2DT9A

Crystal structure of the regulatory subunit of aspartate kinase from thermus flavus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
KAVTGVALDLDHAQIGLIGIPDQPGIAAKVFQALAERGIAVDMIIQGVPGHDPSRQQMAFTVKKDFAQEALEALEPVLAEIGGEAILRPDIAKVSIVGVGLASTPEVPAKMFQAVASTGANIEMIATSEVRISVIIPAEYAEAALRAVHQAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the regulatory subunit of Thr-sensitive aspartate kinase from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Aspartokinase
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
A PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dt9A01
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dt9A02
4NMLA 3MTJA 3TUJC 5FIIA 5IT4A 2H9ZA 2RQMA 2RQKA 1YGYA 2JOQA 2RE1A 3IXQA 2QMWA 2LQJA 3DHWC 3NRBA 2J0WA 3K5PA 3CEDA 1LK5A 2MDAA 3OBIA 1SC6A 3DC2A 4X84A 3IBWA 1LK7A 3ENQA 2CDQA 1KS2A 1Y7PA 3P96A 4PWUA 1M0SA 5IS2A 5JJBA 1RWUA 1PSDA 2KO1A 2QRRA 3OFHA 1UJ6A 2QMXA 2NYIA 1LKZA 3TUZC 1YBAA 3W7BA 4M8LA 3HHEA 3DDNA 3AB4B 2P9EA 3MAHA 2DT9A 1UJ4A 2PA3A 3LUYA 3N0VA 1O8BA 1ZPVA 3LOUA 3KWMA 1UJ5A 2P9GA 3OFEA 2LVWA 2JHEA 4LUBA 3AAWB 2F8MA 3U7JA 2DTJA 3MWBA 3S1TA 2F1FA 3AB2B 3O1LA 3DHXA 1U8SA 4GO7X 3OFFA 2P9CA 2I9SA 2QSWA 2FGCA 3TUIC 2PC6A 2ZHOA 3ENVA 4GMKA 4IO1A 4GO5X 3ENWA 2J0XA 3OFGA 3UW1A 3L7OA 5T41A 1XTZA 5IT0A
chains in the Genus database with same CATH superfamily
1KLMA 2FLPA 1RAIB 4ID5B 3JSYA 4YB6A 2CPHA 3C16B 4IUFA 3D2WA 1VBKA 4LRCA 1HI0P 4TNOA 5L1LA 2NUUG 5F9NA 2XLJA 3BQ0A 4BBYA 3H25A 1AT1B 2BE2B 3L9ZA 3NRBA 5JVGQ 3WC2A 2PI5A 2KXFA 4X4PA 5G0RB 1D0EA 2FVRA 1J2VA 2J76E 1FFWB 3D7SB 4WIQA 3MR2A 1OQ3A 1VK3A 2A2DA 4UTGA 2IBKA 3KLGA 5KFDA 4OYWA 3G6VA 4URSA 3T3FA 2XM3A 3W3SA 1PG5B 5LMUF 2A2CA 4ZLLA 1IBCB 3HZGA 2J9EA 1TK8A 1KQFB 2H5JB 3JAMY 1VQ8S 4CH7A 3Q22A 2H54B 3WIUA 4A8MP 2G0CA 2Y1RI 5H1SV 3NAIA 3ZFVA 3ZZTA 5JJBA 4J9NA 4KHPJ 1C1CA 1URNA 1RAOA 3B78A 4RWWA 3TJ8A 1IKYA 3LP0A 4ED3A 1S72S 2ZEJA 2MKJA 3M2UA 5C24A 1VBYA 3HSZA 1Y00A 4FP9A 1R27B 3ZZRA 1YJTA 3OV7A 1V9OA 5BYQA 2ZKTA 1IBMJ 1RCXB 4Q5VA 5DZ6A 1C1BB 2AKWB 2FUG9 2FHJA 3MGJA 1JJ4A 1HWJA 1F9EB 3MAQA 4CT8A 2ACYA 1FFSB 1SXLA 5D77A 5KG3A 6AT1B 1ZM4A 4MFBA 3VVTA 1YBUA 4UF4A 1SH0A 2VG7B 4Q43A 4YR0A 4B3OB 2ZUGA 2QO3A 5DJBA 3K0JA 1Q86T 1F9HA 4ZOSA 1KR4A 3ZZUA 1SC3B 4AQYJ 4L3NA 1UJ4A 2M7SA 3CO9A 1VLOA 2I8EA 1EETA 3QAUA 2VL1A 2XMWA 3NEKA 2E7VA 2ILZA 1AFIA 3EGVA 2BOAA 4DBQA 1YRXA 2JX2A 2POKA 2WVBA 4J9RA 3MCMA 3NL0A 2G9OA 1CJTA 2ATCB 4ILRA 5GMEA 3JSMA 2CPDA 2A1BA 2HZCA 4CO4A 2QG9B 4ZN3A 4ZIVA 2AYGA 1UEVA 1U1KA 5B0BA 3FMWA 2F7VA 3CD5A 3MEDA 1HQUA 1VLYA 2JRSA 5F8NA 5KT3A 2AX0A 2MY8A 2OEMA 3AODA 1NPPA 1S76D 5JXSA 2LP4A 3UNGC 3G4SS 2DGVA 4YY3J 3UNYA 1S1UB 2WHOA 2HVEA 3KDNA 1VHIA 3N28A 4JOUA 5HQMA 3PKYA 2KRRA 1NRKA 3F56A 2FDNA 1R0BG 1VFJA 2YWWA 3MM9A 1REGX 2W2NP 4I6WA 3RBZA 2YTCA 4DR4F 2QLXA 2QYGA 5KFFA 3OUYB 1Q82T 3OVAA 3N5FA 3TUIC 4TXSA 4CP5A 1TL4A 3CGIA 3THTA 3VR1A 1HFEL 3MEGA 1KQKA 1BMQB 2CIMA 2PFDA 1KP6A 2EI5A 2GC8A 2ZC4A 3NXZA 4DQIA 2CRLA 5FD1A 5BYRA 3ADAC 3FNNA 1ACMB 2VG5A 3MHYA 1NH8A 3L7PA 3OJUA 3OR2B 3MM5B 3K58A 2GIQA 3MD3A 4TQRA 5J2QA 5M2PA 5KFZA 2WVDA 1U7LA 1H74A 2PMZD 1X8DA 4FN5A 5KFLA 2KXHA 5E0OA 3G6ES 3IC1A 3T41A 1TUGB 1IBLJ 1RISA 3IWLA 3CD7A 2E5GA 4NMLA 2CG4A 2JEIA 1XNQF 2YKOA 2IM1A 1TFYA 3BM7A 1MMNA 4QZVB 3I4HX 1O51A 4AT1B 2YPZA 3M8ZA 5C5JA 1SH2A 4QWDA 1RTJB 3MPYA 4R5PA 2QLWA 2GVDB 2WOMA 4OYPA 1OY9A 2J9CA 5A8WB 4E2FB 1RTHA 1AZSA 3H59A 4F4WA 2MSSA 3KXDA 4KKOB 2FLOA 2HFSA 5I3PA 4O3PA 1NJXA 3EGZA 3QGIA 2HWTA 2QV6A 2M0GB 2OMOA 1XEZA 2E1PA 3A13A 5F8MA 1PCAA 2D3ZA 2E5JA 2KT5A 1KBRA 2GQ2A 3KK1B 3OQ2A 2B6AB 5BR8F 3THVA 3KJNB 1QVGR 4ELUA 3PHEA 1S9GB 2DNGA 4PXBA 5DLGA 1S0MA 4DS5A 1NPRA 3GIJA 1D9FA 4Y2AA 4LF7J 1SKRA 5CZVA 5E33A 3CCSS 3T6JA 3FBCA 2Q3PA 3QNWB 4F4XA 1NK6A 2A18A 1A0OB 3H2LA 2Z2ZA 3OFHA 4M5HA 5FLXU 4X62J 1FJ7A 1VQMS 3I5AA 5CQGA 5T7LB 3LH2S 3MCSA 4DCPB 4RW9A 1VJWA 2NSCA 3RYLA 1N5TA 4L3KA 2XS5A 5ETMA 3KLFA 1RAAB 1SUQB 3KUEA 2UXCF 2MSTA 2DNZA 1XNRF 2IJFA 4PG4A 4A8KA 2X7IA 1RLDA 2JWNA 2OFGX 4DV5F 1HNIB 1S57A 2CPZA 2EXUA 5DETA 1LWEB 1IM6A 4RJVA 4O3RA 1T9YA 2R42A 4P2SA 1VQYA 3TA1A 1QUVA 4NE9C 2V5HG 4OL8A 3C6TA 2MLZA 2BABA 4ANEA 4EMDA 4YUDA 2BQ3A 2JNJA 3H90A 3MMAB 4RUHA 3LWMA 1PAUB 1KDNA 2JL9A 2F9DA 2RU9A 3HSGA 4UUXA 3TOQA 1GMWA 2MZJA 1TU0B 4IYQA 4ZHRA 4TU8A 1BQNB 1DARA 3BH6B 3V4IA 1U1RA 1VC5A 1QAIA 3PW2A 3JS9A 3SZ2A 2N3LA 5LMNF 2VB6A 5A8WA 2RMLA 3ENAA 4LRDA 1E6YA 4LRAA 1JNRB 5LT5A 2J7UA 2KG1A 1OY8A 1ZS6A 4D3HA 4J9KA 4NLRA 2CKWA 4A46A 4C3KA 4DUYF 2UV8A 4QWAA 1ZETA 4USTA 3FEYB 5KFGA 1U8SA 2WW8A 3ZZYA 4PG8A 3MR3A 2E66A 2ZBQA 3EUNA 4MAKA 3FCWA 4NYOA 4NYPA 2RHSB 4RUCA 2G0IA 4LSNB 1NJWA 1TV6B 2DRAA 2QYCA 2Y1LB 1Q7LB 1HBUB 4DMZA 4DR7F 1X7VA 4MKBA 5L38A 4ZPCA 3A8JA 4N77A 4RNNA 3M8QA 4Q7AA 4USJC 3E8OA 1RU2A 4NEZA 2W2OP 4USKA 3TJAA 5D0HA 4XPEA 1FKPB 2DJWA 4NZ6A 3TO8A 2DVIA 1WEZA 2EFVA 3J7Z5 4DUZJ 1ZAVA 4RZRA 1JLBB 1U47A 4YEAA 2WCXA 2X51A 4KAIA 1AXQA 4EZ6A 2AHOB 2DCLA 2SXLA 3P3DA 1P1TA 4DV0F 2G2YA 1S6OA 1YZ7A 3ITHA 2DGXA 2PSZA 3A8EA 5KFKA 3R2CJ 2DNPA 2M88A 2BE2A 2YKPA 4WP3A 2VJUA 2KFYA 2H5EA 2WVCA 3C15B 3N6MA 2CQ3A 3UDVA 2YKMA 2C3PA 3W60A 4KB7A 3W9IA 3RB0A 2YXLA 3CDUA 5EX0A 2J8AA 1O0PA 1TL5A 1T9VA 3U02A 4WU2A 3NMAA 2B4VA 3WBZA 2XO7A 4MKYA 1TKTB 4B3RJ 3HSDA 2CG8A 3FGVA 1U6FA 1Q8KA 2FZKB 1MROB 5EWGA 1XWLA 3NNCA 2QMWA 1Y3KA 2LQJA 2LU1A 2RB7A 3HD1A 4ZP7A 4C7QA 1SQGA 2VODA 2A0FB 1FE4A 1KFDA 3AA9A 2CJBA 3KG4A 5AE3A 5GAHU 1SC6A 2AZ3A 2XULA 4X84A 2KL8A 1X9WA 1SC4B 2I5JA 4FBTA 1ZOTA 4AXJA 3D1QA 1GNKA 2XSFA 3KJFB 1KS2A 1NKBA 3J7A1 4LMZA 1DTQA 4R5PB 3UR0A 2VPYB 4XK8C 4HL9A 5KOXA 4R0JA 3I5CA 1S7HA 4ES3A 2OEJA 1HQEA 3V6DB 2ASDA 2AYBA 5IS2A 4ZJLA 3QLHB 4IH5A 1FF2A 1BE4A 1KTQA 4ZPWR 2VA3A 3PRDA 1TELA 3A4TA 4KHMA 4LF2A 2AIRB 2AWZA 3HKZD 2CPXA 5F3ZA 5AXMA 2R7XA 3DDKA 4TLRA 2HURA 4DCOB 4B02A 4WJBA 3DRPB 2FHJD 2XS2A 1VR6A 3KDOA 4FKXA 4FKYA 2ZNYA 5KFUA 1BWEA 5DQHA 1IQZA 4MIAA 5KT2A 4X4QA 1RAFB 4K4VA 1EQ0A 4FYYB 2ADCA 2XMVA 4XDCA 2BE7D 1JJ2R 3S7RA 4PWDB 3P4UB 4M5GA 3K2YA 3VTIA 3M9MB 2B7BB 4OLPA 1OJ4A 4G6VB 4L6V3 4MYTA 4KY3A 4I0WA 3Q24A 1Q8IA 3KLEA 3DLHA 1X4AA 3Q2TC 5GAEI 1X5OA 5GMKa 3ILOA 1RSCA 4LF6F 2UUWA 2JFDA 4FVCA 2UXBJ 2XZTB 1GMVA 2QJ3A 2MZQA 4E98A 2PA3A 3V2UC 4I64A 4EBDA 1YJWS 1IBKF 3LA0A 2XHWA 2LQBA 3N0VA 2D9PA 4MYUA 2ROEA 3KHHA 4GKJF 3OUYA 3LOUA 1F5BA 1BHNA 1F5AA 2EG2A 2D74B 1SPBP 1IJFB 2HQDA 2ZWOA 3OFEA 1HPZA 4NLYA 3RU0A 5G0RA 1H7XA 2CUYA 3W65A 1QM9A 2QFJA 3I31A 2F8EX 2QEXS 1M1HA 3DDIA 2W9CA 5B0GA 1DBDA 1DLOB 3ZO7A 5C2GA 2JH3A 3PO5A 3UD4P 1HIYA 3CJQA 4DV7F 4A8SA 3AQOA 3BGRA 4LSLB 3P5BP 4OYAA 4CM2A 2CXEA 5HP1B 2DGTA 4DPYA 2F65A 1HNZJ 4DFKA 2NLWA 2MXYA 2C22A 1FERA 3A3OB 2HVHA 5HATA 4GO7X 4JI1J 2HHXA 3EPIA 3LTOA 1FXDA 3DKDA 4ECXA 3MD1A 1CLFA 1LXNA 4OHVA 2VUGA 2RS8A 1NZ8A 1PC5A 1V5IB 1WDDA 2FZCB 2ZOGA 5HANA 2VBXA 2IBOA 1IJEB 2YKAA 1PAEX 3PIPQ 2FHOB 5E3CA 1S1WA 2FB0A 2HAFA 2IVYA 2OPSA 4NLUA 1HBNA 4OJ1A 4OHZA 2QLJB 3THPA 5SUHA 4F25A 1B99A 5C2CA 1VQLS 3TAPA 4X4OA 4PCQA 2ZBRA 3R97A 1Q95G 5JMNA 2GHVC 1RHKB 4OZ5A 1QTMA 1D8ZA 1IVZA 2YBVA 4EU0A 2ZM6J 4EGLA 4YHHF 1Y3JA 2B8PA 1HNXF 2Q6BA 4NLTA 1HBMB 1X5TA 2W9BA 5HVGA 3OL8A 3MFIA 1XERA 2BVZA 5ETQA 2Q43A 4O4GB 4TYAA 4F3MA 3CD6S 2XYPB 3IAM9 2DY1A 2EWHA 1RTZA 5SZTA 2DGWA 3DOMA 2GIFA 3TEHB 2CQPA 3H0PA 4WF9Q 5A6WA 4ECWA 1NJZA 3FSIA 2LEAA 3M6WA 2FVPA 2DCUB 1M5KC 3ZTOA 3O2IA 5J1PA 1RWWB 2YH0A 5DO2A 2RDJA 1R31A 2MQ8A 2DR5A 1HI8A 4NRTA 5KT7A 1K0VA 1N32F 5HJXA 2IHR1 3I96A 2OTJS 4CTAA 3AHPA 5KFYA 2OPPB 1RWOB 5HJYA 3T1AA 3QO9A 2HQIA 1NHKL 1XQIA 3DU6A 2KDOA 3GFHA 3K5MA 4RW9B 4K4YA 3P96A 3IGVA 4QYRA 4NXNJ 1RT5B 2BEFA 3GCWP 1IKXB 4WKYA 4DV1J 4YR3A 2UUCF 3PCOB 1RWPB 4KFBB 1RXOB 4MK9A 5D0RA 2KVQE 2LQ8A 1KHWA 2W24A 5RUBA 3MAAA 1NH7A 4X64J 4FF1A 4OHXA 1NB2A 4ZVUB 2VH7A 2QMXA 3MEEB 4RL1A 4J91A 4YOEA 1VQNS 2WB1D 3WIVA 4N76A 3R1HA 2CZ4A 2HHUA 3HP6A 3WX4A 2ZHAA 1VHFA 2CPYA 3TUZC 4K0KJ 1X0FA 5DG9A 2CAJA 3EICA 2XY6A 2BUNA 1Y0HA 2UU9J 3KLVA 4JI7F 2B4PA 2D69A 4LFCJ 1FXLA 4LR9A 2KFNA 3HHEA 4GKKJ 2AEMA 4DPTA 2AYEA 4LF9J 2DR8A 4NLSA 3HHNB 2HSEB 1MG7A 3OTBA 4I2QA 3T5JA 2P9EA 3EVWA 4GC7A 4B3TJ 4V19J 2LXUA 1SV5B 3BO3A 2Y9HA 4DR2F 3G8TA 2V4QA 2U2FA 3UD5A 3IBCB 3BSNA 3LF0A 2FJAB 2QL7B 2AT1B 4WU3A 2HYIB 2V94A 1GK8A 5IT9Y 2IM3A 3D6FB 3J81Y 2ZDOA 2CNKB 3W61A 2YY3A 4B3SF 1N33J 2WRMA 3TVZA 1GTHA 1PC4A 2BJ1A 4J9VA 4URQU 5EX3A 3C46A 1YG0A 1YJUA 3VQTA 2DHHA 1F1BB 2R2SA 1N48A 1MW7A 2P8IA 2WSCC 5IOLA 3GSIA 4K4WA 3PTWA 1N8RT 2DXEA 5L8RC 4QWCA 2HFVA 2JC1A 3HVTB 2BX6A 4P6QA 1YWXA 1S0NA 2VU5A 2IIHA 2EK1A 3TAMA 3C14A 2C28A 1YJ9S 4OX6A 2E7WA 4TKTA 5F0UA 4ZCIA 5GAGI 1EP4B 2EFGA 1YI2S 4ZVEA 1LW2A 4K4XA 3DM2B 3EDQB 2B4OA 5B0AA 2CJ9A 2R7UA 3QJLA 3I32A 1S1XB 4H4KC 4OZJA 2QSWA 3M8RA 2PFFB 3V5RA 3QSYB 2FVQA 2ZZMA 4HLBA 2HNDA 2EBEA 3PNIA 3LP1A 5T7LA 4NI2B 4ANDA 3QMQA 1NXIA 4NRUA 5CYQB 2OLWA 1NDKA 2YNHA 3M2RA 1K9MT 1L3UA 4RLEA 3I4PA 2YNGB 2XMKA 4Z37A 2HNZB 3VAIA 1DFDA 3DXBA 2P6TA 1VRTA 3NLCA 3SQGA 2MKKA 3ELHA 4DV4J 3JTNA 1G4CA 2BRLA 4N7TA 4J9QA 5DM7Q 1A6LA 2V8PA 3BR8A 3ZZPA 1D9DA 1UWAA 3QWUA 3L7OA 1U45A 4KGZB 1RE1B 3G2XA 2BE9B 3C6TB 3OW2R 1H73A 1WI8A 4PXEA 3LPEA 2K06A 5KFVA 2YNGA 4LIWA 2FVSA 4ILLA 3TUJC 2XSJB 2PD1A 4P2FA 1FJGJ 4WIIA 1EETB 3ETMA 1NK8A 2RQMA 3L7UA 1SB6A 3HFVA 3LAMA 3M32A 3X3UA 4K4TA 1J5OB 2DR6A 1PKUA 3KK2A 4A8FA 2BV3A 4Y6IA 1APSA 1OYEA 3IS9B 4WBFA 1AUDA 3ETOA 3H42A 1T9TA 4GVBB 1JLQA 2RRAA 1X9SA 1NK7A 2YX7A 3JYTB 2XZWA 3K5OA 1RT1A 3ILJA 2KH9A 2FJEB 2BM1A 2VC0A 3RAMA 2N3OA 3HVRA 3C14B 2E5HA 4IDKA 2OEKA 1ZH5A 2KFZA 3GTYX 1OY6A 4X4NA 2BKNA 1X0PA 1J5EJ 3SBMA 3CCWA 1FI4A 1TL1A 1U2RA 3OVSA 1LXJA 3J7YI 5K14A 3CPWR 1RT4B 2JZ5A 3ICLA 2QLFB 2JDJA 3MM7A 4B9SA 4LSLA 5HP1A 3PEHA 4H4KA 1IWGA 3UWTA 2W8LA 4RBVA 1YJNS 3KLIB 3AFGA 3AQPA 3QZ7A 4WK1A 2W9BB 1MWYA 3H7HB 5E5NA 2H3EB 3H8YA 1CSJA 4CLLA 1HD1A 3QQCD 2WTFA 1TKZA 4DQQA 2M52A 3T5HA 2NPIA 4ANCA 1JLEA 2RVJA 2F4FA 3BSAA 3OHAA 2CPJA 4M8LA 1N5VA 4QR0A 1L3VA 3AB4B 3FKBA 4H4OB 2ACMA 4F8RA 1ITPA 4PKDB 3CC2S 1T3NA 5DM6Q 3RRKA 3AT1B 5K8NA 2HFUA 3PJWA 1EP4A 2RH3A 4CLTA 1WTBA 2UUTA 3RR8A 4L72B 2N4DA 2VDHA 3KUHA 2MQLA 4YQWA 5A8KA 1FKOB 3FK4A 1TVRB 4JI8J 3KYLA 3T5LA 1UJ5A 4OYMA 2GJIA 2WZ1A 1TL7B 5F3TA 2R8IA 2VFSA 1BLUA 1HWIA 4OX9F 4F4AA 3KG1A 2HNYA 2QN6B 1RKIA 2RF2B 4F7VA 4F36A 1I1GA 3U1NA 2HHSA 3EJMA 2I6WA 3R7BB 3H5UA 3LGNA 4M5LA 3VZIA 2ZH8A 5D4OA 1JXLA 4A8OA 4IDKB 2LEBA 4DL4A 3ZTRA 2E7XA 2K1RA 3EZ5A 1I5OB 1UW9A 5D3GB 1OQ6A 1HKAA 3VGUA 5K9FA 3I9V9 2V67A 3TA0A 3N79A 2B9EA 2RILA 2DGOA 3K8VA 1XMOJ 4LF4F 1L3TA 1GFWB 4WXWA 5I3QA 4PXDA 2EG1A 5AT1B 3CJ5A 4KHRA 1SQEA 2WBMA 3I0SA 4MMOA 4IRKA 5D0GA 2RHQB 1S6QA 2G1HA 1S12A 5AJ3J 3C19A 1M5OC 4WPAA 1UWBA 1N33F 3HT0A 3MECA 1N88A 4CLKA 4JV5J 3TJ9A 3CCRS 3EXCX 3GG0A 3OTOJ 4IO1A 5K5MA 4CLPA 4LSNA 2QLBB 2N4CA 3SFUA 1CJUB 1FNXH 1WUUA 3D1OA 4NCGA 2DB1A 1VQ6S 1HNIA 2BJ9A 2FY1A 2CQ1A 5MAOA 3GJTB 1JX4A 1ZZNA 2M9KA 3R5BA 3NGSA 5IT0A 1TMMA 2XNQA 3MMBA 5CABA 1U49A 4HR2A 1TFWA 1KHVA 2GQCA 1HI1A 3GE9A 5K8PA 1UA0A 4GKKF 5GVQA 3BYRA 4JI7J 3PR5B 4FXVA 1WC5A 3NBPB 2UU9F 4ZCMA 4CLUA 5IT4A 4K0KF 3MDFA 3OTOF 1BQXA 1HBNB 1YGYA 2EVZA 2GO8A 1NKCA 3RTVA 2V4RA 3CJKB 1JK9B 3KG0A 2DHXA 3KUGA 2XEXA 4ZHRB 4ECRA 3V4IB 3FMBA 1NDCA 2YQ0A 5C24B 3J81U 1E6YB 3A3PB 3FC9A 5CYMA 1LK5A 3TRGA 5IT9U 3TI0A 2Y8YA 2I1RA 3KHLA 3DM2A 5K8MA 1B7FA 1W26A 1HMVA 5E41A 3KHGA 3E01A 1GH8A 2XMAA 2V2KA 3OL7A 1VC6A 4LF4J 3AA8A 3IM8A 2WK4A 4RW6A 2C2DA 3MR5A 3POTA 4LF5F 2NXJA 2O01C 2AJ0A 4TVAB 1VJQA 3MMJA 2DXFA 2U1AA 5C25B 2RRBA 3FBEA 3MEGB 3K57A 4CH1A 1EX8A 5DQIA 4LFBJ 4RWXA 1RWUA 3WZ0A 1ZAWA 3CJRA 4CQ1A 3P49B 5B09A 4HKQA 3RBEA 1PSDA 1VRTB 4OIXA 3BV8A 4KGMA 3AOBA 5F0WA 5A8RA 1S99A 3GONA 4J9LA 1NDPA 4RR5A 4DPWA 2VQEF 1N32J 1QVFR 3CDWA 5GADI 4B9MA 2HBYB 2UZAA 4L75A 2FJBB 4G1QA 2HW3A 5KG7A 2V68A 1ZBTA 3SSRA 4URGA 4U9RA 3QPIA 3F0NA 5GAEU 2ZH5A 5CCMA 1WHXA 3PZPA 3W63A 4Q0BA 4PAAA 1OWXA 3CE8A 4C98A 1B64A 1T9WA 4DHVA 3NGTA 1U02A 2YNIB 1KQGB 5LSLA 2BACA 3IP0A 3MCNA 2KG0A 3Q89A 1VQSA 4J9PA 2AJ4A 4F4YA 1KSPA 3OSPA 4NMXA 2IC3A 3CSKA 3MM6A 4HTJA 4HT5A 3GILA 3MAHA 1HNWF 1KLMB 1GX5A 2A10A 2A3JA 3Q2SC 4KQZA 3AD9C 4CO3A 3V81B 2IJNA 4PG7A 4UOHA 2JEJA 4C4WA 1Y11A 8ATCB 2EKYA 4LR7A 4DLGA 3VAKA 3PW7A 2B56A 2W7PA 1ZYQA 1F6TA 2AF6A 2FVCA 5T14A 1Q53A 4K50A 1SJ1A 1CBKA 1NK5A 1A7GE 2BA9A 3PJ9A 3M2VB 4KV8B 2DNRA 2DPIA 3O3LA 1QLNA 4MIWA 1QDUB 2OPPA 3U7JA 1WF0A 5F8JA 1KVIA 2VZ9A 3M4XA 4MIBA 4DX6A 1RTJA 4OYOA 3RGIA 1CS4A 3TP2A 2F1FA 4JI1F 2ZUAA 2YWGA 3VWSA 3O1LA 1QAJA 3M6UA 1HQEB 2CYYA 3V6DA 3JQKA 1R8HA 3UE2A 2MHNA 1HHQA 4FZVA 1CC8A 2RF2A 4QR1A 4KGVB 5B08A 3G86A 3JTOA 2WVFA 3H20A 2R2UA 3KK1A 3CWJA 2CPFA 1BGXT 2PC6A 1IBKJ 2GHWA 4OJHA 2W4PA 2GMHA 1UVMA 3SDEA 1HW9A 2LCWA 1FNMA 5U47A 3SCJE 4PXCA 2VFVA 2CPIA 4UY8T 4DSEA 3OVBA 4KKOA 3TX8A 5H9EK 1R8PA 1CVJA 2HEKA 1P9QC 1SBRA 5AXNA 1FJGF 2DNKA 4AFFA 5IZHA 5KFEA 4DR3J 2PI4A 2VQFF 4Q0BB 4CNZA 4H4MB 3A12A 3N6NA 2R8HA 2LQ9A 1HNWJ 4LF6J 4KH0B 1N6QB 1KNZA 4LVNP 4IOAQ 3G8QA 2CQDA 1VQKS 1JLGA 1QD1A 4O4RA 5LOQA 1VQ7S 1ELOA 5KFBA 3FEXB 4R8UB 3J80Y 2C3UA 3DLJA 4IR1A 3HD2A 5B0FA 2JOQA 4DU8A 5KFRA 1UTAA 3CULA 3MF5A 2W2PP 3LO3A 4ZVGA 1CG2A 4ZVPB 4KSEB 2BDPA 3TAQA 3CJ2A 3CEDA 1D1UA 4ED5A 2K2PA 3C8YA 3R5GA 3G8SA 2YWKA 1Q16B 3SQGB 3IAS9 4YDXA 3I0RB 1FKOA 2IY5B 3P5TL 1T8EA 1LK7A 3HHDA 3EWGA 5DDOC 4DL5A 3ENQA 3MPVA 1CULB 4OI6A 4N8OA 1K44A 4LBPA 2HWIA 3CTRA 3K89A 3P8BB 4MTPA 5L9XA 2M5YA 5LSOA 2GVZA 5L1JA 3GV8B 1K1QA 1UZHA 3CW2C 5KG6A 4DF4A 3PX4A 5H9EJ 1BQMA 2CWXA 2YVSA 4NX9A 1TUWA 4RU9A 4ECQA 1S1XA 2FLLA 2JFKA 3UN2A 3IWXA 2LMIA 4MFBB 1AUSL 2BXJA 1IUJA 4CTAB 5HVHA 2GV1A 1PYTA 2HKEA 1RP5A 1RBLA 1JLFB 1Z4UA 1DRZA 4OI0A 3V6KA 1RABB 1XR6A 3HSJA 5LL6d 2Z2LA 2OTLS 2AGOA 4W90B 3SDEB 2XMTA 3C3LA 1VISA 3BBBA 3DRXA 2XY7A 3O5TB 1YBTA 3DGPA 1TKXA 1WELA 4B3RF 2V50A 2Z57B 4HDHA 4M5JA 1T9XA 4UW2A 4Y2CA 1UEKA 5KG4A 1CJTB 5D4PA 4NLXA 4WZQA 3TUPA 1TK5A 3S01A 4EO6A 4CRJA 2HBRB 4ZN1A 4A8QA 2KZZA 1L3KA 2J7KA 5FDLA 2CDRB 3QFWA 3B4MA 2G4BA 4RBUA 2EPIA 1HW8A 2VPXB 5CYMB 3R7SB 2AU0A 3KK3B 4IRDA 1CC7A 4LFCF 3LUYA 1HNVA 5DDRC 3PYDA 3B54A 5HMYA 4DV0J 2QA4G 3BDEA 2ASJA 2RJZA 1S1VA 2N7YA 2O66A 2CQIA 2RKIB 3F41A 1MMDA 2B0GA 4UZCA 4K5RA 5D15A 4DUZF 4OZ3A 4F50A 4JV5F 3NWRA 4ILMA 2HG4A 2I2YA 5HVFA 2DISA 1JXVA 4ZPAA 5AJ3F 4IG3A 3OLAA 1UMJA 3EGWB 1S0OA 4A8XA 5GAGU 1CULA 1TMJA 2ZDPA 1XMOF 2UVRA 4DUTA 2NPFA 4CO2A 3Q8VA 3MOZA 4NCGB 4LRFA 5HMZA 4A47A 2GGPB 4DV1F 1EIYB 1HWLA 1P8GA 3Q8QB 4NXNF 4DR6J 3AH6A 2JLGA 3HVWA 4OHWA 2EC2A 1VQ5S 3N5BA 1FRLA 3D9BA 1JB0C 1OMSA 1B7YB 5K20B 5L1IA 4ZVRB 4OYBA 2D3UA 1S6UA 2J9DE 4K7QA 4MKAA 4OI3A 1CS4B 4TY9A 1FJEB 4IQXA 1JLFA 1RT6A 4L73A 2UP1A 4RW7A 3CVKA 3DOLA 2IYIA 2R8JA 3PVXA 2B5JB 3HO1A 1ICEB 3NBPA 4JI8F 3FSXA 2L08A 4ED2A 1ULRA 2IRYA 5A8RB 3FBBA 5A0YA 5IV3A 4Y00A 2MHEA 5HN0A 4QWEA 1X4EA 2OPSB 2LXFA 2VD3A 1H38A 2WSFC 4USIA 3TVKA 1JQGA 4ZLPA 1X4DA 5LJ5Y 3OSNA 1A9NB 4CLZA 1B4SA 1B70B 7FDRA 5F8HA 5AXKA 1ZTTA 3HJFA 2DY9A 3BH7B 1D3WA 4DR3F 3BREA 4TY8A 4IQMA 1G2EA 3EVMA 4O3SA 3M8QB 1RWVB 4MK8A 4IFVA 3TQEA 3MM6B 4ED6A 1Q79A 1UPPA 3RRGA 1JLCA 3Q8RB 2VDIA 1FHTA 3HZEA 3A8KA 3M8SA 2KYXA 3LQVA 4PYDA 2YKNB 3M05A 4RUAA 2G2OA 4LT6A 4LF7F 1ZPWX 1NAQA 1FVQA 3JQJA 4HHUA 1N0UA 4BDPA 1GEHA 3I87A 2WBRA 3R5JB 3OXLA 2AEJA 3MUTP 3QIDA 2HGLA 1NSQA 2W2MP 2YX4A 1YDLA 4ED0A 3UN5A 2HIYA 5THWA 4NLGA 4KYZA 4AL5A 2WONA 2O67A 3I0RA 3KFWX 4USVA 3E51A 4DG1A 2IPOB 4WTYA 4ED8A 2Y8WA 2JEFA 1HYSB 1W7WA 3CJ8A 4FYWB 2KHCA 4C8NA 4O23A 3TARA 5E3RA 4C8LA 2E44A 1WACA 5HAOA 3M6VA 1GX6A 3J7AN 5IXUA 2HNZA 2FHKA 2ZJPQ 4GKJJ 4HVZA 2W9CB 2BJEA 4R8UA 3MPDA 4C8YA 2P2CB 4NLVA 1K8AT 4QWBA 1Z2ZA 3W7BA 4DZDA 2HHPA 1BUXA 3LP2A 3M9NB 2PMWA 2VKRA 3DDNA 5ITHA 5KFCA 3FRYA 4KJIA 2Q79A 5EDWA 4QW8A 1ZA1B 1RJJA 4M5DB 1Q4RA 4Z7CA 4N5SA 3MUMP 1RT2A 5ETLA 5LSRA 2XCPA 1Y4ZB 2BANA 5GAHI 2QFIA 4MK7A 4WZMA 1RI7A 3W2VA 3BO4A 4DZ6A 1VBZA 1RBAA 3JQMA 3N6LA 1V3SA 3CDBA 3PFEA 4ZPVR 4ZCLA 3VAFA 3HK2A 4FPIA 4X2BA 4H4MA 4D3GA 1WG5A 4NCAA 1Y5NB 4IFVB 2DGUA 1S1WB 1U8WA 2Z4PA 3CO0P 5KFNA 1RWXB 1JXEA 2LVWA 1DZ5A 1U1NA 4ZVOB 1EZZB 4X4VA 4HACA 1LWXA 4BS2A 5EN1A 1U26A 1EARA 4DDFA 1RWMB 2VQEJ 1SJ3P 4WFAQ 2MQQA 5I3UB 5H9FK 1FTRA 3G96A 5LXYA 2WB4A 1V6HA 1DURA 3DOMB 1C2PA 3FUYA 3MWBA 1JIHA 4HDGA 4WFBQ 3BGFA 4FYDA 3QGGA 3PRBA 1YHQS 3G9CA 1FESA 1H72C 1T94A 2MQMA 5EHHA 4ZLJA 5E7OB 2MQPA 1NKEA 1HBMA 1WKKA 2COLA 1B0TA 3PXGa 4DSLA 4NPOA 3I55S 1M5SA 5IQ6A 4LF1A 4LF5J 4PWWA 4QYZK 5FLXY 3DMJB 2VV5A 1T11A 4ECTA 1UETA 2G13A 2PN6A 1U48A 1Q81T 2ZHOA 3EYZA 4A8WA 2GVZB 2HGNA 4P74A 4GMKA 5L1KA 3UCUP 3UO0A 2BZ2A 1Q5VA 1WHVA 2PEHA 3MI7X 4FNHA 3H40A 1DAXA 3VGTA 4K5SA 2NREA 3OXFA 2QC3A 4PEOA 3HDSA 4ZP6A 1KTVA 2R8KA 4Q8EA 4O44B 3AOCA 4DR2J 4I6YA 4FF3A 4QOTA 4TU7A 5T41A 2BJ7A 5KT4A 3TEGA 2XGPA 4ETXA 1DQ9A 4B3TF 3I6PA 2MLXA 3GB0A 3DFEA 1NJIT 4O3NA 1M5VC 4ZIWA 2Y3YA 4PG5A 1QE1A 2M70A 2CFXA 3C66A 3MMCB 2DXDA 5DGBA 1U0HA 4K2XA 4KRWA 2RT3A 2WONB 3W2WB 2RU3A 2ZNZA 3AOAA 5K8OA 1AW0A 1X31C 3GLJA 1IBMF 4F3QA 3DLKA 1WKJA 1F9FA 2IAJA 4KPYA 3PHTA 1BY9A 2ZH2A 1RAHB 3T9ZA 1IKVB 2RNEA 1W25A 3D6MB 1HNVB 2HVDA 4AE5A 1Y9OA 1WOSA 3P6YC 2OH2A 1S1VB 2XSJA 1VK8A 3RBXA 3W2WA 4DX7A 1RHRB 3S8SA 2R3VA 2UUCJ 2Z58B 2MKHA 2OI2A 3W5ZA 1JKHA 3CF5Q 1QUPA 4IR9A 1EB0A 4OQJA 4NL5A 1HQUB 1R89A 2QT7A 3DRSA 4WE1A 1QJHA 3SXLA 1HBUA 5KFMA 2JVOA 1VDHA 2HRUA 1TV6A 1NK4A 2HQGA 4HHHA 3BGRB 5ETOA 4EBEA 1D09B 4M5KA 5KT5A 3UI3A 4C2MA 3W9JA 4B9UA 4ZPDA 5IC4B 2CADA 5B0DA 2UVVA 1JWWA 4OX9J 4RO0A 2BJ3A 2L3MA 2PT0A 3R5AA 3GV7B 4C0BA 1T9UA 4P2MA 2R7WA 4IO9Q 4BC9A 1SKSA 3US5A 2JLFA 4ELTA 3HPOA 2GHPA 4RNHA 2B3TB 2C3MA 1S0VA 4ZS6A 1SIZA 2O5DA 5CH7B 4KGXB 3WC0A 4O0IA 3JAMU 3ZC4A 4DPXA 5AE1A 1WD6A 3CJTA 2JC0A 1UW4A 1HL6A 2QZ8A 4IFYB 4OI2A 4M94A 1F2HA 2IVMA 1M5PC 1F5CA 5KFPA 2V34A 1HNXJ 3IN5A 1GQEA 1C0UB 4YHHJ 2XI2A 3GIKA 3EPGA 3PX6A 1FRIA 4MT1A 2M3DA 4P75A 4O3OA 3BR9A 2ZH4A 4KBIA 4ETZA 1RTDB 3R8YA 3M2UB 1U6ZA 2YH1A 1WOOA 4MJKA 3CB4A 3QFHA 1DY3A 2VKZG 1B0VA 2EBGA 3QT6A 4NEYA 2DPJA 4ZMMA 3CCZA 4X62F 3W8GA 2F8MA 2DIUA 4ECVA 2H48B 4EEYA 3MR6A 4HEA9 1X60A 2FGOA 2ZFHA 3I9ZA 4IH6A 2E9RX 2QTWA 3D3CJ 1F2GA 1FDNA 2IVFB 2DGSA 4PQUB 4WCEQ 4NWBA 1J5EF 4I2PA 1FCAA 1HNZF 3TANA 1YK9A 1N5SA 4QYZJ 1VBXA 5J2MB 2V2VA 2K3KA 3CIZA 1BWVA 2D7SA 4QU6A 4RW4A 3QSIA 2ZH9A 1SQFA 2CQGA 3DOKA 1LNQA 4G65A 4NOHA 5IM0B 2ZH3A 3H5XA 4JUZA 2V0NA 3NS7B 4WYLA 3MTKA 3AXKA 4DFJA 5HQLA 1KKHA 3DYAA 1P9YA 2KRBA 2DRDA 2PE8A 4BWJA 3BO2A 2V8GA 3GP9A 4DU7A 1CQNA 2A6OA 4I67A 2XWYA 1XC9A 4Q44A 2ABYA 4GO5X 4RNOA 1HMVB 1HYSA 3G6YA 1Y5LB 1R43A 3H4DA 3ZTSA 4V19X 4F02A 3BBFA 4DXLA 4M5NA 2J0QD 4CNYA 2KM8B 2ZVSA 1TL3B 4F4KA 4JBCA 2UVUA 1RBOB 2HGMA 4RW8B 2HFOA 2ADBA 1KC8T 1KRPA 2VONA 3QLHA 4OYXA 3SQOP 1VOMA 4DL3A 2QIFA 2BQRA 4I6AA 4UZBA 3A3NB 4DV4F 1TAUA 3DNCA 1GXTA 4OZNA 4UUWA 3V4MA 3ITHB 4UT4A 1H0HB 2DEJA 4QBUA 5C42A 5CD4A 4I2QB 2ZJQQ 4RW7B 3KLIA 4ECZA 2GCFA 3D0IE 1GXUA 1T3OA 3VALA 1P1LA 2V2QA 5J2PB 2CQ4A 3OBIA 3GJSB 2OIHA 2ATLA 2VOPA 3IMQJ 3MMAA 5KFSA 3IBWA 1LQ9A 2OJ3A 3MMCA 4C97A 2MJNA 2ERRA 4M5IA 3EZUA 3D54A 2NXCA 4ELVA 1JLAB 3NAHA 4LRBA 3I5BA 1W2IA 1LWEA 3BBCA 2BR0A 2XS7A 2ZD1B 1XR5A 5I3UA 3ILLA 2PO4A 1U6BA 3R3TA 4G1IA 2R8GA 4NCBA 4NLWA 3BPDA 2KO1A 5J2NA 1SKWA 1QSSA 2APOA 4OI4A 4DPUA 1VCTA 4FVMA 3FZBA 1XJWB 1S1UA 2K8GA 4OLOA 4OZ2A 5CYQA 2EFQA 2PDAA 4M5DA 1N52B 1UPMB 4B3SJ 1HA1A 2GS8A 2GIRA 2VPZB 3Q23A 1X4FA 2PGCA 2ASYA 5HLFB 2KZMA 1NM2A 3U1MA 4Z2XA 2O3DA 2IA6A 4YR2A 5HBMA 1U0HB 2K7KA 2ZBIA 1VI7A 3M32B 1J5OA 3DGVA 4J9SA 2KJWA 1S9GA 3HKWA 1C4AA 2KVIA 2ZBPA 4IOBA 4UOCA 2V8VA 3PG9A 4ZVTB 2DO0A 3UQSA 3UPFA 1YITS 4LF9F 9RUBA 2P5VA 1N5YB 4DFPA 2LECA 2ZHBA 1PGZA 2XC9A 4QU7A 3NS5A 3CT9A 4C8OA 4OFZA 1C4CA 4JV1A 3OL9A 1AB8A 4C0OC 2C2EA 1H2TZ 2DNNA 1WHWA 3GG1A 1UVIA 1F3VA 2BOPA 5JVHQ 4ZITA 1YSJA 4C48A 4PABA 4QIGA 4WFYA 2DR9A 3Q83A 3GU0A 3FVYA 1CJKB 4IOCQ 2L41A 2Y1JA 4U7CA 5HI7A 2V6AA 3RB6A 2FC9A 2NSBA 1WF1A 1RTIB 3GSDA 3KHRA 1OPIA 2UVWA 4F67A 4EFAC 1JLEB 1HLWA 2G2ZA 2VICA 3D67A 4PR6A 3LP1B 4ZP9A 3IWNC 2AEFA 1P6TA 3AB2B 4FYVB 3DHXA 3WHIA 4EK2A 3UD3P 3R1LA 2DNMA 2AW0A 1O6XA 1CJKA 1M1KT 3MPWA 4E8UA 4KT0C 2ZD1A 1FDBA 4YDDB 1IR0A 3L95X 2Q66A 3CCUS 4DUYJ 2RS2A 2OHDA 2I9SA 4CYUB 2ALZA 1L5UA 2DO4A 1R3NA 2FJDB 1VRUB 2XTJP 5DDQC 2NS1B 1S1TA 4J9MA 2HZAA 2J5AA 2PMHA 4M5MA 4K4SA 4HACB 2ZC3A 1OO0B 5D8HB 1WEXA 2OMLA 1MN7A 1RHUB 4WE1B 1S9EA 3W66A 5HLFA 1PBAA 3KOAA 3LGMA 4Q8FA 2FC8A 1XIQA 3IRXA 4KE5A 2XZDB 1VIXA 1TK0A 2J0XA 2XO6A 2HS3A 4KPCA 5HQ8A 2RSQA 2WOMB 4LR8A 4F0KA 5HBMB 2VG7A 3M9OB 2K1RB 3CC7S 1HQ2A 2IAJB 2LLZA 5F41A 3TYTA 4R25A 1LFWA 1S5ZA 4UQTA 3UDEA 4CWBA 3H5SA 4JV0A 3NMRA 1RT6B 2DBBA 5ETKA 4GRSA 3PACA 1ZZFA 2C2NA 2DHSA 2BJ8A 5D0EA 2R7OA 2R7QA 4CO1A 3IFEA 3HHLD 2Z0GA 4ECYA 2BQUA 1SIWB 1QTNB 3EGNA 2WVEA 4QJVA 3KK3A 2B4UA 2MKIA 3L09A 1XNRJ 2ZM6F 4ZLNA 3K5NA 4DSIA 1UEUA 2B6AA 3ET6B 1UFKA 4Y3CA 1T03B 1C0TA 2RQCA 2J7WA 4TU9A 1S9FA 3MEEA 3CMAS 2HNYB 1WWHA 2FY8A 4Q2LA 2QSFA 2MDAA 1K0TA 3HHLC 2NXNA 3DC2A 4PQAA 2PEBA 2OD4A 2V8HA 4O4GA 3OTEA 1N36J 4FXWA 4Y2KA 4B9NA 4C3LA 3HHKA 1U2CA 2CDQA 2GAHC 4F3OA 4RW4B 2UUAF 3I0SB 3NGUA 4IG0A 4DJBA 2UXDJ 3VAMA 3FDSA 3R5CA 4HTIA 3TZYA 4GC6A 1UA1A 5DG7A 2DR7A 3M8WA 3GCXP 1Q8LA 2KYZA 2Z8QA 3PRVA 4I7FB 4ZVFA 3MM9B 3ZTPA 4DN9A 5BR8J 3KKFA 3BSOA 4CDIA 5CAAA 4BC7A 4DV7J 4FDFA 5CXTA 5F8GA 2H4YB 2NCKL 1RLCL 2H65B 5CZXA 5LM7E 3TVYA 1H2UX 2V9WA 3PO4A 1FK9A 1NLKL 2EEYA 5KFXA 1KOOA 1ZM3A 1R0AA 3TNVA 2D41A 2FTRA 4DL6A 5HROB 5ETTA 3EDRB 4ICLB 3BKUA 2DH9A 4PZVA 4JI4F 5H9FJ 1NDLA 2EKNA 1CQMA 3PIOQ 2FPHX 3DLBA 3TWZA 2IA0A 1UAWA 2OSRA 1RAJA 3QATA 4QPTA 1SL2A 3OR2A 3MURP 2J6UA 2ZZTA 4YN3B 1RHQB 3ZTQA 3VGVA 1N36F 2IM2A 4J9OA 1HR0J 3BDPA 4JV2A 3DU5A 3MUVP 4ED1A 2HZVA 2AGQA 1YKWA 3GFXA 1VQOS 3CC4S 2MPUA 1YRUA 1WJ9A 2UV8G 2HHQA 5DZ7A 3CCJS 4ES2A 1NMEB 2ZOFA 4TQSA 3R9LA 4H54A 3GZ7A 3HHLB 5J2MA 2E9TA 2A6MA 1Q1KA 3DI6B 2ZH1A 3RW6A 3O44A 3D3BJ 3MM8B 4FF4A 2HQ3A 4CO5A 4C8ZA 4ENOA 5I42B 4X64F 3MXHP 2VC1A 4X65J 1GTEA 1IKVA 2B9YA 3HI9A 1S77D 3OJSA 4C8MA 4RW8A 4UQGA 3EM1A 5F9LA 2UXBF 1BQMB 1R8CA 1RACB 1LWFB 5D6GA 1JMTA 2EFPA 3MPUB 3CCLS 4DL7A 4DR4J 1MWQA 5D4LA 1E6VA 1Q0NA 3FQLA 4F04B 2C42A 1X5PA 3CUNA 2E5LJ 1LWCA 1OPZA 3MOJB 1FKPA 4N8NA 3VGSA 4OYZA 2D3OR 2GZOA 2Q6CA 3DRSB 1RA7A 5FJ4A 2H4WB 2PA8D 1V3RA 2IFXA 4PWDA 3VVUA 5D78A 1TKXB 2LA6A 3OLBA 1RTDA 7FD1A 2FGCA 1GXLA 3QGHA 1NK9A 2CVIA 4WP9A 1KN6A 3QT7A 1K1SA 5C42B 3HF5A 5B0CA 3QJPA 3PEJA 5HSPA 4QCLA 2OPQA 5M2RA 1S10A 1F3FA 2B9XA 2ROGA 1FEEA 4LBHA 4QIVA 2KTQA 4LF8J 1TKZB 3RZAA 3DMJA 3Q8YA 1WC4A 2HLTA 4IG0B 4NLOA 3CCQS 2YPYA 2FQQB 1YZ6A 3MFHA 4AQYF 1M5HA 3BKFA 1HBOA 4XIUA 1IN0A 1Y5IB 4DV6J 5IWAF 5IFMA 4OZLA 4DX5A 5C7PA 3PW4A 3E2EA 4DCJB 3GR0A 4DQRA 3FCHA 4DSFA 1SJQA 4BHQA 2KJVA 5HMXA 3H2VE 2VG5B 2C2ZB 1FWPA 3D6TB 3HLUA 3POTB 2ZVIA 3HMJG 5EWEA 1KVKA 1RKJA 2QX0A 1ZM9A 1WI6A 2J0WA 3AD8C 4KR0B 4RUBA 1R0AB 4ZA1A 3VQSA 1NPKA 2MMYA 3BN4A 5E3AA 2XGQA 5DRKA 5J1EA 3KJVA 2R9LA 2VASA 1YJRA 2CNLB 3QAEA 4WK3A 2AJQA 3LAKA 3ZXWA 4DR7J 1FT8A 3NCQA 1NCLA 2YNFB 4Q2MA 3KNAA 1SL0A 3OXGA 1F60B 1PYOB 2KT2A 3C15A 2ZOMA 3M8PA 5ADZA 1H6KX 2CQBA 4I56A 5D3GA 3ISND 4RPFA 1FA0A 4JYAJ 3DOLB 3GV5B 4S0MA 4WFZA 1U0SA 3KJQB 1FNOA 4NASA 3UDLA 3RAXA 1QY7A 3CCMS 8RUCA 1N56A 3UCZP 2NR0A 4CLWA 2KT3A 2FJWA 1L3SA 2LFVA 1MU2B 3BEGB 2H5IB 3GYNA 4QR2A 4C11A 4CT9A 3DRRB 1UJ6A 1VGYA 3CDEA 2HHHF 2GJ2A 2I38A 2B51A 2ZWPA 3QIPA 2IC3B 3GIMA 5LMNJ 4FXDA 2OKQA 4MH8A 4C9DA 1KVJA 3MECB 2CVEA 2VHGA 2RQ4A 1RU1A 2VF3A 3AXMA 2BKPA 1FEHA 1FX4A 3GYXB 4G3IA 3F44A 4DV3F 1RT3B 3OR1A 3HFZB 5CYJA 2HLUA 1LWFA 3T9NA 2ASLA 1KD1T 4MKVA 1D9AA 2AQ4A 2HS4A 1U1MA 2RIJA 1EJ7L 2L9NA 2YKMB 3M1VB 2R2TA 2GMLA 4NLDA 3VAJA 2QGFB 2Z30B 1RGVA 4DV5J 3M7VA 2YKQA 4B9TA 1X4GA 2DITA 2KKHA 1QSYA 2MJUA 4HH1A 4R0EA 3TZZA 2UXCJ 1BXNA 2YKNA 1RUSA 5J2QB 4KC5A 4W98A 3KWMA 4Y34A 1G3OA 4XPCA 3T1YF 3OL6A 4JI5J 4LBIA 1SH3A 2H1YA 4RNMA 2C1EB 4LUBA 2W7AA 2AGPA 2BW2A 4IRCA 1I94J 2OPRA 3Q8SB 2J0SD 1S9EB 2DNQA 5ETRA 4DR5J 3GIRA 4TY8B 2HK2A 4JP8A 4JI2J 2DTJA 1NSPA 4X4RA 3DOKB 2EK6A 3N9UC 3S1TA 1TVRA 2D9OA 4ZPTR 1FWKA 4P72A 3MAAB 2YQ3A 3FSYA 4U67Q 2IMOA 3BYPA 3Q8PB 4F2RA 1WSRA 3E3XA 3L4BC 2JVRA 3VZHA 1UFLA 3NOGA 1G1XA 3NCPA 3OFFA 2MKSA 2LU2A 2P9CA 3C6UB 5KFWA 3PR4A 3PX0A 1RWNB 5KT6A 1N34F 5IV4A 4K4ZA 2KXNB 1XN9A 1M90T 4EI2A 1UVJA 4X4TA 2L48A 3ISZA 2ZBCA 2MZSA 2C2OB 2ZITA 3LP2B 2IM0A 2XMMA 4G1QB 4WFXA 1F0XA 3ENVA 4JI0F 1WKLA 1QAYA 3N4WA 2XCAA 4DS4A 3D68A 1HHTP 3SI8A 1RTIA 3GMGA 3OPKA 2Z2YB 3C16A 2P6SA 2V2ZA 4ECSA 4XO0A 4FS2A 1TKDA 3DLGB 3ENWA 1SI9A 2UUBF 1U25A 5CD4H 5HL7Q 2IMWP 1NSAA 3OFGA 4G1PA 5KFTA 1RQ0A 2DGQA 5KG1A 1RZMA 4EZ9A 1DTTB 1TTHB 1IBLF 4LIRA 2J6SA 3GR1A 4NXMJ 1XTZA 1BD6A 3MEKA 3PYGA 4ZPBA 1U1OA 3DCAA 2CJXB 5D4NA 2CNNB 3U1LA 3D66A 4IFYA 4USUA 2W01A 2E1AA 3MTJA 4RNFA 4Q45A 2R7SA 4HT7A 4USMA 5FIIA 2F3JA 1Y10A 3KNGA 1WHYA 3DLGA 4ED7A 2R7VA 4DG1B 1PJ7A 4YB5A 1HPZB 1UKUA 1FK9B 2X1GA 3FRZA 3O6QA 4H4OA 1WC0A 1H98A 1RT5A 1YVFA 3DHWC 4P10A 1Q5YA 4AUKA 4CI0B 4B9VA 4FF2A 3K5PA 4C3MA 3V6HA 2B5JA 5CCLA 2CJQA 5CA5A 3EX7B 1M1GA 4XDDA 4CLFA 4DR1F 2NZCA 1TQLA 3B8HA 2DNYA 2RUSA 3AJ2A 3PKMA 1FVSA 2DK2A 4U7UK 1EAYC 4EYHB 2HVIA 4I68A 4N47A 3BQ2A 1Y7PA 2VG6B 2G0JA 1WC3A 1U09A 1OSCA 3R7NB 2GJFA 3CNQP 3ULHA 2LYVA 4CM0A 3K5LA 2MB0B 4YY3F 1NO8A 1PYSB 1N5QA 2DIVA 2L9DA 4OV6A 3RUBL 5KFHA 3SV4A 4BWMA 3PV8A 2CNOB 1FXRA 1HD0A 1H3DA 2W2QP 3WX8A 3E01B 2OO4A 4LQ9A 4PPDA 3KTQA 1G6BA 4IH7A 1NNDA 1XBWA 3IR5B 3KMSA 2W4DA 5IM0A 3T19A 2VG6A 1I3OB 1FD2A 2LA4A 4RX6A 3KLHB 2LKZA 3IG1A 2GAGC 3BPSP 1KFSA 3VF0B 2VBWA 1T0TV 1SJFA 1S48A 3D4JA 3BKTA 1W2BR 1BC6A 4WYWA 2HHWA 5LXRA 5A0YB 3GYGA 1YBAA 3G82B 4CLYA 2RKIA 4YB1P 3HCXA 4HHJA 3OT9A 2V8DA 5J1NA 2KM8C 1CEZA 5EWFA 4PQUA 3KK2B 2VFRA 3RG6A 4AD6A 4J37A 4NXMF 3EE3A 1XMBA 2B43A 3RR7A 1JLBA 1R8AA 4OX7A 3HX9A 1JLCB 5DS7A 4DSKA 1RCOB 3FCVA 1WC1A 2K3IA 2NXUA 4Y65A 4KTQA 1Z1ZA 1CJVB 1O8BA 2VJVA 2UUBJ 1UZDA 1FDDA 1RT3A 1ZPVA 3OR1B 4LSZB 1IR1A 2GGPA 4FS1A 3QWPA 2P9GA 2DH7A 3J80U 1G7CB 1MROA 5E3PA 3BS9A 4TN2A 1UWBB 1UCNA 3DYAB 4OI1A 1KOHA 3IRWP 1CPZA 1PILA 2AYMA 2GMJA 2HQFA 4CLSA 5A2QY 2ZH7A 2ALYB 3TW0A 4KHPF 3NG8A 2NQPA 1GAOA 1I51B 3CJKA 4DV3J 3JB9k 3QO9B 2YNHB 3M2RB 2XY5A 1SCJB 4NLPA 1IKWA 2CJKA 1R6VA 3BN7A 1B3TA 5J1EB 4KIAA 5BJRA 3D0GE 2GNKA 2FLNA 2RRNA 3B6BA 5J2NB 4C6AA 4ID8A 4OYIA 5LMUJ 2B8QA 3R6GB 3CD0A 3VAGA 2D3O1 4U8VA 2DH8A 1U1LA 2EC0A 3SCKE 1DTQB 1BQNA 1VC0A 2EFOA 3CDAA 1RAGB 3DLEB 3DN9A 1I94F 2V4JB 3KLHA 4TYBA 5IC6B 4HI1A 3RW7A 1Q7YT 3H98A 2C3YA 1FFGB 1VMBA 3HJVA 3MEDB 2MZ1A 4JI5F 2NXEA 2BRKA 3DGPB 2N82B 2HMIB 2VBZA 1K47A 1RT4A 4F26A 3HM9A 3PY8A 4PG6A 1C0UA 1WF2A 4UOGA 5L46A 1OYDA 5A8KB 2LDIA 4DLEA 1NB7A 4OHYA 1FE0A 3N01A 1UVNA 3CJ3A 3W5XA 3UFCX 2VQFJ 2MGZB 1K73T 1YX2A 4JI6J 4WKRA 1RTHB 4P9SA 4LFBF 6FD1A 4Z7YA 3SMZA 5KG2A 5A2QU 4PUOA 2YWFA 4DQPA 2EW9A 3PW0A 4IKAA 3QRPA 2ILYA 1NEEA 2LEPA 1AYEA 3D0HE 4B3MJ 2BBEA 1IR2A 3BB5A 2DEIA 2XLIA 2AV5A 2MKCA 2HHVA 2GX8A 2JSXA 1Q78A 3GJQB 2FHMA 3ZZ0A 5HMWA 3RAQA 4ZJQA 1U1PA 2F4VF 2IDLA 4NLQA 3WQPA 3D28A 3FEZA 3W8PA 5I4MA 1C1CB 2R7RA 2ZE2B 3R5DA 1KQSR 4UY85 1N0VC 4USHA 3ZNUA 1YLXA 4P7TA 3SIPB 1VQ4S 4ZVSB 1R8BA 2FYXA 4ECUA 3NNHA 1R7IA 2IDEA 2FZGB 4JYAF 1RHJB 1S6QB 2FIUA 4ITSA 1MN9A 4FPRA 5KG0A 2XBPA 2AP6A 4WWSA 1UVLA 1J27A 4I4BA 2QL9B 2YQ1A 4Y28C 4HH0A 1ZM2A 3KLGB 2J9DA 3QRQA 1MLAA 4KO0A 2DRBA 1P27B 2QA2A 2WAQD 1TR0A 1U1QA 1S97A 1VRQC 1T7PA 3M8YA 5LJ3Y 2OPQB 2EFNA 2HHTA 2HWHA 2KI2A 3FJ2A 4ZDNA 2DKOB 3LGHA 3GQCA 3R27A 2GO9A 4LFAF 1ZA2B 3GFZA 3MM8A 4LREA 3EZOA 2M8HA 2V9KA 2VPWB 2YWEA 1REVA 5L9NA 2FD2A 4U95A 4Y2IA 2WW4A 2MGZA 4K4UA 3IM9A 3K7RA 3PW5A 4DV6F 3SFGA 3Q0AA 4CCHA 3T1HF 1QE1B 2BYCA 1PJ5A 1TP7A 1KWMA 3W9HA 2LQ5A 4WTOB 3MCOA 2N7CA 2M4MA 1U4BA 3VV2B 1H7WA 4LF8F 1RWKB 2LXIA 4GVLA 3PM9A 3R2DJ 4DWIA 1SKUB 3DRPA 3W64A 1VQPS 4LQ3A 1REVB 2DHAA 3LWLA 4J90A 2GVDA 4DOZA 2JHEA 3J7ZT 2XG8A 4QIEA 2FJXA 4DL2A 1AZSB 3FBFA 1JNZB 3RJMB 4X66F 4PPZA 4AYBD 3TQ1A 4I69A 4W4MA 2CPEA 4DV2F 1WTFA 1I6JA 1IXKA 3BGOP 1XR7A 3O8WA 4P7VA 2KHDA 2W9AA 1SL1A 1TUVA 2OP5A 4RBTA 3M8PB 1AROP 2MZRA 1LEOA 4OZ0A 2HRTA 4V1Ak 4DI6A 2GFFA 4OX8A 3SEOA 1KONA 2R4FA 1URRA 5ETPA 5KFAA 1TL3A 2E5LF 2M8DB 3KMQA 1EHWA 3IBFB 2XMUA 3HT3A 1S6PB 1T05A 4K59A 4RU2A 4EYIB 1X9MA 4DV2J 2VA2A 4JI3J 1UVKA 4DR1J 1JLAA 2J8SA 3D1HA 5HO4A 4B9LA 3NOCA 4NYZA 2YNIA 4M95A 4ED4A 5KTQA 1JKHB 4L76A 4OJGA 5G4DA 2F8HA 4CO0A 3BZQA 5DGAA 2X3GA 1YJVA 4ALZA 1LFPA 2BW7A 5KAKA 3ONQA 1FKAF 3TA2A 4ICLA 3CMQA 1D8YA 2B9WA 4NZ0A 4AL6A 2X3DA 2XYHB 3IR7B 3UDCA 4J9UE 1TKTA 2V69A 3A1YG 3LALA 2HQCA 2L9WA 4HYKA 4YS2A 4DN0A 1MMLA 4OMFG 5BXIA 2LDYA 4DQSA 2HNDB 3CJSA 2ZKUA 3T1HJ 2XNRA 2C2RA 2OELA 1FO1A 2VBYA 3OD2A 2XB2D 4EWTA 1GT8A 2BANB 4I7FA 3W5YA 3ILIA 2RD5C 4O0NA 4YFUA 3ZNJ1 2BMBA 1LW0A 3RB3A 2CQ2A 3ZZOA 1RK8A 1T95A 2H9ZA 3BGLA 4DL0C 1HWUA 3GPAA 4LFAJ 2W25A 1HHSA 2RDIA 1IKYB 2RE1A 3LP0B 4J5OA 3IXQA 4JI4J 4L74A 5FDLB 2QL5B 3CJ0A 3SCLE 1R0CB 1SVDA 1HARA 1RT7A 2CA9A 1TL7A 5EUHA 5ETVA 4ZJOA 3HULA 5HK4A 1FRXA 3UCGA 3VHQA 2FJVA 4YB7A 1PBUA 3CIMA 2MKYA 5ETSA 1B0PA 3EXYA 2M2BA 5DQGA 3RB4A 3PYEA 2Y0SD 3K59A 2E1MC 2IJRA 5BYSA 1O5JA 3AY0A 2AMCB 4IG3B 4NA1A 1M0SA 2UUAJ 4A8YA 3AJ1A 2HAIA 1JLQB 2W7OA 3BJYA 3G82A 5E3QA 2XI3A 3AD7C 4UOFA 1WC6A 5KFOA 4F2SA 3CXCR 1XNQJ 1EKSA 1EQMA 2OD6A 2QRRA 4I1TA 1WG1A 5IQQA 5M2UA 4JB8B 5I42A 4LJMA 3J81j 6FDRA 1Q8BA 1RAEB 3RBDA 3ZZZA 3AJDA 2QE5A 3QRRA 3GWCA 4ER8A 3TX0A 2ZH6A 4U8YA 4DSJA 3NCRA 4KGKA 4B3MF 3ISNC 1FWLA 1PIEA 1XMQF 1X5SA 3QJJA 1VRUA 3BSCA 3A8IA 1VS3A 5K14B 1CJUA 4C0HA 3TR5A 1DJ0A 1DTTA 1IM4A 2C3OA 2V4JA 1LOUA 1DHMA 3HVTA 4O44A 5GADU 2MEWA 4FYXB 3CCTA 2XQCA 4E0DA 1QSLA 1C0TB 2MTLA 3C2PA 2E9ZA 1LWCB 2CJYB 2HK3A 1N54B 2JJ4D 3HVAA 1LV5A 2OPRB 5KG5A 2R7TA 1N4LA 2DT9A 1NHUA 2OSQA 2KN4A 9ATCB 3CMES 4QIWD 4ZCKA 1NU4A 3TZXA 3GJRB 3JYTA 1S4EA 2CQHA 1LW0B 2OFHX 1RT1B 3QT8A 5B7WA 1XMQJ 3QYYA 2ZJRQ 1U24A 4N56A 4AL7A 4QPXA 7AT1B 3K8WA 3T6BA 2W1BA 3F73A 1FD8A 2IRUA 2K7JA 3AAWB 3IS9A 2Q1LA 1C1BA 3S6EA 1PJ6A 3C6UA 3BQ1A 2HHHJ 4ID5A 4CIOA 5ETNA 3KJVB 4Y2MA 2RUGA 5GMDA 1NK0A 4W92B 2DD8S 3HHLA 2I5JB 2JEGA 1RADB 4Y0FA 2HRYA 4XAKA 4WXOA 4OV1A 3PJXA 4EO8A 3MM7B 2DHGA 2E5IA 2H51B 3LPYA 4J7CA 4XTTA 5AXLA 4QIFA 5B0EA 1RDRA 1T05B 3Q86A 2ROPA 1YTYA 2VOOA 4X4UA 3JSMB 3H4BA 5JUMA 1N5YA 1KEKA 2HMIA 1UFWA 1JJHA 1YQHA 1FRJA 2KB2A 4QQBA 2D1CA 2QMUB 1V3ZA 3M6XA 3PYFA 8AT1B 3FQKA 3NS6A 3VCDA 4K8RA 2MY7A 3DRRA 1VYAA 1WG4A 3GFYA 4C11B 5KFJA 4ERDA 2BKOA 3B82A 1FX2A 3ET6A 1T03A 3VAHA 5MLCV 1RHMB 2IRXA 1JLGB 2MZTA 4B08A 4F4ZA 4B3OA 3DXSX 4KFBA 3M2VA 4KV8A 5AE2A 4U7UD 4P73A 2AD9A 4DX8H 4GVBA 1VIOA 1RT2B 1SV5A 2RDDA 1SJ4P 1NHVA 1RYRA 1ZAXA 1X4HA 5F8IA 3G71S 1TAQA 3DI6A 1X4CA 5E2QA 3L3CA 4B17A 5DLFA 3LW5C 1YJ7A 2CJAA 2BM0A 2YNFA 3B4DA 3H2UB 4OZ1A 3UR3C 3UW1A 4BLGA 4PRFA 5IWAJ 1WDTA 4KH1B 4NA2A 3T5KA 3G6XA 3V81A 4X4SA 1RA6A 1OIAA 2X1AA 3UN3A 2I0XA 3QT5A 1WNEA 3PFOA 3CCES 3U27A 4CYUA 3QZ8A 2HS0A 3CCVS 3IR6B 2HIQA 1FDAA 3IA0A 3NP5A 4ZP8A 4DFMA 2CWKA 1S1TB 2RQKA 1JJCB 2AX1A 2OGUA 4ZVHA 1E6VB 3BGUA 4AXIA 4USWA 3JTPA 5F8LA 5A6PA 4P71A 4HI2A 5CHCB 5HROA 1WORA 4CH0S 1DLOA 1EKRA 3W2VB 4ATNA 3HXMA 4JI3F 3KLFB 3R6LB 4N41A 1GMUA 1U2FA 2HBQB 4O3QA 4ZKAA 2ZZNA 4KO0B 4ES1A 4WFNQ 2QA4S 3DRYA 2CZ9A 2E29A 3MZIA 4QW9A 3GIIA 1ROFA 1IKWB 1YRTA 1WOPA 1PO6A 3M1VA 2CQ0A 3DLKB 4PWUA 2Y1IA 4I2PB 5A76A 1ZTWA 1H2VZ 4DR6F 3SSQA 3NNAA 3DLLQ 3FFIA 1IQTA 4NA3A 1IWAA 2PIIA 4RKUC 1V5VA 3W1YC 3SV3A 2MYFA 3IRXB 2HFZA 2GA7A 1Z2LA 3PDNA 4DEZA 3IGNA 5J2PA 4FBUA 3K17A 4ZVQB 3MM5A 3NGRA 2C2KB 2DNHA 4RW6B 4X66J 3KLEB 2R2RA 3OTDA 2X1BA 1RB0A 2E1CA 2MQOA 3X1LB 3QGPA 1WSVA 3V6JA 1VQ9S 4X65F 1X4BA 2WSEC 2DYAA 5DG8A 1DQ8A 3P45B 1S6PA 4OJ3A 2DNOA 2NYIA 4ZK7M 1LKZA 2JLEA 4C8KA 3NGKA 2KU7A 3M30A 5KOWA 3I56S 3UVJB 2G1DA 4NI2A 2IYGA 3FZ2A 2Z2MA 4WP8A 3RRHA 2CQCA 2BJDA 2OAUA 1N6QA 1HWKA 1IKXA 4TLQA 1YIJS 2W4CA 2XLKA 4PUOB 5L39A 3SYZA 4A4JA 3D6HB 3G87A 5KFQA 1HR0F 4U6PA 1NSKL 2AJ2A 2XHCA 3NGDA 1WEYA 2GW8A 2HBZB 1S4FA 4K2JA 3OHBA 2XWXA 1NZAA 5EGYA 1FJCA 4M63A 1MNEA 2QA1A 3UVJA 4F0HA 4YP3A 2J6TA 3SSSA 3MMBB 1LW2B 1OSDA 3BF4A 1FRMA 2F9JA 1NJYA 4JI0J 5C25A 4EUVA 3LANA 2NYHA 5KFIA 2MLYA 3EVOA 3OTCA 3W62A 1MSWD 2GQQA 1GMWD 2E1RA 1NUEA 1TL1B 2XYGB 1RYSA 1UP1A 3NKYA 4CZCA 1CJVA 1TZ0A 2VFTA 3DLEA 1FRKA 1QAXA 2OUGA 1N34J 3IO1A 1MU2A 4PYAA 2AJFE 2F5GA 4M1KA 3WDOA 3SCIE 3NY0A 4P2XA 1HBOB 1AA1B 3HFKA 1AFJA 3CJ4A 2HPUA 1S79A 3FFIB 2UXDF 2O1PA 4YMEA 2MQNA 2B7CB 2Z56B 1SUQA 4JI2F 1DQAA 2AZ1A 1FTCA 4DR5F 4F0MA 5DDPC 3JSRA 2DNLA 2Y0BB 4NZ7A 4P52A 2AJ1A 1KLNA 2F4VJ 1SC1B 2RAQA 1S49A 3JXOA 2YX1A 1R6YA 2HVZA 3EMTA 3IG1B 4U96A 3I82A 4FNIA 4A48A 1MWZA 3J7YU 2XMJA 3T1YJ 1T02A 2YWHA 1UL3A 2F63A 2VFUA 3MR7A 2NUHA 3JSBA 3D5MA 3M30B 2W8KA 1OS5A 2C2MB 2X1FA 2V63A 1SJRA 2CZVC 1FRHA 3TAMB 2F40A 4BCAA 3QIPB 1NBEB 3QBCA 4EBCA 1S59A 3NWGA 4LVOP 1RT7B 3Q8UA 4DPOA 2VIHA 3H5YA 4DF8A 1S7IA 1XK8A 4JI6F 2HFNA 2NZ4A 3TZWA 2ZE2A
chains in the Genus database with same CATH topology
1KLMA 2FLPA 4ID5B 3JSYA 4YB6A 2CPHA 4IUFA 1HI0P 4TNOA 5L1LA 2NUUG 5F9NA 2XLJA 3BQ0A 4BBYA 3H25A 3NRBA 2BE2B 5JVGQ 3WC2A 2PI5A 2KXFA 4X4PA 5G0RB 1D0EA 2FVRA 1J2VA 2J76E 3MR2A 1OQ3A 1VK3A 2A2DA 2IBKA 3KLGA 5KFDA 3G6VA 3T3FA 4URSA 3W3SA 5LMUF 2A2CA 3HZGA 2J9EA 1TK8A 1KQFB 3JAMY 1VQ8S 4CH7A 3Q22A 4A8MP 2G0CA 2Y1RI 5H1SV 3NAIA 3ZFVA 3ZZTA 5JJBA 4J9NA 1C1CA 1URNA 3B78A 4RWWA 1IKYA 3LP0A 4ED3A 1S72S 2MKJA 3M2UA 5C24A 1VBYA 4FP9A 1Y00A 1R27B 3ZZRA 1YJTA 3OV7A 1V9OA 5BYQA 2ZKTA 4Q5VA 1C1BB 2FUG9 2FHJA 3MGJA 1JJ4A 1HWJA 3MAQA 4CT8A 2ACYA 1SXLA 5D77A 5KG3A 1ZM4A 4MFBA 1SH0A 2VG7B 4Q43A 4YR0A 4B3OB 2ZUGA 2QO3A 5DJBA 3K0JA 1Q86T 4ZOSA 1KR4A 3ZZUA 4L3NA 1UJ4A 2M7SA 3CO9A 2I8EA 1EETA 3QAUA 2XMWA 2VL1A 2ILZA 4DBQA 1YRXA 2JX2A 2POKA 4J9RA 3NL0A 2G9OA 4ILRA 3JSMA 2CPDA 2A1BA 2HZCA 4CO4A 2AYGA 1UEVA 1U1KA 5B0BA 3FMWA 2F7VA 3CD5A 3MEDA 1HQUA 1VLYA 2JRSA 5F8NA 5KT3A 2AX0A 2MY8A 1S76D 5JXSA 3UNGC 3G4SS 2DGVA 1S1UB 2WHOA 3N28A 4JOUA 3PKYA 2KRRA 1NRKA 3F56A 2FDNA 1VFJA 3MM9A 4I6WA 2YTCA 4DR4F 2QLXA 5KFFA 3OUYB 1Q82T 3OVAA 3N5FA 3TUIC 4TXSA 1TL4A 3CGIA 3THTA 3VR1A 1HFEL 3MEGA 1KQKA 2CIMA 2ZC4A 2EI5A 2GC8A 4DQIA 2CRLA 5FD1A 5BYRA 3FNNA 2VG5A 3MHYA 1NH8A 3L7PA 3OJUA 3OR2B 3MM5B 3K58A 2GIQA 3MD3A 4TQRA 5J2QA 5M2PA 5KFZA 1U7LA 2PMZD 1X8DA 4FN5A 5KFLA 2KXHA 5E0OA 3G6ES 3IC1A 1RISA 3IWLA 3CD7A 2E5GA 4NMLA 2CG4A 2JEIA 1XNQF 2YKOA 2IM1A 1TFYA 3BM7A 1MMNA 4QZVB 3I4HX 1O51A 5C5JA 4QWDA 3MR3A 1SH2A 1RTJB 3MPYA 4R5PA 2QLWA 2WOMA 2J9CA 5A8WB 1RTHA 4F4WA 3H59A 2MSSA 4KKOB 2FLOA 5I3PA 4O3PA 1NJXA 3EGZA 3QGIA 2HWTA 2QV6A 2M0GB 2OMOA 1XEZA 5F8MA 2D3ZA 2E5JA 2KT5A 2GQ2A 3KK1B 3THVA 3OQ2A 2B6AB 5BR8F 1QVGR 3PHEA 1S9GB 2DNGA 4PXBA 5DLGA 1S0MA 4DS5A 3GIJA 1D9FA 4Y2AA 1SKRA 5CZVA 5E33A 3CCSS 3T6JA 2Q3PA 1NK6A 4F4XA 2A18A 3H2LA 3OFHA 1FJ7A 1VQMS 3I5AA 5CQGA 5T7LB 3LH2S 3MCSA 4RW9A 1VJWA 2NSCA 3RYLA 1N5TA 2XS5A 3KLFA 1SUQB 2UXCF 2MSTA 2DNZA 1XNRF 2IJFA 4PG4A 4A8KA 2JWNA 2OFGX 4DV5F 1HNIB 2CPZA 4O3RA 5DETA 1LWEB 4P2SA 3TA1A 1VQYA 1QUVA 2V5HG 4OL8A 3C6TA 2BQ3A 2BABA 4YUDA 3MMAB 4RUHA 3LWMA 1T05B 2JL9A 2RU9A 4UUXA 2F9DA 3TOQA 2MZJA 4IYQA 4TU8A 4ZHRA 3V4IA 1BQNB 1DARA 1U1RA 1VC5A 1QAIA 3PW2A 3SZ2A 2N3LA 5LMNF 2VB6A 5A8WA 2RMLA 4ECZA 5LT5A 1E6YA 1JNRB 2KG1A 2J7UA 4D3HA 4J9KA 4NLRA 2CKWA 4A46A 4C3KA 4DUYF 2UV8A 4QWAA 1ZETA 3FEYB 5KFGA 1U8SA 2WW8A 3ZZYA 4PG8A 2E66A 3EUNA 4MAKA 4NYOA 4NYPA 4RUCA 4LSNB 1NJWA 1TV6B 2DRAA 2QYCA 4DMZA 1Q7LB 1HBUB 4DR7F 1X7VA 4MKBA 5L38A 4ZPCA 4N77A 4RNNA 3M8QA 4Q7AA 4USJC 3E8OA 4XPEA 1FKPB 2DJWA 4NZ6A 3TO8A 2DVIA 1WEZA 2EFVA 3J7Z5 1ZAVA 4RZRA 1JLBB 1U47A 4YEAA 2WCXA 2X51A 4KAIA 1AXQA 4EZ6A 3P3DA 2DCLA 2SXLA 4DV0F 1P1TA 3RTVA 1S6OA 3ITHA 2DGXA 2PSZA 3A8EA 5KFKA 2DNPA 2M88A 2BE2A 2YKPA 2KFYA 2H5EA 3N6MA 2CQ3A 2YKMA 2C3PA 4KB7A 3RB0A 3CDUA 5EX0A 2J8AA 1O0PA 1TL5A 3U02A 4WU2A 3NMAA 2B4VA 3WBZA 2XO7A 4MKYA 1TKTB 3FGVA 1U6FA 5EWGA 1MROB 1XWLA 3NNCA 2QMWA 1Y3KA 2LQJA 2LU1A 2RB7A 4ZP7A 4C7QA 2VODA 1FE4A 1KFDA 3AA9A 2CJBA 3KG4A 5AE3A 5GAHU 1SC6A 2XULA 4X84A 1X9WA 4FBTA 2I5JA 1ZOTA 4AXJA 3D1QA 1GNKA 2XSFA 1KS2A 1NKBA 3J7A1 4LMZA 1DTQA 4R5PB 3UR0A 2VPYB 4XK8C 4HL9A 5KOXA 4R0JA 3I5CA 1S7HA 4ES3A 1HQEA 3V6DB 2ASDA 2AYBA 5IS2A 3QLHB 4IH5A 1FF2A 1KTQA 4ZPWR 2VA3A 3PRDA 4KHMA 2AWZA 3HKZD 2CPXA 5F3ZA 5AXMA 2R7XA 3DDKA 4TLRA 4B02A 4WJBA 3DRPB 2FHJD 2XS2A 2ZNYA 5KFUA 1BWEA 5DQHA 1IQZA 4MIAA 5KT2A 4X4QA 4K4VA 2ADCA 2XMVA 4XDCA 1JJ2R 4PWDB 3S7RA 3K2YA 3VTIA 3M9MB 2B7BB 4OLPA 4G6VB 4L6V3 4MYTA 4I0WA 3Q24A 1Q8IA 3KLEA 3DLHA 1X4AA 3Q2TC 5GAEI 1X5OA 5GMKa 4LF6F 2UUWA 2JFDA 4FVCA 2MZQA 4E98A 2PA3A 3V2UC 4I64A 1YJWS 1IBKF 3N0VA 2XHWA 2LQBA 2D9PA 4MYUA 2ROEA 3KHHA 4GKJF 3OUYA 3LOUA 1F5BA 2EG2A 1F5AA 3PIOQ 2D74B 3OFEA 1IJFB 4NLYA 3RU0A 4ED2A 1HPZA 5G0RA 1H7XA 1QM9A 2QFJA 3I31A 2F8EX 2QEXS 2W9CA 5B0GA 1DBDA 1DLOB 2JH3A 3PO5A 3UD4P 4DV7F 4A8SA 3AQOA 3BGRA 4LSLB 5HP1B 2DGTA 4DFKA 2NLWA 2MXYA 2C22A 1FERA 2HVHA 2HHXA 4GO7X 3EPIA 1FXDA 4ECXA 3MD1A 1CLFA 1LXNA 4OHVA 2VUGA 2RS8A 1PC5A 5KG1A 2ZOGA 1VQOS 1N36F 2HHQA 2VBXA 2IBOA 1IJEB 2YKAA 3PIPQ 3D2WA 2FHOB 5E3CA 1S1WA 2FB0A 2OPSA 2IVYA 4NLUA 4OHZA 1HBNA 4OJ1A 5J2PB 3THPA 5SUHA 4F25A 1VQLS 3TAPA 4X4OA 4PCQA 2GHVC 4OZ5A 1QTMA 1D8ZA 4EU0A 4EGLA 4YHHF 1Y3JA 1HNXF 2Q6BA 4NLTA 1HBMB 1X5TA 2W9BA 3MFIA 1XERA 2BVZA 2Q43A 4O4GB 4TYAA 4F3MA 3CD6S 3IAM9 2EWHA 5SZTA 2DGWA 3DOMA 2CQPA 4WF9Q 5A6WA 4ECWA 1NJZA 3FSIA 2LEAA 3M6WA 2FVPA 2DCUB 1M5KC 3O2IA 5J1PA 2YH0A 5DO2A 2RDJA 2DR5A 1R31A 1HI8A 4NRTA 5KT7A 1N32F 2OTJS 2IHR1 3I96A 4CTAA 3AHPA 5KFYA 2OPPB 3T1AA 3QO9A 2HQIA 3DU6A 3GFHA 3K5MA 2KDOA 4RW9B 4K4YA 3P96A 3IGVA 4QYRA 1RT5B 4WKYA 1IKXB 4YR3A 2UUCF 4KFBB 4MK9A 1KHWA 2W24A 1NH7A 4FF1A 4OHXA 2VH7A 2QMXA 3MEEB 4YOEA 1VQNS 2WB1D 4N76A 3R1HA 2CZ4A 2HHUA 3HP6A 3WX4A 2ZHAA 1VHFA 2CPYA 3TUZC 1X0FA 5DG9A 2XY6A 2BUNA 1Y0HA 3KLVA 4JI7F 2B4PA 2KFNA 3HHEA 2AYEA 3HHNB 2DR8A 4NLSA 3OTBA 4I2QA 3T5JA 2P9EA 4GC7A 4V19J 2LXUA 1SV5B 3BO3A 4DR2F 3G8TA 2V4QA 2U2FA 3BSNA 3LF0A 2FJAB 4WU3A 2HYIB 2V94A 5IT9Y 2IM3A 3J81Y 2ZDOA 4B3SF 2YY3A 2WRMA 3TVZA 1GTHA 1PC4A 3C46A 4URQU 5EX3A 1YG0A 1YJUA 3VQTA 2R2SA 1N48A 1MW7A 2WSCC 4K4WA 1N8RT 5L8RC 4QWCA 1S0NA 2JC1A 3HVTB 4P6QA 1YWXA 3TAMA 2EK1A 2C28A 1YJ9S 4OX6A 2E7WA 4TKTA 5F0UA 4ZCIA 5GAGI 1EP4B 2EFGA 1YI2S 4ZVEA 1LW2A 4K4XA 3DM2B 2B4OA 5B0AA 2CJ9A 2R7UA 3I32A 1S1XB 4H4KC 4OZJA 2QSWA 3M8RA 2PFFB 3V5RA 2FVQA 2ZZMA 4HLBA 2HNDA 2EBEA 3PNIA 3LP1A 5T7LA 3QMQA 4NRUA 5CYQB 1K9MT 2OLWA 2YNHA 3M2RA 1L3UA 4RLEA 3I4PA 2YNGB 2XMKA 4Z37A 2HNZB 3VAIA 1DFDA 3DXBA 2P6TA 1VRTA 3NLCA 3SQGA 2MKKA 3JTNA 2BRLA 4J9QA 5DM7Q 1A6LA 3BR8A 3ZZPA 1D9DA 3QWUA 3L7OA 1U45A 3C6TB 3OW2R 1WI8A 4PXEA 5KFVA 2YNGA 4LIWA 2FVSA 4ILLA 3TUJC 2XSJB 2PD1A 4WIIA 1EETB 1NK8A 2RQMA 4K4TA 1SB6A 3LAMA 3M32A 3X3UA 1J5OB 3KK2A 4A8FA 1APSA 2BV3A 4Y6IA 3IS9B 1AUDA 3ETOA 1JLQA 2RRAA 1X9SA 1NK7A 2YX7A 3JYTB 2XZWA 3K5OA 1RT1A 2KH9A 2FJEB 2BM1A 2VC0A 3RAMA 2N3OA 3HVRA 2E5HA 4IDKA 1ZH5A 2KFZA 4X4NA 1X0PA 3CCWA 1TL1A 1U2RA 3OVSA 3CPWR 1LXJA 3J7YI 5K14A 1RT4B 2JZ5A 3ICLA 2JDJA 3MM7A 4B9SA 4LSLA 5HP1A 3PEHA 4H4KA 3UWTA 2W8LA 4RBVA 1YJNS 3KLIB 3AQPA 3QZ7A 4WK1A 2W9BB 1MWYA 5E5NA 3H8YA 1CSJA 1HD1A 2WTFA 1TKZA 4DQQA 2M52A 3T5HA 2NPIA 1JLEA 2RVJA 3BSAA 3OHAA 2CPJA 4M8LA 1N5VA 4QR0A 1L3VA 3AB4B 4H4OB 4F8RA 4PKDB 3CC2S 1T3NA 5DM6Q 3RRKA 5K8NA 3PJWA 1EP4A 2RH3A 1WTBA 2UUTA 3RR8A 4L72B 2N4DA 4YQWA 2MQLA 5A8KA 1FKOB 1TVRB 3KYLA 3T5LA 1UJ5A 2GJIA 5F3TA 2R8IA 2VFSA 1BLUA 1HWIA 4OX9F 3KG1A 2HNYA 2RF2B 1RKIA 1I1GA 3U1NA 2HHSA 3VZIA 3H5UA 3LGNA 2ZH8A 5D4OA 1JXLA 4A8OA 4IDKB 2LEBA 4DL4A 2E7XA 2K1RA 3EZ5A 5D3GB 1OQ6A 5K9FA 3I9V9 3TA0A 3N79A 2RILA 2DGOA 3K8VA 4LF4F 1L3TA 5I3QA 4WXWA 4PXDA 2EG1A 3CJ5A 4KHRA 1SQEA 2WBMA 3I0SA 4MMOA 4IRKA 1S6QA 1M5OC 1UWBA 1N33F 3MECA 1N88A 3CCRS 3EXCX 3GG0A 4IO1A 5K5MA 4LSNA 2N4CA 3SFUA 1FNXH 3D1OA 4NCGA 2DB1A 1VQ6S 1HNIA 2FY1A 2CQ1A 5MAOA 1JX4A 1ZZNA 2M9KA 3R5BA 5IT0A 2XNQA 1U49A 3MMBA 1TFWA 1KHVA 2GQCA 1HI1A 3GE9A 5K8PA 1UA0A 4GKKF 5GVQA 3PR5B 4FXVA 3NBPB 2UU9F 4ZCMA 5IT4A 4K0KF 3MDFA 3OTOF 1BQXA 1HBNB 1YGYA 2EVZA 2GO8A 1NKCA 2V4RA 3CJKB 1JK9B 3KG0A 2DHXA 4ZHRB 2XEXA 3V4IB 4ECRA 4C8OA 3FMBA 5C24B 1E6YB 5CYMA 1LK5A 3TRGA 3TI0A 2I1RA 3KHLA 3DM2A 5K8MA 1B7FA 5E41A 1HMVA 3KHGA 1GH8A 3E01A 2V2KA 3OL7A 1VC6A 3AA8A 2WK4A 4RW6A 2C2DA 3MR5A 3POTA 4LF5F 2O01C 2AJ0A 3MMJA 2U1AA 5C25B 2RRBA 3MEGB 3K57A 4CH1A 5DQIA 4RWXA 1RWUA 3WZ0A 1ZAWA 3P49B 4CQ1A 5B09A 4HKQA 3RBEA 1PSDA 1VRTB 4OIXA 5F0WA 4KGMA 5A8RA 4J9LA 1S99A 1QVFR 2VQEF 3CDWA 5GADI 4B9MA 2HW3A 2UZAA 2FJBB 4G1QA 5KG7A 3SSRA 1ZBTA 4URGA 4U9RA 3QPIA 5GAEU 2ZH5A 5CCMA 1WHXA 3PZPA 4Q0BA 1OWXA 3CE8A 4C98A 1B64A 4DHVA 5LSLA 2YNIB 4J9PA 1KQGB 2KG0A 2BACA 1VQSA 2AJ4A 4F4YA 1KSPA 3OSPA 2IC3A 3CSKA 3MM6A 4HTJA 4HT5A 3GILA 3MAHA 1HNWF 1KLMB 1GX5A 2A10A 2A3JA 3Q2SC 4KQZA 4CO3A 3V81B 2IJNA 4PG7A 2JEJA 4C4WA 2EKYA 4DLGA 3VAKA 3PW7A 2B56A 2W7PA 1ZYQA 2FVCA 2AF6A 5T14A 1Q53A 4K50A 1SJ1A 1NK5A 1A7GE 2BA9A 3M2VB 4KV8B 2DNRA 2DPIA 3O3LA 1QLNA 4MIWA 2OPPA 5F8JA 3U7JA 1WF0A