 3WEMA 5HPCA 4DM2A 4CU6A 4BQ2A 1KWKA 1JF6A 1C91A 3GXMA 3W6MA 5ABFA 3AROA 1VENA 4TTUA 3OA5A 1E6QM 4D6GA 3OG2A 3PZOA 1K9EA 3N1AA 3SCOA 2J4GA 4FLOA 4P7QA 2VR5A 1ISZA 3W25A 3CHFA 3GXDA 2BHYA 3WY1A 4AW7A 3GNPA 1CGTA 2GJPA 4CN1A 3IJ9A 4HOXA 3CZKA 1NWUA 3AQUA 3S2CA 1W9UA 1JF5A 2DEPA 4IPLA 3ZJ8A 1UZ4A 3MSDA 3AS0A 2VX5A 2J75A 5LA1A 5EBAA 1M03A 1VF8A 3RO8A 4CCDA 4QLJA 3T08A 1QI2A 2D0HA 3EDDA 4JKLA 1CGUA 4XV0A 1L8NA 2XWDA 3POHA 5IHSA 3KWXA 1ZJAA 3L4YA 2FGZA 1H41A 2ZXBA 1S46A 3EMZA 2ZUNA 3W0KA 2CNCA 3L4VA 5IFPA 2VCBA 1XCXA 1GOOA 4OKDA 1XCWA 3IANA 3VIPA 1WPCA 3AXHA 4JFSA 2E4TA 5M17A 1RP8A 1GONA 3MMWA 5A8MA 5A8QA 3A4WA 4UFMA 3AIUA 4EANA 1SYTA 4LYPA 2DT3A 1B2YA 5CGTA 2DSVA 5D9NA 1JZ3A 1WDQA 1V0KA 3F5LA 4AZGA 1E15A 2WVSA 1CNVA 1HX0A 1E6SM 3WN6A 1Q6GA 4RE2A 1DEDA 4H8VA 4V28A 3T0DA 4W85A 2W66A 4B9ZA 3T2QA 3CZ8A 1EIBA 5BRQA 3UG3A 4MAVA 1W1PA 1ZBKA 2W92A 4UNIA 4AZ7A 4R5EA 2F8QA 1CGWA 1OT1A 2W91A 4UOJA 4OIFA 4LYQA 5A69A 3CUJA 5GPRA 1CWYA 1Q6CA 3D5HA 4GXPA 2GDVA 3W26A 4AZ5A 2VNCA 3RM4A 4XX6A 2ZIDA 4Q7NA 4QCEA 4D6FA 1MW2A 3MSGA 3DECA 4MNLA 1QNOA 1JFXA 4AZCA 1PJ9A 3VIGA 4MB4A 3WMBA 3NSMA 4KRUA 1Z32X 2WHMA 5I5RA 4JFUA 3VGFA 1YHTA 3CUHA 1KGWA 3WL1A 3WF2A 4P8UA 3VPLA 1GORA 2DPEA 3T2OA 1W3JA 4P8WA
chains in the Genus database with same CATH superfamily
3BMBA 1NELA 3M5YA 3BLLA 4YNGA 3LCXA 4HT3A 3HMJG 2HBVA 2ZYFA 5KZDA 1J6YA 5FD0A 2M1IA 2D0GA 3P8IA 3SFWA 1Q7MA 4WIWA 2QW5A 2XU2A 3H2FA 1JPKA 4C6CA 3GKFA 2DH2A 3B8IA 4GIYA 4AD5A 3O5JA 3S5NA 3PUOA 1VCVA 3PG8A 2GOUA 4AAJA 4YWIA 3MI6A 5A6AA 3AMCA 4J3XA 2OO0A 4UOQA 1EWDA 2QUNA 3CZLA 3LG3A 1W1YA 4PRTA 3LTPA 4JQ4A 1QK0A 3F2BA 2DZXA 4U5IA 4IL0A 3LBMA 1EP2A 1ZENA 2Y62A 1Q2RA 3LA4A 1J01A 5A8PA 3F5JA 1TCDA 1IEIA 3LM3A 1YXDA 3W1TA 3WQDA 3BURA 1IEVA 2PLCA 3FA3A 4OECA 3UNDA 1N8WA 2B5UB 1UH4A 2CYGA 2VI0A 4J3UA 5EL1A 2V5BA 3T42A 4DZHA 1J2WA 4A21A 1QPFA 2PTZA 3HURA 3NL2A 4DAFA 4IP4A 4IT1A 3UXLA 4LPCA 3IHZA 1CENA 5I00A 3MANA 3B0XA 1DTUA 2ZFAA 3N04A 1FFQA 4A3RA 3V5FA 1HKMA 4BCEA 3B03A 2QIWA 1PX8A 1PZ0A 3E0WA 2IPWA 4I90A 4L4MA 3B04A 4PMDA 3CL8A 3IV8A 1RCXB 4I8DA 1J0YA 3KVLA 3A5VA 1XUUA 3NM3A 4ORIA 1EGMA 2RKXA 5HULA 3PZMA 1XH2A 3G0XA 1J4IA 3THDA 4HPXA 4RZ6A 2B7PA 4HA0A 1J9YA 3L4ZA 3RX2A 2HE5A 3SUSA 1XV8A 2DG4A 2X1UA 2CLEA 1VP5A 3LXBA 4W9TA 3LK6A 1RALA 1R46A 3N6JA 2XVKA 1HXVA 3O5MA 2PGRA 3AIEA 2W63A 1JQXA 1RJQA 2VFHA 3ZQ9A 3UWQA 1E6RA 4G9PA 2MLYA 1FWRA 1NOFA 2NQ5A 4DJEA 2CLFA 1W0MA 3LMZA 4CVUA 1YQ2A 1EJVC 2H3BA 1ZAHA 3P84A 3QKZA 4QIUA 4WJEA 2TODA 4OTKA 4R0XA 4M29A 4KCTA 1WUFA 1H3GA 5M1TA 3VO0A 4IGSA 1DXIA 2XH0A 3O0FA 4MWAA 3DH7A 2CXEA 4UTFA 3LCHA 4DHGA 5ABGA 2YXXA 1UWUA 1UKOA 4QQ3A 4KERA 3IGHX 2XN1A 5FF4A 1ONRA 4BF7A 4LCRA 1Q5MA 3G0SA 1GQIA 2ABAA 3BAKA 3AS3A 4JTIA 5C7VA 4IIGA 3GNNA 3LUTA 1QNSA 1S2CA 3UG5A 2SFPA 3MUAA 1FP9A 3WLLA 2X7VA 3EXRA 3ARYA 1U5JA 1WO2A 4HCDA 3FNDA 1F7BA 4MWAE 1UIOA 3T8LA 3JRKA 4WLCA 3R10A 2WSPA 3GLCA 1NOWA 3URAA 1GWJA 3PJWA 3W1MA 2WNQA 4NYUA 1NU5A 2P50A 3GW0A 3CAWA 2XTKA 4ZS6A 3IAQA 5DMMA 2NX9A 2WCSA 3UEQA 4F9JA 3PZTA 4JX6A 1XDMA 4JNZA 4LOCA 4Q6XA 4JQAA 4G7EA 3FHAA 2RQSA 1BQCA 4DB7A 5ABEA 1XLBA 3K8KA 3BUVA 3OHMB 3QR0A 1RLCL 4RZBA 1I2QA 3K4AA 4UTMA 1EJWC 1BQGA 3VINA 3KACA 2ATSA 1FUYA 1FWEC 3OA3A 5CG0A 1XLEA 3R11A 4QXIA 4ACZA 1N1AA 1JNSA 2ZVRA 1J6PA 3WQ6A 1Z89A 2EKGA 2OU4A 3W28A 3S46A 3MKVA 4Q4SA 4L80A 4E8CA 2VD8A 1Q6FA 3W4RA 2PF8A 4GKLA 3VABA 1MMFA 1U1JA 2QVNA 4TMBA 3NA8A 4DH0A 5D4YA 3UG8A 2V5LA 3R79A 3MP3A 4CNSA 4L7ZA 4XAFA 4ATDA 4JTGA 1GTHA 1E43A 3R89A 3ARRA 1KR1A 1WXJA 3P81A 2D9FA 4K38A 4FOJA 4KWOA 3HQNA 1S5TA 2V3DA 1EQCA 5FJJA 3WH8A 2Z7GA 1KB3A 2E0PA 3DBNA 4AH7A 4I7WA 1NFGA 4EVZA 3LHTA 3BGGA 2GGHA 3S6DA 4MUPA 1VHNA 5AYXA 3BXWA 4U28A 4L72B 1OEPA 1HP4A 1MUMA 5BCAA 4C7GA 3LD5A 3OZYA 5JQ9A 3H23A 2D1ZA 4F8XA 3PAOA 1CXEA 4XISA 1I2RA 3PY2A 1X7IA 3NRKA 5B7YA 4FF5A 4HN4A 3AZRA 1VPQA 5DCBA 4HHPA 4DI9A 2C0AA 1TV3A 1BWLA 1HJXA 1Y5XA 4JTRA 5A6BD 4L4OA 3ICJA 1W1B1 2E9LA 2QVHA 2OO6A 2PBGA 2X1TA 2X16A 2DG9A 4U31A 1U33A 2XISA 3MUXA 2KR7A 4QX4A 1AZ1A 3EWCA 4Q32A 3K8LA 3VZYA 3XISA 2RDTA 4QT3A 4JBRA 1VD6A 6XIAA 5DY2A 4XAPA 3M7WA 4HKPA 2IPGA 4UUIA 2LPVA 3VD9A 4R85A 4F2TA 2HCVA 3ZVHB 2L5HA 1M1BA 1B31A 5CSUA 1HJVA 1C92A 3PTDA 4F0MA 1ZP3A 1Q6EA 3LERA 5BXPA 5F4WA 1X39A 4PYSA 1XRVA 4X2RA 1E1CB 5BWAA 3UG4A 1OC5A 4K8HA 3CV6A 1SM9A 3I3EA 3AZTA 3GE7A 1RHCA 2HRWA 4WVXA 4NRRA 2IW0A 1LQ0A 2NQJA 3SSJA 3GQYA 3NO3A 4F4RA 4ZZ9A 4MJ2A 2WXDM 3H2MA 3KBWA 4PBGA 2C14A 4XIAA 3ARPA 3PWIA 4QSHA 3OGVA 4MGGA 2XIBA 3SN0A 1LROA 2WZIA 3M47A 3HG3A 1KT0A 3TOPA 3K1GA 2WO5A 3M5XA 4LXFA 2OCZA 1CGVA 3VGEA 4MY1A 1TV2A 1I1XA 3CLWA 3NR0A 1V93A 3VUPA 1OG0A 3GU9A 4D1IA 1Q2SA 2WKLA 4RDZA 1Z69A 3GTXA 4RE0A 3KS6A 4RNIA 5BRBA 3P5ZA 3UWWA 2J66A 4JCMA 4MB1A 1H7NA 1XXXA 1R3SA 4ZXLA 3FSUA 2VOTA 3MCOA 3I65A 3BG3A 2KX9A 3MC5A 3RX4A 4MJ4A 3RJXA 3UWYA 2ZQ0A 4O1FA 3NQAA 3FKKA 2R8WA 1RCOB 1RQBA 4AIEA 2L2SA 1UZHA 2YLLA 4AWSA 5I3JA 5DANA 2QHAA 2XP6A 3GG7A 3SRHA 3BAYA 2NVCA 3MB9A 3UT0A 2NV9A 3LHZA 4DJDC 1ODUA 4F40A 4R7WA 2RSEA 4GO9A 4HOWA 3CGNA 2ZRZA 4B3KA 2HS8A 2OTDA 4XG1A 2W4XA 2VX7A 5KITA 3K13A 3EOEA 4HA4A 1W6TA 3GXNA 2H6RA 3FLUA 2QAFA 5AOUA 2BY2A 3MBFA 3W00A 3WQPA 2ZC8A 5H91A 2YBTA 2NUWA 3IIOA 3QTPA 2PP3A 3NVDA 1HJQA 4FO4A 3T9PA 1FCVA 1TIMA 4ZQOA 3WQ4A 1DIOA 4F0KA 1MEHA 2ZXAA 2KAUC 2FZBA 2E40A 3W29A 1Q66A 4DQWA 4FPSA 3H2CA 3TE9A 1G9HA 3VNJA 4J2MA 4DIAA 4JGDA 4RNHA 1YE4A 4IQDA 1NP2A 3NEHA 1XLIA 3GNDA 3P60A 3GU2A 1KNWA 3QQ1A 1OZQA 1E6NA 1HFBA 3ZFHA 3FS2A 1XYLA 3DG6A 3CTTA 3LZ3A 2GDUA 3DI1A 1GG0A 2C79A 8XIAA 2VRQA 1FOBA 4UFJA 3KEHA 2HBXA 4UCGA 3MCMA 1BYCA 1GJWA 3HGOA 2H90A 1SMDA 2QF8A 3CO4A 4JY9A 3T7VA 4UZUA 3W24A 3I3DA 3THQA 2Z7KA 4NU7A 1JCTA 3O7UA 4D9PA 5CAHA 1YPFA 2OEKA 1X8FA 5GQBA 5HWCA 1I45A 4CGTA 3CLMA 1AW1A 2ACRA 3MV01 2VDHA 1U83A 2CIPA 2QJGA 3EX1A 3BDKA 4BQ3A 5LIXX 2PCQA 1EJSC 4AZIA 2IF4A 2PBCA 3P8JA 4O2TA 5A2BA 1C29A 4GQRA 2J7GA 2FGLA 3ITTA 4G2PA 4JDYA 1D3CA 3PSVA 7ODCA 3R2GA 3IK8A 4I9MA 1TMQA 2EPHA 3C52A 4AEEA 1W9PA 1W8SA 2D3NA 3FGCA 1KQZA 5E0CA 1LT7A 1EF2A 4Y6GA 1XIDA 3O0KA 4PMRA 2HVMA 1QI5A 1HZYA 4H2CA 1JGIA 2K8IA 3W7JA 3PG9A 4GWEA 4K1WA 4DO5A 3CNYA 5LIWX 5D02A 4FAMA 1L0PA 2Q8XA 4HU0A 1RAKA 2C0HA 3CL7A 5AECA 1F6KA 3SGGA 4QDPA 2IXUA 5F4SA 3CM4A 3TYDA 3H4XA 2NXIA 1TUXA 1M04A 1QAPA 4RDWA 3U2ZA 2XHYA 4DUOA 3L12A 3V35A 1ONWA 3L0NA 3W7EA 3U7BA 2ZUSA 1JDAA 1E55A 2F38A 1F3WA 3A4JA 1OGSA 3GXFA 3PBYA 1TUFA 2JF7A 4JHMA 4IT6A 3KOXA 4UQAA 1OSEA 4I9JA 3IS4A 5TAOA 2YW4A 4F79A 3WJSA 2C8NA 3THUA 5JU6A 1IGSA 3RGCA 3L68A 4GNVA 1VJIA 5FSEC 1B57A 1JDDA 4X9SA 2BZNA 3VNLA 2TRSA 4G50A 4ODPA 2OG9A 3BJFA 6ALDA 2FKPA 4PUJA 5T9BG 4E3VA 1ICSA 1Y5VA 3QW3A 3GH7A 5CJMA 2OQYA 2WZMA 4ADTA 1U5HA 1V77A 4IH3A 2UV8G 4W93A 2W79A 2VC9A 4KS0A 2C6QA 3DFOA 3NJ3A 1YTKA 1ELSA 2X09A 1W3NA 3SADA 1ENUA 1TSIA 1H60A 1LL7A 1KQYA 1UJPA 3ZLFA 2WMIB 2R9RA 1TTIA 1CZ1A 2Y6ZA 3TONA 3B9AA 3L2LA 1IYXA 1V79A 1EZ2A 1KGUA 2CZVA 4D6EA 4CUCA 2VEGA 4KRTA 5CPSA 1ITUA 1JUKA 1UQYA 3GRIA 3S2JA 3CPGA 1ZALA 1BAGA 3FDGA 1QPNA 4K8GA 1XFCA 1J6OA 4S3EA 1P6BA 2JKAA 1GCYA 1OABA 1QR7A 3A3XA 4V1XA 1W37A 4JIQA 4JXCA 2A3EA 3UF9A 4JFIA 2CU0A 1OX4B 4CD4A 2BP1A 4YHGA 2F2HA 3VCCA 4Z42C 1QNRA 1EJRC 5IM51 4KEMA 3C2FA 1XIFA 4B5WA 5D09A 3RN6A 2E68A 4EACA 4A2SA 2A6LA 2Z26A 4LUYA 1PWLA 2BVYA 3P93A 4E8DA 3KAOA 1FKIA 2ZZ2A 1PAMA 4DZ2A 1WBJA 1IEWA 3OVPA 3ANYA 5CEWA 1XD1A 4CNUA 1TWZA 1UMYA 4GQ0A 4O54A 2OX4A 2PTYA 3CB8A 3PF3A 3VMNA 3ZMRA 1H61A 1FWCC 3GDMA 2QDGA 4R7OA 1AA1B 1A5UA 4CD8A 1HN1A 5A6SA 3G3MA 2XP5A 4ATLA 5DMLA 5GPGA 2ESCA 4W7VA 4QE1A 4C65A 1V6VA 3FVDA 2Y89A 3DXIA 4ZPTR 4B5XA 3THCA 2YL5A 3KP0A 2QCLA 4J3WA 2OWXA 3HJZA 3S1UA 1R86A 4L4PA 4L1WA 4AIOA 3ITXA 4LB4A 2G3IA 3V36A 5BU9A 4UZSA 2P4VA 1VKFA 4S3CA 5F2LA 4Z0SA 4PMQA 3CUGA 3RLHA 2R14A 1DJIA 2DV0A 3VUSA 3LI1A 3S8HA 1KW1A 1IQ8A 3A64A 1SQ7A 2GZXA 3OLIA 1XGDA 3KBMA 5DF0A 4N2YA 1XP3A 2ZICA 1RJRA 2PDYA 4WOZA 1HJWA 1WAUA 4N9EA 1SW0A 2OODA 3LBCA 4FIRA 2I7GA 3GX9A 2UY5A 2CXGA 1YPIA 3SSZA 3E74A 1WUEA 4WY0F 1AODA 3P6LA 3F1QA 3DYPA 1AH0A 2ZWZA 3M0XA 3BCJA 4TVUA 3RFAA 3PBVA 4H19A 4AD4A 1V3IA 2YCLB 3M0VA 2NQZA 4MSSA 3OW1A 4XUYA 4R9OA 5HUPA 1J12A 5AB3A 1PXGA 3GDRA 5D8ZA 5HMDA 1NDYA 1OD8A 3KTSA 1SFJA 5E0KA 2BB0A 4XKYB 1BTCA 4N02A 4W86A 3RLUA 3WQ5A 3M5ZA 3WDRA 1E6ZA 4AWEA 4UNKA 1HTIA 1NWRA 4J3TA 3UJSA 5C9RA 4HNOA 4OU1A 4E8GA 4DRPA 1K3UA 1G69A 3IK2A 3SR7A 4PUMA 2VHLA 1XC6A 1FDYA 5IFTA 5CCZA 3CYJA 1R3VA 2A0NA 2GJXA 2DZAA 2PWUA 3SW6A 2CBUA 1FKSA 4N9DA 2WMHA 2FVMA 2WLYA 5A95A 3KZSA 3EPOA 1KFJA 1TYGA 3AALA 4FOUA 2VELA 1C3FA 3TJXA 3DDMA 3R4IA 4ALDA 3GHSA 5D9PA 4GJJA 1F2JA 1E4NA 4IJRA 4JIHA 2O0TA 4M81A 4AWUA 3PA7A 2TPSA 5FEPA 1LORA 3TH6A 1V6UA 2H9AA 2AMXA 1JQVA 3II1A 2QDDA 5K9CA 1RD6A 1KC7A 4JTDA 3CEUA 2YDQA 3AHXA 4AG0A 4EPEC 3BQ6A 4Q8TA 3KCEA 2WAGA 4J9JA 3GK0A 4MHBA 1JVNA 1OVDA 4UTTA 2QCCA 3EB4A 4J7RA 3H7VA 4IZGA 1PKYA 2D0FA 3D0CA 2OZTA 2ZKMX 2WW5A 1BL4A 2YL8A 4NYYA 1H2JA 4DT4A 4QFUA 1FFRA 1ISVA 5FF2A 3ZR5A 4IIFA 4YL2A 4TMCA 1A7XA 3AHTA 2ZZ7A 2XPBA 4Z2JA 2ZRUA 3UXAA 4CNPA 4ZA0A 2QMJA 2DVTA 4BY3A 4A4AA 2CZFA 1XF0A 3L2IA 2VVSA 3C86A 5H8PA 2HNEA 1IEQA 5AC5A 1XINA 1DJWA 3M43A 1M41A 1BVNP 3DX5A 2E09A 4ZPVR 3LN3A 3RR4A 3UGRA 1DWFM 1OFPA 2XSBA 3Q37A 1BXBA 3GXPA 4MKSA 1KXHA 2G3MA 4ZVJA 2GJNA 3UY7A 3OIXA 1TA3B 2J7FA 1V3MA 1NIUA 3B0UX 4ZB5A 4KEZA 1U1UA 2DUXA 1XLLA 4TVCA 4PA8A 3CAVA 3C2VA 5LHEA 2RDWA 3VVGA 3UXKA 4ZENA 4RDYA 3N34A 1E4MM 2WBKA 3NPWA 1Y8BA 4H01A 4EP8C 5CPNA 1K7XA 3NDZA 1E6XM 5DITA 3EWUA 3HG5A 1HF6A 2WC4A 3IIZA 3KL5A 4WD0A 3VFLA 4AISA 1RVKA 4DWSD 1TFVA 1V51A 2WVUA 4O12A 3S4TA 3B06A 2YXOA 3NZQA 3NQDA 4P7OA 1J0IA 5CXPA 4IXXA 3RU6A 5A2CA 2RAGA 3MI2A 4C1NA 3NAVA 2J25A 1W5MA 2PA6A 2QJMA 2ZA2A 1EOKA 4I7VA 3PUGA 3WDJA 1HL8A 2NSXA 3LGEA 3VKAA 2PTWA 4EWJA 4JKMA 4BHYA 4A3HA 2AAMA 3NZ1A 1ADDA 2ETNA 4U85A 4H8UA 4Q8PA 3PZVA 1JNDA 3URNA 3AISA 2ISWA 3TXVA 3Q58A 3VGBA 4ROQA 4JNMA 5CC5A 4KGLA 4YVXA 3TA9A 4A3YA 5EA9A 4S3AA 2I9UA 4QTGA 5BXRA 2GQ8A 4XAGA 3GB6A 3ZJ6A 3RLVA 3MDYB 4NAFB 5AYIA 3EEZA 1XLFA 1C7SA 4XZ9A 4J35A 4MZYA 4WCJA 5FL0A 3AHVA 1VPXA 1NH6A 2XVPA 1XPGA 3NGJA 2A7RA 5C2CA 3KADA 1ISXA 1NAL1 3WLOA 4MTVA 1UWRA 3PUDA 2WM0A 1RPKA 3S5OA 2G41A 2PCEA 1XYZA 1ZGDA 4IL2A 1JI2A 1XH0A 3WLMA 3VOIA 3VD3A 2VUNA 1Q6OA 2C7FA 4R88A 3BOXA 4O52A 2BXVA 4DF2A 1KBJA 4PSRA 4H6KA 3VKKA 2Q02A 3VA8A 2ZDRA 1YXCA 2BX7A 3ABOA 4JAWA 4NZ3A 5K4ZA 1UUMA 3ARTA 4IGHA 1GT8A 1FH9A 1CXIA 4KF1A 3VKBA 3ITGA 4K36A 4EIVA 3OVRA 4ADSA 3W81A 2DG3A 3QV7A 1XD0A 1QI0A 3WD1A 5CPQA 4OWGA 4DXVA 5XIMA 1AL7A 4WSKA 3VNIA 3BW3A 1TZ9A 4EX4A 1BSIA 3W7PA 3KVJA 3WNLA 7XIMA 2I57A 2V30A 1D6OA 2XH2A 2D2HA 3FAWA 1UKPA 1TPFA 2PLMA 1H5VA 1TWDA 2BG5A 1TPEA 1JNTA 1HGWA 2H3DA 3P3BA 3DN5A 4M3PA 4XUGA 4IPPA 3W7QA 1UWSA 4B4FA 3PRBA 5LXEA 1F6YA 4GVGA 2PRLA 2QJHA 4E2VA 1EOMA 4NAEA 2CETA 1RBOB 4J3VA 3NZPA 1WOAA 3MHFA 4GCXA 4CQAA 5D2XA 1WE5A 3P7YA 4HNTA 1BKFA 3NPXA 4HA3A 1Q6DA 3P74A 3M6DA 3H6OA 1HKWA 4GXWA 2PU0A 3RLGA 1GNXA 3EA1A 4HHHA 4CU7A 2HS6A 5I7GA 4OV9A 4XK2A 3PWGA 4S39A 3TKFA 1TTQA 3WBEA 4FXSA 4PMOA 1HVQA 1FDZA 1RP9A 3ZT6A 2QPUA 1N82A 4KMQA 2KZHA 4IGMA 1KGXA 4Y96A 5GNZA 3COTA 4ZTYA 2PP0A 5KZEA 2WMKA 4ZEPA 4MKNA 3POCA 2DJLA 2V3FA 3M0HA 1V08A 3RJYA 2ISSA 4NJJA 3BQ5A 1IX5A 4GFSA 3ZM8A 4QJ4B 2VEPA 3IJ6A 1QNQA 5JXQA 1XBZA 1ZK6A 2FTWA 4JX5A 2XM2A 5ENLA 4ML4A 1X6NA 4N7QA 1LCOA 8CGTA 5FSDC 3JU2A 4YCPA 6TIMA 2GLKA 1G4SA 3LLXA 2BFGA 3O1NA 3CBWA 3JUGA 2X0YA 2F9RA 1AMYA 2PE4A 1TR9A 3UR2A 1PTGA 3HV9A 4EPDC 4GA8A 4Z0JA 1B5TA 4B2DA 2H8XA 2FZ8A 3MQTA 5IBXC 5SWUA 4XVDA 5CZTA 3MVIA 1JI1A 5HMEA 3RO6A 3UWUA 1W3LA 2WCAA 3M9YA 5GJNA 3LGGA 2XWEA 1QPKA 3AMKA 4QLLA 1YTEA 4N4PA 1UD6A 1MUWA 2G37A 4NZFA 2P3EA 4POCA 3GYCA 3RMJA 2HSAA 1L6WA 3AICA 4QT2A 3QPZA 1YEYA 3SAZA 2NZLA 1J4EA 4CU6A 2VFIA 3VZZA 3OBKA 4ECLA 1YPXA 1W5OA 1U22A 2E1DA 1K8YA 3JR2A 4JEJA 3SBFA 5D2TA 4ZSUA 3AROA 4IOTA 3Q45A 1FD9A 1ME7A 5CBIA 1KBIA 1E6QM 3OG2A 2FZMA 3W7NA 2ASHA 3W01A 1SPQA 1FWFC 3SCOA 3W25A 3DHFA 3CHFA 3QPYA 2BHYA 1VLIA 3DCPA 5MKGB 3MJYA 3KTXA 1VFLA 3N2OA 3PUEA 4L3NA 1XL9A 2Z2AA 1NWUA 5BOOA 1O1ZA 2C3ZA 1UZ4A 4G1NA 3PR9A 1EEXA 5HQLA 4ZQNA 1D8CA 2GDQA 3EPMA 3QN3A 1X1ZA 4JTCA 4JIRA 1MZHA 4CCDA 4QLJA 3PPHA 4HN8A 3T08A 3EDDA 3KCLA 2J9XA 1A0DA 2E28A 4XV0A 2QT3A 3TROA 1J5SA 1A50A 2A21A 3B0VC 3KWXA 3L4YA 4IJBA 1H41A 3IRSA 3W0KA 2ALDA 2I5GA 4A8LA 1UBPC 2CZEA 1SZRA 3SQSA 1Z44A 5C54A 2YW3A 2AWGA 4GQGA 4JFSA 1AH3A 3A4WA 4ROPA 3LV5A 2Z1BA 3AIUA 1SYTA 3ISIX 3R1ZA 3QGKC 3STEA 2NQHA 3VOFA 1SJAA 1AD4A 2FMOA 1JZ3A 1V0KA 3PVFA 2QUMA 4JEQA 1HX0A 4AQLA 4GGQA 5F4XA 3W86A 2X41A 4H8VA 4V28A 1M9HA 1HG3A 4JTUA 4GNJA 2CLOA 3UG3A 1W1PA 4UNIA 2F8QA 1CGWA 1OT1A 4GVFA 4N4QA 1KM5A 1XI3A 4UOJA 5DIUA 1TREA 3TSBA 1P43A 4OIFA 3CMFA 1RXOB 1Q6CA 3CB3A 4HU4A 2VEIA 1R3WA 4LSBA 4AZ5A 1WX0A 4KIEA 3WLKX 1AQFA 1OFRA 1JFXA 1YNYA 1PJ9A 4MB4A 4CEUC 3CPRA 3W02A 3G1RA 4EWND 4JIIX 2RHGA 1XQLA 3CUHA 4P61A 1QT1A 3WF2A 4TW8A 1ZRQA 1GORA 3T2OA 2FZNA 3T4CA 1Y5WA 3UFYA 3AMDA 1TJRA 3KE0A 4MGVA 2Y8VA 3MO7A 4DAIA 4PMZA 2Z25A 4KKXA 2PDNA 3NUKA 3EWZA 3PB0A 4C60A 3GYEA 1UD2A 3G1SA 1FBAA 3AIRA 4H9UA 1KCXA 4UMBA 3NCOA 1OBAA 1J79A 4FX7A 1S2WA 4P2VA 4JFKA 2VT0A 4LRTA 5EPDA 2PDIA 2D3LA 5DT5A 4ZO9A 3TDFA 5TIMA 4GUGA 3SN1A 1VLWA 7A3HA 2WV8A 1JRBA 3H2AA 3WFAA 1CI1A 3AXXA 3LQLA 4PL2A 2PF0A 4GI9A 3MUIA 4KETA 4DELA 3AHYA 1N55A 1REQA 4FZIA 3KABA 4CCCA 5E1QA 3RM8A 3BW2A 2Y5EA 1TV8A 2F84A 4U3AA 4UFHA 2C1GA 2VC6A 1QI4A 2PGWA 4TXEA 5I03A 2PDGA 2ZE3A 5G1YA 1T7LA 3CMGA 3G1YA 3M5VA 4BEUA 4I9AA 4ATWA 1PKNA 3ATZA 1K9FA 4GO8A 3NOYA 2DZUA 2P0OA 3VYLA 1RK6A 3GDLA 1QBAA 3AUJA 4K7YA 1XLGA 1O4UA 3ZVIA 5I06A 3TQPA 1LP6A 4UMCA 1MW1A 2QQ6A 2NT1A 3M6YA 1VFMA 5ABFB 1MXGA 2IXVA 3WJYA 5I09A 4O28A 1PINA 2PFHA 3QTGA 1DL3A 1Z8AA 3E96A 4DYKA 4XWUA 3A12A 4FNSA 3QKEA 2EQDA 4KQNA 1DV7A 1CEOA 1K6AA 3KS5A 3TJLA 2QCDA 4HSNA 1E1EA 4H6RA 2JFEX 3MUY1 5JMUA 1G6CA 2OOFA 3PZ9A 4H2HA 5CZJA 1W3KA 2QCFA 1AK5A 4S3GA 3TX9A 1TPDA 4O53A 3WEOA 3NEVA 1DWIM 4LAVA 1E1FA 3WH6A 2ZXQA 4ICCX 2O92A 2G4FA 1ICPA 4FLQA 3TZNA 4Y8EA 5CH9A 1ITQA 2E25A 4QM1A 2EXOA 4Q22A 4BZYA 3EA3A 3WQCA 1GVRA 3W38A 5I77A 1JCMP 4IQ2A 3AMLA 1JCLA 3QHOA 1UD8A 3W75A 4MLRA 4G1KA 5EFFA 1MZRA 1I2OA 2HZGA 1JUBA 4IISA 4RE4A 4TX6A 4UTWA 3TQVA 4FI4A 4JTQA 1E3XA 2CLIA 4H41A 2OT0A 2ZUUA 3VK5A 3AIVA 4XKMA 1JVWA 1NARA 5FF0A 1LBLA 1J96A 3Q67A 4MY8A 3WF0A 2QULA 3O15A 2QLYA 4QISA 3QZ6A 4BS0A 5AC6A 4M8UA 2EEXA 1F74A 1DQUA 3S2MA 1B4EA 3SUWA 4HBEA 4DEFA 2VENA 4Q33A 3IGUA 2J7CA 2B4GA 3WQWA 5K9XA 1UR0A 4NVTA 4ITZA 1F73A 1UC5A 3BCDA 3GVRA 4FR1A 1NWSA 1KRCC 1WDPA 1WP6A 5C0QA 4QCFA 5FCZA 1XLJA 3HB9A 5JH1A 3WBAA 1UROA 4AZCB 1SR9A 2OELA 4HA1A 4QBXA 1EJUC 2Z6IA 1WB0A 4LCSA 1NDZA 4JN6A 4PTDA 3TC7A 3CU2A 3R12A 1EIXA 1XLAA 1PS9A 4DY1A 4M80A 2Y7FA 2WSKA 2V38A 3WCZA 3LOTA 7REQA 3TYAA 1C90A 5D2WA 4JOMA 3M44A 4GHRA 4E4FA 1V0LA 5FEWA 1XLMA 4GVIA 2FDMA 4D2JA 4ONVA 3Q94A 1L1PA 4WJ8A 3N4EA 1VYPX 4GLEA 4H6QA 1TE1A 1CXHA 1YNPA 3F4DA 3OQ8A 4UBPC 3MWCA 1A47A 7TIMA 4IGNA 3QMTA 4ZB0A 1HGYA 1ITCA 5KMYA 3SQLA 2MPHA 4FNRA 1B30A 3U2EA 2PDMA 1QUMA 3C6CA 2PRHA 2AAAA 3BSMA 1MYRA 4FNTA 5CQ1A 3TSDA 2WJZA 2WWCA 3KZPA 3C0JA 3CS2A 5I3HA 1G4PA 2DT2A 1PKMA 4DJED 3OJGA 3TIMA 3GBDA 4I8YA 4ZE4A 3VE7A 3CPUA 3VOCA 3O8AA 2NV2A 4NZJA 2LGOA 1DIEA 3ERPA 4GE8A 4LNYA 3DFQA 4Q6JA 3XINA 1GZGA 3BLFA 3FY1A 4RLIA 3VMOA 4NHVA 3OBAA 4E2OA 4MWAD 1NF7A 4IMAA 1GYLA 1LQ2A 3EPNA 3W83A 1Y65A 1OK4A 5HW6A 1V6YA 1UR8A 3ONBA 1S2TA 4BWLA 4TR9A 2ZZ5A 3LU2A 5AC7A 3R8RA 1ZCNA 3QYSA 5F1UA 5D32A 3BZGA 1W26A 4JICA 4WXZA 1FWSA 2OKOA 3DZ1A 3O06A 2EGZA 1YMYA 1QW7A 3CIXA 3KAGA 8TIMA 4AIUA 4JTLA 1DWHM 3U0HA 3B8UA 4ENLA 3KAFA 1W1IE 1B3XA 3QV6A 1XRFA 1XIIA 3V0UA 4NJHA 4FF7A 1L6SA 1WQ5A 4RNFA 1THFD 1CXKA 1V3JA 1UWQA 3OQEA 3NO1A 3PFMA 3LZ5A 5BMXA 3VNZA 3WLSA 1ISWA 4YTRA 4H83A 3O5PA 4HK5A 5IBXA 4S3DA 1JL8A 2F61A 4CKQA 3VIJA 1RBLA 4P7NA 1H4PA 1JXJA 2VGFA 1FKKA 2OQLA 3KZ7A 3GY1A 3EB3A 3N2BA 4TX0A 1DWGM 2Z27A 3GTYX 2CC0A 1E72M 2ZUMA 2VZOA 2W5FA 5HNNA 2WVVA 3GPKA 3APYA 5E0FA 3PZUA 1OX5A 4MUZA 3A5FA 1A0CA 4WQ6A 4AYSA 2Q71A 2W27A 1A3HA 2R24A 2RGLA 3I7QA 2JALA 2VZSA 4XIMA 4AHOA 3G8EA 3GW3A 3G1XA 5CPMA 5HTGA 1LOQA 4LAZA 1A5OC 2Z00A 2PS2A 4GQQA 1MRQA 3AO0A 3S1VA 4XVEA 1WYIA 3B8WA 2XINA 3QOKA 3G1DA 1ZCOA 4M1BA 1AW5A 4LBSA 1FP8A 3HZ3A 2O9PA 4O18A 3QC3A 3A4AA 5HMFA 4JHZA 1GVIA 1MXSA 1LLOA 5LA2A 1KCKA 4HSOA 1EBGA 3NDOA 3CEPA 1KRMA 1QJWA 1KM2A 1XDLA 2PURA 4KWSA 3ITLA 4PEEA 1UWTA 3GTHA 4WUIA 4WZHA 3UBPC 3IRDA 1MFUA 5DIVA 5D30A 4C7DA 3E3HA 2ZQTA 1FX6A 2OLHA 2P1FA 4HVXA 2FHFA 1KKOA 1H5YA 3B97A 1MI3A 4YXGA 1XR2A 3QMRA 1BWKA 2HVOA 3VKDA 2Z1VA 5C9WA 4UR8A 1XLHA 3WD2A 2G3JA 3ZO9A 3N14A 1EZWA 5HWBA 5DBUA 2B0MA 1CECA 2DUAA 1WKDA 5CKSA 3E6EA 3KL0A 3WFLA 3YPIA 3AXKA 2WK2A 1YYAA 3VFCA 4EF8A 3FDKA 4GZEA 3VC6A 5CLWA 2EO7A 1R5YA 1EWEA 2I16A 3SCSA 1W9VA 4JYEA 1JUEA 4DF1A 2AGTA 4ZE5A 2G5WA 2QCHA 4LS2A 5HQEA 1GZJA 3LX9A 5I2UA 1E0WA 5D04C 4HTBA 2RJGA 2ZR4A 1F4AA 4JIEA 4LU0A 1XH1A 3FSTA 4GINA 1Q45A 1FKBA 3WUEA 2PI6A 4D72A 5LNUA 3MWAA 1DHKA 2B7NA 2X40A 2I1OA 1P7TB 1W91A 3BAXA 2OEMA 2ALRA 3QGVA 1D7IA 1YKWA 3B9NA 3OEXA 2QGHA 2A3HA 1A3XA 2VVNA 2WYSA 2OOGA 2J9ZA 1UJQA 1S2UA 2XM1A 2WWDA 1P48A 1PIIA 4YHEA 4S3BA 1R85A 4EXAA 2GFTA 4H1ZA 5HINA 1UOZA 4REQA 5LA0A 3OPSA 1ZBCA 3OOBA 4XO7A 5HATA 1N8FA 4Q7IA 4DLFA 5I07A 5B80A 2XGZA 4FIQA 1PUDA 1G0CA 1RBAA 3F4NA 5DN1A 4FNQA 3MMDA 4ZPWR 2YA2A 2XP7A 3NXFA 4V33A 2QDEA 3WFZA 1B90A 1XSJA 3ARWA 3E9AA 1V4YA 2ZZ1A 3BE7A 4WSHA 4C5ZA 4AD3A 2ZWYA 3QYQA 2YDAA 1ESWA 2R82A 3FAXA 3ZLGA 4FMVA 5RUBA 2DT0A 3CJPA 3KX6A 4IFKA 3LPFA 4IMEA 1W54A 2NVDA 4A3UA 1PZ2A 4ZXOA 2I56A 3WDIA 1ME9A 3BOFA 3K4DA 4PULA 5K9DA 5K2ZA 4MSPA 4TO8A 1EKOA 3HG4A 4RXGA 3L4WA 1LRQA 1J4HA 2C13A 1B3ZA 1L2UA 5BROA 4NUWA 3ID7A 1EDQA 4U3CA 1EC8A 1BHGA 1XM3A 1UQZA 2AQOA 5E5CA 1QPRA 2YKKA 4ASTA 1XIJA 1JZ6A 4B5VA 2F21A 5C9UA 3AZSA 1AJ0A 5E6ZA 2TAAA 5DBTA 4Z2HA 1RY0A 1EH9A 2CBIA 3A3WA 1M7JA 5A6KA 1LRNA 1NQ6A 3VDGA 1E56A 1UKQA 3JS3A 2DIEA 1TVNA 2FZDA 3LNMA 4GY0A 2OPJA 3SGZA 3IJDA 4X0VA 3W6LA 1HIZA 3UERA 3E0FA 5FAJA 1ROUA 4Q4KA 3DHUA 1UA7A 3OTRA 3V5OA 4Z2IA 3N6QA 4I5UA 4IWWA 5I02A 2E9MA 3AIBA 3AJXA 1BKSA 4BI5A 1ITXA 4O17A 3SIMA 2A1YA 5DQPA 4LBRA 1KKRA 1B6CA 4HPNA 3W23A 2E67A 4HNCA 4Z1YA 4D1JA 4M82A 4Z17A 3OLGA 4GQBA 4CVWA 3IJQA 3VOGA 4ZOCA 3UZXA 1H50A 1FKTA 2DP3A 3REQA 4QLKA 2WLZA 4KFOA 3CIWA 4O19A 2YCEA 5JUVA 4M6PA 1QK2A 4HTYA 1SZNA 3OHIA 1OWQA 2R1LA 3O6DA 4V1YA 1CGXA 3U2OA 2YX0A 4EKJA 1UOKA 1WZAA 2WNNA 2PWVA 2J7EA 4IIHA 1PIFA 2YPIA 3ALFA 3MSYA 1EA9C 2V9DA 5AVHA 3CGMA 1N2VA 5I0DA 1K4HA 3FKRA 4Y2WA 2YDSA 1FWGC 1XIBA 2E6YA 2EG6A 2QF7A 3RMEA 4Q8MA 3UY8A 3N3TA 5HWJA 4K37A 1QPQA 4QG8A 4S1FA 1I6NA 3BJSA 3NQCA 4CD5A 1E9LA 3APGA 4J1OA 1FKJA 3R8HA 4C6MA 2AMGA 1FKGA 3S1XA 2WMJA 4UOZA 4CQBA 2F4EA 1TWWA 3MCNA 3N15A 4EK7A 1W5NA 2JGQA 2QPXA 1BG4A 4ERIA 4Z2KA 3L0GA 4W8LA 4MOZA 4WDTA 4DXKA 5IDIA 2PODA 3NWRA 1XYFA 1WXZA 2INEA 3BAJA 1W17A 5EYWA 3BTNA 2OYKA 1GKQA 3GHUA 2XGIA 3LPOA 4G56A 2MANA 4WJXA 5DCEA 1KM1A 1ADSA 4H8HA 3BZJA 4XSMA 2QUUA 4FP1A 2GQ9A 4W9PA 1K8CA 4Y9OA 3PNZA 4JR5A 3WYZA 1GG1A 1HNYA 1Z3NA 2GUUA 3ENLA 1FHVA 3L5LA 2V82A 1FH8A 1TV7A 4AY8A 3OLDA 1Y0OA 1HVXA 3W82A 2ZRYA 3NZRA 3V1HA 3AYRA 4PODA 4LVBA 1ZL1A 3R0DA 3S5YA 2DQXA 2VWTA 2J24A 3N2TA 4PFHA 1D8WA 4QRNA 4X61A 4F48A 3KUMA 4FLRA 3S5ZA 4U2YA 3BAWA 3T81A 1FKLA 2Y7DA 2OJPA 2EF9A 5AHIA 1V03A 2BOEX 2NV1A 3CC1A 1GHSA 1AQ0A 1AJZA 1IIHA 4HBOA 3AHZA 1R2TA 2KE0A 1RJPA 2R91A 2ZQVA 3AFBA 3T0AA 3WK0A 1EC9A 5ABTA 3UW6A 4JDBA 3O63A 3I4EA 1T8XA 1TQXA 1R9HA 5DO8A 1RA0A 4DWSC 4G5DA 1KR0A 4KR0B 1YBQA 4LRSA 5DCDA 4DBUA 3UVIA 1XGEA 4PTNA 4EAYA 3R58A 2P10A 1RQEA 1TIWA 2P0IA 3KBSA 1IXQA 2Y2WA 5L6UA 4GBUA 2X42A 3GTFA 3IVUA 2VJXA 1VFOA 2Q01A 5XIAA 3U6WA 2J88A 4U4MA 2OZ0A 1WZLA 3K1DA 2ZX9A 1ECQA 1TRIA 4G2DA 3CT7A 1MEIA 3CQ0A 4NT0A 4R9XA 1VIZA 4ZQRA 3B7XA 4RKAA 1C9WA 3U8GA 5FKYA 1YATA 4LUTB 2IKJA 4QEHA 4XTIA 3UCQA 4KBXA 1UWAA 2DGAA 2WPGA 3EX4A 4DPQA 4LAKA 4PE8A 2NWSA 2JKEA 3D47A 4B5NA 1M7XA 3ZJ7A 4HMCA 3SRKA 2X05A 4U33A 4ICNA 1FHUA 1C8QA 3UWVA 1S1RA 5FESA 1QPLA 1H7XA 3LNPA 4OBTA 1PO9A 3NTYA 2ADAA 1O7AA 3QXBA 3HJEA 4AX7A 4L56A 2PV2A 4YYCA 1DJZA 1NMVA 3RUBL 3UNTA 2B81A 2A85A 2CITA 3VD5A 1ZB5A 9XIAA 5HPOA 3TJIA 4XB3A 1POKA 1F5ZA 4I9TA 4L9YA 1A5SA 3FYYA 4IMFA 1MWOA 1VBUA 4PRRA 1C93A 3H22A 4WGXA 2IUZA 1US0A 5HXMA 1Y0EA 3RCYA 3O5DA 3BSHA 1IZCA 3QW4B 1V6XA 4RL3A 2V68A 3N6HA 1XIEA 3UI5A 4BQ4A 2LKNA 3PPGA 3EBVA 4PUDA 1IR2A 3R94A 4C5YA 1UWIA 3USBA 5HKGA 5U7SA 4FLSA 4JKKA 1H1NA 3RDKA 1AQMA 1IWAA 5HNRA 6ENLA 3QR3A 4O16A 2QCNA 5A8GA 4JY8A 3O6YX 4TX9A 1QHOA 3GKAA 3HN3A 1OCBA 4EPKA 4IPJA 3PRAA 2BVDA 4GZIA 1I0BA 5TF0A 3WBXA 3GO2A 4HNLA 1OADA 2I5QA 3K2GA 4EOUA 1VAHA 3UJRA 1PZ1A 2DZPA 1XX1A 2JIEA 3WD0A 4HYRA 5BXJA 3N25A 1QNPA 3B9DA 3N29A 1SO5A 4AYGA 4D71A 1F05A 3G1HA 3O6AA 3TNBA 1KXTA 2QNEA 3T44A 4DO6A 2FTYA 1KLYA 1H1ZA 3S6TA 2TSYA 1TPWA 3LB0A 4FNUA 1G7UA 2PWHA 3S9IA 3AS1A 3O5QA 5IXEA 1XBVA 2BY0A 3AWNA 2PGEA 4LC6A 3A21A 2Q3OA 1VYSX 2PPNA 2VEFA 2GK1B 3PM6A 1C8YA 3NNTA 1FWAC 3MZ2A 4NNRA 3D6NA 4JFJA 2EBNA 1X7FA 3MPGA 2UWFA 4ODRA 4NJKA 3P0XA 4JCLA 3NTPA 3GNRA 4P7LA 1V02A 3L4XA 1PPIA 4YJ5A 1Q7ZA 3RILA 2CZDA 3QZEA 4YLWA 2OGJA 4B15A 2G97A 3S3GA 2ZZ6A 3KVKA 3I7SA 4MYAA 5ECVA 1EL3A 3HPZA 1F76A 4PH6A 2ZZ4A 1XBXA 2W67A 1UASA 3D3AA 5JIPA 1I0DA 3LV6A 2IMRA 4YTTA 3H53A 1T0OA 3AYSA 1LUCB 2EJ1A 2C1HA 3SURA 2POZA 3TWAA 3DAQA 3OZOA 2HROA 2BGNE 4FXRA 2POTA 1XDJA 5KEZA 3VNDA 1TTPA 4H04A 4WY0B 3H12A 1V02E 3AU2A 3LENA 1F40A 2RUDA 3WEZA 2QIIA 1J10A 4HB7A 3UYCA 1AUSL 3CAKA 1OX6A 1WZMA 1W2PA 3ZJKA 4YPJA 1KTCA 1K4GA 4W9QA 2AL2A 1YXYA 1FCQA 3TFXA 1OFAA 4GG9A 4DWSB 4Z08A 4PFMA 3NQ6A 1XYAA 5REQA 3WLPA 1OHLA 1US2A 3NIYA 3ORWA 3P80A 2WZEA 1FKRA 1E0VA 3W1LA 5FI8A 1LWJA 2A3AA 4PZVA 1ZPTA 1GOWA 2JKPA 1N7KA 2VC5A 2IKHA 1R3YA 4XSLA 2VURA 4IQJA 4E3TA 3KW3A 4BK9A 4LNCA 1FJDA 3WUGA 3C0SA 3CT2A 2Z0IA 4HYWA 2CWNA 4LUSA 2E9BA 2GOKA 2Q5AA 2NVAA 4O15A 2VRKA 4DRJA 4QITA 1W2VA 4EPBC 4DI8A 4PUUA 4YYFA 4EAMA 3TLQA 4NZ1A 4H9VA 4B5SA 1HKJA 2YZRA 2OB3A 2XPKA 1KWGA 3R0KA 2WSYA 3OLEA 4GD0A 1NWTA 3GVGA 1NMWA 3TK7A 4Q4PA 2WHLA 2REQB 2DSZA 1LQAA 4O0KA 2J7HA 2JF6A 1F3TA 2XN2A 3GZ3A 3E5PA 3WMCA 3M0JA 4O11A 5G2IA 3UJ2A 5IRPA 2EG8A 4PUEA 2LLEA 4O57A 4L65A 3SUTA 4GH3A 4M5PA 1DP0A 3QVQA 1C8XA 3C4UA 1GKRA 3EY6A 4DJFA 1KLZA 1D7KA 4LY8A 4FXJA 1E9YB 1GRJA 1LL4A 4PCNA 1OCQA 5FOOA 3E2SA 2JBMA 1J2BA 1ALDA 4LX4A 4WGHA 3BV4A 3QZAA 4NKCA 1DE5A 2KFWA 1ZJHA 3TP4A 4W87A 1GOKA 3W2KA 4AF0B 1XLCA 2KI3A 4QSFA 4D6JA 1DKWA 3HFTA 3H54A 3LM7A 1OGBA 3PBGA 1UKSA 3H7UA 1VQTA 3BMXA 1VFSA 4L6OA 3URQA 3ARSA 5B7ZA 3W1XA 1CXLA 3WZ0E 4B4HA 4H9XA 5LNVA 4DF0A 3N2MA 1FY6A 2Y63A 5CC6A 1XLDA 3IVTA 1PBGA 4H4IA 2QCGA 2RDUA 3W87A 1QU4A 2QR6A 1O5RA 3KTCA 2XYLA 3L5AA 4DZIA 1DYSA 2CHRA 3MHUA 4A8NA 3CGTA 5CAKA 3TR2A 4LVGA 1V0MA 1LG1A 3LXAA 2OMAA 2JK2A 1IXNA 1XSKA 1UPMB 3UETA 2O9TA 3AIQA 2CKSA 2CHNA 3VAWA 2Z1KA 2A3LA 6REQB 2ZX6A 1T40A 1TX0A 4IMDA 2GVLA 3UESA 5EU9A 1JDCA 2OSWA 1IZKA 1S3TC 2BLEA 1KM6A 1H7PA 4JZ5A 4DVOA 3ZR6A 5J6EA 4IPIA 1ICQA 2V67A 2WJFA 3NQ2A 3U5YA 1WAWA 1CXFA 3V16A 4J4NA 1TR1A 3WSUA 1I1WA 1M5YA 1DJQA 1B54A 4PCPA 4BEQA 4MVAA 5H2ZA 3BLOA 4YWSA 3SZ8A 2HWGA 1EHAA 3WEMA 4DLMA 3B8VA 4PB3A 4BQ2A 3WJWA 3R7MA 5C5YA 4GYKA 3GXMA 2DU2A 3W6MA 4UC5A 2YYTA 1SU5A 1OG6A 1VENA 1SFLA 1P5QA 4D6GA 1XG4A 2XPAA 1K9EA 1PBKA 1DJHA 3TYZA 5MF5A 3N1AA 1FWBC 4JTKA 1TPVA 2DZTA 4P7QA 2VR5A 1DQXA 4GVHA 2ODOA 4XD6A 3WY1A 1QCWA 1WKFA 1MSSA 3B9OA 1CGTA 1O5KA 3LY0A 4CN1A 1OY0A 4HOXA 4D8ZA 3S2CA 3G0UA 4UWMA 1UP3A 4Q8NA 1JF5A 3C5QA 2ZTKA 4ZODA 4B90A 3MSDA 3WX7A 5MHBA 5LA1A 5EBAA 5DX7A 3RO8A 5FA5A 4NJGA 5D2YA 5K3VA 1DHPA 4XQ6A 5DRIA 4NY2A 1PCWA 5DELA 3NQFA 3G2GA 5IHSA 3JXVA 1GTEA 1JDEA 2F6XA 2FGZA 3EMZA 1R3QA 1D7JA 3S47A 4LH8A 3L4VA 1DOSA 1QO5A 1GOOA 4OKDA 4FSAA 1WPCA 2E4TA 1RP8A 3UI4A 1EPVA 3TUUA 1BKHA 3PJTA 4EANA 2X1RA 2DSVA 1P5BA 5AHNA 2EHHA 4HNUA 5HK4A 3W2JA 5LIKX 3GR7A 1SJBA 1DEDA 1SVDA 2O7SA 4B9ZA 3MI3A 3H2EA 4CQCA 3MZNA 4B2DD 5HAOA 3ZS4A 5FJIA 1I9CB 1AW2A 3AXMA 3W84A 1A5AA 1I60A 1CCWB 2BODX 5AYYA 3V0TA 4F0RA 2JZVA 4XX6A 1MW2A 3NXLA 3MSGA 2G3FA 3BPWA 5G1TA 4AVFA 3PBUA 4MNLA 1EP3A 2M2AA 2BVWA 3KRBA 3NSMA 3GFZA 5I5RA 2LJ4A 4HJFA 3T6CA 3VCRA 3M0MA 3WLJA 3VPLA 4GZ7A 2DORA 4UB9A 3P67A 1W3JA 1IIGA 5PTDA 2D24A 1J8VA 1IV8A 4CNTA 1R2RA 4GACA 3W1PA 3TAKA 3DEQA 4C6IA 4O1EA 2CLPA 3TLLA 4M6UA 1UR1A 4HNVA 1QOXA 1F07A 2GSHA 3CASA 3CK5A 2PDCA 1SZEA 2Y85A 3EOSA 3BVJA 4W7WA 2CESA 4C6DA 3HGJA 1Z6KA 4QEEA 3W3OA 5A1AA 2WQDA 1VPYA 3GXIA 5FJTA 1ZQ5A 5HWNA 5E9XA 3W7OA 2PN0A 4J4OA 2FYMA 3WNOA 2F7FA 4RX0A 1YLVA 3ARXA 4OUIA 1Z41A 3GFYA 3QC0A 2R6OA 2Z2UA 2XN0A 1X97A 3MMTA 3EKZA 2HXUA 2HK0A 3UCCA 3ITYA 3OZPA 1E40A 3F7JA 2AQVA 1E0XA 5BXSA 1TCMA 4GXMA 3KHJA 5LNRA 2DSUA 2J6XA 1MW0A 1QATA 4N42A 3ES8A 3AYTA 2M08A 3GSMA 4K39A 4WDXA 2Y8KA 3MW7A 2OKTA 1M7PA 1AQHA 4UR7A 1VEOA 1R9YA 3T2PA 3WLIA 1CYGA 5HWMA 3W1AA 2NT0A 3HGSA 3IGXA 1W8GA 1W1A1 2Y78A 4ERAA 2A3CA 4DO4A 3OVQA 8A3HA 1FAPA 4DJEC 3F4CA 5FL1A 2FH8A 3S1WA 4I7UA 1GQKA 4ODNA 3VCNA 4WKFA 1H62A 1Y7VA 3RIKA 1BLIA 2Y5SA 3PULA 3EKGA 2ZCGA 3IUIA 5FIPA 5LXXA 2VEKA 4U10A 4ZQMA 4F0SA 1US3A 4MWAC 3RHGA 1OF6A 1RLDA 4S3JA 5A94A 4D6IA 1BG9A 1O1HA 3L23A 2TMDA 4HPHA 3I6RA 4R33A 3LLDA 3WF3A 1LOSA 1EDGA 2UY3A 4ES4A 1E5NA 2E6DA 4I3GA 4AHQA 3MBDA 3QRHA 2PLKA 2V63A 3ZWTA 2X0SA 3ZVHA 4LY4A 3BICA 4MPQA 4DXXA 1UIPA 2Y0FA 1GVFA 2J8TA 3BLEA 3ZIZA 4US5A 2ZQUA 1V6WA 1E1CA 3P62A 5T8GA 5E6YA 1LM1A 3U4FA 3QMSA 4GUFA 1L6GA 2EPKX 2VFGA 3UQBA 3W73A 3ZT7A 4TTGA 1Q6QA 3GG8A 4LV9A 2ZTJA 1U2YA 3DESA 3LI0A 2E3ZA 1G5AA 3BANA 3W53A 5JBEA 1J0ZA 3OGRA 5I3KA 2EKCA 4O1AA 5J5RA 2WJDA 4OBRA 3M0ZA 1E73M 3UD6A 4H9MA 1B0IA 1TCOC 4W4QA 2ABBA 1EF3A 1TELA 3UJFA 2UZ9A 3WH9A 1K70A 2CFFA 3TTQA 2IQ0A 3HIJA 3TTSA 3LSBA 2XH7A 2VR4A 2CW6A 3CQHA 1SW7A 4JTAA 1G67A 2ZZ3A 4GMEA 2XP8A 3MU7A 1BRLB 4GI8A 3L7RA 4DBWA 1EP1A 3GVQA 3QFWA 4R27A 3TCEA 2EAWA 3NO5A 4URIA 1PZ3A 3I6EA 4HMEA 1ECEA 3CUZA 3IIVA 2QYGA 3L67A 3LLFA 1VBGA 3H55A 1GVSA 1TPH1 3FYOA 1KFBA 2XFWA 4O14A 1D7FA 1LJYA 4F2BA 2G8ZA 6CGTA 1VR6A 1XSIA 2XJ7A 4DUVA 4PMNA 3WDPP 4CLMA 7TAAA 1G94A 3KLLA 1HT6A 3CXOA 3WMSA 1OYCA 4PUNA 4AD0A 3T8QA 2FVLA 4CQDA 4BF5A 1FRBA 3WH0A 3WQ8A 1VJZA 1ZUAX 4FAPA 3SM0A 4DRMA 5BU6A 5HNTA 1JCJA 1QFEA 2PC8A 3LHYA 4GGBA 1VRXA 4LAMA 5HJXA 1TVPA 2PD9A 4X9YA 3VGHA 5I78A 1TE6A 3SEPA 4ODOA 3KCOA 5DRCA 4NNBA 4KEVA 4NQ1A 5AN7A 2YGYA 1F9CA 2CBJA 3TC5A 3ZR4A 5BOEA 4Z1AA 4F3HA 4RV8A 2E5CA 3W7DA 3TFCA 7PTDA 1XHGA 4N0RA 4O13A 3FK4A 3NQBA 2QJIA 1OT2A 1VC4A 3IAPA 3H4GA 1HL2A 3PZQA 1C9DA 2NX3A 1WBHA 3RRXA 1V6TA 1J5TA 3SY5A 5GNXA 3H24A 1J0KA 5H6HA 2PAJA 3C2YA 4IIDA 4PCSA 2O4MA 4JHOA 1VEPA 1Z48A 4C7FA 1XS2A 1FHLA 5F2MA 1E9ZB 3NL5A 1RY8A 3CWOX 2ZX8A 4OVXA 5C6MA 4D8LA 4LBUA 1CW2A 4U2ZA 4Q4OA 1LBFA 2O56A 9RUBA 4ZCWA 4JFMA 3A47A 4ILSA 2J6VA 2ACUA 3GDBA 3WK2A 7CGTA 2ZE0A 4IIEA 1KFKA 3VILA 2DVXA 3MMUA 3MS8A 5DEZA 4ZQPA 2CLKA 2WPBA 3GXTA 5AYBA 3MVTA 1MRAA 2F2DA 2EPNA 3QF0A 2QMKA 3ELFA 4M1RA 4S3KA 3U5UA 5BW6A 2XVLA 2YCJA 3D46A 3LQGA 4PB5A 5DY3A 4E5TA 4C6EA 3SN4A 2XFYA 2BTMA 3GUWA 3WLTA 2QKFA 1R3TA 3CUXA 1NFBA 3UR8A 4MWAB 3STCA 1QZ2A 1IZJA 2XH4A 2C15A 3RRAA 1XQKA 1S1PA 1H09A 5CZ0A 3B8TA 3H2NA 1FWTA 3R5EA 1AL8A 1E3ZA 1H11A 2RFGA 2PDJA 3DYOA 1VH7A 3EEGA 2BY3A 5D8WA 1SO3A 3L2MA 4MJZA 2ZQSA 3PZIA 2GUBA 1O95A 2DSKA 2PWDA 4LUSB 3V5CA 4OE7A 4Q7BA 5AHFA 4AXNA 2HDJA 2VDIA 4UCFA 1SSDA 1MDRA 2WSRA 1A5MC 3W2LA 4JL1A 2XP3A 2AGKA 1LL6A 2ZADA 3VDCA 1EXPA 4W8BA 1OFQA 3ABXA 4TVDA 3U48A 2B31A 1TVLA 2YJQA 1VBHA 1NSGA 4KCWA 3TC6A 5T9CE 3DKLA 3UPMA 1MNZA 3T09A 1L8PA 2GWGA 4G7EB 1F6PA 4RV3A 1U5VA 3PS7A 4B91A 3W1UA 3QM3A 2G50A 2C91A 1JZ8A 2J27A 1U1HA 2WMIA 5FAGA 4AD2A 1H0IA 4HK7A 3HPXA 2W62A 1L2QA 1QVBA 2P5NA 2PWGA 2FDSA 4QAWA 4A8RA 1SZFA 1OC6A 1SFSA 2WMFA 4DROA 1W32A 2PWEA 4KFPA 1KXVA 1QI3A 4S2CA 2WCGA 2XP9A 2XIIA 4S23A 2D22A 1Q7QA 4JTHA 5D75A 2A7NA 3KOFA 4L6HA 4QNWA 4ACZB 5M5DA 5LNWA 1NTHA 5GJMA 2NLYA 1IT7A 5G4WA 3DG3A 3PN8A 1LYXA 3WNMA 4GISA 2HNHA 1UPPA 1R38A 2R94A 4MPKA 3OG3A 2TYSA 1V3HA 5A8OA 4Y8FA 4DJDA 3TWBA 1OX4A 2FKEA 1KM4A 1Q63A 1X38A 1D9EA 2FMNA 1UR4A 4N9BA 4RR4A 2HTMA 4GY7A 4MDOA 4LGXA 1LWHA 4X2PA 2Z24A 1P4CA 3PNUA 3W85A 3EWYA 1L9WA 3ZT5A 3BL3A 3O3RA 3I7RA 4E2BA 2V3EA 4GYFA 4UQ9A 2Z29A 3HOJA 4AHPA 1X6UA 3GUGA 5E70A 3WQGA 3CHDA 1H49A 1EGZA 4K2SA 1YE6A 4M6QA 3WJZA 1XRTA 1LLWA 2JIWA 4QP0A 4IQCA 4IHCA 2IKIA 2V81A 4C91A 2FHBA 2HV5A 4WSJA 5HJLA 3C0QA 5JH2A 4ODMA 3RXZA 3KAIA 3O5KA 5HT1A 2FPVA 1YIXA 2FB3A 1TWSA 3EOLA 3EWWA 2W3ZA 1MW3A 3R6IA 4HD5A 4KGJA 2WKJA 1QHPA 3WK1A 1TJ0A 2D73A 3H21A 3BH4A 3W07A 1JULA 2CLLA 2Y70A 1BF2A 4ZB2A 4XZMX 2UBPC 3MY9A 3JVAA 2HISA 3W7CA 3VGGA 1JCNA 4LF1A 5AFDA 4DZAA 2RUSA 4PCTA 2WNZA 3TQ0A 3HTWA 1WDRA 4FA3A 3W7RA 2R1NA 1UG6A 4JFTA 3LBOA 4AB4A 1WA3A 2RH9A 3CQIA 1PX4A 3VIKA 1GW9A 1WZKA 1W5PA 1BD0A 1HKVA 7ENLA 2ZR6A 3CUFA 2MLXA 3E2QA 1IT0A 3RM9A 2IPFA 3KOZA 1M65A 1UZ1A 2PC4A 1ZLPA 1S5MA 3RPDA 2JE8A 1JFHA 1PIGA 2YCLA 3BLKA