2DSWA

Binding of chitin-like polysaccharides to protective signalling factor: crystal structure of the complex of signalling protein from sheep (sps-40) with a pentasaccharide at 2.8 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dswA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dswA01
1R87A 3SCQA 4L4PA 1W9VA 3MS8A 4YN5A 2OYLA 1H49A 1M01A 3OZPA 3MANA 1BGAA 1PAMA 4UQDA 2YA2A 3OB8A 2XIBA 1RH9A 3EYPA 2BV9A 2ZUNA 3PTKA 4HU8A 5CPTA 4LX4A 1V0LA 3N1AA 3ARXA 3EDJA 4E4PA 1W1PA 1HF6A 3MMUA 1JFHA 3WEZA 3N04A 5EFDA 5E70A 4AIOA 1K9DA 1CXFA 2J7DA 2O9PA 3IAPA 1E6XM 2EJ1A 1V6UA 2GVYA 3WH7A 4PMVA 4D6HA 2EO7A 2WMIA 1OM0A 4TTUA 1OWQA 3N13A 5A8PA 3UESA 4GI6A 4W89A 3ZQ9A 1GOMA 1FH9A 4WF7A 1IZKA 3W28A 5D9MA 4M24A 1NOFA 2ZXDA 2EPKX 1CXIA 1OCQA 5BROA 3VIMA 3OBAA 1GORA 3A3HA 1G0CA 2WVUA 5KEZA 3AHYA 4CD6A 1PX3A 3M46A 2VZSA 4J3XA 4RE3A 1JZ8A 2PWGA 2XWDA 4JFSA 1JYXA 2WLZA 1LL6A 2WMHA 4F66A 3VD4A 2BVDA 4Z2KA 4HA3A 3AS0A 3AYSA 2XVLA 3F4VA 1VENA 3AMLA 4DM2A 3WF2A 3QR3A 2NT0A 2GSJA 1JF5A 1VFFA 1EOMA 3UR7A 3K8LA 1EDQA 5CQ1A 2OWXA 1KWGA 1QOXA 1HJUA 1DHKA 1EOKA 1RPKA 4UFHA 3GXMA 1BYDA 2VCAA 4DUWA 4E8DA 3TONA 4F9JA 3W4RA 5A6SA 1UKOA 1AVAA 1CENA 2VNCA 1B3YA 3AOFA 4S3KA 4BQ3A 1GNXA 1H1NA 1P6WA 4NI3A 1RP9A 5CLTA 3OGRA 2G8ZA 1HL9A 4GKLA 2X8RA 3NCOA 3T08A 3VO0A 5CSUA 2CBJA 4RE2A 5E09A 2VX7A 2WXDM 1CZ1A 3K4DA 4U3CA 3CZLA 2PWFA 1IT0A 1TVPA 1CGVA 2HVMA 4F79A 1CNVA 3T2PA 2NT1A 4IPLA 1W91A 3IK2A 1GZJA 1BGGA 4ZE5A 3K1DA 2YBUA 3ARSA 2E8ZA 1OGGA 4CVWA 1XC6A 4WSKA 1WP6A 3TTYA 4OUEA 3THCA 5KZ6A 3WDJA 1PJ9A 1EHNA 3ARZA 2BY3A 3K4AA 4U5IA 1JGIA 1R8LA 4AZ6A 3WD4A 3UG3A 3GBDA 4M82A 1E40A 3LPOA 1JZ7A 4U31A 3ZT6A 5CG0A 2YJQA 2V38A 2CCRA 5CGMA 3KE0A 4OOZA 1NOUA 1E55A 2OYMA 3DYPA 5A95A 2V5DA 3M7SA 5I24A 3GDBA 3WELA 4AD5A 3VD3A 4MDOA 3AZRA 3WNMA 2ESCA 2DPEA 4Z2IA 3N15A 1VRXA 1JYVA 3AMKA 4OOUA 1ESWA 1JZ3A 3BAKA 1UWRA 3SUTA 5HXMA 1ODUA 4JHOA 3K8KA 4D6IA 1CYGA 2W67A 3CBWA 5IDIA 2EEXA 3ALFA 3N12A 3VGGA 4WSJA 3W53A 4BZYA 4DWSD 1MQPA 4ACZB 4EK7A 5I6SA 4A3YA 5LA2A 2PF0A 3D3AA 4NRRA 5I77A 2V3FA 2VR5A 1XCWA 3IJ7A 4PMYA 4EE9A 1GONA 1LL4A 5A8MA 3WF3A 4H8UA 1GQKA 2VCCA 4OBSA 4FLOA 1QVBA 5I2UA 3WQ8A 4AZCA 3EDKA 1H3GA 1UD4A 5IXEA 1BQCA 3RM8A 3QHOA 4XV0A 5M17A 1QNPA 3VU2A 1AQMA 1CXHA 4M80A 1H09A 3WQWA 2D0GA 1D2KA 2JFEX 5A6MA 4CD7A 2EPLX 1K9EA 9CGTA 2E9BA 3UCQA 1TZ7A 3A4AA 4UZSA 4CCCA 4D1IA 1UH2A 1E70M 5M03A 4B9YA 1DTUA 2W91A 2OWCA 4BA0A 2J47A 1KFWA 4AISA 3VM5A 1HJWA 2WSPA 1E5NA 2D3LA 5JBEA 4OJYA 1XD0A 3WD0A 4YHGA 2BY2A 1QI3A 3MV11 3WD3A 3WUGA 3MMDA 4D6CA 1V3HA 4CD5A 2WK2A 3ZJ6A 1HKMA 3PHAA 1S46A 1GVIA 1JYWA 3L2LA 4HZ7A 2J62A 4PN2A 4S3JA 2CKRA 4BQ4A 3W82A 2GJXB 4M81A 4KH2A 3PZNA 1UH4A 5A2AA 3AMGA 1NP0A 3POHA 2ZUSA 5GNYA 2YL8A 4IPNB 1ZBVA 3A6OA 2UWFA 4Z2JA 5D4YA 1E4IA 1ZB5A 4MNLA 3KZSA 4MJ2A 2XG9A 1RD6A 2D20A 4N42A 1K6AA 2VZUA 1MFVA 5A6BA 3PZGA 2ZXBA 3QHNA 4GINA 3TA9A 3CPUA 5JUVA 3N9KA 1HVQA 3U57A 1E0VA 1PIGA 2WHLA 4R27A 1XH1A 1UG6A 5E0CA 4CCDA 1CLVA 4V28A 2W61A 2EPNA 4U2ZA 4H41A 4WK9A 1J01A 1UZ4A 1N82A 1NARA 2W63A 2CBVA 4XUYA 4JCLA 1G94A 1OIFA 1B30A 4YHEA 5CPQA 5CLWA 2CIPA 1ZL1A 1V3LA 1C7SA 1HNYA 1W9BM 3L2MA 3CHDA 1HIZA 4CD4A 1BG4A 5DT5A 2UY3A 2XFRA 1UZ1A 2FH6A 1KR0A 5JBDA 1W2PA 3LPFA 2CHOA 4LYPA 2VQTA 4V2XA 1ISZA 4Q22A 5EB8A 2F8QA 2YDQA 1KWKA 5CGTA 4D6FA 1PEZA 4MNKA 1JZ5A 2PC8A 3WD1A 1GUVA 3WL0A 1DWGM 1AQHA 1CTNA 2ZICA 3WH5A 3KEHA 1UR0A 2Z1SA 2V5CA 4JKMA 3MMWA 1KBBA 2G3NA 5GQBA 1JZ6A 5BRPA 1BAGA 1C7TA 3W27A 5I78A 1DWFM 4QAWA 4ZENA 3OIHA 2WW5A 3OG2A 2YA1A 3WFZA 2FH8A 1LF1A 2DGAA 1TVNA 3KWXA 1E71M 4A3HA 1PX8A 1W3KA 3AIVA 1GJWA 1KGUA 1JIBA 2HISA 5E6ZA 1SFSA 3WH9A 3B8SA 3GXIA 2F61A 2PBGA 3F5JA 2YDRA 5JBFA 1OSEA 2VURA 4HA1A 2Y5EA 3WEMA 3D5HA 2TAAA 1E4MM 2J78A 2WHMA 6CGTA 2GFTA 3ZT5A 1QBAA 1O7AA 1DWIM 2V3DA 4GI8A 1TFVA 1CPUA 1UKQA 2PWEA 3NSNA 3WMBA 3IJ8A 1MFUA 2D0FA 1E6ZA 1WDRA 4H8HA 4AEFA 3SCUA 3SCNA 5BXRA 3U7VA 4U5KA 4Q7NA 2XGIA 4AD2A 3QGVA 3OLDA 3I3EA 4PTWA 1V3JA 1QI5A 2J7HA 2ZX6A 2DT0A 3WNOA 3CMJA 4CCEA 3VIIA 2EQDA 1US2A 5DF0A 1WE5A 1XV8A 4QLLA 2WCSA 1JD9A 1UWQA 4OKDA 1W9PA 1CEOA 1QPKA 1XRVA 2WZHA 4HOWA 5HPCA 3U5YA 1X1NA 4KRUA 1GVYA 1GJUA 2J25A 4UTFA 1VEPA 2DSZA 1WDPA 1NWTA 4TVDA 3EDEA 3SCPA 4ZXLA 3PBGA 2WMGA 7CGTA 1W3LA 1WO2A 3RO8A 4KGJA 5GNZA 4PUDA 1GOWA 3AZSA 2VTFA 4AZHA 3VIPA 5ABFB 1OGBA 5FD0A 2X0HA 3F5KA 2UY5A 3AIQA 4AD3A 1JDCA 4KGLA 2XFFA 3ZSSA 3WBEA 3F5LA 4HP5A 4JCMA 3AIBA 1FP8A 3VTRA 1LJYA 1F4AA 3RPMA 2ZX8A 5A69A 1ITCA 2ZUWA 4NZCA 3ECQA 3BMVA 4UQ9A 3CUHA 1C8YA 2UY2A 1VEOA 4IISA 3GH4A 1E0WA 3S6TA 5CJ5A 1TCMA 4U33A 1OB0A 3VUPA 1BFNA 2D0HA 2CHNA 7TAAA 2Z1KA 1K9FA 2DH3A 3WFLA 5CXPA 4MB4A 3SUWA 5IFPA 4QP0A 1H11A 4JZ5A 4AIEA 4PRWA 4XX6A 5HOSA 5HDRA 3I3DA 3B9DA 1KCLA 1VBUA 3GTNA 5E0FA 5EMYA 1V3KA 1JYNA 1OT1A 4CGTA 1WZAA 4JFWA 3AZTA 2ZWYA 4PUEA 1U33A 1GW1A 2BVYA 3RCNA 4MAZA 1KGXA 1ISVA 3CUFA 4IUGA 3L4XA 1QW9A 3VDBA 1PIFA 2D1ZA 1E5JA 2EBNA 1E73M 3BH4A 4ZEPA 1XGZA 1XD1A 3GYCA 2QPSA 1Y7VA 2BXZA 4ACZA 2FDMA 1ISXA 1UOKA 2XSAA 3WY1A 1JG9A 3VIKA 4W87A 3EMCA 3PZOA 2ZX5A 1IZJA 3BC9A 1V03A 5F7UA 3PZTA 1JAKA 5BRQA 4PSPA 1CGYA 2YL6A 1PZ2A 4CUCA 4WKAA 2WVSA 1B9ZA 4D72A 1HT6A 5I79A 1B0IA 4R5EA 1KB3A 3MV01 2V3EA 1TR1A 1XSIA 1W9XA 3OZOA 3BLPX 1PZ3A 2EPOA 1XYFA 1XCXA 5LA1A 1UD8A 3ARUA 3B9EA 1CIUA 3GZAA 1MW0A 1EHAA 4PMXA 3AHZA 4PTXA 2O9RA 2XVPA 4TTGA 5C8BB 1QI0A 1KQZA 1DEDA 4E2OA 2BVTA 5A8OA 3G6LA 2IUZA 4Z2GA 2WHJA 5AY7A 3NSXA 1O6IA 1C91A 1TA3B 1VFUA 1MYRA 2GJXA 1FFQA 2VOTA 1J0IA 3VIJA 3ARYA 3VX0A 5DFAA 3CGTA 2WBKA 4MADA 3ARTA 4GQRA 1CLXA 2E8YA 1WB0A 1LLOA 5A8NA 5I5RA 1IV8A 3MUIA 1UD2A 4GO8A 1JFXA 2CESA 4X0VA 3MUY1 1U30A 1JAEA 4JL2A 4UOJA 1SYTA 2WM0A 4HPHA 5FL1A 4LYRA 3FAWA 2W4XA 3MU7A 5A2BA 4PSRA 1C90A 3AYRA 2OSYA 4UCFA 3VD9A 3WDIA 5AYIA 4HMEA 1HN1A 1ZBCA 1QI2A 2J8FA 1Q6GA 4H2CA 1W3HA 4WJXA 3BCFA 4K68A 3UERA 3RILA 1CGUA 2RGMA 1V02A 4GZJA 4AD1A 1CGWA 1BSIA 1Q6FA 2E3ZA 2JALA 4PYSA 1KXHA 1UA3A 3AXXA 4J3WA 2VJXA 2VR4A 2WMFA 1HX0A 1X6NA 1MQQA 3AI0A 4PTVA 1E1FA 4FLSA 1V02E 5D9NA 3POCA 3CZGA 2YL5A 4AD4A 3FN9A 5CZKA 3TTOA 3VKKA 4QLJA 3L4WA 1VAHA 5A6BD 3NDYA 3ZT7A 2VUYA 1H0IA 1I1WA 4AZ7A 4FMVA 2DEPA 2EXOA 3MUAA 3ZJ8A 2WYSA 2XSBA 5ABGA 3E1F1 2Y2WA 2XYLA 4GZEA 1FFRA 5CPSA 5EFFA 3THDA 3FHQA 3ZJ7A 5IFTA 2YOCA 4PMDA 4OIFA 4BQ5A 1BHGA 5FCZA 1C8QA 4AIUA 1QHPA 5I23A 2JIWA 1XH0A 3WMSA 3A4WA 4BQ2A 4E8CA 1C3FA 1UQZA 5IHRA 1VB9A 1YQ2A 2WSKA 3BSGA 5FKYA 4JIEA 3CUIA 1V3MA 2AAAA 2FHBA 3VX1A 3BGAA 3II1A 2ZUMA 2WB5A 1JDDA 2J79A 3U7BA 1GHRA 3AXHA 3QHMA 2D24A 3VD7A 3IAQA 1AMYA 2BHZA 4CU8A 3RMEA 1WDQA 1CXLA 1EH9A 5FOOA 1SMAA 4M8UA 3N18A 3B9AA 4QDMA 1LL7A 4AWEA 4PMOA 5A6LA 2W92A 3WF1A 3PZQA 3RJYA 2WCAA 4W8LA 4P7NA 4CN4A 1UUQA 2V3GA 3SURA 4EANA 1HKJA 2C0HA 2JF7A 2J77A 3PZUA 2JEQA 4Y7EA 3VGFA 4PMNA 3WQ5A 3ZR5A 5AC4A 4TVUA 1E1EA 3CIVA 1VFOA 2NSXA 1TUXA 3AHXA 4BCEA 4C7DA 1YHTA 1W9UA 3L4ZA 3L4YA 4HPGA 1WZMA 1GOIA 3IJ9A 1W1VA 2E4TA 2G3MA 5FL0A 6TAAA 3VM7A 4AMCA 4LQ1A 2PWDA 8CGTA 4Z2HA 4C7FA 4W8BA 1OINA 3WNPA 2VX5A 1GQJA 4QFUA 2YKKA 1NWUA 3VIHA 3SEPA 1DWJM 2XPKA 4P8WA 3WH6A 1CBGA 2GDVA 4X0NA 2F2HA 1FP9A 3KL3A 1CXKA 2WBGA 3DC0A 4UQCA 4AY1A 2O92A 4JFTA 1PX4A 1GPFA 2FGZA 4P8UA 3T2QA 2VVSA 2G3IA 3GM8A 2BNJA 1BYBA 2VZVA 1HJVA 3WQ4A 5DEZA 2VRQA 1D7FA 2A3BA 5ABFA 5LA0A 3I3BA 3KL0A 3WD2A 3DYOA 4D6DA 4CD8A 5M5DA 2XVNA 1R86A 1UR8A 2VCBA 4GZIA 1V6VA 4AXNA 4D71A 2O9OA 5JH8A 4WLCA 2CERA 5A3HA 2W62A 3RIKA 1WCGA 4UFMA 3T0DA 1FHLA 1ZS2A 3GH5A 1ITXA 4ML4A 4AYSA 1EO5A 1VF8A 1G01A 2BFGA 1NP2A 5A1AA 3SCOA 2DSUA 3GNPA 4H8VA 3O9NA 1NWSA 5CSYA 4PMZA 5C71A 1UR9A 2VO5A 1EQPA 2E40A 2VRKA 2DSWA 1UYQA 4MJ4A 4DWSB 1E6QM 3CZEA 5A6JA 3J7HA 4CU7A 1J9YA 1JNDA 2PI6A 1UD5A 1UWUA 1FA2A 1UQYA 2BHYA 2WMKA 1KXVA 1J0ZA 2WC4A 4M56A 4H7VA 1QNOA 2CPUA 2WHKA 4DM1A 3ARRA 2B31A 4F9DA 4HZ8A 1MQRA 4WKFA 4W88A 1JNEA 1V0MA 2WANA 2XJ7A 3NIYA 3ZMRA 4XZBA 3S2CA 4LPCA 2VX6A 2VZOA 2Y8KA 4ATDA 4W5UA 3WNNA 3N11A 1TG7A 2GJPA 1J12A 2DIJA 1B3XA 4AZ5A 3GNOA 2XVKA 2CEQA 2WZIA 4P8XA 4XZWA 4HTYA 3AIEA 1BTCA 4CVUA 1E56A 1US3A 4V27A 4UFKA 4KWUA 4LYQA 3SCRA 1V6XA 3ZIZA 5ECUA 2XTKA 2DT1A 3NSMA 1MVYA 3CH9A 3VPLA 4IM4A 4RE4A 2BY0A 2ZUTA 4UZUA 1EXPA 2VRJA 5ABEA 3DYMA 3GXFA 4OBRA 3NYDA 2PB1A 4ATWA 1W32A 3U5UA 1B2YA 1UA7A 3CZ8A 1R85A 4W86A 3RDKA 2VL4A 3PZVA 1OD8A 1VJZA 3HJEA 5D9OA 1V6YA 2MANA 3CO4A 4GXPA 2DSKA 1EGZA 4MB5A 3VGEA 4JKLA 4MNJA 4HMDA 1HVXA 3VNYA 4MPKA 2A3AA 3AS3A 1C92A 1LWHA 4PMRA 3VVGA 4J27A 4GPNA 1ISYA 5E6YA 4UQEA 1TMQA 1QNSA 1H5VA 4HOZA 5BXPA 4QLKA 4C7GA 3ZM8A 1XSJA 1A47A 2DH2A 3O6AA 3W26A 5E9AA 4OZOA 4WKHA 4J28A 4PTMA 3ZSTA 5ABHA 1GQLA 3WUEA 2JEPA 4DUXA 1CECA 1FHDA 2Q8XA 3QOKA 1W1TA 1E6NA 1XSKA 2VZTA 3FNDA 5DO8A 1TA3A 4PEEA 1UR2A 4NSBA 4GO9A 2J8GA 4HU0A 1GCYA 3ZJKA 3EMQA 2IXVA 4M1RA 2QF8A 4W5ZA 3VIGA 2VT0A 4JKKA 5FIPA 1XH2A 2ZX9A 2GUYA 3AIUA 1FH8A 5BWFA 2JE8A 2ZOXA 1KQYA 2VQUA 2XM2A 4J3SA 1ZBWA 3CLWA 6A3HA 2J75A 1OBAA 4D1JA 1E6SM 4PCTA 3WBAA 2Y8VA 3T0BA 1E6PA 3DHUA 3RM4A 2ZX7A 2WPGA 1JI1A 3L4TA 4P7LA 5AYBA 4HOXA 1E4NA 1MXDA 2CXGA 5A8QA 2OSWA 2GK1B 2JF6A 1UWIA 3AIRA 1UHVA 1JI2A 4Z2LA 1XYZA 4AC1X 2WVVB 4P7RA 3VMOA 5EBAA 1V3IA 5D8WA 2XGBA 1BVZA 4UQBA 2YLAA 2OSXA 5BYWA 4FLRA 1QW8A 2AOSA 1PPIA 3SUUA 3VDHA 4UOZA 4CU6A 4EAMA 3WL1A 2XHYA 4UNIA 1X6LA 2ZE0A 2D2OA 3WQ6A 3AQUA 4A4AA 3O2LA 4GIAA 1XHGA 4KMQA 3CHFA 3FXYA 1J11A 3W6MA 2J4GA 2ZUUA 1J0YA 3AIWA 4XB3A 1W9DM 3SUVA 4B15A 3APGA 1JL8A 2IXUA 4W93A 2BHUA 3WQVA 4AZIA 3MKKA 4AEEA 1H4PA 3BSHA 1ODZA 3ARVA 1OD0A 4D6JA 1E6RA 2QLYA 1MXGA 2YBTA 1U2YA 2WMJA 3OLGA 4UR9A 1HKKA 1B3WA 1DP0A 2GJRA 3JUGA 2DT3A 1F4HA 4FK9A 5A6KA 2OWWA 3W29A 2DT2A 3TOPA 3AHTA 1E43A 1H0GA 2QPUA 2W5FA 1UR4A 4HA4A 3VILA 2XWEA 1Q4NX 3VMNA 4AD0A 1PBGA 1SMDA 1WKYA 4ZXOA 1ZJAA 4LXFA 2J74A 1UH3A 1J10A 1QHZA 1EA9C 4W7VA 1MW3A 2PBOA 5HPOA 5IHSA 4CKQA 1QNRA 4P8VA 1E3XA 1EIBA 5GPRA 3W38A 1NM9A 4JFVA 3FW6A 4KRTA 5DMYA 5C70A 2DQXA 3WF4A 4MNMA 3MSGA 3SCWA 2ZXQA 2DSVA 1CGTA 4WIWA 4UOQA 4PBGA 4MB1A 2A3EA 3EMZA 4MDPA 1QNQA 1NWRA 1UKPA 2DDXA 1WAWA 1GOKA 1RP8A 2CITA 1J18A 2FHCA 2WMIB 4NF7A 1BPLB 3PZ9A 3TTQA 1KXTA 4TX8A 3WNLA 2FGLA 4B3LA 2ZIDA 4W8AA 2X09A 3WUBA 3W24A 1I75A 3WDRA 2CBUA 3EDFA 3VNZA 2XUCA 3WDPP 4L4OA 3WDQA 2CKSA 1UR1A 3CHCA 3AXIA 3ARWA 5I3DA 1B3VA 1KBKA 3WENA 2WZEA 2Y4SA 1BLIA 2QMJA 2WKLA 2QHAA 4P7QA 1L8NA 1KR1A 1CGXA 2C8NA 1J0HA 3CMGA 3CHEA 3QOMA 3CUGA 5BXSA 3HU7A 3BMWA 1G1YA 3AMCA 4UFIA 1UWTA 3MUZ1 1JZ4A 1EDGA 4HMCA 4M29A 3WKZA 4F8XA 2CETA 1LG2A 1Q6EA 1CXEA 4AZGA 4PMQA 3T0AA 2WLYA 1EDTA 1E0XA 4GI9A 1HJSA 1HP5A 1UD3A 1GOQA 1ZBKA 3BAIA 5HBFA 1JDAA 2OLHA 1M53A 5A94A 1GQIA 1VJSA 1WPCA 2FHFA 1JF6A 1OT2A 1OIMA 3OA5A 2WNWA 4LGXA 1VBRA 2WKGA 1HL8A 1KGWA 1WDSA 3BLKA 3DHPA 5A2CA 3WSUA 3AROA 3OGSA 1KCKA 2EPMX 1V0KA 1HXJA 4DWSA 3VMPA 3A47A 2W66A 3UR8A 2UY4A 3LPGA 4W84A 4DUVA 3WN6A 5BCAA 2VC9A 4ACYA 4UQAA 4JAWA 3WF0A 5I0DA 2E0PA 3TP4A 1OGSA 3BAWA 3NJ3A 3VINA 1BYAA 2YL9A 1ZJBA 2WWCA 2NW0A 3BAXA 3CZKA 1WZLA 3OLEA 4ATLA 1FOBA 3K46A 1TE1A 3PTMA 3M6DA 1UKSA 2OYKA 1CWYA 2WWDA 4N0RA 4FLQA 3OGVA 1B31A 4FF5A 3ARQA 1M7XA 3TTSA 3KL5A 1G9HA 3AISA 2YDSA 4B3KA 3EDDA 1HJQA 4NRSA 1J0KA 4X9YA 3W37A 4W85A 3W0KA 2J7BA 2RGLA 5LYRA 3RJXA 1W2VA 2J7CA 1MW2A 1VFMA 1B3ZA 3SIMA 3BCDA 3CTTA 1JZ2A 1ISWA 3SCTA 3ZOAA 1NQ6A 3AFBA 2GDUA 2VVNA 1ZU8A 3CUJA 1Q6DA 4TX6A 3PZMA 3PTQA 3WDHA 1BVNP 5D8ZA 3ZO9A 1E72M 4J3TA 3W81A 2PWHA 4AZCB 3BXWA 2BS9A 1ECEA 4D6EA 1QBBA 4AW7A 1C93A 1VIWA 1UWSA 1EQCA 5JIPA 3ALGA 1E3ZA 4YPJA 1J0JA 4PMUA 1A3HA 1LQ0A 7A3HA 3VIFA 4W7UA 3ARPA 2CBIA 3PZIA 4ZE4A 1V6WA 4ZFMA 4UFJA 3W25A 3WEOA 4U2YA 4TXEA 2JIEA 1B1YA 3L4UA 3WIJA 2A3CA 1EO7A 2VMFA 5A6AA 2YLLA 2J7EA 3HMCA 3GBEA 3SUSA 2YIHA 4B9ZA 2A3HA 1WNOA 2D23A 1NH6A 1JD7A 1R7OA 3VD5A 3LMYA 4MAVA 2QMKA 4JHZA 1MWOA 4TUFA 3VOCA 1E15A 2WCGA 2QV4A 2WAGA 4TVCA 5GNXA 5DT7A 3NUKA 3AICA 1LWJA 3WH8A 1FH7A 2Y24A 3L4VA 1CDGA 2O9TA 2XVGA 3VDCA 3MSDA 5D9PA 3GNRA 5BXTA 2BY1A 2ZWZA 4QCEA 3AJ7A 1W3JA 1E4LA 2G41A 1K9TA 1BF2A 1UKTA 4RL3A 1GOOA 1SR0A 2X1IA 3CZJA 3MO4A 3FY1A 3OLIA 5JIWA 3N17A 4MB3A 3UETA 3K8MA 4MTVA 1V0NA 2D22A 2J7GA 4QCFA 4P7OA 4BS0A 1VEMA 2VI0A 2G4FA 1R7AA 2GK1A 2E9MA 2C7FA 1G5AA 2D3NA 2WVVA 1W1YA 4J3UA 1BG9A 4CN6A 3VGBA 4CN1A 3RM9A 1KXQA 3VGHA 4J3VA 3AMDA 3T2OA 4EKJA 4H04A 3WMCA 5TD4A 3ZR6A 2WC3A 2CNCA 4TOQA 2G3JA 1JXJA 4GQQA 4HZ6A 1H41A 2CYGA 4DWSC 2ZXAA 3UEQA 4JL1A 1GHSA 3WUFA 3M07A 3T09A 8A3HA 3A4XA 4U3AA 4AZBA 4URIA 3BAJA 3PN8A 1M04A 1Q6CA 1L0PA 1MW1A 2BXYA 5HNNA 3BAYA 3W6LA 2WVTA 3FAXA 3HN3A 2X05A 1JXKA 1HP4A 4J7RA 1Z32X 1QHOA 5M3WA 2WC7A 2XIIA 3UG5A 2ZUVA 1E9LA 3DECA 3G6MA 3GH7A 2DIEA 3VDAA 4B16A 3FHAA 3UG4A 1UD6A 1AQ0A 2VX4A 3LPPA 3AS2A 3VGDA 2AMGA 2XM1A 2XFYA 4D6GA 3SCVA 1NOWA 1C8XA 3EBVA 3AHVA 4W7WA 2J7FA 4PCSA 1LG1A 3GXDA 3VIOA 4JFUA 1D3CA 1QI4A 1WZKA 4BF7A 1H2JA 1HKIA 3NDZA 2YA0A 1I1XA 2X0YA 1BYCA 2E9LA 1B90A 1DWHM 3WNKA 5AC5A 2X2YA 1V08A 3SCSA 1DWAM 1M03A 3AS1A 4UFLA 3IANA 1HJXA
chains in the Genus database with same CATH superfamily
1FWRA 1DXFA 2V67A 4KCWA 1H49A 1Q66A 4C91A 1ZJIA 2QGYA 2VEPA 2YA2A 4DROA 2XIBA 1RH9A 4HU8A 4LX4A 1V0LA 3ITLA 2DIKA 3ARXA 3PAJA 2NVAA 2DZUA 1JFHA 5EFDA 5I3HA 3N2BA 4IQ2A 3SM0A 1NDZA 1K9DA 1TV2A 3GUWA 1XRFA 3IAPA 4LNCA 1P0KA 3S5NA 2GVYA 4PMVA 1XLBA 1OM0A 4TTUA 3NQ7A 4DH0A 4UTHA 3UR2A 5A8PA 4GI6A 4W89A 3ZQ9A 1GOMA 4H9YA 4WF7A 2TODA 1U1JA 3CL6A 2VWTA 3CYVA 1CXIA 4ICCX 3VIMA 1GOXA 3A3HA 4IGMA 4O50A 3LV5A 1RLDA 2VZSA 4J3XA 4RE3A 4NJHA 4JFSA 2WLZA 1F5ZA 3UPWA 2WMHA 2VEIA 4HA3A 3TYEA 4A2SA 1VENA 3IJLA 2WQPA 4WDUA 4MYXA 4DM2A 4NIRA 4LVDA 3QR3A 2NT0A 1VFFA 3K8LA 2OWXA 3RU6A 4LRTA 1AH0A 2IQ0A 3CQIA 3M9YA 3NAVA 1EZ2A 3OVRA 4F9JA 3GHRA 4ROPA 3HV8A 5AVHA 3AOFA 4BQ3A 1H1NA 4M6QA 3OGRA 1HL9A 2JKAA 4F2BA 3T08A 3NCOA 5CSUA 5E09A 2V69A 1SGJA 4LH8A 1TMHA 3RO6A 3NQ2A 3WLHA 5K9DA 2PDQA 1LT7A 4XQ6A 1CNVA 3OTRA 4M7SA 3UZJA 1XBZA 4IPLA 1W91A 2ALRA 1KM1A 2ZZ5A 5DITA 3K1DA 1NY1A 3ARSA 3W7OA 3M43A 3LLFA 3Q94A 3HZ3A 3NQFA 2VFHA 1WP6A 3IEBA 3THCA 4NYUA 2BZNA 1PJ9A 1EHNA 3ARZA 3GVRA 2E6FA 2E7FA 4IMEA 1JGIA 1D7IA 4AZ6A 3NOEA 3UG3A 1PCWA 3GBDA 1JZ7A 4U31A 5CG0A 3O5KA 2CCRA 3RK8A 2YXGA 2E5CA 3KE0A 3N3MA 4HHPA 4OOZA 4RJEA 1L9WA 3GG0A 4ECLA 3M16A 5I24A 2V8ZA 1RAKA 3PWAA 3AZRA 2ESCA 4LC8A 4A29A 1MMFA 3ZWTA 4HK7A 3DU0A 1VRXA 3FYOA 5F2GA 1JCLA 3VC6A 5I7GA 2W67A 1ZNNA 5HWMA 4Q33A 3VGGA 4JX6A 4WSJA 3TQKA 4ACZB 2BP1A 3I68A 5I6SA 1A0EA 2F6UA 5LA2A 4NRRA 1XICA 4IMAA 1L6WA 5XIAA 3G18A 2FZNA 3WF3A 3SI9A 3VNJA 3RGCA 2VCCA 4FLOA 4OWGA 1QVBA 3LI0A 3WQ8A 3JZUA 3EDKA 5IXEA 3LUOA 3QHOA 4MIMA 4HHHA 1QNPA 1AQMA 3I4KA 4K7VA 2ZTJA 3ATYA 4Q4KA 5T9BG 3DZ1A 5A6MA 1Z3NA 3VFCA 5HW6A 1XPYA 2QCDA 4G7EA 4UZSA 4N6FA 1EWDA 3AXMA 4Z1DA 7ODCA 4Z0SA 1EC9A 2OCZA 4JNZA 4B9YA 4DJFA 1HO1A 2OWCA 4ILSA 5FEXA 2J47A 2XN2A 1XRSA 1KFWA 3VM5A 3W1LA 2WSPA 3VNDA 2D3LA 3P2VA 1IT8A 5JBEA 1J4HA 5D37A 3UJSA 1IEQA 3MV11 2MPHA 3WUGA 4M5PA 3MMDA 3QF0A 2V9DA 4RDVA 2P0IA 1HKMA 5I07A 3SY5A 4DF0A 5A6TC 2F21A 2INEA 5I3IA 3EOOA 1AW1A 4ODPA 4BWLC 4AMAA 2R82A 4BQ4A 3W82A 3G1HA 1DPMA 4M81A 5BXJA 3H4WA 3PZNA 5A2AA 2DQWA 2HRWA 1NP0A 3H2EA 3A6OA 1QWKA 1KM0A 3W2UA 3QGAC 3UA3A 3G1FA 4PUNA 2VGIA 2XG9A 4JEJA 4N42A 1K6AA 3V3WA 3N2CA 2VYOA 3H2OA 1R9YA 3S2MA 2XISA 1D6OA 5G4EA 1EP2A 2O7SA 2WHLA 1S38A 4L1XA 4IH3A 5LNRA 5E0CA 4CCDA 4V28A 3QZ6A 2OX4A 4FSAA 3WQPA 4ZTXA 3HPAA 3EEGA 5HQEA 1S2VA 1HXVA 3FS2A 1XRTA 2CZFA 3M64A 2CBVA 4XUYA 3NQVA 1B30A 1TCDA 3H23A 4YHEA 2UBPC 1TWSA 4L5ZA 2CIPA 1V3LA 1W9BM 3CHDA 5DT5A 2QJIA 1FAPA 2XFRA 1UZ1A 3N4EA 4F48A 1KR0A 4L1GA 2CHOA 3QC0A 2AQWA 2WJZA 4HHMA 4YTSA 3V36A 3WLSA 5L9FA 1IXNA 2DZWA 3ZXWA 2F8QA 3VZZA 4TV6A 1KWKA 3GFZA 4US5A 5RUBA 2PC8A 3BLOA 3P5YA 3CQ0A 2ZICA 5GJMA 1UR0A 5HATA 2AKMA 5CCZA 1TPB1 4XSLA 3MMWA 4NZ3A 3BQ5A 1JZ6A 4FALA 1HW6A 3S42A 1G69A 4WRHA 2O56A 4QAWA 4ERGA 4YU1A 5LIUX 2QT3A 2AL2B 3IJDA 1TVNA 4A3HA 1WDDA 1OF6A 1VPQA 3AIVA 3TKFA 3VCNA 1LRNA 1SFSA 3R10A 1F8IA 2QR6A 2MLZA 4XD5A 4GY1A 1A5OC 2F61A 2DY3A 4YWSA 5JBFA 1A53A 4HA1A 2Y5EA 3VOJA 4RW5A 2OT1A 4MFDA 3ZT5A 3FX4A 3CWNA 2PDKA 4U84A 2V3DA 4ZOEA 3UNTA 1CPUA 2C18A 2PWEA 3WMBA 1IEIA 1GVFA 4H9MA 1MFUA 1E6ZA 1WDRA 2OELA 3B4YA 4Q7NA 1OFRA 3BGGA 3OLDA 3CEUA 3I3EA 4JD4A 1QI5A 4R9XA 3CMJA 3VIIA 4B5VA 3UT0A 4QT3A 4FHAA 3W7NA 2FQIA 2FTPA 1W9PA 5EMUA 1XRVA 1F6YA 2WZHA 4LWWA 2DU2A 5HK4A 1SZGA 4F0SA 1OZQA 4PUWA 4JTIA 1BSLA 3A64A 3O5RA 2J25A 1P1MA 3MCMA 4U10A 1SR9A 2OGJA 4L3NA 2QAFA 2XP8A 2PPOA 1WUFA 5LNWA 1NWTA 1R5YA 1DL3A 3L5LA 2MNTA 3WZ0E 4ZA0A 1Z69A 3LXAA 3VE9A 1WO2A 3O5MA 1UIPA 4KGJA 5GNZA 4PUDA 2VTFA 1Y5VA 3W7LA 1OGBA 1J4EA 2RSEA 3AIQA 3F5LA 3GO2A 1JDFA 4JCMA 1FP8A 2XFWA 1F4AA 4C90A 2PTXA 5A69A 1ITCA 3EWWA 2NLIA 4PL1A 5DBUA 2PV3A 4UQ9A 5EPDA 3PB0A 2UY2A 1J93A 3Q45A 1SPQA 2WOQA 1G4TA 3HQPA 1PZ0A 2I1OA 5J8LA 3S6TA 4G50A 5LKYA 4X22A 2BGQA 4AWUA 3UU0A 1QMLA 4U33A 5HT1A 2D0HA 1SM9A 2R1MA 3NQDA 2AAMA 1QOQA 5BNKA 4FIRA 1FXPA 3GHSA 3FSUA 4JY8A 3Q4DA 5KZMA 1AA1B 3LCLA 4ADTA 2OFNA 1FDZA 1VBUA 3TLLA 3LTPA 3AZTA 2CZDA 3P80A 2BVYA 2OU4A 1KGXA 1TYGA 4BK9A 2G4JA 3HQOA 1P7TB 4ZEPA 4BWLA 1XD1A 2QPSA 4ACZA 1UOKA 1JG9A 5CKSA 2Y88A 3V5CA 4Q8TA 3PZOA 2XPAA 1M9HA 5F7UA 2BWGA 5BRQA 5C2XA 2P1FA 1M68A 3THQA 2FB2A 2YL6A 4PRTA 4LAYA 4GRSA 1YBQB 2F84A 1UC4A 4I7UA 2VGBA 4XZ9A 3F7JA 1M1BA 2IPFA 1XYAA 3BLIA 2RDXA 3CH0A 1AK5A 3EXRA 1DBTA 1TJRA 1T0OA 1XISA 3OZOA 4JQ3A 4RNIA 1UD8A 1MZRA 3B9EA 4ZO9A 3GZAA 3RN6A 1EHAA 4ES4A 4UTUA 1WKEA 2VCDA 4QDWA 3WLJA 3G0SA 4RK8A 4O1BA 4H6QA 2NUWA 1KQZA 2PRLA 4F2TA 3EKZA 1TV8A 1X38A 2ZQVA 1B4EA 4Z2GA 4DYKA 1EJXC 4DYJA 1KKRA 5BOFA 4POCA 4PUMA 5DFAA 2Z0IA 3W1AA 4GQRA 2E8YA 1LLOA 1XW8A 1R2TA 3GIQA 3SECA 1BKHA 1UD2A 1JFXA 2NWRA 3IRSA 1JAEA 4UOJA 5BOEA 2PDWA 3FAWA 4DXVA 3TX9A 5A2BA 2QVHA 3RAOA 2JK2A 1QU4A 4ZSTA 1O95A 5K9CA 3G3MA 3RPTA 5AYIA 4HMEA 1YW5A 5D38A 3VOGA 1QI2A 4K68A 1W3HA 4NNRA 4E6MA 1P1XA 3OOBA 3DC8A 3LRKA 4GZJA 4AD1A 1CGWA 4PYSA 2JALA 4NNBA 1YXDA 1KXHA 1UA3A 3AXXA 2WMFA 4N7QA 1GPWA 4UMCA 4FLSA 3PS7A 5D9NA 1WA3A 3CZGA 4MY1A 1BWVA 4Q32A 4AD4A 3TTOA 1VAHA 2ZC1A 1ADOA 5A6BD 1RA5A 2QS8A 1Q85A 3KAHA 3ZT7A 2F23A 1FWFC 2VUYA 1XF0A 1I6NA 1I1WA 2ZQSA 3CGNA 4XIAA 1AJ0A 4FMVA 3C0QA 2WYSA 5ABGA 2HXUA 3ZYZA 1XGDA 2XYLA 4GBUA 4TW7A 5CPSA 3ZJ7A 3CJPA 4X9SA 1R3YA 2HPMA 3LEPA 1BHGA 1R38A 5FCZA 4L9XA 2XP5A 4AX7A 1QHPA 2YCEA 5I23A 3IGXA 4JBRA 4E8CA 2R91A 4A21A 2GJLA 3NR0A 1U79A 1K03A 4KQZA 1ALDA 4WX2A 1JDDA 2RUSA 2Z7KA 2AL2A 3TYZA 3W1TA 3AXHA 4ORMA 2D24A 2ZCGA 4QHRA 2AQOA 3IAQA 1UUOA 1VZWA 5FEWA 4L7ZA 3V75A 2H90A 2E77A 5FEPA 3L23A 3W74A 1WXZA 2G0WA 4FAMA 1BD0A 4GFIA 1EJWC 4AWEA 1SZFA 3OEXA 1FDJA 1EJ7L 5TAOA 5EU9A 4FNRA 4WXYA 4W8LA 1W56A 1MI3A 1UUQA 2QCMA 1F8MA 4Y7EA 2Z6IA 5LZLA 4PMNA 4JTGA 3ZR5A 5AC4A 2FB3A 4TVUA 1E1EA 1UR3M 3NDOA 4DF1A 4GE8A 1AD4A 3PUGA 1UUMA 3H2CA 3L4ZA 2Y70A 3IJ9A 2VGFA 4S3FA 5FL0A 4AMCA 5A5WA 3BZJA 3IARA 4Z0JA 2OR2A 1W31A 1W17A 2I5QA 8CGTA 1OYCA 4TIMA 2OKOA 1LOSA 1NDYA 5XINA 2VX5A 4QFUA 1QPOA 2YKKA 3O1NA 4EIVA 3MVTA 4P8WA 3L0GA 3T9PA 2M1IA 1NDVA 2X1UA 4NZFA 3DC0A 3MI3A 2BX7A 4DBSA 4AY1A 3BW4A 4IIDA 4JFTA 1PX4A 1FJDA 2FGZA 3K30A 3T2QA 3NEVA 1HL2A 3JRKA 3G1SA 3XINA 3LENA 2L5HA 1HUVA 2VRQA 3PJXA 5LA0A 4N9DA 3S6OA 3KL0A 4JTEA 3WK0A 1XLKA 4CD8A 4FI4A 4IQLA 4X63A 4J35A 5AKQA 4KETA 4QEHA 4MKNA 5IM51 3QQ0A 1X1ZA 4E3TA 3LLDA 1R3SA 4JN6A 3EOUA 3LCGA 4YNGA 1RPXA 3C61A 3RIKA 1AL7A 1VCFA 1VF8A 1VBJA 3GNPA 3O9NA 4BF9A 1UR9A 1ZK6A 2CLMA 2YCLB 1K77A 3MDYB 2ETNA 1XLLA 3M1ZA 1E6QM 4J9JA 2MNRA 3SR7A 1OY0A 1C9DA 4O19A 4IP7A 4XIMA 1GQNA 2AGTA 4XD6A 4XWUA 3REQB 1J9YA 4CU7A 1S5MA 3GTHA 1X7IA 3VZXA 4JR5A 3SRHA 2BHYA 3LGEA 3E3HA 1XINA 3ABZA 4DM1A 3MBDA 4F9DA 1NDWA 4WKFA 1JNEA 1CCWB 2PTYA 3NIYA 1VFLA 3ZMRA 4XZBA 3S2CA 4LPCA 2VZOA 4W5UA 3WNNA 3ISIX 3N11A 4Y9AA 1ZFJA 4XBJA 5DRIA 3BOLA 1WKFA 2X2GA 1J5TA 3EKGA 4RCXA 4P8XA 4NASA 4XZWA 3QV9A 2PV2A 1P7TA 3AIEA 3DUGA 4KERA 1TV5A 2OZ0A 1QXLA 4UFKA 3LMZA 1XR2A 3PUOA 3SCRA 5ECUA 4L4MA 3NSMA 1THFD 4N9CA 1MVYA 3VPLA 4IM4A 4CNNA 4IT6A 2OZTA 1V5XA 2P3EA 3DYMA 5KTLA 3H8AA 1SUXA 2PB1A 4QIUA 3I65A 5HNTA 1FCBA 4BFAA 3CZ8A 1VCVA 1R85A 1DJIA 3LGGA 2VL4A 5JVLA 3PZVA 3URBA 1PV8A 2BLEA 3PSVA 4IPPA 1VJZA 3M44A 5GJNA 1PKNA 5D9OA 4HZMA 4EOUA 1CB2A 3GK0A 4X60A 1YBQA 1E9YB 3LHZA 4LAMA 3CO4A 3B8VA 2HS6A 3VGEA 3QJAA 3UG8A 1OX5A 3VNYA 3TK7A 1LWHA 2RAGA 2X30A 2E5BA 4N6EA 4GPNA 1ISYA 5E6YA 3GXTA 5BU6A 4O2TA 3LRLA 1QNSA 1RVKA 1H5VA 1QWGA 5BXPA 2WJEA 3HM7A 1FWTA 3H4XA 1XSJA 4H1ZA 1R6WA 4M6UA 1R3TA 4PTMA 1GQLA 4ODKA 1FHDA 3APYA 1EGMA 3UWZA 4FNSA 2GWGA 4AY8A 2VZTA 1V8EA 3FNDA 1RQEA 2I9EA 5D2YA 4PEEA 2Y0FA 3WX7A 2QULA 3WQGA 3WQOA 3W3OA 3O7UA 3GG1A 4XUGA 4NX0A 5FJIA 3VIGA 1JVWA 3KVJA 4MF4A 3UXKA 1U5HA 2PCEA 5BWFA 2YB4A 1X96A 2ZOXA 5HMEA 1GG1A 2XM2A 2OOFA 2J66A 2A5HA 4J3SA 3LERA 3LXCA 2LKNA 1YMYA 4PCTA 3FK4A 2VM8A 3GR8A 1ZAHA 3LGDA 2ZX7A 3L4TA 3NL6A 1JQVA 3HG5A 4P7LA 1E4NA 3I4EA 3N2XA 2OSWA 1NSJA 4Z2LA 1XYZA 2WVVB 4AYGA 4CNSA 1JCHB 2XGBA 1BVZA 4UQBA 4GYFA 3C86A 4DRMA 2AOSA 1PPIA 2BODX 4HCDA 2E28A 3H22A 4UNIA 4A8RA 1WXJA 2D2OA 4QTGA 4HIBA 4H9ZA 3AQUA 2YZRA 5KZEA 3OJGA 3NZ1A 3C6CA 3ABRA 1F3TA 3N2MA 3C52A 3G5EA 4C5YA 1SSDA 3CHFA 3FXYA 2UV8G 3W6MA 1MEHA 2ZUUA 4DI9A 3PG8A 4WXZA 4XB3A 4UB9A 1W9DM 4Y2WA 2BHUA 3WQVA 2XINA 3QEZA 3SRFA 1ODZA 3ARVA 4D6JA 3CL8A 1N2VA 2YBTA 3FAPA 3DENA 1HKKA 4C1NB 2OLAA 1VGAA 3F4DA 2OWWA 2KE0A 2DT2A 1Y0OA 4JYSA 1XM3A 4ICMA 2A7RA 4XD3A 5LIWX 1R0MA 2ZQTA 4KEVA 4ADSA 4HA4A 3VILA 2XWEA 2ABBA 3VMNA 1YX1A 4JIHA 4Q8QA 1UH3A 3EWYA 3CB8A 4W7VA 1QJWA 3G8RA 1EF2A 2REQB 3SADA 1YADA 4CKQA 4DVOA 4P8VA 3N4AA 3NZQA 3W38A 4GVIA 2Z2UA 4EPDC 5I06A 3DG3A 2O4MA 1TUFA 2M2AA 4FOUA 4LEFA 1PHQA 3EMZA 1QNQA 1NWRA 4UTTA 2F7FA 5AN7A 4H7CA 1WAWA 1O12A 1GOKA 1RP8A 1EEPA 3KWSA 2QQ6A 3MC5A 3L21A 2WMIB 2YX0A 1UZDA 3TJIA 5CC6A 3W7HA 3HGSA 5K9XA 4EACA 2PAJA 4W8AA 3WUBA 3E38A 3TMQA 5CC5A 2PDBA 3EAUA 1KLYA 4L56A 7PTDA 2CKSA 1HQTA 2PU0A 3HURA 3W7EA 3BMBA 2CLOA 4R3UA 4ZL1A 1KBKA 2HDJA 3WENA 4O15A 1HGWA 2WZEA 2LJ4A 4HNLA 2PEVA 2B7OA 3C5QA 1L8NA 4TYOA 2AQVA 2CWNA 3LCFA 4OFCA 3UPBA 4YVXA 5DLCA 3UQNA 3CHEA 3NYZA 3MA8A 1EKOA 1F8AB 1QTWA 2HZGA 3W7KA 2HNEA 4DZHA 4UFIA 2PODA 1KM6A 3WKZA 2CETA 3FYYA 3N2OA 1VP5A 4PMQA 1DV7A 5LSMA 3UBPC 4RX0A 1GOQA 1H51A 3TSDA 5HBFA 1GTHA 1D9EA 4G1NA 2FHFA 3MKVA 4LGXA 2WKGA 2NQZA 5A2CA 4Y9OA 3EKLA 2PWVA 3UJFA 2YCLA 4YCOA 1JUEA 5J5RA 1V0KA 3Q37A 4O18A 1YEYA 5HINA 3LPGA 3ANUA 1PE1A 5J5DA 2DV0A 4DUVA 3REQA 4ACYA 4UQAA 4WR3A 5G5IA 2XH7A 1QPLA 1BYAA 3LK6A 2RH9A 4O12A 3QPYA 3SRKA 1TE1A 3UQIA 1CWYA 4RDZA 4HPNA 3O5IA 1SJBA 4O1DA 3WLQA 4IMCA 4HYWA 3O06A 1IWAA 2B0MA 2PWUA 2WSYA 4FXJA 2J7CA 3QFEA 3W84A 1B3ZA 3VDGA 5DCDA 5H91A 1H7RA 1JZ2A 3ZOAA 4TQTA 2VDHA 2AL1A 1I2QA 2JBMA 4RKAA 1W5OA 5AYYA 3Q67A 4EXBA 4QIBA 1SW3A 1E72M 4S1FA 1AH3A 3BXWA 1UASA 4JIQA 2BS9A 1X97A 1ECEA 1QBBA 2Y7EA 5CGQA 3VYLA 1VIWA 1XLHA 1EQCA 4QSFA 1BWLA 3TE9A 2BVWA 4R33A 4LV9A 2VKZG 1UP3A 5JQ9A 1J0JA 2SFPA 1A3HA 1LQ0A 2O55A 1Q8AA 3GW3A 4CQBA 4ZTYA 1V6WA 4UFJA 3W25A 1YKWA 2KZHA 1MEWA 2C71A 4TXEA 2NQ5A 3T0TA 1SO3A 4ZO8A 1UMLA 3VUSA 3QGKC 1B1YA 5K4XA 2FVMA 3VA8A 1EO7A 1TV4A 3HMCA 2B5UB 1O5RA 4B9ZA 3VFLA 3B9OA 3S1WA 3TXVA 3VD5A 3N25A 2BOFX 3VOCA 4RPPA 1WUEA 1E15A 1W54A 4O52A 5FF2A 3CIWA 5DT7A 3VOFA 4C6EA 1FKDA 5GPGA 1SFLA 3T8QA 4HVXA 4PB4A 3PBUA 1H1ZA 3FFSA 2EG6A 2QKFA 2Y24A 3MW7A 1KFLA 5JH1A 4LVGA 2QJNA 4FXSA 1JCJA 2G3FA 4LUJA 3EOEA 3O6DA 2J6XA 4FNTA 1K9TA 1GOOA 1LRTA 1L6SA 1SVDA 1TPVA 1XC4A 3FY1A 3S5OA 5JIWA 1IXQA 1UIOA 3NL2A 4MB3A 3UETA 2FKPA 3V1HA 4KCVA 1V0NA 2D22A 3DH7A 3RR4A 1VEMA 1Y0EA 1R7AA 3KRUA 2WVVA 3EA2A 3SFKA 4DO5A 3UJRA 4XKYB 3LCXA 4E2VA 3AMDA 3C2VA 4H04A 4IPIA 3ZR6A 1A5CA 3KAIA 2G3JA 3M0ZA 3W72A 4R0XA 4Q8UA 2R1KA 3GNDA 4JL1A 3OVPA 1N8WA 2ODOA 4ZO7A 4GH3A 3DXIA 3MVIA 4V15A 1JPHA 2CLKA 4EPKA 3CASA 1E0UA 4MYAA 1PINA 4FB7A 3BQ6A 2XN1A 1LQ2A 3VKBA 4Q8PA 4J7RA 1QHOA 3TN5A 3V1PA 5A8GA 2PGFA 1ELSA 1E9LA 3G6MA 1F3EA 2Z6JA 3GH7A 4IIBA 4E2DA 2A85A 3LBOA 2KAUC 3B8WA 5BWAA 1EYEA 2AMGA 1W5PA 4OVXA 6ENLA 3A5FA 4Q8VA 1XUZA 3SCVA 4C1NA 1NOWA 1C8XA 5BOOA 4LY8A 4HNVA 3TYBA 3AHVA 3DFSA 2J7FA 1J6OA 3BLDA 1D3CA 3EX1A 3V35A 2DZTA 4ZSUA 3S1GA 1WZKA 1YPXA 1I2RA 3O5FA 3DFPA 4YVVA 5GVJA 4LVBA 5G1YA 4DRNA 3ITVA 5AC5A 3GUGA 4G2PA 1PL9A 1M03A 5FF7A 3IANA 1XG3A 2WKJA 3PPFA 3NVTA 1ROTA 1R87A 4S38A 3EGJA 2FMNA 3HF3A 3MS8A 4AHPA 2REQA 3W1MA 3GB6A 1M01A 1EUAA 3OZPA 3T4CA 1BGAA 4UQDA 3UZYA 4I9AA 5EMMA 3T05A 3N4FA 3EYPA 2BV9A 3PTKA 5TBOA 4XZNX 3EDJA 1HF6A 3MMUA 4LRSA 3WEZA 3HQ1A 3N04A 1LWIA 2HE5A 2CLEA 1CXFA 4KKXA 2O9PA 1V6UA 2QUVA 1S5VA 1KT0A 2EO7A 3G1XA 2WMIA 3IS4A 4N9EA 4GY0A 3ID7A 3A4JA 3N13A 4I9JA 3E5PA 4YTUA 3T4WA 1S5NA 3UESA 4HU4A 3U6WA 3W28A 1R2SA 1PIIA 4M24A 2N87A 1EJVC 3C3NA 1OCQA 4K6AA 2OGYA 2YBVA 1GORA 1G0CA 2WVUA 1FKKA 3G1AA 4NJJA 5KEZA 4CD6A 2WJDA 3M46A 1JZ8A 3O0FA 3Q2DA 5LXXA 2XWDA 2BOEX 1H1YA 3VD4A 4Z2KA 1M6JA 1TPDA 4MLRA 1YNPA 1X8FA 3UF8A 2XVLA 3AYSA 5CG7A 3PNUA 4MM1A 1KBIA 3W86A 1EBGA 1ZHAA 2GSJA 1JF5A 4PBFA 1RCOB 1KWGA 5FACA 2CZVA 4DZ2A 1RPKA 3UFYA 4K7YA 3GXMA 2VCAA 1YDVA 4DUWA 4A8LA 3LBMA 3C4UA 5HWNA 2VNCA 3W9ZA 1M65A 2YXOA 1GNXA 1RP9A 2J13A 2G8ZA 3TR2A 3B97A 2X8RA 4DRSA 4RE2A 2GZXA 2VX7A 2WXDM 3R43A 4U3CA 4L6OA 2PWFA 2XP4A 1IT0A 1CGVA 2WSQA 4XZIA 3H2FA 3KS5A 2O4QA 2QUNA 5H8UA 3ZLFA 4WY0B 4ZE5A 4KWWA 3M5ZA 3ABSA 3PJUA 4G8TA 5C9RA 2VC7A 5DMMA 1OGGA 1XC6A 3U2CA 4WSKA 2DP3A 1RA0A 3M0HA 5G1TA 2BY3A 3SN1A 4C6BA 4U5IA 4EXQA 1GT8A 4RZ5A 3WD4A 1PTDA 2F2KA 1E40A 4LUSB 5FA5A 3CXOA 1NOUA 1TQJA 3GYEA 5DY3A 1XIFA 2GGEA 3GDBA 3E02A 3R58A 1YPIA 5AHLA 1RCXB 2BOGX 4PB3A 3VD3A 1PZ1A 3WNMA 1BF6A 1MZHA 4Z2IA 5D2TA 1VQTA 1XKYA 4ZVJA 1KM5A 1JDEA 1UWRA 3SUTA 4O54A 1E1CB 1ODUA 1QUMA 3CQKA 3K8KA 5IDIA 3ALFA 1MO0A 3B8TA 2E6YA 1RVGA 1OQFA 4EK7A 1A0DA 1EWEA 2PF0A 5I77A 2V3FA 5BMXA 3DERA 1XCWA 4JOMA 4LAVA 5LIXX 3EX6A 4EE9A 2J9YA 1W3TA 4H9TA 1JNTA 3FYPA 4DO7A 5I2UA 2IW0A 2RHGA 2YDAA 1KC7A 1H3GA 4LS1A 9RUBA 3CPGA 4WOZA 3WQWA 2D0GA 4NL1A 2RURA 3TSBA 4CD7A 1FKHA 2E9BA 3A4AA 3KHJA 1UH2A 2QDHA 4ZQPA 1E70M 4PR4A 4DWDA 5M03A 2W91A 4AISA 2VFDA 2EG7A 1KV8A 1LBFA 4LEQA 3NVDA 5CEWA 4OJYA 4AWSA 4UTMA 1D8WA 4Q8MA 1RY0A 3DFYA 1JUBA 3WD3A 3GTYX 4D6CA 1V3HA 1HKWA 1QPQA 3ZJ6A 2HROA 1WKDA 1S46A 3C8NA 1JYWA 3MB9A 3JR2A 1H63A 3OODA 4V33A 4S3JA 2CKRA 2GQAA 3NXFA 2GJXB 4KH2A 3AMGA 3LB0A 4MWAB 2OQLA 4TW6A 3POHA 4HN4A 1JCYA 4GUHA 4IHCA 3N19B 3B04A 5D02A 4TMBA 4L9ZA 3U0HA 2A6LA 5JXQA 4MJ2A 2D20A 1WOAA 3NO3A 3IJQA 4GFSA 4XAZA 1KM4A 4PE8A 1CLKA 3PZGA 1CB7B 3OBEA 3DI1A 3A23A 1OF8A 1SO6A 4Y9PA 3CPUA 2Y89A 5JUVA 3N9KA 3U57A 3HGJA 1EJTC 1LTDA 1UG6A 3KAFA 1K6WA 2FLIA 3GQYA 1JCXA 2W61A 2EPNA 2PDLA 3TJLA 4H41A 4WK9A 1W0MA 1Q7MA 1XLGA 4XKYA 4JCLA 1OIFA 2OG9A 3HV9A 1WXYA 5CPQA 3TCZA 4L9YA 5LGXA 3L2MA 3E96A 2W79A 2UY3A 3N29A 2IKGA 3O0KA 1I2OA 1OYBA 2GSEA 4EX4A 2ZQUA 1XQLA 4DLMA 3L5AA 2WNQA 5JBDA 1W2PA 2A1YA 4IIEA 4MWAC 3ICJA 3DFHA 3EB4A 4IIFA 5DELA 3UZWA 5FF0A 5CGTA 3QQWA 3TW7A 4MNKA 3P62A 4M3PA 3PUDA 3WL0A 1DWGM 2V63A 1CTNA 3WH5A 3KEHA 4HN8A 1BEUA 1FKFA 1N1AA 2V5CA 1B54A 9XIMA 1ENUA 2G3NA 5GQBA 2X1SA 3ANVA 3CTLA 4PL2A 4UNKA 2Z26A 3W27A 5I78A 3EA1A 3U4AA 4ZENA 4ODOA 4UTJA 1VR6A 2WW5A 4RR4A 4E3VA 4UBPC 1XLFA 2FH8A 2QDDA 3W1NA 3KWXA 1E71M 4IQJA 4F2UA 2PP1A 3H6OA 3UJEA 3N6HA 3WH9A 4JYFA 4IQEA 2YW4A 5BW6A 3S47A 3RXZA 1EPXA 3HGOA 1QAPA 1OSEA 2CLFA 3WEMA 3G24A 3L2IA 3D5HA 5KINA 3O63A 1V51A 1E4MM 2J78A 3W83A 3MYPA 2GFTA 3TC7A 4GI8A 1TJPA 1TFVA 1UKQA 3B9NA 1TV7A 2PD9A 3UQBA 2ZKMX 4JTDA 4H8HA 4LUTB 1H7OA 3GX9A 4AD2A 3QGVA 3TW9A 3WNOA 4JS3A 4UIOA 4O13A 2EQDA 2PDCA 3MUCA 3WJSA 5I3KA 1XV8A 4QLLA 3TOYA 1JD9A 1CEOA 4DXKA 4P2VA 5HANA 4NT0A 2Q6ZA 3D47A 4QE4A 3LQGA 4KRUA 2QJHA 2Q8ZA 1GJUA 2OODA 1DJHA 5FEZA 1KTCA 2IKHA 2I16A 4NAEB 1VEPA 3KW3A 1F2JA 1WDPA 2PC4A 4TVDA 3EDEA 1AD1A 3HQNA 1EEXA 1W3LA 4OGZA 2XU2A 2KI3A 4Q4RA 1SU5A 4WVXA 1W3IA 3WJWA 1XIBA 1K3UA 3DG7A 1PDZA 1M41A 3W02A 4GUJA 2C15A 4AZHA 2ZRXA 3SW6A 3O5QA 2UY5A 3B0UX 3CPRA 4KGLA 2XFFA 3I10A 1BKSA 1EUNA 3VTRA 3KZPA 3G1YA 5I03A 1FBAA 2FPTA 2ZX8A 2ZUWA 4NZCA 4R9OA 5K2ZA 1UJQA 1C8YA 4DN1A 4C6CA 2Y62A 1G67A 3CUZA 4IISA 4GJJA 4B3ZA 4JYEA 1E0WA 2FGBA 3FEQA 4WY0A 4DAFA 2OX1A 3VUPA 4DEFA 1SW7A 3VXGA 1AL8A 1HGYA 1RQBA 3GXNA 4BEQA 3IGHX 4GUIA 5T9CE 3FOKA 4HCHA 4LUSA 5HOSA 4ERAA 3B9DA 3G0XA 4I5XA 4US6A 1V3KA 1I8JA 4ZB2A 1OT1A 4HYVA 4JNMA 1WZAA 4CGTA 4U85A 1U1UA 3EPMA 4DLFA 2H3BA 3B0PA 5H6HA 5HNRA 1S39A 3CUFA 3N14A 4IUGA 1E1CA 4G9PA 4HHLA 2D1ZA 1E5JA 1TTIA 1SFTA 3NURA 3GYCA 1ISXA 1ADSA 1DQWA 2A0NA 3VIKA 3CU2A 4W87A 5C9ZA 2VENA 2V0TA 3BC9A 3TR9A 5E93A 3PZTA 4O8RA 4PSPA 2XP6A 2ZRVA 3IIZA 2PPPA 1OADA 5LIYX 2PTDA 4CUCA 3AUOA 2LLEA 4WKAA 2WVSA 1B9ZA 3HFTA 1T99A 4D72A 1B0IA 1EXBA 3WLOA 4R5EA 5T26A 4N4QA 4W9PA 2F6XA 4FIQA 4EVZA 3MV01 2DUAA 3V7PA 2R6OA 3JXVA 2W3ZA 1ONXA 3G3DA 5LA1A 2QCEA 2DFAA 2G5WA 3AHZA 4PTXA 1GYMA 3KCJA 2QCLA 2O9RA 3GR7A 3S5SA 3TFCA 1YIXA 1A0CA 4IIGA 1ADDA 3F2BA 4TTGA 5DX7A 4C6IA 3KOYA 1TTJA 1W6TA 4KFOA 1DEDA 1R30A 1RJQA 1DJNA 4MSSA 4GIVA 2CZEA 2BVTA 2Z24A 4OV9A 1JPKA 3G6LA 4B2DD 5I3FA 1O6IA 1KO0A 1VFUA 3R0DA 1MYRA 2GJXA 3PTDA 3VIJA 4MWAA 3P93A 1FKTA 2RUQA 3R13A 2P0OA 4H3DA 2WBKA 1WB0A 1VPXA 4GX8A 3QRHA 4B5NA 4GCXA 2PDGA 3MUIA 1IGSA 3QKEA 2CESA 4X0VA 3MQTA 4ZCWA 4MWAE 4CNUA 3W1RA 2PCQA 1O1ZA 4XO7A 5FL1A 1EZWA 3NZRA 2W4XA 3ZR4A 2H3DA 3AYRA 3DBNA 4XO6A 2J9XA 1YE4A 3EX3A 3LNMA 4XVDA 4WJXA 4LBUA 3GC5A 5HW8A 3RILA 2TPSA 2RGMA 2GOKA 1BSIA 1Q6FA 2E3ZA 3W1PA 3V0TA 3QC3A 4HCLA 4DXXA 3BCJA 3IRDA 1ZRQA 4IG2B 3D0CA 1X6NA 2E6DA 2X41A 4PTVA 1XYCA 1Q2SA 3V5OA 2PLCA 2XIMA 3NO5A 1V4YA 2YL5A 2PTWA 4J4NA 5CZKA 4FAPA 3PBYA 3VKKA 2ACSA 2Y8UA 3L4WA 3WLNA 4G56A 3NDYA 3MDWA 2IMRA 1H0IA 3DDMA 4DNMA 1VBHA 5TF0A 4AQLA 1GVQA 2DVXA 3E1F1 5EFFA 1FFRA 5IFTA 1UOZA 4OIFA 3U2ZA 2A7NA 1KBJA 3A4WA 1XFBA 1UQZA 4R7WA 1YQ2A 2Z1XA 5FKYA 3CUIA 4ODNA 3JZEA 3BARA 1V3MA 3MPGA 3BGAA 3M0YA 1J2WA 4KESA 3H21A 1BWKA 3DEQA 1GHRA 3UWUA 2GDQA 1DXEA 2MLYA 3VD7A 3RMEA 3MCNA 1WDQA 4G2DA 4M8UA 1RCQA 1GVRA 1OK4A 4K36A 3NPXA 5C5YA 4KW2A 5A6LA 2W92A 1VYSX 3UR5A 3PZQA 4HNCA 2WCAA 5K4ZA 3C0JA 2V3GA 3H24A 2GVLA 3D46A 4EANA 3SSJA 2JF7A 2FZ8A 1IWBA 2JEQA 3VGFA 7XIMA 3WQ5A 4LUTA 4XG1A 4QQUA 1JQXA 3EEZA 1EL3A 3U2EA 2KGJA 3AXKA 1XS2A 4K3ZA 1TUXA 3AHXA 3WLKX 1YHTA 3W7IA 1AH4A 3I7SA 2HWGA 2PGWA 1W1VA 1XG4A 2XIOA 3LX9A 6TAAA 5TNVA 3H2AA 2NV9A 5BU9A 4PCPA 3HIJA 4W8BA 4CQ8A 1OINA 1FCVA 2B7NA 2HK1A 3WNPA 1LCOA 2QXWA 2FKEA 2Z1BA 1NWUA 3VIHA 1J96A 2FZMA 3WJYA 2PDFA 1RY8A 2GYIA 1NU5A 4ERIA 3E0IA 4K1WA 2F2HA 4NAEA 5D2WA 3KL3A 1YE6A 1CXKA 1YTEA 4ZQNA 4QISA 3B0YA 4E2BA 4DYEA 1SO4A 3GM8A 4YL2A 1PDYA 1S2AA 3ONBA 3WQ4A 4JFLA 5DEZA 4XD4A 4L72B 5I02A 3OA3A 3PRDA 3DYOA 5CZSA 4H8NA 5HWBA 2VCBA 2NQLA 1V6VA 4AXNA 4XTIA 5IBXA 5JH8A 1PKLA 4HQVA 2OJPA 4WLCA 3WG6A 1IEXA 3M7WA 4UFMA 2FZBA 2Q71A 4ML4A 1XPGA 1EO5A 1PO9A 3ABOA 1TPH1 4PMJA 5A1AA 2ZA1A 3VE7A 3IUHA 4PMZA 4JICA 1TR9A 1EQPA 2E1WA 5AECA 2VRKA 2DSWA 3R94A 1AUSL 5F2LA 1MDRA 4YXGA 4MJ4A 1VJIA 4HT3A 4PUUA 1IHIA 3KTCA 4NXKA 2BXVA 2BMBA 3QLLA 2EAWA 3J7HA 2XP3A 3BICA 1JNDA 5TQLA 1UD5A 1UWUA 2PS2A 4Q4PA 3DGRA 2R1LA 3IPWA 5G2IA 1PYMA 1ZTVA 1KXVA 1J0ZA 3P67A 4M56A 1MQRA 1GZGA 3OZYA 4W88A 1F73A 1V0MA 3B03A 3LSCA 4D8LA 2GVJA 5HAOA 2VX6A 1ONEA 2C6QA 2DIJA 4AZ5A 2INFA 4IMGA 2XVKA 3I7RA 4GABA 4AFYA 2WZIA 4C6FA 5C55A 2QNEA 5AHMA 4HJFA 3HB9A 1YDOA 4LYQA 4C1LA 1RJRA 4JNYA 1VFTA 2XTKA 4W9OA 1S2UA 4RE4A 2ZUTA 4IMFA 4A6GA 1EXPA 2GLKA 3JW7A 4OBRA 1DJZA 1TIMA 1W32A 1JNSA 3WLLA 2DZSA 1SW0A 3RDKA 1OFDA 1FHVA 3SN0A 3QLDA 4O0ZA 5C54A 2HS8A 1ITQA 1IT7A 2MANA 3EWDA 5PTDA 2DSKA 5D75A 3LDVA 2IPJA 5HW7A 1KFKA 4LCSA 2G95A 1XJBA 2VEMA 1IGWA 4C6NA 2W27A 2GVEA 2BDQA 3CWHA 1XYLA 3E5BA 1D3HA 4QLKA 4JQAA 3W7JA 3O6AA 5E9AA 4C02B 2BASA 4OZOA 3LYEA 5ABHA 2VEKA 3WUEA 1CECA 2Z28A 4L1WA 2Y7DA 2E25A 5DO8A 3FGCB 3UXIA 1HG3A 1V7AA 1TZ9A 1Z42A 1F07A 1GCYA 3ZJKA 1VC4A 5D04C 3QMTA 2IXVA 4S3EA 4M1RA 4Y8EA 3TAKA 2QF8A 4GC3A 1UP0A 3DAQA 1Y8BA 1C9HA 2UZ5A 3WBXA 4NUWA 1FWWA 2ZBTA 2NXGA 3GY1A 1KQYA 2RJHA 2IPWA 3EIPA 3QPZA 6A3HA 2J75A 5J6EA 1OBAA 1E6SM 3WBAA 2Y8VA 3T0BA 3DHUA 4LANA 2V5LA 4LAZA 3C2YA 2Z29A 1FWJC 2CXGA 5A8QA 3MWAA 3ES7A 3BDKA 1KBLA 2JF6A 1UWIA 3AIRA 3TYCA 5KMYA 3VMOA 4KIEA 3SO7A 2YLAA 4IG2A 5BYWA 4FLRA 3S3GA 3VDHA 2W0UA 3WL1A 5H2ZA 3BJSA 1X6LA 3TU9A 6TIMA 8XIAA 1EIXA 1ZQ5A 3RCMA 3L12A 3TDBA 4A4AA 4GIAA 5T8GA 3GRIA 4KMQA 4DZIA 4AX6A 3VKAA 1TX2A 2J4GA 3QZAA 3SUVA 3PA7A 3APGA 1JJKA 1EA0A 3KLKA 3EB2A 1YRRA 2NX1A 4N4PA 1OD0A 1QR7A 1I60A 4Z08A 2BB0A 3ZWSA 1SSGA 1U2YA 3OLGA 3CLMA 4NNCA 3PBWA 1M7JA 1R9XA 1MNZA 5HMFA 4JFMA 2GJRA 3JUGA 3PP7A 2DT3A 1F4HA 1PS9A 4IZGA 1RJPA 5A6KA 3RLGA 3AHTA 3ITTA 2GGHA 3NPVA 3U9IA 3GKAA 1FWAC 3W76A 5HR7A 1WBJA 1PBGA 4ZXOA 4LXFA 1TIWA 2J74A 1J10A 1EA9C 1MW3A 3QY8A 3C2FA 2V30A 4MY8A 5IHSA 1P0EA 1E3XA 3H54A 4NAFA 5GPRA 4KRTA 4LU0A 3LM7A 3DKJA 2DZVA 1E9ZB 2VP8A 3SCWA 4GY7A 4WIWA 4UOQA 4PBGA 4Q6XA 4EP8C 5HNUA 4O57A 4IP5A 4XBKA 3I7QA 1WQ5A 4QAIA 2CITA 4Y90A 1J18A 4F0KA 3TTQA 1JPDX 1KXTA 4K39A 4TX8A 4XZHA 1A4MA 4B3LA 2P8BA 2ZIDA 1E44A 3S4TA 1TWZA 4AU0A 4GHRA 3WDRA 3MBFA 4K1GA 3C2EA 3VNZA 2GGIA 4L4OA 3T8LA 3WDQA 1QDSA 5AVNA 4C6OA 1LYXA 2QMJA 3UWYA 2BBFA 3QY7A 4FR6A 4ZOAA 1KR1A 3DFTA 1CGXA 4IGNA 3BANA 3CMGA 4B92A 3QOMA 5LHEA 1TMLA 2NX9A 3CUGA 5FF3A 4EWJA 5HJXA 3AMCA 2QUMA 4HPXA 2ZZ4A 4AEOA 1UWTA 1TTPA 2ZVRA 4F8XA 4FOKA 4ALDA 2RDWA 2D9FA 1CXEA 1V79A 2Y6ZA 1LP6A 1PCKA 2WLYA 4GGBA 4RPQA 1EDTA 1E0XA 1HJSA 5E1QA 1AODA 4AHQA 3S2NA 3MCOA 1JDAA 1K8CA 1UCWA 1Q6UA 1GQIA 5A94A 3IJIA 5LXEA 4GQ0A 4WDXA 4AXKA 3W07A 1WDSA 1KGWA 3BLKA 5H8MA 3STGA 3I6CA 1VPYA 4KWSA 2AMXA 3VNMA 4DY1A 1HXJA 3M0XA 1UW9A 2NV2A 3A47A 1GYNA 4P5UA 4UDMA 4R88A 4FZIA 3WN6A 4UTWC 4NI8A 1QPFA 3WF0A 3MP3A 3WLIA 3GHTA 3LHWA 4E38A 3NJ3A 3VINA 4V1YA 3E0FA 2YL9A 2OVLA 2NW0A 1DIOA 3BAXA 2HV5A 1M7OA 3OLEA 4WJEA 4ATLA 1EJUC 1FOBA 1GKPA 1A5NC 4N0RA 3S1VA 3I6EA 4FF5A 3WK3A 3UY7A 2NX3A 7REQB 3TTSA 1EF3A 4L65A 2PP0A 4H00A 4LF2A 1J0KA 4W85A 3HA1A 5HQLA 4JEQA 1S3TC 2ZZ2A 2YCIX 3BCDA 3KBMA 3SCTA 4ZODA 5HMDA 2GDUA 1IE7C 3BG9A 1Q6DA 5U4NA 3PZMA 4CQCA 3PTQA 4JGDA 1BVNP 5D8ZA 3KS6A 4GZ7A 3ZO9A 4J3TA 2QIIA 2GUUA 3LCIA 4AZCB 2XN0A 2OPJA 3C0LA 2W6RA 1DKWA 5FI8A 2QDEA 5JIPA 3ALGA 3EWUA 2PPGA 1GGOA 3EXTA 3HPFA 4ZZ9A 4PMUA 4PEKA 2P3ZA 4GYKA 3VIFA 3ARPA 3PZIA 4PFHA 4ZE4A 3FEMA 4ZFMA 2PD5A 2QEZA 4NZ1A 3WEOA 1W8SA 3CEPA 1Y5XA 2JIEA 1TCOC 3B8IA 3L4UA 3PRAA 4V1XA 3SUSA 2NWSA 5CBJA 1WNOA 3ITYA 3VNKA 2LGOA 2D23A 3ME3A 4RE0A 5EMLA 1CX9A 4MAVA 4ODRA 3W71A 2GUBA 4ORIA 4DBWA 1QCWA 4LB3A 2V82A 1JCMP 5GNXA 4NVTA 4HK6A 2HXTA 3AUJA 1XIDA 3NUKA 2C14A 4WY0F 3GU9A 1Q6LA 4I8DA 1H61A 1GZ1A 3L4VA 1TV3A 3BLFA 4HK5A 5D9PA 3A12A 1UPMB 3GNRA 3G77A 5BXTA 3NG3A 1T8XA 5D33A 4O4WA 2OFJA 3NRKA 1RQHA 4IFKB 2CC0A 1EJSC 1Q6RA 1BF2A 4RV8A 1UKTA 2P88A 2WO5A 4RL3A 4RDWA 3BJTA 3FCPA 3LZ3A 3N17A 3LU2A 3G1VA 3R4IA 1TWIA 3K8MA 3AU2A 3NM1A 4BS0A 4GNJA 4ONVA 3S9YA 3LV6A 1G5AA 3FA3A 3S2LA 3WQDA 1HO4A 1BG9A 2I14A 5B80A 4CN1A 2J6VA 4J3VA 4EKJA 2CNCA 1H60A 2P10A 4JTQA 1ZLPA 3FVMA 4GQQA 1OFQA 3O5OA 1EX1A 2HQAA 4YCPA 2I56A 1I4NA 4LJ3A 4ZPVR 3PSWA 4DWSC 4QG9A 3WUFA 1L2QA 2HJPA 8A3HA 3D6NA 3TH6A 3V0UA 4AZBA 3PN8A 3BAJA 1OFOA 1M5YA 1P6BA 1Q6CA 1L0PA 4NP7A 4GA8A 3KAOA 4LVFA 1YYAA 3O8AA 2X05A 4QROA 3DG6A 3O5EA 2ZVIA 3OHIA 3SQSA 5M1TA 3EXSA 4HD5A 4LS0A 3VCRA 1IEVA 2ANUA 4GLEA 1POKA 3OO2A 4D8ZA 3UG4A 3MDUA 1AQ0A 1K4HA 3LPPA 1J6PA 4QE5A 5EMJA 1OABA 1QO5A 2I5IA 2Y1HA 2FJKA 2IKJA 3RF9A 1QI4A 1LRQA 1H2JA 1HKIA 2YA0A 2X0YA 1YDNA 3UA4A 1DWHM 1T41A 3WNKA 1KLZA 3W70A 1V08A 3DOPA 4DRIA 3SCSA 1DWAM 3AS1A 1P5QA 3TN6A 3CM4A 3KXQA 3MI2A 3LTYA 3CV7A 2OYLA 2A21A 3ERPA 1KRCC 3UWQA 4NZJA 1AFSA 3OB8A 1XP3A 4E4PA 1W1PA 3MJYA 4LALA 5E70A 3CQHA 3UF9A 2PDHA 3NI6A 2PDJA 3B3DA 2J7DA 1E6XM 2EJ1A 3UXLA 1S2WA 1S5TA 4DQWA 3GTXA 1G7UA 2ZTKA 2DG4A 3FKRA 5EA9A 2VDGA 3THAA 2FIQA 4R85A 2HVOA 2TMDA 1NOFA 1L6YA 2ZXDA 2EPKX 1BRLB 3UP8A 4CEUC 3OBAA 4A3QA 3S5YA 4QNWA 1RXOB 1XIMA 3WK2A 2PE4A 2BVDA 2IPGA 5E5CA 3W2NA 3VCCA 3F4VA 1ZALA 3AMLA 4QG8A 1LROA 5TIMA 4TNSA 3TC6A 4IFRA 1VD6A 3APTA 1VH7A 2EPHA 2ZRYA 2ADAA 4PRRA 1EDQA 1Z7AA 4A05A 1DHKA 1EOKA 2PDUA 1S2CA 4UFHA 3TONA 3CS2A 3W4RA 4LNYA 1AVAA 3EWZA 3ZLHA 4F0RA 5CLTA 5AOUA 5DN1A 4GKLA 2KFWA 2PA6A 1CZ1A 3K4DA 3GHUA 5HUAA 3CZLA 3S2JA 4MOZA 2HVMA 3T2PA 1IX5A 5C2CA 2RUDA 3IK2A 1GZJA 4Q4SA 4JQ1A 1BGGA 3BSMA 1RLCL 4HA0A 4I9MA 2PLJA 1K1DA 4JFKA 2QVNA 2XGZA 4HNUA 4OUEA 5KZ6A 3WDJA 4WZHA 3H2NA 1QOPA 3K4AA 5B7YA 3EOLA 3LPOA 3ZT6A 3S9ZA 2B81A 2GOUA 4X3ZA 1E55A 1F05A 3DYPA 3DFNA 3M7SA 4C6JA 7REQA 1ML1A 4AD5A 2DPEA 4X2RA 2QJMA 1JYVA 1ESWA 5K7JA 2VDIA 4JHOA 4D6IA 3CBWA 1VKFA 1O68A 2B7QA 3N12A 4BZYA 4DWSD 1MQPA 4HBKA 2OO6A 3UPMA 1XIGA 1NFBA 4GG9A 4XKMA 5LNUA 3D3AA 3B05A 2ISDA 2VR5A 3IJ7A 4PMYA 5U7SA 4DJEC 1GONA 3CV2A 3GNXA 5A8MA 1VIZA 1GQKA 4OBSA 4W9TA 4AZCA 3VNLA 1UD4A 3JS3A 3ITGA 3EWBX 1MSSA 2CXEA 3VU2A 3A3XA 4MFEA 1ICQA 1D2KA 1DE6A 2EPLX 4KEUA 3RITA 1K9EA 4ZPTR 3IVUA 3UCQA 4FNQA 1YW1A 7TIMA 1AMKA 1W8GA 4IX0A 1PSCA 3AC0A 4BA0A 3T6CA 4WD0A 2XSXA 1UJPA 3BV4A 1FKIA 5AHIA 1O5XA 5D03A 3S83A 3FLUA 4MJMA 3WD0A 1TSIA 3W7RA 4YHGA 2BY2A 3WYZA 1U22A 3O6CA 4CD5A 2WK2A 1WOBA 2ZE3A 4MSPA 3OOQA 3DHDA 3GDRA 2WSRA 3A13A 5F1UA 3L2LA 2YSWA 4B91A 4DBUA 4Q4OA 3O5LA 5AC6A 2PDNA 1XYBA 1SZRA 4H01A 1UH4A 3UWWA 3OG3A 2Z7GA 2V2DA 4DIAA 3IUDA 5GNYA 5C9WA 2YL8A 1OG0A 2ZR5A 1ZBVA 5SWUA 2UWFA 4UNLA 1ONRA 1D7KA 3KZSA 4R53A 3UXDA 1Z9AA 3QKZA 4C6LA 4YJ5A 1ME7A 1QFEA 2ZR6A 4DX3A 1MFVA 5A6BA 1Q3NA 3SZ8A 4NYYA 3UVIA 3AWOA 3TA9A 1L6FA 4UTKA 1JGMA 1DJYA 3ZZ1A 1Q2RA 2QW5A 4R27A 1XH1A 3PULA 1CLVA 1WAUA 1WV2A 1VFHA 4NX5A 3QY6A 1EYMA 4GBDA 1NARA 3NA8A 4JTFA 2ZRUA 3TTEA 5CLWA 1C7SA 1HNYA 4BKNA 1BG4A 1KKOA 2PDIA 4H2HA 3S6DA 3BG3A 2OZ8A 2ABAA 3WMLA 1ZCCA 3MZ2A 2ON3A 3QN3A 3FA5A 3PY2A 4IT1A 3SJNA 2VQTA 4V2XA 3PAOA 5FJRA 4FX8A 4Q8WA 4Q22A 2TRSA 5EB8A 1FWNA 3BMXA 5EY5A 3LHVA 5HWJA 4D6FA 3W00A 1JZ5A 1KD0A 5F4WA 1GUVA 3IV8A 3IUIA 1AQHA 5EMKA 2Z1SA 2I7GA 3WCZA 2X7VA 3L68A 4JKMA 1A5BA 1KBBA 1Q6HA 1UROA 1F3WA 1DWFM 3OIHA 6XIMA 3OG2A 1OHLA 2YA1A 3WFZA 3OW1A 3PR2A 3QVQA 4DRPA 2OOGA 2INZA 1LF1A 1DORA 3OYZA 8XIMA 3CV6A 2PLMA 3V5FA 1PX8A 1W3KA 4AHOA 1GJWA 1KGUA 1JIBA 2HISA 5ECVA 3ITOA 5E6ZA 1A5SA 3URQA 2XZ7A 2JKPA 3W7CA 3B8SA 3GXIA 1FX6A 3CO8A 3V16A 2PBGA 2FZDA 4K37A 5IDZA 4LAWA 3F5JA 2YDRA 2NQJA 2TAAA 6CGTA 4OV4A 1DWIM 1TQXA 1AZ1A 3A24A 3IJ8A 1P5BA 1XLMA 2A79A 4AEFA 2C1GA 2WJFA 3SCNA 5BXRA 4U5KA 1DXIA 2XGIA 4MY9A 2QPXA 4WSHA 1YXYA 2DT0A 2IF4A 4DJED 3T1GA 2E09A 4ZQRA 1SJCA 1NELA 1US2A 1WE5A 4NZ5A 3WLTA 1C9WA 4OKDA 1DJQA 1TRDA 2YW3A 2FFIA 4HOWA 3G0UA 1Q6IA 1BQGA 1BRLA 1X1NA 2V5BA 1DHPA 3GVQA 2DG3A 3NQCA 3RYSA 3KRZA 3AAMA 4CQAA 2PZNA 1T40A 4INFA 1OEPA 4UTFA 2DSZA 3N34A 5D05A 1MRAA 3SCPA 1VFSA 4ZXLA 3PBGA 2JGQA 2F38A 3LD5A 3RO8A 4LYKA 3W87A 1OC6A 4O0KA 1B4KA 1GOWA 3AZSA 5JMUA 3VIPA 5ABFB 3VOHA 5FD0A 4HJWA 3N3TA 3F5KA 4GYPC 4I5UA 3ZSSA 3P61A 4HP5A 4A2RA 1N7KA 3B7XA 3AIBA 1EFZA 3RPMA 1H62A 2KO7A 4UTLA 3M0MA 3NOYA 2NVDA 3BMVA 3ECQA 3SGZA 3HOJA 2I9UA 3GH4A 1AW5A 4XISA 5J04A 4MMWA 5DMLA 2RDTA 1ZCNA 2ZZ3A 3FSTA 1XLEA 4RNHA 2DZXA 1BFNA 2CHNA 7TAAA 2Z1KA 1HFBA 1K9FA 2DH3A 5CXPA 4MB4A 1J4RA 1D8CA 5IFPA 4OT7A 4QP0A 4B5SA 2QUUA 2ATMA 4JZ5A 1J8VA 4AIEA 4LSBA 4H4IA 6REQB 3K2GA 2DUXA 4FP1A 4XX6A 4HB7A 2Y5JA 3GDLA 5HDRA 4KFNA 1PWMA 1KCLA 3M5XA 3GTNA 4O28A 5EMYA 4DBDA 5CPNA 4OBTA 4PUEA 4GXWA 6ALDA 2G37A 3GC2A 3VKJA 1GW1A 4MAZA 4QJ4B 1ZJHA 2DORA 2GQ9A 3QZEA 1MDLA 4BI5A 1QW9A 5HUOA 1PIFA 1ZY9A 1E73M 3BH4A 5MHBA 1XGZA 2FDMA 2HBVA 3E2SA 2XSAA 4W4QA 4MG4A 4S23A 2NXIA 4KEMA 1R3QA 3M0KA 4M0XA 5IRPA 1IZJA 3NZGA 4GUGA 2VOMA 4GVHA 1JAKA 3R8HA 3EX2A 4Y9MA 5AYXA 4B4FA 1PZ2A 3NTPA 4H9UA 1ZP4A 1XWYA 1HT6A 1VLWA 1ZAIA 4M6PA 1E0TA 2P8CA 3H2MA 4TX0A 4PCNA 1KB3A 2PTZA 2V3EA 4UTIA 1XSIA 2BTMA 2PFHA 3QTGA 1VYRA 3VAVA 1JCNA 1PZ3A 4R7JA 6XIAA 4RNFA 3ARUA 1XYMA 1CIUA 1MW0A 3IKDA 4QG6A 2PGEA 4J1OA 1K70A 4C6QA 1K8ZA 3O5DA 3UI4A 4Q4QA 1A5AA 3JVAA 5C8BB 4BJHA 3O16A 2WQDA 1FWSA 4E2OA 5A8OA 1A80A 1W5NA 2ZRWA 3NSXA 1TA3B 1A50A 3O5PA 1FFQA 2VOTA 3P81A 1J0IA 1S1PA 3NTYA 3VX0A 1DTNA 4AUBA 3CGTA 1R2RA 1Y65A 3ARTA 3QBUA 1CLXA 5A8NA 1W26A 1IV8A 3S1UA 4DJFD 1AQFA 1IIGA 3BGJA 3UW6A 4W9QA 1U30A 3MUXA 3MUY1 2GQ8A 4JHMA 4QXIA 2QF7A 2WM0A 3DCPA 4HPHA 2X42A 4LYRA 4NNAA 3W1XA 2P53A 3MU7A 2Y63A 4PSRA 1C90A 2OSYA 5G4WA 4OECA 3VD9A 3TQVA 3WDIA 3OQ8A 4QGCA 1HN1A 1ZBCA 4WDWA 2J8FA 3BCFA 3IGUA 1KW1A 3UXAA 3UERA 3P8IA 6PTDA 1V02A 1O1HA 4GVFA 5GJPA 1V77A 3EX4A 3UQAA 4PFMA 1W1B1 4IXXA 4J3WA 3QXBA 2VWSA 2O7QA 4I5RA 3GWQA 1E1FA 2NVCA 1T7LA 3NWRA 3C2OA 1V02E 5ENLA 3W22A 5H8PA 2GGGA 3L0KA 1S5WA 3SRDA 3WK1A 3D3FA 4LC6A 1QW7A 2X16A 2VFFA 4MZ8A 1XLJA 3VOIA 4AZ7A 4M19A 1WYIA 3MUAA 3ZJ8A