2DSWA

Binding of chitin-like polysaccharides to protective signalling factor: crystal structure of the complex of signalling protein from sheep (sps-40) with a pentasaccharide at 2.8 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dswA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dswA01
4CUCA 2JIWA 4RE4A 4LX4A 1NWSA 2E40A 2J78A 2GFTA 3KE0A 1LLOA 3WBAA 3MKKA 4BQ5A 4H8UA 4K68A 1KCLA 3AJ7A 1MYRA 1HXJA 1OD0A 1DWHM 3OB8A 1TA3B 4CN4A 3NDZA 5CJ5A 1YHTA 2J79A 1DP0A 3VM5A 1BLIA 1OIFA 4NSBA 2MANA 5TD4A 3OA5A 1ZB5A 2XM1A 4JFVA 5AYBA 4CU8A 1PBGA 5BXSA 1QNSA 3DECA 1E71M 2GVYA 5HXMA 1UWRA 1W3KA 4N0RA 2EPNA 3CGTA 1NWTA 1V6WA 3OGRA 3VD4A 3WF2A 1S46A 2D1ZA 4JFTA 3T2OA 3VD9A 3GNPA 1UR9A 3GM8A 1EH9A 1AQMA 4F8XA 2W62A 1G5AA 2ZX5A 3BAJA 2VT0A 1W1YA 4W7WA 4UFLA 2CBUA 4AZ5A 2X8RA 5BCAA 4WK9A 4WJXA 3GBEA 3AHVA 3U5YA 3N11A 3IANA 1GQJA 2Y5EA 2ZXQA 4W7UA 1GOIA 3N04A 2VUYA 2WANA 3PTMA 3A4XA 3U5UA 3KEHA 4W84A 1JZ4A 4AZHA 4W89A 4XZWA 2DT2A 1KR0A 1UUQA 1UA7A 2XPKA 4R27A 4U33A 1V6YA 3WNPA 1PZ2A 3VIOA 3W26A 1NP2A 1HKMA 1RPKA 2DH3A 1SFSA 1MQQA 2YA1A 1J11A 4CKQA 5A2CA 2E8YA 5A6SA 3QGVA 1TA3A 1NQ6A 5CQ1A 5AYIA 1M04A 4UZSA 2XVNA 1UKTA 5A6JA 4MPKA 5LYRA 2IXUA 4D6DA 4Z2JA 1CXLA 3QHMA 1V03A 2WMJA 3VX0A 2YDRA 3U7BA 3AHXA 5DT7A 2WNWA 2XGIA 4Z2HA 4NI3A 1PX4A 4TVUA 1BGAA 1FOBA 4OBSA 1AQ0A 1C8XA 1K9EA 1IV8A 3POHA 1BG9A 3WDJA 1QVBA 3L4XA 5CZKA 4RE2A 3O6AA 4MB5A 5FCZA 1JYVA 3AIQA 1KQYA 4AZCB 1IZJA 2DDXA 3PHAA 5D9MA 1V3KA 1CECA 1WCGA 1GOQA 1W1VA 3ZQ9A 2WVUA 1ZBVA 3ARXA 3CZ8A 3UR7A 3TTYA 2CETA 3DYPA 2WZEA 3B9AA 5BROA 1OGSA 4MTVA 4KMQA 4M24A 3GTNA 3RILA 3WNLA 4BA0A 3ARZA 4AY1A 2A3BA 2VX7A 1UQZA 3AS2A 4MNLA 1MXGA 2D2OA 1MW2A 1OD8A 3ZJ6A 2YL6A 3WD4A 3BGAA 1TUXA 5BYWA 3NSMA 2O9OA 4W8BA 4KGJA 2EBNA 1BYAA 4BQ2A 3A47A 1VEPA 3ZM8A 1XH0A 4GIAA 2WHKA 4HMEA 5A6LA 2A3CA 4UQ9A 2A3AA 5D9PA 3IAPA 2QF8A 2EPOA 4Y7EA 2OYLA 3RCNA 4M29A 2G41A 3PZVA 3T2PA 1EA9C 1OM0A 1WKYA 1WZMA 1EGZA 3WH5A 5FL0A 1KFWA 2YJQA 4D6EA 2QLYA 4OUEA 4X0NA 1G9HA 3TTSA 2EXOA 3M6DA 3DC0A 1E6SM 4WKFA 3NYDA 2WBGA 2J4GA 4MJ2A 2WK2A 4M1RA 1BF2A 5FKYA 2D0GA 1NOFA 3CHDA 2BY3A 1JNDA 3ZSSA 3BXWA 2WMIB 3VD3A 2ZOXA 3SCUA 3WF4A 2D3NA 4QAWA 5I78A 3WNOA 1YQ2A 2WZHA 1ISZA 1H09A 1UR0A 4DWSB 4PEEA 3BAWA 5C71A 2CESA 2J62A 2X05A 1A3HA 1TG7A 5KEZA 1DWGM 1GQIA 3OLEA 1VEMA 4CCDA 3AXIA 4HU8A 1WDRA 4ZENA 1J0HA 5JIWA 4LQ1A 1U30A 4PMZA 3MSDA 3U7VA 3ZO9A 3UR8A 2C7FA 2V5CA 1BHGA 1TFVA 5DO8A 1B30A 5FL1A 2FGLA 3THDA 3PZMA 5D9NA 2WC4A 3VIFA 2YOCA 2Y2WA 1PZ3A 1HT6A 3AS3A 1C92A 3G6MA 1J10A 1CGTA 4YHEA 2UWFA 4D72A 1OB0A 1BGGA 2V3FA 3BSGA 2QV4A 4WKHA 4V28A 4N42A 2QPSA 3AYSA 1XHGA 5BXRA 1I1XA 3L2LA 2PWGA 1LWHA 4CD5A 4AD3A 2J75A 3TA9A 1G1YA 1Z32X 8CGTA 3NDYA 2ZWZA 2XUCA 1IT0A 4PN2A 4U3AA 4UQBA 4F9JA 4P7OA 5LA2A 2BNJA 1UYQA 5HOSA 3KZSA 2YA0A 1JF6A 1WP6A 4MB4A 4UR9A 2J7FA 2CPUA 1ZL1A 1C8YA 3WNNA 5A69A 3MUAA 3L4YA 5I0DA 2UY2A 3N17A 3BCFA 2E4TA 4AZBA 1WDSA 2ZX8A 3MMWA 3VIPA 4BCEA 2VX5A 2VZVA 4JCMA 3SCSA 4MADA 3AXHA 2AAAA 1QBBA 4Z2LA 2WVSA 3L4ZA 4EAMA 1H49A 1WE5A 3LPOA 3GXIA 3K8KA 4JHZA 3UETA 1JZ2A 1V6XA 2FDMA 3G6LA 1SMDA 4MB1A 1UD4A 1UG6A 2ZXDA 2WW5A 4D6GA 4QCFA 9CGTA 3A4AA 2XVGA 1HVQA 1D7FA 3BLKA 1XYZA 4TVCA 2Y4SA 1VRXA 2IUZA 4C7GA 1R8LA 5CPTA 2C8NA 5I23A 1RP8A 3ZIZA 4FLSA 1JL8A 1HJSA 1J18A 1XRVA 4GI6A 4YPJA 3CO4A 3ARPA 1PX3A 4TTGA 4HOZA 1DWAM 3AQUA 1AVAA 2XYLA 3GXMA 5JH8A 4PTWA 3K4DA 3OLIA 3WH6A 2YBUA 2VO5A 3CBWA 4M56A 2JFEX 4CVUA 1J0IA 4TX6A 5D4YA 4DUXA 3SCWA 2F61A 3UEQA 3TTQA 3BAKA 3OZPA 1J0ZA 3CLWA 3DYMA 4NRRA 4B9YA 4AXNA 5ECUA 2OWWA 2JF6A 5A95A 3QHNA 3S6TA 4Q7NA 3J7HA 3WBEA 4J7RA 2WPGA 2WZIA 1R7OA 2XTKA 2CKSA 1UA3A 5A2AA 1NH6A 2X09A 2ESCA 5CLTA 4EANA 1B2YA 2CIPA 3VDBA 4JIEA 3TONA 1HJUA 3WUGA 5E0CA 1H3GA 1QI5A 1J0JA 4JFWA 4FLOA 1CGWA 3IJ7A 4P8WA 5E6YA 1E6QM 1V0LA 1KCKA 3WIJA 3CHFA 4W87A 5I24A 4U2YA 1HVXA 1EQPA 3CTTA 3PZTA 5I77A 2OYMA 2WWCA 3WDHA 4P8VA 3VGFA 4OZOA 1MW0A 3N13A 2Y8KA 3FAWA 2BXZA 1R87A 3WENA 4DWSC 4BQ3A 1FFQA 5A8QA 1KR1A 4FK9A 1JYNA 4GI8A 2BHUA 1JZ5A 2XSBA 3MUY1 4FLRA 4RE3A 3ZJ7A 1TMQA 4UTFA 1NOWA 4A3HA 3SCVA 1CIUA 3WUEA 1JG9A 1E1EA 4PRWA 2GJXB 3POCA 1SR0A 1L8NA 1W9DM 4CCCA 4JZ5A 3TOPA 1JNEA 2XHYA 1QOXA 1CXFA 4AYSA 4CGTA 1BVZA 2BFGA 5FD0A 2JF7A 1R7AA 3VTRA 1PIGA 4JFUA 1TE1A 2EEXA 2WCSA 1WNOA 1XH2A 3E1F1 4GQRA 3SCTA 4EK7A 1P6WA 1QI4A 2F8QA 5CSUA 5IHRA 1E4IA 1CENA 1D2KA 4H2CA 2GJXA 1BPLB 4XUYA 3LMYA 4ATLA 1R86A 4PYSA 1VFMA 3VM7A 4PUEA 1W1TA 3N12A 4QCEA 4U3CA 1E4LA 2W66A 1ZBWA 2Y24A 5ABFA 2VRKA 4WLCA 3RM8A 3VD7A 5EFFA 2HISA 2VZUA 1JYXA 1ISVA 3LPGA 1V0MA 4AD2A 2DSWA 3A3HA 3FW6A 5AC4A 1MXDA 1IZKA 3UG4A 3RO8A 1CYGA 3VOCA 2ZE0A 4D6HA 1UQYA 1CXIA 3I3EA 3VGGA 1CXEA 1E15A 3WFLA 2BY2A 3NIYA 1E5JA 1OWQA 1VENA 6A3HA 4ZE5A 4HPHA 2XFRA 3AMKA 3W53A 1XC6A 1FP8A 2CHOA 2VR4A 2WLZA 2OSWA 2O92A 2XWEA 3IK2A 1OIMA 4GKLA 1UKOA 3PZOA 3QR3A 2O9PA 2NT0A 4PSPA 1KWKA 1MFVA 4H04A 1DTUA 3IJ8A 5I2UA 2ZUTA 1GOWA 4TXEA 1C7TA 1CDGA 4QFUA 3OGVA 4NF7A 2E9MA 2J47A 2OSXA 1E0WA 4QLJA 5C8BB 5IFTA 2VMFA 3O9NA 3D3AA 2BVDA 2XVPA 1LQ0A 1GHRA 2WVVB 1NM9A 3ZR5A 2JEQA 3FY1A 4F9DA 2V38A 1CXKA 4Z2IA 3VIHA 4GQQA 2Q8XA 4AC1X 2NW0A 4W7VA 4J3WA 1BTCA 2YL5A 1AMYA 4UQDA 1PIFA 2WSPA 5E70A 1QHPA 2X1IA 3WEOA 3WD2A 2WC7A 1HJVA 4GZEA 2XIBA 2V3EA 1GCYA 1V08A 2CBVA 2E9BA 1H5VA 2ZICA 2ZX7A 3II1A 4PSRA 1UOKA 2VQTA 1E73M 4URIA 2WB5A 2FH6A 1TZ7A 4H8VA 3OZOA 6TAAA 3WFZA 1I1WA 1X6NA 2V3GA 4PMNA 2WMKA 2F2HA 1GUVA 5A2BA 4PTVA 1QPKA 3W82A 7CGTA 1VBUA 5A6BA 3DYOA 3WMBA 3WMSA 4DM2A 4IPLA 1ZS2A 4MAVA 2VQUA 4B15A 2VC9A 1AQHA 2W67A 3OLGA 4QDMA 5JBEA 4KH2A 5D8ZA 3W81A 1V3LA 1W9XA 2J7GA 2DSUA 4B9ZA 5A94A 1I75A 2DH2A 3GH4A 2WCAA 4JHOA 5DEZA 1A47A 1ITCA 1EDGA 2BS9A 2XM2A 2CXGA 3L4TA 3PN8A 3WQ5A 4HOXA 3WN6A 2FGZA 5M5DA 5CLWA 5JUVA 1TVPA 4DM1A 1E9LA 3RJYA 2ZWYA 3WEZA 4ACZA 2EPMX 5LA0A 1W9VA 2CITA 1E3XA 1ISXA 3AIEA 2PWEA 4DUWA 3N15A 4KRTA 3PZQA 4D71A 2VRQA 4J3VA 1OT2A 3HJEA 4W88A 3A6OA 1K6AA 4PMXA 4AWEA 3BMWA 4CU6A 2ZUSA 1FP9A 3ZOAA 3SUTA 5HPOA 3CMJA 1BQCA 3I3BA 5ABFB 1HJQA 1EDQA 2CYGA 2GJPA 2WC3A 3LPFA 1WAWA 2O9RA 4LGXA 1XCXA 1W3LA 4Z2GA 4ATWA 1EXPA 1SMAA 3JUGA 4KWUA 4JKMA 1UD3A 3K8LA 2UY3A 3OGSA 1M53A 2GK1A 3WF0A 3PTQA 2YLAA 1KB3A 4CVWA 2PF0A 3MUIA 1JZ6A 1GORA 4H8HA 3W6MA 1CGYA 1TVNA 3PZNA 1E6PA 2DT0A 2PC8A 2JALA 3VIJA 3CUJA 4PCSA 2PBOA 1VAHA 1MW1A 3GNOA 3CZKA 3EDFA 5CG0A 1K9FA 2J7EA 5A6AA 3ZMRA 1OGBA 3GDBA 1CWYA 4J3UA 2G3JA 4BS0A 2PBGA 4CCEA 2AOSA 4D6IA 4BF7A 4NRSA 4QP0A 1XSJA 3VIKA 3EMQA 2VI0A 3VX1A 2JE8A 2W5FA 5E9AA 1QNOA 2YL8A 4P8UA 3ALFA 1KWGA 2BVTA 1EOMA 1XH1A 3GXDA 4B3LA 2ZX6A 1M01A 3MUZ1 4AIEA 2J7HA 4ACZB 1GJWA 2JIEA 5CGTA 1KGXA 1PJ9A 1DWJM 3EDEA 1QI2A 1H1NA 2J8GA 2J25A 3VNYA 3QOKA 4U31A 3FXYA 3S2CA 3SIMA 3VIIA 1HL8A 3IJ9A 1V0NA 2WCGA 3AIBA 1W9BM 1BYCA 1VB9A 2GSJA 2D3LA 2GJRA 5A8NA 3AS1A 4KRUA 3WQ6A 5FOOA 1JI1A 3OG2A 1QNRA 5JBDA 3RMEA 1G0CA 1FH9A 2WKLA 1H41A 1UH4A 2WLYA 3UERA 1GNXA 4YN5A 2WXDM 4BZYA 3RJXA 3WELA 1JZ8A 2VJXA 1KXTA 3CIVA 5M03A 1EOKA 3GH7A 3KL5A 1LJYA 3NCOA 3CHEA 3MANA 4AEFA 4J28A 5AY7A 3SUWA 1QBAA 4BQ4A 1E6NA 4S3KA 3SCOA 4ATDA 4FLQA 1UD6A 6CGTA 2NT1A 4U2ZA 1UH3A 4PMQA 1W3HA 1UWSA 2VTFA 2W4XA 3ARUA 1C93A 1HF6A 4V27A 1B3ZA 3PZIA 3ARQA 1ECEA 3NUKA 4PTXA 2HVMA 2X0YA 1JXJA 4PCTA 2WMIA 1BAGA 1ZBCA 4PMOA 3T0DA 1ZJAA 1GW1A 5HPCA 2VURA 3W29A 5EBAA 2ZUVA 1Q6GA 1WZLA 5IHSA 3OIHA 3PZGA 3CUHA 5A1AA 1CGVA 4L4OA 5E09A 4IM4A 7TAAA 3WD1A 4LXFA 5D8WA 3VVGA 2D23A 4HP5A 3T0BA 5BXPA 2CKRA 3WDQA 3WQWA 1J12A 2VZOA 3EBVA 1DEDA 1K9DA 1JI2A 1EHAA 1KBBA 3CPUA 1PX8A 4C7FA 2O9TA 3WQ8A 1KQZA 2PB1A 5DMYA 4JKKA 2TAAA 2ZXBA 1W32A 2WHLA 4JL1A 1J0KA 1G94A 2A3HA 4CN1A 1VFUA 2BXYA 1N82A 3BMVA 4UNIA 1KXHA 4B16A 1CPUA 4M82A 3SURA 4ZE4A 4CD6A 5DFAA 3AZRA 1FHLA 2WBKA 1JD7A 5GPRA 4E8DA 3AYRA 1GQKA 4EE9A 1XSKA 2PWFA 1W3JA 3RM9A 1E6ZA 3CUFA 5CPQA 1HJWA 4UFIA 4AIOA 4PMRA 4R5EA 5DT5A 2WKGA 2BHYA 1WO2A 1E43A 5GNXA 4IUGA 1W2VA 5E6ZA 3KL0A 4DUVA 1B3VA 1B31A 1GOMA 2DIEA 2DEPA 4HA4A 1QHOA 3W24A 5HNNA 3WSUA 3ARRA 3SUUA 3ALGA 5C70A 1X6LA 2VX6A 4AW7A 4P7RA 3ZJ8A 1VFOA 2G3IA 3KWXA 5IFPA 4MAZA 3WF1A 2BY1A 5BRPA 1NWRA 4WF7A 1DHKA 1XSIA 3K8MA 4XX6A 2ZIDA 3AHYA 3CMGA 3VDHA 2Z1KA 4ML4A 4MJ4A 4ACYA 3F5KA 3CZGA 1K9TA 3EDKA 3B9DA 3ARYA 1M03A 1JXKA 3OLDA 2EO7A 1FH7A 4W86A 5I3DA 5KZ6A 1KGUA 3N9KA 4XZBA 1WZAA 3WD3A 3I3DA 4AIUA 4CD8A 3VIGA 3FN9A 4M80A 1Q6FA 1J0YA 1HKIA 1VEOA 1GJUA 2DT3A 2V3DA 3K1DA 4AD0A 1GVYA 1UWIA 1HIZA 3MU7A 2WHJA 1SYTA 3DHPA 2PWHA 4MB3A 4ZEPA 1E6RA 2CNCA 5A3HA 1JYWA 1GHSA 2W91A 1UR8A 1W91A 2ZUNA 3ZJKA 3N1AA 3EMZA 2CEQA 4GI9A 2YIHA 3BAIA 3VPLA 3M07A 4HTYA 3WUBA 5I5RA 2WAGA 1V6VA 4MNJA 2V5DA 1C7SA 5A6MA 3VU2A 2ZUWA 4PTMA 3UG3A 1L0PA 3K46A 4CU7A 1HP4A 4X9YA 4AEEA 4NZCA 4AMCA 1J01A 4TUFA 3ZT7A 3UESA 4W8AA 2DSKA 4OBRA 3AMCA 3N18A 3T0AA 4D1JA 1GOKA 1JZ3A 1V3JA 4E4PA 2GUYA 1V0KA 1JDDA 3F4VA 3WY1A 1LL7A 2VCCA 2YL9A 1JFXA 3VMNA 1FH8A 3W37A 2JEPA 3B9EA 1BFNA 3W25A 2BVYA 1NP0A 3ZSTA 5BWFA 1CGUA 1ZJBA 5EMYA 2DQXA 1JIBA 4QLLA 1E0XA 1Y7VA 1KBKA 3VINA 3UG5A 4S3JA 4PUDA 1HX0A 1FFRA 4D6JA 3VDAA 2DT1A 3VDCA 1CXHA 1MFUA 1UD5A 3WUFA 5I79A 3GYCA 1LL6A 4L4PA 3ARVA 3BSHA 3K4AA 2DIJA 1VIWA 1MW3A 4H41A 4WSJA 3A4WA 1LL4A 1F4AA 1VF8A 4UOJA 4JL2A 2CBIA 3UCQA 1UZ1A 1BYBA 2VNCA 3EDJA 5LA1A 1CBGA 1U2YA 2VZTA 1VJZA 2WMFA 3VUPA 3EMCA 4TX8A 1RH9A 4WIWA 2FHFA 2D22A 1JAEA 1JDAA 3AIWA 1BYDA 2ZUUA 4ZFMA 2EQDA 2WM0A 3SUVA 1PAMA 1B9ZA 1WDPA 4FF5A 4HA3A 3CZEA 4UFKA 5I6SA 2G8ZA 3VNZA 4C7DA 1EDTA 3IAQA 3WL0A 1UKPA 5A6BD 2VR5A 1B1YA 4E8CA 1UWUA 1EO7A 3BC9A 2BHZA 1NOUA 3PZUA 3NJ3A 3WD0A 3CZJA 5CSYA 5ABGA 3VGBA 5JBFA 3AS0A 4F79A 3TTOA 3AROA 1NWUA 1UH2A 4UQEA 1X1NA 2W92A 1E55A 1OGGA 4MNKA 3FNDA 3SCRA 1PPIA 2W63A 4KGLA 4LPCA 1CNVA 1XD0A 1ISWA 4GO8A 2GDVA 3L4WA 2ZXAA 4MNMA 2XG9A 1PEZA 1UZ4A 2VX4A 3W38A 2YKKA 1RP9A 3ZT6A 2WMGA 5M3WA 3VGDA 2QMKA 4AD5A 4P7LA 1HL9A 3AIUA 1C90A 1FA2A 3AHTA 3WH9A 2Z1SA 1D3CA 4XB3A 1UR4A 4TTUA 2OSYA 3VIMA 1E6XM 3VD5A 2WYSA 3AXXA 2DSVA 4RL3A 1OT1A 1Q6EA 2B31A 2OWCA 4AD4A 3SUSA 2RGMA 3AMLA 3WDPP 3CUIA 3VKKA 4FMVA 4DWSD 2D20A 4ZXOA 1FHDA 1QNQA 3F5JA 3ZR6A 4U5IA 1E1FA 1XD1A 1CGXA 3PTKA 1JF5A 1EHNA 5BRQA 1CLXA 1QNPA 2UY5A 3W4RA 3L4VA 2YDSA 3APGA 5A8PA 4XV0A 2W61A 4D1IA 4UOZA 3LPPA 2VVSA 3AIVA 3AFBA 4UFMA 3WH7A 3AHZA 1TR1A 1VFFA 4W93A 1V3HA 4ZXLA 4TVDA 1GPFA 3ZT5A 4AZCA 1W2PA 4LYQA 3AOFA 3ECQA 2BV9A 1R85A 1WPCA 1V02E 2VCAA 3W28A 2VCBA 3GZAA 3GXFA 3SCNA 1C3FA 2CBJA 4OOUA 2J7DA 3T09A 4CN6A 4D6CA 3FHQA 1V3IA 1NARA 2WSKA 2YBTA 2E0PA 3FHAA 2DSZA 3AISA 1VJSA 5FIPA 1ESWA 4W8LA 2BY0A 4GINA 4EKJA 4J3TA 3M7SA 2YA2A 4OOZA 4HMCA 4CD4A 1QHZA 3ARWA 3KL3A 1BVNP 1RD6A 2G3MA 4Z2KA 1ZU8A 1B3XA 1TCMA 1H2JA 1ISYA 1EO5A 1B90A 3OBAA 3SCQA 4OJYA 3D5HA 3VGHA 4HMDA 5A8OA 3WDRA 1V02A 4B3KA 2OYKA 1GOOA 4JKLA 4AISA 3ARTA 3BH4A 3TP4A 4UQCA 3B8SA 4PMUA 3QOMA 1UKSA 1HKJA 1QW9A 4AZ7A 2VZSA 1GONA 1QI3A 1CZ1A 4HOWA 1EIBA 2WHMA 2EPKX 1H4PA 1OBAA 2XFFA 1HKKA 3GNRA 2QMJA 2E3ZA 3MMDA 3WKZA 1ZBKA 4D6FA 2C0HA 2X2YA 1QW8A 2OWXA 4V2XA 1JDCA 4GXPA 4CD7A 4UZUA 2Y8VA 3MV01 2D24A 4J3SA 1KXQA 1DWFM 1UR2A 4DWSA 1V6UA 1MQRA 3QHOA 4UFHA 5M17A 1GQLA 3AI0A 1C91A 1XCWA 5AC5A 1UR1A 1ITXA 1OINA 2DPEA 1HJXA 1HP5A 4JCLA 1MWOA 4P7NA 1VBRA 1US3A 2WWDA 1W9UA 4IPNB 1B3YA 1LG2A 2GK1B 1UHVA 2D0HA 3BAXA 2YLLA 2FH8A 1CLVA 5JIPA 3AZSA 1OSEA 3WEMA 3PZ9A 2IXVA 5F7UA 1F4HA 3AMDA 4W5ZA 2PI6A 5ABHA 3THCA 8A3HA 1QI0A 2QPUA 1LF1A 3WF3A 2J74A 2ZUMA 5ABEA 3AZTA 4JAWA 4Q22A 3WQVA 5GNZA 4JFSA 4M8UA 1XYFA 2CHNA 3O2LA 2WVTA 3VILA 1B0IA 1KGWA 2WMHA 5D9OA 4J3XA 1DWIM 3EYPA 2EJ1A 4YHGA 3BCDA 4IISA 4WKAA 2DGAA 1HNYA 4HU0A 4PMDA 4PMVA 1CEOA 3HMCA 1M7XA 3RPMA 1E5NA 4HPGA 5DF0A 3NSXA 4A4AA 3T08A 1V3MA 1E70M 3MV11 3VMPA 1E4MM 2CERA 5IXEA 1E0VA 5EB8A 2YDQA 1MQPA 1UWQA 2G3NA 1JFHA 4U5KA 4GO9A 3WDIA 2FHBA 2PWDA 2XWDA 3VGEA 3AMGA 1H0GA 3L4UA 3WNMA 2XVKA 1LWJA 3SEPA 5HBFA 1OCQA 2VRJA 4PBGA 3U57A 4A3YA 5CGMA 1O7AA 2NSXA 3W27A 1ODUA 4PMYA 4HZ8A 4GZIA 5CPSA 2J77A 1G01A 1UD8A 3WL1A 2X0HA 1UKQA 2UY4A 2XFYA 3WNKA 5IDIA 1H0IA 3WQ4A 2G4FA 1E3ZA 3GBDA 1E4NA 1WDQA 5GQBA 1BG4A 3RM4A 5E0FA 3L2MA 3MSGA 2XVLA 1ODZA 1Q6CA 2VL4A 1GVIA 4W5UA 3SCPA 1H11A 4GZJA 1Q4NX 1W1PA 4F66A 1BSIA 3RDKA 1E72M 3HN3A 4AZGA 3PBGA 7A3HA 1KXVA 2GDUA 1HN1A 2J7CA 2J8FA 3CZLA 1J9YA 1U33A 5A6KA 3WMCA 4P8XA 4P7QA 4AZ6A 3W0KA 4HZ6A 4E2OA 3AIRA 3AICA 4HZ7A 1MVYA 2E8ZA 2VOTA 3BLPX 2OLHA 5BXTA 1US2A 2RGLA 1C8QA 3T2QA 3VO0A 1JZ7A 1W9PA 3CHCA 2AMGA 3W6LA 2J7BA 2XGBA 4X0VA 4QLKA 1JD9A 2WVVA 1O6IA 1E56A 1CTNA 3MO4A 2VVNA 4GPNA 3VMOA 1WB0A 4HA1A 1Q6DA 4LYPA 1UWTA 4UFJA 3RIKA 3MMUA 4W85A 3GH5A 2D0FA 4WSKA 4J27A 3WH8A 1UD2A 4UCFA 2CCRA 1JAKA 2XSAA 5EFDA 1E40A 3NSNA 4OIFA 2ZX9A 1EQCA 3FAXA 1XV8A 3EDDA 2QHAA 4AZIA 3HU7A 2XJ7A 4H7VA 3ARSA 4MDOA 3MS8A 4MDPA 5CXPA 5HDRA 5GNYA 2XIIA 1XGZA 4LYRA 4TOQA 3BAYA 2A3EA 3F5LA 5A8MA 2EPLX 4M81A 1B3WA 4AD1A 4OKDA 2FHCA 1JGIA 3CUGA 4UQAA 4UOQA 2E9LA 3DHUA 1WZKA 1LG1A 3M46A 1GZJA 3CH9A
chains in the Genus database with same CATH superfamily
2JIWA 4H01A 3T40A 1LLOA 2HMCA 1TWSA 1FKKA 4K68A 1KCLA 1NFPA 3ITTA 1MYRA 1YXYA 2NXHA 3NDZA 1YHTA 2QCHA 2CLHA 2INZA 3O16A 4LEFA 4TMBA 1OIFA 4JFVA 1BRLB 3FS2A 3STGA 1E71M 1SO6A 3PRAA 2GVYA 1YXCA 5CAHA 7ODCA 1LDCA 2EPNA 4Q8PA 3NPXA 3OGRA 3LBMA 2D1ZA 1P4CA 1R6WA 3CAKA 4JFTA 3WF2A 1ELSA 4HB7A 5F1VA 3CIWA 1IEWA 1ROTA 3RRXA 3AWOA 4F8XA 2W62A 2ZX5A 1DQWA 1MXSA 1BEUA 2WJZA 4DT4A 3GBEA 3HPSA 3AHVA 2IQ0A 3N11A 3U5YA 4NI8A 2Y5EA 1IXPA 4W7UA 1VYRA 2WANA 3PTMA 4QQ3A 3UWUA 4LW7A 4GFSA 3S5ZA 3U5UA 4W84A 3S0CA 4LYKA 1KR0A 5LIKX 1UA7A 3U48A 4FNRA 3WNPA 3LI1A 1HKMA 1A5CA 2XH0A 1GVEA 3N4EA 3T4WA 4H9UA 1RJQA 3LK6A 5D02A 4Z1DA 3WLPA 2FB2A 3I6RA 3H4XA 4RZ4A 1YX1A 4Y9PA 2OEMA 3MQTA 5FJOA 4E4UA 2ZZ1A 3WLMA 5A6SA 3QZ6A 4DROA 1HG3A 3QGVA 3RMJA 1TA3A 1NQ6A 4K8HA 1H60A 3P8JA 1GEQA 3ES7A 3HG5A 3QXBA 3IIVA 3QHMA 1CI1A 1V03A 3ANYA 3RCMA 2YDRA 4HYRA 3U2ZA 1ZQ5A 2CXEA 1XQKA 2WNWA 3PBUA 3UXIA 2QW5A 3M44A 4IP4A 1F40A 2PODA 3LXAA 1LTDA 3QEZA 5TAOA 1BG9A 4L4MA 5HQEA 5CZKA 4TW6A 4HPJA 3TSMA 2JGQA 3GXTA 2Y70A 3NGFA 5FCZA 4DRIA 4XZIA 4AZCB 1IZJA 1FKJA 2PD5A 4ZFCA 1V3KA 1CECA 3WLHA 4KRZA 3VFCA 4F3HA 1ZBVA 4QG6A 3ARXA 2HK1A 4XAGA 1SO5A 2CETA 3DYPA 4N6FA 3URBA 3GRIA 1OK4A 1XGDA 4DEFA 3WBYA 3B0YA 1OX5A 4BA0A 1EF3A 1RVGA 2VX7A 4ADSA 4MNLA 1RK6A 3ZJ6A 1POJA 3BGAA 1XKJA 4KPLA 3OPSA 1ADOA 3UU0A 4JIPA 5K3VA 2NLIA 4EPKA 3NOEA 1RD5A 1FHUA 2H9AA 3MWAA 4KERA 2OYLA 4DPPA 4G2PA 3T2PA 1U5JA 1QDSA 2M1IA 2XP5A 1WZMA 5G4HC 1EGZA 3ANVA 1X97A 3C0QA 2QLYA 4ODKA 5D2VA 1A49A 3M6DA 4G7EA 1E6SM 4WKFA 3NYDA 4KIEA 2J4GA 5PTDA 3S2MA 2D0GA 3SSZA 3CB8A 3PNUA 3KRZA 2EG6A 1JNDA 1T11A 2ZOXA 3WF4A 5HMSA 1TZ9A 1VHNA 4HYVA 2ZZ6A 4ODNA 1CLKA 5C71A 1H1YA 1NDVA 1A3HA 1TG7A 1BL4A 1DWGM 3OLEA 1VEMA 2VEMA 1VBJA 4IMCA 3N2MA 4CCDA 1JNTA 4HU8A 1WDRA 1J0HA 5JIWA 1U30A 5M2FX 3G1SA 2OGYA 4PUJA 2XIOA 1EP1A 3S2NA 5DO8A 1B30A 2AGTA 3PZMA 5AZ1A 5CPMA 2WC4A 5EMKA 4HQVA 1XWYA 5FEPA 4S3EA 4C90A 3AS3A 3LV6A 1C92A 3KOYA 3G6MA 1CGTA 3T05A 1DORA 4HZMA 3BSGA 2QV4A 3AU2A 3EKLA 1OFDA 3AYSA 1XHGA 5BXRA 3PPHA 4Z42C 1P0KA 4O1FA 3L2LA 4G8TA 2CLLA 3R2GA 5C6MA 2QR6A 4CD5A 1Q6RA 4B4FA 4ODQA 3RGCA 8CGTA 1OZQA 3CWOX 2YB4A 5FJIA 3KZSA 1JF6A 4INFA 2J7FA 1RHCA 4GOAA 3UW6A 4EXQA 3MUAA 2GVJA 3NQEA 4LY4A 4B5VA 2E4TA 4NZ4A 4IL0A 4BCEA 2VX5A 2VZVA 3FKRA 4JCMA 3L4ZA 1JCXA 4O17A 1WE5A 5J6EA 1DXEA 3UETA 1T41A 1V6XA 1SMDA 3P7YA 3H7UA 4LEQA 1UD4A 4D6GA 1RQEA 5AC7A 4PCPA 3A4AA 2V68A 1SVDA 4D9PA 1XLGA 2Y4SA 1VRXA 3NTPA 3PULA 2C6QA 4JTTA 3UWZA 3TUUA 1R8LA 2C8NA 2OX4A 4FNQA 5EKYA 4FLSA 2J8TA 1JL8A 1HJSA 4IWWA 1J18A 1XRVA 3CIXA 2F6XA 4TTGA 1MMFA 3CO8A 4HOZA 1DWAM 3AQUA 3V4BA 2HCVA 3WH6A 1IYXA 3CBWA 2JFEX 3C2FA 3EAUA 5HR6A 4TX6A 3ZXWA 4IX2A 3KACA 3DFTA 2P3ZA 5KZDA 3BAKA 2FPYA 3TDBA 3V18A 1D6OA 2OWWA 2OB3A 5CZJA 5A95A 1SGJA 3S6TA 2P5NA 4Q7NA 4Z1YA 3J7HA 1F6YA 2VC6A 2PDCA 3W1AA 2GLKA 4YVXA 1SW7A 5H91A 4GY0A 3R11A 3WUGA 5E0CA 4UTWC 1ONEA 1J0JA 4PMJA 4JFWA 2FB3A 1LBMA 2P0IA 4ORIA 2HK0A 1S1PA 3VFLA 4P8WA 1E6QM 2ZFAA 3WIJA 4W87A 4Q8MA 1E1CB 4N2YA 3R8RA 3CTTA 3PZTA 5I77A 3SO7A 2OYMA 2WWCA 2WM1A 4OZOA 1MW0A 3N29A 5HANA 2Y8KA 1E9YB 4F0RA 5CPOA 3WENA 4GACA 4RDYA 4GY7A 4JFLA 2P10A 3SECA 1MNZA 3MUY1 3ZJ7A 2E25A 3S1WA 4O4VA 2OVLA 2YCJA 1TE6A 3KFTA 2GJXB 1R3QA 3FYYA 1SR0A 2KAUC 1P7TB 1W9DM 3AO0A 4GIEA 4Q7BA 2DG4A 3UXDA 1PTGA 3R12A 4B5XA 1CXFA 1FDZA 4AYSA 1HXVA 4JYFA 5FD0A 3VTRA 1O4UA 3W7JA 3BJTA 2JQXA 4JFUA 2WCSA 3UI4A 3WQCA 1TJ2A 4NYYA 5DXXA 2XP8A 5D32A 3VK5A 3M0IA 3QR0A 1CENA 2A3LA 2IKJA 2YXXA 4H2CA 3W9ZA 1R86A 1BQGA 1JDEA 1TTJA 4L61A 2AGKA 1VGAA 4A8RA 2W66A 2Y24A 1ZBWA 3HF3A 5EMJA 4U84A 4WLCA 3RM8A 2C3ZA 2VZUA 4M0XA 3LPGA 3O5GA 1V0MA 4K3ZA 2P0OA 4LT9A 3A3HA 4IIDA 3DAQA 2IPFA 1IZKA 3NZGA 3IIOA 1M65A 1ZP4A 2BY2A 3NOYA 3WBXA 4IP5A 4HPHA 3AMKA 1NDWA 4RXGA 5AHLA 1FP8A 2DZXA 2WLZA 3PJTA 4NJIA 1FDYA 4O12A 2F2KA 1XYAA 3IGXA 2ATSA 4V1YA 2O9PA 1RLCL 3G8EA 3UWEA 1KWKA 4IFOA 1UIPA 1Q7MA 5J8LA 4C6QA 1GOWA 2QUUA 4LCQA 3OGVA 2OTDA 4O1EA 4QFUA 4NF7A 5C54A 2OSXA 4QLJA 5C8BB 2VMFA 2GOKA 4C6KA 3LQGA 5DRCA 3DFPA 2BVDA 4L1WA 1VCVA 4M6PA 1GHRA 2WVVB 5LNWA 3FY1A 1F7BA 4DO7A 1CXKA 3TXVA 3S1UA 4W7VA 4ES4A 1BTCA 2YL5A 1PIFA 1BWKA 3L2IA 1QHPA 1H50A 1QPNA 4C6EA 2A6LA 1HJVA 4GZEA 3DFOA 4FPSA 3QQ1A 1GCYA 4ITZA 2E9BA 2ZX7A 3NVDA 2VQTA 5TBOA 1KO0A 1MSSA 3ITOA 4IIBA 2XP4A 3F2DA 3Q58A 1YXDA 4ML9A 3WFZA 2GGJA 4LUTB 2XU2A 1X6NA 2V3GA 2R1MA 2F38A 3W82A 3GG8A 1GG0A 3W7NA 2Y88A 3WMSA 4HCLA 4B15A 2VQUA 3NZRA 3GU0A 1XBVA 2PP0A 2VC9A 4IIFA 1R0MA 1AQHA 2Z6IA 3B9OA 3W81A 3MTWA 2J7GA 1WKEA 2DSUA 2V81A 4B9ZA 4DHGA 1T8XA 3FEQA 3CH0A 1DJWA 2DH2A 3Q37A 3GH4A 4UTKA 5CH9A 1YPXA 2WJDA 1R3WA 3L4TA 3PN8A 1M7OA 3KTCA 1F8IA 3E38A 3LZ3A 3DGBA 5LHFA 4QAIA 4MZ8A 2ASHA 3IPWA 2CITA 1ISXA 1YNPA 4JBRA 4KEMA 5U7SA 3A3XA 5CC5A 1A5UA 1IEQA 4WJ8A 1IX5A 4AWEA 1EJRC 2QYGA 3W7KA 3BMWA 4CU6A 3SUTA 4DF2A 1CB7B 1UP3A 4XD4A 4DZ5A 2QDHA 3ABZA 3W84A 4GXWA 1HTIA 1WAWA 2MF9A 2C91A 1W3LA 4DZAA 4PZVA 1EXPA 1G4TA 4UTTA 3K8LA 3QJAA 4LAUA 3RR1A 4C6BA 1KB3A 2PF0A 4HK6A 8RUCA 3W6MA 4DZIA 4JOMA 2ZQUA 1QOQA 2Z4GA 3BG5A 3WFAA 3V0TA 5H8MA 1TVNA 2DT0A 3TK7A 2NVAA 4MGVA 1VAHA 2WQDA 2P76A 3BG9A 5DO2A 2J24A 2PBGA 4CCEA 4DBEA 4NRSA 4QP0A 5HINA 3EMQA 3USBA 3PB2A 4X2RA 2KE0A 3QV9A 2G95A 3RRAA 1GRJA 4LALA 4RW3A 3OVQA 3E49A 1B54A 1XS2A 4G1KA 2YL8A 1B4KA 4P8UA 1Q6LA 1AW2A 1O95A 2O7QA 2J7HA 1GJWA 1M3UA 1GYLA 3W83A 3FLUA 1EA0A 1QI2A 4AQLA 1XFCA 3N6QA 2X40A 2ZKMX 4ALDA 3NFUA 1QPRA 1UR3M 1V0NA 3NZQA 3W1MA 3AIBA 1W9BM 1XXXA 2D3LA 4KRUA 1XINA 2OXNA 4UMCA 1GEHA 2FVMA 3VZYA 1A80A 2F21A 2VN1A 1IXQA 3VKBA 2HWGA 5JBDA 1DQXA 1Z3NA 1RCOB 3TW7A 1DKWA 3CB3A 4GKTA 4J9JA 2F23A 3RJXA 3TMLA 1KXTA 5M03A 2DZAA 4EX4A 1LJYA 4D2JA 5T8GA 1PB0A 5MKGA 1OFPA 3GC2A 3MANA 3L9CA 4S3BA 4R9OA 4R7OA 4AEFA 1Y0EA 1UD6A 4HHPA 3PSWA 4XQ6A 1Q6QA 3OTRA 2W4XA 4HBOA 3O5FA 1HF6A 2OELA 1ECEA 1PL9A 4PTXA 3SAZA 2X0YA 4IQCA 4EWND 1RUSA 3HQNA 3T0DA 2VURA 2ITKA 4IQDA 4KWSA 1Q6GA 2ISWA 5IHSA 4PCNA 3W73A 3LCWA 3C8FA 3UI6A 5D8WA 4GMEA 4HP5A 2I17A 1XICA 5BXPA 2I7GA 1ZGDA 3N3TA 3SADA 1K9DA 2WJEA 4DWDA 1KBBA 3CPUA 2QQ6A 2I56A 4BR1A 3S83A 2PB1A 2QCEA 3WLSA 3PWIA 2ZXBA 2FZNA 3ID7A 3QQ0A 4JL1A 2A3HA 3JU2A 3BG3A 3F2CA 2BXYA 4A35A 5LIYX 4M82A 4GD0A 1X98A 3RGTA 3AZRA 1FHLA 1JD7A 3UR5A 1LOSA 3S2JA 2XP6A 2ZRVA 1W1B1 1XYLA 3GDTA 3MUXA 1E6ZA 5CPQA 3DKLA 1HJWA 1TB3A 2ZDRA 4R5EA 4E8GA 3WLJA 3KP0A 5LNRA 2BHYA 1O5XA 1O5RA 4DUVA 1GOMA 2VD8A 4LC6A 2DEPA 1F2JA 1TPDA 3BW4A 4HA4A 1QHOA 4UTIA 1W3IA 2R8WA 4GGQA 1WXYA 1X6LA 4AW7A 5D33A 3KWXA 3SGGA 3HPZA 3LHZA 3AALA 2AMXA 5BRPA 4Q3MA 1NWRA 3H2FA 1XSIA 3K8MA 3VDHA 4L9XA 5E5CA 3B9DA 1NMVA 3ARYA 1M03A 1FH7A 4W86A 1M1BA 4PE8A 3N9KA 1WZAA 2ALRA 1KBIA 4HNNA 4Q4OA 4NAEB 1AD1A 2PRMA 3GWQA 5DMMA 1J5TA 4AY7A 4ODRA 3KLKA 4M80A 1Q6FA 1HKIA 1GJUA 4IMEA 3K1DA 1EBHA 1XUUA 1WYIA 3R58A 1HIZA 4UCGA 1VZWA 2WHJA 4RJEA 1SYTA 3CAWA 2VCDA 1TWIA 1IEIA 2PWHA 3G3DA 2VDHA 5CSSA 1E6RA 2CNCA 1JYWA 3NDOA 1W91A 4HHHA 4G7EB 3GDKA 3O5MA 2ZUNA 4I7VA 3LS9A 3N1AA 4H3DA 3EMZA 2HE8A 4J35A 1Q7ZA 1WAUA 4HTYA 3WUBA 5I5RA 7REQB 4PTDA 4PTMA 2Q5AA 4CU7A 4AMCA 2VEPA 4TUFA 5IM51 5FEWA 3OYZA 1WDDA 1K4HA 1DPMA 4DZ2A 3COTA 3S6OA 5G1TA 5AKQA 1QNVA 3M47A 2NWSA 2PE4A 1EL3A 3FA4A 2ZRUA 3IIPA 2YL9A 2YSWA 4XTIA 3NVTA 4MY9A 1UUOA 4AVOA 2X41A 2JEPA 2BVYA 5HWCA 1JIBA 4UTHA 2XN0A 3LHVA 2V5LA 2V82A 1KBKA 3GNXA 4A3QA 4S3JA 3NGJA 4PUDA 3TYDA 3OIXA 2RFGA 1MFUA 3GYCA 1LL6A 4L4PA 3K4AA 1VIWA 1QO5A 3A4WA 3A5FA 4XAZA 3HG2A 1RSCA 2CBIA 1UZ1A 1YMYA 3N6HA 1QRQA 4LAWA 1ZFJA 3DFHA 4IMDA 1PBKA 1HO4A 1CBGA 2PTDA 1U2YA 4CNNA 2WMFA 3EMCA 4TX8A 1RH9A 4MUPA 3W1LA 4WIWA 4FXJA 3T9PA 4GVFA 3CV1A 1K4GA 2D69A 2IPGA 2Q6ZA 2I5GA 1LT8A 3GNNA 1SU5A 2EQDA 2QXWA 2PU0A 3SUVA 4B4HA 1PAMA 1B9ZA 2RJGA 3IHZA 1L2UA 4GC4A 2BOFX 2G8ZA 3IVTA 3VNZA 4C7DA 3KBNA 3GR4A 4PCFA 3WL0A 3IAQA 4NQ1A 3DI1A 3JW7A 4GH3A 4E8CA 5CPLA 4HN8A 1V5XA 1EO7A 3OQEA 2FFIA 5T9BG 4Q7IA 4I7UA 2BHZA 1NOUA 3PZUA 1EGMA 3OVGA 3RX3A 1XFBA 3CLMA 4K37A 1Q2RA 4PBEA 4JNYA 3AROA 3O5IA 2W92A 1YPFA 1PWLA 2J6XA 3E2RA 1OGGA 3SCRA 1XJBA 4DRMA 4HNLA 4LPCA 1FX6A 2CLOA 3LI0A 1ISWA 4V1XA 1W5NA 2GDVA 3L4WA 4MWAA 3DFYA 2EKGA 1TX2A 2TSYA 4IF2A 3W38A 1XDMA 2FIQA 4O53A 3ZT6A 3TVAA 4JX5A 5M3WA 3FFSA 4OUIA 4P7LA 2Z25A 3TC7A 4LUTA 3DX5A 4GH1A 1NMWA 3E74A 3AHTA 1LOQA 4KW2A 4LBSA 3UQBA 3AXXA 5I00A 3NQ2A 3MW7A 1VYPX 1QPFA 3DIPA 4B3ZA 4IQ2A 1F3WA 1QATA 2RGMA 2YCEA 3WDPP 3CUIA 4DWSD 5BXJA 1OJXA 4TQTA 1QNQA 1DE6A 3ZR6A 1E1FA 1XD1A 3PTKA 2O4QA 3KDNA 3APGA 1U5VA 3EWBX 2VVSA 1TJ1A 3AFBA 2IS7A 3M16A 1F6KA 2J66A 1X1ZA 1S2AA 2E6AA 3EWUA 3BLEA 4W93A 3PPGA 4TVDA 1VH7A 4ZVJA 3ZT5A 4JTCA 4LYQA 4DELA 5HQMA 1UIOA 3M43A 3TCEA 3TR2A 1ZHAA 1AMKA 2BV9A 4NU7A 1WPCA 1V02E 3G1HA 4LS0A 4AWSA 2VCAA 1Q6IA 3SCNA 2WZMA 2HNHA 3FHQA 1SFTA 6REQA 3E12A 3TX9A 1V7YA 4C6OA 4EKJA 5AOUA 3GDRA 3O5OA 3RYSA 1AQFA 4CD4A 4ONVA 1QHZA 4NJHA 3QKZA 1BVNP 2NX3A 2OZ0A 1RD6A 1CX9A 1EF2A 3IS4A 1IWAA 5IBXC 1N2VA 1H2JA 5CSRA 1A5AA 1EO5A 2E6FA 1F9CA 3OBAA 3OYXA 3VAVA 4ZMGA 1N8IA 2UZ5A 4B3KA 2PPNA 1GOOA 4JKLA 1U22A 3N4FA 1F73A 2R94A 6XIAA 3W76A 1IIHA 5CJNA 4O1BA 4PMUA 5GVJA 3E2SA 1I9CB 3TKFA 2VZSA 1AJ0A 1I2PA 2DJLA 1GONA 1CZ1A 4CNPA 4OHQA 3UG8A 1V93A 2INFA 3IWPA 2XFFA 2UV8G 1DJHA 1TPB1 3MMDA 4NAFB 4F0SA 4UIOA 3NPVA 3L67A 1S5VA 3UNDA 2Q3OA 3H2CA 5ECVA 5AYXA 2A0NA 4JEQA 2OWXA 3S42A 1HO1A 4AF0A 4KWVA 4CD7A 4P2VA 2Y8VA 3MV01 4HSHA 3MP5A 1S2VA 2ZTKA 1FRBA 1UR2A 4YYCA 3LUOA 3FJ4A 4FHAA 3LOTA 5H1WA 1C91A 1SO4A 1ITQA 2DPEA 2PBCA 4JCLA 2X2GA 3KUMA 4KS0A 1W9UA 1LG2A 4A8IA 4XSLA 3H8AA 1UHVA 5JH2A 2YLLA 2FH8A 4HSNA 4J2PA 9RUBA 3F4CA 3AZSA 3TIMA 3S6DA 4QBXA 5F7UA 4RXFA 3E2VA 3AMDA 3ICJA 1E51A 4O0KA 3R6IA 1QASA 1QI0A 2HBXA 5D2YA 2IKGA 1LM1A 2PLCA 5GNZA 4M8UA 2CHNA 2WVTA 8XIAA 3UJFA 1DE5A 4J4OA 4JHMA 5DIVA 2PDWA 4AHPA 4R3UA 4J3XA 3EYPA 3LQLA 3LU2A 3MVTA 4B5UA 2DGAA 2CFFA 4LF2A 1OABA 4H9VA 4HU0A 4NX5A 2YR1A 1JPHA 3NNTA 2MLXA 5DF0A 4HPGA 4XKYA 2Y89A 5KZMA 3DU0A 1TPH1 1DJZA 1V3MA 2XIMA 5FJPA 1OFRA 3FV9A 2YDQA 1XPGA 2G3NA 4MGGA 4W9TA 5HA7A 1TV4A 1QFEA 2Z6JA 3WH0A 3WNMA 4Y9OA 2FVKA 4DLMA 1EP2A 2GQ8A 1PYMA 2FKPA 1S5WA 4BHYA 3T07A 4A3YA 1X96A 2WSRA 1O7AA 2NSXA 4NYUA 2RDUA 5CPSA 2J77A 1EX1A 4E2VA 3WL1A 2WZTA 3N25A 2UY4A 5FF7A 1KM3A 2FVLA 5EGRA 1CW2A 1BWVA 4M1BA 4IPXA 2V0TA 1WDQA 4KEUA 5HUAA 3RM4A 4K39A 3MSGA 4UDMA 3W1RA 2XINA 2VL4A 4LJ3A 1GVIA 1ME9A 2QJGA 1H11A 1Q4NX 4O15A 3UZJA 4AZGA 1VR6A 3TWAA 4YTSA 4W4QA 1KKRA 3TNOA 2IMRA 1AL8A 4ZPVR 1XLIA 4GISA 1U33A 3T7VA 3UXAA 3VNKA 4DBWA 4E2OA 4R33A 4I8YA 3HTWA 4KCUA 3LX9A 3BLPX 1US2A 4HPXA 2RGLA 3VO0A 1JZ7A 3W6LA 4DO4A 1JPMA 1P0NA 5K9DA 4YCPA 4WDXA 1E56A 1DYSA 4U10A 4LV9A 3P81A 4LB4A 4HA1A 3ABQA 3LHTA 2ACQA 3RO6A 3N73A 1UWTA 3RNDA 4W85A 1YNQA 2YXGA 3WH8A 2CCRA 4C1LA 5K7JA 1SUXA 1E40A 3NSNA 3R8HA 4LWWA 4FOJA 1GTEA 2BMBA 3FAXA 5CPNA 3UCCA 2ZR6A 5HDRA 3PC0A 5HK4A 1XGZA 1Q5MA 3BAYA 2CZVA 4G5DA 2A6NA 1SZFA 2EPLX 3I7QA 1ICPA 3O6DA 2WKJA 2FHCA 1MDLA 1YDVA 2HEJA 1JGIA 4UOQA 3TSDA 3HZ3A 2E9LA 1XLBA 1SZNA 4LX4A 1WX0A 1EWEA 1NAL1 2GFTA 1SW0A 5DLCA 5M1TA 4CNOA 2OO6A 2ETNA 1S5TA 1HXJA 5KINA 3SW6A 4CN4A 4B91A 1FWEC 1PKMA 1BLIA 1ZB5A 4JTRA 2XPAA 4XK2A 2DZVA 2F9RA 4V15A 3SQSA 4Z0SA 4WX2A 3O1NA 4ICCX 3NL5A 4D8AA 2GUBA 2A2IA 1S46A 3P82A 3GM8A 3S9YA 4MSPA 1G5AA 3BAJA 2VT0A 1AD4A 3QZAA 4UFLA 2CBUA 3W75A 5B8IC 2GSEA 3GLCA 2I1OA 1JPIA 2PDUA 3HQOA 3MY9A 3N04A 3SIZA 1P43A 3A4XA 2FFCA 2UBPC 5DMLA 4AZHA 4A29A 3C2EA 2OCZA 2DT2A 2WO5A 3IJIA 3IVSA 4Z08A 1XC4A 3KHJA 5HWMA 1PZ2A 4B2DD 1P6CA 2Y62A 3AXKA 3PR9A 1H7XA 1RPKA 1EYEA 2DH3A 4S3AA 4PODA 2ZTJA 5REQA 1MQQA 1J11A 4A8NA 2C79A 4CKQA 4QJ3B 1FJDA 3EOEA 3SRFA 1QO2A 5HT1A 1O66A 5AYIA 3IK8A 1P7TA 4UZSA 3M4HA 2O7SA 4NP7A 5A6JA 3SZ8A 5BW6A 1GTHA 1PDYA 1GGOA 3DDMA 3P5YA 1OX4B 3KAGA 1JNSA 3A21A 2P8BA 1KKOA 1BGAA 3EWDA 4OBSA 3LLDA 4AHQA 1C8XA 1K9EA 1IV8A 1QR7A 1PCKA 1IZCA 4RE2A 3DHDA 4PB5A 4QHRA 3TYZA 2B7OA 3AIQA 3NQAA 4AMAA 3WLQA 5B7YA 3IV3A 4WDTA 4DI9A 4OE7A 2Q09A 2A4AA 1WCGA 3NQBA 5A5WA 1GOQA 3VKCA 1OF8A 2ZRXA 1K8YA 3CZ8A 1YLVA 1S2UA 3OOBA 3BURA 4EWJA 2W0UA 3WLIA 4AH7A 1OGSA 2GQAA 3VOIA 1ZCOA 5DANA 3ARZA 2C1IA 2Y7GA 3LBCA 4NHVA 4ZO6A 1UQZA 4RZ6A 1HGYA 1M6JA 1QCWA 3AS2A 1REQA 1MXGA 2D2OA 4NNRA 1MW2A 4OQVA 2W9MA 4N9EA 1W26A 2O4MA 5F4WA 2O9OA 4KGJA 2EBNA 4BQ2A 3ZM8A 1XH0A 3M41A 3GUWA 4QJ1A 2A3CA 1I2NA 2A3AA 1VJIA 3IAPA 3PRDA 2F84A 4DVOA 2G41A 2RDTA 4IICA 3PZVA 2R1PA 2X30A 1GG1A 1AW5A 3C0SA 2ON3A 3IJ6A 3MSYA 2RHGA 3EPNA 5FEZA 1KFWA 5I07A 2EXOA 2INEA 2WBGA 3GKAA 2QGHA 3IJLA 1TCOC 2VXNA 3CHDA 2Z28A 1KCXA 4Q6JA 3ZSSA 4JFIA 3BXWA 3W7IA 5HWJA 1PSCA 3EOUA 5I78A 2WZHA 3UZZA 3DENA 3CGNA 1H61A 5HNRA 4PEEA 5XIAA 1KBLA 3GXNA 2AQOA 2X05A 2PCQA 2DJXA 3HOJA 4BI5A 2DVTA 3AXIA 1FWGC 1VD6A 2GVEA 2HBVA 3GVVA 1L8PA 3UR8A 4L1XA 4UTLA 3BTNA 1ADSA 3W88A 1PE1A 4X2PA 4ZQRA 1Q1CA 3BLDA 2QAFA 3R43A 1T0OA 2CU0A 3LCHA 3RF9A 3BLIA 5FL1A 1DXFA 5D9NA 3KS5A 3A9BA 4UNKA 3VIFA 4IHCA 3D0CA 1Y5VA 4DXXA 1Z48A 1W37A 1TVLA 1HT6A 1JCLA 5T9CE 2X1RA 3R0KA 4N9BA 3NWRA 1OADA 1Z69A 3P60A 2UWFA 1FKDA 3BW2A 4Y8EA 4V28A 5G2HA 1I1XA 3CQHA 2NQJA 1UWAA 5BRBA 1LWHA 1KM0A 1Z32X 5GJNA 1BKFA 4GLEA 1OC7A 3NDYA 4UMAA 4TW8A 5K2ZA 2XUCA 3B0VC 1IT0A 3CJPA 3GSMA 2OOFA 3MCNA 4FO4A 4F0HA 4P7OA 5LA2A 3HBLA 4UR7A 3O3RA 5HOSA 2F4EA 1O68A 2Q71A 2YA0A 4F4RA 1BVWA 5I3FA 4K1GA 3B8VA 4UR9A 1EEXA 2CPUA 2EAWA 3PF3A 3L4YA 3O6YX 1F8MA 5I0DA 3N17A 2BDQA 3BCFA 4ZBCA 4AZBA 1IEXA 2VD9A 4DYEA 2ZX8A 3MMWA 5C9UA 4DJFA 4O54A 2BOEX 2IQTA 4JTHA 1QBBA 3GFYA 3OBEA 1TV3A 1H49A 3LPOA 3PB0A 9XIMA 1PYFA 2FDMA 3G6LA 4MB1A 4DZHA 3N2XA 1UG6A 3H2EA 2WW5A 3VNIA 3W2MA 4QCFA 3SQMA 1HVQA 5AHIA 4H2HA 4REQA 3UY7A 4TVCA 1R47A 4GJ1A 4C7GA 5CPTA 1O60A 2FZ8A 1RP8A 2XP9A 5FF0A 3IGHX 1ZP3A 1OX4A 1PX3A 4MKVA 1RALA 3GXMA 4PTWA 2TYSA 4NZJA 3I7SA 2YBUA 3TJIA 4M56A 3B4UA 1XRFA 3TDFA 3IACA 3EWWA 3UQAA 5D4YA 2OO0A 2EG8A 4DUXA 2H3BA 2F61A 3VNDA 3MBDA 4W9OA 3TTQA 3UGRA 3OZPA 1J0ZA 5C7VA 1FCVA 3LHWA 5ECUA 3O5JA 1TMLA 1YBQB 3KS6A 3QHNA 1AK5A 4ZS6A 3WBEA 2HPMA 4J7RA 1I2RA 3V16A 2LGOA 4YU1A 2CKSA 2B81A 2OQLA 5FJUA 1B2YA 5F4XA 5DN1A 1ZJHA 1WBJA 3M9YA 3W87A 3VDBA 1ZRQA 1EYMA 1IF2A 4XWUA 1TIMA 4HNVA 4Y9MA 5B80A 3EA2A 4RW5A 3HJZA 3LN3A 3W86A 3WYZA 3EIPA 1QI5A 3DZ1A 3LDVA 3PK7A 1EP3A 1EPVA 3T0CA 4F2TA 3GFZA 5AZ0A 3UZYA 1DJXA 3U2EA 2DZUA 4FNUA 6PTDA 3LMZA 4GYPA 4O1DA 1ITUA 5CJMA 5FJJA 2Y7FA 1Y65A 4EXAA 4P8VA 4C6IA 4RPQA 3N13A 1IT7A 3BE7A 3FAWA 2BXZA 5G2WA 3VI2A 3V7PA 4FK9A 1JYNA 3Q45A 5HJXA 1NOWA 3SCVA 1CIUA 3KOZA 3PWGA 2JKEA 4PRWA 5CZSA 3POCA 5LXEA 3SDOA 3TYCA 3PPFA 4JZ5A 4OV4A 1TJPA 3NXLA 1JNEA 3KOFA 2DUAA 1H7PA 1QOXA 4B5WA 1R2TA 3GG7A 4BY3A 4CGTA 1BVZA 1OG6A 2JF7A 2UZ9A 3CV7A 4RNFA 1TE1A 3KCJA 1E44A 1XH2A 5BWAA 3SCTA 3M6YA 2F8QA 5CSUA 3FDKA 1RAKA 4KQZA 3FSTA 4PL2A 1BPLB 4IGSA 3WX7A 3EXSA 1GWJA 2QPXA 1W1TA 3H4WA 3N12A 4S38A 1J2WA 2CHRA 3LYEA 2TODA 1AODA 4TIMA 5EFFA 2HISA 3NRKA 4I5XA 1OC6A 2PP3A 6ENLA 2DSWA 4UR8A 2HE5A 2PP1A 3FW6A 5AC4A 4M51A 3PTDA 4GC3A 1XKYA 3ZWTA 4CQDA 3UG4A 3RO8A 1CYGA 3PP7A 4QITA 3NPUA 1E15A 3WFLA 1OWQA 4KCTA 4LANA 6A3HA 7ENLA 4Y9AA 1VIZA 1N8FA 2IPJA 2OSWA 2R14A 4JX6A 4LRSA 5D03A 1VPQA 2VFGA 5C7HA 2IPWA 2CLEA 1JUEA 1K8XA 3CU2A 3DFSA 3G1DA 3LRLA 5LKYA 6TIMA 2E9MA 4IL2A 1E0WA 5IFTA 1V77A 4O1AA 3D3AA 1GVRA 2XVPA 1LQ0A 4N19A 1DIOA 3LSCA 3KBWA 3ZR5A 4PEKA 2G3FA 3VIHA 3TZFA 3NL3A 4AC1X 2NW0A 4L80A 1U1UA 4MWAE 2DW6A 1OQFA 4HMNA 1AMYA 3LZ5A 5E70A 3WEOA 4DF1A 4OU1A 4GI4A 3CWNA 4GIRA 4FSAA 2OT1A 2CZ5A 3WK1A 1M5YA 2XISA 3P5ZA 5JH1A 4PSRA 5G4EA 3SRHA 1UOKA 3THUA 3NQVA 4H8VA 3OZOA 3CMFA 3NL6A 4GQGA 1I1WA 3HO8A 1JUBA 4PMNA 2Z24A 5A2BA 1GYNA 1QPKA 4GYJA 4IQEA 3W1PA 3GR7A 7CGTA 2OKOA 5A6BA 4L5ZA 3OW1A 3WMBA 4DM2A 4JTLA 1ZPTA 4MAVA 1K6WA 3JR2A 1RV8A 3OLGA 5F2IA 4LVFA 1W9XA 1QK2A 2Y85A 3BJFA 3TW9A 3H2AA 2WCAA 5HATA 4ZA0A 4CQ9A 1X7FA 1A47A 3PJXA 2ZRYA 3USZA 2XM2A 1B3OA 1MO0A 4WGHA 4YMZA 4HOXA 5M5DA 1UC5A 2POZA 5CLWA 4E3TA 5JUVA 3HGOA 3RJYA 3WEZA 4ACZA 1R9XA 4ZOAA 1W9VA 4JEJA 5LHEA 3L7RA 3AIEA 1I60A 4PC8A 3HFYA 3N15A 4WVXA 2VRQA 4J3VA 1QW7A 5KSWA 1WKFA 5CGQA 3E0LA 3EEZA 4ZTXA 2W3ZA 1YIXA 2DVUA 1FQ0A 1HJQA 3I65A 3SBFA 2PLMA 4JQ3A 3NQCA 2YCIX 4QTGA 3BARA 3VKJA 3B05A 4H6EA 3PRBA 2HDJA 3BW3A 3JUGA 1UD3A 2YB1A 4PUWA 4F2BA 2DFAA 2GK1A 2R91A 3WF0A 3PTQA 2YLAA 1A5BA 3KVKA 4H8HA 4IZGA 1R2SA 4X63A 3B8UA 1E6PA 2PV2A 4LCSA 4NZ3A 3N14A 2PC8A 4I8DA 4OTKA 2RJHA 1IE7C 3QYQA 3OO2A 3EDFA 3XINA 5CG0A 3ZYZA 4BEQA 5A6AA 1KD0A 3GDBA 1CWYA 2G3JA 4BS0A 1XIFA 3P67A 3S3GA 2WSQA 2XDFA 9XIAA 3F7JA 3VIKA 2Y63A 3LSBA 2VI0A 3BZJA 1XIMA 3CEPA 2JE8A 1WV2A 3LCGA 5E9AA 3O5DA 4XAFA 3NM3A 1TPFA 1S39A 1F07A 2BVTA 2DZSA 4I6VA 3GXDA 4B3LA 1M01A 3MUZ1 4ACZB 3KCLA 2JIEA 3ABOA 4B5TA 4E2DA 1JRCA 4IIEA 1PJ9A 3WLRA 3EDEA 4I9MA 6ALDA 1X38A 2B7NA 3QOKA 4U31A 3FXYA 3SIMA 3VIIA 3BICA 2PDIA 4I9TA 2WCGA 2HS6A 1UP2A 2R24A 3LRMA 2DIKA 3TYUA 3O5EA 3APTA 3DH7A 2R1KA 5FOOA 3QM3A 4HYWA 3L0NA 3RMEA 4KEVA 3FYPA 2O56A 2EGZA 4YN5A 5J5RA 2WXDM 3WELA 2A1YA 4FN2A 2VJXA 2IW0A 3IV8A 4EPDC 3GH7A 3KL5A 4D8ZA 1AL7A 2QCLA 3CHEA 3BOXA 1KM6A 3L0GA 3OU8A 3L65A 2QJMA 3KP1A 3VCRA 2NV2A 7TIMA 3EKGA 4FLQA 1XDJA 4ZB5A 4PMQA 1XF0A 3GTYX 1W3HA 2ANUA 2BGNE 1EYWA 4V27A 3NUKA 4Q8WA 1H5YA 1W1ZA 4WUIA 4PMOA 1ZBCA 3V5FA 1ZJAA 3R4IA 5HPCA 1Q6HA 2TPSA 4O16A 1LRTA 5EBAA 1RQHA 3GU1A 1ZUAX 2OLAA 4XD3A 1PCWA 1CGVA 4L4OA 5E09A 3TYEA 1IHIA 4IM4A 2BZNA 5FACA 4LXFA 1VRDA 4H7ZA 3VAWA 4AX6A 3T0BA 1V8EA 4JTIA 3WDQA 3UPWA 3WQWA 1J12A 2VZOA 1JI2A 2X0SA 1EEPA 1PX8A 4C7FA 4JNZA 4WEVX 1PUDA 5BOEA 4JX4A 1A0EA 2X7VA 5REQB 1Q3NA 1ICQA 4NILA 2P88A 3BJSA 1T7LA 4UWMA 1SFLA 4CN1A 3F03K 2Y78A 4IG2B 4UNIA 4B16A 1CPUA 3SURA 4CD6A 5DFAA 3ZWSA 3P84A 4S3GA 1KNWA 4X61A 5GPRA 4E8DA 1VQTA 5K9XA 1BXNA 4WR3A 1GQKA 2OZ8A 2PWFA 4JPGA 3CUFA 4FF7A 4ZQMA 2GQ3A 5DT5A 1JCJA 5GNXA 4IUGA 2NUXA 1B3VA 1F3EA 2DIEA 4XSMA 3M0LA 3W24A 3ELFA 1EJSC 1EX5A 3ARRA 3SUUA 4US6A 2C71A 2FPVA 3IIXA 4AXKA 3ZJ8A 3B0UX 5C9RA 3BLFA 1P0DA 1I2QA 3RU6A 2A79A 1TCDA 2GJLA 2ZIDA 3CGMA 2Z1KA 4C02B 4RNIA 4ACYA 1R2RA 1NEYA 3LTSA 1K9TA 1D7KA 1OHLA 4C6DA 1BXCA 4RZBA 1KGUA 1FKHA 4XZBA 4RE0A 3N9RA 3AJXA 4AIUA 3VIGA 3ONBA 5BOFA 1PZ0A 1VEOA 2DT3A 4DO6A 3WJWA 2L5HA 4EVZA 2E5CA 4JYEA 2ZA3A 4UTWA 1GQNA 4IT1A 4ADUA 1KFEA 3DHPA 5A3HA 3B8WA 4XKMA 3ZJKA 3P62A 2CWXA 1LCOA 3VPLA 1AJZA 3M07A 4MNJA 5EA9A 5A6MA 4JIHA 3UG3A 4DJDC 1FWNA 1AH4A 1OCBA 4AEEA 4NZCA 1J01A 2Y8UA 4W8AA 4HIBA 1Z8AA 3T0AA 1FKRA 1SZGA 1V3JA 4E4PA 2GUYA 1U1JA 3ITLA 1BD0A 2E09A 3FXGA 4DRHA 4GRSA 1XLAA 2GWGA 4GCAA 3UD6A 4LFYA 1JFXA 3W37A 2RKXA 3S5SA 3B9EA 3W25A 1NP0A 3ZSTA 1ENUA 1UPPA 1ZJBA 3F4NA 5EMYA 3KX6A 4TU1A 1E0XA 4U85A 1Y7VA 4A8LA 1XBZA 3UG5A 3LGEA 1HX0A 2QJJA 4D6JA 2NV9A 2DT1A 3WUFA 2OZ3A 3ARVA 4IOTA 1RA5A 1MW3A 1F4AA 2PPOA 2ZBTA 3ATZA 3EDJA 4O0ZA 2Z26A 4B5SA 3T81A 1O1ZA 3VUPA 2QIIA 1LQAA 2BLEA 4MUZA 4RNHA 1FKIA 4R0XA 1HW6A 2EHHA 2VDIA 1W5MA 3HGJA 3BMXA 1PDZA 3C52A 1PVNA 1C8VA 4GUHA 5LSMA 2E6DA 3UVAA 4BJHA 4DNHA 5HQLA 3CZEA 2Z29A 4JN6A 4AVFA 1Z6KA 1EDTA 4A3RA 1UKPA 4AC7C 5A6BD 3E0WA 1UWUA 3IUDA 3FVMA 3T8QA 4LS1A 3QPEA 3KW3A 3IJDA 3LGGA 5CSYA 2BASA 3VGBA 2XH7A 2HVOA 3TTOA 2I9EA 2H90A 3KAFA 2HXTA 1E55A 3FNDA 2W63A 2XIQA 4AIBA 1XD0A 2GPTA 3OZYA 4RR4A 3K30A 1IQ8A 3DFNA 2ZXAA 1XLKA 5DCBA 2XG9A 2VX4A 3SM0A 1LYXA 2FZMA 2V2CA 2WMGA 4H9MA 4K1WA 3KAOA 1U83A 3U2CA 4NASA 3GHTA 5I09A 4AD5A 3OOQA 1HL9A 4K38A 3BWWA 1FWCC 1JVWA 1RPXA 1C90A 1FA2A 3QZEA 2ONEA 2MUCA 4XB3A 1D3CA 3WH9A 3W22A 1JEZA 2NXGA 3ZVHA 2WYSA 4GJIA 4HJWA 2DSVA 4RL3A 3U9IA 2FTPA 2A85A 5CKSA 4Q4KA 2B31A 4AD4A 3SUSA 4I9JA 3AMLA 2HS8A 3UI5A 4JR5A 4FMVA 2Z2BA 3RLUA 3VNMA 3VKKA 3B3DA 5A6TC 1EJWC 3KBJA 1ONXA 5BRQA 3MB9A 3NM1A 3L4VA 1SR9A 3V5OA 2W61A 4UOZA 4Y6GA 3LPPA 1LOLA 3AIVA 3WH7A 2FMNA 1TR1A 1ONRA 3T42A 4IUOA 1OX6A 1OVDA 4JIQA 3RITA 4AZCA 1W2PA 4X3ZA 1EC7A 1M7PA 3AOFA 1XG3A 1J4EA 3G1VA 1ZLPA 4GBDA 3ECQA 5CBIA 4FR6A 4BF5A 2PEVA 3GX9A 4MY1A 4JXCA 2VCBA 3CC1A 3GXFA 4HGXA 1C3FA 2C13A 4OOUA 4FX8A 1P5QA 4OFCA 2GYIA 2IKIA 3A3WA 4CN6A 3FA5A 3GDLA 4ZSTA 1PS9A 2YBTA 1VCGA 2X16A 4C6MA 4DJEC 2I57A 1UMLA 2BY0A 4A22A 3AUOA 5C2CA 4DIAA 1M9HA 3MDWA 1GKRA 2H8XA 4Y96A 2C19A 1EC8A 1A5OC 2G3MA 2VFIA 2ATMA 4Z2KA 3E3HA 2MLZA 4D8LA 3SCQA 1Q85A 3PNZA 3TC6A 3WO8A 1FWSA 3WDRA 3SN4A 2RUDA 1VHCA 4IXXA 5DXYA 4H6KA 3EGJA 4AISA 3TP4A 1LZOA 4HU4A 1UASA 1YNYA 2GGGA 4UQCA 1Y0OA 2ZA2A 1UKSA 3KWSA 3URAA 1QW9A 3V36A 3W6YA 3TCSA 4HOWA 2XP7A 2I16A 3BZGA 5TIMA 3JZUA 2EPKX 2HJPA 2A7PA 1HKKA 3GNRA 2X1TA 3EX6A 1V79A 1EJTC 2GWNA 3T55A 2C0HA 3EA3A 3L5AA 3EWZA 4US5D 1JDCA 4UZUA 2PS2A 1N55A 3WQPA 2NUWA 5LNUA 3IGSA 3QHOA 1GQLA 1OFAA 4JY9A 2YZRA 4JICA 1XCWA 1FWHC 1UR1A 3M0ZA 4JIIX 1OINA 1Z7AA 1YRRA 1HJXA 4A2RA 1IWBA 1OF6A 1VBRA 4IPJA 5C0QA 1K7EA 1FWRA 2PGFA 4XBSA 1WDWA 4IPNB 2D0HA 3DBNA 3CT2A 2VKZG 5JIPA 1OSEA 3PZ9A 1OFBA 4MMWA 4FS9A 1F4HA 4PH6A 5B7ZA 2ZQTA 1YTDA 2VGIA 5J04A 3UYIA 1JGMA 5BMXA 5ABHA 8A3HA 3LENA 1R3VA 1L9WA 2ZUMA 5TQLA 2Y7DA 5DY3A 2Y7EA 2KI3A 4Q22A 4MF4A 3CASA 4JFSA 1D7JA 5MHBA 4EP8C 3QYSA 3H22A 2WMHA 5D9OA 5TNVA 3HB9A 1DWIM 5EMLA 2EJ1A 4YHGA 3O5QA 2ZRZA 3BCDA 2Z2UA 3PA7A 3S5OA 3S9ZA 3UA3A 1NJJA 4PMDA 1M7XA 3GXPA 1PTDA 4H00A 1E5NA 5DELA 3TYBA 4F48A 3T08A 2B5UB 3TWBA 1E70M 3MV11 1E4MM 3TROA 1E0VA 5EB8A 3OHMB 1MQPA 1F6PA 1RY0A 4P61A 4QEEA 2OG9A 4DJFD 3VOGA 3PSVA 2VRJA 4PBGA 1VYSX 3KBSA 5I98A 2YCLB 4PMYA 4M6QA 8XIMA 4Q4SA 1UBSA 4NAEA 4L6HA 3LXBA 1EB3A 4DIPA 2XFYA 3KTSA 4YTUA 1QMLA 1XIEA 5LIUX 1E3ZA 1B9BA 1AH0A 1E4NA 1PO9A 5F2MA 1J6YA 3PVFA 3OZMA 1HZYA 1A5NC 5HW7A 2XVLA 1B57A 5ENLA 3NQ6A 2W79A 1TKKA 3TA6A 1W1PA 4F66A 4DYJA 1E72M 1EGVA 4DAIA 3ITXA 4C5ZA 1DL3A 2GDUA 1HN1A 2J7CA 2J8FA 1FBAA 3CZLA 2QF7A 1Q7QA 3NL2A 3UT0A 3H4GA 3ORWA 3PJWA 3AICA 2VOTA 2HZGA 1X6UA 5U4NA 1XYCA 5BXTA 4RKAA 2PDYA 2G50A 4QLKA 1JD9A 2WVVA 2JKAA 1A5LC 2NQZA 3ME3A 1O6IA 1QUMA 3T44A 1SPQA 1KC7A 1Q4WA 4O0QA 3EOSA 4W9PA 4GPNA 4X22A 1Q6DA 5G1YA 3GH5A 3GU2A 2D0FA 1P0BA 5D30A 3M1ZA 1GYMA 3G2GA 4JY8A 3MI6A 1TO3A 4TO8A 3HURA 1XV8A 4YYFA 3NI6A 3WK2A 4RDVA 4IQLA 3ARSA 5FAGA 3TLQA 3H21A 5FSDC 3OG3A 2XZ9A 3T78A 5GNYA 3EXTA 4CCZA 2XIIA 4LYRA 4TOQA 4GIYA 4FXRA 4DBSA 3MUCA 4M81A 4XZHA 4ZB2A 1E0TA 3UXLA 1FVPA 1P5BA 3CUGA 3AYVA 4UQAA 2FJKA 3DHUA 2G37A 3M46A 1GZJA 4HNUA 3LY0A 3EB2A 4RE4A 1NWSA 2BP1A 1XCFA 2J78A 4Q4RA 3KE0A 4QSHA 5C2XA 3MKKA 1SJAA 3GHSA 3AJ7A 1NTHA 1W8SA 3GC4A 3OB8A 1Z89A 1XISA 1W54A 2DUXA 3NG3A 3VM5A 4QZVB 1J6PA 1NF7A 2MANA 1IR2A 5TD4A 2XM1A 1EFZA 4RNJA 5KMYA 1PBGA 1UMYA 5BXSA 1RCXB 1GPWA 5HXMA 3GU9A 1UWRA 1EBGA 1TTPA 4IJRA 2B7QA 1NWTA 2KGJA 1V6WA 3G24A 3LBOA 2HXUA 3T2OA 2KZHA 3VD9A 3EEGA 1UR9A 3A22A 1ZALA 1AQMA 4YCOA 4HSOA 2B7PA 1JJKA 3MVIA 1NSJA 3DEQA 1R9YA 2X8RA 4LUYA 4AZ5A 4C91A 4WK9A 4Q8QA 2Y5JA 3IANA 1GQJA 2DUZA 4KQNA 2VUYA 2ZVIA 4RV8A 2VR2A 4O13A 5C9ZA 5K4XA 1JZ4A 3FIGA 4XZWA 4R85A 1UUQA 3UZWA 4K36A 2Q02A 3DC8A 1V4YA 4U33A 1KTBA 3W26A 3DGRA 5I3GA 1LORA 4IXHA 5D38A 4LAMA 3EX1A 1AZ1A 2YA1A 2YFOA 4O50A 3N19B 1JCHB 5A2CA 4PUNA 1SFJA 2E8YA 3K4WA 3CXOA 4EACA 4G1NA 2OMAA 2MPHA 1F61A 5CQ1A 4S3DA 3PBMA 4S2CA 1M04A 2XVNA 1VCFA 4AFYA 5LYRA 4OVXA 3D47A 5BNKA 3VX0A 1A5SA 2YPIA 4AEOA 1TPC1 5DT7A 4NI3A 4PTNA 4ORMA 1XLMA 4WJEA 2DZTA 1FOBA 3KXQA 4NNAA 3UCDA 1XRSA 3POHA 4C60A 4YWIA 4N4QA 4HD5A 3WDJA 2CZEA 1D9EA 1FWJC 3O6AA 3LCFA 3I6TA 1JYVA 1KQYA 1SZEA 2EKCA 3PHAA 4ADTA 4QIBA 1ME8A 2WVUA 3I68A 4M5PA 4NXKA 1RY8A 4GNJA 3H23A 2BGSA 2WZEA 2P4VA 3JVAA 5BROA 2HROA 4KMQA 1SZRA 2AAMA 3WNLA 4AY1A 3QSRA 4ZTYA 4U28A 2C1HA 2A3BA 2ZZ7A 3R25A 4NIRA 3ITVA 4JNMA 4FAMA 3WD4A 5BYWA 4W8BA 1KT1A 1XUZA 2P3EA 4MFDA 2AKZA 3BDKA 2QAPA 4JFKA 2WHKA 4HMEA 5A6LA 3KVMA 2EPOA 4IJBA 3A64A 3RCNA 1EA9C 2ZZ3A 1OM0A 1WKYA 4FALA 2ZE3A 5FL0A 1YTKA 2YJQA 2IQDA 2CZFA 2J9XA 3R1ZA 4ERAA 4DRJA 2PDKA 4X0NA 4IH3A 4IMFA 3DC0A 2ZC8A 4B92A 1BXBA 4P5UA 1BF2A 5FKYA 1TX0A 2PURA 2Q3RA 1VFHA 1FWAC 3LD5A 4N02A 4NT0A 3VD3A 4CEXC 3SCUA 2D3NA 4QAWA 1RA0A 1ONWA 1YQ2A 1MNSA 2EF9A 2OT0A 3D46A 4DWSB 2Y61A 2CESA 2J62A 3H7RA 1BWLA 3KABA 2XIJA 3G1RA 4LSBA 2DZWA 1K3UA 1GQIA 2C0AA 5HMEA 3MMTA 2RUSA 3M0YA 4Q4PA 3TC3A 3LHYA 4PMZA 3MSDA 3U7VA 3ZO9A 3PFRA 1XLHA 3DHFA 1FKLA 1K70A 1TFVA 1IXOA 4ASTA 1KRBC 3THDA 5LZLA 3CNYA 4DBUA 2FYMA 2CLPA 4E4FA 1ZK6A 2Y2WA 1JCNA 3VDGA 3PJUA 1PZ3A 2RUQA 1T40A 2BVWA 4QS6A 3QFWA 1J10A 4MWAC 2F6KA 3TN5A 3T1GA 1H7RA 1EJ7L 4D72A 1BGGA 4TX9A 2WNZA 1W1A1 4TMCA 2OZTA 2VOMA 1WUEA 3TQVA 3UA4A 3I6EA 3KBMA 4ZO9A 2ISFA 2ZWZA 1SJBA 3W02A 4PN2A 4UQBA 3MYOA 1OCNA 3WBWA 5HR7A 5HMFA 1UYQA 4WRHA 2N87A 4MWAD 3CPGA 4IIGA 3OVRA 2PPGA 4C1KA 5AB3A 2NX1A 1ZL1A 1C8YA 5A69A 2UY2A 2WNNA 2QJHA 1WDSA 3IARA 3VIPA 3SCSA 5D04C 3NO3A 4MADA 2AAAA 1XDLA 4ZO7A 3GXIA 1HKWA 3PUGA 1IGSA 3CAVA 3SGZA 1JZ2A 3WQDA 5C5YA 3SY1A 5C2GA 1F76A 2ZXDA 3DOPA 1D3GA 9CGTA 1RK5A 4I9AA 4NG3A 1D7FA 5L9FA 1XYZA 3H12A 4NJGA 2DY3A 4KETA 3KTXA 1LWIA 3CPRA 3REQB 5I23A 4GXMA 4PL1A 2QJIA 1XBXA 4GI6A 2BBFA 3CO4A 4FNSA 4ROQA 4ZOBA 3GTFA 3A5VA 3P6LA 1AVAA 4ICNA 5JH8A 2MNTA 3ES8A 4IX0A 4RK8A 3AXMA 3DFQA 5I3KA 4NKCA 2A7NA 1GZ1A 5I02A 4NZ5A 3VKDA 4WOZA 1OYBA 2V8ZA 3SCWA 3W71A 3MO7A 2ZVRA 4EOUA 4YJ5A 3RK8A 5LNVA 1EUNA 4H6RA 5IBXA 4AXNA 4B9YA 5AECA 2JF6A 1F8AB 4L1GA 1J4HA 2WPGA 2WZIA 1EIXA 5A2AA 2X09A 3WQEA 5CLTA 5HJLA 2W27A 2CIPA 1WOAA 3W74A 3WQGA 5HKGA 3G3MA 1M68A 3TONA 1HJUA 3HA1A 2PDFA 1H3GA 3BLOA 2FZBA 2NVCA 3QRHA 1V0LA 3JXVA 1KCKA 2AKMA 2NUYA 3QFEA 3IKDA 3JRKA 4O19A 4HK5A 3WDHA 4BF8A 3SI9A 3VGFA 3W2LA 4J4KA 2C16A 4ERIA 5CG7A 4AHOA 3CQJA 4WSHA 3TJLA 5LNSA 3GNDA 5EL1A 3U3HA 4DWSC 4BQ3A 1FWFC 5A8QA 3WQOA 3TJ4A 4GVGA 2BHUA 4FLRA 4RE3A 1YDYA 1NVMA 4WXZA 4JDBA 4GCXA 3U0HA 4A2SA 3H2MA 1R3YA 1PKYA 3V0UA 1V7AA 1L8NA 4CCCA 5FJTA 1A5KC 1RCQA 5DIUA 1S38A 2GOUA 1R7AA 4FX7A 3VE9A 1Y5XA 5KETA 2EEXA 4GQRA 2YCLA 4EK7A 4IGNA 1K77A 4I7WA 1QI4A 2OKTA 5IHRA 4MWAB 2VP8A 1E4IA 1S2CA 4DRSA 2GJXA 4O11A 2QNEA 3QY6A 4PYSA 1VFMA 3VM7A 4PUEA 4QCEA 1XP3A 1E1CA 4KCVA 1TYGA 5ABFA 1RXOB 2ISDA 3DI0A 4QIUA 1W5PA 4GGHA 2V67A 2XN1A 2PSNA 4AD2A 5IOBA 1YPIA 1MXDA 3CV6A 3P74A 2J9YA 3VOCA 4U4MA 4D6HA 1G4SA 1UQYA 2E77A 2QVNA 1XYBA 4IT6A 3I3EA 5CCZA 4QDWA 5HNUA 4LNCA 3GIYA 4ZPWR 1TWZA 4ZE5A 3W53A 1XC6A 3JYJA 2VR4A 1S5MA 2O92A 2XWEA 3KRUA 3IK2A 2POTA 1QJWA 2VEKA 4GKLA 3PZOA 1S1RA 1K03A 3QR3A 1XR2A 2QCFA 3UJ2A 2NT0A 4F0MA 4H04A 4M19A 1VPYA 3IJ8A 5I2UA 2ZUTA 4TXEA 5CZ0A 1C7TA 1CDGA 2YYTA 3O9NA 1TELA 1PWMA 2PWUA 1NM9A 4GWEA 1B4EA 1IEVA 4F9DA 3AYTA 2V38A 4DXVA 4DQWA 1JR1A 4A21A 4Z2IA 2PC4A 4MZ1A 2BTMA 2V69A 1LLWA 4J3WA 4IGHA 1VLWA 3V5CA 4UQDA 1J79A 3BLLA 3GVRA 2XIBA 2V3EA 5BZAA 3EB3A 4DJFC 4MLRA 4KWOA 4UTTC 3GTHA 1E73M 1C9DA 2CLKA 4URIA 2WB5A 2HV5A 3Q67A 2FH6A 3Q4DA 1TZ7A 1OC5A 3O06A 5HTGA 3WK0A 1VC4A 3H24A 4E2BA 2BOGX 2A5HA 2F2HA 4PTVA 4DJDA 1VBUA 1AUSL 3DYOA 2AQVA 4IPLA 2GJNA 4LVBA 1U5HA 2IF4A 4CNTA 5D8ZA 5AVNA 4PUUA 1RBOB 3GAKA 3B40A 4HHMA 3NURA 4PRTA 5A94A 3VCNA 4QNWA 3C3NA 5DQPA 5DEZA 5HMDA 3NXFA 5FSEC 1ITCA 2ZZ2A 4AUBA 2CXGA 2YW4A 3VC5A 4LAXA 4GUFA 1D7HA 4JYDA 2ZR5A 2GQ9A 1OK6A 2PPPA 1TVPA 4Y8FA 2JK2A 1UP0A 4DM1A 1E9LA 4L64A 3O63A 2JZVA 1OFOA 2B4GA 2DU2A 5KZEA 5RUBA 4DUWA 4KRTA 3P0WA 4LAOA 1H7WA 1UCWA 1OT2A 3W7LA 3RHGA 1K6AA 3H53A 4IGMA 5D09A 2ZUSA 3ZOAA 5HPOA 1YADA 3I7RA 3I3BA 5ABFB 2QUNA 1EDQA 1QT1A 5AC6A 3GS6A 1K02A 4BI7A 3LPFA 4R9XA 3C56A 4Z2GA 4ATWA 4YXGA 5FEXA 3GK0A 1VBHA 2UY3A 3OGSA 2QCDA 2Q8LA 3F4WA 1X7IA 2I5QA 4YTQA 4HBKA 3MUIA 3EWCA 5G4WA 1GORA 4S23A 3TFXA 1CGYA 2D2JA 3HQPA 3PZNA 1OCJA 3C0JA 4I5RA 1M5WA 4HKPA 2GL5A 2JALA 3T0TA 1REQB 2PBOA 3CZKA 2HNEA 1K9FA 3ZMRA 1FCUA 1OGBA 1FKXA 1J8VA 2LJ4A 1NQKA 4ZQPA 1SJDA 3TJXA 2FMOA 5I03A 4QG9A 4MLJA 5DCDA 2OR2A 5EY5A 3VX1A 2PTWA 3I4KA 3W23A 4AY8A 1S3TC 1MUWA 4TW7A 2L2SA 3C61A 3KAHA 4JFJA 1TRDA 4HNOA 1XH1A 3W01A 4QJ5B 4AIEA 5JXQA 1A53A 5DBTA 1KGXA