2DSWA

Binding of chitin-like polysaccharides to protective signalling factor: crystal structure of the complex of signalling protein from sheep (sps-40) with a pentasaccharide at 2.8 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dswA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dswA01
1UA3A 3SUUA 3OZOA 3W82A 3QOMA 3GBEA 2PBOA 1E71M 3O6AA 4AIEA 2BNJA 3WD4A 3UERA 5KZ6A 4W88A 2A3HA 3M6DA 1V3JA 4NSBA 5BROA 1MW2A 4P7LA 1PPIA 1GPFA 1US2A 3AXIA 2ZIDA 1PAMA 3HJEA 3VNZA 5C8BB 2BY0A 2VX7A 4IUGA 1VBUA 4AEFA 2DT1A 1UR2A 4GQQA 1C93A 2Y24A 4JCLA 4AZBA 3VGDA 4WJXA 5BXSA 3SCWA 1TA3A 4UZSA 2Z1KA 3WUGA 5A6LA 1DWIM 2J78A 5IHRA 4K68A 5ECUA 5LA2A 1K9TA 1H11A 3OLGA 4W5UA 3L4UA 4CD8A 1CXFA 3MMDA 4DM2A 2ZUUA 2WZHA 4LYPA 5A6BA 1EDQA 2BFGA 1V3MA 1M04A 5I77A 3WH6A 4UQDA 4NRSA 2EPNA 3WH9A 1W2VA 4S3JA 3ALGA 1E15A 3AS1A 1H0GA 1E6RA 1EOMA 4P7QA 1B0IA 1WP6A 4DM1A 1PIGA 2XWDA 5EB8A 3CMJA 1JFXA 5D9PA 3NIYA 2YJQA 2J77A 3CUIA 2C0HA 2XVNA 3PZMA 2OSXA 1CNVA 1MXDA 5M03A 1HKIA 4AZGA 4BS0A 3WF2A 2VZOA 4N0RA 5D9OA 4UOQA 1VEMA 1C3FA 2AMGA 1GOMA 3AICA 1HJWA 3VUPA 1FA2A 3VM5A 4CN6A 1UWTA 4MAZA 1J10A 2YA2A 3GH7A 4LYRA 1MFVA 1JNDA 1DWJM 3BC9A 1QW9A 3G6LA 1GCYA 1WDSA 5E09A 3UETA 3SEPA 1LL6A 3NDZA 1E0XA 2DDXA 3VD4A 1F4HA 2O92A 1CWYA 3U5UA 1NQ6A 4W89A 2OLHA 2GK1A 2FH8A 4BA0A 4KRUA 2W63A 5AYBA 1W9UA 2E40A 3EBVA 5FKYA 4D1IA 1EIBA 2BXZA 5E6YA 3T2PA 1P6WA 4WK9A 2WHLA 4JL2A 2O9OA 4UOJA 3WDRA 1UZ1A 3ARSA 5A6AA 1VRXA 3W6MA 4AD1A 4A3YA 3RM9A 1TE1A 3K8LA 3KWXA 1WDRA 3AMDA 4F79A 3OBAA 1G94A 1L8NA 3N04A 1V03A 2WXDM 3THDA 1MVYA 1UKTA 3SCQA 4ACYA 2G3IA 1D2KA 1EQCA 4ACZB 1B2YA 3PZOA 4HZ7A 3U5YA 7A3HA 3BAIA 2CBVA 1JGIA 5BYWA 1W9BM 4J27A 4MB1A 5DF0A 4NZCA 1BTCA 1CGYA 1QI3A 4DWSA 1MQQA 4KH2A 3UG5A 2V5CA 4AIOA 2Y4SA 4UZUA 4BCEA 3B9AA 4JIEA 1PX3A 5A6SA 2DSKA 4H2CA 1CTNA 3WEOA 3EDFA 4AWEA 2ZUNA 1J18A 4DUWA 3CZ8A 1W3HA 3L4WA 5BWFA 3AHYA 2DEPA 3RM8A 1V08A 1BG4A 3BH4A 4UOZA 1XCWA 1UR0A 2GVYA 3SUSA 3OLDA 4JFUA 4OUEA 3CPUA 3CUJA 2YDQA 4KWUA 4U2ZA 4OBSA 4JKMA 2CHNA 1C7TA 2VZSA 1WAWA 4HU0A 3PZ9A 3N1AA 3VX0A 3MMWA 5CXPA 3W26A 5A69A 2XJ7A 2A3AA 1KBBA 3CBWA 2GFTA 5AY7A 2G41A 2VO5A 2G4FA 1UQYA 5IFPA 3ARPA 1X6LA 3T08A 5AC4A 1DWAM 4KRTA 3TTYA 2VT0A 1V3KA 4HPGA 4L4OA 2DIEA 4WF7A 1GOIA 1XV8A 1J0JA 1W1PA 2WSPA 1NWRA 1GQJA 1Q6GA 1XH1A 2NT1A 1HIZA 4H8VA 3THCA 3ARYA 4D6CA 1C8XA 4UFLA 3WL0A 4W84A 3AIQA 4FLOA 2YDSA 5HPOA 1EQPA 4H41A 4CD6A 4QDMA 1GNXA 1VEPA 1JZ6A 3SCVA 1BG9A 2XG9A 1Q6FA 2W5FA 2X0YA 1E5JA 1JZ8A 4YN5A 1ODZA 3ZJ7A 4JHOA 1UWUA 4PCSA 1JYWA 3FN9A 4MB4A 4CU7A 1GVYA 2CITA 1CYGA 5D4YA 1JAKA 1OSEA 4CD5A 1FHDA 3QHNA 4F66A 1BYAA 2VRJA 1W2PA 5FCZA 2Y5EA 2WBKA 4MDPA 1JI1A 2XWEA 3VIHA 2J8GA 1E4IA 3WNLA 4DUXA 2DT2A 2FHFA 1GQKA 1K9FA 2ZUSA 1GW1A 2YIHA 3VGHA 3PHAA 2OSYA 5LYRA 3KL5A 4P7NA 3FAXA 4PMOA 5I3DA 4ZE5A 4OJYA 3ZSSA 1J0IA 1VBRA 1ZBKA 3A6OA 5A1AA 4PSPA 4J3SA 2VX4A 3N12A 3WQ4A 3GYCA 2OWCA 1OCQA 3N17A 3PZIA 3NYDA 4F9DA 3TONA 3CH9A 1C8QA 1OGSA 2Z1SA 4WKHA 4PCTA 4PMVA 1E40A 3CO4A 2VCAA 2WCAA 3IJ9A 2EBNA 2D23A 3WEMA 1ZB5A 4MPKA 4X0NA 4LGXA 2UY3A 1C8YA 3KE0A 1UH4A 2PBGA 3VKKA 1E6ZA 2BVDA 4W87A 3VGGA 2E3ZA 2FH6A 4U31A 1TR1A 4LX4A 2GUYA 1KWKA 1HKJA 3ZO9A 1UKSA 2BHYA 1JXJA 5IHSA 4UCFA 2IUZA 4KGLA 1Y7VA 1DHKA 4YHGA 3L4XA 4TX6A 4AXNA 1OT1A 3VVGA 5F7UA 1GUVA 3B9EA 3VNYA 1UR4A 1WZAA 2VMFA 4IISA 4GZIA 4QCFA 4EAMA 4OKDA 4B9ZA 3OG2A 2V5DA 2WVSA 1E73M 4MNMA 3VPLA 3VDBA 3SUTA 3IJ7A 1Q6EA 2ZOXA 4AD3A 3WUBA 3VD5A 5E6ZA 5JBEA 1HL9A 2Y2WA 1UWRA 3L2LA 1C91A 3WENA 2Y8KA 4AYSA 1QHOA 2XM2A 3WL1A 3OA5A 3POCA 3LPPA 1W32A 3WD2A 2E0PA 1UQZA 1TG7A 3SCRA 3F5LA 3M7SA 2BXYA 3VMNA 1SMAA 4N42A 4RE2A 4GI8A 3ZT7A 4D6DA 5ABFA 1SMDA 2V3DA 5E0CA 3WNNA 4PTVA 3FY1A 4QAWA 3RMEA 1GHSA 4GI6A 2YDRA 3OLIA 1CGTA 1NOUA 2F8QA 4AISA 3ZIZA 4GI9A 2WVTA 3WDPP 5JIPA 4UQAA 3VIOA 2PWDA 2JIWA 4UFMA 2VZVA 1ZJBA 1XGZA 3AROA 3NCOA 3KZSA 3WUFA 1JZ4A 3W81A 5HOSA 2ZX8A 1F4AA 2X1IA 2O9TA 4RL3A 1GVIA 2ZX6A 3IANA 3D5HA 1H4PA 1QNOA 3K4AA 1NP2A 3QHOA 3WKZA 1G01A 2EQDA 1SR0A 3SCOA 1GQLA 4W8LA 2VX5A 3MANA 2YL8A 3VTRA 3EYPA 2VZTA 2BY2A 3IJ8A 4M81A 3U7VA 3DECA 3GXMA 4H04A 3ZQ9A 4AZHA 2JF7A 1CGXA 1JZ5A 2DH2A 1CGWA 3QOKA 4XZWA 1QNRA 3WMCA 2WC3A 1LWHA 1TCMA 2VRQA 4A3HA 1U30A 2W66A 2WW5A 2BHZA 4FLQA 4PUDA 4Z2LA 4MB5A 1EHNA 2OSWA 1LWJA 2VQUA 1KCKA 1UD2A 2WCSA 4EE9A 4UQEA 2VX6A 1OGBA 2CYGA 2J7BA 1XHGA 1DWFM 4WKAA 1MFUA 5HDRA 2XIIA 2J47A 4QLJA 5CLTA 3I3DA 4Q7NA 1JNEA 3K8MA 1UA7A 5HNNA 1JDAA 4D71A 1UZ4A 2WVVB 2FHBA 1HX0A 1W3JA 2GJRA 6CGTA 4AEEA 5EFDA 3CZKA 1FFRA 4CCCA 3GDBA 1KXQA 4QP0A 3CUGA 1B3YA 2PWHA 3NUKA 2CEQA 5D9MA 4CKQA 3VU2A 1HN1A 3K46A 3A4WA 3CUHA 5BRQA 1Z32X 2CPUA 4LQ1A 3T0DA 4LPCA 3GBDA 3RO8A 4X9YA 1JIBA 1W9XA 2XVGA 1GOWA 2WSKA 3N15A 4F8XA 3AS0A 2ZWZA 5AYIA 2W91A 1V6YA 1ZL1A 1V6WA 1B31A 3BAXA 2JALA 3ARTA 3WNPA 5JBDA 2CKSA 4HA1A 1RP8A 1CXKA 3WBEA 1UD8A 2A3BA 2WKGA 4NI3A 3VMOA 3W27A 4LYQA 4ACZA 1V3HA 2FGLA 4AC1X 4Z2HA 3OGRA 4MJ2A 2WC4A 1JYXA 1B3XA 2XYLA 5CZKA 3OGVA 4AD5A 1GOOA 1ZJAA 3T09A 1UYQA 3AISA 3MUZ1 2BVTA 4HA3A 4A4AA 1ZU8A 1D3CA 5BCAA 3I3BA 4TVUA 1ZS2A 3ZSTA 3EDDA 4KGJA 2VZUA 2D3NA 1BVZA 3WDHA 1B3ZA 2EPKX 1PZ2A 3F4VA 4FLRA 1O7AA 1BGGA 1VB9A 3OZPA 1W3LA 4DWSC 4CCDA 8CGTA 4UNIA 1J0KA 2BHUA 2JEPA 1ECEA 1ISZA 2PC8A 3WDIA 1HKKA 1C90A 3VIKA 1VFUA 1K6AA 2YKKA 2VOTA 5BRPA 3RDKA 1ITXA 4JZ5A 4U33A 1GORA 2WHJA 1BPLB 1C92A 3TTOA 3WQ8A 3RJYA 1FH7A 4ZEPA 3K8KA 1X1NA 1MWOA 4AW7A 1JDDA 1XCXA 2QV4A 1PJ9A 2J7DA 2GDVA 1V02A 2WHKA 3UR7A 2DSZA 3W0KA 1BYCA 1QI2A 4IM4A 3WH7A 3W24A 4M56A 4FF5A 3BAYA 2G3MA 4PRWA 3TTSA 1O6IA 4D72A 1L0PA 3MV01 2WHMA 2WNWA 3W38A 3F5JA 3W28A 5LA1A 1TFVA 4GIAA 1AMYA 4JKKA 3DYOA 3M46A 1EO5A 1LLOA 1WZKA 3CZEA 2QMJA 5DFAA 2XTKA 3W4RA 3AI0A 4B9YA 5BXTA 3RPMA 3A47A 4W8AA 4GPNA 2G8ZA 3BAWA 3AIUA 4PTMA 1KGWA 3CZLA 5A2BA 1R7AA 3CHDA 4HOZA 5CPTA 1UD3A 1W91A 4RE3A 4BQ2A 2XIBA 5JBFA 3VDAA 1FH8A 1QI0A 4ZE4A 2DSWA 2RGLA 1JZ7A 1CXHA 2WMKA 2D0GA 4XB3A 1V02E 3VO0A 3QGVA 4J3TA 5JIWA 1VF8A 1FP9A 2C7FA 5CLWA 2XFYA 5A8PA 4PTXA 4ATLA 3CGTA 3UCQA 1DP0A 5KEZA 2OYMA 3SURA 2WYSA 2QF8A 2FGZA 2XGBA 2YA0A 2ZX9A 4H8UA 2F2HA 1CBGA 3VD3A 1SYTA 4UR9A 3AZRA 4U2YA 1UD4A 1S46A 2XVLA 5A6KA 4JKLA 1RD6A 1X6NA 2WKLA 4H8HA 3U57A 4D6JA 2O9RA 4B16A 1CXLA 2DPEA 5ABEA 3GNPA 5AC5A 4JHZA 1GOKA 1K9DA 2UY2A 1KCLA 2W4XA 2WANA 2PWEA 5M5DA 3VIMA 2ZUMA 4JFWA 1J12A 1MW1A 1W9DM 1EXPA 5A8NA 5HXMA 1R87A 1E72M 4E8CA 5EMYA 4BF7A 5CSYA 1OB0A 2V38A 1VFMA 4CD7A 1EDGA 2ZUWA 4XV0A 1OT2A 5BXRA 5BXPA 5M3WA 4URIA 4R5EA 3ZJ6A 1ZBCA 5GQBA 2VVSA 3BLKA 2ZXDA 2C8NA 4DUVA 4JCMA 2JF6A 1KGXA 4W7UA 2WWCA 3GXFA 5GNXA 5A8QA 1BGAA 4PMDA 3CZGA 3WD0A 2WMFA 1CGUA 2J4GA 4U3CA 3MS8A 1WDQA 3EMQA 3CHCA 2DSVA 3NDYA 3RM4A 1H2JA 2IXUA 2CCRA 5CG0A 4PUEA 1OIFA 4FLSA 2ZXAA 3WSUA 3EMZA 3AS3A 2XSBA 4Y7EA 4DWSD 3FW6A 2E8ZA 4CU6A 7TAAA 3WQWA 4J3UA 4Z2KA 1E1EA 4HTYA 4YHEA 5FL0A 1QVBA 4W8BA 2CETA 1WCGA 4C7FA 3ARRA 2D2OA 4Q22A 5ABGA 1J01A 1VJZA 2WLZA 2V3GA 1PZ3A 1WB0A 5DEZA 1TZ7A 5DO8A 3WNOA 1H41A 2NW0A 4AIUA 4W86A 1R8LA 3ZJ8A 2YA1A 5E0FA 1JAEA 3IAPA 3PZNA 1V6UA 3GXDA 4WSJA 1H49A 5I79A 1UR1A 4GZEA 1E9LA 4AZCA 4JAWA 2ZICA 1KXVA 3LMYA 3GH4A 4BQ3A 5JUVA 1HJQA 1V3IA 2D20A 3PZQA 4MB3A 1KXTA 4PYSA 4AZIA 1QPKA 3DYMA 3I3EA 4P8XA 4FK9A 3WFLA 5D8ZA 1HJXA 1JXKA 3RCNA 4MADA 9CGTA 4U5KA 2GSJA 1A3HA 3AFBA 5FOOA 3MSDA 3WIJA 4MAVA 2W67A 5JH8A 2DQXA 2V3EA 4ML4A 4HZ6A 1IT0A 2XVPA 3MSGA 5ABFB 4HP5A 4M80A 3VIFA 3FHAA 3QR3A 4E4PA 3HU7A 4HMEA 1V3LA 3CMGA 3WH8A 3CHFA 1GHRA 2YBUA 3UR8A 4CVWA 1UR9A 1UWIA 1MYRA 1XD0A 2DSUA 3ALFA 4UFJA 5I0DA 1KQZA 2VUYA 3VILA 4E8DA 2OYKA 4CVUA 3AMGA 1W1YA 5DT7A 1EH9A 2VNCA 2VJXA 1HJUA 3A3HA 3BSGA 4MDOA 1E5NA 4CUCA 1HVXA 4MNLA 3VIJA 4PMUA 1UKOA 1IZJA 2D24A 3CUFA 3OB8A 5HPCA 4AD0A 2D1ZA 1JF5A 3WY1A 3FXYA 4AMCA 2XSAA 3WDQA 3AIBA 4MTVA 1G1YA 1N82A 4GKLA 1QNSA 1J0ZA 1RPKA 2JFEX 2WAGA 1HXJA 1TA3B 3KEHA 4AY1A 3WD1A 2VRKA 1HNYA 2VR4A 1ESWA 2Q8XA 1FH9A 1VJSA 3KL3A 8A3HA 5TD4A 4TVDA 4TXEA 3RJXA 2DH3A 1LF1A 2EPLX 5I78A 4TTUA 1FHLA 4ZXLA 5A6JA 4UQBA 2E4TA 1CLXA 4PEEA 2HISA 5A6BD 4AZ5A 2VTFA 2J8FA 1MW3A 4BQ5A 3MU7A 3J7HA 2XPKA 2VURA 2X8RA 1GONA 3M07A 1GOQA 1BSIA 5A8OA 1KWGA 1E4LA 3MV11 2BVYA 4J3XA 2CBIA 3DYPA 1ISXA 4GQRA 4JL1A 4GINA 2WK2A 3ZM8A 4XZBA 4HOWA 4PMXA 1IV8A 3GH5A 3B8SA 4PTWA 4W93A 3W29A 3VIPA 3EDJA 1UUQA 3TA9A 2PI6A 3BMVA 1AQMA 1KFWA 3AYRA 5C71A 5CGTA 1QNQA 2QPUA 1LG2A 1E6NA 3L4YA 4OOZA 2HVMA 3WEZA 4R27A 4OBRA 1JFHA 2YLLA 1HKMA 1VFFA 1M7XA 3A4AA 4J3WA 4D6GA 3T2OA 2GJXA 4OIFA 1KXHA 2W62A 2VQTA 5M17A 3JUGA 4UFHA 3ZT5A 3GXIA 4F9JA 3PZVA 5FL1A 5A8MA 1UWQA 1CGVA 1CPUA 2J74A 2JEQA 3W6LA 3APGA 1E4NA 1W1TA 2WMJA 3ZT6A 1QNPA 4GZJA 3PZGA 1OWQA 2WLYA 5CGMA 3B9DA 1V0NA 1NH6A 1DWHM 3AYSA 3GNRA 1QHZA 3NSMA 4OZOA 5GNZA 4B3KA 3D3AA 1JG9A 2CESA 3SCTA 3N9KA 3ARVA 2ZWYA 4J3VA 1MW0A 2WMIA 4LXFA 1I1WA 4HMDA 1YHTA 2F61A 1ISYA 3GTNA 1UD5A 3HN3A 1V6XA 1TUXA 4D6FA 4GXPA 3II1A 2PF0A 3L4ZA 3WQ6A 3UESA 1LL4A 3MO4A 2ZX5A 4P8VA 3VIIA 2VR5A 3WF1A 1BYBA 4RE4A 1SFSA 3PZUA 2XM1A 2A3EA 1M53A 4EKJA 5CJ5A 2VL4A 1LQ0A 2VC9A 3WH5A 1I75A 4MNJA 2VCCA 1JF6A 3S2CA 4L4PA 5CPQA 1CLVA 2XGIA 3AZSA 2DGAA 1EDTA 3VIGA 2ZUVA 5E70A 4FMVA 3ARQA 1UH2A 2XHYA 1OD8A 4NRRA 1U2YA 3AXHA 1WKYA 2RGMA 2WMIB 5EBAA 4PMNA 1PIFA 1UWSA 1WPCA 4UQ9A 2GJPA 4HOXA 5EFFA 5FIPA 2E9MA 3UEQA 1HP4A 2JIEA 2E8YA 2W61A 2QHAA 4OOUA 2BY3A 1HP5A 1E3XA 2WZIA 4UTFA 3TP4A 2WMHA 1NOFA 1Q4NX 4W85A 3WD3A 1EHAA 6TAAA 2ZE0A 1XSJA 4C7DA 1JD9A 1MQRA 3TOPA 4PMRA 4PMYA 2J7HA 2O9PA 4WLCA 3T2QA 4CCEA 2EEXA 3WQ5A 2VVNA 1QW8A 1WO2A 1JI2A 1TVNA 2WB5A 1BFNA 4AD4A 5A6MA 4PMZA 1W3KA 3AOFA 4CGTA 4ZXOA 3IAQA 3PTMA 3W25A 1JYNA 6A3HA 4DWSB 3EDKA 3UG4A 4WKFA 1NWUA 5FD0A 3VMPA 1E1FA 3AHZA 2A3CA 2XVKA 5DMYA 3VX1A 1WZLA 2PWGA 4XUYA 2ZUTA 1V0KA 3KL0A 1DTUA 1E43A 1V0MA 1H1NA 2CERA 3VM7A 3ECQA 2J7GA 3SCPA 2W92A 1GZJA 1XD1A 1B90A 4M29A 1R85A 1XYFA 3WMBA 1J11A 1JYVA 1XH0A 1RP9A 3K4DA 3CIVA 4E2OA 4AD2A 1PEZA 2G3NA 1BHGA 1CXIA 1U33A 1H0IA 3VGEA 4J7RA 1IZKA 5GNYA 5E9AA 2V3FA 2CXGA 2EO7A 5D9NA 1QI5A 4CN1A 4QLKA 1JD7A 3CLWA 3VGFA 1JL8A 1PX4A 1AVAA 1KQYA 3UG3A 1J0YA 1W1VA 1B30A 1GJWA 2E9BA 2ESCA 3ARZA 1E6QM 3DHUA 4AZCB 3ARXA 7CGTA 2YBTA 1NM9A 2Y8VA 2WZEA 3AIEA 4EK7A 3WFZA 1UKQA 1FP8A 3SUVA 5ABHA 2QLYA 1CDGA 1LL7A 2EXOA 4TUFA 3N13A 4Z2IA 3L2MA 3EMCA 3SUWA 4M24A 3N18A 1K9EA 2EJ1A 4GO9A 2WPGA 4M1RA 4ZFMA 3FNDA 3IK2A 5A95A 3RILA 3VD9A 3BAKA 4PSRA 3WMSA 1QI4A 1J9YA 3VOCA 2QMKA 3LPOA 4P8UA 3BXWA 3W37A 2FHCA 4D6EA 2YOCA 4YPJA 5DT5A 5LA0A 4WIWA 4XX6A 4ATDA 2YL9A 2CBJA 1M03A 3BMWA 1JZ3A 2EPMX 3WF0A 1CENA 1NWSA 2DT0A 3L4TA 1KR0A 1NOWA 2WVVA 1E4MM 4P7RA 1OM0A 3WNMA 2J79A 1ZBVA 2UY4A 1WNOA 1BLIA 1XSIA 1E6XM 3ZR5A 2D22A 2GJXB 4B3LA 4V27A 4V2XA 4BZYA 3LPGA 3E1F1 2J7EA 4AZ6A 2J62A 1EO7A 1VENA 3WQVA 1ISWA 1W9PA 4PBGA 3GZAA 4HPHA 1KR1A 4PMQA 2X2YA 3AMLA 3RIKA 3L4VA 2WBGA 3AMKA 5I23A 2UY5A 2CKRA 2E9LA 1E70M 3WN6A 1RH9A 1TVPA 3ARUA 3WF4A 2ZXQA 3MUAA 1ODUA 4UFIA 5I6SA 1VIWA 2OWWA 1VAHA 1QHPA 4AZ7A 3BLPX 1B1YA 2WMGA 1JDCA 4HZ8A 4CU8A 1BVNP 1KB3A 4TX8A 2DT3A 1CXEA 2VCBA 1J0HA 3WDJA 4TVCA 3AIRA 1DWGM 1LG1A 3A4XA 1DEDA 2YL5A 1MXGA 4Z2GA 1I1XA 4GO8A 1HF6A 1CIUA 1UHVA 1EA9C 3QHMA 3WF3A 4EANA 1E56A 3LPFA 3MKKA 2PWFA 2YLAA 1QOXA 1VEOA 3VD7A 3AHTA 3AIVA 4Z2JA 1FFQA 2AOSA 3OGSA 5I2UA 4CD4A 4X0VA 3WNKA 1G0CA 3F5KA 2X05A 3VINA 2NSXA 2ZXBA 3GNOA 4U3AA 4D6IA 1HT6A 1D7FA 3OLEA 4HMCA 1BYDA 1XYZA 4CN4A 3ZR6A 3AJ7A 3NSNA 1B9ZA 2OWXA 3K1DA 3ZJKA 5A94A 1E0WA 2CBUA 3SCUA 5I5RA 4QCEA 4V28A 4W7WA 1V0LA 4QFUA 1EOKA 2BY1A 1CEOA 2GDUA 4H7VA 2WVUA 1AQHA 5CPSA 4UQCA 1LJYA 1NWTA 1HJVA 4ATWA 1B3VA 1UD6A 3PTQA 1PBGA 1ITCA 1E55A 1OBAA 2D3LA 3MUIA 2OYLA 1BQCA 1VFOA 4JFVA 3GM8A 2CIPA 5A2AA 5CQ1A 2G3JA 3O2LA 1W9VA 2IXVA 2J25A 2XUCA 5A2CA 2WCGA 3NSXA 3AS2A 3SIMA 3ARWA 4MNKA 3U7BA 5I24A 5A3HA 2ZX7A 2CNCA 5IXEA 1NARA 5D8WA 2DIJA 2PB1A 1H3GA 2XFFA 4PN2A 2CHOA 2JE8A 3AHVA 2B31A 4W5ZA 2WM0A 4NF7A 1BF2A 3NJ3A 3AMCA 1UR8A 2J7FA 4P7OA 1US3A 2D0HA 1E0VA 3HMCA 1A47A 1NP0A 4C7GA 2MANA 4WSKA 1HVQA 1OIMA 3PN8A 2D0FA 4HU8A 5HBFA 2J75A 3DC0A 3FHQA 1WZMA 1ZBWA 3MMUA 3WELA 1GJUA 3WBAA 1C7SA 3BCDA 2TAAA 1E6PA 3AIWA 3SCSA 1OINA 1QBBA 2GK1B 1R86A 1UKPA 1XC6A 1M01A 3N11A 3VDHA 4D6HA 3EDEA 1Q6CA 3TTQA 1BAGA 4IPLA 5GPRA 1WDPA 1ISVA 1CECA 1H5VA 2AAAA 5IDIA 2UWFA 2BV9A 2XFRA 4MJ4A 1B3WA 4JFSA 4KMQA 3T0AA 3BAJA 1WE5A 4M82A 3BCFA 1JZ2A 3S6TA 3POHA 1E3ZA 4QLLA 3AHXA 3DHPA 4TTGA 1GQIA 2WC7A 3WUEA 5IFTA 3PTKA 3AZTA 4P8WA 3BSHA 1UH3A 3AQUA 2BS9A 3O9NA 3VGBA 1Q6DA 1XSKA 1FOBA 1QBAA 4M8UA 5C70A 1TMQA 4D1JA 4U5IA 1HL8A 1KGUA 4J28A 4B15A 1G9HA 1XRVA 2VI0A 5CSUA 2J7CA 1XH2A 2X09A 3MUY1 3W53A 2QPSA 2WWDA 4ZENA 3SCNA 4W7VA 1YQ2A 1UG6A 3PBGA 1G5AA 1V6VA 4BQ4A 3ZMRA 4UFKA 1H09A 1OGGA 1E6SM 1UOKA 1KBKA 1EGZA 3PZTA 2YL6A 1HJSA 4HA4A 3T0BA 3CZJA 3FAWA 2FDMA 3BGAA 3CHEA 3AXXA 1R7OA 3OIHA 2EPOA 4TOQA 1OD0A 4IPNB 2X0HA 1AQ0A 3VDCA 1PX8A 2NT0A 1CZ1A 3CTTA 4JFTA 4S3KA 3ZOAA 3G6MA 1MQPA
chains in the Genus database with same CATH superfamily
5EBUA 3LRKA 2QGHA 4HSNA 4DBWA 2NVDA 4DAIA 1PZ1A 3WD4A 2O55A 3WQGA 2GJNA 3F4WA 4S1FA 4NSBA 3BOLA 5DCBA 4WDUA 3T55A 3JRKA 1GPFA 2CZVA 4J9JA 5AC8A 1PAMA 4LOCA 3G5EA 2LJ4A 1HQTA 5C8BB 2VX7A 4OTKA 4IUGA 1YW5A 2DT1A 1UUOA 1XC4A 4AZBA 1IYXA 3S5SA 4B91A 3PPGA 3UJFA 4N19A 3TQVA 5A6LA 3GTIA 5K9CA 5FF2A 3RFWA 3BMBA 4K68A 2EJAA 5D03A 4GFIA 5C0QA 1H11A 1LDCA 3L4UA 4CD8A 3PK7A 1XXXA 1ZGDA 1TELA 3QFWA 5A6BA 1EDQA 2BFGA 2PDBA 3MBDA 3DEQA 4HIBA 2IMRA 3WH9A 1K4GA 3KDOA 3ALGA 4YU1A 4NZ3A 3CUXA 5I3HA 3UF8A 2XWDA 4L5ZA 1YBQB 5EB8A 5ECVA 2Q6ZA 3TUUA 2Z2AA 4NUWA 3TNBA 1SO4A 5DRCA 5DCDA 3KVJA 3UWYA 1DHPA 1CNVA 1FKBA 1MXDA 4Q6JA 5M03A 1R5YA 1HKIA 3Q4DA 5MKGA 4FR6A 4GWEA 4HGXA 4Q3MA 3WF2A 5I3GA 4HT3A 5D9OA 1XYLA 3PG8A 4UOQA 4F2TA 1C3FA 4MGGA 3I6CA 2QJGA 1TPB1 3VUPA 2I17A 1EX5A 4C60A 4CN6A 2YA2A 4RDWA 4LYRA 1S5TA 1JNDA 3W2JA 1IQ8A 3G6LA 1ADOA 5E09A 3UETA 2DDXA 3PSVA 3TYAA 2GUBA 1DIDA 3UJSA 4JTGA 1CWYA 1FRBA 5I06A 4AY7A 3UPWA 3W7KA 2OLHA 1LZOA 3KBVA 3QR0A 1HO4A 1TWIA 2YCJA 4KRUA 1KBLA 3B05A 5KETA 4D1IA 4R9OA 2I56A 2BXZA 2JKEA 4XWUA 5E6YA 3BLDA 3SQSA 3WLSA 3QKZA 3WDRA 3S2LA 2MLXA 3W6MA 2PCEA 4AD1A 3GD6A 3TV8A 4DXVA 1T5AA 4QISA 1WUFA 1S3TC 4LVAA 2ZC8A 1WDRA 4F79A 4FB7A 3OBAA 5CKSA 1G94A 1PINA 3HZ3A 1SM9A 3THDA 1D7IA 1UKTA 4HYRA 3SCQA 4NILA 3NURA 2G3IA 3LHZA 4ACZB 3BQ6A 3PZOA 4Y2WA 4Y8EA 3DESA 2CBVA 4DIPA 1PKMA 8TIMA 4L56A 4J27A 1LLZA 2DVUA 4GIYA 2J6VA 4HYVA 5HNTA 3IIVA 4KH2A 2V5CA 2Y4SA 4UZUA 1O60A 5A6SA 3O0FA 4O13A 3OYZA 4H2CA 4US5A 4GH3A 1ROTA 3LXCA 4A8RA 1D7JA 4TMCA 2PPGA 2H9AB 3UWVA 5H8MA 1IWPA 1OZQA 3CZ8A 3L4WA 5BWFA 2DEPA 4CLMA 1BG4A 3JR2A 3CEPA 3S5ZA 3BH4A 3RGCA 1DQUA 7REQB 1XCWA 4QS5A 2QKFA 4OUEA 3M0ZA 1XKJA 4U2ZA 2CHNA 2R8WA 2VZSA 4HU0A 3PZ9A 3N1AA 5L6UA 3VX0A 5CXPA 4DLMA 2QW5A 2QUVA 2FKPA 3EXRA 1KBBA 1PWLA 4FNSA 4HPNA 1Q6LA 1SUXA 3LUOA 1UJPA 3GC4A 4C65A 1X6LA 3KCOA 3T08A 4DRMA 1C9WA 4KRTA 1G6CA 1F07A 2RURA 3W7QA 3H4XA 3BICA 4H1ZA 4HPGA 3IUDA 1KKOA 4WF7A 1GOIA 1EA0A 2PSNA 1NWRA 2VEGA 1Q6GA 1XH1A 2NT1A 1LROA 5D04C 4GUIA 1H7NA 1QDSA 1K6WA 4D6CA 2RDXA 3KWSA 1FWTA 3WMLA 3AIQA 2YDSA 5HW6A 1EQPA 3U9IA 1N8FA 1ADDA 4UTKA 1JZ6A 1PTDA 2X0YA 3VXGA 3N9RA 4YN5A 1ODZA 5REQB 5HWBA 5C54A 4PCSA 1CI1A 1JQVA 4IQEA 4JNYA 2ODOA 4MB4A 4GHRA 2PP0A 2CITA 5C9RA 4HHHA 1JAKA 4EF9A 4MY8A 3RXZA 4CD5A 2ISWA 1BYAA 1WXZA 1W2PA 1AW2A 3WG6A 3MKCA 2XH4A 4M1BA 4O0QA 4PTNA 4Q4QA 4AX7A 2A7NA 2DT2A 1OC7A 2FHFA 1DYSA 1TPDA 4YTRA 4IFOA 1KM4A 4FZIA 4J3ZA 4QIUA 3VGHA 5LYRA 4GIRA 3FAXA 4ZE5A 3WK2A 3UXAA 1PL9A 3ZSSA 4AVNA 1J0IA 1VBRA 3G1YA 3A6OA 4XZ9A 5A1AA 3C0QA 4J3SA 3OQEA 3WQ4A 4AFYA 2OWCA 1K4HA 3QW4B 1FBAA 1H7XA 1C8QA 1OGSA 3O06A 3S1UA 2X30A 3UZJA 4WKHA 1E40A 2O4QA 2VCAA 2WCAA 3XINA 1I2NA 3O5RA 2OOFA 3SIZA 4LGXA 3R58A 5D02A 1FKHA 3LCLA 3MBFA 1V79A 1EF2A 2E3ZA 3BSMA 2HK0A 1OK4A 4IIDA 1KWKA 4DI8A 2BVWA 4DEFA 3NZ1A 4UCFA 3T4CA 2WJZA 3DI1A 4TX6A 3STCA 2OEMA 1OT1A 3W7IA 1GUVA 1WZAA 2VMFA 4IISA 3G1FA 4OKDA 5CPMA 4PB4A 3FDGA 3UP8A 4MNMA 1QRQA 3VDBA 4G2DA 2ZOXA 1JR1A 2E25A 4AD3A 2J66A 3VD5A 3RMJA 3BLOA 4LCRA 1EZWA 4JYDA 4Q8NA 1Q8JA 3ES8A 1C91A 4K6AA 4EWND 4AYSA 3O6DA 1FAPA 1UASA 3WL1A 3M5VA 3C0LA 3OA5A 3POCA 2ZRUA 3RRXA 2RHGA 3W3OA 2EHHA 3M7SA 2IQ0A 3FV9A 4RE2A 3B0YA 4AMAA 5D09A 3IRDA 5ABFA 5CSSA 4BF8A 3WNNA 3RG6A 3CO8A 4LT9A 1OCJA 3OQ8A 3LS9A 3I7SA 3I7QA 1BF6A 2F8QA 3NRKA 3ZIZA 3M0JA 4KS0A 2WVTA 3REQB 3WDPP 3CHVA 2Y6ZA 3WJYA 3KZSA 3W81A 5HOSA 2O9TA 2J9YA 4DF1A 1KFBA 4RL3A 1LCOA 4DRQA 4AIBA 4ZOAA 3D5HA 3K4AA 3E0FA 1GQLA 2VX5A 1ZAIA 4WHBA 3VTRA 4I6KA 3LRMA 3U7VA 4DHGA 3DECA 3CMFA 4H04A 3NEHA 2VGFA 3HTWA 3N9SA 1B54A 9XIAA 4LY8A 1CGXA 4I5RA 3QOKA 4XZWA 2P50A 1JNSA 2VFFA 2VRQA 4A3HA 4UB9A 2PDUA 1U30A 1SJBA 3A9IA 3PBWA 4DO6A 4FLQA 1P43A 1M68A 1REQA 1PUDA 1O12A 2QUMA 2WPBA 4UQEA 4G1KA 1OGBA 5HDRA 2WQPA 3D3FA 2H8XA 1LRTA 2V30A 3E2VA 3F03K 4C1LA 3I4EA 4QLJA 4IUOA 3I3DA 4Q7NA 1RAKA 3N73A 5HNNA 2H8ZA 1PCKA 2WVVB 2FHBA 1HX0A 1RA0A 4AEEA 5EFDA 3VNJA 2HXTA 1P1MA 4QP0A 1B3YA 2PWHA 1PS9A 3KRZA 2CEQA 4OV4A 4CKQA 3VU2A 4FSAA 1HN1A 3UBPC 2V82A 2OT0A 4QE4A 1NELA 1Z32X 3T0DA 3GBDA 1EFZA 3RO8A 2XVGA 3C56A 3N15A 1OYCA 3N2OA 2W91A 3AWNA 2PPPA 3KVLA 3FA5A 3O5GA 3S9ZA 4L72B 3BJSA 3SN1A 4HA1A 1RP8A 1CXKA 6ALDA 3PUEA 1W31A 2WKGA 3VMOA 3W27A 2FGLA 4Z2HA 2J9XA 2J27A 4EF8A 1SZGA 5CZKA 2TRSA 1OFRA 1TCOC 4H83A 5G2IA 4D2JA 4ZB2A 2D2JA 4QIBA 4RZ4A 1VBGA 3CL7A 4WXZA 1KA9F 2BVTA 2OGYA 1ZU8A 1QTWA 2Q5AA 3KZ7A 1D3CA 5BCAA 1FKTA 3QXBA 1ZS2A 4YNGA 4JDYA 4KGJA 2VZUA 3WQDA 1Z6KA 3ABXA 2EPKX 1JQXA 6ENLA 2OPJA 3T4WA 4DWSC 3EOOA 8CGTA 5I7GA 2JEPA 3GKFA 4QNWA 2PC8A 4LWWA 5F4WA 3VIKA 3IV3A 2YKKA 4US6A 1OEPA 4L6HA 2Q3RA 4B2DA 2VOTA 2XP8A 4A21A 3O16A 4DZ3A 4Z42C 1GORA 1BPLB 1J6OA 1L9WA 2NV1A 4LUYA 5AHFA 4ZEPA 3K8KA 1X1NA 1MWOA 4EXBA 1OYBA 4JX6A 4JQ4A 3U4AA 2KFWA 3HIJA 3P81A 1GVSA 1RD5A 2PCQA 3STPA 3VE7A 2DSZA 5HWMA 1BYCA 1QI2A 2HE8A 4IT1A 1XM3A 2EG8A 1XLGA 1HO1A 2ZBTA 4FF5A 4QAIA 3BL3A 3LBCA 3TTSA 1S5NA 1L0PA 3DI0A 3MV01 2YB4A 4LSBA 5C2XA 2PDKA 3H26A 3UD6A 3C52A 1TFVA 4LNYA 4JS3A 4JKKA 1EO5A 1M7PA 3CZEA 1FKLA 2CWXA 2D2GA 5LNSA 4XTIA 4HBEA 1PVNA 4OGZA 1XDMA 4W8AA 1A5LC 4AVOA 4QHRA 3CHDA 1GT8A 4RZBA 2Z6IA 4RE3A 5JBFA 1QI0A 4KIRA 3G8EA 2DSWA 1UUMA 3N6JA 5AHLA 1JZ7A 2D0GA 1V02E 3WLKX 4MLRA 1OX6A 1Z42A 3QGVA 5JIWA 1VF8A 2C7FA 4PTXA 5C6MA 5KEZA 2VXNA 3PG9A 2IQDA 1K8XA 4G50A 3PAJA 4L7ZA 2EULA 1O5XA 4LB3A 2IKJA 1S46A 2XVLA 4XQ6A 2FZNA 2WKLA 4B16A 4ADTA 3RITA 5ABEA 1BWVA 4FIQA 1XQLA 5BOOA 3GNPA 2GPTA 3RYSA 4LV4A 4JHZA 1K9DA 2UY2A 1BL4A 5FEXA 2WANA 3BLEA 1U1JA 4QS6A 3P67A 1FCQA 4MWAD 3JW7A 3UWQA 3WQFA 5EMYA 3UJ2A 1P7TA 4NZJA 3NGJA 5CSYA 3G22A 3C86A 1DTNA 1J8VA 3S8HA 3LRLA 2NQHA 4NASA 1EDGA 5G1TA 3KOXA 3FKRA 2ZADA 3MI2A 5M1TA 4R5EA 3OVGA 2PRLA 3MO7A 4RXFA 5DBTA 5HNRA 3BLKA 3TCSA 1ZP4A 4NJHA 5GNXA 3MY9A 1P0NA 5FJIA 1S2AA 1BGAA 4PMDA 1TWZA 2WMFA 3I7RA 3EMQA 1QWKA 3P82A 8RUCA 1H2JA 2CCRA 2BP1A 1TV7A 1UR3M 2WJDA 1P0EA 1IT8A 4GE8A 2BLEA 1FQ0A 3EMZA 3AS3A 1GOXA 1A80A 4Y7EA 2PLMA 7TIMA 1WBJA 4CU6A 4NYUA 3TZFA 4HTYA 4YHEA 4DYEA 4NHVA 2FVLA 1WCGA 3THUA 3LQGA 4GVIA 2WLZA 3ONBA 1WB0A 1TZ7A 4J4KA 2NW0A 1MDRA 3W01A 2QDDA 2QUNA 5I09A 4NXSA 1R8LA 2YA1A 1FCBA 3PZNA 3L7RA 1JRBA 3GXDA 1QOQA 2ATSA 3ID7A 3N6HA 1LQAA 1UR1A 4DH0A 1SFLA 1FDYA 4DPPA 3DFTA 1NSJA 4WJEA 4LAMA 4JOMA 2NVCA 1FKGA 1KXVA 3BPWA 4BQ3A 1XIDA 5JUVA 2NXHA 1KXTA 1TQXA 3B03A 1HFBA 3GG1A 3M0XA 4M6PA 4AZIA 1CB7B 2BOGX 3WFLA 2W27A 1HJXA 1JXKA 4QJ3B 5G1MA 3TLQA 4FOUA 1XWYA 1ZQ5A 1OCBA 3O63A 4MAVA 2HPMA 3W9ZA 2YCKX 4O4WA 1IT0A 2VFIA 3EZ4A 4M80A 3EEZA 3FHAA 2YXOA 3G3DA 4IGMA 1NFGA 4E4PA 3HU7A 4HMEA 4YXGA 3SRDA 3CMGA 1L1PA 4DPQA 4NAFA 1GZGA 4CVWA 1KFLA 1KV5A 3SZ8A 4IT4A 1TZZA 4W9PA 4ZPVR 4DUOA 5C2GA 1OG0A 1AA1B 4CVUA 5HJXA 5KZDA 5DT7A 3NTPA 2REQB 2VNCA 2VJXA 1HJUA 1K3UA 3TMQA 3BV7A 2Z7GA 1E5NA 3KAGA 1Z69A 1RVGA 4NZ5A 4N9CA 1X8FA 2PP1A 5HPCA 1C9DA 1TTIA 1TWSA 3BK0A 3MKVA 4AMCA 2OQLA 2JGQA 2ZZ6A 3AIBA 4MTVA 2XP3A 4JN7A 3Q37A 1J0ZA 1RPKA 3IJLA 1TA3B 2VRKA 2KO7A 1ESWA 4NZ4A 3B8VA 3P61A 5TD4A 4G7EA 4C5ZA 1FKFA 1XLKA 4FNTA 1FHLA 4ZXLA 3T8LA 1J4RA 1FJDA 2OU4A 2PTXA 3QQWA 2LLEA 2PLKA 3UWZA 5A6BD 3I4KA 3MCOA 4B4FA 3N2CA 2VTFA 2J8FA 1VYRA 2XPKA 2VURA 1FWRA 2X8RA 1GONA 1GOQA 4S3GA 2VENA 2QULA 1E4LA 2G0WA 2PMQA 2YW3A 3DYPA 1DIEA 1ISXA 1W8GA 2WNNA 4GQRA 4GINA 4XAPA 4XZBA 4JEJA 1RA5A 4AWUA 2WSQA 4YVXA 4EOUA 2NQLA 4W93A 1W37A 3VIPA 4Z1BA 4PZVA 1U79A 1G7VA 1KT1A 5AHMA 3PA7A 4UTLA 1QFEA 2PI6A 4INFA 3BMVA 3TAKA 2AGKA 1BKFA 5CGTA 1QNQA 1E6NA 1V6TA 1Y5VA 4QQ3A 2PFHA 5IM51 2OTDA 4HNNA 1VFLA 5CPLA 1Q6OA 3NZPA 2YLLA 2RUQA 2ACQA 4FN2A 1W5NA 2RJHA 3HQ1A 1FVPA 3JUGA 3ZT5A 3GXIA 5D38A 1UWQA 3KM8A 3NQGA 2FZMA 2YB1A 4LF1A 1OYAA 3LHTA 3LHVA 2OXNA 2JEQA 3W6LA 3DG3A 4LB4A 2DORA 3I68A 4DXKA 1QNPA 1OWQA 3B9DA 5FEPA 3B97A 3RUBL 3GNRA 4Q8PA 4MGVA 1RY8A 3D3AA 3P60A 1W5PA 3N9KA 4UTJA 3B8WA 4OU1A 2F61A 1GG0A 4ERGA 5CSRA 1TUXA 3ANUA 4KCWA 3II1A 2PF0A 3WQ6A 1HZYA 5HAOA 3CQ0A 2B81A 2VEMA 3C2FA 2A0NA 1EEPA 3WF1A 3JXVA 4CNSA 2FKEA 4MFDA 1Q63A 4ITZA 2XM1A 3UCCA 4EKJA 5CJ5A 2VL4A 4UNKA 4O8RA 2C19A 3UI4A 4ZSTA 2FTWA 4L4PA 3CV7A 4IP5A 3AZSA 5AZ0A 1EDTA 3HG3A 3VIGA 4LH8A 5D75A 4ZTYA 2ZUVA 1UH2A 3LTYA 3W1AA 5I3IA 2Z1WA 1UWSA 1WPCA 1FWCC 5EFFA 3WLQA 1I2PA 2GVLA 4GBUA 2JIEA 2E8YA 2W61A 1JULA 3BOXA 2X0SA 5HUAA 4PR4A 1BEUA 1JCHB 4O1AA 2R14A 4UDMA 1EHAA 3HPFA 5AYYA 4PMRA 3T2QA 4CCEA 1TKKA 3TJXA 2OLAA 4ZGYA 3XIMA 1WO2A 1JI2A 3SB0A 3ABSA 4PMZA 4UUIA 3IAQA 3PTMA 1NTHA 3W25A 1NWUA 5FD0A 3APYA 2XVKA 4GMEA 4JQAA 1AJZA 4H9UA 1CCWB 3ITOA 3NDOA 1XIGA 1W8SA 3NA8A 3EOUA 4EACA 4O10A 3LCXA 3LLXA 2L5HA 2CERA 3ECQA 2J7GA 1EXBA 4IPIA 2D69A 3G0UA 1XD1A 1QK2A 3DG6A 1R85A 1H7WA 3NPWA 1RP9A 3CIVA 4O53A 1PEZA 4WJ8A 1CXIA 1U33A 4XIMA 4U10A 4J7RA 4IMCA 1EC9A 1P0BA 1R3RA 1XLCA 5GJNA 1NJJA 1GRJA 3WZ0E 1SW0A 1DVJA 3R43A 1JD7A 1D3HA 2PU1A 4PULA 2NX9A 1AVAA 2Y62A 3R8RA 1J0YA 1THFD 1W1VA 1GJWA 3UR5A 3LM3A 1E6QM 4Z1YA 2HJPA 3BGJA 3SECA 3UQNA 1W5OA 1NM9A 3MI6A 3NL6A 4L9ZA 3OBEA 4EK7A 1UKQA 1FP8A 1W5MA 5ABHA 5AYXA 4DNHA 3C2OA 4LAKA 4ZO9A 4UTUA 1E44A 3L2MA 3EMCA 5LGXA 1RJRA 2RDTA 3DUGA 1Q2RA 4GO9A 2WPGA 4ZFMA 1H1ZA 3QN3A 3S5YA 5A95A 2ZA3A 3VD9A 1QI4A 4NNRA 4LW7A 3VOCA 4P8UA 4D6EA 8XIMA 4YPJA 3ZWSA 2YL9A 1O5KA 3BMWA 4JTRA 1XR2A 3KBMA 1EWEA 4Q7BA 3B04A 1EPVA 1E4MM 2WVVA 3WLNA 6XIAA 2KX9A 1JCNA 4PC8A 3C4UA 1P4CA 4FI4A 2QVHA 3WNMA 1WDDA 2J79A 1ZBVA 1BLIA 1FY6A 2QCLA 1TTPA 2VN1A 3MC5A 1XSIA 1S2UA 1WUEA 3ZR5A 2GJXB 4JTTA 4V27A 1QPFA 1REQB 4AF0B 2ISDA 1SZFA 4HCDA 3CC1A 2IPJA 3PUGA 3S6OA 4HPHA 5T91A 1EL3A 1FKDA 1VPQA 5I23A 1TZ9A 4H8NA 2CKRA 1G69A 5FJRA 3TN5A 1KW1A 3WN6A 5T9CE 3DIPA 2QCCA 5H8UA 1DQXA 1NVMA 2OT1A 3MUAA 3PP7A 1PKNA 2DZBA 1A4MA 3TZNA 4QDPA 4ZB5A 1HGWA 3UG8A 1JCJA 4IJBA 4HMNA 2AQVA 1CXEA 1J0HA 1ZRQA 5BW6A 5C7VA 2C14A 3A4XA 4O57A 2YL5A 5F1UA 3VZZA 4Z2GA 2DZXA 1VRDA 1U83A 1E56A 2Z2BA 3OW1A 5ABTA 3E0LA 1QOXA 3MTWA 5TAOA 4KKXA 1QPLA 4Z2JA 4C6IA 2AOSA 5I2UA 3M0YA 1KM1A 3VINA 4I6VA 3S47A 3BJTA 1SJCA 2ACSA 4OVXA 4D6IA 2A85A 1HT6A 1RV8A 3GHTA 3G1RA 2HNHA 4CN4A 3ZR6A 2KR7A 5HUPA 4RCXA 4O8AA 7REQA 3ZWTA 3ZJKA 3GLCA 3SCUA 4JPGA 3SADA 4W7WA 5I00A 4CEXC 1CEOA 4C6NA 2KE0A 4XIAA 3TA6A 5CPSA 2F38A 1Q4WA 1TJ0A 3QY7A 1LT7A 4ATWA 3PTQA 1MXSA 2AMXA 1PBGA 1PSCA 1YATA 3BZJA 2F2KA 3WJWA 1P0KA 4GRSA 1ECQA 4XTDA 4BEUA 4K37A 3TC5A 3O2LA 2IXVA 5A2CA 1WV2A 4H6QA 3M5XA 4FO4A 2QR6A 5B7YA 1WOAA 2FQIA 3NVTA 2FZ8A 3S0CA 3W2KA 3W73A 2QCNA 2ZX7A 4NY2A 5IXEA 3H4WA 4EIVA 4QM1A 4IMDA 2DIJA 4PN2A 3R25A 2CHOA 4OT7A 3T8QA 4NF7A 4QEEA 1W3IA 1UR8A 2FPYA 2VC6A 3AAMA 2PGEA 1B4EA 4ZOCA 1OIMA 3VNKA 4UNLA 5HBFA 7XIMA 4MG4A 3PWAA 3DFPA 2MLZA 3NQDA 2AL2A 1OX4B 4R7JA 5C9XA 4GJIA 1K8YA 3HM7A 4K3ZA 4LALA 1R86A 1XBZA 2E6DA 2LGOA 1TB3A 9XIMA 5XIMA 3VDHA 3R79A 4MYAA 2NUXA 3GNNA 1WDPA 3IWPA 3A3WA 3CGMA 3LV5A 1YNYA 5IBXA 4CQCA 4HD5A 2G4JA 2BV9A 4DBUA 4MJ4A 1B3WA 2QUTA 1DOSA 4IT6A 3DERA 3SM0A 5LNVA 3T9PA 3QBUA 5HMDA 4QLLA 3AHXA 4TTGA 5MKGB 3PTKA 3VKJA 2NSOA 3AQUA 2PV3A 3VKDA 1R38A 3W74A 2XINA 2I57A 1M3UA 5B7ZA 4MKSA 3GC2A 1HL8A 1KGUA 1KFJA 3T0TA 5F2GA 4XZMX 5HK4A 2VI0A 4LCQA 2X09A 3MUY1 1RY0A 4IQ2A 1L2UA 4BR1A 2WWDA 4ZENA 3SCNA 3QH2A 3PBGA 1G5AA 3EIPA 4Q4OA 1OFAA 4BQ4A 1U5HA 3ZMRA 1E6SM 1EJVC 4LVGA 3PZTA 1BKSA 4G1NA 1HJSA 3T0BA 3CZJA 3N2TA 3SR7A 3GFXA 2OO0A 3AXXA 1UC4A 1A3WA 3UJEA 1A5CA 3VDCA 4BWLA 4XAZA 3LGDA 3MMTA 1CZ1A 3CEUA 3AU2A 4JFTA 4S3KA 1E0UA 1GW9A 2XP7A 3MDYB 3R0KA 1L6FA 3E96A 3G6MA 1R0MA 4H6KA 1MQPA 4DYKA 3IV8A 3TQKA 4IMFA 2A4AA 4JEQA 3SUUA 3OZOA 3WLJA 4JNMA 3GVRA 1B6CA 3O6AA 1EKOA 5KZ6A 3SGZA 4W88A 4ZB0A 2A3HA 4GC3A 4S3AA 4R85A 2HSAA 2POTA 2F6UA 5BROA 3IJQA 4P7LA 1DKWA 2QUUA 5HMEA 3VKAA 4PH6A 4IICA 1RJPA 3KCLA 3U2EA 3WX7A 2BY0A 1L8PA 4AEFA 4HZMA 2OO6A 1LQ2A 4XAFA 2JK2A 2H9AA 1PCWA 3LHWA 5K9DA 5BOEA 3FJ6A 3B0XA 3V5OA 1J2WA 1I4NA 5ECUA 5LA2A 1K9TA 2GVGA 1IR1A 1OABA 1CXFA 3MMDA 5JH2A 4DM2A 3S1XA 4LYPA 3GTXA 3B8TA 4GISA 5DO2A 3G1HA 4NX0A 4IX0A 2GWNA 5I77A 4NRSA 2EPNA 3AXMA 1W2VA 4S3JA 5HANA 1E15A 4JTKA 2I5GA 1E6RA 2CWNA 4P7QA 1PIGA 3C2YA 4G56A 3LUTA 5DXYA 4UTTC 3NIYA 1ONRA 2WNQA 3QC3A 2J77A 3UF9A 3GPKA 1X39A 3OHMB 2ISSA 2OSXA 2DFAA 3KP1A 3ITYA 4AZGA 2BGQA 2P0OA 2VZOA 4DF0A 1XF0A 3W87A 2QIIA 1WKFA 3URBA 5FACA 3LGGA 5E5CA 2NQZA 2CXEA 1UWTA 1J10A 1TRDA 3BC9A 3Q58A 3P2VA 3LCWA 2UZ5A 1GCYA 1WDSA 3C2EA 3NDZA 2ZR6A 4PFHA 4XD3A 1KKRA 2GUUA 3QJAA 3V0SA 1F4HA 1KM0A 2PDXA 2O92A 1IXPA 2P3ZA 1XI3A 3H23A 4PUKA 4W89A 3UPMA 2B5UB 2GK1A 4BA0A 2QV5A 1W9UA 2E40A 2C16A 4QG8A 1F74A 2XN1A 3NZQA 4I7UA 4XZLX 4I7VA 4WK9A 2WHLA 4S3EA 4JL2A 2Y7GA 4P61A 3NQ2A 2O9OA 4UOJA 5LHFA 1K70A 5H6HA 5A6AA 3LOTA 1VRXA 3VFCA 1R3SA 4IP4A 4A3YA 3RM9A 3K8LA 2HXUA 3HF3A 3PJTA 4M51A 3AMDA 3HO8A 4J35A 1LRQA 4HCLA 4YVPA 1V03A 4MHBA 5CPOA 2WXDM 1KFCA 3EWXA 4L9YA 1ZSXA 3S2NA 4B5TA 3MCNA 4KERA 5LXEA 1OJXA 7A3HA 5KTLA 2CLKA 5LIXX 1VYSX 1XLDA 4HB7A 4YTUA 5DF0A 2DG4A 2Y5JA 4ZQCA 4NZCA 4FEZA 3MCMA 1VKFA 1QI3A 1XFBA 1MQQA 3UG5A 4AY8A 1ZTVA 3WLRA 3B9AA 1PX3A 1XYBA 1KRBC 4JIHA 3ZLGA 4R53A 4UMBA 1TV4A 4F48A 2CFFA 2ZUNA 1J18A 1YXCA 4E2DA 2GOUA 1IGWA 1F3EA 4BI6A 3UXDA 4Q8UA 3ZXWA 4YCOA 4IQCA 4JGDA 4ZMGA 4TO8A 3OLDA 4QTGA 2ZC1A 4XKYA 4Y90A 3TFCA 3GAYA 4JKMA 1IXOA 2ZRYA 4ASTA 4K38A 4G7FA 4DJDA 4IJCA 2GQ3A 1NDYA 3O5QA 2OFJA 1QW7A 1HUVA 2HNEA 2XJ7A 5AYZA 1AL8A 3RX4A 3K1GA 2GFTA 4N9EA 5AY7A 5BXJA 3YPIA 5JMUA 3TWBA 2C15A 3ARPA 4MY1A 4A35A 1UCWA 1EC7A 2YZ5A 3W88A 4TR9A 2VT0A 1BWLA 5CG7A 3GWQA 2NXGA 1FWWA 4L4OA 3BW4A 3JZUA 3COTA 3H2EA 1D9EA 4W9OA 3ZFHA 2WSPA 4LFYA 2PS2A 3VUSA 4H8VA 3K5XA 3WL0A 4HVXA 3W7EA 3GXTA 2QNEA 4GYKA 3SCVA 2FJKA 4ILSA 3STGA 3V1PA 3EKGA 1A5NC 1Q6FA 2W5FA 3DFHA 1WKDA 4M0XA 4C6EA 4NKCA 3ZJ7A 4IH3A 1JYWA 2CZDA 1MEIA 5GJPA 1U1UA 4XK2A 3GE7A 3P5YA 1YXDA 3NPXA 1NIUA 3IUIA 3TAOA 4PRRA 4IPJA 3O5KA 2QZRA 3CQKA 3K30A 4GVFA 5FCZA 1JI1A 1IX5A 1W3TA 3GG8A 3NQBA 4PUUA 1UC5A 3VIHA 4REQA 3H7RA 4GBDA 5FJOA 3KFTA 2CU0A 2TODA 1RCQA 4XSMA 1GW1A 2YIHA 2O56A 4PMOA 3JZEA 4IL2A 4OJYA 1LUCB 3QV9A 3KZPA 4WDTA 4PSPA 2DUAA 3N12A 3NZGA 2ZTKA 3GYCA 4X2RA 2PDNA 4F9DA 3TONA 4DO5A 3GY1A 2I5IA 1JPDX 3DOPA 4PMVA 3SJ3A 3IJ9A 4H9VA 2D23A 3P6LA 5E9XA 2ZRWA 3FDKA 1K03A 1PDYA 3QGAC 4MPKA 3L0NA 5GPGA 1EJRC 2ZQTA 2ANUA 4RUBA 2VD9A 3VKKA 2BVDA 2NXIA 4LX4A 3CB8A 3GHUA 2BHYA 1JXJA 1N8IA 5IHSA 1MRQA 2TPSA 5CH9A 3KVMA 4AXNA 3VVGA 1JDEA 2FPTA 1UR4A 1AH4A 4QCFA 4IPXA 2GZXA 3HPXA 3OG2A 2GSEA 3LI1A 1KCZA 3IJ7A 1Q6EA 1TJ1A 3AJXA 3WJSA 4DZHA 3WUBA 4E38A 1A5OC 4FAPA 4JFMA 5GJMA 4N9DA 1XIHA 5DQPA 4JTAA 1OQFA 1TYGA 1EBGA 4PBEA 3LB0A 4W9QA 1PV8A 4LVBA 5KITA 2OEKA 2ZVIA 1XBXA 4Y9AA 3OU8A 4GYPA 3SCRA 5CBJA 3F5LA 3K13A 2BXYA 3M44A 3NWRA 4D6DA 1SMDA 2VEIA 4G6CA 4XD4A 4QAWA 3QTGA 3TR2A 1GHSA 4GI6A 4Z1DA 1NOUA 3W7OA 3JYJA 5J8LA 4GI9A 2E6FA 4HNOA 4EXAA 4LVDA 3VIOA 2JIWA 3B0VC 4UFMA 3WLMA 1EUNA 2Y8UA 5CZ0A 3NCOA 1PDZA 1JZ4A 3WUFA 1QMLA 5A5WA 1X7IA 2OGJA 2ZX6A 4RV8A 1J5TA 1H4PA 2YBVA 1QNOA 3TDFA 1M65A 2EQDA 1H5YA 3UYCA 1K1DA 3MANA 2V63A 1VLWA 2YL8A 2VZTA 1KBIA 3GXMA 3O5EA 3ZQ9A 1XYMA 3FIGA 1GPWA 1CGWA 3WMCA 3P0XA 4K7YA 4JQ3A 2QCDA 3GIYA 4LBSA 4Q4KA 3LTPA 4MM1A 2W66A 2BHZA 1QZ2A 2E68A 5CC5A 4EE9A 3LERA 2EPHA 2VX6A 3UXIA 2J7BA 3GFZA 2ZZ3A 3FAPA 4ZQOA 3N19B 1VFTA 1JGMA 4ERAA 1XLMA 1UA7A 4D71A 3UZYA 3G8RA 3LLFA 1W3JA 2GJRA 3MQTA 4KFPA 1XKYA 3M0LA 3GDBA 1KRMA 1W56A 3NUKA 3LENA 5D9MA 1FX6A 1JCMP 3HPSA 2VDIA 2KI3A 2ZZ7A 3RFAA 2GQ8A 4AWTA 2HS6A 1RK6A 3FA3A 5BRQA 1LM1A 4LPCA 4X9YA 3VA8A 1W9XA 4CQAA 2Q02A 3ANYA 4F8XA 5AYIA 4GYFA 2HWGA 3MWAA 5AVHA 3R7MA 5JBDA 2QAFA 4NJJA 2RJGA 1AUSL 3RCYA 3WBEA 1XS2A 4GOAA 5F4XA 2A3BA 4NI3A 1F6YA 3E6EA 1V3HA 1NEYA 2F84A 3OGRA 2QCMA 4MJ2A 3OHIA 3TYDA 3AXKA 1K7FA 3QM3A 2E6YA 4Y9OA 2XYLA 1E1CA 3W72A 4LV9A 3OGVA 4AD5A 2OELA 3DXIA 4JTSA 1ZUAX 3DN5A 4RDZA 1TPUA 3UXLA 2VCDA 1GOOA 3T09A 4FPSA 3N2BA 5HMSA 4A8NA 2DUXA 4TVUA 5CCZA 3EDDA 1AFSA 2W3ZA 3B40A 3WDHA 4V1XA 1RQBA 1ONEA 1O7AA 1BXCA 3IIXA 3OZPA 4A2SA 1VFUA 1K6AA 3PY2A 2AKMA 3QQ0A 3RDKA 1TUFA 1ITXA 4O0KA 8XIAA 2WHJA 1C92A 2EAWA 3L12A 4GKTA 3SSJA 3EKLA 4ZO8A 1FH7A 3W7CA 3PRDA 2V2HA 1XCXA 2E5BA 3BURA 1PJ9A 2OOGA 1V02A 1IZCA 2QYGA 2LKNA 3KCJA 3W0KA 1TIMA 4O2TA 4I9AA 2PDJA 4PCPA 3I65A 1Q13A 2O7QA 2G3MA 1O6IA 4F2BA 2WHMA 4JTEA 2WNWA 2D73A 3F5JA 5LA1A 1VFHA 4Q4RA 2NQ5A 3PS7A 4PB3A 2IKIA 4B5WA 3FLUA 2ZQ0A 3TVAA 3WBXA 3DYOA 1J2BA 1LLOA 2QMJA 5CPNA 2ATMA 3W7NA 2XTKA 3W4RA 3Q45A 2DUZA 3RPMA 3A47A 4GPNA 1LWIA 4ZA0A 3BAWA 1E9YB 4ICNA 3CZLA 5A2BA 4ORIA 3QPYA 1UD3A 3ZR4A 1FH8A 1TRIA 1V7AA 5JVLA 4ZE4A 1S5VA 4OQVA 3PNZA 1BSLA 4N4PA 1Q6UA 3PTDA 1DP0A 1MRAA 3AWOA 2QF8A 1DJQA 2FGZA 3THAA 2ZX9A 1EX1A 3HGSA 4S3BA 2R82A 3MYPA 1OFOA 4UR9A 1T40A 4E8GA 1XUUA 3F4DA 3OZYA 1PHWA 3PULA 4U2YA 3N14A 3GRIA 4ZPTR 1RD6A 4B5SA 2INEA 2NQJA 4D6JA 3W1RA 1FWNA 5EYWA 1IGSA 1H61A 1O94A 1E9IA 1EEXA 4PFMA 3IJIA 4AEOA 1GGOA 3ATYA 4NQ1A 4LUTB 2W4XA 2DZAA 4X3ZA 2GWGA 4JFWA 1J12A 1W9DM 4IIBA 4MJZA 4ORMA 4MZ1A 5A8NA 2GSHA 4DXXA 1R9YA 1DIKA 5KZEA 4BF7A 3A5VA 2V6AA 2X1UA 1DV7A 3RK8A 5D2TA 1VFMA 2ZQUA 4CD7A 5M3WA 4HJFA 4ZPWR 2VVSA 2X1RA 2WZTA 3V7PA 4DUVA 2JF6A 1KGXA 4L3NA 2WWCA 1NMWA 5DMMA 3RRAA 2C91A 3LZ5A 2YCEA 5IRPA 3MZNA 3WD0A 2A79A 3B0PA 1H50A 2J4GA 3DKJA 3MS8A 1WDQA 3CHCA 5AKQA 1EUAA 4K7VA 2IXUA 5F1VA 5CG0A 4O54A 2R1NA 1O68A 4CNOA 3GSMA 2OG9A 3C8FA 3WSUA 5DELA 2QCDB 1FTXA 7TAAA 4GIEA 3WQWA 1E1EA 1P6BA 3PJWA 1QVBA 4W8BA 2CETA 1GTEA 3QLDA 5I03A 3UY8A 5DO8A 1PZ3A 4Q8MA 1H41A 2E1WA 2Z26A 4ODRA 1DIOA 2MF9A 3IAPA 4IOTA 5E0FA 1Z8AA 1KM5A 4QG6A 1MNSA 5I79A 4ODMA 1HKWA 2D9FA 4GZEA 2DW7A 7PTDA 1OG6A 3W84A 1E9LA 2ZICA 3GH4A 2YCLB 1HJQA 5F2MA 4DN1A 1A3XA 4QGCA 3RGTA 3GW3A 1XIBA 4MADA 3BW3A 9CGTA 5XINA 1A3HA 5FOOA 4JN8A 3WIJA 3MDUA 2DQXA 4HZ6A 2PEVA 2J88A 4G7EB 1OADA 3M43A 4O50A 4HP5A 5FSEC 3C6CA 4O52A 4H7CA 2QT3A 1DJZA 4C02B 3SSZA 1OFPA 4TX0A 1V3LA 2OCZA 2AQWA 1T7LA 3EX2A 4L65A 2J13A 1UR9A 1TIWA 5D05A 1KRCC 1UWIA 3KOWA 1DJYA 4RLIA 2DSUA 3L5AA 1SGJA 4UFJA 1SSDA 3TXVA 2VUYA 3VILA 3JYMA 3KOFA 3O15A 1XJBA 4YYCA 4LUIA 3S83A 4FNRA 4HARA 2OKOA 3A3HA 3B8DA 1B4KA 1M9HA 2P1FA 3GTYX 1XPGA 5FESA 1UKOA 3CUFA 3OB8A 4IIHA 1VPYA 4EXQA 4MJMA 5EMMA 1R9HA 5HTGA 3S1GA 2WAGA 2Z1BA 1HXJA 4KIEA 5DLCA 4AY1A 4PGLA 1HNYA 1T8XA 2Q8XA 4RNJA 3B06A 3L67A 1VJSA 3DZ1A 4C6MA 4LAZA 3KXQA 3D0CA 1OFBA 3H24A 3RJXA 2EPLX 5I78A 3NO5A 4TTUA 1EYMA 5F2IA 1Y8BA 2HISA 2Q8ZA 3G1XA 4GGQA 3MU7A 3J7HA 1Z48A 3M07A 5CZTA 1KWGA 4FA3A 3MV11 3H7UA 4LS1A 1GYNA 4DBDA 4HSOA 2ZTJA 2Y70A 3E74A 4DZ2A 1FKIA 1IV8A 2HBVA 4M6QA 3W29A 4DI9A 3SO7A 3SI9A 1WA3A 4QNEA 3ABZA 1WQ5A 3MA8A 1G4EA 1AQMA 3FFSA 3N4EA 5C71A 4CQ9A 1HW6A 3UGVA 2QPUA 3MUCA 4S3FA 3PR2A 4O15A 3BLIA 4GJ1A 3MUXA 3WEZA 4R27A 1YKWA 4RNHA 4OBRA 3WQOA 1HKMA 3LMZA 4JY8A 2FB3A 1VFFA 3OOQA 3MYOA 3T2OA 3E0IA 2W62A 4MFEA 5M17A 3GVVA 4F9JA 3L66A 3GFYA 1D8WA 4JXCA 3PZVA 4ICCX 1K8ZA 2B7OA 5A8MA 3KUMA 1CPUA 3GR8A 2WMJA 2EG6A 3CL8A 4DBSA 3W70A 2DZSA 2WLYA 4WY0B 3FJ4A 1NH6A 1DWHM 3AYSA 4YTSA 2ZDRA 1P1XA 3NSMA 5GNZA 3ORWA 2RUSA 1FKWA 1R3TA 2WMIA 4GNJA 1ISYA 3GTNA 1UD5A 3HN3A 1V6XA 3ICJA 4TV6A 4D6FA 4E5TA 1LL4A 2CLFA 1VHNA 3UWEA 3S2MA 5FF3A 3VIIA 1Q5MA 5HQEA 2Z7KA 4LBRA 1TSIA 3WLOA 2A3EA 3CAQA 1M53A 3FXGA 3L9CA 2VC9A 3WH5A 4MNJA 4DWDA 1J4EA 1HG3A 4O12A 1XQKA 2XGIA 3PWGA 2QXWA 3ARQA 3M9YA 4DZAA 3EWBX 2RGMA 1ZK6A 1XLLA 2CZ5A 5C5YA 5EBAA 3R8GA 4PMNA 4HOXA 2Z2UA 1E51A 3QQ1A 2FTYA 1W1B1 2BY3A 1HP5A 3THQA 4NJGA 1Q65A 1SZEA 1ME7A 1TE6A 4HU3A 4DB7A 4AF0A 4W85A 4OE7A 2ZE0A 4U84A 1XSJA 4C7DA 4Q8OA 1MQRA 3CWNA 3TOPA 4WLCA 2O9PA 2EEXA 2TMDA 4AD4A 3PRAA 1W3KA 4CGTA 1B5TA 1KV8A 3OBKA 1JYNA 3R0DA 3FYPA 3UG4A 3EDKA 2ACUA 4FNPA 4H00A 3VMPA 1E1FA 5DMYA 3VX1A 1WZLA 3F7JA 2XZ7A 1XLBA 3RLVA 4TMBA 1T6MA 2Z29A 2NX3A 1V0KA 1S2CA 1V0MA 1H1NA 2W92A 4E2BA 1GZJA 2CLPA 3DKLA 4M29A 3WMBA 3NEVA 3VKBA 4KWWA 4HK7A 2PAJA 4N02A 2WSRA 4E2OA 4AD2A 2G3NA 5IBXC 1BHGA 2Z0IA 3S9YA 1H0IA 3VGEA 3OTRA 1I2QA 4B5UA 1W6TA 5E9AA 2V3FA 2B0MA 2FMNA 3NZRA 2C1GA 4CQ8A 1IXQA 3CLMA 1KLYA 1F61A 1JL8A 3W83A 1VIZA 1PX4A 1KQYA 3H8AA 3NOEA 4WCJA 4MWAE 1B30A 2ESCA 2PU0A 4YTTA 1W17A 5CJMA 4DLFA 2OMAA 1LOQA 4QDWA 3C8NA 4GY1A 3UZWA 3QGKC 1M5WA 1QPRA 4WX2A 1MI3A 4L61A 5AOUA 2DZPA 3SUWA 1GVFA 1K9EA 1H7RA 2FFIA 1VCGA 2EJ1A 2X42A 2AQOA 1RLDA 3KRBA 3VCRA 2B7PA 3RILA 3N2XA 4TIMA 3BAKA 3EOLA 4PSRA 1J9YA 3SDOA 3LPOA 3GTHA 4GLEA 2G37A 3LGEA 3HJZA 3JVAA 5HWNA 5LA0A 3W2NA 4WIWA 1XIJA 3E2RA 2XDFA 2PC4A 3EX4A 4NT0A 2VGGA 4NAEB 3WF0A 1CENA 3UPBA 3L4TA 1RHCA 3T44A 4P7RA 2E7FA 2ONEA 1P7TB 3A4JA 3N25A 3MVTA 4DBEA 1WDWA 3MWCA 3MJYA 2C13A 2HQAA 2BASA 3WQCA 1E6XM 4M6VA 1HKVA 1X96A 2DG3A 4JY9A 4V2XA 4OBTA 3LPGA 4IFKA 3NQFA 3RN6A 4AZ6A 3LV6A 2ZA2A 5D2YA 1EO7A 2YXGA 5C7HA 3WLLA 4KCVA 4PMQA 4DRNA 1CT5A 3K2GA 5EKYA 3L4VA 2KGJA 2WBGA 2O4MA 1TV8A 2ISFA 2DZVA 2UY5A 2E9LA 3KP0A 3VDGA 5EL1A 1SQ7A 4KETA 5MF5A 3IS4A 4QJ5B 4ZR8A 3UI5A 5I6SA 5LSMA 1QJWA 1M7OA 2OEJA 3KBWA 5TQLA 1QHPA 3BLLA 4GI4A 5J5DA 5FF0A 2YFNA 3VCCA 3TJ4A 3FSUA 4CU8A 2DU2A 1KB3A 2VCBA 5EMLA 1K7XA 5DX7A 3IVTA 3AIRA 1O1HA 1U1HA 1P5BA 5BNKA 1I1XA 2Y88A 1HF6A 3L68A 1Z44A 4K8EA 3LPFA 4H01A 2YLAA 1UPPA 2RDWA 4A8IA 4LVFA 1N55A 4TQTA 5CBBA 2PUZA 4IXXA 4IQDA 3QMSA 1JCXA 3WNKA 2YGYA 4WGHA 3U0HA 3F5KA 4Q8VA 3C0JA 4QX4A 2X05A 5HNUA 3GNOA 3FK4A 2MNRA 4U3AA 1ALDA 3OLEA 4PODA 5G4WA 1NDVA 2QJMA 4MOZA 3NSNA 1B9ZA 1ZALA 5A94A 1TV5A 3IGSA 1O4UA 2CBUA 3G1SA 4V28A 4WR3A 2PRHA 3ELFA 4YCPA 3NPUA 4ZBCA 2BY1A 2GDUA 1V93A 2V5KA 3PBUA 1XLIA 3AYVA 1LJYA 3H2OA 3PJUA 1B3VA 4ICMA 1Z3NA 2JKPA 2Z6JA 3V3WA 1ITCA 1OBAA 4FXFA 3MUIA 5EA9A 3GDLA 1BQCA 1WOBA 5A2AA 3QMRA 2H3DA 3P62A 1YRRA 2A6LA 4TX9A 2J25A 3O5LA 3QRHA 1O66A 2OVLA 4ZODA 3NSXA 3AS2A 4FIRA 3SIMA 3EA3A 2PDFA 5I24A 2CNCA 4K39A 3UY7A 1GKQA 1KT0A 2LPVA 3NL5A 2MPHA 2XFFA 2CW6A 5HMFA 3AHVA 3W6YA 5LIYX 3NJ3A 1XIFA 4P7OA 1US3A 4RX0A 4TNSA 1E0VA 3W2LA 4W9TA 4DT4A 4Z0SA 3DC0A 4UXDA 5BMXA 1AK5A 5CZSA 1WZMA 4A3RA 3MMUA 4P5UA 1Q85A 1GJUA 3ABQA 5EMKA 4PUMA 2AWGA 3PJXA 3WBAA 1C7SA 3BCDA 1EF3A 1E6PA 2IPFA 2ZE3A 3AIWA 3SCSA 1OINA 1QBBA 1PWMA 1XC6A 1H60A 3Q94A 1TX0A 3HPAA 2V2DA 3I6TA 4KEMA 1S1RA 4MMWA 4NG3A 3TYZA 3EDEA 1SR9A 2FYMA 3TTQA 1BAGA 5E1QA 4S2BA 4C1NB 4ODPA 1CECA 1QWGA 4ROQA 1H5VA 4X9SA 1YXYA 1KD0A 4JFSA 2VFHA 3FCPA 3T0AA 3M0MA 3BAJA 2HK1A 1JPKA 1JZ2A 3S6TA 3POHA 3M41A 1NF0A 3TDBA 2PGRA 3B8UA 1WXJA 4B2DD 1KTBA 3AZTA 4P8WA 3BSHA 1UH3A 2UV8G 2E1DA 2GGIA 2REQA 1Q6DA 1XSKA 1FOBA 2QIWA 4S23A 4M8UA 5C70A 4D1JA 4DIAA 1FHVA 1X1ZA 4PCFA 4U5IA 1NDWA 1XRVA 3TROA 2VEKA 4XKMA 1TREA 3PNUA 3RLGA 3UNTA 5EU9A 5D30A 3UA4A 4XZHA 4W7VA 4F2UA 3PM6A 3TYBA 1US0A 1V6VA 3H21A 1OGGA 4J1OA 1KBKA 2NLYA 1EGZA 4KFNA 2BMBA 2YL6A 3FAWA 4GCAA 1I60A 2FDMA 2V81A 3UGRA 3H54A 4C91A 1R7OA 4HYWA 4TOQA 1BQGA 4IPNB 2X0HA 1X7FA 3GDMA 4M5PA 4PTDA 2NT0A 3HOJA 2Y63A 4ODKA 1XGEA 2ITKA 3SGGA 5EMJA 2ZRZA 1ZHAA 5FSDC 5FJUA 2RAGA 4IF2A 1KM2A 4PE8A 2ZZ4A 1G7UA 1ITQA 3A24A 1YX1A 3W82A 2NWRA 2PBOA 3QYQA 4AIEA 1OC6A 3UERA 3PBVA 3VABA 4RJEA 2J6XA 3ONCA 3M6DA 1V3JA 3PPFA 4FHAA 3PBMA 2C1IA 1MW2A 3R89A 1T11A 1PPIA 3WH0A 3AXIA 2E67A 3GQYA 2ZIDA 3B8IA 3KX6A 3EX6A 3VNZA 4EWJA 3LK6A 2G97A 4MY9A 3E2SA 1UR2A 4MSSA 2X1TA 4FF7A 1C93A 5EY5A 4JCLA 3VGDA 3RLUA 2GGGA 2OX4A 3EGJA 4GY7A 3LBMA 4IFKB 2CLMA 4UZSA 4R9XA 3F2DA 2Z1KA 3QEZA 3WUGA 2Y61A 2ZRVA 3LHYA 4ODLA 2J78A 4F0KA 3W2MA 4U28A 5FF4A 4W5UA 3HPZA 2ZUUA 2WZHA 1D6OA 1EP1A 4QR6A 1V3MA 1M04A 3LN3A 2I7GA 5DIVA 3TKFA 2GOKA 4KQZA 2QGYA 1SO3A 4CCZA 1EOMA 1WP6A 4DM1A 1XGDA 3ODKA 1UWAA 5D9PA 3KBNA 1IEXA 3CUIA 3PFRA 2XVNA 4Z1AA 4AU0A 1S1PA 3SW6A 4GIVA 2J9ZA 3ANVA 4O19A 2P8CA 2X16A 3WLHA 2OQYA 3TCEA 1TPFA 4N0RA 3PB0A 4YVVA 1A0DA 1VEMA 3PC0A 1GOMA 4DRKA 2EKGA 1VYPX 5CZJA 3AICA 1HJWA 1FA2A 4X61A 3P14A 2XISA 3EWUA 1M5YA 3CQJA 3GH7A 3GAKA 4V33A 3R94A 3QLLA 1YDOA 5JU6A 1QW9A 1OY0A 3SEPA 1QO5A 1LL6A 1E0XA 3PWIA 1F3XA 1SPQA 3RHGA 3BJFA 5MHBA 3VD4A 1JCTA 1N2VA 3DBNA 4EVZA 3AYTA 3U5UA 1DJXA 1NQ6A 1LBLA 3TOYA 4TV5A 2RFGA 2W63A 4KF1A 5AYBA 1PKYA 5FKYA 4O1FA 3OEXA 3L5MA 1EIBA 4KCTA 1P6WA 2PV2A 3VOIA 4K36A 1UZ1A 3ARSA 4ODNA 2V69A 3LSCA 1L8NA 4HA0A 4LCSA 1UOZA 1Q2SA 1Z9AA 1MVYA 3LX9A 5TF0A 2OLSA 1D2KA 1B2YA 3EB2A 1UIOA 4HZ7A 7ODCA 3U5YA 2PLJA 3BAIA 4LAUA 3EWCA 5HULA 1JGIA 2V68A 4PB5A 5AC7A 1W9BM 2E6AA 2VGBA 3B3DA 3IPWA 4LS2A 4V1YA 3ISIX 3BV4A 2XIJA 4DWSA 2QS8A 4DO4A 4AIOA 5T26A 1QCWA 4BCEA 3MW7A 2B7NA 4JIEA 3H6OA 1DJWA 4AAJA 2RKXA 2QCFA 3WEOA 3EDFA 1LOSA 5U7SA 1SZNA 3BW2A 4HHMA 1XG4A 3HGJA 4DUWA 4WZHA 4L1WA 5PTDA 1I0DA 2PDLA 3VOFA 4PUWA 1W3HA 3P7YA 1ICSA 2PLCA 3INPA 3QYSA 3T05A 2BODX 1UR0A 2GVYA 3WO8A 4RK8A 1A0EA 1TPH1 2XIOA 4QJ1A 4JFUA 3CPUA 5AHNA 3S1VA 2YDQA 4OBSA 4J4OA 1C7TA 1GQNA 2A1YA 1WAWA 3NQEA 1ONXA 2HE5A 3KADA 2IKGA 1IWAA 3A5FA 2B4GA 3MMWA 2W79A 5A8GA 4YLWA 2A3AA 3EXSA 3UZ5A 2PDMA 3QY8A 3O6YX 3GDTA 2YCLA 2G41A 1XUZA 3S5NA 1V77A 1UMYA 2GVEA 2BTMA 3VC6A 4L64A 1M1BA 1QOPA 1EJWC 2QCGA 3L5LA 2ZYFA 1R3YA 4LU0A 2IF4A 5F4SA 5AC4A 3KTSA 4GXWA 4A8LA 2OZTA 3FJLA 1EJ7L 3A9BA 1V3KA 1FCUA 4I8DA 2DIEA 2HCVA 3IARA 1FWAC 1I2RA 4FXJA 4AHOA 1VP5A 1XV8A 1W1PA 2Y78A 1GQJA 4MZ8A 3R6IA 4KBXA 3ARYA 2ZZ5A 3FX4A 4FLOA 3CT7A 5HPOA 4DRJA 3HG5A 3IIZA 4IMGA 4QDMA 3IUHA 1VEPA 4I9JA 4O1CA 2XG9A 2N87A 4OV9A 4MKNA 4GGHA 4JHOA 2ZR4A 5FEZA 3O5PA 4CU7A 1FKRA 3LA4A 1CYGA 1KRAC 5K9XA 1LTDA 2UZ9A 3RCMA 3SQMA 3QHNA 4F66A 4C6LA 2Y5EA 2WQDA 4JX5A 3KACA 4C6KA 2J8GA 1E4IA 2VKZG 4GK8A 2E77A 4JFIA 3WNLA 4DUXA 3P8IA 4WY0F 3R11A 1K9FA 3LG3A 2ZUSA 5DBUA 3TYUA 3PHAA 4JQ2A 4BHYA 2OSYA 3KL5A 4P7NA 4UR7A 3S1WA 1OF6A 4DJFD 4RR4A 1DJNA 3BLFA 1ZBKA 2FMOA 4B5NA 4QE1A 2VX4A 2RH9A 4HK5A 1YMYA 2PWUA 3LYEA 2Y7DA 3MB9A 3MPGA 3N17A 3EX1A 1S2TA 3FA4A 3PZIA 1OFDA 1R47A 1I9CB 3CH9A 4F0MA 4Q8TA 4RKAA 3FYOA 4XVDA 4PCTA 1PXGA 3IIPA 3KCEA 4JTQA 4QITA 1DE6A 2EBNA 1QUMA 1ZB5A 5FAJA 3S4TA 4YJ5A 4X0NA 1YDVA 2UY3A 4PBFA 2GLKA 4NP7A 3KE0A 4TYOA 4GX9A 1QK0A 1UJQA 2PBGA 4K2SA 1E6ZA 1FWIC 5BOFA 3VGGA 4U31A 1TR1A 4LAOA 5HWCA 1HKJA 2QVNA 3F2CA 5AVNA 2NQ9A 1ZY9A 3KBJA 3DBPA 1R9XA 4KGLA 1JUBA 1DHKA 3KTXA 4YHGA 4S3DA 3GXPA 2P3EA 5F7UA 3B0UX 3VNYA 2FDSA 3HMJG 4O1BA 5HWJA 3UVIA 3GUGA 1SZRA 2DW6A 4B9ZA 4N6FA 1E73M 3VPLA 3M5ZA 5CEWA 3LZ3A 5E6ZA 3MT1A 3EAUA 4AHPA 5JBEA 3W23A 2Y2WA 1HL9A 1E0TA 1YTKA 1BXBA 2V67A 3L2LA 4RPPA 3WENA 4NIRA 1XL9A 2Y8KA 3DC8A 3OOBA 2XM2A 1K02A 3WK1A 3LPPA 3WD2A 1G4PA 3HV9A 5CC6A 3LEPA 4HJWA 5G4EA 3VMNA 1SMAA 5FA5A 2X7VA 2YSWA 3ZT7A 1RJQA 1S5MA 5E0CA 1EJTC 4PTVA 1C29A 2A3LA 4A29A 4DRIA 1CGTA 5DN1A 1XLJA 4JDBA 3GDKA 1FCVA 4MVAA 3KRUA 1GWJA 2VDHA 4UQAA 3S42A 2VZVA 3KABA 2V5LA 2P4VA 1CLKA 3AROA 3LNMA 2X7WA 1FKJA 3VE9A 1ZAHA 3ZVIA 1MMFA 1J4IA 1LT8A 1GVIA 3C5QA 3LCGA 2HMCA 3IRSA 1NP2A 3QHOA 1FWEC 3WKZA 4UMCA 1SR0A 4FXSA 3DFNA 3EYPA 1XPYA 2BY2A 3QVQA 3BARA 3A3XA 2JF7A 3NNTA 3TWAA 3W1TA 3GX9A 4P2VA 1JZ5A 3N4AA 2DH2A 1LWHA 1UIPA 3KVKA 2IPGA 2C6QA 5HA7A 1G4SA 5KSWA 2EF9A 4PUDA 4PL1A 2OSWA 2VQUA 1KCKA 1UD2A 4M3PA 2VEPA 5TNVA 2IPWA 1DWFM 1L6YA 1MFUA 2XIIA 2P0IA 4Q32A 2J47A 1S5WA 1AH3A 1PB0A 5JQ9A 1JNEA 3K8MA 3PFMA 1IEQA 1DQWA 4RPQA 1JDAA 5CAKA 3H2MA 1UZ4A 5RUBA 1F40A 3ITCA 5GVJA 4XBSA 3S3GA 6CGTA 1POKA 2WJFA 1Q66A 3CZKA 1FFRA 2NWSA 3GXNA 1KXQA 4LBUA 4XG1A 3CUGA 1L6WA 4IQLA 3GIPA 4AVFA 3ITTA 1N1AA 1XW8A 4LQ1A 2W0UA 1VFSA 1GOWA 3C61A 4DY1A 1XIMA 3AS0A 3QKEA 2ZWZA 1TJ2A 4NNBA 2C3ZA 3CM4A 1B31A 3HA1A 3H2AA 4LS0A 1RZMA 3IHZA 3DAQA 3UFYA 3H22A 3NQAA 4DX3A 1UD8A 4QE5A 4LYQA 4AC1X 1R6WA 2VOMA 4PCNA 2WC4A 3B9OA 2M1IA 3OVRA 1B3XA 2IQTA 2C79A 4HNUA 1XYAA 4LJ3A 1RCXB 4J40A 4FAMA 1UYQA 3AISA 3MUZ1 3C3UA 4HA3A 1QNVA 1JVWA 4BJHA 3CIWA 3I3BA 3ZLHA 2JQXA 2D3NA 3AO0A 4JBRA 4XO7A 2XP9A 3F4VA 3M0KA 4XZIA 3LCIA 3MP3A 4UNIA 4UTWC 1EP2A 3IKDA 1PTAA 1ECEA 1ISZA 3WDIA 3FJNA 1HKKA 5BMWA 2EG7A 5BRPA 1GKPA 2PRMA 4JZ5A 4U33A 2FLIA 5HJYA 5FJJA