2DSWA

Binding of chitin-like polysaccharides to protective signalling factor: crystal structure of the complex of signalling protein from sheep (sps-40) with a pentasaccharide at 2.8 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding properties and carbohydrate induced conformational switch in sheep secretory glycoprotein (SPS-40): crystal structures of four complexes of SPS-40 with chitin-like oligosaccharides
pubmed doi rcsb
molecule keywords Chitinase-3-like protein 1
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dswA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dswA01
4MNKA 1NQ6A 2J79A 5A6AA 2J74A 3KEHA 1JI1A 1XHGA 1JDDA 1QNPA 4UFIA 2J75A 4W7VA 4CVWA 2Y5EA 3CIVA 1V6UA 4BS0A 3WBEA 3A4WA 4MDOA 4AEEA 1B31A 4PTXA 2VR4A 3J7HA 2JIEA 4W85A 1HXJA 5GNXA 1ISZA 1U30A 1HP5A 1UKQA 1VFMA 4PMZA 3ZSSA 1WNOA 1ODZA 1GQIA 2X09A 2F2HA 1KQZA 4GXPA 3BAYA 1QNOA 3CHFA 3VDCA 2PBGA 3RO8A 5FIPA 1CGVA 2Y8KA 2D0HA 2YA0A 4P7LA 3VVGA 4A3HA 3EDFA 4BCEA 4LYPA 3ZJKA 5A6JA 2YBTA 3QOMA 1W2VA 1XH0A 4AZCA 1GQLA 3O9NA 4J3XA 1ISVA 2DIJA 4W88A 6TAAA 1CZ1A 2DQXA 2UY5A 1GOQA 1B0IA 1I1WA 2EXOA 1VEOA 3DC0A 4AD2A 2VCBA 3ZM8A 1UD3A 4BZYA 4WSJA 1R7AA 1ZL1A 1R86A 2E8YA 3VDHA 3WF3A 3WL0A 4GO8A 3RDKA 3M07A 3TTSA 1HKMA 4D6HA 2BY1A 2J7BA 1VFOA 4JKKA 1HJXA 2UY3A 4WKAA 1TA3A 1J11A 3AXIA 1BFNA 3SIMA 4PEEA 1VJZA 2WZIA 1V0MA 1EDTA 3ARQA 3WL1A 4ACZB 3BSGA 2ZUWA 4K68A 4PTWA 5D4YA 2YKKA 3LPFA 1BAGA 2VCAA 3WN6A 4D6JA 5BWFA 1MQQA 4UTFA 4YHEA 4UZSA 1VAHA 1F4HA 3BGAA 1QVBA 4JAWA 2CBUA 2X0YA 2WSKA 3OB8A 2WKLA 2A3HA 2O9RA 2ZUMA 4WIWA 5DT7A 4IUGA 3MO4A 3N04A 3U5YA 4UQDA 4EAMA 3VD7A 4LPCA 4TX8A 1QOXA 4TVUA 2OSYA 2G3JA 3VMPA 1EO7A 3B9EA 5A69A 3WDHA 4D6IA 3W25A 3UR8A 5ABFA 1Q6FA 3VGHA 4ATDA 1IZJA 4YHGA 2D3LA 4M56A 3VMOA 2F61A 1ZS2A 1GPFA 3W82A 4UFLA 2QV4A 1BQCA 4DM1A 4AZ6A 3ALFA 1TZ7A 1UOKA 3VD3A 1W1TA 2ZX6A 2CBVA 3QHOA 4WSKA 3HN3A 1JZ6A 2BVDA 3CMGA 3VDBA 1EH9A 4J3TA 4GZEA 2GSJA 5KZ6A 2X05A 2VZTA 3KL3A 4GZJA 1GZJA 1XGZA 4PMQA 3VMNA 4WKHA 1CDGA 3SCOA 2GJRA 3IAQA 2ESCA 1E56A 5FL1A 4LGXA 2Y4SA 4TVCA 2MANA 3N15A 4CGTA 3SCTA 1EHAA 4MJ2A 4DWSB 4MAVA 1BG4A 2CEQA 3VIOA 1AQ0A 3W27A 5EFDA 5I78A 3WD3A 4CN1A 4AZHA 1B2YA 3CGTA 1QHZA 3ZMRA 4KMQA 1K9EA 4M29A 1NWSA 3WDPP 3CZLA 3MSGA 4X0NA 3S2CA 5A94A 5EMYA 1U33A 4N0RA 1UD8A 1B3ZA 3WY1A 1X6NA 5DMYA 1HIZA 2OSXA 4JFVA 3K46A 3CZEA 4DUVA 1VIWA 3RMEA 3ZT7A 4GPNA 1NWTA 2XWDA 1C93A 5CPQA 4AD3A 1UR1A 4PMYA 3AHVA 1PIFA 1GNXA 2DEPA 4PTMA 1HJUA 2GK1A 3K8LA 3WDIA 1ZBCA 3AMDA 2J4GA 1TCMA 2WHKA 1UWUA 1R7OA 3ZQ9A 3F4VA 2DPEA 4R5EA 2ZUSA 1SFSA 4URIA 3KL5A 1EDGA 1W3LA 3MUY1 4U5KA 2OYMA 3VGGA 3VO0A 2XPKA 1PAMA 4HP5A 5HPCA 5CJ5A 4A3YA 4CVUA 2ZICA 1EOKA 3VKKA 5JIPA 4UFHA 4RE2A 3E1F1 2CBJA 3WQ8A 3L4UA 2WANA 4OJYA 5CGTA 1ISWA 3FXYA 1FP8A 3WIJA 2G3MA 3VIMA 3PZTA 2BHYA 5BYWA 1XYFA 3AIVA 5GQBA 2WVSA 3ARYA 3RIKA 2ZUVA 1W3HA 3W24A 5BXRA 3BAKA 4W93A 2GJPA 2ZUNA 3UG3A 5BRQA 1DEDA 1MXDA 1K9TA 3WDJA 2V3DA 3PZIA 2EEXA 3KWXA 2EPOA 3AZRA 3RPMA 1K9DA 3W37A 1NWRA 5ECUA 1UQZA 4TOQA 5CQ1A 4XZWA 2E4TA 2VQTA 2XGBA 2NSXA 1V03A 4B16A 5A8NA 4XX6A 3AFBA 2WMKA 2FHCA 2JF7A 4F79A 1AQMA 4W87A 3DHPA 3O2LA 2PWEA 1XCXA 1RH9A 3SCRA 2VOTA 3CUHA 4XV0A 5F7UA 2XFYA 3II1A 4D6EA 2AOSA 3FAXA 4X9YA 2XVLA 2XHYA 3POCA 2WZHA 2GDUA 1LG1A 1JYNA 2DH2A 2CESA 5FL0A 2VRJA 4PMXA 3MSDA 1WDPA 3AQUA 1X6LA 1H09A 3VD5A 4PCSA 1HKJA 3PTQA 2ZOXA 3PZNA 4B3KA 1F4AA 3AS1A 5BXPA 1WPCA 1QW8A 3RM4A 2VR5A 1KB3A 5JBFA 4JZ5A 1FFRA 3ARRA 3M6DA 2NT0A 2NT1A 3PZMA 4B9YA 2D20A 2J7HA 1B3WA 2WCGA 2XM2A 2QMJA 3BLKA 4HZ7A 4OOZA 4WKFA 1A47A 1XH1A 3W29A 3WEOA 4QLJA 5AC5A 1E55A 4AD4A 1UR4A 2CBIA 1QNSA 1UR9A 3ECQA 1CGWA 1HVQA 1V6VA 3WNOA 1GVIA 4D6GA 3AS2A 1QHPA 1J10A 1CENA 2DT1A 2WAGA 3WH7A 3AICA 3QHNA 2VZOA 2WNWA 1BVNP 4YN5A 1B30A 3AHTA 1B3YA 2X1IA 2XGIA 1SR0A 5I5RA 1UD4A 2VURA 4W5ZA 3ARUA 4OOUA 3SCWA 2YDRA 3ZOAA 2A3EA 3AHYA 3ARPA 4Z2IA 1H0GA 1Q6GA 2O9OA 1J0HA 5LA2A 3CPUA 1R87A 1PEZA 2XSBA 4EE9A 4QDMA 3LPGA 1EHNA 2XYLA 2F8QA 5IHRA 2J7EA 4D6FA 1UKSA 4HMDA 4KH2A 2J7GA 2WCSA 2CKSA 1K6AA 2E0PA 1MFVA 4W5UA 1UQYA 2QLYA 1VB9A 1Q6CA 2WMHA 3D5HA 2WLYA 3WNNA 1CXFA 2XWEA 3OBAA 4HA4A 1KR1A 1E4MM 2BVYA 3FN9A 3KZSA 3BCDA 2XIBA 3WH8A 3BAWA 3WFZA 2E3ZA 3SUWA 2Y2WA 3WFLA 3WSUA 3MMWA 5FKYA 1RP9A 3WQVA 4J27A 2G4FA 2G3NA 4P7RA 7CGTA 3ZSTA 2OYKA 2ZXQA 3AIRA 3WMSA 4QCEA 2ZXAA 1MW2A 4MADA 4BQ4A 1E71M 4JKLA 3RM8A 4DM2A 4D1IA 5ABEA 3L4YA 8A3HA 3PTKA 1R8LA 1DHKA 6A3HA 1UA3A 2V5DA 4ACZA 1M04A 1DWIM 4GI6A 4KGLA 1UKTA 2WVVA 3DYPA 1D2KA 1EIBA 1V3IA 3L4ZA 3TTQA 3VD9A 1GOWA 3WF4A 1CXLA 2VX7A 2O9TA 1W9VA 3BXWA 3T0AA 1M7XA 3CUFA 3ZJ7A 1J0JA 4EKJA 4FF5A 2EQDA 4X0VA 1V6XA 4CD5A 2VI0A 1KXQA 3T09A 3APGA 3WEMA 1OGBA 2YDQA 3THCA 1CLVA 1V0LA 2GFTA 1UH2A 2J62A 2VZSA 5C71A 1BGGA 4NF7A 1E40A 1W9BM 1QI3A 3ARSA 1E6XM 1XD1A 1PX8A 1UH3A 5DEZA 2VMFA 3WF2A 4P8WA 1ECEA 2EO7A 3F5LA 4J3VA 1UYQA 3ARTA 1RP8A 3BMWA 4XB3A 3VU2A 3MMDA 2PBOA 2J7DA 2O9PA 4W8AA 4AD5A 2QMKA 4MB1A 3PZUA 2YDSA 4KGJA 1E0VA 4D6CA 1UUQA 2WBGA 3RJXA 3UERA 1S46A 1BHGA 3RILA 5CGMA 3SEPA 4PBGA 3VGBA 3UR7A 1BYAA 3K1DA 1JDAA 1JIBA 3WD0A 1P6WA 3NUKA 4QCFA 1EDQA 1WE5A 4JFSA 1NP0A 4UQCA 3OA5A 1DWHM 3T2PA 3WH6A 1OSEA 2D2OA 5A6BD 4CCDA 2FGZA 2VTFA 4B9ZA 4DWSA 1KQYA 3AYSA 2GJXB 1XSJA 1AVAA 1GJWA 3WQWA 3WD2A 3EDEA 3WDQA 2FHBA 1V3KA 1LL7A 2UWFA 3ZR5A 4UOZA 4UQEA 4Z2HA 3GM8A 1GCYA 4J3WA 1ITXA 2CERA 4FLSA 4AZBA 2PWFA 1OT2A 2O92A 5LA1A 5DFAA 4U2YA 5A95A 3HU7A 4PSPA 4V2XA 1RD6A 5GNYA 5M03A 2CCRA 2CETA 2ZX5A 2WCAA 4P8VA 5D9OA 2HVMA 1JFHA 4H04A 2WZEA 3S6TA 1KGUA 2XVKA 4H8VA 3WNLA 5I77A 2D22A 1FP9A 4AWEA 4CKQA 3AMCA 1V3MA 4TTGA 4MNJA 3F5KA 4M8UA 2W62A 2BY3A 2HISA 4GIAA 4C7GA 3B8SA 4NI3A 1VBUA 1UWTA 4HU0A 1YHTA 1GOIA 4Q22A 1MYRA 4N42A 3NJ3A 2ZX8A 1RPKA 1E43A 4LX4A 3AMKA 4IISA 3WMCA 1QI0A 1Z32X 4IPLA 1HN1A 1LQ0A 1NWUA 1JXJA 6CGTA 1JAKA 5EBAA 1ZB5A 1XRVA 3AIUA 4AIUA 3VIPA 3MANA 2GUYA 2IXVA 1W1PA 5IFTA 4C7FA 3VUPA 4KRUA 3GXFA 2YIHA 3GXDA 1HKIA 1CYGA 1JF6A 2JFEX 1JD7A 5IDIA 4W8LA 2DT3A 2BVTA 4Z2LA 5KEZA 1TVPA 2BY2A 3CUIA 3SCVA 4HOZA 3L4WA 2WHJA 3AHZA 1UWSA 2V3FA 4NRSA 1B3VA 3UG5A 3SCUA 4H41A 5CSYA 1DWAM 1H5VA 5A2AA 1M03A 2YL5A 1QI5A 1WO2A 2J7FA 1JF5A 2D1ZA 4GQQA 3VX0A 2W4XA 1NP2A 2JIWA 2D0GA 3OGVA 5BCAA 1J9YA 1HF6A 4OIFA 4J28A 3WF0A 5M17A 1ZU8A 4ZFMA 4PMUA 3U7VA 4QAWA 4HZ6A 4GZIA 4QFUA 3VIIA 2OLHA 3L2MA 3FHQA 5A6SA 2Z1KA 3WH5A 3ZT6A 3VOCA 2FH6A 3AIQA 5CG0A 3OGRA 1LJYA 2IXUA 4HTYA 4HMCA 1WZAA 3RJYA 3WEZA 5M5DA 2RGLA 2WSPA 2JEQA 4QLKA 4MB5A 3SURA 1JZ2A 3IJ9A 3EDJA 2GVYA 3OLIA 4CN4A 4W86A 2WWCA 1JAEA 2VRKA 1WP6A 3TONA 4MPKA 3NSMA 4W7WA 1V3JA 2VVSA 2BV9A 4CU7A 3LPPA 1SYTA 2W67A 2XM1A 4JHOA 3UESA 4U3AA 2J25A 3N13A 4JFUA 4H8HA 4RE3A 3WD4A 3T2OA 2UY4A 1W9XA 1V02A 4D71A 4S3KA 1HJSA 2G41A 2WM0A 3BCFA 5A8OA 1FHDA 3PHAA 5GNZA 2DSUA 1M53A 3GZAA 1H3GA 1H41A 2WC4A 1QBBA 1TA3B 1BVZA 1CLXA 4U2ZA 5I24A 3WNMA 5A6LA 2WHLA 4CD6A 5E09A 2VVNA 2QHAA 4CCEA 1PX4A 3OGSA 2VO5A 1OCQA 1OT1A 1EOMA 2ZIDA 2W61A 4PSRA 4U33A 1OWQA 5AYIA 4LXFA 2DT2A 2EPLX 1HT6A 1E5JA 1TR1A 2EPMX 1VJSA 3BC9A 1JI2A 1I1XA 3BAXA 3AROA 1B9ZA 2EBNA 1BYCA 5C70A 4JL1A 3WDRA 4P7NA 1BSIA 3SCSA 1OIMA 3VNYA 2WHMA 3SCQA 1J18A 3K4DA 1E6RA 1FH8A 2BFGA 5FOOA 1UD6A 4AIOA 4L4PA 1E6PA 3LMYA 3U57A 3NDZA 3QGVA 3RCNA 5ABFB 1CTNA 1MFUA 3WUFA 3MMUA 4PTVA 3OLDA 1IV8A 1E3ZA 4E2OA 1KFWA 3VM5A 5IFPA 4W7UA 1Y7VA 1H2JA 4QP0A 5BROA 3NCOA 1C8XA 1EQCA 1YQ2A 2DT0A 4MAZA 5M3WA 1CECA 3N12A 1DWGM 4AMCA 4UOJA 1JNDA 1CGTA 1UWQA 2E9MA 1E72M 4IPNB 2C0HA 2BHZA 3A3HA 3AS3A 2D23A 2XG9A 4D6DA 3AZSA 1EQPA 4PYSA 4JHZA 1E6NA 4AIEA 2VT0A 4GQRA 4CU6A 5AC4A 2A3BA 4AZ7A 2X2YA 4D1JA 4UOQA 3AI0A 1J0YA 2BXZA 1JGIA 3VGDA 4CD4A 4P7OA 2Z1SA 1W9DM 3IANA 3F5JA 4PMDA 3BLPX 4V28A 2BNJA 1OINA 3FNDA 5I79A 1OD0A 2RGMA 2VX4A 1HL8A 3UG4A 4MJ4A 3WELA 2WB5A 4JCMA 4UNIA 3U7BA 3A4AA 1QBAA 1NM9A 1E3XA 3VGFA 1OM0A 1CXIA 3IAPA 2ZWZA 1JZ8A 1HJVA 1MVYA 4H8UA 2GK1B 1E4NA 3QHMA 3EBVA 2YLAA 1XD0A 4DWSD 3THDA 2VZVA 1NARA 1V6YA 4MB3A 5LA0A 4MNMA 1QI4A 2CHOA 3AIBA 5E0CA 2CYGA 3VTRA 2JALA 3CHDA 2QF8A 1EA9C 3VIJA 3ZO9A 4TXEA 1W91A 3MS8A 4S3JA 9CGTA 5A6KA 1L0PA 5HDRA 1JFXA 2W91A 2GJXA 4UCFA 1BGAA 1JG9A 1UHVA 2WYSA 3OLEA 3M46A 1E73M 1ZBVA 4RL3A 1J0KA 5D9PA 4HPGA 1C90A 1KWKA 3PZQA 3MKKA 2Q8XA 3WUBA 1UZ1A 1PZ2A 3B9AA 1W2PA 1WCGA 4M80A 4P7QA 1CGUA 3ZJ6A 2FH8A 4Z2KA 1GQJA 3BSHA 3GNOA 3NIYA 1LWHA 1GW1A 4HMEA 3TP4A 2WMGA 3IJ7A 2QPSA 4HOXA 8CGTA 3NSXA 3PTMA 1J0ZA 3LPOA 4J3SA 1Q6EA 4TVDA 1KBKA 1QHOA 4AC1X 3L4TA 4XZBA 1E70M 1MW0A 1KXVA 4M81A 5IXEA 4E4PA 4HA3A 5HNNA 3SCNA 3SUTA 1D7FA 3WH9A 5JUVA 1HKKA 1WAWA 1DWJM 2C8NA 1PBGA 2ZX7A 1V3LA 4H7VA 4QLLA 1JZ7A 1PZ3A 2J77A 5LYRA 2JE8A 2OWWA 1WKYA 5D8WA 1XSKA 4PMOA 1V3HA 1CXKA 4AZ5A 3GNPA 3AJ7A 5FD0A 3N17A 4UFMA 4UR9A 2FDMA 3QR3A 2EPKX 4DUWA 5EB8A 3MV01 5CPSA 4CD8A 2J8FA 1WZLA 1V0KA 2EJ1A 2WBKA 1ISXA 1CWYA 4F66A 3FAWA 2V5CA 3HJEA 5ABGA 1XSIA 4M1RA 3VIGA 2AMGA 1OBAA 4TUFA 5HOSA 4ZEPA 3VGEA 1OIFA 3DHUA 4M24A 2PI6A 3GH5A 4CN6A 3WNKA 2OWCA 1GHSA 3VD4A 3OG2A 2E9LA 3PBGA 5JBDA 3VPLA 1SMDA 2PWHA 2PWDA 1E9LA 3MV11 1VF8A 5AY7A 1UH4A 1VFUA 1JL8A 2YA2A 2VCCA 3T08A 1JXKA 1NH6A 2DDXA 1XV8A 3WUEA 2CKRA 3GBDA 4ATWA 2VNCA 3FY1A 4V27A 1J01A 4GI8A 1E4IA 2DH3A 2YJQA 1DWFM 1VFFA 1JD9A 1LL6A 3VNZA 1CEOA 1NOWA 2TAAA 1UG6A 2PC8A 2ZWYA 1Q6DA 1O7AA 3PN8A 4WF7A 1TG7A 2W66A 2Y24A 2XIIA 1C3FA 2YOCA 4DUXA 3CHEA 2W5FA 3K8MA 1W9UA 3QOKA 1EXPA 2E9BA 2GDVA 1FH9A 1H1NA 3NDYA 4U5IA 3WQ5A 1B3XA 1CXHA 3AMLA 2J78A 1EGZA 2VJXA 4AYSA 1KCKA 4GO9A 1H49A 4HU8A 2J8GA 4PRWA 2A3AA 1OGSA 2XSAA 1G1YA 3I3EA 1V08A 3W38A 1NOFA 1UR0A 3BH4A 2A3CA 5I0DA 3UCQA 3T0BA 2WMIB 1BF2A 5EFFA 4FMVA 1L8NA 1B1YA 1GOOA 1KGWA 2YA1A 3MU7A 1BPLB 4EK7A 1E4LA 2BY0A 4F9JA 2EPNA 2ZX9A 3T0DA 1N82A 1JZ3A 1X1NA 1QPKA 3AXXA 4CU8A 1A3HA 4PCTA 4TTUA 2CITA 3DYOA 5E6YA 1AQHA 3VM7A 2DSKA 3GYCA 1ESWA 3WNPA 1MQPA 2XUCA 5D8ZA 2XVPA 4Z2GA 2VX6A 1W3JA 4KWUA 1CIUA 4OUEA 5A8PA 1JZ5A 3VIFA 3AHXA 1BTCA 2WVVB 3HMCA 4EANA 3NSNA 1BG9A 1ZBKA 1E5NA 1W32A 3WBAA 1UWIA 1IT0A 5I23A 4ML4A 4NRRA 2VL4A 4AZIA 5A3HA 4JL2A 1WB0A 5JIWA 1V6WA 4OBRA 3GXIA 3CZGA 1W9PA 3OZPA 1ITCA 3ARWA 3GNRA 2FHFA 1JDCA 4CCCA 2YL8A 5CXPA 3I3BA 2WC3A 2G3IA 3VX1A 1W1VA 2PWGA 4IM4A 1BLIA 3JUGA 3PZGA 1LG2A 1UD2A 3OZOA 1MWOA 4FLQA 1GOKA 1C7TA 4FLOA 4XUYA 5E0FA 1MXGA 1V02E 3L4XA 3SUUA 3N18A 4F9DA 3A4XA 1KXHA 3RM9A 2CNCA 1GONA 2JEPA 4MNLA 1DTUA 1KXTA 4GKLA 1UKOA 2J47A 3U5UA 3VILA 1ODUA 4JKMA 4ATLA 5CLWA 3WF1A 1VENA 4DWSC 3W6LA 1H11A 2DIEA 5IHSA 3ZT5A 4ACYA 2V3GA 1PJ9A 3I3DA 3W6MA 4ZE5A 4AEFA 1ZBWA 2VZUA 4YPJA 5FCZA 2WC7A 1G01A 1OGGA 3PZVA 2XFRA 1JYWA 1OD8A 3GH4A 3TOPA 4F8XA 1XH2A 2C7FA 3DECA 3W4RA 5DT5A 5DF0A 1TUXA 1XC6A 2VRQA 3OIHA 2YL9A 5A6MA 5A2BA 1KCLA 2VUYA 5A8QA 3CHCA 5A6BA 4UQ9A 4AZCB 3CO4A 4P8UA 3PZOA 4ZXLA 1CXEA 3L4VA 4RE4A 4MTVA 2WK2A 1HJWA 1HL9A 3UEQA 2XJ7A 3WD1A 3SUVA 1H0IA 3SUSA 1LF1A 1PX3A 2XFFA 1PPIA 3AMGA 1G0CA 2WXDM 3WUGA 5HBFA 1LL4A 4NZCA 1ISYA 4BQ3A 2D0FA 4GINA 3CZJA 1MQRA 3KL0A 2UY2A 2DSWA 3OLGA 2WVUA 3W81A 5CPTA 3N1AA 1GUVA 2V3EA 4W89A 1UKPA 2WPGA 2X8RA 3IK2A 4U31A 5D9MA 2VX5A 5I6SA 1C8QA 4UZUA 3K4AA 2G8ZA 2YL6A 3IJ8A 3T2QA 4TX6A 1DP0A 4Z2JA 1SMAA 4PUEA 4E8DA 4ZE4A 2FGLA 1GJUA 1JZ4A 2AAAA 4LYQA 4M82A 1HVXA 4C7DA 1LWJA 1UR8A 3MUAA 1HP4A 3ZJ8A 2YBUA 2BS9A 4WJXA 1H4PA 1J0IA 1QNQA 2XTKA 3CMJA 4U3CA 3GTNA 3AOFA 4CD7A 1WZMA 3GXMA 4PN2A 3ARZA 4WK9A 3EDDA 3WQ4A 2ZE0A 5ABHA 3A6OA 1W1YA 1K9FA 3N9KA 3WQ6A 2WVTA 1FOBA 1C92A 3N11A 3BAJA 1CNVA 1VEPA 4MB4A 1EO5A 3CLWA 1UD5A 4FLRA 1G5AA 2QPUA 2XVNA 2OYLA 1VBRA 4KRTA 4JFWA 1GVYA 5TD4A 1TFVA 4H2CA 1JYXA 3D3AA 2BXYA 2ZXBA 1IZKA 5A2CA 2D24A 2X0HA 5BXSA 1UWRA 4E8CA 4PMVA 2DSVA 4UFJA 2WKGA 2DGAA 5CZKA 7A3HA 3ZIZA 3O6AA 4W84A 3ARXA 2B31A 1FHLA 4HPHA 4Y7EA 1C8YA 2BHUA 4R27A 2D3NA 4AZGA 3W26A 3G6LA 1V0NA 5JBEA 1AMYA 1E1EA 4UQAA 3UETA 3EMZA 4PUDA 5E70A 4AY1A 3GH7A 4LYRA 2OWXA 1UA7A 1OB0A 1Q4NX 2VC9A 5BRPA 1WDSA 5AYBA 4J3UA 2WLZA 4OBSA 1FFQA 4PMRA 3GDBA 1PIGA 5HPOA 1BYDA 4JFTA 3EMQA 1MW1A 2VQUA 1US2A 1CPUA 3EYPA 3VINA 1FH7A 1O6IA 1ZJAA 3FHAA 3GBEA 4CUCA 1KR0A 3SCPA 1D3CA 1E6SM 1E0WA 3W0KA 1KGXA 1WDRA 3K8KA 2DSZA 3MUIA 2ZUTA 7TAAA 2CXGA 3CTTA 2WWDA 1CGXA 1TMQA 4W8BA 1HX0A 5CSUA 3WMBA 2WMFA 1M01A 1HJQA 3VIKA 4FK9A 1JYVA 4AD1A 3POHA 3FW6A 3AISA 2WMJA 3CZKA 3L2LA 1C7SA 4UQBA 1LLOA 3TTYA 2CHNA 4AD0A 4HZ8A 2W92A 3CZ8A 1E15A 1US3A 2W63A 2ZXDA 3DYMA 2J7CA 1W3KA 1G94A 4ZXOA 3WKZA 5CLTA 3AXHA 1NOUA 3WENA 4LQ1A 3CBWA 3AZTA 2WW5A 1QI2A 3MUZ1 3TTOA 3VDAA 1KWGA 1R85A 2YLLA 5A8MA 3CUJA 3ARVA 1FA2A 1KBBA 3BMVA 2CPUA 5D9NA 1E0XA 4D72A 3CH9A 3KE0A 1XCWA 3EMCA 4JIEA 1CGYA 2V38A 3M7SA 4B3LA 1CBGA 2XVGA 2WMIA 5I3DA 1BYBA 3B9DA 3EDKA 4OZOA 5GPRA 3CUGA 1VEMA 2Y8VA 2PF0A 5E6ZA 4BA0A 4JCLA 3BAIA 4BQ2A 1JNEA 3TA9A 1E1FA 1MW3A 4HOWA 4Q7NA 1UR2A 1ZJBA 3PZ9A 3W53A 3VIHA 1TE1A 1B90A 4A4AA 1UZ4A 4ZENA 1GORA 3NYDA 1GQKA 1QW9A 1WDQA 4AW7A 4AISA 4B15A 1WZKA 1E6QM 3AYRA 1QNRA 2E8ZA 2OSWA 3W28A 2NW0A 5JH8A 4GI9A 4J7RA 4L4OA 1HNYA 3A47A 4HA1A 1C91A 5DO8A 2JF6A 4WLCA 2PB1A 5BXTA 3ALGA 3AIEA 3G6MA 1TVNA 4P8XA 2E40A 4AXNA 4NSBA 1GHRA 1G9HA 3AS0A 1I75A 4PMNA 4BQ5A 1E6ZA 5A1AA 4MDPA 1U2YA 2CIPA 4OKDA 5E9AA 5I2UA 1XYZA 1VRXA 2ZUUA 1GOMA 5HXMA 4UFKA 4BF7A 2IUZA 3AIWA 5C8BB 3ZR6A 1J12A
chains in the Genus database with same CATH superfamily
3B0UX 3IJIA 3N4FA 2Z0IA 3MP5A 4AWTA 4NT0A 2Y5EA 1NDVA 1X1ZA 2QPXA 4RDZA 1I2OA 3CIVA 4BS0A 1YNYA 3NG3A 3RGCA 4ILSA 4QRNA 4DUOA 2CFFA 3WQCA 4ZODA 5DRCA 2QDGA 2VR4A 3J7HA 1T0OA 2JIEA 1J5TA 4DJEC 4DBEA 1U30A 1VFSA 1FVPA 4JTDA 1UKQA 4PMZA 3ZSSA 1AMKA 3CUXA 4CNOA 3CPGA 4WJEA 3BAYA 1QOQA 1QCWA 4D9PA 2YCIX 2Q02A 4BCEA 3SRKA 4KRZA 4LYPA 4NNAA 5A6JA 3KTCA 5I06A 4PCFA 1ISVA 4H9MA 2ZRXA 3QH2A 2WNZA 3ZLHA 3TN5A 1SFJA 4PRRA 3WMLA 1GKQA 4LVGA 4A8LA 1OFPA 1R7AA 1Q5MA 2V30A 1ZL1A 3P0XA 4I7WA 1VPXA 3GAKA 3RN6A 3TTSA 1HKMA 3K13A 4QHRA 3PB2A 2BY1A 1HJXA 3UI4A 1TA3A 4IJRA 3M6YA 1OFBA 3PSWA 1XUZA 3SIMA 3UXAA 3QQWA 1Y5WA 1EDTA 1BKFA 3ARQA 4ACZB 4S3FA 4GG9A 4YTTA 5FAGA 2ATMA 4PTWA 3MP4A 5D4YA 1X38A 4XO6A 2YKKA 2VCAA 3WN6A 4D6JA 4YYCA 1MQQA 3LQLA 4UTFA 3VI2A 3LS9A 2R94A 4JAWA 1OFRA 1EC7A 1TTQA 1GZ1A 1H5YA 2L2SA 3W2JA 4M6QA 4AWSA 4JIQA 3ISIX 5AHIA 4IUGA 2FPTA 5DMNA 2OSYA 3B9EA 2NXIA 3WDHA 2JKPA 3UJFA 4ERGA 5PTDA 4D6IA 4PZVA 3TVAA 3VGHA 4ATDA 4A6GA 4M56A 4DRMA 1ZS2A 4UFLA 3VNJA 3ALFA 3PVFA 1I8JA 3GR8A 3V4BA 3ZZ1A 1EP2A 2C91A 3G1VA 4WSKA 1XBZA 3RPTA 1JZ6A 2VN1A 1OX6A 1EWDA 1TPFA 1CB2A 4YVVA 4GZEA 3NURA 2GSJA 4TV6A 2X05A 4FB7A 3KL3A 4XBJA 2EHHA 4L9YA 1XGZA 1KFLA 4PMQA 5D38A 4TU1A 1XL9A 4GGHA 3IAQA 2ESCA 2XH4A 1E56A 2C71A 3W23A 1TWSA 4NIRA 2Y4SA 3C0SA 5HA7A 4FS9A 4TVCA 1KA9F 3HURA 2MANA 5DLCA 1N8IA 3W22A 4NUWA 4DWSB 4GUGA 4L1XA 3S6DA 4ZQCA 2PEVA 4Q3MA 5HNUA 2QCLA 5I03A 1GWJA 3WH0A 2Z28A 3SW6A 3HGRA 8XIAA 1X7FA 1XXXA 2P8BA 3MSGA 4TIMA 3KBNA 3PUGA 2I5QA 1U33A 4FOKA 3TROA 1JPDX 5DMYA 3CZEA 1VIWA 3NFUA 3FS2A 4IP5A 3PWGA 5CPQA 2P5NA 1K77A 2SFPA 3TV8A 1OC5A 3TH6A 5IDZA 3B0PA 3K8LA 3HFTA 3WDIA 2M1IA 4FR1A 1R7OA 1A5BA 3F4VA 1QASA 3NA8A 3R79A 6ENLA 2BLEA 2LJ4A 2QVHA 3G0SA 3VGGA 3VO0A 4ZFCA 1NF0A 3OEXA 5CJ5A 2QIIA 1EOKA 1R2RA 3W7EA 3OBKA 4JDBA 5REQB 1T40A 4QGCA 4J2MA 4ZZ9A 3L4UA 4AEOA 1UP3A 4Q6XA 2R82A 3PZTA 1XYFA 3AIVA 1FWGC 2WVSA 3NTPA 3S5ZA 3BJTA 3UW6A 3EX4A 4Q33A 3GUWA 3BTNA 5BXRA 2AWGA 4R3UA 1S38A 2VWTA 3GR7A 4LUYA 3RK8A 2GJPA 3UG3A 2ZZ6A 4DRJA 4L6HA 3HG2A 1MXDA 1K9TA 1H7PA 3WDJA 3KWXA 1HFBA 2L5HA 4BEQA 4FHAA 3W37A 4TOQA 3DC8A 5H6HA 1V03A 4AU0A 2XN2A 4F79A 5T26A 1TZ9A 4U85A 3O2LA 3BW2A 4UTHA 1Y0OA 2VOTA 4XV0A 5AECA 5HQMA 3S2NA 1V77A 4D6EA 3CB3A 3TQPA 3VOFA 3LERA 1RY0A 3H7VA 2REQA 3POCA 4BY3A 2DQWA 3TLLA 2DH2A 4HN8A 2KGJA 4XUGA 5FL0A 1JR1A 3B7XA 1H09A 1WDPA 1EF2A 4JTIA 5DCEA 1XISA 3W1QA 4IL0A 1JDEA 3CQIA 1W5OA 4RZ4A 3B06A 3JVAA 4TQTA 3AS1A 4A22A 1WPCA 3O5QA 4Q7IA 4YTQA 3H2OA 3N4AA 1FFRA 2PWUA 2QJJA 4F0RA 3M6DA 1BTMA 3GHRA 1UZDA 2CW6A 3NZ1A 4PUWA 4B9YA 4ODOA 2J7HA 3UWZA 1B3WA 3EWXA 1VIZA 2QMJA 4ZOEA 3BLKA 4HZ7A 1R3TA 4HVXA 1XH1A 1TPC1 1LZOA 1CB7B 3WEOA 1F6PA 5AC5A 4AD4A 1QNSA 3USBA 1Z69A 1CGWA 3QZAA 3T0CA 2PODA 1ZAIA 4IGSA 1J10A 1CENA 2DT1A 3CV6A 2VZOA 2X1IA 3NQ7A 1TX2A 3C2YA 5I5RA 3ARUA 4OOUA 4FAPA 2YDRA 3EA3A 4Z2IA 1I2RA 1MZHA 1X6UA 3IRDA 1J0HA 1R87A 2EJAA 1HTIA 2XSBA 5AHFA 4MM1A 3AC0A 1XGDA 4KF1A 1EJUC 4EPEC 4XBKA 3KTSA 1UKSA 4HMDA 4KH2A 3RPDA 2WCSA 4IP7A 1K6AA 4IIFA 4IIEA 1UQYA 4YLWA 1VB9A 1Q6CA 2WMHA 4ZO8A 3O5DA 1CXFA 3PY2A 3E2RA 4HA4A 1KR1A 2MLZA 3H4WA 3O5KA 3B8UA 2VFDA 3KZSA 3BCDA 2XIBA 5AVNA 4OTKA 3WH8A 5B80A 2Y0FA 3W3OA 3WFLA 1IEWA 3MMWA 3DKJA 4N9CA 1RP9A 4HHPA 2RURA 9XIMA 3K4WA 3IWPA 4W4QA 1TRDA 3VNDA 4JIIX 4LALA 1MW2A 1IQ8A 1E71M 4O4VA 4JKLA 3MZNA 3P8IA 2DORA 3H53A 3TK7A 5ABEA 1NELA 1R8LA 1DHKA 1P0KA 6A3HA 2OZTA 2V5DA 4ACZA 2XP7A 5E9XA 2OQHA 5I3IA 1V3IA 1GOWA 2BOGX 3WF4A 2O9TA 5AZ0A 4U10A 2PDBA 2MLYA 4EKJA 3DN5A 1XLLA 1HQTA 2VI0A 1OGBA 1MUWA 3HMJG 1G4PA 2YDQA 3THCA 1CLVA 4QQ3A 1UH2A 2J62A 3WCZA 1BGGA 1K3UA 1QI3A 1EJWC 4Z1BA 3UPWA 1DJQA 4Y9NA 1XD1A 4O1EA 1LOSA 3S1WA 3WF2A 2IKGA 3E02A 3F5LA 3LBOA 1UYQA 5HWJA 3RF9A 1IGWA 4CNPA 4XB3A 3MMDA 5HTGA 2PBOA 2HS8A 3GC5A 1IEXA 4AD5A 2AAMA 3N2BA 4D6CA 2WBGA 3SEPA 1VPYA 3VGBA 1KW1A 1BYAA 1RALA 2VFGA 1SW7A 1JDAA 1R3RA 4QBXA 1KFBA 4RW3A 5A6TC 1TWDA 4LY4A 3I7RA 3DG6A 1TTJA 3NUKA 4QCFA 1NP0A 2I17A 3OA5A 1IR2A 3P60A 1S3TC 1VBJA 4DWSA 4US5D 3VNKA 3N6JA 4W9QA 3WDQA 1VFLA 1ONRA 1V3KA 2P76A 4XSMA 2UWFA 3TE9A 4I9AA 4GQGA 1GCYA 4J3WA 3KBWA 3GG1A 2YFNA 2WO5A 4NXKA 5DANA 5CZJA 5BU9A 4U2YA 5A95A 5M03A 4K7VA 1DIDA 1WBHA 4GUIA 2ZX5A 3IK8A 2WCAA 2HVMA 2GVEA 5HQLA 1NFBA 3S6TA 4Q8UA 5EGRA 2XVKA 3WNLA 3DFSA 1KM6A 2D22A 4S3CA 3AMCA 4UUIA 2QCDB 3E2VA 3S1XA 4TTGA 4ZOAA 5AYXA 2W62A 5G1MA 2BY3A 3VE7A 4NI3A 4WX2A 3NJ3A 1RPKA 4LX4A 4MF4A 3I68A 5REQA 1LQ0A 4B4HA 1N2VA 3W1TA 4XD6A 5C9RA 3KCLA 3RITA 5C7VA 3EOEA 3AIUA 2HBXA 2PE4A 2GUYA 4PCPA 2OCZA 4JEQA 4DRSA 4C7FA 3L68A 4KRUA 1RCOB 4HNCA 4O4WA 3DGRA 3REQB 2YIHA 3PUEA 1CYGA 2A6LA 3W7PA 4MSPA 4WUIA 2JFEX 5IDIA 3ZVHB 5J5RA 2WOQA 2IKJA 3N9RA 2BVTA 2GQAA 3GR4A 3N34A 4DT4A 1TVPA 3F03K 2XP3A 2TPSA 1Z7AA 3L4WA 4K3ZA 1UWSA 4MIMA 4JFMA 4I7UA 4NRSA 4O15A 4FIQA 3SCUA 3KABA 2NV1A 1DWAM 3D6NA 1P6CA 4G9PA 1H5VA 4HHMA 1QI5A 2J7FA 1JF5A 3LOTA 2ZC8A 5BCAA 1MO0A 1FWCC 1Q7QA 5CG7A 3INPA 5M17A 1ZU8A 4ZFMA 4PMUA 3U7VA 2Z2BA 4UB9A 2BASA 1JRCA 3BK0A 3LXBA 5A6SA 4ZTXA 2Z1KA 5CEWA 1PS9A 2PLJA 1XGEA 3QV8A 3DGBA 1RBOB 3IJLA 4YWSA 1ZENA 1WZAA 5GJMA 2PPGA 3RJYA 4LOCA 3TR9A 2ZR6A 1ELSA 2DZPA 2GGGA 4NY2A 4GC3A 3TYZA 3WLHA 3SURA 1TV3A 2OFJA 3IJ9A 5D05A 4E2BA 3OLIA 4CN4A 4NILA 4W86A 4Q8OA 1WP6A 1N7KA 1B6CA 1V3JA 2P0IA 1KD0A 2W67A 3S47A 5SWUA 1GKRA 3VK5A 2J25A 3N13A 4GE8A 4IGHA 3KZPA 3HG3A 1W8GA 3FSUA 3HOJA 1V02A 1W1A1 2G41A 5H8UA 1PKMA 4S3BA 2PF8A 3PS7A 3A9IA 3PHAA 3G1DA 4ODLA 4J4KA 4AIBA 1H41A 4Y8FA 4U2ZA 1RCQA 1D7IA 1U1JA 5I24A 3G8EA 1RV8A 1H7OA 4WXZA 3OGSA 4DZ3A 1TIWA 2VO5A 3JYJA 1OCQA 1FWTA 2PBCA 2WM1A 2ZIDA 1F6KA 4PSRA 1OWQA 4LCQA 4LXFA 3QYQA 3W87A 2HROA 2EPMX 1JI2A 1R3SA 1SVDA 7PTDA 3AROA 3M5VA 3DOPA 3NPVA 1OIMA 3MWAA 4MLRA 3SCQA 3K4DA 4AVNA 3I4EA 5FOOA 4G50A 2PDIA 1AW5A 4Q32A 4L4PA 3R94A 3U57A 1S2VA 1CTNA 1V4YA 2WSQA 3E96A 4NZ1A 4MY1A 4S3GA 2PAJA 1XWYA 2QJGA 4NYUA 3OLDA 1IV8A 4PTVA 2VEPA 2W27A 1TO3A 2KE0A 3ZVIA 5CPMA 4NVTA 4QP0A 4YJ5A 5BROA 1YPIA 1C8XA 3KS6A 1YQ2A 4JYFA 3OP2A 1OFOA 4MAZA 1Q6LA 3MJMA 1BWVA 1SUXA 2UZ5A 5M3WA 2PN0A 3VKDA 4Z0SA 3PRBA 4UOJA 1UWQA 2QUMA 4YXGA 3CO8A 3DFOA 3LN3A 4KIEA 2XG9A 3AALA 1E6NA 1N1AA 5AC4A 3MB9A 4CQBA 1TPUA 3AI0A 1XICA 3UD6A 1JGIA 3QV9A 3WLLA 2QVNA 3BLPX 4ICMA 2EKGA 4FNUA 5I79A 2BNJA 4RNFA 5T91A 1VJIA 2RGMA 2QUUA 4TMBA 4E3TA 3WLOA 2OEKA 4ERAA 2QUNA 2WB5A 1QJWA 5K4ZA 3SI9A 1VQTA 3STPA 1OM0A 3MMTA 4NI8A 4KERA 3KS5A 1J8VA 2ZWZA 1JZ8A 1KRAC 4Y6GA 2Z4GA 3QHMA 3WBYA 4ZPWR 2VZVA 1NARA 1V51A 1O12A 1QI4A 2WJEA 3AIBA 2FTPA 2CYGA 2VFFA 3VTRA 2JALA 5DY2A 2QF8A 1VFTA 2OOFA 3V36A 3ZO9A 4H9TA 2HK0A 4ZPTR 5DQPA 2H90A 2ZC1A 9CGTA 4L6DA 1BKHA 4H4IA 1U5VA 4XTDA 1BGAA 1XX1A 1MI3A 4U86A 2WYSA 2GZXA 2PD9A 5CSSA 1E73M 1ZBVA 4FIRA 4DAIA 1C90A 3S2JA 1A5NC 1PZ2A 4GFIA 4PCNA 3B9AA 1LLZA 3F4CA 3TXZA 4DO7A 1X8CA 2YGYA 1PYMA 2FZNA 3BSHA 1TTPA 3UYCA 2PTWA 2Q3OA 4E2VA 4L4LA 1GW1A 4KWOA 3XIMA 1Q8JA 1FUYA 3NSXA 1HL2A 5LZLA 3KAOA 1Q6EA 3HPZA 4NL1A 4TVDA 1SSDA 3KDOA 2ATSA 3PULA 1KXVA 2X30A 2QCDA 4KT2A 4RPQA 1QK0A 3SRDA 5IXEA 4E4PA 3SUTA 3SQMA 3U2OA 4IICA 1D7FA 3UGRA 1QWGA 5JUVA 1DWJM 1HXVA 4HMNA 4KFPA 4US6A 1PBGA 1Q2SA 1W56A 2JE8A 2C1HA 1WKYA 5D8WA 1XSKA 1V3HA 1QR7A 2OX4A 2VEFA 4QSHA 1P43A 1AW1A 3GNPA 2QNEA 3N17A 3QFWA 2FDMA 3RG6A 5L9FA 3D46A 1WZLA 1V0KA 1U5HA 3PNZA 4GD0A 2EJ1A 3FAWA 4AY7A 1OFQA 2NQHA 3ZVHA 3K2GA 1OCJA 4GKTA 4PFHA 3GIYA 3GH5A 4MWAD 2PMQA 2E9LA 1FDYA 7REQB 4EWND 3R11A 3EB3A 1I2PA 4QJ3B 3W1RA 1JXKA 4X61A 3W1UA 2DDXA 5TQLA 1AJ0A 4MKSA 4C6CA 4H1ZA 3FY1A 3MBFA 3RU8X 3SY8A 4GNKB 5CGQA 4GI8A 2DH3A 2YJQA 3T4WA 1JD9A 1LL6A 1CEOA 4H6KA 3GHSA 5FJOA 4IOTA 1YLVA 1A3XA 3PN8A 4Q6JA 2M08A 4JTQA 3N2TA 1AW2A 4DXXA 1C3FA 4YWIA 3H54A 3W7CA 2HMCA 1Q6OA 3BW4A 1SFLA 3NDYA 4GX9A 1B3XA 5F2IA 5KSWA 4A05A 1CI1A 1OC7A 4GO9A 4KFOA 2FPYA 3TWAA 4ASTA 3VOJA 1SZRA 5LSMA 4PRWA 2PTXA 1E9IA 1F7BA 4L7ZA 1G1YA 1ONWA 3W38A 3I10A 3MW7A 2A3CA 3UCQA 3T0BA 2WMIB 1VZWA 2CZDA 5EFFA 4FMVA 2JKAA 2AMXA 4QEEA 1BPLB 3C0QA 1SGJA 3P7YA 2J88A 3NTYA 3W7JA 1ZCNA 4E4FA 3LBMA 3RCMA 4DZIA 2BY0A 2EPNA 2FKEA 4XZLX 1QPKA 4MJZA 3AXXA 2EAWA 4PCTA 2NUYA 4RLIA 3IJDA 1TPH1 3T78A 4ODKA 5F4WA 1Q7ZA 3WNPA 1NIUA 2VC6A 3LTSA 1Q45A 3PPCA 3M0LA 1GEHA 3G77A 3FAPA 3TAKA 1UJPA 1X1OA 1MDLA 3VIFA 4KCVA 3M5YA 3AHXA 2WVVB 2DZVA 3RLVA 3WLNA 2R14A 5FJIA 3UZWA 4Q8QA 1E5NA 4O0ZA 2DP3A 4DRKA 3W88A 1UWIA 1IT0A 4NX0A 1ZQ5A 2CC0A 5D32A 4NRRA 2Z6IA 2WNNA 3GG0A 5A3HA 3M5ZA 1ZY9A 1W9PA 3OZPA 3UY8A 3GNRA 1R3YA 2FHFA 4IT4A 4CCCA 1KRMA 1VCVA 3G8RA 3LRMA 1A4MA 1P0NA 2A6NA 3VX1A 4UMCA 1W1VA 4IM4A 1FD9A 4IX2A 2RUQA 1RK5A 4X60A 1MWOA 2KFWA 1GOKA 3WLJA 3BLOA 4FEZA 3GVVA 4KWWA 2VOMA 4F9DA 3PK7A 3V0TA 5ECVA 1KXHA 3RM9A 2FMNA 5FSEC 2JEPA 4I9JA 4MZ8A 4LBUA 3UNDA 2GJNA 4GYFA 4IJCA 5HMDA 1S1PA 2BOFX 2Y70A 2CLIA 4XAFA 4ATLA 3MHUA 4GJ1A 3SM0A 5LNSA 3ZT5A 4QJ5B 3EX6A 2DY3A 4IQDA 4ZE5A 3T81A 2XN1A 2CXEA 4YPJA 3ANVA 2V63A 3WO8A 1OD8A 3TOPA 1XH2A 2C7FA 1Z6KA 3DECA 4G6CA 4XZNX 5DT5A 5DF0A 1EF3A 3VE9A 5A2BA 1KCLA 1AH3A 1DBTA 1OYAA 2PV2A 1NSGA 4AZCB 4US5A 3CO4A 3PZOA 4RW5A 2PDCA 4RE4A 3S4TA 1HG3A 4S3DA 4A8IA 3PJWA 5A5WA 3JYMA 3FYOA 1UC5A 3O15A 3SUVA 5HWBA 3SUSA 4KQNA 3NL2A 4H7ZA 2HNHA 3NO1A 1HO1A 3C0JA 3AMGA 4LVBA 3TCZA 1XLEA 5CBBA 4QEHA 4JN6A 3UVAA 1EEPA 3WUGA 4NZCA 3CT7A 5B8IC 2D0FA 3CZJA 4DRHA 2DVTA 3P5YA 4F40A 5HW7A 1RCXB 2UY2A 3P6LA 1O94A 1LBMA 2PDNA 3N1AA 4W89A 2X8RA 3PBYA 4B2DD 4DRPA 1TTIA 6ALDA 1R3WA 5KZEA 2VD8A 3Q2DA 3K4AA 2X1SA 3KX6A 3CGNA 3NQFA 3APYA 4E8DA 3TWBA 2FGLA 2RUSA 3HB9A 4LYQA 4M82A 1QAPA 1OCBA 4C7DA 3MUAA 4A8NA 1HP4A 2ZCGA 4LUTB 1NMVA 4V1XA 5IRPA 4WJXA 1H4PA 2GQ9A 3LYEA 2E28A 1QNQA 3M7WA 3WLRA 3GTNA 1KBIA 1WZMA 3GXMA 3URQA 1YX1A 3ARZA 3EDDA 3A6OA 3N9KA 5CH9A 2WVTA 1PZ1A 3CV2A 3UYIA 5C7HA 1P1MA 1OC6A 1VEPA 1QPFA 3JZEA 3I7QA 1UD5A 4NKCA 4G1KA 3W2LA 2OYLA 4CQAA 1K8CA 3PAOA 2GUBA 3V7PA 2CZFA 2WPBA 4M5PA 1YIXA 4MYXA 4TV5A 4N6FA 1S3HA 1PWLA 4JD4A 4GACA 4PMVA 4H00A 4TW6A 3SN0A 3EEGA 1L9WA 4ZR8A 1U83A 4GBUA 2Y5JA 4H19A 4Y7EA 2ZRVA 3QSTA 2KZHA 5JBEA 1E1EA 3MHGA 1ADOA 4AY1A 2OWXA 4BI6A 3TU9A 1UOZA 5D75A 3EIPA 2VR2A 2MPHA 1WDSA 4J3UA 2WLZA 1FFQA 2RAGA 4AC7C 1SZEA 5LIUX 1TVLA 3K30A 1RLDA 1BYDA 2P10A 2TODA 4Q4OA 7REQA 3UGVA 1MW1A 3LNPA 5CKSA 3S83A 3KBJA 3RRAA 5HKGA 2A2IA 1FH7A 2E6YA 1ZJAA 4CUCA 3GBEA 2VYOA 1T96A 3NEVA 3SCPA 1D3CA 2PFHA 4JNMA 1KGXA 2OZ0A 2DSZA 3MUIA 2ZUTA 1TB3A 1TMHA 4C6IA 2WWDA 4LAKA 1CGXA 4AX7A 4W8BA 4MY8A 3UWWA 5CSUA 1DOSA 2DUXA 2WMFA 4PMJA 3GTYX 3VIKA 3OYZA 1KLZA 4DBSA 3P93A 3WLPA 1JYVA 4ONVA 4QROA 2CZEA 1PTAA 1KTBA 1JQVA 1P4CA 3OHIA 4HZ8A 4Z17A 2HCVA 2W92A 3CZ8A 1E15A 3L66A 5F2MA 2ZA3A 2PDQA 1LOLA 1FWBC 1FDZA 2Z7GA 4NX5A 1G94A 1WYIA 4XZMX 2D2HA 2HQAA 3AXHA 4YVPA 1VD6A 3AZTA 2WW5A 3TTOA 3EWDA 3TLQA 2A5HA 1R85A 1O66A 3S1GA 1KBBA 2CPUA 3DFQA 2YBVA 4GK8A 3CH9A 3VDGA 3KE0A 1EL3A 1CGYA 1OK6A 3T44A 2WMIA 3C2VA 2BZNA 1KC7A 5GPRA 1VEMA 3UJSA 3LMZA 1XIJA 3CEUA 2NV9A 2HJPA 1KNWA 3BAIA 3LENA 1J4IA 1XBYA 4AYGA 4Q7NA 3IV3A 2ZVRA 3NPUA 9RUBA 1JULA 4JFKA 3ITTA 2I9UA 1VC4A 3LLXA 3SADA 1QK2A 3NYDA 5FF4A 3C3NA 1FKRA 3S1UA 4AW7A 4AISA 4B15A 3AYRA 2OSWA 4PFMA 3S9ZA 1FKHA 4LNCA 2ZQTA 3G1HA 2FPVA 4HA1A 2YYUA 3OIXA 4Q8PA 3BE7A 1SR9A 4NSBA 1G9HA 4R85A 1BQGA 3AS0A 1LBLA 2Y7DA 1I75A 2YCLB 5FJPA 5A1AA 1XQKA 1U2YA 4KETA 1PVNA 1T5AA 2ACQA 5D2WA 1XYZA 5FF0A 2PA6A 3G18A 4JNZA 2QAPA 4GXWA 1J12A 1NQ6A 3GSMA 2J79A 5A6AA 2PPPA 1JI1A 3C2RA 1XHGA 1JDDA 1QNPA 1JPHA 2RQSA 3O07A 5DELA 3P67A 3XISA 2OPJA 4JTFA 1EYEA 2ONEA 4PTXA 4IPPA 1S5WA 2WZMA 2Y8UA 3QR0A 3ABSA 4M6VA 3DZ1A 3JZUA 4Y9OA 1ISZA 2OT1A 1GK8A 3W7OA 1GVOA 5FI8A 4QE4A 3BG9A 4QSFA 3M0VA 4ZO7A 3E5BA 1WNOA 1ODZA 1WKDA 2QAFA 3O63A 5JH2A 2POTA 3KP1A 4K1WA 4EXAA 1XLHA 3IIPA 2CLHA 1QNOA 4GY7A 2QCNA 1CGVA 2D0HA 3VVGA 3ZJKA 2WKJA 5I00A 3QOMA 1VS1A 1XH0A 3NI6A 4AZCA 4DVOA 4ML9A 2Y6ZA 1TQXA 6TAAA 3CYVA 3CC1A 3QMRA 1CZ1A 2UY5A 4WRHA 2EXOA 2ZFAA 3FGCB 3R89A 2VCBA 3H7RA 3ZM8A 3UWVA 4BZYA 4XIAA 4GIYA 1R86A 3VDHA 1L6GA 1W31A 1XLJA 3GTHA 4GO8A 4HPJA 3M07A 3LHYA 4D6HA 4JQ3A 2PP1A 3MCNA 2BGSA 3WK0A 1JRBA 3CM4A 2XIMA 3M0JA 5EKYA 2C13A 1VJZA 2WZIA 1I2QA 3GDKA 3CMFA 4XG1A 4TW7A 3CAWA 1NTHA 5HR6A 3VZZA 2ZUWA 4ROQA 1Y0EA 4JNYA 2GL5A 3HQ1A 4F3HA 4N7QA 3V0UA 1MDRA 4UZSA 1J4HA 1QVBA 3C8NA 3W7HA 5H8PA 1T99A 2X0YA 2WSKA 3OB8A 2WKLA 5EMKA 4WIWA 1KKOA 5DT7A 3W75A 4Y2WA 3MI2A 4O57A 3N04A 3U5YA 4G2DA 4UQDA 3VD7A 4EAMA 1QOXA 3ABOA 4DRQA 2OLSA 4HK6A 1EO7A 2Z27A 3UR8A 5CZ0A 2I57A 1TE6A 1IZJA 3H6OA 4YHGA 3PUDA 2QCGA 4DLMA 1YBQB 2GVJA 3BQ6A 4AZ6A 1GVSA 1M1BA 4DZ5A 3MI3A 3L67A 4TO8A 3PC0A 1R9ZA 4ITZA 2O55A 1X39A 1FCQA 3WLSA 3PUOA 4Q4PA 1GZJA 3KBMA 3E2SA 4PRTA 4WKHA 4LV9A 3AUOA 2H6RA 4P5UA 2GJRA 1PDZA 3NO5A 3IVUA 3TIMA 4LGXA 4N6EA 5LGZA 3KTXA 1L2QA 3N15A 3W07A 1A49A 3SCTA 1OZMA 2CEQA 1S39A 1W37A 3CWHA 1LQ2A 4EACA 2ZA1A 4XQ6A 5EA9A 4YL2A 3LHVA 1B2YA 3CGTA 1QHZA 1P48A 4KMQA 3ZMRA 1K9EA 3S6OA 3CZLA 1UPMB 4X0NA 1UBPC 3S2CA 4J1OA 5KTLA 4G7EB 1B3ZA 3G1YA 2OSXA 4JFVA 3K46A 3QQ1A 4DUVA 3L0GA 1NWTA 3CYJA 1C93A 4B5UA 2GWGA 4WR3A 4O8AA 4PMYA 1EJ7L 1DJWA 1AL8A 2HDJA 1PIFA 1M7JA 1KM4A 2DEPA 3AMDA 3FFSA 1TCMA 4ECLA 3QY7A 1UWUA 3CHVA 3N29A 3G3MA 4D8LA 1EXBA 2QR6A 3P84A 1EDGA 2PZNA 1W3LA 3VOHA 2OYMA 1TPWA 2YB1A 4AFYA 4RNJA 3PB0A 4HP5A 5HPCA 4ICNA 5JIPA 1EQ3A 5BOFA 3VKCA 4H9ZA 3APTA 2CBJA 3WQ8A 4KFNA 4OJYA 5CGTA 2ACRA 1DE5A 5JQ9A 5KZMA 2GJLA 3WIJA 5BYWA 1B3OA 3TC7A 2V8ZA 3EKZA 4X3ZA 3STCA 4S38A 3CL6A 2ZUVA 2F2KA 2AQOA 4NAEA 3LI1A 4W93A 2PDKA 2ZUNA 3UU0A 4Z42C 5FESA 3FEMA 3O5MA 1YXCA 4I5RA 1FHUA 2EPOA 4RZBA 4QE1A 3FIGA 4GRSA 5HINA 4WOZA 3NQGA 4JYDA 2E4TA 1DORA 2XGBA 5EBUA 2NSXA 1C9WA 4XX6A 3AFBA 2D2JA 3KXQA 2WMKA 2FHCA 4L65A 4DRNA 3E0LA 1FKDA 1AQMA 4W87A 3DHPA 2QV5A 2PWEA 5D09A 4RR4A 1KM2A 2Z25A 2CZ5A 1TJPA 3B8WA 3G24A 3ICJA 4WOQA 3H23A 3EB4A 3G3DA 2TRSA 4JN7A 2ZQUA 5CC7A 4IQJA 3GS6A 2CESA 2VRJA 3OVGA 3AQUA 2F21A 3VD5A 3C5QA 3W7GA 4QG8A 3FJLA 3PTQA 3EWWA 1F4AA 4RZ5A 1XIFA 3QPZA 2OODA 3M9YA 4RZ6A 2GOUA 2YCLA 4DBDA 1THFD 3Q94A 3ARRA 1TX0A 4GXMA 3UR2A 2NT1A 3B9NA 6REQB 3KZ7A 1FKTA 4UBPC 6TIMA 4FNSA 4J4OA 4LC6A 1FX6A 1FWIC 4YTSA 1KTCA 4WKFA 1A47A 2VD9A 3W29A 3GRIA 1E55A 4OGZA 2CBIA 4ZQRA 1UR9A 2VEIA 1HVQA 3WNOA 3N2CA 3SO7A 5LNRA 1WKEA 1UPPA 2WNWA 3HPXA 4FNTA 1BVNP 5AHMA 4YN5A 1B3YA 1SR0A 3GHUA 3GVQA 4PUJA 2X7WA 1UD4A 1W54A 4C90A 3SCWA 1RXOB 1P7TB 3ZOAA 3R25A 3ARPA 4GABA 1H0GA 3TN3A 1DIOA 2PLCA 4CNTA 3CPUA 1QO2A 3CIXA 3KRUA 4EE9A 1TRIA 3LPGA 3FYPA 3OQEA 2XYLA 1SZFA 2K8IA 2J7EA 4GHRA 3QM3A 4KIRA 2CKSA 1ZALA 4DN1A 1MFVA 4W5UA 3BPWA 1HZYA 1XM3A 3RLHA 2DZSA 4JX6A 3DG3A 3OBAA 1E4MM 2BVYA 2Q09A 2VFEA 3A23A 3BAWA 2E3ZA 3H2EA 3SUWA 3FGCA 4V33A 1GZGA 4CQDA 5FKYA 5D03A 4OVXA 4J27A 2G4FA 2G3NA 3ZSTA 3TW7A 2OYKA 1MNZA 4HHHA 4GH1A 3AIRA 3HM7A 3WMSA 2ZXAA 3IIVA 4MADA 4BI5A 1UB3A 2HVOA 1ROUA 4DM2A 4D1IA 1VPQA 5HMFA 1P0BA 4NJKA 4ZSUA 3UJEA 3CIWA 1DIKA 1UA3A 4U84A 5DY3A 1M04A 3B05A 1Q6IA 4FOJA 1LRQA 1EIBA 3DUGA 3AUJA 5D30A 3BXWA 1FKBA 3CUFA 3O0FA 3R10A 1J0JA 3VC6A 4E6MA 3IRSA 3APGA 3WEMA 4JEJA 3NVDA 2VZSA 1XBXA 4CNSA 2QUVA 3PF3A 1FXPA 2NX1A 3WK2A 1PX8A 2C79A 4GH3A 3SGUA 1ECEA 4KS0A 2EO7A 4O1DA 3T07A 3STEA 1YBQA 1T41A 4ZSTA 4NJHA 1A50A 4KGJA 1BHGA 2PZ0A 4OV4A 3RILA 3FYYA 3WFAA 3UR7A 3K1DA 3BZGA 3OBEA 3NQ6A 1JIBA 3WD0A 1P6WA 3W1LA 4DF0A 3CQJA 3W7RA 3ZS4A 4KCWA 1WE5A 4UQCA 3R12A 3WH6A 3DCPA 1KFEA 1YMYA 4CCDA 3MKVA 4DELA 1ECQA 3L23A 3WJSA 3KLKA 1AVAA 2P50A 3BLEA 3HGOA 3EDEA 2YYTA 2PDGA 4LUJA 1LL7A 4UQEA 4Z2HA 1XDMA 2GWNA 2OT0A 1S5NA 1G4EA 3GC4A 3N25A 2I9EA 3O0KA 2BXVA 5HR7A 1VHNA 2O92A 2R1MA 5DFAA 4V2XA 4EXBA 1L1PA 3KWSA 1DV7A 2FMOA 2J9YA 3TDBA 1JUEA 5D9OA 3UY7A 1KV8A 1EC9A 4H3DA 5HJXA 3O06A 4H8VA 1R3QA 2ZRYA 5I77A 2LKNA 4AWEA 1F6YA 1L6SA 2PDWA 2YZ5A 1NAL1 3F5KA 3ITLA 5HJYA 5FEZA 4LV4A 4C7GA 3IVTA 4LBSA 4HU0A 1YHTA 1GOIA 1A0DA 2RHGA 1MYRA 3C4UA 2X1TA 4IISA 3WMCA 4WEVX 4IPLA 4DNMA 2O4QA 4MLJA 1JXJA 3IKDA 1JAKA 1ZB5A 3TJ4A 3WQEA 4CCZA 4DBWA 1XINA 3F4DA 4HZMA 5H2ZA 1D8WA 5FF7A 4GOAA 1Y5XA 4GFSA 2IXVA 5HUOA 3VUPA 3NEHA 5DRIA 4A35A 1JF6A 4NNRA 3PBMA 5EY5A 1JD7A 4W8LA 1SZGA 4FXFA 2PDYA 1Z9AA 1Z3NA 5KEZA 4C6JA 2XIOA 2BGQA 5CJNA 3B8VA 3NZGA 3TCSA 4HOZA 2WHJA 3HPSA 1XW8A 2PTDA 2IKIA 4H41A 3TDFA 5CSYA 3QC0A 1M03A 3LU2A 4YCOA 5H91A 4IFKB 2CLFA 3LK6A 1PHWA 2D1ZA 2Y7GA 1OYBA 4LAWA 2RDTA 3C52A 3OGVA 1IXPA 4GIVA 4OT7A 4OIFA 4GY0A 3JR2A 2F6UA 4GZIA 4UWMA 2JBMA 1ML1A 2H9AA 3NQDA 5G4EA 4F4RA 4UNKA 3CNYA 3UI6A 2WJDA 2VEKA 4A2RA 5IM51 3OU8A 1LJYA 4CLMA 3ABRA 3GKAA 3MDWA 3WEZA 3G1FA 4QTGA 5LXEA 4QLKA 2OZ8A 4DJDA 2YX0A 3KOZA 4W7WA 1F73A 1UP0A 4CU7A 5E93A 4UDMA 4RNHA 1F8AB 3HPAA 4RE3A 3T0TA 1SJCA 3T2OA 2UY4A 1WUFA 2ZADA 1GJPA 1R6WA 2AL2B 1BF6A 2WM0A 3QTGA 3UVIA 1YNQA 3M5XA 4GUHA 4Q4SA 5GNZA 3O7UA 1TCDA 1DPMA 1P7TA 4FSAA 4IPXA 3CLMA 1QBBA 2I5GA 1TA3B 2XN0A 1BVZA 4RUBA 2XP5A 3W2KA 4CD6A 1QWKA 1NQKA 2DV0A 2QHAA 1Z48A 1YATA 1PX4A 1G4SA 2QS8A 2C19A 3U0HA 3UZZA 2WSYA 1MNSA 3CGMA 1OT1A 1EOMA 2W61A 5AYIA 2DT2A 2PDUA 4S3AA 1V7YA 3H2FA 3LI0A 3S0CA 5BRBA 4XAZA 3FJ4A 4B5SA 3BAXA 3NGFA 1BYCA 1H1YA 3M64A 4DBUA 2PURA 1OFDA 1YW5A 1NVMA 1BSIA 5DXYA 4C91A 4BHYA 3H2CA 3P80A 1FH8A 2DZTA 3V35A 2BFGA 1UD6A 1TR9A 2CU0A 4CQCA 2YXXA 3LMYA 3IK4A 3S1VA 3RCNA 1OFAA 2PCQA 2WJZA 2A7NA 3CEPA 4XD3A 2E5BA 1A0EA 1EBGA 4OBTA 1JCLA 3DFPA 2PGEA 1KFWA 3VM5A 1FAPA 2YDAA 4GGQA 1Y7VA 1XUUA 1H2JA 5HNRA 5HW8A 5BW6A 2C1IA 1IIGA 2CWXA 3WLIA 4O1CA 4MOZA 3R8GA 1TWZA 1QOPA 2VC7A 4AMCA 1JNDA 1QPOA 1A5LC 2Z6JA 4AHOA 3A3HA 4NXSA 4LB3A 2D23A 2Y7FA 4D6DA 5XIAA 3LCLA 3GUGA 3H21A 2Y89A 2EKCA 3A22A 2E09A 3EY6A 4UTJA 4AIEA 2ZTKA 4GQRA 3M44A 2HV5A 3NQEA 4RXFA 4CU6A 2X2YA 3EOLA 1ENUA 2Z1SA 3KADA 2FZDA 4TX9A 1PV8A 3FNDA 1FRBA 1OD0A 3OA3A 1HL8A 3UG4A 4MJ4A 1FKLA 4JQ2A 1WA3A 3TYBA 3U7BA 3A4AA 1NM9A 5JU6A 1R5YA 4Y9AA 1CXIA 1XF0A 3IAPA 4V15A 1MVYA 4MPQA 4O12A 3EWUA 1E4NA 2G97A 1RR2A 3FCPA 5LIWX 2YLAA 3L7RA 4DWSD 2EULA 5F2LA 2CHOA 5E0CA 3GQYA 3VIJA 2DUZA 4S3JA 4DJEA 4FAMA 4IGMA 5A6KA 1MEHA 4IP4A 1XR2A 1JGMA 2QJHA 2QJNA 4FX8A 3OLEA 1NEYA 1PBKA 2Q6ZA 4FZIA 1J0KA 4L5ZA 1AK5A 1UZ1A 2QKFA 1FWRA 1W2PA 4OQVA 4XAPA 1WCGA 4M80A 1OX5A 2MNRA 4A3QA 1CGUA 4RK8A 4AMAA 4Z2KA 2B81A 3GNOA 3DXIA 3WJWA 3EAUA 5TIMA 5FF2A 4KPLA 5HWMA 3S5OA 3TP4A 1TPVA 2WMGA 4OU1A 8CGTA 3LHUA 1J0ZA 3LPOA 2VGIA 4J3SA 5BU6A 1RBAA 3C3UA 1NDWA 1QHOA 5G2IA 4AC1X 4XAGA 1E70M 4M7SA 1MW0A 3BGJA 3GXPA 1OJXA 2ISFA 1WXJA 4DX3A 1KBJA 1U1HA 4M1BA 3WH9A 1MMFA 1HKKA 1AFSA 1RJQA 2JGYA 1ME9A 1XLIA 7XIMA 1YXYA 4R7OA 4DI9A 2V69A 3EX3A 1VYRA 1PZ3A 4JTCA 4S39A 1E0TA 2OWWA 4J4NA 4RJEA 4DZAA 4F2BA 5LHFA 2FZ9A 3RAOA 2PLKA 3W1NA 4D2JA 4JTEA 3QR3A 4MGGA 2EPKX 1U5JA 4QE5A 3UF9A 2WBKA 2PUZA 2E5DA 3VIGA 1FWWA 4I8DA 2AMGA 3VCCA 2FVKA 2XPAA 1R0MA 4ZEPA 1JUKA 4UMAA 3KDNA 4M24A 4J40A 5CC3A 2VP8A 4CN6A 1PZ0A 2OWCA 4D8ZA 1IEIA 1F76A 4DRIA 1SMDA 4NJIA 5LIKX 3MV11 1VF8A 5AY7A 2NQ5A 1UH4A 4IQLA 2YA2A 3BICA 1OEPA 4IFKA 4Q8MA 1ME8A 3G0XA 3QR1A 1KM0A 4C6OA 3WUEA 3SN4A 2CKRA 3GBDA 4ATWA 1E4IA 2D2GA 1M65A 1GRJA 4WGXA 6XIAA 3VC5A 3EWZA 1XS2A 2W3ZA 2ZWYA 2VGFA 2CLLA 5DMMA 3LNMA 4F2UA 2NX3A 4H6EA 4KBXA 2YOCA 1ZAJA 3K8MA 3O5FA 1W9UA 3M16A 3QOKA 2GDVA 1H1NA 4U5IA 4OWGA 3RX2A 3UQBA 3SZ8A 1EGZA 4F0KA 4O11A 2DJXA 1YPFA 4AYSA 4FF7A 3UWEA 3R13A 2FKPA 4TW8A 1EIXA 4FNPA 3HV8A 2A3AA 4MY9A 3ATZA 2XSAA 4JTTA 1W8SA 3I3EA 3TC5A 5GJNA 3DEQA 1W0MA 1UR0A 3BH4A 5I0DA 1BF2A 4MFDA 1B1YA 4I5UA 3IUHA 1KGWA 2IQ0A 2YA1A 4P2VA 3TQ0A 1E4LA 4F9JA 4MWAE 2AL2A 4HK5A 1F8MA 3MDYB 3ODKA 1OQFA 4CU8A 1A3HA 2CITA 5E6YA 2VGBA 3K1GA 3S42A 5KITA 4K8HA 5AB3A 2DSKA 4IUOA 1ESWA 1XIHA 4TYOA 1N55A 1MQPA 3GLCA 5D8ZA 3UCCA 4Z2GA 2VX6A 4H9YA 2OOGA 1Q66A 1W3JA 4KWUA 1CIUA 5A8PA 4C6MA 3O6DA 1EP3A 2Q3RA 3QZ6A 1KRBC 4JQ1A 1D9EA 1BG9A 1F3TA 1ZBKA 1W32A 3WBAA 4R33A 1HKVA 2E67A 4WHBA 5HUAA 4ML4A 2PLMA 2PS2A 4M51A 1UZHA 4JL2A 4TNSA 4RE0A 1CLKA 1PUDA 3GTIA 4OBRA 4X2PA 3OVRA 1ITCA 3SY5A 4YIWA 3WX7A 5BZAA 1JDCA 3GTFA 3G22A 3BO9A 1S5TA 2ZZ5A 5HJLA 4J9JA 3NL6A 1WOAA 1JNTA 3JUGA 3PZGA 1LG2A 1UD2A 2Z26A 3PPHA 1ME7A 1YKWA 4FLQA 4HNLA 4M3PA 5E0FA 4EP8C 4TX0A 1MXGA 4GYPA 3N18A 3BJFA 5I09A 3EPNA 2CNCA 3FK4A 4UTMA 4MNLA 1DTUA 4E38A 4GKLA 2ZR5A 4O18A 1UKOA 4B4FA 3W85A 2J47A 3U5UA 5CLWA 1VENA 4B3ZA 3KHJA 4DZ2A 3H7UA 2DIEA 4ACYA 3BGGA 3U48A 3EA1A 3I3DA 3W6MA 3HJZA 2W6RA 4AEFA 2VZUA 3FEQA 4PGLA 4G7FA 2R1PA 5GVJA 2ZR4A 3U8GA 1IXQA 3FDKA 4QG9A 2R1NA 3W4RA 2E7FA 3GB6A 1K4HA 2NSOA 4BF8A 1TUXA 2YL9A 3ERPA 4BK9A 1F05A 3TMLA 1M5YA 1ADDA 2PU1A 3CHCA 4EIVA 3N6QA 2PTZA 1PSCA 1PCWA 1REQB 4L4MA 3TN6A 1M41A 3KCEA 5K2ZA 1CXEA 1WAUA 5F1UA 4MKVA 3SJ3A 4JIPA 1HJWA 2XJ7A 1EFZA 5FSDC 4I9MA 2VM8A 4HB7A 3FKKA 1PX3A 1EP1A 3DENA 3B4YA 4XO7A 1PPIA 2H3BA 3BZJA 2F23A 3S3GA 3ZR4A 4YMZA 1YNPA 1GW9A 4BF5A 1J79A 4Q4RA 2ZZ1A 3OODA 1EBHA 3UWQA 2RJHA 1C9DA 2DSWA 3HG5A 1SSGA 2OXNA 2V3EA 2FTWA 4BI7A 1UKPA 3IK2A 3HTWA 4EXQA 3LLDA 4UTKA 3MQTA 4F48A 2XISA 5E5CA 3UXDA 4UZUA 1H7WA 2YL6A 3FVMA 4KEUA 3EPOA 1SMAA 1WBJA 4PUEA 4E3VA 4ZE4A 3GU1A 1KO0A 3O5JA 1K8XA 4JDYA 1VBHA 2QF7A 3UA3A 4XVDA 1BKSA 3ORWA 1UR8A 3W2UA 4ODNA 2QDDA 1UASA 1SW3A 3DFYA 2IPGA 3ZJ8A 2BS9A 3UFYA 3ITCA 2F38A 1SPQA 1IWPA 1IIHA 3AOFA 3TW9A 4CD7A 3GWQA 2B4GA 3WQ4A 2Z1XA 4MWAC 3WQ6A 1J2BA 1H1ZA 3UG8A 1FOBA 3N2OA 1PHQA 1C92A 3N11A 4IPIA 1CNVA 4NYYA 1EO5A 3CLWA 4C5ZA 2J9ZA 2FAPA 2NV2A 1H50A 1VBRA 4O53A 3BLIA 1LT7A 1GVYA 1IZCA 1Q6UA 4Q8TA 4AH7A 3GDTA 1DQXA 2ZXBA 3M43A 5A2CA 1UUOA 2X0HA 2FZBA 5BXSA 4BJHA 4AWUA 1QMLA 1S1RA 2PRMA 4L80A 2WKGA 4JN8A 2DGAA 2DUAA 3A3XA 2A7RA 3ARXA 1O5KA 4ALDA 4XBSA 1MUMA 2JKEA 1FHLA 4R27A 3G6LA 5MKGB 3NXFA 4RX0A 3E6EA 4R7JA 4UQAA 5LXXA 4O54A 1RA5A 3MHFA 2IW0A 4LYRA 1NY1A 1X7IA 5AC8A 3T40A 5BRPA 5AYBA 3LCFA 3LLFA 4UMBA 1TMLA 1D7HA 1VYPX 1YDVA 5HPOA 1G4TA 4H9UA 3SY1A 3PP7A 1JPIA 1PDYA 3NM1A 3PR2A 2DZUA 3VINA 3FHAA 4IIHA 3TUUA 1KR0A 4S3EA 1E6SM 3CT2A 3W0KA 3TR2A 7TAAA 2CXGA 2GQ8A 1TMQA 4H7CA 2YW3A 1M01A 4CNNA 3EXSA 3POHA 3AISA 2WMJA 3UWYA 4HSOA 3CZKA 4GJIA 3VAWA 4LAYA 4EWJA 3L9CA 4AVOA 4NZ3A 2CHNA 2GGJA 1GKPA 2ZXDA 2E5CA 2AGKA 2J7CA 2X42A 3IJ6A 3E9AA 4PB4A 4ROPA 3GZ3A 4IMGA 1P0DA 4IT1A 3WKZA 3GNNA 1YTDA 5CLTA 3HBLA 3WENA 4LQ1A 5C2CA 3UF8A 4ZB5A 1XJBA 4GY1A 1QW7A 1TSIA 3BV4A 5A8MA 2OJPA 3ARVA 3CUJA 4P61A 3QRHA 4IFRA 3LM3A 4C6EA 3GDMA 5HQEA 2V38A 4B3LA 1BYBA 2PWVA 3EDKA 1KRCC 3CUGA 3A24A 5E6ZA 2GYIA 4IHCA 4BA0A 4K7YA 2OQYA 1JNEA 3GNXA 4JBRA 4W9OA 4JY9A 3VIHA 2Q01A 1L6YA 3TC3A 4NU7A 3W00A 4A4AA 2F4EA 3IGXA 2OR2A 1UR3M 4JS3A 3TZFA 4IIGA 3NVTA 4UTIA 1XIDA 3LY0A 4LUSB 1NFGA 5LIYX 1E6QM 1QNRA 4FI4A 1WQ5A 3RR4A 3MYPA 1RPXA 3NZQA 1C91A 3C61A 5DO8A 4U4MA 2PB1A 2P3ZA 2ZBTA 4X2RA 4R9XA 2VC5A 3G6MA 1FDJA 3AIEA 1QXLA 1C8VA 2I1OA 1GPWA 3NO3A 4KKXA 2VKZG 4X63A 1KTNA 1LLWA 2AQWA 3U2EA 3W83A 3WK1A 3LCXA 1HO4A 3PR9A 3IUDA 5I2UA 4NAFB 2NQJA 3WQOA 2ZUUA 1GOMA 2IUZA 5C8BB 3ABQA 1NDZA 4IG2B 3V0SA 2VXNA 4GWEA 3N3TA 4KWSA 5BMWA 4UFIA 2JK2A 4N4PA 2J75A 1HKWA 1B4EA 4R0XA 2GQ3A 2XP8A 1V6UA 3OVPA 2O0TA 3WBEA 3PG8A 1FQ0A 3O5IA 3A4WA 4MDOA 4LT9A 1GG1A 4UTWC 3W73A 1ZJHA 1T6MA 3QVQA 1HXJA 1E51A 5GNXA 1HP5A 4QS6A 3E5PA 1VFMA 2R91A 3C8FA 3GY1A 1RBLA 1GQIA 3QTPA 3BARA 2QGHA 3KRBA 5I7GA 1EPVA 1RVKA 1R46A 4Q4QA 1RLCL 1YW1A 3CHFA 3VDCA 5KETA 1AG1O 4L6OA 3LUTA 3RO8A 5FIPA 3AU6A 4PODA 2YA0A 4P7LA 4A3HA 3OOBA 2YBTA 1K03A 2I56A 1W2VA 1REQA 1GQLA 3O9NA 2ZZ3A 1R9XA 1M7PA 5F1VA 4DROA 1TPDA 4IH3A 1KFJA 3GVGA 2DQXA 2IKHA 1B0IA 1I1WA 1VEOA 2FZMA 2MLXA 1LP6A 3DC0A 3KAHA 4PEKA 4WSJA 3NQ2A 3P74A 3E12A 2E8YA 2PDLA 2VWSA 3Q45A 1DHPA 5G5IA 1DIEA 5L6UA 3A3WA 3RDKA 3P62A 4WKAA 3IV8A 3AXIA 2R24A 1BFNA 1DL3A 4PEEA 4G1NA 4DYJA 1V0MA 4QDWA 4ZL1A 3BSGA 3W72A 3O5OA 3L12A 1M9HA 3LPFA 1BAGA 1IT8A 3W70A 5BWFA 2PRHA 1S2CA 3CB8A 1O68A 1VAHA 3NRKA 2G0WA 2Z29A 4HARA 4ZA0A 1P0EA 4HYWA 2O9RA 2ZUMA 1PKNA 2P8CA 5HMSA 2VEGA 2ZRWA 4TX8A 6PTDA 2P3EA 4TVUA 3BWWA 3MCOA 3E74A 3OTRA 4AVFA 1HW6A 1TJRA 3NDOA 2Y5SA 3W25A 1SZNA 5ABFA 4QQUA 3THQA 2D3LA 3W6YA 3ITGA 4JQ4A 2QV4A 1PKYA 4DM1A 1O1HA 3V5FA 5T9CE 3UR5A 1W1TA 2CBVA 1LOQA 2GUUA 3BW3A 3HN3A 5K7JA 1EH9A 2YPIA 1D7JA 5EPDA 5MHBA 2NVDA 3SQLA 2W9MA 8RUCA 3NXLA 5MF5A 3KFTA 4GZJA 1MZRA 3VMNA 1CDGA 4LYKA 1N8WA 3SCOA 4JY8A 3O05A 5FL1A 4K8GA 1RD5A 2TYSA 1ICPA 3LBCA 3PNUA 4CGTA 3CASA 1EHAA 1A53A 4MJ2A 4MAVA 1BG4A 2CZVA 1YTEA 5FEXA 7ODCA 5MKGA 4AZHA 1K8ZA 2PCEA 4WD0A 1PTDA 4GA8A 4M29A 1Q6QA 3WDPP 5A94A 5EMYA 5K9DA 4N0RA 4BWLC 1HIZA 4IWWA 3RMEA 3KP0A 3ZT7A 1VBGA 2DG9A 3ME3A 2XWDA 3OW1A 2F6XA 5I3HA 4AD3A 3OVQA 4PUMA 4QAIA 3UZ5A 4IXXA 1H7NA 1TV8A 1GNXA 4PTMA 1HJUA 3O5EA 3TKFA 3NR0A 2GK1A 3RX3A 1ZBCA 5LNVA 2WHKA 2V82A 4B5TA 2OLAA 2DPEA 4R5EA 3H9RB 1SFSA 3O6CA 3KL5A 4JTRA 1BSLA 3MUY1 4I5XA 1ROTA 4U5KA 5AHNA 9XIAA 5LGXA 1ZSXA 1PAMA 1MSSA 3B0VC 4O52A 4XWUA 1QZ2A 3E1F1 4HSHA 1B54A 3KBSA 3LCIA 3IHZA 4BKNA 1FP8A 3A5FA 3CQ0A 3ARYA 4PUNA 2UZ9A 3NPXA 3RIKA 1W3HA 1JCJA 1Z42A 2N87A 5BWAA 3LCWA 3BAKA 3B0XA 4JIRA 4RDYA 1DEDA 4UTUA 2PDHA 2R8WA 2G95A 2V3DA 1BL4A 3KOXA 2EEXA 5LKYA 5IBXC 5D37A 1NWRA 1QPLA 4GYKA 4XZWA 2BX7A 3COTA 1I45A 3VOIA 4XZ9A 1A5AA 3RFAA 3LV5A 1EZ2A 2C0AA 4NZ4A 2YSWA 2BB0A 3LCGA 5J8LA 3SCRA 3SECA 1U1UA 1SO4A 5F7UA 2XFYA 3II1A 4LUSA 3NYZA 5U7SA 2NQ9A 4RCXA 1RSCA 3KAGA 1ZZMA 4GYJA 4ORMA 4GCAA 1G69A 2XHYA 2WZHA 2ZA2A 2XIJA 3T6CA 3IVSA 4I6KA 4JX4A 2PDMA 4QZVB 1CX9A 4PCSA 1HKJA 3H2NA 1V79A 1UWAA 4JTAA 3GHTA 1QW8A 1XPYA 2VR5A 4PC8A 5ABTA 1DJIA 2UV8G 4FXRA 4NAFA 2NT0A 3CS2A 1K1DA 4IZGA 3CWOX 2GVLA 1IEQA 4IG2A 2XM2A 3USZA 5CPLA 1W17A 4OOZA 4GI4A 5AFDA 2V81A 4QLJA 3TA6A 4DF2A 3PRDA 2E6DA 4UXDA 1UR4A 3ECQA 2FFIA 1V6VA 4D6GA 5I3KA 3AS2A 3WH7A 3CJPA 3AICA 3R58A 4N9DA 5ENLA 2FGBA 5JXQA 3VUSA 4I8YA 4M19A 1AH4A 3ZXWA 1S2WA 2VURA 4LY8A 2BTMA 3AHYA 4PBFA 2HTMA 3MTWA 1V8EA 4E0CA 3ANYA 1LTDA 4ADSA 2O9OA 1PB0A 5LA2A 4ZQMA 1PEZA 3G1XA 2QW5A 4MZYA 4AXKA 4HNOA 1EHNA 1F07A 5IHRA 4IMEA 4D6FA 3E2QA 4WVXA 3V75A 1AD1A 1A5MC 4GCXA 2WLYA 3WNNA 3PM6A 5XIMA 4HPNA 4NASA 1MUCA 2Y1HA 3E0IA 3VFCA 1FKFA 2AKMA 2VDHA 1R2SA 5EMUA 4P7RA 3V16A 7CGTA 2J9XA 1CT5A 4DB7A 3WQPA 2ZXQA 1RAKA 5HULA 4CEXC 4RKAA 2VENA 3NOEA 3SBFA 3RM8A 3TSBA 8A3HA 3PTKA 3TEVA 2WNQA 4DI8A 7TIMA 3VCRA 2GGEA 4AAJA 1E9ZB 5BOEA 1XP3A 4IGNA 1FKSA 1DWIM 4KGLA 5TAOA 4YTRA 3DYPA 1D2KA 2FDSA 3L4ZA 3TTQA 3VD9A 2A0NA 1CXLA 2VX7A 4A3UA 1W9VA 1M7XA 2ACSA 3QFEA 1TPEA 4FF5A 1ZGDA 4CD5A 3BDKA 2XFWA 1QNVA 3VA8A 4NF7A 4IQCA 2ISWA 3DX5A 1E6XM 3D3FA 2ALDA 5DEZA 2VMFA 4K38A 5C55A 3ARTA 1RP8A 2J6XA 3BMWA 3IIZA 1EPXA 1NF7A 3RHGA 3VU2A 3URBA 2W79A 1ZAHA 2NLYA 1FWNA 1I4NA 4W8AA 4MB1A 1LORA 4WJ8A 3A12A 3U3HA 1UUQA 4DO4A 1AZ2A 5CGMA 1S46A 1NU5A 1I60A 4XISA 4AF0B 1PO9A 4O1BA 2PV1A 1A4LA 3EKLA 4EX4A 3BG5A 2D73A 4BFAA 2XZ7A 4WY0A 3CK5A 1EDQA 5KMYA 3TJLA 3KVKA 1DWHM 3T2PA 2FB2A 4JTSA 2D2OA 5A6BD 1KQYA 1XRTA 3GFXA 3AYSA 2GJXB 4XK2A 2C18A 3HZ3A 1GJWA 3WQWA 1XI3A 3WD2A 1LDCA 3LD5A 2PDFA 3T1GA 3HIJA 3ZR5A 4UOZA 3GM8A 4QNEA 2CERA 2PWFA 1OT2A 2ON3A 5CJMA 2HVNA 3HU7A 3OOQA 4PSPA 3P2VA 4GBDA 2I7GA 5CBIA 2CCRA 2CETA 2QZRA 5T9BG 4LUIA 4GNJA 4XAKA 4P8VA 1POJA 5HWCA 1JFHA 1TV4A 3M0XA 2WZEA 3NQMA 3ZYZA 4UIOA 1G7UA 3QN3A 1OFEA 3STGA 1FP9A 5H1WA 2RUDA 4CKQA 5CSRA 1IEVA 1F74A 3NZRA 4MNJA 1Q13A 3ZWSA 3RRXA 1S2UA 4M8UA 5HMEA 2HISA 3OPSA 3QC3A 3VCNA 3B8SA 4L9XA 1VBUA 4K39A 3E38A 3PG9A 4N42A 1A3WA 1QI0A 3R43A 4GMEA 4Z08A 3EOUA 5EBAA 4XSLA 3DIPA 1XFCA 1XIGA 2PTYA 3EPMA 4AIUA 3IIXA 3VIPA 4C6DA 3SB0A 1F61A 4JYEA 4POCA 2FLIA 2VCDA 5T8GA 4DZHA 2VELA 4Z1DA 4C6FA 4LS0A 1V5XA 3IS4A 1EJRC 1XLGA 2Y62A 1O5QA 3G1SA 2O7QA 4QNWA 3MYOA 1JCTA 4ODRA 2B7NA 2DT3A 4Z2LA 3F4NA 1KT0A 3WQFA 1LUCB 3FDGA 2BY2A 1JPMA 3SCVA 1XKJA 1XG4A 4HKPA 3AAMA 2HZGA 3TSDA 2V3FA 1GG0A 5A2AA 2YL5A 4HBOA 1WO2A 3BOXA 3VX0A 4JICA 2W4XA 1K8YA 2FVLA 2PGWA 2OEJA 4L56A 2UBPC 3NL5A 4J28A 1DJYA