2DSWA

Binding of chitin-like polysaccharides to protective signalling factor: crystal structure of the complex of signalling protein from sheep (sps-40) with a pentasaccharide at 2.8 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dswA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dswA01
1CLXA 2IUZA 1VIWA 2OYKA 1CPUA 3RIKA 4UQEA 1MQRA 1C8XA 1GOMA 2D0GA 2D0FA 2XVLA 5M3WA 4EKJA 3G6LA 1MW0A 3CUIA 4D6GA 5CQ1A 3BAJA 3ZJKA 3UR7A 3VGBA 1ZBKA 4MNLA 2IXUA 1V3JA 3AXIA 4AD3A 4YPJA 2CBIA 3F4VA 3VD7A 1JI1A 1HIZA 3MKKA 1JYWA 1SMAA 4CD4A 1B1YA 1LQ0A 4UQ9A 4N0RA 2WVVA 2CERA 2HVMA 3BAKA 2NW0A 4PTMA 4JIEA 4CN6A 1E4IA 2GUYA 2WSKA 2GK1B 4LYPA 2OSXA 4V2XA 2XG9A 1WP6A 4UR9A 3T2OA 3ZIZA 2ZIDA 4OJYA 3VDAA 3VD3A 1G0CA 5A2BA 1KGUA 2XGIA 3L4ZA 5I23A 1H4PA 3A4AA 3WD4A 5JBEA 2FHFA 1TVPA 3W81A 1V02E 3CUHA 1CGXA 3T0BA 2FHBA 2ZUMA 4J3UA 4HPGA 5A6MA 5JBFA 3PN8A 3WY1A 3AS2A 2GSJA 3DYPA 3LPPA 3WNLA 5ABHA 3AQUA 3PZNA 3CMJA 4D71A 2ZXBA 3W38A 2WBGA 1B3WA 4CN4A 4FLSA 1XRVA 5M5DA 2XSAA 3OIHA 3VDBA 3NSMA 4CCDA 4WF7A 4PSRA 4BQ2A 4Q22A 2V5DA 2WVSA 4CCCA 5CPSA 2CKSA 3RILA 1NP2A 5I24A 4PN2A 2YA1A 5I77A 2VURA 1CDGA 2DDXA 2WMJA 1ISWA 1M53A 5LA0A 4X0VA 2NT0A 5DO8A 4GKLA 4Z2KA 1H41A 4AZGA 1HKKA 4AD4A 1UWUA 1WCGA 1MXDA 4B3LA 2JEPA 2E9BA 2WWDA 2WKGA 4RE4A 2DT3A 3UETA 3ECQA 2GK1A 5LA1A 3CZLA 4MPKA 2GDUA 4Y7EA 4H7VA 2YLAA 2OSYA 5HPCA 4TTUA 2DT0A 4LYRA 2GJPA 3AMDA 7A3HA 1HX0A 4TXEA 4UFJA 1W1PA 2J79A 2WHMA 3KEHA 5D9PA 3WL0A 1E3ZA 3TP4A 4HMCA 2ZXQA 1LG1A 5D9OA 4MNJA 4D6EA 3GH5A 4JFTA 4DUVA 3PZTA 3W24A 2ZUNA 4BS0A 1GONA 3QOKA 1ESWA 1DWHM 1VJZA 3OZOA 3WH5A 5ABEA 4AISA 1UQYA 5CJ5A 1CXEA 4TVUA 2ESCA 3AS1A 2WVUA 4S3KA 1UD3A 4BA0A 1UR8A 3SCOA 1J0JA 2W63A 1JFHA 2VRJA 1DWGM 3WD0A 2E4TA 2BNJA 1UD5A 1PIGA 4C7DA 3WSUA 4PMDA 4U2YA 3DYMA 4DUWA 1UWTA 3UG3A 3CBWA 2J8GA 5HNNA 3BXWA 4V27A 4QLJA 1BG4A 1MYRA 1KQYA 2NT1A 2WLZA 3WENA 4CN1A 4UOJA 5EFFA 3BLPX 3PZUA 4ZFMA 3FY1A 1JGIA 3AIRA 1BFNA 2GJXB 3II1A 3FAXA 2DSVA 5DT5A 4AYSA 4NRRA 4UNIA 3CZEA 1VF8A 3B9DA 5IHSA 1W1VA 4XX6A 3ZT7A 3WD2A 4D1JA 1HKJA 2DPEA 3SUWA 3LMYA 2X09A 4HU0A 3SURA 4J7RA 1GZJA 1JXKA 3OLIA 4UOQA 9CGTA 2G3NA 2XIBA 5FL0A 2GFTA 4AW7A 1R7AA 2CEQA 3ARXA 2XFYA 3VNYA 5E09A 4BQ5A 1E55A 1G1YA 1DWIM 2PF0A 1W9UA 4HTYA 3UESA 1KXTA 1GQIA 4S3JA 2BXZA 4IISA 1QPKA 4J3SA 5A8QA 4UFKA 4PMVA 4AZBA 1OIFA 1S46A 2OWWA 2D22A 1V3LA 1NQ6A 1LG2A 5KZ6A 3SUSA 4Q7NA 3ZJ6A 4E4PA 3N12A 2JEQA 1BTCA 2O9RA 2G8ZA 1CENA 1CXHA 1W9DM 3DHPA 2DT1A 4PTVA 3BAIA 1G5AA 3L4YA 2WCSA 2RGMA 1R86A 2VX6A 1E6SM 2D2OA 3WNMA 3CTTA 4FLQA 3VGGA 4B3KA 1ISVA 2G41A 2WW5A 2CYGA 3PZ9A 2ZXDA 3AROA 3VIFA 2WMHA 4FLOA 2XGBA 5BXSA 1FH7A 3PTQA 4IPNB 4A4AA 1VJSA 1BYDA 3ZQ9A 4CD5A 4M1RA 2WPGA 1B3XA 4UFHA 4D6JA 3EYPA 1E0VA 2EPLX 4LXFA 2CNCA 5CPTA 4OKDA 3GBEA 2EPNA 2G4FA 2X0YA 4OBSA 1CWYA 4M81A 3MMDA 1RPKA 5HPOA 3AYSA 4M24A 3AHZA 1VEMA 3THCA 1UKSA 2VVNA 2XTKA 5BXPA 1MVYA 1E0WA 3ZMRA 2BY0A 1UOKA 3M7SA 4DWSD 3UR8A 1JD9A 3DHUA 4KH2A 2X05A 1MXGA 5C70A 4R5EA 1M7XA 2Y24A 2Y8VA 4M82A 1UKOA 1WDSA 4MB4A 4ACZA 1E70M 1O7AA 4TUFA 4DWSC 3KL3A 4UQAA 1UD2A 3WF1A 2VNCA 2YDQA 3KE0A 3KL0A 5A69A 2WC3A 3PTKA 1D3CA 4W8LA 1HKMA 1UZ4A 1NH6A 2V5CA 1YQ2A 2DT2A 1UD6A 3GXMA 1NP0A 1XSJA 1JDDA 1XC6A 1G94A 1N82A 4HA1A 3AMGA 4KRTA 4RL3A 1ODZA 3IJ8A 3WH9A 1E72M 3BC9A 4AMCA 1D7FA 2W91A 3WNKA 1C90A 3AIWA 4LQ1A 5TD4A 3U5UA 3N15A 2XFRA 2J7DA 1YHTA 2WNWA 4A3YA 1GORA 1Z32X 4QLKA 5F7UA 3HN3A 5E6ZA 2BFGA 5GPRA 1BGAA 4BZYA 3WQWA 2W92A 1NWSA 1PPIA 2PB1A 4PMXA 3VM7A 1EOKA 2Y5EA 2EXOA 5E9AA 1XD1A 3F5LA 4F8XA 1X1NA 1P6WA 4JFVA 3LPFA 2XHYA 3ZR6A 1B3YA 3N18A 1RD6A 3VTRA 4XZBA 5D8WA 3CZKA 1W9PA 3PBGA 3GXFA 3MANA 1WDRA 4FF5A 4TOQA 3CPUA 3A47A 3E1F1 4QFUA 5LA2A 2EEXA 4ATLA 4AWEA 4F9DA 1RP8A 4W7WA 3BLKA 4QDMA 3WNNA 4GI6A 1WZAA 4GZJA 2C8NA 1ZB5A 4P7LA 4JAWA 1IV8A 2VR4A 1AMYA 1SMDA 3MUIA 4PMNA 2AOSA 1PZ2A 4JZ5A 4E8DA 2E3ZA 1TG7A 2A3CA 1AQ0A 1C91A 4MB3A 3U5YA 1DEDA 1KR0A 1B90A 2DIJA 3VO0A 1FH9A 1EXPA 2CIPA 3SCUA 1C92A 2CCRA 4U33A 2WCAA 2J62A 3VX1A 4GI9A 4MADA 4JL2A 3NIYA 1GOWA 1J01A 1V3KA 1UR2A 1BG9A 3EDEA 5HDRA 1US2A 5D8ZA 3T09A 4D6DA 1TA3A 3CO4A 4NZCA 4AD5A 1EDGA 3BCDA 3BSGA 3W53A 5CGTA 1GVYA 5JH8A 5CSYA 3CUGA 3CGTA 5BXRA 2ZUSA 3WF3A 3BSHA 4AC1X 4ZXLA 1LLOA 1UG6A 3PZVA 3EDJA 3POHA 1OWQA 2FGLA 4Z2JA 3CZGA 2VZVA 1TUXA 1FH8A 3GNRA 4AZIA 4DWSB 1IT0A 3M46A 3NDZA 2J7FA 4EAMA 3ARUA 2BV9A 1UWRA 3W27A 2F61A 3FHAA 3L2MA 2J7HA 4XB3A 4KRUA 4P8XA 2WCGA 4H04A 4W7VA 3I3BA 1QOXA 1BYCA 3WH6A 3OLDA 3L4XA 4OUEA 1OGSA 2W61A 1V3HA 3CZ8A 2WSPA 3AISA 4PSPA 1UZ1A 4LYQA 4HU8A 1GJWA 2JALA 1FHDA 1OIMA 5CZKA 3W4RA 3HMCA 3SCWA 5CLWA 3L2LA 1E5NA 4HA4A 4J3VA 5AY7A 1JZ4A 3O9NA 1UQZA 3MO4A 3EBVA 2VX7A 3WD3A 3S2CA 1B2YA 2YA0A 3G6MA 2F8QA 2VX4A 4H2CA 3AS0A 4P8WA 4AY1A 2J25A 4JCMA 1VFMA 1HNYA 3WUGA 1E1FA 3VIJA 2ZICA 5I0DA 1VAHA 3OGVA 3VGDA 1JZ5A 8CGTA 3BAWA 4DWSA 1QNQA 3PZGA 4X0NA 2VCBA 3OGRA 1KCLA 1QVBA 4L4OA 3IAPA 3AICA 1GOKA 3VDCA 5CG0A 3IANA 1HJVA 4IUGA 4CVUA 4NF7A 2XVNA 1ZU8A 1PZ3A 1UR9A 2JIWA 3WFZA 4QP0A 4YN5A 1XH0A 4WIWA 2V3EA 1DP0A 4GINA 1US3A 1OSEA 1HJQA 3BCFA 1KGWA 1WB0A 2ZUVA 1ECEA 4QCEA 2OWXA 4BQ3A 1XCWA 2TAAA 1V02A 1VB9A 3CLWA 1LF1A 2J74A 4OOZA 5A2AA 4P7NA 2XIIA 6TAAA 4PMUA 4CVWA 4JCLA 4AEFA 2NSXA 4UOZA 3O6AA 3IK2A 3ARVA 3CHFA 4MNKA 4ACZB 1D2KA 2WMFA 4OOUA 3HU7A 4GO9A 3AZRA 2YLLA 2VZOA 1L8NA 5CSUA 3NUKA 1XV8A 3AIEA 1PX3A 4Z2IA 3NDYA 4AZ7A 4KWUA 3VD4A 4MTVA 3ZT6A 1ZS2A 1W1YA 5DF0A 1NOFA 4AZ5A 2O92A 3AMKA 1OD0A 4Z2HA 1CGVA 3W28A 2PC8A 4GI8A 2ZUTA 1B30A 1ZJBA 4JFSA 2C0HA 3AHXA 5EFDA 1EHAA 3WFLA 3SCVA 4MDPA 4B9YA 5BRPA 1V0LA 1UR4A 1IZJA 1V3IA 2PWFA 4CKQA 4K68A 1H3GA 2BY2A 3VMNA 2J4GA 2ZWYA 1A3HA 1JXJA 2CPUA 1OINA 1Y7VA 1XSIA 1XH2A 3U7BA 3QHMA 1HN1A 2VL4A 3BMVA 3A3HA 1U2YA 3CHDA 3TTYA 1KB3A 3W29A 2G3MA 2YL8A 5A6KA 3MMWA 3ARQA 2J47A 5C8BB 4GZEA 4JKMA 3WQ8A 1V6UA 3A6OA 4UZSA 2XM2A 3GTNA 3VILA 1TR1A 1NARA 3WMSA 4DUXA 2ZX8A 1JYNA 3EMQA 3ZJ7A 1W3LA 5BROA 4ATDA 2J7EA 4ACYA 1JZ2A 1I1XA 2YJQA 3GYCA 2J8FA 3OG2A 3OB8A 1EOMA 3F5KA 2EPOA 2EPMX 4AZCA 2QMJA 3WMCA 3PZMA 4W8BA 1MFUA 3WNPA 1ITXA 4AZ6A 2J7GA 2VTFA 4EANA 3AOFA 3VX0A 1CNVA 2WZIA 4H41A 1BAGA 5A6BA 3M07A 1B31A 1E6XM 4MAVA 3DC0A 3IAQA 1GUVA 3PTMA 1HT6A 3CMGA 3WF4A 4ZE5A 1UKTA 1MW1A 1CGWA 2VX5A 2D0HA 2WYSA 4V28A 4PTXA 4UFLA 1C8QA 4EK7A 3TTSA 3AIVA 1SFSA 4TX8A 3T0AA 1J12A 3TOPA 3BH4A 2A3HA 5FIPA 3O2LA 2WKLA 1GHRA 1UH4A 1W9BM 3TONA 1C93A 3DYOA 1Q4NX 5A8NA 3FXYA 2DEPA 3K4DA 4MJ4A 2HISA 4UQDA 1MQQA 1E3XA 1OGGA 3WDRA 1CGTA 2RGLA 1XD0A 2VUYA 3WELA 4PUEA 2WVVB 1V6XA 2DGAA 4M29A 3VGEA 4HZ8A 2BS9A 1J11A 1E71M 1O6IA 4U2ZA 1BVNP 2BHUA 3OBAA 3I3DA 4ZXOA 1UYQA 1W3KA 1WZLA 4AZHA 5JUVA 2XFFA 4QLLA 2EPKX 2J78A 3B9AA 3N9KA 5I78A 1EO5A 1PAMA 3S6TA 1VEOA 3CUFA 3WF0A 1EH9A 5A6AA 2WAGA 3SUUA 2GDVA 2PWHA 3L4VA 1CZ1A 2QF8A 3SCPA 3W25A 3AHVA 1BYBA 1GCYA 3HJEA 3I3EA 4LGXA 1DWAM 2E40A 1EQPA 1NOWA 2ZOXA 3VGHA 2XVKA 2QHAA 2XSBA 5CGMA 4MB1A 6A3HA 2FHCA 4Z2LA 5A8OA 2XVPA 1FP8A 1K6AA 2D23A 2VVSA 3WQ5A 2QPUA 2ZUWA 2J7CA 1JZ8A 1HJUA 2VR5A 2C7FA 1Q6GA 4PCSA 1OGBA 3POCA 5EMYA 4WK9A 1UD8A 2BVYA 4TTGA 5A95A 1GNXA 4QAWA 3SUTA 4LX4A 4OIFA 2YDRA 1H0GA 1EIBA 1M01A 3GXDA 1QNPA 1CIUA 1LJYA 2EO7A 2VC9A 4JFUA 5A6JA 2OYLA 1GQJA 3EMZA 5I2UA 1CLVA 3FN9A 2DQXA 2D3NA 1UKQA 3L4WA 1ISZA 2EQDA 2ZXAA 4BF7A 5BXTA 3SCTA 5A6LA 3OLEA 3QHNA 2X1IA 1E40A 7CGTA 3VD9A 1E43A 1FFQA 4U3CA 2BVDA 2YIHA 1TCMA 2WZEA 3GNOA 2VRKA 1ZBVA 3ARWA 3RDKA 3WDPP 3ZSTA 1E0XA 1R85A 2OLHA 1BYAA 3K8LA 2UY4A 1UR1A 4DM1A 1TA3B 3J7HA 2WMIB 1CXIA 3NYDA 1Q6CA 1E73M 1V6YA 1CYGA 3W6LA 4E8CA 4AIEA 3AIBA 4W5UA 1UWIA 4WKHA 1HP5A 3AJ7A 3WH7A 3VDHA 2BY1A 1CXKA 1WDPA 4RE2A 1HVQA 3ZT5A 2UWFA 4D72A 2E8YA 1QW8A 3WDIA 3N17A 1QBAA 1JFXA 4H8VA 2UY2A 2PBOA 2YA2A 3WDHA 1NOUA 1DWJM 3MUZ1 4PUDA 3B8SA 1VFOA 5CPQA 1AQHA 2OSWA 2ZX7A 1V0NA 3GM8A 4E2OA 2D24A 2ZX9A 1XCXA 3VU2A 3BMWA 1M03A 5I3DA 1UH2A 1UA3A 5DEZA 1IZKA 1J0YA 1QHOA 3W26A 4PEEA 2ZUUA 1HL9A 3WBEA 4UTFA 5IXEA 3AI0A 3VIIA 2XPKA 1OCQA 2XWDA 4CUCA 3QHOA 1W32A 5A6BD 3SUVA 3IJ7A 2VZTA 5JBDA 1H0IA 3WQVA 3BAYA 3LPOA 2Z1SA 1JIBA 4WKAA 1QW9A 2W62A 4P7OA 1LL6A 3OGSA 4YHGA 1OBAA 3N13A 4MB5A 1MW3A 1F4AA 5EBAA 2FDMA 3U57A 1BGGA 3VMOA 3VMPA 5AC5A 5A6SA 3ALFA 1H5VA 2E0PA 4KMQA 3UG4A 1OD8A 5BWFA 3K1DA 3UERA 4CU6A 2PBGA 2VI0A 4GO8A 3VINA 2DH2A 4WSJA 2Y4SA 3UG5A 4GPNA 3ZOAA 2PWDA 1VRXA 1AVAA 3WF2A 1UWSA 3WNOA 4C7GA 3D3AA 3VIOA 4PCTA 2CHNA 1CECA 4UFIA 2G3IA 3FNDA 4UFMA 3KL5A 1MWOA 5HBFA 1FA2A 4U5IA 2CESA 1WKYA 3ARPA 1H1NA 1RH9A 4AXNA 1I1WA 1UKPA 4PMOA 1GVIA 3VIKA 8A3HA 4H8UA 4PMQA 5IDIA 3A4XA 3WN6A 4NSBA 3N04A 1JG9A 5CXPA 1M04A 5GNZA 2FGZA 3VOCA 3SCRA 1J0IA 2W67A 3AMCA 3N11A 2FH8A 4D6HA 2V3FA 1R87A 4JKLA 3T0DA 5HXMA 5FD0A 2PWGA 3NSNA 1TE1A 1WZKA 2VJXA 1V0KA 4EE9A 5HOSA 3QR3A 2WBKA 5IHRA 3ALGA 1E6RA 2A3AA 4M56A 1R7OA 1W2PA 4U5KA 3AZSA 5DMYA 4HPHA 1QNSA 3SCNA 1JZ7A 2GJXA 4CGTA 5D4YA 1W2VA 3MS8A 1GPFA 1EDTA 1JNDA 1QI0A 2D3LA 1E15A 5FKYA 4CU8A 1MQPA 2O9TA 3GDBA 2WLYA 3NCOA 1QI2A 4QCFA 1QNRA 1C7TA 1PIFA 3WDQA 2A3BA 3RPMA 2Y8KA 1OB0A 1CTNA 2VMFA 3VM5A 2CXGA 2EBNA 4HMEA 2VCCA 1W3JA 1BF2A 3MSDA 4NRSA 5DT7A 3AMLA 2JF6A 4GXPA 4CCEA 1H09A 5BRQA 1WO2A 3MV01 3SCSA 3EMCA 3WIJA 4W84A 3EDKA 5GQBA 2AAAA 2W66A 1HXJA 4AIOA 4D6IA 2EJ1A 2BHZA 2WHLA 1CBGA 1BPLB 3WUBA 1RP9A 1JF6A 2WMGA 3VKKA 5GNXA 2GVYA 1ZBCA 3FW6A 5A8PA 1MFVA 1ODUA 1B3ZA 5ABGA 4ML4A 1E6PA 2VO5A 3NJ3A 4JKKA 4PMRA 1HL8A 1PJ9A 3AXXA 1XYZA 3M6DA 1EQCA 3VGFA 5IFPA 1E56A 3ARTA 3MUY1 5AYIA 4ZE4A 2V38A 4JL1A 4TVCA 1UR0A 2F2HA 3WQ4A 3W82A 4IPLA 3W37A 2YDSA 3RJYA 3WEZA 1OT2A 3AIQA 4AEEA 1C3FA 2QLYA 1MW2A 1JD7A 2V3GA 4AIUA 4LPCA 2XVGA 3KWXA 4GIAA 5GNYA 1EO7A 1KFWA 2OWCA 1WDQA 3QOMA 2WXDM 4P7RA 2G3JA 2XWEA 3TTQA 1X6NA 3GZAA 1W9XA 3MUAA 1LWHA 3AS3A 1E6QM 4X9YA 3RJXA 1V6VA 1J0HA 3A4WA 2E8ZA 1CGUA 5A2CA 2XM1A 1PX8A 3CHCA 5M03A 3ARSA 1KQZA 4MNMA 3BAXA 1A47A 2O9PA 2BHYA 2CITA 1I75A 3AXHA 4RE3A 2WZHA 4GQRA 5IFTA 2YBUA 1SYTA 2X8RA 1PBGA 3LPGA 4J27A 1HKIA 1UHVA 4JHZA 3PHAA 2XUCA 1GOQA 2OYMA 2W5FA 4U3AA 1PX4A 3MSGA 2B31A 1PEZA 4IM4A 1HVXA 4H8HA 3VD5A 2CHOA 4C7FA 1LL7A 4KGLA 1HF6A 5A1AA 3THDA 1UWQA 1JL8A 1FOBA 4W87A 1JDAA 3EDFA 4W89A 2WB5A 2DSKA 5AC4A 4W88A 1V3MA 1BHGA 3GH4A 1K9DA 4HZ7A 3K8KA 2DSUA 3K8MA 4PMZA 4TVDA 3SCQA 3RM4A 3ZSSA 2J7BA 4PTWA 2ZX5A 3PZQA 3UEQA 1FP9A 2CBUA 5E70A 4UCFA 1V0MA 2QPSA 3OZPA 3F5JA 1KXQA 1VFUA 5D9MA 4WKFA 1GQKA 5EB8A 1JAKA 3VIPA 2V3DA 5E0CA 3CZJA 5BCAA 5LYRA 5D9NA 2E9MA 1VFFA 3GBDA 4R27A 4D6CA 5A8MA 3RO8A 2WC7A 3AHTA 4KGJA 4N42A 3TA9A 3NSXA 3FAWA 5E6YA 4B16A 1DHKA 2X2YA 2YOCA 5BYWA 4BQ4A 3WUEA 2ZE0A 1BLIA 2E9LA 5DFAA 1GJUA 1K9TA 4UQCA 1JDCA 1E9LA 1TMQA 2JFEX 1ZL1A 2YL9A 2WANA 1B3VA 1BSIA 4PYSA 1KXVA 3OLGA 1NWUA 1XH1A 2J77A 5I6SA 1L0PA 4XV0A 1UD4A 4OBRA 3PZOA 1HJXA 1UA7A 1VEPA 4W5ZA 2WM0A 4J3WA 3ARYA 3QGVA 1JAEA 4ZENA 1E4LA 1QHPA 5JIPA 2PI6A 2CBJA 2YL5A 1XHGA 4J3TA 4MDOA 5FCZA 4BCEA 3W6MA 1AQMA 1EA9C 1E1EA 3RCNA 1KGXA 1G01A 3K46A 4HZ6A 4J28A 3ARZA 3WH8A 4P7QA 3GNPA 3K4AA 1JI2A 1VBRA 3VIMA 3VNZA 3WMBA 4HOXA 4GZIA 1K9FA 4HA3A 1QI4A 1JYXA 1TZ7A 1ISYA 1R8LA 3IJ9A 3ZJ8A 2WMKA 1HJWA 1E4MM 2UY3A 1FHLA 4WLCA 1NWRA 4XUYA 4M80A 4WSKA 3FHQA 2VQTA 2WHKA 4J3XA 5FL1A 4FMVA 3WUFA 1W1TA 2BVTA 1CEOA 2CKRA 1C7SA 4B9ZA 1QBBA 2QV4A 3RM9A 1GW1A 1B9ZA 4HP5A 4CD8A 3UCQA 1GOOA 1JYVA 3CIVA 1SR0A 2XJ7A 1J0ZA 2A3EA 1V08A 4OZOA 5A94A 4F9JA 2UY5A 4F66A 2AMGA 2VQUA 1V03A 1WE5A 3VIGA 3W0KA 3U7VA 1X6LA 3RM8A 4P8VA 1ZBWA 3B9EA 1XYFA 1JZ3A 1LL4A 1NM9A 1GHSA 4PBGA 1XGZA 1EDQA 1KR1A 2DSZA 1GQLA 1J10A 2DH3A 1KBKA 5E0FA 1GOIA 2J75A 2WK2A 3EDDA 5CLTA 2WC4A 4CD7A 4M8UA 2DIEA 4JHOA 1J18A 1QNOA 1TVNA 4GQQA 4U31A 3RMEA 2BY3A 3AHYA 1ITCA 3MMUA 1U30A 5ECUA 1JNEA 3WDJA 2VCAA 3D5HA 1FFRA 4MJ2A 5AYBA 5A3HA 5FOOA 1B0IA 3WD1A 4P8UA 3VPLA 4ZEPA 1HP4A 2JF7A 4DM2A 3T2QA 1JZ6A 3KZSA 1W3HA 4W8AA 5ABFB 4YHEA 1EGZA 4MAZA 3WL1A 3T08A 4AD1A 1UUQA 4FK9A 4B15A 1EHNA 3CUJA 2CETA 4JFWA 5C71A 1G9HA 1JF5A 1DTUA 5I5RA 1J9YA 1KBBA 3WEOA 1E5JA 1KXHA 2DSWA 3VIHA 1QI5A 4W85A 1WZMA 1TFVA 3TTOA 2IXVA 1DWFM 2YKKA 4W93A 1WAWA 4WJXA 1OT1A 7TAAA 3AIUA 2VRQA 2Y2WA 3CHEA 3WKZA 2WVTA 4W86A 3WQ6A 6CGTA 4PMYA 2GJRA 4CU7A 1KCKA 5I79A 1W91A 5M17A 1F4HA 3WBAA 2BXYA 1VBUA 2YBTA 1H11A 2Q8XA 1XSKA 1CXLA 4D1IA 4L4PA 2JIEA 2VZUA 1W9VA 3MU7A 3T2PA 2W4XA 1BVZA 2VOTA 2WMIA 3JUGA 3PZIA 1HJSA 2VT0A 1BQCA 3VVGA 2FH6A 2VZSA 1E6ZA 2WHJA 4UQBA 4F79A 1OM0A 4XZWA 1Q6FA 4CD6A 1V6WA 3VUPA 3AFBA 1CXFA 1E4NA 4TX6A 1Q6DA 2X0HA 2O9OA 3AYRA 4Z2GA 3OA5A 4PRWA 1C8YA 1CGYA 2PWEA 4FLRA 1QHZA 3L4TA 1H2JA 3SIMA 3ZO9A 1VENA 1WPCA 4AD0A 1K9EA 1E6NA 2XYLA 3CH9A 2YL6A 3AZTA 1U33A 3APGA 2ZX6A 4UZUA 2JE8A 5KEZA 3L4UA 4AD2A 2D1ZA 4AZCB 1J0KA 4D6FA 3ARRA 3WEMA 3ZR5A 4HOWA 2CBVA 3MV11 1NWTA 3N1AA 2D20A 5JIWA 4URIA 1QI3A 4W7UA 3SEPA 2ZWZA 1ISXA 1H49A 3ZM8A 5ABFA 4HOZA 4NI3A 2WWCA 2MANA 1UH3A 2Z1KA 1KWKA 1LWJA 3GXIA 1KWGA 3DECA 4HMDA 4A3HA 1ZJAA 3GH7A 1Q6EA 1WNOA 4ATWA 2QMKA 3BGAA
chains in the Genus database with same CATH superfamily
3F03K 3ITXA 2OYKA 4IP4A 3RIKA 1Q6UA 3DESA 4S3BA 5MF5A 4HZMA 2CFFA 2XVLA 4NNCA 3IVUA 1MW0A 4KFPA 3I7SA 5CQ1A 4IT4A 1V3JA 3NNTA 3PUGA 4AD3A 4U84A 2CBIA 3RLUA 3UWYA 3H4WA 2VM8A 4MY1A 1JI1A 1HIZA 4MSSA 3GXPA 1SMAA 5BMXA 2Z0IA 1B1YA 4LVBA 1NFGA 4UQ9A 4N0RA 4ENLA 2CERA 4KEMA 1F3EA 4I5RA 4GHRA 3FK4A 2QCDA 4CN6A 4DB7A 1E4IA 2GUYA 3ITTA 1U5VA 2OSXA 2GQAA 3T2OA 1DJZA 4DJFA 1G0CA 1AD4A 2VFEA 3P62A 3G1FA 3MMTA 4ZS6A 3O3RA 5I23A 3B0XA 4HHMA 2YGYA 1GVRA 2B7NA 2PLCA 1TVPA 1V02E 4GUFA 3STCA 3W7IA 1A5OC 3T0BA 1GG1A 3LTSA 4HPGA 3RR4A 5JBFA 4TO8A 1Z3NA 3BPWA 1TPFA 4X60A 2DG3A 1DJHA 4B5WA 4P5UA 2ZXBA 2WBGA 2DZSA 2Z28A 1B3WA 5FJTA 5I00A 4ORMA 2XSAA 3OIHA 4Q6XA 3N14A 5FA5A 4BQ2A 4RE0A 4CCCA 2CKSA 5FJJA 1NP2A 1KFJA 3SY1A 3TCZA 4L72B 3TR9A 2DDXA 4C5ZA 1CX9A 3M0LA 3EB3A 2NT0A 3W84A 4GKLA 1H41A 1OHLA 2GUBA 3BG9A 5HUPA 1MXDA 2JEPA 4JYFA 2QEZA 4WEVX 3UETA 3ECQA 2GK1A 4PA8A 3VUSA 3O5OA 4O52A 3TIMA 3CNYA 4R7OA 5HPCA 4IG2A 2DT0A 4LYRA 4J40A 3QH2A 3LENA 3G2GA 2MNTA 5D9PA 3O07A 4LC8A 4LCQA 2VEPA 1E3ZA 4O8RA 4BK9A 6REQB 3TMLA 3CV1A 1WXZA 2ZXQA 3U2EA 3QYSA 5D9OA 3GH5A 3S2JA 2XH7A 2YPIA 4BS0A 2ZUNA 1ESWA 2A79A 4DI8A 4AISA 4TVUA 4UTHA 2ESCA 2H9AA 4NX5A 4GCXA 4S3KA 3IV3A 4DXVA 1DWGM 3WD0A 4GRSA 4LRTA 2ZQTA 3DYMA 3UG3A 1AW2A 5HNNA 2VWTA 4ZO7A 1XI3A 2C14A 2WLZA 4I8DA 1XKJA 3PZUA 4KQNA 4UTTA 4QT3A 3AIRA 2FTPA 4QDPA 2FVLA 4AYSA 4NRRA 1AODA 1QWKA 2QUUA 1LT7A 2YXXA 3THUA 1W1VA 5F4WA 4DF1A 3EWCA 4D1JA 2X09A 1EWEA 2YZRA 1GZJA 4R34A 9CGTA 4UDMA 3G1HA 1X6UA 2C16A 5CBBA 4AW7A 3R6IA 3H9RB 3M0JA 2CEQA 4DNHA 2XFYA 3BQ5A 2FZDA 3T6CA 1QTWA 4HTYA 1A5BA 1KXTA 2A2IA 3UPWA 3PA7A 3GLCA 3NQEA 4HGXA 5HQLA 1Z7AA 3GX9A 4J3SA 5K2ZA 4AZBA 4HNCA 1FTXA 1TPVA 2OWWA 1V3LA 2EHHA 1NQ6A 4NZ4A 3SUSA 4Q7NA 3BV4A 3U48A 3ZJ6A 1KLYA 1R6WA 1OK6A 2O9RA 2G8ZA 1IHIA 1CXHA 1W9DM 4DRSA 2DT1A 3MCNA 1LUCA 1G5AA 1V93A 1KFKA 1AA1B 1R86A 4LUIA 1X7IA 2VX6A 5IRPA 2JGYA 4FLQA 2P88A 1ISVA 1PSCA 3AROA 1O1HA 3WZ0E 1OCBA 2WMHA 1D7JA 3NQMA 3PTQA 2QS8A 1BYDA 2V6AA 4GYFA 4JPGA 4UFHA 1FY6A 2YW3A 1E0VA 4LXFA 5CPTA 4OKDA 3VNDA 3GBEA 4NY2A 2FFIA 3W02A 1JCHB 4MIMA 2XN2A 4N6FA 2EPNA 4PULA 2X0YA 5FJPA 1B4EA 2KAUC 3MMDA 6PTDA 1W1ZA 5DCBA 5CPMA 1DXFA 3GVQA 1QRQA 4BHYA 2H3DA 3GWQA 3V1HA 4AAJA 2I9UA 1WKFA 1RBLA 1UKSA 1EJUC 5BOOA 4XVDA 2OQLA 4ZR8A 2V8ZA 1NSJA 1UOKA 3M7SA 1D6OA 4DWSD 1W56A 4BEQA 3UR8A 1H50A 4HIBA 3R8RA 2X05A 2E6FA 5FSEC 2LGOA 2E28A 5I09A 4NASA 5C70A 1M7XA 5LNVA 1WDSA 2EG6A 2PPNA 3LS9A 4L9XA 1W5MA 5AB3A 2ABBA 1TV5A 1THFD 1O7AA 1FCQA 2DZPA 5DELA 1RQBA 1HQTA 2ALRA 4RZ5A 2DZUA 3R12A 1V8EA 3KL0A 2Z25A 5A69A 2WC3A 3JS3A 4XSLA 3M43A 2XIQA 4I6VA 1HKMA 3U0HA 1YQ2A 4MGVA 1XC6A 1XINA 1YTKA 5IDZA 5HWBA 2ITKA 3TJLA 3VDGA 3TOYA 2QCLA 2W91A 4LQ1A 1K8CA 1I2QA 3E02A 4GISA 1XG3A 3TQ0A 2WNWA 1YHTA 4JYEA 1LOQA 1UMLA 3E5PA 3PJXA 4QLKA 3ABZA 2FYMA 3TZFA 3GO2A 5E6ZA 4EF9A 2XPAA 5ECVA 1P6BA 4L6OA 5FF0A 3PPCA 2B0MA 4L4LA 5TAOA 3HBLA 3EPMA 5LXEA 1I4NA 2Q8LA 1A80A 4F8XA 2AKZA 1X1NA 1S2AA 3LPFA 1EYEA 3QW4B 3N18A 5D8WA 2FZBA 4P61A 3PBGA 3GXFA 1JUBA 3S3GA 2PDKA 4TOQA 3E1F1 4QFUA 2XIOA 1YPFA 3ZFHA 4L61A 4O15A 1XYBA 3N29A 3N2TA 1TPC1 4P7LA 3CQHA 4PUKA 4DRMA 2VR4A 2OO0A 5IBXC 5CH9A 4ZMGA 4NX0A 2ISWA 2E3ZA 4EP8C 2GJLA 3G8EA 2A3CA 3VO0A 1FH9A 1EXPA 1C92A 4TV6A 2CCRA 2HE8A 2WCAA 1FAPA 1GGOA 4L1WA 1SU5A 4JL2A 4MADA 1J01A 1V3KA 1UR2A 3W7LA 4ZQCA 3LCIA 1US2A 5EA9A 5D8ZA 3T09A 1TA3A 2X1UA 3IK8A 1IXQA 2QULA 4H9VA 4AD5A 3BSGA 3M0XA 5JH8A 3VYLA 3HQPA 3H2MA 2OEJA 5BXRA 3DHFA 3WF3A 2A1YA 2OZ0A 1OWQA 3CZGA 4HPNA 2FQIA 4H01A 3NAVA 1Q7MA 4F0RA 1UMYA 3O5PA 4O10A 2NWSA 3NDZA 3NFUA 1R3WA 3CT2A 2WCGA 4MFEA 1QOXA 3WH6A 1XIMA 1OGSA 4GG9A 1V3HA 2JBMA 4JS3A 2I17A 4HU8A 5D02A 2JALA 1B5TA 5CLWA 4ZQOA 2VENA 1E5NA 3PJWA 4J3VA 4EXBA 4RNIA 3BDKA 4YCOA 1O12A 4Y8EA 5DXYA 3Q65A 3IGUA 2WNQA 3G6MA 2F8QA 2VX4A 3G3DA 3AS0A 4H2CA 3TNBA 1E9YB 4GNVA 1LLZA 4JIHA 2ZICA 2YW4A 4C6BA 1JZ5A 1NF7A 3BAWA 4Q4KA 4HBKA 2Z1XA 4CNSA 1JULA 2VCBA 3OGRA 3HTWA 1KCLA 3IAPA 4NT0A 4S2CA 3AICA 3E12A 1EQ3A 4QGCA 3VDCA 4IUGA 5CC7A 2XVNA 5E1QA 5J5RA 3WFZA 2KR7A 4PFMA 3UD6A 3W72A 1IF2A 2ZRVA 4GINA 1PDYA 1Q1CA 2OWXA 1UIOA 1V02A 1VB9A 3B8TA 1TCOC 2O7QA 4C6IA 1UB3A 2XH4A 4JX5A 4AEFA 4XTDA 4UOZA 2TMDA 2RUSA 1J8VA 2G37A 2O4MA 5I98A 1PYFA 2WMFA 1L6SA 3TA6A 3GB6A 3WQOA 3H24A 3W9ZA 1L8NA 1YLVA 3NUKA 4MZYA 3AIEA 1F3TA 3NDYA 2XP3A 4ZOAA 3URAA 1ZPTA 4AZ7A 4KWUA 3VD4A 4WSHA 4M6VA 3EX2A 2Z2UA 2O92A 5HUOA 4C60A 3O5FA 1CGVA 2PC8A 4GI8A 4C6KA 3S83A 5H8MA 2PPGA 2OFNA 4NL1A 3OYXA 4WJ8A 1UOZA 1ME9A 4JFSA 5FJOA 3AHXA 5EFDA 2ZR5A 1EHAA 3CPRA 3H26A 4JNYA 4B9YA 1V0LA 1E9ZB 2WM1A 1V3IA 4IIDA 3I65A 4DRKA 4UTUA 2BY2A 1HFBA 3IK4A 2NXHA 3EWYA 3LD5A 2DG4A 4RZ4A 3V7PA 1K7XA 2YCEA 3FDGA 3A13A 2R1KA 4HJWA 5C9ZA 4Q8OA 2G3MA 5A6KA 3LNMA 5C8BB 3DFSA 4JKMA 1IZCA 1KBJA 4RZ6A 3A6OA 1PZ0A 3GTNA 4DUXA 1JYNA 5FF4A 4I6KA 4ZBCA 4ATDA 1FKXA 2GUUA 1TELA 1JZ2A 4CQ8A 9XIAA 4HNTA 3RPTA 2NX3A 2OCZA 2A7NA 2EPMX 2EPOA 3EKZA 3UR5A 1MFUA 3WNPA 4AZ6A 2VTFA 3LN3A 2B7PA 2ZZ3A 4NAEA 3C2FA 5A6BA 3M07A 1E6XM 3TYZA 3QSTA 4ZE5A 3TCEA 2PGEA 1MW1A 1CGWA 2VX5A 5FACA 4V28A 5BRBA 3M0ZA 3W7OA 2GQ9A 3AIVA 2E5DA 4I7WA 4AG0A 4TX8A 2M2AA 1S1PA 4HNUA 3M7WA 2W9MA 3O2LA 1W9BM 2G4JA 1XLAA 1C93A 2ANUA 2O4QA 2WPBA 2XIMA 2Y5JA 1IIGA 3HQNA 4MJ4A 4KRZA 2HMCA 4UQDA 4UBPC 1MQQA 1E3XA 1WQ5A 1C29A 1TWIA 4MOZA 4JTIA 4XD3A 3TSMA 1XLGA 4XWUA 4UB9A 5BNKA 3ITOA 1DIDA 1EP3A 5D30A 3VGEA 5CBJA 3LTYA 4NYYA 4PFHA 4O17A 2BHUA 4TW8A 3OBAA 3ITVA 5JUVA 2XFFA 1WXYA 4C6FA 5HW6A 2EPKX 2QUMA 1M41A 1H1YA 1O95A 3REQA 3B3DA 3N9KA 2VWSA 2ICSA 5I78A 1PAMA 4MG4A 1EH9A 4FXJA 4JQ2A 3SN4A 1OG0A 2REQA 2GQ8A 4AHOA 3SCPA 2Y63A 2Y89A 3UGVA 3TYDA 3HM7A 1J6PA 4GIRA 4LGXA 5LIWX 1EQPA 3E2QA 4PUNA 1NOWA 3OZMA 2ZOXA 2QJJA 3VGHA 1VRDA 3ODKA 2PP3A 2XSBA 4WOQA 3MSRA 1ZP3A 6A3HA 3PR9A 4BEUA 3V5CA 2F2DA 1RBAA 1B6CA 2QPUA 4LYKA 1D3GA 2ZUWA 2YFOA 1HJUA 3LHVA 4PCSA 1OGBA 4REQB 3POCA 2YCJA 3HG2A 1UD8A 4TYOA 3KCJA 3SUTA 3R2GA 3NRKA 2X41A 5EMUA 4K37A 1HW6A 5EBUA 3UU0A 3NQCA 4WQ6A 3K30A 1QNPA 2RUQA 1J4EA 5A6JA 2VC9A 4JFUA 2OYLA 4DF2A 5I2UA 4HMNA 3UWUA 4IIGA 2EQDA 1SFJA 2ZXAA 1NEYA 3SCTA 4MUPA 4QE5A 3OLEA 3QHNA 2X1IA 3HV9A 4U3CA 2BVDA 3FEQA 2YX0A 3KTCA 2V5JA 4MZ1A 2WZEA 4RR4A 1QU4A 4V33A 3GNOA 5ENLA 1ZBVA 3O5DA 3DUGA 3RDKA 2PC4A 3WDPP 1OF8A 1E0XA 3Q67A 2UY4A 2PLKA 3NTPA 5CPOA 4KCVA 4FPSA 3TYUA 1Z69A 4DLFA 4NILA 4MYXA 1CXIA 4IG2B 1ZAHA 3U2CA 3BTNA 3W6LA 1FWFC 3W1XA 4WY0A 3AIBA 4W5UA 3UCCA 3P82A 4Z17A 4WKHA 3RLHA 3SRDA 1HP5A 3P7YA 1OFDA 1SSDA 3V0SA 2AWGA 1YATA 2I5IA 2BY1A 1YTEA 2QDGA 3W85A 4RE2A 1HVQA 2UWFA 3H12A 1XCFA 3E5BA 3A23A 3P5ZA 2PDMA 2P1FA 4LV4A 2YFNA 1JPKA 3ID7A 2YSWA 3WDHA 3H4GA 3B8SA 1VFOA 4Q4SA 3EWBX 5I3HA 3CUZA 2OSWA 3JYJA 4S2BA 1TJPA 3LMZA 2ATMA 4E2OA 4N6EA 2D24A 4ZB2A 3BJSA 1F61A 3BMWA 5LIUX 4PZVA 4NZ5A 1T6MA 1UH2A 1UA3A 3KRSA 4FB7A 3W26A 4PEEA 1EYWA 1QT1A 1HL9A 3WBEA 2ON3A 4HCHA 2X1TA 3DOPA 4DBEA 5HQMA 1W32A 2O56A 5JBDA 3S9ZA 4Q4OA 3NXLA 1YDYA 2PTYA 1JCNA 5L6UA 2RKXA 1MW3A 4DEFA 2PDLA 1RBOB 3TFCA 2PN0A 4YTTA 2TYSA 1FWTA 2ACQA 3HPZA 5BWFA 3QV8A 1HL2A 3OIXA 4XD4A 2ZRXA 2JQXA 4TX0A 3L0GA 4WSJA 2Y4SA 2JKAA 4AVNA 4Y2WA 2PWDA 1VRXA 1AVAA 5EL1A 3WF2A 1DE5A 4Y8FA 4GX8A 4DUOA 1CECA 4IL0A 6XIAA 2LPVA 4UFMA 3AWOA 1QPFA 1FA2A 4U5IA 2CESA 2HJPA 5BOFA 2UBPC 3EXSA 3P67A 1I1WA 4NJHA 1OY0A 4HB7A 4PMOA 3HG5A 3PAJA 4ZPWR 4RK8A 2OQYA 4LS2A 4PMQA 3WN6A 1M7OA 3FYYA 4NSBA 3NL5A 3ANYA 2X7VA 2FGZA 3SCRA 1IEXA 4PE8A 3IARA 4J4OA 3N11A 2FH8A 3F7JA 2O55A 4IJRA 5BZAA 3M0YA 2PWGA 5FD0A 1WZKA 2GVEA 1V0KA 4H6RA 1SR9A 1VCFA 3QR3A 1MUWA 2VEGA 4QTGA 3PNZA 3DFOA 4JICA 3K4WA 3Q37A 3V36A 3I6RA 1EDTA 1JNDA 4KWSA 1OCNA 1CB7B 3CWOX 3R58A 3CWNA 3ZWTA 3LXBA 1MZHA 4BFAA 2WLYA 4LNYA 3XIMA 1QUMA 1PIFA 1IQ8A 5HWMA 1FUYA 3PPHA 4RDVA 2Y8KA 4FNUA 4C90A 3E96A 3EEZA 3SRFA 1EUAA 3TAOA 3WQDA 1JVWA 3AMLA 3HPXA 4O13A 4BR1A 4J9JA 3C2YA 3QN3A 1H09A 5CPNA 1UROA 1WO2A 5CZ0A 2OT0A 3LRKA 4JIQA 2A21A 3MV01 3SCSA 4UTWA 2AAAA 1FCUA 3HGSA 3WK3A 3SY8A 4AU0A 4FX8A 2BHZA 4JFMA 2DY3A 1CBGA 3W07A 2QUNA 3E0FA 4JD4A 1ZBCA 1L2QA 2Z7GA 1MFVA 4IMEA 1ODUA 1B3ZA 1E6PA 3TN3A 3LBOA 4LAUA 4QIBA 1Y0EA 3G22A 4WY0F 3BW3A 2ZQ0A 5B80A 5FEWA 3AXXA 3M6DA 4K36A 5IFPA 3C2EA 3UBPC 1FKLA 3ARTA 3MUY1 3HJZA 3H7RA 2I14A 1FCBA 1K02A 2ISFA 1FXPA 4IWWA 3V5OA 3NM3A 3NTYA 1EJTC 3DHDA 3UY7A 3RG6A 4GABA 3GNNA 4TVCA 1UR0A 2YZ5A 3LCWA 4JFKA 1NQKA 3RJYA 4MLJA 4Q8VA 1EA0A 3SAZA 1J2BA 3CMFA 1KRBC 1YE6A 2QLYA 1JD7A 2V69A 2WJZA 1GQNA 1SFTA 1H7XA 1EO7A 1KFWA 5HANA 5DLCA 2P5NA 1AH0A 3T78A 1WDQA 3BGGA 3GTYX 4ZO8A 4A8IA 4AWTA 1F5ZA 4R7JA 2XWEA 3O15A 5JXQA 3JXVA 1E6QM 3VNKA 3NZ1A 4F2UA 3MHUA 5HWJA 3WJYA 1KFEA 1KFCA 1YBQB 3TU9A 1U1HA 1KBLA 4C5YA 2CWNA 3KBVA 5HMSA 1QJWA 1PVNA 1JQVA 4ZB0A 2IQTA 1W17A 1W3NA 3BAXA 4FS9A 1AW5A 2WZHA 4GQRA 3GKAA 1N55A 1YNPA 1G69A 3NQVA 3O5EA 3P6LA 2XUCA 1GOQA 3L5LA 2NUWA 1J6OA 1PX4A 1PEZA 4MMWA 4IXHA 4FX6M 1NSGA 1JL8A 5RUBA 3XISA 4ZTYA 3UVAA 5AC4A 3KLKA 4UIOA 3LERA 3CJPA 1F2JA 1K9DA 4HZ7A 3LNPA 5DANA 3K8KA 4C1KA 1NY1A 5K4ZA 4PMZA 3RO6A 1IT7A 2X2GA 3DAQA 3TN6A 2HK1A 5T9CE 2CBUA 5E70A 4OWGA 1NDVA 3OZPA 3HURA 3F5JA 1BEUA 1GW9A 2R8WA 1KTCA 4WKFA 5EB8A 3VIPA 3CTLA 3PRBA 2BTMA 3GHUA 3IRSA 4HD5A 5BCAA 5D9NA 1XRFA 5HR6A 3D47A 4R27A 4D6CA 5A8MA 2WC7A 3APYA 4MZ8A 4LF1A 4KGJA 3NSXA 3LLXA 2BODX 2X2YA 3BWWA 3P0WA 3WLTA 1XQLA 5BYWA 4BI5A 3W73A 1ZALA 3T0TA 3TLQA 3A22A 1BLIA 4HSNA 1E9LA 1Q6IA 4I90A 3MY9A 4GBDA 4RXGA 2PWVA 4JX6A 2WANA 1EF3A 3CGNA 1TCDA 1BXCA 1GKPA 1TRIA 2NWRA 3P84A 1BSIA 4Q7BA 3WJSA 1K70A 4ASTA 1XH1A 3VZYA 5I6SA 3H54A 1L0PA 3SSJA 2J9XA 4OBRA 3UP8A 2BGQA 3NGJA 1UA7A 4O1DA 3TWAA 3CQJA 1R2TA 2OT1A 4ODKA 2QJHA 3QGVA 4GUIA 1JAEA 1QHPA 2QKFA 3BW2A 5JIPA 4GUHA 2PI6A 1XHGA 3Q45A 3IHZA 2QR6A 5F4SA 2PDFA 1VCVA 3WH8A 4HK6A 1UW9A 3PK7A 2ZZ1A 1DIKA 4XZMX 4GZIA 4QAIA 1XFBA 3GU0A 2FB2A 3URBA 1JYXA 1HGYA 2GL5A 1A53A 3TW7A 3LXAA 1HJWA 3LZ3A 4M80A 3FHQA 4GY0A 4MVAA 3VCCA 3PR2A 2AL2B 3FVDA 3KTXA 5FL1A 2IKJA 3C2VA 1W1TA 1C7SA 1QBBA 2PCQA 3SI9A 1XYLA 4JIPA 3TXVA 4CD8A 3UCQA 4GNKB 1GOOA 2XJ7A 5T26A 4AB4A 4DXXA 1X97A 5A6TC 4WOZA 2A0NA 3TFXA 4F9JA 2UY5A 1FWGC 3L68A 1J4IA 1X6LA 3W2JA 4P8VA 1ZBWA 4ZZ9A 3UNDA 1MRQA 4WZHA 4BI7A 3B9EA 3NQFA 1Q63A 1JZ3A 2QJNA 2TODA 1GHSA 1XGZA 1DJXA 1J10A 3IIVA 1KBKA 1KM1A 2J75A 5FAJA 4M7SA 4J2PA 4TIMA 4XZHA 1EIXA 1QASA 4ECLA 1LOSA 3I68A 2OZ8A 4M8UA 1FRBA 3MZNA 1J18A 1TVNA 1DXIA 1R30A 3OO2A 5KSWA 3RMEA 3E2SA 4NAFA 2Y62A 2VCAA 3D5HA 4UTMA 4GXMA 1SUXA 3CQIA 3WD1A 1LTDA 3VPLA 4ZEPA 3KOWA 4DM2A 2JF7A 2ZR4A 2DVUA 3IEBA 1NJJA 1HGWA 4GJIA 1S2VA 4DO7A 1ZZMA 3OOBA 3GE7A 4HNOA 1DTUA 2VGFA 3WEOA 4S23A 2OMAA 2DSWA 2E25A 4O1AA 4W85A 4GKTA 2UV8G 4RUBA 3IV8A 1QPNA 3SJNA 3B05A 2YKKA 3LM7A 1KC7A 3VXGA 1REQA 4W93A 1WAWA 1OT1A 1FKRA 3O8AA 3AIUA 1SFLA 1KFLA 2VRQA 2Y2WA 4KEZA 1IEQA 2IS7A 4W86A 1ONEA 4IQEA 2PV2A 4JYDA 1KCKA 1YNYA 2PCEA 1W91A 3KS5A 3KOYA 1VYPX 3EKGA 2BXYA 1VBUA 1EC7A 1XIGA 3TWBA 1XSKA 1CXLA 2A85A 4ERAA 4PUUA 3EX1A 2W4XA 2VOTA 2PV3A 4HU3A 2WMIA 3ONCA 3TAKA 4WDXA 1B9BA 1BQCA 2ZC8A 3EA3A 4DQWA 1R3YA 1OM0A 4QITA 1B4KA 1V6WA 2VFDA 4NQ1A 1F8MA 1WBJA 4DY1A 3AAMA 1CXFA 3K1GA 1TIWA 4JEQA 3BMBA 3DIPA 3W7NA 3TROA 3UGRA 1C8YA 3A3WA 5LNSA 1K9EA 5HMDA 3CH9A 2YL6A 1FWJC 3AXKA 5KEZA 4AD2A 2D1ZA 3KHJA 4AZCB 4IGMA 4A35A 1Z41A 3KOXA 3S6DA 3ZR5A 3MV11 2D20A 3PG8A 4W7UA 3SEPA 4PTDA 1H49A 4KF1A 4XUGA 3ZM8A 5CPLA 4LALA 2FZNA 3IJDA 4CLMA 5CBIA 2MLXA 1LBMA 2MANA 3ATYA 2Z1KA 5E5CA 3SW6A 3DECA 3GG1A 4A3RA 1Q6EA 3BGAA 4I5UA 4L65A 4UQEA 1C8XA 2D0GA 4EKJA 4H6KA 3CUIA 4D6GA 2C13A 1GVOA 3C2OA 3UR7A 5DRIA 4C65A 3AXIA 3F4VA 4HSHA 5FJUA 4GIVA 3GIYA 3MKKA 3PS7A 2BOFX 5AHIA 2QCFA 2H8ZA 3DH7A 5BXJA 5TF0A 2PTDA 2HVMA 3BAKA 1ML1A 3HG3A 1KT1A 3BMXA 2NW0A 4PTMA 3THQA 4UR9A 1HXVA 3ITGA 4K3ZA 1U83A 3VDAA 2C18A 3IIOA 1OABA 3VD3A 5A2BA 3AU6A 3TW9A 3IUDA 3BZJA 2DQWA 2CU0A 2BGNE 6TIMA 2XZ9A 4C6DA 4BF5A 4HHPA 3WD4A 3VNLA 5H6HA 5HMEA 3UZJA 4DJFD 2FKPA 3CUHA 3MZ2A 3N2OA 2BP1A 2RFGA 1N1AA 4E3TA 3AS2A 3LPPA 4GUGA 5ABHA 4H9XA 2DORA 4DYEA 3PZNA 3O5GA 4U85A 3CMJA 2IMRA 3W38A 3LG3A 4KIEA 3STGA 4ORIA 1XRVA 3W1PA 4H83A 3UY8A 4CCDA 4FEZA 4ODQA 3DDMA 4R33A 5M2FX 5FSDC 2WVSA 5U4NA 1XS2A 5CPSA 3V5FA 4L9YA 4PN2A 1XX1A 3OOQA 4FIQA 4YYCA 1ISWA 2OZ3A 3N2CA 1S3HA 2VP8A 3BG3A 3INPA 4Z2KA 3G1DA 1WCGA 3C61A 1ZJIA 4B3LA 3TYAA 2WWDA 1SJCA 2WKGA 4RE4A 4HHHA 4UCGA 4XKMA 2V9DA 3G1RA 2CLFA 3KRUA 4MJZA 4Y7EA 4H7VA 1GKQA 3QFEA 4WUIA 4TTUA 3TKFA 1W3TA 2GJPA 3IWPA 1TR9A 4E2DA 5EY5A 3T8QA 5G4EA 3GY1A 4RPQA 2D2HA 3KDNA 4HMCA 3DFQA 1LG1A 1E9IA 2PRMA 4D6EA 3MWCA 2VUNA 4JFTA 1KM5A 2R24A 3W24A 1GONA 1K7EA 1O5RA 2POZA 3EIPA 3OZOA 2GOKA 3GDLA 3L2IA 3PY2A 3PPFA 2POTA 2HTMA 4AH7A 2HRWA 1KCXA 3AS1A 1NFPA 2WVUA 1UD3A 2XFWA 1J0JA 2NQHA 2W63A 2VRJA 4K7VA 1V5XA 4B92A 4DYJA 2WSRA 1PIGA 4JTRA 4LSBA 3CBWA 2XP6A 4LUJA 4P2VA 3STEA 1P4CA 1QO5A 1K4HA 1BG4A 1AFSA 1C9WA 1MEHA 3O7UA 3WENA 1G4PA 1YTDA 2BG5A 4CN1A 2NVAA 1H51A 3H23A 3FY1A 2VDGA 3FAXA 1XDMA 4X2RA 1HUVA 2WZTA 5U7SA 1X38A 1ZK6A 3A5VA 1PIIA 3MP3A 3E2VA 3DC8A 1EBHA 2XSXA 4BY3A 3DGRA 2DPEA 3SUWA 4Q6JA 1XLMA 3SURA 1LRNA 3G24A 4MFDA 3H2OA 4IIEA 3HZ3A 1XDJA 2A3LA 3BK0A 4XO7A 4KETA 5FL0A 4LS1A 4JFLA 2E67A 2H3BA 4EF8A 2GLKA 3AC0A 3VNYA 1Z48A 1IGWA 1JPDX 1HO1A 1XWYA 4BQ5A 1E55A 1DWIM 3MUCA 2DFAA 2VFGA 4OU1A 3O5KA 3UESA 3A3XA 1GQIA 4S3JA 1MI3A 1QPKA 3K2GA 4UFKA 5LIYX 1S46A 2D22A 4TR9A 1I2PA 3C0QA 5KZ6A 3OODA 1ZP4A 3L4YA 2M1IA 3WJZA 4H8NA 4F3HA 1H1ZA 4RDZA 3WNMA 6XIMA 3WLRA 3CTTA 4FP1A 4EACA 1GVFA 3VGGA 2WW5A 4GFIA 3CIXA 1BD0A 3FKKA 5EKYA 4YMZA 3QR1A 3TYEA 4DJED 2ISDA 1OX4A 2XGBA 3EPOA 4IPNB 3NOYA 1D7IA 3ZQ9A 3I6CA 2WPGA 4QDWA 5D2TA 2FDSA 1TX0A 3USBA 2RJHA 3B06A 2V2DA 1DBTA 4M3PA 3NG3A 5DN1A 1CWYA 1TQXA 3CV2A 2ISSA 2LKNA 4M24A 3V0TA 3OVGA 1UUMA 4K38A 1R9YA 1Y5XA 3PWGA 1MVYA 3ZMRA 2QAPA 2BY0A 4OE7A 3DHUA 3M1ZA 4LV9A 3WLMA 4KH2A 1MXGA 3MPGA 4LFYA 4LRSA 1TV3A 4NJJA 3K5XA 4R5EA 3O6DA 2Y24A 1UKOA 2JZVA 2VFIA 3QGAC 3B0YA 1E70M 5JH2A 4TUFA 3BJTA 2WJFA 1XKYA 2VNCA 3KE0A 3DZ1A 3YPIA 1TPWA 4C1LA 5XIAA 4FOKA 1RA0A 3U8GA 4CNUA 3LTPA 4TMCA 5HNUA 1EJXC 2V5CA 3TYBA 3GXMA 1NP0A 1JDDA 4XKYA 4Q8WA 4M6QA 1N82A 4HA1A 3C4UA 3AMGA 4KRTA 5HW8A 3REQB 3WH9A 1PKYA 1PCKA 3BC9A 1LUCB 1D7FA 3WNKA 3AIWA 4ODLA 3U5UA 4G7EB 3WQEA 4GQ0A 1XLJA 2XFRA 1PTDA 1JCJA 2DUAA 2FPYA 3ES8A 4EXAA 5F7UA 1U22A 3LRMA 4LY8A 3B9OA 5GPRA 4KEUA 2J9ZA 3WQWA 5F2IA 1T5AA 1EXBA 5G1TA 1F07A 4NZ1A 2PB1A 3C8FA 4PMXA 1EOKA 2EXOA 4YYFA 5F2GA 2X42A 3MC5A 1RD6A 3R1ZA 1DQUA 2ZDSA 4UMCA 3UR2A 1W54A 5EMMA 3T81A 1UPMB 3O5JA 4CQBA 2C3ZA 3ATZA 5LGZA 1WDRA 4FF5A 3CPUA 3WLLA 3A47A 2VFHA 1IWBA 1RK5A 1GYLA 2NQ9A 5D2XA 4TW7A 4PUMA 3BLKA 4QDMA 4GI6A 1WZAA 4GZJA 4FR1A 1LWIA 2DW7A 4QHRA 1EC8A 3MUIA 2AOSA 2Y85A 1PZ2A 4LC6A 3OHMB 1BKFA 1TG7A 1C91A 4MB3A 3I7QA 1KR0A 4MWAB 1PHWA 4M7TA 2FZMA 1P43A 4GI9A 3F2CA 2HE5A 3NI6A 3SN1A 5C9RA 5E0KA 1YDNA 1EDGA 1WX0A 1UP3A 2GGJA 1XQKA 3CUGA 1I2RA 4DZAA 2ZUSA 3BSHA 4ZXLA 1UG6A 2MPHA 3PZVA 4IGSA 2YBVA 2FGLA 3FOKA 2PTZA 3OA3A 3TNOA 3LQLA 4A6GA 3M46A 4DJDA 2OELA 3FHAA 4RW3A 4XB3A 1M3UA 1XLCA 4KRUA 3OLDA 4OUEA 2E5CA 3H55A 1GVQA 3CZ8A 2WSPA 3SDOA 3SO7A 4X3ZA 1GJWA 3FYPA 1FHDA 3O5MA 1Q6QA 1JQXA 2G5WA 1WOBA 3L2LA 3NQ8A 4HA4A 3CT7A 2DJXA 5AY7A 5BU6A 3M44A 3AYVA 3GHSA 3O9NA 4S1FA 1UQZA 3EBVA 2Q3RA 3QM3A 1PS9A 2IPJA 4JTCA 2DZXA 2PZNA 4ZTXA 1XIJA 2J25A 3F4WA 1E1FA 3VIJA 2V5KA 2NLIA 5I0DA 1VAHA 3VGDA 3UWWA 4DWSA 3PSVA 4K1WA 3PZGA 4IICA 3HFTA 2C79A 3MJYA 3BLEA 1U1JA 5CG0A 3C3UA 2DZBA 4Y6GA 4QP0A 2RJGA 4GBUA 3WCZA 4GQGA 1DP0A 5I07A 1US3A 4O16A 2ZQSA 3APTA 1KGWA 1WB0A 1RJQA 4QCEA 1XCWA 2TAAA 2JKEA 5LKYA 2IQDA 5A2AA 2HPMA 1EL3A 3A64A 4PMUA 1PBKA 5AZ1A 5DQPA 4LBRA 2DUZA 2WJDA 2ASHA 3MUXA 4E0CA 3S46A 3R0DA 3L0NA 1VYSX 3MP4A 5XINA 1L1PA 1POJA 2BXVA 3UQAA 3C8NA 3E0LA 4XD5A 4GO9A 3EXTA 2YLLA 2VZOA 1XV8A 4CNTA 1PX3A 3ABOA 2DZVA 2FJUB 4ALDA 3OQEA 3NPWA 4FIRA 3P61A 1OD0A 3A9BA 4DZ2A 1KRMA 4JY9A 1AQFA 3MYOA 1Q6RA 1IIHA 3NURA 1F9CA 3IJIA 2QCNA 5BU9A 5DIVA 4C02B 2C0HA 2P8BA 5D05A 3TC5A 4G5DA 1XIFA 4MDPA 1US0A 4HK5A 5BRPA 1FKBA 1BTMA 4LVDA 1IZJA 2KZHA 4JTUA 4K68A 4MKSA 1QOPA 1ICQA 3P2VA 1A3HA 3KFTA 3ANVA 1XSIA 3U7BA 5AYZA 3T8LA 2FGBA 3QHMA 2VL4A 5T9BG 1O68A 4ZQPA 1U79A 4OQVA 2C71A 1U2YA 1JNSA 2ZVIA 3W29A 4Q8TA 2VEFA 3MMWA 2HVNA 3QY8A 3KS6A 5GPGA 2ATSA 3CQKA 1V6UA 3M47A 1OADA 1QK2A 2FPTA 1ZNNA 3RF9A 2PLMA 5MKGB 1NARA 3MYPA 3WMSA 3GXTA 3MHGA 2R91A 4IFOA 3PBMA 3EMQA 4E5TA 1QOQA 3OB8A 1JNTA 5D33A 2PMQA 4XQ6A 4AZCA 6ENLA 3RRXA 3VKBA 4KBXA 4EANA 2J7GA 2QCHA 1ZLPA 3WLKX 5HNTA 5HNRA 1B31A 5AHEA 2V2HA 1ITUA 1GUVA 3CEPA 3CMGA 4HBEA 3R79A 3LSCA 2REQB 3WF4A 2VDIA 1O4UA 3KBSA 3RRAA 1S2WA 2DJLA 4UFLA 2WQPA 3LDVA 1ONXA 1UWAA 3TOPA 3G77A 3UPMA 5REQA 1GHRA 4CQDA 3GAYA 4C6CA 2VEMA 3VZXA 2R14A 4GK8A 2HISA 5L9FA 4JTHA 4V15A 4K2SA 2V63A 1YX1A 1A5AA 1CGTA 1DJWA 1OYBA 2CLHA 4WJEA 2RGLA 4Z42C 4IT6A 2EJAA 4WVXA 3TV8A 1HKVA 4XZLX 2WVVB 2PURA 4JQ3A 4HHLA 2R1NA 1O5QA 1E71M 1FQ0A 2QW5A 3N19B 2KGJA 1HO4A 3I3DA 3NL6A 4ZXOA 2HS8A 4AZHA 5CC5A 3TQPA 1QZ2A 3ZLGA 1EO5A 2GOUA 4GC3A 4YWIA 3AUOA 3LHYA 3UNTA 2WAGA 4A3QA 3L4VA 3L21A 3W25A 3KBWA 4DRPA 1GCYA 5CC3A 4BF8A 3HJEA 3I3EA 3ANUA 2OLAA 5J5DA 4GWEA 5D75A 4B5NA 2NUXA 2XVKA 2QHAA 1O5XA 4Z2LA 3ORWA 1T8XA 1SPQA 5A8OA 1K6AA 1XDLA 1RA5A 2VVSA 3LEPA 3VOFA 3WQ5A 4DBUA 1QO2A 2XP4A 5CSRA 1JZ8A 2Z6IA 2PZ0A 2VR5A 4PUJA 5EMYA 2LJ4A 4WK9A 1JDFA 4TTGA 4Y9NA 1W31A 4DJDC 4QAWA 2ZCGA 4GGHA 2Y6ZA 1OCJA 1I9CB 1H0GA 1TJ0A 1M01A 5MKGA 3A4JA 1BQGA 2EO7A 4I8YA 1H62A 1GQJA 1Q8JA 3BW4A 3KDOA 3UF8A 1JEZA 4GH3A 1GYMA 1S3TC 4DJDD 1QATA 4BF7A 4EVZA 2NVCA 3DFNA 2OLSA 1I0BA 5A6LA 3GDMA 4MHBA 3B40A 4CNPA 4H6EA 3VAWA 3T7VA 4DRJA 4AXKA 1FFQA 5JU6A 2CLLA 3G3MA 4RDWA 5CZSA 5KZMA 2HROA 1R2SA 3FA3A 4G9PA 2V0TA 2LLEA 2Q6ZA 2PDHA 3DFPA 1GVEA 4XZIA 1DKWA 3JR2A 2NQ5A 3K8LA 4QQ3A 2YDAA 4GQBA 3KLLA 1FKGA 4DX3A 2VKZG 2INZA 2QUVA 5FEZA 3NYDA 1TJRA 1CYGA 3C3NA 3VOGA 2I56A 4RV3A 4S39A 4N9EA 4E8CA 1N8FA 5D09A 1UC5A 3AJ7A 4KS0A 2B5UB 3VDHA 4NI8A 1W8GA 4F0LA 4UTKA 4B5SA 5LHEA 4XBSA 3ZT5A 1X39A 4RNFA 4D72A 4EX4A 3E9AA 2E8YA 4AWSA 3UQBA 1QW8A 3WDIA 5CJNA 3UZXA 1JFXA 3EPNA 4H8VA 4MGGA 2UY2A 4MYAA 4E8GA 1DWJM 4K8GA 3W1MA 3TJ4A 1A7XA 4PUDA 4QJ1A 1IWAA 3NPVA 3ABQA 4H4IA 5CPQA 1AQHA 3ABRA 1PYMA 3UW6A 4JTKA 4ZL1A 1RQEA 3R43A 3LHUA 2ZX9A 4JTTA 4ROQA 3DN5A 1M03A 4GY1A 4YTSA 3LGGA 1IZKA 4L56A 4S3FA 5IXEA 4UTFA 4I9TA 3VIIA 3R11A 3OJGA 2F23A 1OCQA 2XWDA 1F8AB 1L6YA 3QHOA 3E49A 3SUVA 1GG0A 3OG3A 1JRCA 4LAYA 2Z1SA 1GVSA 2NX9A 3QEZA 1YNQA 2W62A 4P7OA 5B7ZA 3OGSA 3TR2A 2OGJA 3W74A 4D8AA 2ZA2A 5EBAA 3PC0A 2NQZA 3PFMA 2Y7DA 5AC5A 4KWOA 1I2OA 3URNA 5DY3A 3ALFA 1YW1A 4QISA 4ZOCA 2GYIA 4RW5A 1DL3A 3UERA 1FWNA 4GVGA 3HMJG 1EX5A 3HQ1A 3VINA 2CZ5A 3W7MA 2I16A 1UWSA 4IMAA 4C7GA 4PCTA 1TV2A 1WYIA 3CAVA 2CWXA 3MTWA 2RUCA 2G3IA 1GT8A 1MWOA 3ARPA 1KM4A 3NPXA 1RH9A 4DHGA 3B9NA 4S38A 3BLIA 3DENA 3S1GA 2CZEA 1JVNA 5G1MA 1UC4A 3N04A 4HQVA 1JG9A 4JQAA 3O06A 3PB2A 4LAZA 1J0IA 1BXNA 2J8TA 1G7UA 2CLPA 2W67A 1T96A 1M7PA 2V3FA 1IEIA 1PDZA 3T0DA 5HXMA 3NSNA 1R3QA 3KADA 4HNVA 1RAKA 4GIEA 2WBKA 1Y65A 2FIQA 4K1GA 1E6RA 2EPHA 4YVXA 3LV6A 4F0SA 1JZ7A 4CGTA 5D4YA 1W2VA 3RCYA 1Z44A 1J79A 1UBSA 5FF2A 2VD8A 1QI0A 2D3LA 5FJIA 1E15A 3GDKA 1J93A 2D2GA 5FKYA 2J6VA 4X2PA 4IIHA 4CU8A 1RVGA 3GDBA 4JEJA 1VC4A 1QI2A 1EPXA 2A3BA 2M08A 3L0KA 1EFZA 3O5RA 3FDKA 3BURA 3QLLA 3CXOA 1XGDA 4HMEA 4MWAC 3QLDA 3S2MA 3SQLA 4LAKA 5IBXA 4NRSA 2JF6A 3H2EA 4QG9A 1TZ9A 3QV9A 4HPJA 3WIJA 4AIBA 3QY6A 3EDKA 4O0KA 4AIOA 5BOEA 2G97A 2EJ1A 2QCEA 4L9ZA 5K9XA 4QE1A 1KW1A 3GK0A 4ERGA 4AX7A 1BPLB 1RSCA 2HXUA 3LBMA 4UTWC 4HARA 5GNXA 3QKEA 1J4RA 3UZYA 3LI0A 3G8RA 2VO5A 1X96A 3NJ3A 3N4AA 2Q8ZA 1PKMA 1XLKA 1HKWA 1H7WA 1XYZA 2HQAA 3VKDA 3VGFA 2ZKMX 4EPKA 1TJ1A 3O16A 4US5A 2V38A 3UG8A 5H2ZA 1VPQA 3WQ4A 1H63A 3W37A 2YDSA 4GVHA 5LZLA 1OT2A 4AEEA 1MW2A 3FGCB 4RJEA 4DWDA 4R7WA 2Q02A 4FN2A 5I3FA 2XVGA 4B4HA 4GIAA 4R9OA 2QT3A 5DX7A 1XIBA 1OFAA 2WXDM 4GOAA 2ZZ2A 4QRNA 1XRSA 2PRHA 3FLUA 3DEQA 3GZAA 5C2XA 1LWHA 2BBFA 3AS3A 4M19A 3SRHA 4X9YA 2H9AB 3RJXA 2F2KA 4A8LA 1V6VA 4AFYA 2E1WA 5A2CA 4DZIA 1PX8A 3IVTA 1TPEA 4LU0A 5FF7A 3HOJA 3G1SA 1I2NA 2E6AA 1N8WA 1A47A 2O9PA 2BHYA 1N2VA 1EJVC 4UR8A 4O28A 1QCWA 5F2MA 1SYTA 4G1KA 4O1EA 1ZUAX 3OVQA 3OP2A 1UHVA 2F6KA 3KCLA 2H90A 4U3AA 4NVTA 3UCDA 1DJGA 3LUTA 3VD5A 3IUIA 2CLKA 2GVLA 4ICMA 1HF6A 2OODA 7ODCA 4Q4RA 1EJWC 4W89A 3JRKA 3ZS4A 4ICNA 4B5XA 5DXXA 1BHGA 2OB3A 3P74A 3GH4A 3TEVA 5HQEA 2DSUA 1Q65A 5LNRA 2ZX5A 4DJFC 1FP9A 5EMKA 1GZGA 2Z1WA 3TN5A 3B8UA 4UCFA 3W7GA 1WOAA 3BANA 3GZ3A 1CT5A 1GQKA 3DG6A 1LRTA 4XAYA 4LUSB 4B16A 4YL2A 1Q13A 1RVKA 3UXKA 2E6YA 2GGGA 1E51A 4BQ4A 3S0CA 2ZZ6A 1W1A1 1NTHA 3G0XA 2E9LA 4L4MA 3FJLA 1XLLA 3MJMA 3B8IA 4LF2A 1TTQA 1X8FA 3GTFA 3H21A 1B3VA 2IKHA 2J77A 4IMDA 1TV7A 3CB3A 4WDWA 1HJXA 2Z2BA 2WM0A 4J3WA 2PGFA 3ARYA 4H7ZA 5K7JA 1CW2A 3P8IA 1E4LA 1M68A 2GWGA 4J3TA 2YL5A 4MDOA 4RLIA 4BCEA 3W6MA 2V67A 1EA9C 2D69A 5IOBA 5EYWA 1IGSA 4J28A 3R8HA 3ARZA 3GNPA 3VIMA 2O0TA 4LEFA 3WMBA 5GVJA 2OVLA 1QI4A 3DX5A 1NU5A 4XAGA 1ZAJA 2Y61A 1ISYA 2WMKA 1OQFA 2W6RA 1FHLA 4AYGA 2HSAA 1A4LA 3VK5A 4B2DD 4J3XA 4ADTA 3ZVHB 1L9WA 3CUXA 1LCOA 4B9ZA 2QV4A 2VC5A 1TO3A 3RM9A 5CG7A 1GEQA 1P6CA 3FAPA 1B9ZA 1VCGA 2QGYA 4BWLC 2ONEA 4QNWA 3WBYA 1ROUA 3GUWA 5KZDA 4DAFA 3IRDA 3C52A 1J0ZA 4O18A 3M41A 5A94A 2VR2A 3R94A 3KWSA 4GYPA 4R85A 4F66A 2VQUA 1KKRA 1V03A 2Z24A 4YTUA 1QDSA 2HPIA 3FEMA 1LL4A 2AL1A 3PSWA 3RK8A 2O7SA 1EDQA 2Z27A 3RX3A 3NO3A 5LGXA 3UXIA 3BZGA 1V4YA 3CV7A 5LNWA 3EWDA 4KWWA 2JGQA 4U31A 3SSZA 3H8AA 4JTFA 1QWGA 4MLRA 1ITCA 2R94A 5ECUA 5A3HA 3GR7A 4P8UA 3MCMA 4R53A 1OZMA 1JZ6A 3W2UA 3KZSA 1XBZA 4UR7A 3VE7A 1TTPA 1TV8A 3GHRA 4LT9A 4LUSA 4LOCA 4B15A 1EHNA 3DU0A 2CETA 4JFWA 4PBEA 1IXOA 1G9HA 4YS1A 3W7JA 1J9YA 1KBBA 3S4TA 4CEXC 4CCZA 2NV9A 4JTQA 1Q8AA 1DWFM 3L7RA 4F0KA 4POCA 4WJXA 1DHPA 2OR2A 4QROA 5I7GA 5JH1A 7TAAA 3T0CA 4EPDC 3CHEA 3WKZA 2WVTA 3MDUA 2PAJA 2GJRA 1RQHA 2VDHA 3LZ5A 5HMFA 2R1LA 5TIMA 2YBTA 3N73A 1H11A 1OX6A 2ZTKA 4L4PA 2JIEA 1W9VA 3MKVA 3OZYA 4LAOA 3MU7A 4JQ4A 2VT0A 3BLFA 1AG1O 4MM1A 2B7QA 3W22A 2VZSA 1AK5A 5DMNA 2J88A 1Q6FA 1TWDA 3VUPA 5D2WA 1E4NA 5AHMA 5I02A 4Z2GA 3BL3A 4YIWA 3CU2A 3UYCA 1CGYA 4C6QA 3QPEA 1WUFA 2NV2A 4IXXA 1VENA 1DOSA 1OFEA 3VI2A 1U33A 1RPXA 3L4UA 4FALA 3WEMA 3WLPA 2CBVA 2HBVA 3T42A 1UIPA 5JIWA 2IQ0A 4URIA 4IPIA 1D8CA 2ZWZA 2QJMA 1FDZA 3LGEA 4FX7A 2GZXA 3IVSA 3R4IA 1DIOA 1F74A 1FKSA 3W7EA 3UJ2A 4E38A 2PD5A 4HOZA 2WWCA 3B8VA 1UH3A 3S1VA 4A3HA 3GH7A 5CGTA 1CLXA 1XYAA 4WR3A 1F40A 4A2RA 4JFIA 1VIWA 1W5PA 1CPUA 1VP5A 2P8CA 1MQRA 3P14A 1GOMA 4HN8A 2D0FA 2WKJA 5M3WA 4HBOA 2DV0A 1LYXA 1MSSA 1R0MA 2MNRA 4L1GA 1JPMA 1W5OA 4PUWA 4MNLA 2ACRA 3UA3A 4YPJA 1EF2A 1W0MA 5C6MA 3VD7A 1O5KA 2BMBA 4F0MA 4DZ5A 1JYWA 1GYNA 2YB4A 4CD4A 4ZB5A 1LQ0A 2DVXA 5BMWA 3N3TA 3T05A 3NDOA 4LYPA 1WP6A 3H7VA 3ZIZA 1VBJA 1G4SA 4KPLA 1IWPA 2OOFA 1NVMA 4NP7A 1I0DA 3L4ZA 3QFWA 4Q4PA 3W1QA 3ZR4A 4B5VA 1P0BA 5CSSA 2Y78A 2INFA 5JBEA 2FHFA 3HA1A 5XIMA 4NIRA 3QMRA 5K4XA 4J3UA 3MHFA 3PN8A 4XO6A 3OW1A 4KWVA 3B8DA 4D71A 2E5BA 3P60A 4B2DA 1NMVA 3S5NA 4OFCA 4TU1A 1H60A 3S2LA 1TPB1 3N9RA 1TZZA 2W3ZA 4Q22A 4B91A 1E44A 2V5DA 3EZ4A 3UWEA 4K7YA 5G2IA 3RILA 1KV8A 3UPBA 2YA1A 2VURA 1CDGA 3H2CA 1EGMA 4NJGA 4AF0B 2WMJA 2ADAA 1M53A 5LA0A 2PDXA 4UTTC 4X0VA 3SQMA 1Q7QA 4Y9OA 4AZGA 1HKKA 3UI4A 3G5EA 5HKGA 1ZRQA 2DT3A 1XIDA 1S39A 3CIWA 2GDUA 1VLIA 2YLAA 1VS1A 2OSYA 1RHCA 3VKAA 4J4KA 3TDFA 3AMDA 4UFJA 3GVVA 1W1PA 2WHMA 4LB3A 1FVPA 4L1XA 1KA9F 5F1UA 3TMQA 3W7CA 3TP4A 3DBNA 2ZVRA 4FNRA 4X61A 3ABXA 3KAHA 1RUSA 4ZODA 3CYJA 4DUVA 3PZTA 1ITQA 3E38A 3R25A 3QOKA 2HVOA 2J6XA 3F2DA 1BXBA 2FZ9A 1VJZA 3C56A 3QPZA 1FJDA 1KT0A 3WH5A 5ABEA 1MXSA 1MUMA 4IFKB 1VBHA 2GVGA 1SW0A 3B04A 4BA0A 4XAZA 2P3ZA 3W7PA 3QQWA 1UD5A 4C7DA 2DZTA 4U2YA 4DUWA 2OGYA 1UWTA 1TTJA 3I6TA 2V2CA 2ACSA 3BXWA 4V27A 1S2TA 2WNNA 1MYRA 3TLLA 1ONWA 3UQNA 3W1AA 3GC5A 1LT8A 4XIMA 4UOJA 2PDUA 4I9MA 2FJKA 2AGTA 4LVAA 2GJXB 4GYJA 7TIMA 2DSVA 5DT5A 2EAWA 3NQDA 4DPQA 3CZEA 1YXDA 3W1UA 1VF8A 3LXCA 2GWNA 3ZT7A 3O5IA 3I7RA 1HKJA 4HU0A 1KLZA 4D9PA 4IP5A 4MY8A 1SW7A 4KT2A 4O0ZA 3EWUA 2XIBA 5H8UA 1FHUA 5AKQA 3UZ5A 2GFTA 4UTIA 3ARXA 3CASA 1GOXA 3VKJA 2TPSA 2CZFA 4AF0A 3DGBA 4NZFA 1R2RA 2PPPA 1PXGA 5HK4A 2XP5A 1OIFA 1LG2A 4UXDA 4E4PA 2MLYA 3N12A 2JEQA 1BTCA 1CENA 4PTVA 3BAIA 1RJPA 2RGMA 5J8LA 3PWAA 4GZ7A 1E6SM 4W9PA 2D2OA 1Q45A 4AWUA 1J2WA 4GJ1A 2Q71A 4L64A 4JN6A 3PZ9A 4PC8A 3VIFA 4FLOA 1KV5A 1Q6HA 4M1RA 3KVLA 4XSMA 2CNCA 4DRNA 1XUZA 1G7VA 4L5ZA 1UPPA 2PD9A 1UP0A 3NVTA 2G4FA 2QDDA 2YCKX 5D2VA 4G1NA 3UVIA 2AL2A 1VHCA 4JOMA 4HNNA 1F3XA 3AYSA 3U2OA 3AHZA 4IIFA 2YCLA 3N6JA 2Q09A 3UZWA 2HNEA 3THCA 1VZWA 2X1SA 3W71A 4E3VA 2VVNA 2XTKA 3D3FA 5BXPA 1IX5A 3L23A 3P80A 2MUCA 5CZJA 4FOJA 4GH1A 3GNDA 3GW0A 4LNCA 4GVFA 1KM3A 2PDJA 2Z26A 5EU9A 2EG7A 4MB4A 4ZQRA 5GJPA 1S1RA 4DWSC 1T0OA 3KL3A 3W70A 4OVXA 5IM51 4MKVA 2YDQA 3FKRA 3GRIA 3T40A 3C0JA 1D3CA 2AQOA 1YDOA 3QC3A 1NH6A 1UD6A 1P7TA 2QUTA 1G94A 2R1PA 3ABSA 1ODZA 3IJ8A 4N9BA 1E72M 4FXRA 4AMCA 1C90A 5TD4A 4AY8A 1DIEA 3N15A 4JNMA 3JVAA 4AEOA 1IR1A 3T4CA 4A3YA 3FJNA 2PUZA 4FNPA 2BFGA 4KW2A 2QYGA 1EWDA 4EWJA 4LAWA 4NG3A 3L9CA 5T8GA 2ZZ4A 1PPIA 3VM7A 2Y5EA 3LLFA 3F5LA 1VFSA 3PBVA 3C6CA 1P6WA 3S9IA 1ICSA 4JFVA 4LUTB 3KOZA 4QJ3B 3IGXA 1AL7A 1A0CA 4XZBA 3W7DA 3CZKA 3ZZ1A 1W9PA 4CNNA 1K77A 3IIZA 3A24A 3IJQA 2C91A 1OZQA 3AJXA 4QS5A 3MANA 3C86A 3PVFA 5FEXA 1TWSA 3WFAA 1I60A 3UI5A 4O57A 1XUUA 1IEWA 4ZPVR 2EEXA 4AWEA 3MWAA 4W7WA 4A3UA 4UMAA 2VXNA 1YW5A 2Z2AA 3WNNA 1V7YA 1QMLA 3L66A 1I6NA 4WD0A 1IV8A 1AMYA 1SMDA 1XP3A 3SJ3A 1XFCA 1XICA 1M5WA 4E8DA 5E93A 1O60A 3U5YA 1DEDA 2DIJA 1B90A 2CIPA 2D2JA 4HJFA 5K3VA 3OHIA 3VX1A 2KI3A 1AZ2A 3SRKA 3QMTA 1GOWA 4N4QA 4IQCA 1Q2RA 1BG9A 3EDEA 5HDRA 1G6CA 4QG6A 2ZE3A 4D6DA 4FZIA 3CO4A 4QJ5B 3BCDA 3W53A 3AALA 1GVYA 1LQAA 5AVNA 1SQ7A 4I7UA 3CGTA 2PV1A 2A6LA 1UJPA 9XIMA 5FF3A 3EDJA 3POHA 4Z2JA 1XIIA 1TUXA 1W26A 3SFKA 3GNRA 4AZIA 1IT0A 2VEKA 3ES7A 4Q8NA 2J7FA 3SQSA 4EAMA 2BV9A 2F61A 3L2MA 4H04A 1BYCA 2QV5A 3MA8A 4UTLA 1KCZA 2CLOA 2I5GA 4PSPA 3AISA 2Y88A 3U9IA 7XIMA 1OIMA 3WG6A 5CZKA 3HMCA 3GXNA 3KBMA 3P8JA 3NQAA 4Q33A 4F48A 3W3OA 4NKCA 4G7FA 3F1QA 3SFWA 3VAVA 1XIHA 3CV6A 3H2AA 1DJQA 1B2YA 4DYKA 2YA0A 4G50A 4P8WA 4QEHA 4IP7A 2GVJA 4AY1A 1VKFA 4JCMA 1VFMA 3LRLA 4YLWA 1HNYA 4Z1AA 1OYCA 2E77A 3SN0A 5JVLA 3PUDA 3WUGA 5HWCA 3OGVA 1OYAA 4PL1A 3DG3A 1YDVA 4L4OA 2QJGA 4O0QA 3M16A 1NDWA 5CGQA 3URQA 2RDXA 1GOKA 2OTDA 3IANA 3DI0A 4NF7A 1ZU8A 4MSPA 1PZ3A 1VPXA 3MVIA 5AVHA 4YN5A 1XH0A 1HJQA 2PE4A 3BCFA 1ECEA 4BQ3A 3TC7A 3WLHA 1LF1A 4PB5A 4OOZA 2RH9A 4P7NA 6TAAA 4QSHA 4JCLA 1FWIC 2NSXA 3M64A 3O6AA 2W27A 3W7RA 3ARVA 1F73A 4MNKA 4ACZB 2IPWA 3FGCA 1D2KA 1QPRA 3EAUA 3V3WA 3EX3A 5F2LA 4GCAA 3N2XA 4Z2IA 1F05A 3TQKA 4FR6A 3AO0A 3EX4A 4F4RA 4UNKA 4CQAA 1OFBA 1RK6A 2CC0A 4RZBA 1EJ7L 4C6OA 4Z2HA 3W28A 4PRRA 4N7QA 5HJYA 1B30A 5LHFA 2OZTA 1GEHA 4Y9AA 2L2SA 3WBXA 1OFRA 3WFLA 3SCVA 4UWMA 1N7KA 4CKQA 1H3GA 3VMNA 1PKNA 1JXJA 4Z1YA 1TSIA 3KHDA 3W1NA 2CPUA 1OINA 2I7GA 1A49A 1WXJA 2WJEA 1HN1A 3KVMA 4TQTA 3BMVA 4OBTA 5REQB 1W6TA 3CHDA 3WJWA 2UZ9A 4LBSA 4RX0A 4KCUA 2PP1A 4EWND 1BKHA 1XG4A 2YL8A 3GPKA 1X1OA 4H9MA 3ARQA 1Q7ZA 2J47A 1I8JA 4GZEA 3PNUA 3BARA 4N4PA 4DNMA 4EOUA 2OQHA 3LSBA 4UZSA 1A50A 2UZ5A 1NFBA 1TR1A 2OJPA 1L6FA 5KETA 1W3LA 5BROA 3RXZA 1ME7A 5G4HC 2QCMA 4IQLA 3RR1A 3GYCA 2R6OA 2J8FA 3CL8A 2NZLA 1TKKA 3W1TA 1WDDA 1EOMA 3GG8A 4AVFA 3WMCA 4L7ZA 3PZMA 4W8BA 3G0SA 3AOFA 3VX0A 1KO0A 1CNVA 3ZLFA 3HQOA 3MO7A 2QDHA 3NQ7A 3TVAA 3IGSA 3N6HA 4LJ3A 3DC0A 3PTMA 1BWLA 1UKTA 4G8TA 4PTXA 3QPYA 4EK7A 1OC6A 1SFSA 3LUOA 3BH4A 5FIPA 1UH4A 2FZ8A 3TONA 2Q01A 1P5QA 1QPQA 1CLKA