2DTHA

The crystal structure of the orthorhombic form of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotin and adp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dthA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dthA01
1SETA 4P72A 1D3BA 4M75F 3JCMJ 2ZT5A 4H2SA 3CMQA 4CH3A 1EVKA 5GMKm 4RCCA 4WF2A 1ASYA 4Y91A 1WNLA 2FYKA 2J3LA 3KFUA 3A7RA 2G4CA 2ZIMA 4M7DD 3V8JA 2ZZFA 3V8LA 2EWNA 2E5AA 4NL3A 1USYC 2AKWA 4JRIA 2ZR2A 4LNSA 3HY0A 3QTCA 4M7DC 5GAOq 3HXYA 3A5ZA 1RIQA 4CH5A 4XU3A 3A31A 4M7DG 4X5OA 5C51B 4YRMA 1E1TA 1SERA 1EOVA 5GMKe 3A74A 2IY5B 4M77D 3ICAA 3AHUA 4TVYA 4M7DF 3BJUA 3BW1A 4M77C 1PYSB 4P75A 2Q7EA 2E3CA 4YROA 5LJ3g 2ODRD 1C0AA 3VBBA 3V7RA 4M77G 4H02A 2CJAA 1WPYA 3L4GB 2DTOA 4H2TA 5C52B 2ODRC 2ZXFA 3HXWA 4XEOA 4P74A 4XTVA 2ZZGA 4EO4A 4UP8A 2VXFA 2Q5HA 11ASA 4M78G 4M78A 4P3NA 3VU3C 5HGQA 4M77F 5GANe 2HNIA 3SWNB 3L1AA 5GMKj 4P73A 1BBWA 4P71A 2ZZEA 4M7AD 1JBMA 5GAOm 4PJOB 4YRLA 3REXA 1N9RA 5GANh 1NYRA 3RKYA 4M7AC 1B7YA 2CJBA 3JB9I 1YFTA 3JCMe 5GAN6 1EIYB 1NNHA 1M8VA 4M7AG 3G1ZA 4YYEA 3HSBA 1JJCB 1YFSA 3VQXA 3JCMW 4EMHA 1GGMA 3JCMh 5LJ3j 1X56A 2RM4A 4J6XA 5LJ5g 3LSSA 4C8QE 1I81A 4M7AF 3NENA 5LJ5d 4TQFA 2YLBA 1Y96B 4CS4A 2ZCEA 2RHQA 3MF2A 4H2VA 4YRCA 3M4PA 3EFSA 5DY9A 2RHSB 4N0AA 2ZNIA 4F7UB 2E65A 4DPGA 4YRJA 4YRSA 4C8QA 1TH7A 1MGQA 2DVEA 4HT8A 1EQRA 1WLEA 3JCMQ 3JB9J 2JN0A 5GAMd 4G84A 4XQ3A 5GAN5 4JRKA 1EFWA 1I4K1 3RACA 3NEMA 3PCOA 2DXUA 4PG3A 4P3OA 3RKXA 4RMFA 3RL6A 3FB9A 5GAN4 4K87A 4KR2A 1NJ2A 1E22A 3A7AA 4TVAB 4O2DA 1LNXA 4CH4A 5LJ5f 4C92B 4P72C 4YPFA 1X01A 3HXXA 4ZIBA 4WJ3M 4XTWA 4CS2A 1WYDA 5F5WA 4M75B 1JRIA 1J5WA 3QSUA 1IL2A 3HFZA 4YREA 4TVAA 3FIFA 3JB9H 2XGTA 2E1HA 5GAMf 4EMKA 3BFMA 1N9WA 3LC0A 4HWTA 3UGTA 1ASZA 4TQDA 3VQVA 3IKLA 1B34B 2AMCB 1HC7A 4H2UA 3L2ZA 1ADJA 1NJ8A 3A7UA 3TEHB 4XTZA 3NELA 4HA8A 4A54A 4WJ4A 4YCWA 3V8KA 2EJFA 2DZ9A 4RQFA 2CIMA 1M5Q1 3PGGA 1H4SA 3HTZA 5K1XA 4P75C 4M7DB 1WU7A 3MF1A 1EVLA 5K1PA 2DEQA 1E1OA 1HXDA 4UPAA 4M78D 5GMKh 4P74C 1U1TA 3EFRA 5GMKi 3QO7A 4J5YA 3JCMV 4M78C 5GAOr 2IY5A 4PHCA 5GAN2 4M77B 5LJ3e 4UP7A 4P73C 2ARUA 1PYSA 2ALYB 2CGHA 4P71C 4JUVA 5GMKl 4QVCA 2C8MA 2ZTGA 3TEGA 4EMGA 3L4GA 4QVDA 5LJ3h 3QHSA 1B70B 4M78F 1KMNA 2QHSA 3QUIA 4PJOE 3V7CA 2I4MA 3JB9G 2I4OA 2DQ0A 4CH6A 3ERRA 1W66A 3RIRA 1I5LA 1G5HA 2YHTA 3SWNA 4JLIA 2Q7HA 3MEYA 5GAN3 2ZT7A 2DDZA 2DZCA 3GIBA 4PJOA 2J3MA 2RA2A 4M7AB 2I4LA 3QO8A 3UFGA 1H4TA 1BIAA 1EIYA 1H4VB 4C8QD 2ZNJA 2Y90A 4N0AC 3OD1A 1JJCA 2VXEA 4K88A 4C8QC 5LJ5e 4XTUA 5GAN7 2ARSA 2DXTA 3HRKA 4RDXA 4F7UE 1YCYA 3IALA 4C8QG 5GAMg 2EL9A 2DQ3A 4KR3A 1H641 5ELOA 1KMMA 1Y96A 3LSQA 4YRKA 4C8QF 2RHSA 2EAYA 3P8VA 4YP0A 4F7UA 1U1SA 2Q7GA 4DQ2A 5GAOl 2DTHA 4XU2A 3NETA 1ADYA 4HWOA 4YCUA 3UGQA 3VQYA 4HT9A 3HFNA 1NYQA 1X2HA 4BW9A 4C92E 3HXUA 2DU7A 5LJ5j 3HXVA 4H2XB 1G51A 4CS3A 2DTIA 4M75E 4WI1A 4E51A 3W3SA 3I7FA 1H4QA 2CJ9A 3V7SA 4EMKC 4YRGA 3JCMP 4ZTUB 3RESA 4HVCA 4C92A 3IKMB 3BDUA 3REUA 1YFRA 4OLFA 1X55A 1WQWA 4X9CA 4P3PA 5GAMj 4HWPA 4M75A 2K57A 4XTYA 4OP0A 5GAOp 1QF6A 2ZGWA 3P8TA 4L87A 4YRIA 3HRIA 5I21A 2AKWB 1SRYA 1LYLA 2P0LA 1B34A 2AMCA 4J15A 4TVWA 3TEHA 4RCBA 1FYFA 1X54A 4M7DE 4YDQA 4TTVA 1BBUA 3HY1A 4NOYA 1G5IA 1LOJA 3RERA 4UP9A 1NJ6A 4Q15A 1KOGA 1USYA 3R07A 3DSQA 3BY7A 1QE0A 2ZT8A 4M7DA 1NJ1A 4H2YA 3TUPA 5ELNA 4YRNA 4M77E 2RB6A 3JB9D 1ATIA 1WQ7A 4X9DA 1YGBA 1NJ5A 3QO3A 4M78B 3HFVA 3M4QA 4M78E 1LJOA 4A53A 5GAN8 2VC8A 4ZTZB 2ZIOA 1VQZA 2E64A 2EJ9A 3FJPA 4M77A 3SWNC 5GANg 4PJOD 4Q6GA 4V2SA 4NCXA 2ALYA 5LJ3d 4PJOC 2XTIA 5GANd 2ZINA 1B7YB 1Z7MA 3JB9F 1I8FA 1B70A 5KNNA 4PJOG 4XEMA 3M4GA 3JCMg 4M7AE 3WQZA 2Q5IA 2P5IA 5E3IA 3QO5A 4J6YA 2DJZA 3PZCA 3E9HA 4TWAA 3VQWA 2E10A 4MMKA 3JCMd 4HWSA 3JCMc 5GAOn 4PJOF 3QNEA 5CAIA 3HXZA 1L0WA 1N9SA 1HTTA 4NL2A 4M7AA 4XTXA 4AH6A 1B8AA 3RF1A 2C7IA 5LJ3f 1X2GA 2RHQB 4J6WA 1KQ1A 3RUXA 4K86A 4YRPA 5GANf 3UH0A 3JCMX 5LJ5h 4XU1A 1YB3A 4YRTA 2YLCA 4C8QB 5GANj 3RKWA 3JCMb 4HWRA 3A32A 3RGLA 1HK9A 4MMLA 2FB7A 4YRQA 2RD1A 3INZA 5GAMe 5C53B 4F7UG 2DU5A 4BWAA 2EJGA 3JCMf 2E41A 1KQ2A 3PCOB 4XU0A 3HFOA 4YRFA 5GAMh 2I4NA 4F7UF 4C92D 2ZT6A 2QHVA 2QHTA 4YCVA 2DKGA 2PMFA 2I2LA 4EX5A 4M75D 4C92C 1Z7NA 3SB2A 4YRRA 1B76A 3P8YA 4C92G 4M75C 1D3BB 2ZR3A 1E24A 4RQEA 12ASA 3HFZB 2ARTA 3E9IA 1BIBA 4PNOA 4H2XA 4KQEA 4M75G 2PMEA 2QHUA 1SESA 4EMKB 3IG2A 4G85A 4H2WA 3A5YA 2QTXA 4C92F
chains in the Genus database with same CATH superfamily
4P72A 2KGTA 3EGDB 1KC8U 4FW1A 3JCMJ 3CMQA 1E7OA 5I22A 3ULRB 1GXIE 1EVKA 4A4KA 1KD1U 4RTWA 2K5IA 1UHFA 1ASYA 5DM7R 1WNLA 2J3LA 1G5VA 1GRIA 2ZIMA 1ACMB 1VQMT 3HY0A 2EGEA 2CDTA 3L2RA 4M7DC 3M0SA 4CH5A 3A31A 4OB0B 4OMLA 4M7DG 2ATCB 5KYNA 2VB6A 4YRMA 2A3LA 2EQUA 1EOVA 1FMVA 4J9GA 2AKLA 1JU5C 1TWBA 3AHUA 1SSHA 3BW1A 3CQTA 2Q7EA 4YROA 1H92A 1C0AA 1OYXA 2CJAA 2DPPB 3PFSA 1GBRA 4JJDA 3H41A 1MNDA 2ODRC 1FWZA 5CK9A 4EO4A 2VXFA 1RI0A 2Q5HA 1NPPA 3CPFA 4IURA 4P3NA 4WCIA 5HGQA 2MWPA 2P4RA 1AZEA 5DLQE 1QVPA 1JQQA 1MV0B 1D09B 5GMKj 4P73A 3CCLT 2P0KA 2ZZEA 4M7AD 1FXXA 1G3WA 1PD1A 2CP7A 4PJOB 3REXA 4E7KA 2RJFA 2NUTA 3VS3A 3CCJA 3GOXA 1NYRA 4GLMA 3S3MA 2K3BA 4C5IA 2CJBA 3JB9I 1YFTA 4OMMA 4OMOA 4KGZB 1M8VA 4YYEA 1SKUB 4JZ3A 1K8AC 4MZPA 1NG2A 3CCJQ 3JCMh 1X69A 3TEEA 5LJ3j 2RM4A 3PMTA 1BKBA 2DM1A 2PUKB 1VQ9A 2MWOA 1ZSGA 2JJ9A 2B86A 4RTYA 3QJ6A 4ANJA 4M7AF 4RTUA 2JVVA 5LJ5d 3NMZC 2EBPA 2YLBA 2KRSA 1RLQC 4H2VA 4YRCA 3SEMA 2QQSA 3M4PA 2M02A 1YJWA 3CCQA 1VQ9Q 2JTFA 4F7UB 2E65A 1NEGA 2V1QA 2MYSA 3UA7A 2EQKA 2ZZDA 2DVEA 3JCMQ 3CC4T 4ZN3A 2MAMA 4J8OA 2JN0A 1X2KA 2BZ8A 4XQ3A 1YJWQ 3CCQQ 4JRKA 1I4K1 4K11A 2RI5A 3RACA 3TVTA 3PCOA 4C0ZA 2BUDA 2D8JA 3RKXA 4RUGA 4KGVB 1WHJA 2QDLA 3FB9A 4RG2A 5GAN4 5HCKA 4K87A 4KR2A 1NJ2A 3M0TA 1UB4A 4J9EA 1M3BA 3J81E 1VQKT 1E22A 3EFOA 4TVAB 2H3JA 6AT1B 3G4SA 2HMAA 2C0TA 1SPKA 3QDRB 4CS2A 5F5WA 4LDUA 1IXDA 1ZUKA 3CXCS 4E2FB 1TXQA 1VQOQ 2IIMA 2GQIA 1M2VA 4QT7A 4YREA 3G4SQ 3OYEA 1ZSZA 1N9WA 3MPUB 1WZOA 2JNGA 3IKLA 2EQIA 3L2ZA 1WLPB 1NJ8A 3A7UA 3TEHB 3NELA 4HA8A 1IGQA 3M0PA 4YCWA 3OBYA 1IO6A 3X28B 2OX7A 1T3SA 2RK2A 3HTZA 1G3YA 2DAQA 4O6JA 2CZ1B 3MF1A 2V1RA 2CZ7B 1V76A 5EG2A 5K1PA 2DEQA 3DLLA 1Q81U 3UA6A 2LMJA 3WVEB 2EYQA 4C0FA 3QO7A 3CMAT 4M78C 3HRSA 4D8KA 2C06A 1KC8R 4PHCA 3QZ9B 5GAN2 2Y4YA 1QP2A 3GLXA 5LJ3e 4UP7A 5AYFA 3GP8A 3G71T 4HKEA 4P71C 5GMKl 2ZTGA 2GFUA 4LDXA 1XNIA 3TEGA 2J6KA 2OTLA 4EMGA 3UPUA 1H3ZA 4HCCA 1UJ0A 3QUIA 3V7CA 3OMCA 1NJIU 4CH6A 1D0XA 3ERRA 3H0IA 1W66A 3RIRA 4FT4A 2OTLQ 1QCNA 2DZCA 2O88A 2DL3A 4FSSA 1W2BS 2A37A 2J3MA 1YJ9T 4M7AB 2I0NA 2YUQA 3GNFB 3UFGA 2FRYA 1H4TA 1BIAA 2FO0A 2KDSA 2ZNJA 3PVLA 2E6ZA 3OD1A 2E70A 5I11A 1JJCA 1QCFA 2VXEA 4K88A 3X24B 3FC3A 3MJXA 5LJ5e 1CKBA 2ARSA 1T0JA 1JXMA 3OS5A 3IALA 2C0OA 2EL9A 1K9AA 2DQ3A 3OYKA 1XOVA 2ENMA 4C0GA 2XKOC 1Y96A 1I1JA 5FU6B 3LSQA 4YRKA 2BE9B 5KYWB 5A2QE 3S3OA 4DQ2A 3VS5A 2QASA 4HWOA 3VQYA 1K4US 1B7TA 3QIIA 4XAXB 5CKFA 4BW9A 3MEVA 4ZGDB 4RMOA 3EG1A 4A4FA 4CS3A 3BE3A 4BB7A 2F2VA 3AT1B 2QQAA 4L5GA 2RMOA 3E2UA 4WI1A 3W3SA 3I7FA 2CJ9A 4EMKC 1VQNT 3I55T 2VGNA 1X43A 2QGGA 3RESA 4HVCA 1XJWB 1ZA1B 3IKMB 1YFRA 1X55A 1KG1A 5A0GA 5GAMj 4M75A 4ATOA 2J05A 2K57A 2M1HA 4OP0A 4GLKA 3LX7A 2K3YA 1QF6A 4ZTFA 3UDCA 1M90C 3P8TA 3HRIA 3CMEA 1YWPA 1SRYA 3LWIA 4TVWA 4RCBA 1FYFA 1GCQC 1EZZB 4YDQA 2EKHA 1BBUA 4NOYA 1M4ZA 4X34A 5FRMA 2H3EB 3H6ZA 5FW9A 4AG1C 3CCUA 3DSQA 2O9SA 4HVVA 1QE0A 2ZT8A 2CP0A 1G3SA 4M7DA 1KK7A 2A0FB 3LYIA 3MHXA 3OYAA 2KBTA 4F16A 1UEBA 2KSSA 3M53A 2RJCA 3VS4A 5KYYB 5GAN8 4JPBW 1AHJB 4KH1B 1RI9A 1EIFA 3FJPA 1FX7A 1KSWA 1NLOC 4NCXA 3PNWC 4KUDK 3MKDA 1NZ9A 5GANd 2GBQA 2M0OA 2GQVA 5J39A 5IHIA 1Z7MA 3EG2A 3TSWA 4RTZA 2DRKA 1VYUA 5HK3A 1B70A 4Y92A 4DA4A 3G7ZA 1QMCA 3M4GA 4XEMA 3JCMg 3CPWS 4AG2C 3OSVA 4J6YA 1VQ4T 3ZBDA 4Q5WA 3JV3A 3M5AA 3JCMc 5CAIA 3HHTB 3C95A 2CT4A 1HTTA 4FYYB 2F5KA 4LDVA 2HD0A 3QG1A 3R6NA 4XTXA 1MMAA 3OBWA 2C7IA 5LJ3f 1X2GA 1YITT 5IH2A 4YRPA 4C5GA 1YFNA 4C0DC 4XU1A 5GANj 2NUPB 3JCMb 3CC7A 3A98A 2FB7A 4YRQA 2RD1A 5GAMe 4M4ZA 1GL5A 2DU5A 2EYXA 4PFPA 4BWAA 4ME7A 1VQ7T 2CZ0B 4JJCA 1KQ2A 4LNPA 1G83A 5HY6A 3CC7Q 4C92D 4QKUA 2QHTA 2I2LA 4WTOB 1IZ6A 4KT0E 1Z7NA 3SB2A 3OYCA 2PU9B 4BDYA 4ZNXA 3HFZB 1LPLA 4PNOA 4H2XA 1MMDA 3QXEB 4J9HA 2QHUA 2OAWA 1QVFS 2DXCA 4A4EA 1YI2A 4C92F 2RHZA 5CQXA 1N6AA 1SETA 1KHCA 4A4HA 1D3BA 2FPDA 2K2MA 1FYNA 3LGLA 2ZT5A 3VYGA 3FEOA 1D1BA 1NEBA 4CH3A 3EGXA 1YHQT 1YI2Q 2AZSA 4QVZA 1QLYA 3A7RA 2F69A 4BI3A 2G4CA 3RMQA 4A4GA 2IG0A 2MMPA 2EWNA 4NL3A 2NWMA 1USYC 9ATCB 5EC7A 1GFCA 3CC2T 2MK5A 4XU3A 2DD5A 2GNCA 2XDDA 2P0QA 1FMKA 5C51B 2LZ6B 1E1TA 1SERA 4B9WA 1YJNA 3EAEA 4M77D 5CCAA 2DL8A 2D9TA 2CSIA 1PYSB 4LD9K 2KXDA 1VQ6A 2X4JA 1YJNQ 4LVLA 3FJ5A 1AEYA 4IIOA 3L4GB 4H2TA 5C52B 3HXWA 5IXBA 1Z9QA 1RADB 2ZZGA 1CKAA 1PG5B 4UP8A 2ECZA 4FSXA 2H8HA 4M78A 1S72T 2VKNA 1AWXA 1XTDA 2F2WA 1VQ6Q 4M77F 5GANe 3SWNB 4IUVA 2K6DA 4GBQA 1BBWA 2QTVA 4P71A 3VKIA 3META 4YRLA 2LT4A 4DBHA 1B7YA 2K79A 1AWWA 5CQYA 5GAN6 5KH6A 1J3TA 1BBZA 2WACA 4KULA 2YUPA 2QEXT 1QVGP 1X56A 3LH0A 1NLPC 4C8QE 2L0AA 1ABOA 4PFOA 3EG9A 2ZCEA 2RHQA 3MF2A 3M57A 1IGUA 3EFSA 4R0KA 2RHSB 2ZNIA 3O5ZA 1QVFA 2QA4A 5A0LA 1TH7A 2CREA 1MGQA 1WHKA 5FU7B 2D0QB 3A8MB 4DBQA 3JB9J 1OEBA 3A8GB 2EQMA 4G84A 5GAN5 2F2XA 4P3OA 5IAYA 3RL6A 3G6ET 3CEYA 3NTKA 3A7AA 2CYZB 1LNXA 4C92B 3CMAQ 1X01A 1JB0E 5A0DA 1M1KR 1RAHB 4XTWA 4ZIBA 3OYHA 1VQ5T 2PVDB 5KYUB 1J5WA 2GF7A 4BACA 3H0FA 1RACB 3SD4A 3TU4K 4TVAA 3MP6A 2CUBA 3EG0A 5GAMf 4EMKA 1Y07A 5CKDA 4HCKA 3M9QA 4J7IA 1ASZA 1B34B 2AMCB 3PIOA 1UG1A 3I56A 2OTJA 4XTZA 1ZUUA 1TSFA 1VQPA 2EJFA 2DZ9A 1U8RA 1R8OB 1T3LA 2CIMA 2ZPBB 3I56Q 2OTJQ 2LJ0A 2AT1B 1PM3A 3PGGA 3A8OB 4JJNK 2HAXA 3CCET 2HKNA 1QKXA 1WU7A 1WI7A 1VQPQ 3X20B 2G3RA 2O4XB 1GCQA 2RNAA 4P74C 5GMKi 3GPLA 3CCMA 1SHGA 1YBYA 2IY5A 4OB3B 1OPKA 1QWFA 3MQZA 4M77B 4AT1B 3REBB 2ALYB 2DO3A 3CCMQ 1WHGA 2E4HA 2C8MA 2ZPEB 1VQLT 4ELZC 4QVDA 1ARKA 3QHSA 1KIKA 4PJOE 2I4OA 2IPOB 1PRMC 4Z8AA 8ATCB 3QPHA 4JLIA 2Q7HA 2JM8A 3MEYA 5GAN3 2YDLA 3PTAA 4DBRA 4HVWA 2BIVA 2RA2A 2RI2A 3QWXX 3CBMA 3DB4A 2I4LA 5CKBA 5FLXE 1U3OA 1EIYA 1H4VB 2AHJB 3M4YA 2SEMA 2Y90A 3HRUA 4N0AC 4E6RA 4C8QC 3PE0A 1Q7YC 2X35A 1M1FA 3HRKA 4FYVB 4F7UE 1YCYA 2FG0A 3ZFJA 3M58A 4C8QG 1OU8A 2LQNA 1LCKA 3DLMA 1KHIA 3EGUA 5KE2A 3L2QA 1UJYA 5HK0A 1W4SA 4IIMA 2KI7A 3UATA 3CCRA 4YP0A 3CCVA 2DNUA 1U1SA 2Q7GA 2RO0A 1BU1A 2EYZA 3DB3A 4XU2A 5GAOl 1VQOA 4E7ZA 2DBMA 4HT9A 4E7LA 4FW2A 4LUDA 3JRZA 1WFWA 1X2HA 1OZ2A 3RBBB 5LJ5j 1KD1C 1EX4A 3CCRQ 3CCVQ 2BE7D 1G51A 4RG8A 1PWTA 4E47A 1F1BB 1VQ8T 1E6GA 1OI1A 1VYVA 4J7FA 4E51A 2CZ6B 1JJ2P 4YRGA 3CD6A 3C12A 4OF1A 4ZTUB 2JS0A 1ZBJA 3SFMA 5AT1B 3CCSA 4BE1A 2EIFA 4FL6A 2COZA 2B8AA 1MUZA 3CXCP 1C1AA 3CD6Q 1WGSA 5GAOp 2ZGWA 3CCSQ 4L87A 5KYXA 4YRIA 2HCKA 5I21A 4FYXB 1KQSP 5DLOA 3WVDB 2NLUA 2P0LA 1UGQB 2HSPA 1K8AR 2AKKA 4J15A 2FRWA 2QQRA 3OW2P 4F17A 3U23A 4PLIA 1M3CA 3M55A 3HY1A 1G5IA 1LOJA 2HQXA 3D7SB 3H0HA 4OGCA 2MOXA 2PTKA 1USYA 2RJEA 4AMCA 2E5QA 1NJ1A 3TUPA 2MPXC 4YRNA 2RB6A 5IHKA 1M90U 4HXJA 1U5SA 2RJDA 4BY6B 2K5FA 2FZKB 2ROTA 1WJSA 2ZCFB 3M4QA 2LX9A 1VOMA 3QJYA 2CSQA 1ZLMA 2VC8A 4ZTZB 2E5KA 1MNEA 2ZIOA 2A36A 2M16A 2EJ9A 2YXYA 3L2WA 3OYMA 5L23A 1IB8A 4BD3A 3EH1A 2X4WA 5KYYA 2NUTB 4PJOC 3ER0A 3OA6A 2E3IA 2BZXA 5KNNA 4PJOG 2G6FX 3KXTA 4FT2A 4M7AE 3WQZA 2YUNA 2Q5IA 3GNGA 2QDYB 2LT1A 2DJZA 3PZCA 1PSEA 3E9HA 3QYHB 4TWAA 3JCMd 5KCHA 1UECA 4BE0A 1M9SA 3RUXA 1TUDA 3UH0A 2LNVA 4MDXA 1V29B 3QBYA 3INZA 4F7UG 1OQKA 2ESWA 2PZ1A 4B9XA 2FHDA 2XIDA 1YIJA 2E41A 3ME9A 8AT1B 5M9OA 3PCOB 2QK0A 1GCPA 4E7IA 3EFOB 4BDZA 4OMPA 4YCVA 4M75D 3L2VA 1M2OA 1SG5A 1YIJQ 2JM9A 4IUTA 1PCXA 3FRNA 4II1A 2DERA 1KQSA 3M59A 4RQEA 2HL3A 5CIUA 1M2VB 4ZTJA 2KK4A 1BIBA 2LTOA 2PMEA 2VGMA 3HTRA 2DYIA 3P8DA 1ZSZB 3OS2A 4G85A 4H2WA 1D1AA 1AT1B 1QP3A 3REAB 5J3BA 4Z02A 1BI1A 4J9FA 3CCJT 4EIKA 4M75F 4H2SA 1AWOA 1S72Q 1M1GA 5GMKm 5L8RE 4WF2A 5LL6S 1T0HA 2HZYA 1X6GA 5IHNA 4M7DD 1WHLA 2V8KA 1VQ9T 1N5ZA 2AKWA 2ZR2A 4LNSA 4JRPA 1RAAB 2X3WD 2YSQA 2XG8D 3A5ZA 2O31A 1RIQA 2KAFA 4X5OA 2CP3A 3HL8A 2KT8A 2EFIA 3H8ZA 3CCQT 1YJWT 3A74A 3ICAA 3TREA 2GCXA 4M7DF 4AFSC 2E3CA 1KFZA 2ODRD 3MEAA 1WDXA 4UC4A 1WPYA 5C6SA 3HP9A 2DTOA 3X26B 2ZXFA 4P74A 4OMFB 3VYHB 2VYTA 4J9CA 3G4ST 2HNIA 3LH5A 1SSFA 4E7SA 3CBPA 4JRQA 3EG3A 3TQ7P 4XK8E 2RQTA 1N9RA 3A8HB 2ZPGB 4M7AC 2A08A 3JCMe 3OYDA 3OYFA 4M7AG 2MCNA 1JJCB 1M1KU 3JCMW 1VQ5Q 5CR2A 1NM7A 4EMHA 1GBQA 2DILA 1GGMA 2P4TA 1M90R 2KXCA 4KRTA 4J6XA 3LSSA 1VQMA 2KQWA 1I81A 3VV0A 3NENA 4OB2B 4TQFA 2CP5A 1Y96B 3QZ5B 5FU6C 4N0AA 1VQMQ 2KR3A 2YT6A 2BTTA 4YRJA 4C8QA 4YRSA 2DF6A 4L6V5 1WLEA 1I5OB 2PVOB 4ZN1A 2AK5A 4PLLA 3NTIA 4B6MA 2E3HA 4Y28E 5IT9E 2CKKA 1VYTA 2DXUA 4PG3A 1Q86C 4RMFA 3QYGB 4J9IA 1MMNA 4LVJA 1N27A 1AZGB 1FMWA 3FLGA 4O2DA 4CH4A 1BI0A 5LJ5f 1YP5A 2OJ2A 1N8RC 4YPFA 1R0BG 4PKCC 2OTLT 1PRLC 3HXXA 1H3HA 1HYOA 2R58A 3OSSC 2KE9A 4M75B 3CCLA 1JRIA 1OPLA 1UGRB 2J6FA 2O9VA 3QSUA 1H8KA 1NYFA 1Q82C 4BI8B 2RQWA 4ORZA 3BFMA 3LGFA 1QKWA 3LC0A 1K73C 3CCLQ 4HWTA 3LWHA 4TQDA 3VQVA 5KYUA 3EGDA 4H2UA 4TVRA 1ADJA 2LRQA 3OYJA 4DOVA 4J9DA 2DVJA 1SRMA 4R56A 4DEYA 2DX1A 2WSFE 1VUBA 1M5Q1 3PMIA 3OY9A 1JEGA 1H4SA 4QQ6A 5K1XA 1BB9A 4P75C 4M7DB 3VJPA 1EVLA 2LDMA 3OQ5A 2M0YA 4UPAA 1NYGA 1ZQ1A 4M78D 3VS1A 4C5EA 5GMKh 5KE3A 2EYWA 1U1TA 3EFRA 3CC4A 4J5YA 2EPDA 3JCMV 1BI3A 2COWA 3S3NA 1JXOA 3HKSA 3N5BB 2DBKA 4CI0C 2O4XA 1G8XA 1NPRA 1VQKA 2CGHA 3CC4Q 2F5TX 2K9GA 2VV5A 4JUVA 4CC3A 1PKTA 2JUFA 5LJ3h 3NHNA 2ZAEA 1B70B 4M78F 1KMNA 2QHSA 2P84A 2I4MA 1BI2A 1Q86R 1VQKQ 3OYGA 2EVRA 1G5HA 1P92A 1N8RR 2ZT7A 4F04B 1VQ8Q 1RL2A 1ZBXA 4A63B 4PJOA 2VVKA 2V8IA 3J80E 2L8DA 4CC2A 2QQBA 1UUEA 3UF4A 3QO8A 3VUBA 1Q82R 2HQEA 2CH4W 3CMET 1QWEA 1OULA 5FWBA 1K73R 2J06A 1UE9A 4XTUA 5GAN7 2XD0A 2DXTA 3VS2A 1UGSB 1Y0MA 1WHMA 2VUBA 4X1VA 4KR3A 2CUDA 1H641 3IQLA 5ELOA 1KMMA 1VIEA 3CCUT 2K2VA 3J7AF 3R6OA 4FU6A 3A8LB 1K8AU 3CMAA 2HSEB 2EAYA 2DETA 2XI9A 3P8VA 4F7UA 2D1XA 3P8BB 2DK3A 2DRMA 4MDWA 3NETA 4YCUA 1ADYA 1K0XA 3UGQA 2JT4A 4PL6A 2K4YA 2RQUA 3HFNA 1PKSA 3G71A 1NYQA 1X27A 4C92E 4D6WA 2DU7A 1C6VX 4H2XB 2JMAA 4QQDA 2IVWA 3EHQA 1H4QA 1M3AA 1ZA2B 2LCCA 3V7SA 2JW4A 3JCMP 1NBEB 3G71Q 5HKCA 4OMQA 1W70A 1UDLA 4PFZA 4KUIA 4JDSA 1ZHIA 3I35A 3REUA 4OLFA 3A1PA 2W10A 1RAEB 4HWPA 3EGXB 2P0PA 2OI3A 4MZMA 2JTEA 2WSEE 1YJ9A 1K9MC 3QWYA 4IUQA 2E12A 5C0MA 2COYA 2DEUA 2D6FA 2RI3A 2D8HA 1LYLA 3OYBA 2GTJA 3LLRA 1YJ9Q 4E7HA 1OOTA 1PSFA 1WYXA 1IRXA 1IREB 3TEHA 1OV3A 4AFQC 5FROA 1O75A 4QQGA 3LW5E 4BI4A 3CC7T 3EH2A 4J83A 4Q15A 1KOGA 3BY7A 2X4XA 4KBMB 2HBPA 4N4GA 1PHTA 3MCAB 1R77A 5FRNA 5ELNA 4M77E 2NS6A 2LJ3A 3JB9D 1KJWA 1ATIA 1QQJA 4EDUA 1YGBA 3QO3A 4M78B 4M78E 2DL4A 1OU9A 2E6NA 3G1JA 4A53A 1QVGA 3S6WA 1VQZA 2E64A 1R0CB 3SWNC 3Q1JA 2DL5A 4V2SA 1VQNA 5LJ3d 3I55A 4FYWB 3M0RA 3C0CA 2ZINA 5FWCA 2KNBB 1B7YB 2L3QA 1SF9A 3JB9F 3ZL7C 1YI2T 5J26A 3RR6A 1VQNQ 3I55Q 1X6BA 3OMGA 2P5IA 2GFAA 3QO5A 2DD4A 3VQWA 2E10A 4MMKA 5GAOn 3VRZA 3H9NA 4CRIA 4M7AA 1Q95G 3EG9B 1K9MR 2RHQB 4RKUE 4J6WA 1KQ1A 1MHNA 2KROA 5GANf 4YRTA 3MP8A 2GTOA 2YLCA 3CBOA 3RKWA 2FEIA 3A32A 4MMLA 2X4YA 2XU8A 2ED0A 5C53B 5FU7C 1MMGA 1Y57A 2XMFA 1PD0A 1YJNT 1D0YA 1KC8C 2EJGA 1BYMA 4XU0A 2JS2A 2LQ8A 2CS7A 4FIBA 5GAMh 2L3SA 1WJRA 2RHXA 2QHVA 5KYWA 4LD6A 1VQ6T 3VUZA 2X9HA 4C92C 3BDLA 4OB1B 4YRRA 3M54A 4C92G 2ZR3A 1JJ2S 3O8VA 1E24A 2LJ1A 12ASA 2EYYA 3E9IA 3E19A 4KQEA 1TTHB 3HRTA 2EKOA 4EMKB 1Y71A 3OB9A 2EW3A 2QG9B 3NTHA 5CVIA 1VQ4A 3TSZA 2YRCA 5KCOA 4RCCA 3M0UA 1KQSS 4Y91A 2FYKA 2PQWA 3KFUA 2LQKA 3NPFA 2DA9A 3OW2S 1VQ4Q 3V8JA 3QDFA 3V8LA 2ZZFA 1YITA 2E5AA 4JRIA 1X75C 1IHVA 2JMCA 4DEXA 3QTCA 2GGRA 2YUOA 1K0SA 1G2BA 5IN1A 5GAOq 3MEUA 3VS7A 3HXYA 2FPEA 1O9SA 1Q7YR 4DOWA 1YITQ 5GMKe 1VQ7A 2QA4T 3HPWA 2ABLA 2IY5B 2QGFB 3OS0A 4F14A 4TVYA 3BJUA 1HSQA 4M77C 4P75A 2DJQA 1G3TA 2YRDA 4CC7A 5LJ3g 1YCSB 3VBBA 5D6XA 3V7RA 1TU0B 1VQ7Q 4M77G 4H02A 1WJQA 2RN8A 1BCMA 4P5NA 2XHCA 4LVIA 4XEOA 4XTVA 2KEAA 4J9BA 4LE9A 4JS4A 11ASA 4M78G 1KD1R 3VU3C 2BZYA 3L1AA 3WXMB 3OYNA 2PNIA 3OYYA 1JBMA 5GAOm 2QYZA 3PVQA 5GANh 1ABQA 3RKYA 1RLPC 4C5HA 2BKDN 5D6WA 4IKFA 1X2QA 3MP1A 1EIYB 1YHQA 1NNHA 2LC4A 1W2BP 2DFUA 4N4HA 3G1ZA 3HSBA 1Y7XA 1YFSA 3VQXA 2XDPA 3I56T 2OTJT 2CP6A 2HQHA 1S1NA 5LJ5g 1U06A 1TUCA 1VQPT 1YHQQ 2KMTA 3CC2A 2FZCB 4RTVA 3ASKA 1JJ2A 1RAGB 4PJLA 4CS4A 1PC0A 3RDVA 1I0CA 4C0DB 2V26A 5DY9A 2D0NA 4ZGJB 2L89A 1SHFA 4KH0B 4DPGA 4PJNA 4HVUA 2O2OA 2DIGA 2XICA 2XK0A 2NUPA 3CC2Q 2K3XA 2CT3A 4L59A 3CXCA 2CH4A 1BK2A 4HT8A 1EQRA 1ZUYA 2O01E 3SHWA 5GAMd 2EGAA 3CCMT 1E6HA 1EFWA 3NEMA 1BCOA 5I2SA 2FZGB 2EGCA 2L3RA 1SRLA 3OW2A 1S72A 2R57A 2DXBA 4P72C 4WJ3M 4LUEA 1RUWA 1WIEA 1WYDA 1WHHA 2M51A 1IL2A 3M56A 3HFZA 3SDZA 2Z0WA 3KBGA 1C0MA 3FIFA 2HL5C 3OYIA 3JB9H 1Q81C 2XGTA 5KYXB 2E1HA 2KRNA 4ZGEB 3UGTA 1B3QA 1WX6A 3KUFA 1WXTA 1HC7A 2RHYA 2LCLA 2QQ9A 3I5SA 1Q86U 1B07A 2QEXA 4A54A 4WJ4A 1W1FA 3V8KA 1QW1A 2ROLA 3TCJA 4LXCA 4RQFA 4QW2A 3FDRA 4ESRA 1N8RU 1WXUA 3MO8A 5CKEA 2HDAA 2QI2A 3I5RA 2QEXQ 4JZ4A 1HD3A 3RMSA 2KRMA 1NJIC 2DL7A 1XQHA 4O5VA 1AD5A 3CMEQ 1Q82U 1OX8A 1HXDA 1E1OA 2LVMA 4BY6C 1HJDA 4PJMA 3CCRT 1K73U 3CCVT 5GAOr 2EQJA 3I9QA 4FCYA 1VQOT 2JXBA 3G6EA 3PT9A 3E1SA 1ZX6A 2K5LA 5D6YA 1W2BA 1PYSA 2ARUA 4P73C 2X3XD 1UGVA 7AT1B 3CCUQ 4QVCA 1OX9A 3L4GA 2QAZA 2PUOB 2AIRB 1VQ5A 3CD6T 3JB9G 3G6EQ 2DQ0A 1RAIB 3DKMA 3C94A 1I5LA 3CCST 2YHTA 3SWNA 2DLPA 1AVZC 1D0ZA 2DDZA 3CPWP 2NUZA 2DIQA 3VS6A 4HT4A 3GIBA 1NE8A 4IUPA 1DJ7B 4JJBA 4JS5A 4VUBA 2L5QA 1VIFA 2L2PA 4ELYC 4DBFA 4C8QD 1Q81R 1EFNA 2V8JA 4YTLA 3UT1A 1I07A 1YNZA 2YWWA 1WA7A 3VRYA 2W0ZA 4RDXA 2RQVA 1WXBA 3CCEA 2AZVA 5GAMg 3JSCA 1UGPB 2RH2A 2J7IA 2YRVA 2XDBA 2Y4XA 2L3PA 2SRCA 4C8QF 2RHSA 1JO8A 1TOVA 3E9FA 3CCEQ 2KYMA 1RABB 4BE2A 2ZPHB 4LVMA 2DTHA 2VASA 1NJIR 2OAUA 5GJVB 2MIOA 3HXUA 3HXVA 3VS0A 2DTIA 4M75E 1VQLA 3L2UA 3GF5A 2MI6A 3URGA 1ZSZC 4OMNA 2RF0A 2J6OA 3C4SA 2WSCE 3KFVA 1W6XA 1YWOA 5D7UA 4C92A 3BDUA 1QVFP 4AFZC 1WQWA 2LNHB 4X9CA 1VQLQ 4P3PA 4PK4A 2K7AA 4XTYA 2A28A 2ED1A 4NS5A 3NFCA 1K1ZA 2R5AA 2RPNA 2FVUA 1PNJA 1X6OA 2KT1A 2A7YA 2AKWB 3UWNA 4FM4B 2QXFA 4E7JA 1M27C 3A5ZB 1B34A 2AMCA 2CP2A 3X25B 3P8HA 1OZ3A 5GJWB 1X54A 4M7DE 4TTVA 2JOYA 3F70A 1TS9A 4MZTA 1Z9ZA 2FPFA 3L42A 2LCSA 1M30A 2LQWA 4LN2A 3RERA 2M9UA 4UP9A 2DMOA 2LP5A 1NJ6A 2JTMA 3R07A 2C0IA 1A0NB 2RQRA 4LDYA 3MEWA 4IUUA 4H2YA 4LVKA 2ZPIB 5ECAA 1YIJT 1K9MU 2LX7A 2MF2A 1AWJA 1LVKA 1RAFB 2VWFA 1WQ7A 4X9DA 3GBQA 3CPWA 1GFDA 4BUGA 1NJ5A 3HFVA 1M8MA 1LJOA 1IHWA 1V1CA 2ZPFB 2JZ2A 4OGEA 1M1KC 1VQ8A 3M0QA 1UHCA 4M77A 5GANg 4PJOD 4Q6GA 2ALYA 2KVQG 3THKA 3JAME 2XTIA 2RK1A 4GY5A 3OS1A 2R5MA 2A8EA 1VA7A 1I8FA 4RTXA 4Z89A 1K76A 1TG0A 4KGXB 2RHUA 4HCBA 5E3IA 1TUGB 1QVGS 1UTIA 4HWSA 4CC4B 3QNEA 4PJOF 3HXZA 4JLGA 1L0WA 1N9SA 4NL2A 2HEQA 4AH6A 5I2MA 3E9GA 1B8AA 3RF1A 5IXFA 2FL7A 2KYBA 3OYLA 4K86A 1CSKA 4PJJA 2RHIA 5LJ5h 3JCMX 1YB3A 3EHRA 1D1CA 4AFUC 4HCZA 4C8QB 4N4IA 2KY9A 4HWRA 3RGLA 1HK9A 4Z88A 4D8DA 5CO7A 4OVAA 1AOJA 1MV3A 3ZEHA 3T9NA 1UFFA 4LDWA 3JCMf 2DYBA 4EPCA 3HFOA 4YRFA 2HBWA 2I4NA 4F7UF 3PIPA 1YN8A 2F1LA 2DE0X 2ZT6A 2NYSA 2DKGA 2PMFA 4RTTA 4EX5A 1Q7YU 3QKJA 2QA4Q 2PVGB 5CKHA 1B76A 3P8YA 4M75C 1D3BB 2X51A 2ARTA 4M75G 1SESA 3IG2A 3RNJA 3A5YA 2HKQB 2QTXA 1SEMA 3NGPA 4R55A 1QCOA
chains in the Genus database with same CATH topology
4P72A 1KC8U 3JCMJ 3CMQA 1GXIE 1EVKA 4A4KA 1KD1U 2K5IA 1ASYA 5DM7R 1WNLA 2J3LA 1G5VA 2ZIMA 1VQMT 3HY0A 3L2RA 4M7DC 4CH5A 3A31A 4OB0B 4M7DG 4YRMA 2A3LA 2EQUA 1EOVA 3AHUA 3BW1A 2Q7EA 4YROA 1C0AA 1OYXA 2CJAA 2DPPB 3PFSA 2ODRC 1FWZA 5CK9A 4EO4A 2VXFA 1RI0A 2Q5HA 1NPPA 3CPFA 4IURA 4P3NA 5HGQA 2MWPA 5DLQE 1QVPA 5GMKj 4P73A 3CCLT 2P0KA 2ZZEA 4M7AD 1FXXA 1G3WA 4PJOB 3REXA 4E7KA 2RJFA 3CCJA 3GOXA 1NYRA 3S3MA 4C5IA 2CJBA 3JB9I 1YFTA 1M8VA 4YYEA 1K8AC 4MZPA 3JCMh 3TEEA 5LJ3j 2RM4A 3PMTA 1BKBA 2PUKB 1VQ9A 2MWOA 3QJ6A 4M7AF 2JVVA 5LJ5d 2YLBA 4H2VA 4YRCA 2QQSA 3M4PA 1YJWA 3CCQA 2JTFA 4F7UB 2E65A 2EQKA 2ZZDA 2DVEA 3JCMQ 3CC4T 4ZN3A 2MAMA 4J8OA 2JN0A 4XQ3A 4JRKA 1I4K1 2RI5A 3RACA 3PCOA 4C0ZA 2BUDA 3RKXA 3FB9A 5GAN4 4RG2A 4K87A 4KR2A 1NJ2A 1VQKT 1UB4A 1E22A 3J81E 4TVAB 2H3JA 3G4SA 3QDRB 4CS2A 5F5WA 4LDUA 3CXCS 4YREA 3OYEA 1N9WA 2JNGA 3IKLA 3L2ZA 1NJ8A 3A7UA 3TEHB 3NELA 4HA8A 4YCWA 3OBYA 3X28B 2RK2A 3HTZA 1G3YA 2DAQA 4O6JA 2CZ1B 3MF1A 2CZ7B 5EG2A 5K1PA 2DEQA 3DLLA 1Q81U 3WVEB 2EYQA 4C0FA 3QO7A 3CMAT 4M78C 3HRSA 2C06A 4PHCA 3QZ9B 5GAN2 2Y4YA 1QP2A 3GLXA 5LJ3e 4UP7A 5AYFA 3GP8A 3G71T 4HKEA 4P71C 5GMKl 2ZTGA 2GFUA 4LDXA 1XNIA 3TEGA 2OTLA 4EMGA 3UPUA 1H3ZA 4HCCA 3QUIA 3V7CA 3OMCA 1NJIU 4CH6A 3ERRA 1W66A 3RIRA 4FT4A 2DZCA 1W2BS 2J3MA 1YJ9T 4M7AB 3GNFB 3UFGA 1H4TA 1BIAA 2KDSA 2ZNJA 2E6ZA 3OD1A 2E70A 1JJCA 2VXEA 4K88A 3X24B 3FC3A 5LJ5e 2ARSA 3OS5A 3IALA 2EL9A 2DQ3A 3OYKA 1XOVA 4C0GA 2XKOC 1Y96A 5FU6B 3LSQA 4YRKA 5A2QE 3S3OA 4DQ2A 4HWOA 3VQYA 3QIIA 4XAXB 5CKFA 4BW9A 3MEVA 4ZGDB 4RMOA 4A4FA 4CS3A 4BB7A 2QQAA 4L5GA 4WI1A 3W3SA 3I7FA 2CJ9A 4EMKC 1VQNT 3I55T 2VGNA 3RESA 4HVCA 3IKMB 1YFRA 1X55A 1KG1A 5A0GA 5GAMj 4M75A 4ATOA 2K57A 2M1HA 4OP0A 4GLKA 3LX7A 2K3YA 1QF6A 4ZTFA 3UDCA 1M90C 3P8TA 3HRIA 3CMEA 1SRYA 3LWIA 4TVWA 4RCBA 1FYFA 4YDQA 1BBUA 4NOYA 1M4ZA 4X34A 5FRMA 3H6ZA 3CCUA 3DSQA 1QE0A 2ZT8A 1G3SA 4M7DA 3LYIA 3MHXA 3OYAA 1UEBA 2KSSA 3M53A 2RJCA 5GAN8 1AHJB 1EIFA 3FJPA 1FX7A 4NCXA 3PNWC 4KUDK 1NZ9A 5GANd 2M0OA 2GQVA 5J39A 1Z7MA 1B70A 5HK3A 4DA4A 3G7ZA 3M4GA 4XEMA 3JCMg 3CPWS 3OSVA 4J6YA 1VQ4T 3ZBDA 4Q5WA 3M5AA 3JCMc 5CAIA 3HHTB 3C95A 1HTTA 2F5KA 4LDVA 2HD0A 3QG1A 4XTXA 3OBWA 2C7IA 5LJ3f 1X2GA 1YITT 4YRPA 4C5GA 4C0DC 4XU1A 5GANj 3JCMb 3CC7A 2FB7A 4YRQA 2RD1A 5GAMe 2DU5A 4BWAA 4ME7A 1VQ7T 2CZ0B 1KQ2A 5HY6A 4C92D 2QHTA 2I2LA 1IZ6A 4KT0E 1Z7NA 3SB2A 3OYCA 2PU9B 4BDYA 3HFZB 4PNOA 4H2XA 3QXEB 2QHUA 1QVFS 2DXCA 4A4EA 1YI2A 4C92F 5CQXA 2RHZA 1N6AA 1SETA 1KHCA 4A4HA 1D3BA 3LGLA 2ZT5A 3VYGA 3FEOA 4CH3A 1YHQT 4QVZA 3A7RA 2F69A 4BI3A 2G4CA 3RMQA 4A4GA 2IG0A 2MMPA 2EWNA 4NL3A 1USYC 3CC2T 4XU3A 2DD5A 2XDDA 2P0QA 5C51B 1E1TA 1SERA 4B9WA 1YJNA 3EAEA 4M77D 5CCAA 2D9TA 1PYSB 4LD9K 1VQ6A 2X4JA 4LVLA 3L4GB 4H2TA 5C52B 3HXWA 2ZZGA 4UP8A 4FSXA 4M78A 1S72T 1XTDA 4M77F 5GANe 3SWNB 4IUVA 1BBWA 4P71A 3VKIA 3META 4YRLA 2LT4A 1B7YA 5CQYA 5GAN6 5KH6A 2WACA 4KULA 2QEXT 1X56A 3LH0A 4C8QE 2ZCEA 2RHQA 3MF2A 3M57A 3EFSA 2RHSB 2ZNIA 1QVFA 2QA4A 5A0LA 1TH7A 1MGQA 5FU7B 2D0QB 3A8MB 3JB9J 3A8GB 2EQMA 4G84A 5GAN5 4P3OA 5IAYA 3RL6A 3G6ET 3CEYA 3NTKA 3A7AA 2CYZB 1LNXA 4C92B 1X01A 1JB0E 5A0DA 4ZIBA 4XTWA 3OYHA 1VQ5T 2PVDB 1J5WA 2GF7A 4BACA 3SD4A 3TU4K 4TVAA 3MP6A 5GAMf 4EMKA 1Y07A 5CKDA 3M9QA 4J7IA 1ASZA 1B34B 2AMCB 3PIOA 3I56A 2OTJA 4XTZA 1VQPA 2EJFA 2DZ9A 1U8RA 1R8OB 2CIMA 2ZPBB 3PGGA 3A8OB 4JJNK 2HAXA 3CCET 1WU7A 3X20B 2G3RA 2O4XB 4P74C 5GMKi 3GPLA 3CCMA 1YBYA 2IY5A 4OB3B 3MQZA 4M77B 2ALYB 2DO3A 2C8MA 2ZPEB 1VQLT 4ELZC 4QVDA 3QHSA 4PJOE 2I4OA 3QPHA 4JLIA 2Q7HA 3MEYA 5GAN3 3PTAA 2BIVA 2RA2A 2RI2A 3CBMA 3DB4A 2I4LA 5CKBA 5FLXE 1EIYA 1H4VB 2AHJB 3M4YA 2Y90A 3HRUA 4N0AC 4C8QC 1Q7YC 2X35A 1M1FA 3HRKA 4F7UE 1YCYA 3ZFJA 3M58A 4C8QG 3DLMA 1KHIA 5KE2A 3L2QA 5HK0A 1W4SA 3CCRA 4YP0A 3CCVA 1U1SA 2Q7GA 2RO0A 3DB3A 4XU2A 5GAOl 1VQOA 4HT9A 4E7LA 3JRZA 1X2HA 1OZ2A 1KD1C 5LJ5j 1G51A 4RG8A 4E47A 1VQ8T 1OI1A 4J7FA 4E51A 2CZ6B 4YRGA 3CD6A 3C12A 4OF1A 4ZTUB 3SFMA 3CCSA 4BE1A 2EIFA 4FL6A 2B8AA 1WGSA 5GAOp 2ZGWA 4L87A 4YRIA 5I21A 5DLOA 3WVDB 2NLUA 2P0LA 1UGQB 4J15A 2QQRA 4PLIA 3M55A 3HY1A 1G5IA 1LOJA 2HQXA 4OGCA 1USYA 2RJEA 2E5QA 1NJ1A 3TUPA 4YRNA 2RB6A 1M90U 2RJDA 4BY6B 2K5FA 1WJSA 2ZCFB 3M4QA 2LX9A 3QJYA 2VC8A 4ZTZB 2ZIOA 2M16A 2EJ9A 3L2WA 3OYMA 4BD3A 2X4WA 4PJOC 3ER0A 3OA6A 5KNNA 4PJOG 3KXTA 4FT2A 4M7AE 3WQZA 2Q5IA 3GNGA 2QDYB 2LT1A 2DJZA 3PZCA 1PSEA 3E9HA 3QYHB 4TWAA 3JCMd 5KCHA 4BE0A 1M9SA 3RUXA 3UH0A 2LNVA 4MDXA 1V29B 3QBYA 3INZA 4F7UG 4B9XA 2FHDA 2XIDA 1YIJA 2E41A 3ME9A 5M9OA 3PCOB 4E7IA 4BDZA 4YCVA 4M75D 3L2VA 4IUTA 4II1A 3FRNA 1KQSA 3M59A 4RQEA 5CIUA 4ZTJA 2KK4A 1BIBA 2LTOA 2PMEA 2VGMA 3P8DA 3OS2A 4G85A 4H2WA 1QP3A 5J3BA 4Z02A 1BI1A 3CCJT 4M75F 4H2SA 1M1GA 5GMKm 5L8RE 4WF2A 5LL6S 4M7DD 2V8KA 1VQ9T 2AKWA 2ZR2A 4LNSA 4JRPA 2XG8D 3A5ZA 1RIQA 2KAFA 4X5OA 3HL8A 2EFIA 3H8ZA 3CCQT 1YJWT 3A74A 3ICAA 3TREA 2GCXA 4M7DF 2E3CA 2ODRD 3MEAA 4UC4A 1WPYA 5C6SA 3HP9A 2DTOA 3X26B 2ZXFA 4P74A 4OMFB 3VYHB 2VYTA 3G4ST 2HNIA 1SSFA 3CBPA 4JRQA 4XK8E 1N9RA 3A8HB 2ZPGB 4M7AC 3JCMe 3OYDA 3OYFA 4M7AG 1JJCB 1M1KU 3JCMW 5CR2A 4EMHA 1GGMA 2P4TA 4J6XA 3LSSA 1VQMA 2KQWA 1I81A 3VV0A 3NENA 4OB2B 4TQFA 1Y96B 3QZ5B 5FU6C 4N0AA 4YRJA 4YRSA 4C8QA 4L6V5 1WLEA 2PVOB 4ZN1A 4PLLA 3NTIA 4Y28E 5IT9E 2CKKA 2DXUA 4PG3A 1Q86C 4RMFA 3QYGB 4LVJA 1N27A 3FLGA 4O2DA 4CH4A 1BI0A 5LJ5f 4YPFA 1N8RC 4PKCC 2OTLT 3HXXA 2R58A 3OSSC 4M75B 3CCLA 1JRIA 1UGRB 3QSUA 1Q82C 4BI8B 3BFMA 3LGFA 3LC0A 1K73C 4HWTA 3LWHA 4TQDA 3VQVA 4H2UA 4TVRA 1ADJA 2LRQA 3OYJA 4DOVA 4R56A 2WSFE 1VUBA 1M5Q1 3PMIA 3OY9A 1H4SA 4QQ6A 5K1XA 4P75C 4M7DB 3VJPA 1EVLA 2LDMA 3OQ5A 4UPAA 1ZQ1A 4M78D 5GMKh 4C5EA 5KE3A 1U1TA 3EFRA 3CC4A 4J5YA 3JCMV 1BI3A 3S3NA 3HKSA 3N5BB 4CI0C 2O4XA 1NPRA 1VQKA 2CGHA 2F5TX 2VV5A 4JUVA 2JUFA 5LJ3h 1B70B 4M78F 1KMNA 2QHSA 2I4MA 1BI2A 3OYGA 1G5HA 1P92A 2ZT7A 1RL2A 1ZBXA 4PJOA 2V8IA 3J80E 2L8DA 2QQBA 3QO8A 3VUBA 2HQEA 3CMET 4XTUA 5GAN7 2XD0A 2DXTA 1UGSB 2VUBA 4KR3A 1H641 5ELOA 1KMMA 1VIEA 3CCUT 2K2VA 3J7AF 3R6OA 4FU6A 3A8LB 1K8AU 3CMAA 2EAYA 3P8VA 2XI9A 4F7UA 3P8BB 2DK3A 4MDWA 3NETA 4YCUA 1ADYA 3UGQA 4PL6A 2K4YA 3HFNA 1NYQA 3G71A 4C92E 4D6WA 2DU7A 4H2XB 4QQDA 2IVWA 1H4QA 2LCCA 3V7SA 3JCMP 5HKCA 4KUIA 4JDSA 1ZHIA 3REUA 4OLFA 4HWPA 2P0PA 4MZMA 2WSEE 1YJ9A 1K9MC 4IUQA 2E12A 5C0MA 2D6FA 2RI3A 1LYLA 3OYBA 3LLRA 4E7HA 1PSFA 1IREB 3TEHA 5FROA 1O75A 4QQGA 3LW5E 4BI4A 3CC7T 4J83A 4Q15A 1KOGA 3BY7A 2X4XA 4KBMB 2HBPA 4N4GA 3MCAB 5FRNA 5ELNA 4M77E 2NS6A 3JB9D 1ATIA 4EDUA 1YGBA 3QO3A 4M78B 4M78E 2E6NA 4A53A 1QVGA 3S6WA 1VQZA 2E64A 3SWNC 3Q1JA 4V2SA 1VQNA 5LJ3d 3I55A 2ZINA 1B7YB 3JB9F 1YI2T 5J26A 3OMGA 2P5IA 2GFAA 3QO5A 2DD4A 3VQWA 2E10A 4MMKA 5GAOn 4CRIA 4M7AA 2RHQB 4RKUE 4J6WA 1KQ1A 1MHNA 5GANf 4YRTA 3MP8A 2YLCA 3CBOA 3RKWA 3A32A 4MMLA 2X4YA 2XU8A 5C53B 5FU7C 1YJNT 1KC8C 2EJGA 1BYMA 4XU0A 2LQ8A 2CS7A 4FIBA 5GAMh 1WJRA 2RHXA 2QHVA 1VQ6T 4LD6A 3VUZA 4C92C 3BDLA 4OB1B 4YRRA 3M54A 4C92G 2ZR3A 1JJ2S 3O8VA 1E24A 12ASA 3E9IA 3E19A 4KQEA 3HRTA 2EKOA 4EMKB 1Y71A 3OB9A 3NTHA 5CVIA 1VQ4A 5KCOA 4RCCA 1KQSS 4Y91A 2FYKA 2PQWA 3KFUA 2LQKA 3OW2S 2ZZFA 3V8JA 3V8LA 1YITA 2E5AA 4JRIA 1X75C 3QTCA 5IN1A 5GAOq 3HXYA 3MEUA 1O9SA 4DOWA 5GMKe 1VQ7A 2QA4T 3HPWA 2IY5B 3OS0A 4TVYA 3BJUA 4M77C 4P75A 1G3TA 5LJ3g 3VBBA 5D6XA 3V7RA 4M77G 4H02A 1WJQA 4P5NA 2XHCA 4LVIA 4XEOA 4XTVA 4JS4A 11ASA 4M78G 3VU3C 3L1AA 3WXMB 3OYNA 3OYYA 1JBMA 5GAOm 5GANh 3RKYA 4C5HA 2BKDN 5D6WA 4IKFA 3MP1A 1EIYB 1YHQA 1NNHA 2LC4A 4N4HA 3G1ZA 3HSBA 1Y7XA 1YFSA 3VQXA 2XDPA 3I56T 2OTJT 5LJ5g 1VQPT 2KMTA 3CC2A 3ASKA 1JJ2A 4CS4A 4C0DB 5DY9A 4ZGJB 2L89A 4DPGA 2DIGA 2XICA 2XK0A 2K3XA 4L59A 3CXCA 4HT8A 1EQRA 2O01E 5GAMd 3CCMT 1EFWA 3NEMA 5I2SA 2L3RA 3OW2A 1S72A 2R57A 2DXBA 4P72C 4WJ3M 1WYDA 1IL2A 3M56A 3HFZA 3SDZA 3KBGA 3FIFA 3OYIA 3JB9H 1Q81C 2XGTA 2E1HA 4ZGEB 3UGTA 3KUFA 1HC7A 2RHYA 2LCLA 2QQ9A 1Q86U 2QEXA 4A54A 4WJ4A 3V8KA 1QW1A 3TCJA 4RQFA 4QW2A 3FDRA 1N8RU 3MO8A 5CKEA 2QI2A 3RMSA 1NJIC 1XQHA 4O5VA 1Q82U 1E1OA 1HXDA 2LVMA 4BY6C 3CCRT 1K73U 3CCVT 5GAOr 2EQJA 1VQOT 3G6EA 3PT9A 2ARUA 3E1SA 2K5LA 5D6YA 1W2BA 1PYSA 4P73C 4QVCA 3L4GA 2PUOB 1VQ5A 3CD6T 3JB9G 2DQ0A 3DKMA 3C94A 1I5LA 3CCST 2YHTA 3SWNA 2DDZA 2DIQA 4HT4A 3GIBA 1NE8A 4IUPA 1DJ7B 4JS5A 4VUBA 2L5QA 1VIFA 4ELYC 4C8QD 2V8JA 4YTLA 3UT1A 4RDXA 3CCEA 5GAMg 3JSCA 1UGPB 2RH2A 2YRVA 2XDBA 2Y4XA 4C8QF 2RHSA 3E9FA 4BE2A 2ZPHB 4LVMA 2DTHA 2OAUA 3HXUA 3HXVA 2DTIA 4M75E 1VQLA 3L2UA 3GF5A 2MI6A 3URGA 3C4SA 2WSCE 4C92A 3BDUA 1WQWA 4X9CA 4P3PA 4XTYA 4NS5A 3NFCA 2R5AA 2FVUA 1X6OA 2AKWB 2A7YA 3UWNA 4FM4B 2QXFA 4E7JA 3A5ZB 1B34A 2AMCA 3X25B 3P8HA 1OZ3A 1X54A 4M7DE 4TTVA 2JOYA 3F70A 4MZTA 3L42A 3RERA 2M9UA 4UP9A 1NJ6A 2JTMA 3R07A 4LDYA 3MEWA 4IUUA 4H2YA 4LVKA 2ZPIB 1YIJT 1K9MU 2MF2A 1WQ7A 4X9DA 3CPWA 4BUGA 1NJ5A 3HFVA 1LJOA 2ZPFB 2JZ2A 4OGEA 1M1KC 1VQ8A 4M77A 5GANg 4PJOD 4Q6GA 2ALYA 2KVQG 3JAME 2XTIA 2RK1A 4GY5A 3OS1A 2R5MA 2A8EA 1I8FA 2RHUA 4HCBA 5E3IA 1QVGS 4HWSA 3QNEA 4PJOF 3HXZA 4JLGA 1L0WA 1N9SA 4NL2A 4AH6A 5I2MA 3E9GA 1B8AA 3RF1A 2FL7A 3OYLA 4K86A 3JCMX 2RHIA 5LJ5h 1YB3A 4HCZA 4C8QB 4N4IA 2KY9A 4HWRA 3RGLA 1HK9A 5CO7A 4OVAA 3ZEHA 3T9NA 4LDWA 3JCMf 4EPCA 3HFOA 4YRFA 2I4NA 4F7UF 3PIPA 2ZT6A 2DKGA 2PMFA 4EX5A 1Q7YU 3QKJA 2PVGB 5CKHA 1B76A 3P8YA 4M75C 1D3BB 2ARTA 4M75G 1SESA 3IG2A 3A5YA 2QTXA 4R55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SET A;  4P72 A;  1D3B A;  4M75 F;  3JCM J;  2ZT5 A;  4H2S A;  3CMQ A;  4CH3 A;  1EVK A;  5GMK m;  4RCC A;  4WF2 A;  1ASY A;  4Y91 A;  1WNL A;  2FYK A;  2J3L A;  3KFU A;  3A7R A;  2G4C A;  2ZIM A;  4M7D D;  3V8J A;  2ZZF A;  3V8L A;  2EWN A;  2E5A A;  4NL3 A;  1USY C;  2AKW A;  4JRI A;  2ZR2 A;  4LNS A;  3HY0 A;  3QTC A;  4M7D C;  5GAO q;  3HXY A;  3A5Z A;  1RIQ A;  4CH5 A;  4XU3 A;  3A31 A;  4M7D G;  4X5O A;  5C51 B;  4YRM A;  1E1T A;  1SER A;  1EOV A;  5GMK e;  3A74 A;  2IY5 B;  4M77 D;  3ICA A;  3AHU A;  4TVY A;  4M7D F;  3BJU A;  3BW1 A;  4M77 C;  1PYS B;  4P75 A;  2Q7E A;  2E3C A;  4YRO A;  5LJ3 g;  2ODR D;  1C0A A;  3VBB A;  3V7R A;  4M77 G;  4H02 A;  2CJA A;  1WPY A;  3L4G B;  2DTO A;  4H2T A;  5C52 B;  2ODR C;  2ZXF A;  3HXW A;  4XEO A;  4P74 A;  4XTV A;  2ZZG A;  4EO4 A;  4UP8 A;  2VXF A;  2Q5H A;  11AS A;  4M78 G;  4M78 A;  4P3N A;  3VU3 C;  5HGQ A;  4M77 F;  5GAN e;  2HNI A;  3SWN B;  3L1A A;  5GMK j;  4P73 A;  1BBW A;  4P71 A;  2ZZE A;  4M7A D;  1JBM A;  5GAO m;  4PJO B;  4YRL A;  3REX A;  1N9R A;  5GAN h;  1NYR A;  3RKY A;  4M7A C;  1B7Y A;  2CJB A;  3JB9 I;  1YFT A;  3JCM e;  5GAN 6;  1EIY B;  1NNH A;  1M8V A;  4M7A G;  3G1Z A;  4YYE A;  3HSB A;  1JJC B;  1YFS A;  3VQX A;  3JCM W;  4EMH A;  1GGM A;  3JCM h;  5LJ3 j;  1X56 A;  2RM4 A;  4J6X A;  5LJ5 g;  3LSS A;  4C8Q E;  1I81 A;  4M7A F;  3NEN A;  5LJ5 d;  4TQF A;  2YLB A;  1Y96 B;  4CS4 A;  2ZCE A;  2RHQ A;  3MF2 A;  4H2V A;  4YRC A;  3M4P A;  3EFS A;  5DY9 A;  2RHS B;  4N0A A;  2ZNI A;  4F7U B;  2E65 A;  4DPG A;  4YRJ A;  4YRS A;  4C8Q A;  1TH7 A;  1MGQ A;  2DVE A;  4HT8 A;  1EQR A;  1WLE A;  3JCM Q;  3JB9 J;  2JN0 A;  5GAM d;  4G84 A;  4XQ3 A;  5GAN 5;  4JRK A;  1EFW A;  1I4K 1;  3RAC A;  3NEM A;  3PCO A;  2DXU A;  4PG3 A;  4P3O A;  3RKX A;  4RMF A;  3RL6 A;  3FB9 A;  5GAN 4;  4K87 A;  4KR2 A;  1NJ2 A;  1E22 A;  3A7A A;  4TVA B;  4O2D A;  1LNX A;  4CH4 A;  5LJ5 f;  4C92 B;  4P72 C;  4YPF A;  1X01 A;  3HXX A;  4ZIB A;  4WJ3 M;  4XTW A;  4CS2 A;  1WYD A;  5F5W A;  4M75 B;  1JRI A;  1J5W A;  3QSU A;  1IL2 A;  3HFZ A;  4YRE A;  4TVA A;  3FIF A;  3JB9 H;  2XGT A;  2E1H A;  5GAM f;  4EMK A;  3BFM A;  1N9W A;  3LC0 A;  4HWT A;  3UGT A;  1ASZ A;  4TQD A;  3VQV A;  3IKL A;  1B34 B;  2AMC B;  1HC7 A;  4H2U A;  3L2Z A;  1ADJ A;  1NJ8 A;  3A7U A;  3TEH B;  4XTZ A;  3NEL A;  4HA8 A;  4A54 A;  4WJ4 A;  4YCW A;  3V8K A;  2EJF A;  2DZ9 A;  4RQF A;  2CIM A;  1M5Q 1;  3PGG A;  1H4S A;  3HTZ A;  5K1X A;  4P75 C;  4M7D B;  1WU7 A;  3MF1 A;  1EVL A;  5K1P A;  2DEQ A;  1E1O A;  1HXD A;  4UPA A;  4M78 D;  5GMK h;  4P74 C;  1U1T A;  3EFR A;  5GMK i;  3QO7 A;  4J5Y A;  3JCM V;  4M78 C;  5GAO r;  2IY5 A;  4PHC A;  5GAN 2;  4M77 B;  5LJ3 e;  4UP7 A;  4P73 C;  2ARU A;  1PYS A;  2ALY B;  2CGH A;  4P71 C;  4JUV A;  5GMK l;  4QVC A;  2C8M A;  2ZTG A;  3TEG A;  4EMG A;  3L4G A;  4QVD A;  5LJ3 h;  3QHS A;  1B70 B;  4M78 F;  1KMN A;  2QHS A;  3QUI A;  4PJO E;  3V7C A;  2I4M A;  3JB9 G;  2I4O A;  2DQ0 A;  4CH6 A;  3ERR A;  1W66 A;  3RIR A;  1I5L A;  1G5H A;  2YHT A;  3SWN A;  4JLI A;  2Q7H A;  3MEY A;  5GAN 3;  2ZT7 A;  2DDZ A;  2DZC A;  3GIB A;  4PJO A;  2J3M A;  2RA2 A;  4M7A B;  2I4L A;  3QO8 A;  3UFG A;  1H4T A;  1BIA A;  1EIY A;  1H4V B;  4C8Q D;  2ZNJ A;  2Y90 A;  4N0A C;  3OD1 A;  1JJC A;  2VXE A;  4K88 A;  4C8Q C;  5LJ5 e;  4XTU A;  5GAN 7;  2ARS A;  2DXT A;  3HRK A;  4RDX A;  4F7U E;  1YCY A;  3IAL A;  4C8Q G;  5GAM g;  2EL9 A;  2DQ3 A;  4KR3 A;  1H64 1;  5ELO A;  1KMM A;  1Y96 A;  3LSQ A;  4YRK A;  4C8Q F;  2RHS A;  2EAY A;  3P8V A;  4YP0 A;  4F7U A;  1U1S A;  2Q7G A;  4DQ2 A;  5GAO l;  2DTH A;  4XU2 A;  3NET A;  1ADY A;  4HWO A;  4YCU A;  3UGQ A;  3VQY A;  4HT9 A;  3HFN A;  1NYQ A;  1X2H A;  4BW9 A;  4C92 E;  3HXU A;  2DU7 A;  5LJ5 j;  3HXV A;  4H2X B;  1G51 A;  4CS3 A;  2DTI A;  4M75 E;  4WI1 A;  4E51 A;  3W3S A;  3I7F A;  1H4Q A;  2CJ9 A;  3V7S A;  4EMK C;  4YRG A;  3JCM P;  4ZTU B;  3RES A;  4HVC A;  4C92 A;  3IKM B;  3BDU A;  3REU A;  1YFR A;  4OLF A;  1X55 A;  1WQW A;  4X9C A;  4P3P A;  5GAM j;  4HWP A;  4M75 A;  2K57 A;  4XTY A;  4OP0 A;  5GAO p;  1QF6 A;  2ZGW A;  3P8T A;  4L87 A;  4YRI A;  3HRI A;  5I21 A;  2AKW B;  1SRY A;  1LYL A;  2P0L A;  1B34 A;  2AMC A;  4J15 A;  4TVW A;  3TEH A;  4RCB A;  1FYF A;  1X54 A;  4M7D E;  4YDQ A;  4TTV A;  1BBU A;  3HY1 A;  4NOY A;  1G5I A;  1LOJ A;  3RER A;  4UP9 A;  1NJ6 A;  4Q15 A;  1KOG A;  1USY A;  3R07 A;  3DSQ A;  3BY7 A;  1QE0 A;  2ZT8 A;  4M7D A;  1NJ1 A;  4H2Y A;  3TUP A;  5ELN A;  4YRN A;  4M77 E;  2RB6 A;  3JB9 D;  1ATI A;  1WQ7 A;  4X9D A;  1YGB A;  1NJ5 A;  3QO3 A;  4M78 B;  3HFV A;  3M4Q A;  4M78 E;  1LJO A;  4A53 A;  5GAN 8;  2VC8 A;  4ZTZ B;  2ZIO A;  1VQZ A;  2E64 A;  2EJ9 A;  3FJP A;  4M77 A;  3SWN C;  5GAN g;  4PJO D;  4Q6G A;  4V2S A;  4NCX A;  2ALY A;  5LJ3 d;  4PJO C;  2XTI A;  5GAN d;  2ZIN A;  1B7Y B;  1Z7M A;  3JB9 F;  1I8F A;  1B70 A;  5KNN A;  4PJO G;  4XEM A;  3M4G A;  3JCM g;  4M7A E;  3WQZ A;  2Q5I A;  2P5I A;  5E3I A;  3QO5 A;  4J6Y A;  2DJZ A;  3PZC A;  3E9H A;  4TWA A;  3VQW A;  2E10 A;  4MMK A;  3JCM d;  4HWS A;  3JCM c;  5GAO n;  4PJO F;  3QNE A;  5CAI A;  3HXZ A;  1L0W A;  1N9S A;  1HTT A;  4NL2 A;  4M7A A;  4XTX A;  4AH6 A;  1B8A A;  3RF1 A;  2C7I A;  5LJ3 f;  1X2G A;  2RHQ B;  4J6W A;  1KQ1 A;  3RUX A;  4K86 A;  4YRP A;  5GAN f;  3UH0 A;  3JCM X;  5LJ5 h;  4XU1 A;  1YB3 A;  4YRT A;  2YLC A;  4C8Q B;  5GAN j;  3RKW A;  3JCM b;  4HWR A;  3A32 A;  3RGL A;  1HK9 A;  4MML A;  2FB7 A;  4YRQ A;  2RD1 A;  3INZ A;  5GAM e;  5C53 B;  4F7U G;  2DU5 A;  4BWA A;  2EJG A;  3JCM f;  2E41 A;  1KQ2 A;  3PCO B;  4XU0 A;  3HFO A;  4YRF A;  5GAM h;  2I4N A;  4F7U F;  4C92 D;  2ZT6 A;  2QHV A;  2QHT A;  4YCV A;  2DKG A;  2PMF A;  2I2L A;  4EX5 A;  4M75 D;  4C92 C;  1Z7N A;  3SB2 A;  4YRR A;  1B76 A;  3P8Y A;  4C92 G;  4M75 C;  1D3B B;  2ZR3 A;  1E24 A;  4RQE A;  12AS A;  3HFZ B;  2ART A;  3E9I A;  1BIB A;  4PNO A;  4H2X A;  4KQE A;  4M75 G;  2PME A;  2QHU A;  1SES A;  4EMK B;  3IG2 A;  4G85 A;  4H2W A;  3A5Y A;  2QTX A;  4C92 F; 
#chains in the Genus database with same CATH topology
 4P72 A;  2KGT A;  3EGD B;  1KC8 U;  4FW1 A;  3JCM J;  3CMQ A;  1E7O A;  5I22 A;  3ULR B;  1GXI E;  1EVK A;  4A4K A;  1KD1 U;  4RTW A;  2K5I A;  1UHF A;  1ASY A;  5DM7 R;  1WNL A;  2J3L A;  1G5V A;  1GRI A;  2ZIM A;  1ACM B;  1VQM T;  3HY0 A;  2EGE A;  2CDT A;  3L2R A;  4M7D C;  3M0S A;  4CH5 A;  3A31 A;  4OB0 B;  4OML A;  4M7D G;  2ATC B;  5KYN A;  2VB6 A;  4YRM A;  2A3L A;  2EQU A;  1EOV A;  1FMV A;  4J9G A;  2AKL A;  1JU5 C;  1TWB A;  3AHU A;  1SSH A;  3BW1 A;  3CQT A;  2Q7E A;  4YRO A;  1H92 A;  1C0A A;  1OYX A;  2CJA A;  2DPP B;  3PFS A;  1GBR A;  4JJD A;  3H41 A;  1MND A;  2ODR C;  1FWZ A;  5CK9 A;  4EO4 A;  2VXF A;  1RI0 A;  2Q5H A;  1NPP A;  3CPF A;  4IUR A;  4P3N A;  4WCI A;  5HGQ A;  2MWP A;  2P4R A;  1AZE A;  5DLQ E;  1QVP A;  1JQQ A;  1MV0 B;  1D09 B;  5GMK j;  4P73 A;  3CCL T;  2P0K A;  2ZZE A;  4M7A D;  1FXX A;  1G3W A;  1PD1 A;  2CP7 A;  4PJO B;  3REX A;  4E7K A;  2RJF A;  2NUT A;  3VS3 A;  3CCJ A;  3GOX A;  1NYR A;  4GLM A;  3S3M A;  2K3B A;  4C5I A;  2CJB A;  3JB9 I;  1YFT A;  4OMM A;  4OMO A;  4KGZ B;  1M8V A;  4YYE A;  1SKU B;  4JZ3 A;  1K8A C;  4MZP A;  1NG2 A;  3CCJ Q;  3JCM h;  1X69 A;  3TEE A;  5LJ3 j;  2RM4 A;  3PMT A;  1BKB A;  2DM1 A;  2PUK B;  1VQ9 A;  2MWO A;  1ZSG A;  2JJ9 A;  2B86 A;  4RTY A;  3QJ6 A;  4ANJ A;  4M7A F;  4RTU A;  2JVV A;  5LJ5 d;  3NMZ C;  2EBP A;  2YLB A;  2KRS A;  1RLQ C;  4H2V A;  4YRC A;  3SEM A;  2QQS A;  3M4P A;  2M02 A;  1YJW A;  3CCQ A;  1VQ9 Q;  2JTF A;  4F7U B;  2E65 A;  1NEG A;  2V1Q A;  2MYS A;  3UA7 A;  2EQK A;  2ZZD A;  2DVE A;  3JCM Q;  3CC4 T;  4ZN3 A;  2MAM A;  4J8O A;  2JN0 A;  1X2K A;  2BZ8 A;  4XQ3 A;  1YJW Q;  3CCQ Q;  4JRK A;  1I4K 1;  4K11 A;  2RI5 A;  3RAC A;  3TVT A;  3PCO A;  4C0Z A;  2BUD A;  2D8J A;  3RKX A;  4RUG A;  4KGV B;  1WHJ A;  2QDL A;  3FB9 A;  4RG2 A;  5GAN 4;  5HCK A;  4K87 A;  4KR2 A;  1NJ2 A;  3M0T A;  1UB4 A;  4J9E A;  1M3B A;  3J81 E;  1VQK T;  1E22 A;  3EFO A;  4TVA B;  2H3J A;  6AT1 B;  3G4S A;  2HMA A;  2C0T A;  1SPK A;  3QDR B;  4CS2 A;  5F5W A;  4LDU A;  1IXD A;  1ZUK A;  3CXC S;  4E2F B;  1TXQ A;  1VQO Q;  2IIM A;  2GQI A;  1M2V A;  4QT7 A;  4YRE A;  3G4S Q;  3OYE A;  1ZSZ A;  1N9W A;  3MPU B;  1WZO A;  2JNG A;  3IKL A;  2EQI A;  3L2Z A;  1WLP B;  1NJ8 A;  3A7U A;  3TEH B;  3NEL A;  4HA8 A;  1IGQ A;  3M0P A;  4YCW A;  3OBY A;  1IO6 A;  3X28 B;  2OX7 A;  1T3S A;  2RK2 A;  3HTZ A;  1G3Y A;  2DAQ A;  4O6J A;  2CZ1 B;  3MF1 A;  2V1R A;  2CZ7 B;  1V76 A;  5EG2 A;  5K1P A;  2DEQ A;  3DLL A;  1Q81 U;  3UA6 A;  2LMJ A;  3WVE B;  2EYQ A;  4C0F A;  3QO7 A;  3CMA T;  4M78 C;  3HRS A;  4D8K A;  2C06 A;  1KC8 R;  4PHC A;  3QZ9 B;  5GAN 2;  2Y4Y A;  1QP2 A;  3GLX A;  5LJ3 e;  4UP7 A;  5AYF A;  3GP8 A;  3G71 T;  4HKE A;  4P71 C;  5GMK l;  2ZTG A;  2GFU A;  4LDX A;  1XNI A;  3TEG A;  2J6K A;  2OTL A;  4EMG A;  3UPU A;  1H3Z A;  4HCC A;  1UJ0 A;  3QUI A;  3V7C A;  3OMC A;  1NJI U;  4CH6 A;  1D0X A;  3ERR A;  3H0I A;  1W66 A;  3RIR A;  4FT4 A;  2OTL Q;  1QCN A;  2DZC A;  2O88 A;  2DL3 A;  4FSS A;  1W2B S;  2A37 A;  2J3M A;  1YJ9 T;  4M7A B;  2I0N A;  2YUQ A;  3GNF B;  3UFG A;  2FRY A;  1H4T A;  1BIA A;  2FO0 A;  2KDS A;  2ZNJ A;  3PVL A;  2E6Z A;  3OD1 A;  2E70 A;  5I11 A;  1JJC A;  1QCF A;  2VXE A;  4K88 A;  3X24 B;  3FC3 A;  3MJX A;  5LJ5 e;  1CKB A;  2ARS A;  1T0J A;  1JXM A;  3OS5 A;  3IAL A;  2C0O A;  2EL9 A;  1K9A A;  2DQ3 A;  3OYK A;  1XOV A;  2ENM A;  4C0G A;  2XKO C;  1Y96 A;  1I1J A;  5FU6 B;  3LSQ A;  4YRK A;  2BE9 B;  5KYW B;  5A2Q E;  3S3O A;  4DQ2 A;  3VS5 A;  2QAS A;  4HWO A;  3VQY A;  1K4U S;  1B7T A;  3QII A;  4XAX B;  5CKF A;  4BW9 A;  3MEV A;  4ZGD B;  4RMO A;  3EG1 A;  4A4F A;  4CS3 A;  3BE3 A;  4BB7 A;  2F2V A;  3AT1 B;  2QQA A;  4L5G A;  2RMO A;  3E2U A;  4WI1 A;  3W3S A;  3I7F A;  2CJ9 A;  4EMK C;  1VQN T;  3I55 T;  2VGN A;  1X43 A;  2QGG A;  3RES A;  4HVC A;  1XJW B;  1ZA1 B;  3IKM B;  1YFR A;  1X55 A;  1KG1 A;  5A0G A;  5GAM j;  4M75 A;  4ATO A;  2J05 A;  2K57 A;  2M1H A;  4OP0 A;  4GLK A;  3LX7 A;  2K3Y A;  1QF6 A;  4ZTF A;  3UDC A;  1M90 C;  3P8T A;  3HRI A;  3CME A;  1YWP A;  1SRY A;  3LWI A;  4TVW A;  4RCB A;  1FYF A;  1GCQ C;  1EZZ B;  4YDQ A;  2EKH A;  1BBU A;  4NOY A;  1M4Z A;  4X34 A;  5FRM A;  2H3E B;  3H6Z A;  5FW9 A;  4AG1 C;  3CCU A;  3DSQ A;  2O9S A;  4HVV A;  1QE0 A;  2ZT8 A;  2CP0 A;  1G3S A;  4M7D A;  1KK7 A;  2A0F B;  3LYI A;  3MHX A;  3OYA A;  2KBT A;  4F16 A;  1UEB A;  2KSS A;  3M53 A;  2RJC A;  3VS4 A;  5KYY B;  5GAN 8;  4JPB W;  1AHJ B;  4KH1 B;  1RI9 A;  1EIF A;  3FJP A;  1FX7 A;  1KSW A;  1NLO C;  4NCX A;  3PNW C;  4KUD K;  3MKD A;  1NZ9 A;  5GAN d;  2GBQ A;  2M0O A;  2GQV A;  5J39 A;  5IHI A;  1Z7M A;  3EG2 A;  3TSW A;  4RTZ A;  2DRK A;  1VYU A;  5HK3 A;  1B70 A;  4Y92 A;  4DA4 A;  3G7Z A;  1QMC A;  3M4G A;  4XEM A;  3JCM g;  3CPW S;  4AG2 C;  3OSV A;  4J6Y A;  1VQ4 T;  3ZBD A;  4Q5W A;  3JV3 A;  3M5A A;  3JCM c;  5CAI A;  3HHT B;  3C95 A;  2CT4 A;  1HTT A;  4FYY B;  2F5K A;  4LDV A;  2HD0 A;  3QG1 A;  3R6N A;  4XTX A;  1MMA A;  3OBW A;  2C7I A;  5LJ3 f;  1X2G A;  1YIT T;  5IH2 A;  4YRP A;  4C5G A;  1YFN A;  4C0D C;  4XU1 A;  5GAN j;  2NUP B;  3JCM b;  3CC7 A;  3A98 A;  2FB7 A;  4YRQ A;  2RD1 A;  5GAM e;  4M4Z A;  1GL5 A;  2DU5 A;  2EYX A;  4PFP A;  4BWA A;  4ME7 A;  1VQ7 T;  2CZ0 B;  4JJC A;  1KQ2 A;  4LNP A;  1G83 A;  5HY6 A;  3CC7 Q;  4C92 D;  4QKU A;  2QHT A;  2I2L A;  4WTO B;  1IZ6 A;  4KT0 E;  1Z7N A;  3SB2 A;  3OYC A;  2PU9 B;  4BDY A;  4ZNX A;  3HFZ B;  1LPL A;  4PNO A;  4H2X A;  1MMD A;  3QXE B;  4J9H A;  2QHU A;  2OAW A;  1QVF S;  2DXC A;  4A4E A;  1YI2 A;  4C92 F;  2RHZ A;  5CQX A;  1N6A A;  1SET A;  1KHC A;  4A4H A;  1D3B A;  2FPD A;  2K2M A;  1FYN A;  3LGL A;  2ZT5 A;  3VYG A;  3FEO A;  1D1B A;  1NEB A;  4CH3 A;  3EGX A;  1YHQ T;  1YI2 Q;  2AZS A;  4QVZ A;  1QLY A;  3A7R A;  2F69 A;  4BI3 A;  2G4C A;  3RMQ A;  4A4G A;  2IG0 A;  2MMP A;  2EWN A;  4NL3 A;  2NWM A;  1USY C;  9ATC B;  5EC7 A;  1GFC A;  3CC2 T;  2MK5 A;  4XU3 A;  2DD5 A;  2GNC A;  2XDD A;  2P0Q A;  1FMK A;  5C51 B;  2LZ6 B;  1E1T A;  1SER A;  4B9W A;  1YJN A;  3EAE A;  4M77 D;  5CCA A;  2DL8 A;  2D9T A;  2CSI A;  1PYS B;  4LD9 K;  2KXD A;  1VQ6 A;  2X4J A;  1YJN Q;  4LVL A;  3FJ5 A;  1AEY A;  4IIO A;  3L4G B;  4H2T A;  5C52 B;  3HXW A;  5IXB A;  1Z9Q A;  1RAD B;  2ZZG A;  1CKA A;  1PG5 B;  4UP8 A;  2ECZ A;  4FSX A;  2H8H A;  4M78 A;  1S72 T;  2VKN A;  1AWX A;  1XTD A;  2F2W A;  1VQ6 Q;  4M77 F;  5GAN e;  3SWN B;  4IUV A;  2K6D A;  4GBQ A;  1BBW A;  2QTV A;  4P71 A;  3VKI A;  3MET A;  4YRL A;  2LT4 A;  4DBH A;  1B7Y A;  2K79 A;  1AWW A;  5CQY A;  5GAN 6;  5KH6 A;  1J3T A;  1BBZ A;  2WAC A;  4KUL A;  2YUP A;  2QEX T;  1QVG P;  1X56 A;  3LH0 A;  1NLP C;  4C8Q E;  2L0A A;  1ABO A;  4PFO A;  3EG9 A;  2ZCE A;  2RHQ A;  3MF2 A;  3M57 A;  1IGU A;  3EFS A;  4R0K A;  2RHS B;  2ZNI A;  3O5Z A;  1QVF A;  2QA4 A;  5A0L A;  1TH7 A;  2CRE A;  1MGQ A;  1WHK A;  5FU7 B;  2D0Q B;  3A8M B;  4DBQ A;  3JB9 J;  1OEB A;  3A8G B;  2EQM A;  4G84 A;  5GAN 5;  2F2X A;  4P3O A;  5IAY A;  3RL6 A;  3G6E T;  3CEY A;  3NTK A;  3A7A A;  2CYZ B;  1LNX A;  4C92 B;  3CMA Q;  1X01 A;  1JB0 E;  5A0D A;  1M1K R;  1RAH B;  4XTW A;  4ZIB A;  3OYH A;  1VQ5 T;  2PVD B;  5KYU B;  1J5W A;  2GF7 A;  4BAC A;  3H0F A;  1RAC B;  3SD4 A;  3TU4 K;  4TVA A;  3MP6 A;  2CUB A;  3EG0 A;  5GAM f;  4EMK A;  1Y07 A;  5CKD A;  4HCK A;  3M9Q A;  4J7I A;  1ASZ A;  1B34 B;  2AMC B;  3PIO A;  1UG1 A;  3I56 A;  2OTJ A;  4XTZ A;  1ZUU A;  1TSF A;  1VQP A;  2EJF A;  2DZ9 A;  1U8R A;  1R8O B;  1T3L A;  2CIM A;  2ZPB B;  3I56 Q;  2OTJ Q;  2LJ0 A;  2AT1 B;  1PM3 A;  3PGG A;  3A8O B;  4JJN K;  2HAX A;  3CCE T;  2HKN A;  1QKX A;  1WU7 A;  1WI7 A;  1VQP Q;  3X20 B;  2G3R A;  2O4X B;  1GCQ A;  2RNA A;  4P74 C;  5GMK i;  3GPL A;  3CCM A;  1SHG A;  1YBY A;  2IY5 A;  4OB3 B;  1OPK A;  1QWF A;  3MQZ A;  4M77 B;  4AT1 B;  3REB B;  2ALY B;  2DO3 A;  3CCM Q;  1WHG A;  2E4H A;  2C8M A;  2ZPE B;  1VQL T;  4ELZ C;  4QVD A;  1ARK A;  3QHS A;  1KIK A;  4PJO E;  2I4O A;  2IPO B;  1PRM C;  4Z8A A;  8ATC B;  3QPH A;  4JLI A;  2Q7H A;  2JM8 A;  3MEY A;  5GAN 3;  2YDL A;  3PTA A;  4DBR A;  4HVW A;  2BIV A;  2RA2 A;  2RI2 A;  3QWX X;  3CBM A;  3DB4 A;  2I4L A;  5CKB A;  5FLX E;  1U3O A;  1EIY A;  1H4V B;  2AHJ B;  3M4Y A;  2SEM A;  2Y90 A;  3HRU A;  4N0A C;  4E6R A;  4C8Q C;  3PE0 A;  1Q7Y C;  2X35 A;  1M1F A;  3HRK A;  4FYV B;  4F7U E;  1YCY A;  2FG0 A;  3ZFJ A;  3M58 A;  4C8Q G;  1OU8 A;  2LQN A;  1LCK A;  3DLM A;  1KHI A;  3EGU A;  5KE2 A;  3L2Q A;  1UJY A;  5HK0 A;  1W4S A;  4IIM A;  2KI7 A;  3UAT A;  3CCR A;  4YP0 A;  3CCV A;  2DNU A;  1U1S A;  2Q7G A;  2RO0 A;  1BU1 A;  2EYZ A;  3DB3 A;  4XU2 A;  5GAO l;  1VQO A;  4E7Z A;  2DBM A;  4HT9 A;  4E7L A;  4FW2 A;  4LUD A;  3JRZ A;  1WFW A;  1X2H A;  1OZ2 A;  3RBB B;  5LJ5 j;  1KD1 C;  1EX4 A;  3CCR Q;  3CCV Q;  2BE7 D;  1G51 A;  4RG8 A;  1PWT A;  4E47 A;  1F1B B;  1VQ8 T;  1E6G A;  1OI1 A;  1VYV A;  4J7F A;  4E51 A;  2CZ6 B;  1JJ2 P;  4YRG A;  3CD6 A;  3C12 A;  4OF1 A;  4ZTU B;  2JS0 A;  1ZBJ A;  3SFM A;  5AT1 B;  3CCS A;  4BE1 A;  2EIF A;  4FL6 A;  2COZ A;  2B8A A;  1MUZ A;  3CXC P;  1C1A A;  3CD6 Q;  1WGS A;  5GAO p;  2ZGW A;  3CCS Q;  4L87 A;  5KYX A;  4YRI A;  2HCK A;  5I21 A;  4FYX B;  1KQS P;  5DLO A;  3WVD B;  2NLU A;  2P0L A;  1UGQ B;  2HSP A;  1K8A R;  2AKK A;  4J15 A;  2FRW A;  2QQR A;  3OW2 P;  4F17 A;  3U23 A;  4PLI A;  1M3C A;  3M55 A;  3HY1 A;  1G5I A;  1LOJ A;  2HQX A;  3D7S B;  3H0H A;  4OGC A;  2MOX A;  2PTK A;  1USY A;  2RJE A;  4AMC A;  2E5Q A;  1NJ1 A;  3TUP A;  2MPX C;  4YRN A;  2RB6 A;  5IHK A;  1M90 U;  4HXJ A;  1U5S A;  2RJD A;  4BY6 B;  2K5F A;  2FZK B;  2ROT A;  1WJS A;  2ZCF B;  3M4Q A;  2LX9 A;  1VOM A;  3QJY A;  2CSQ A;  1ZLM A;  2VC8 A;  4ZTZ B;  2E5K A;  1MNE A;  2ZIO A;  2A36 A;  2M16 A;  2EJ9 A;  2YXY A;  3L2W A;  3OYM A;  5L23 A;  1IB8 A;  4BD3 A;  3EH1 A;  2X4W A;  5KYY A;  2NUT B;  4PJO C;  3ER0 A;  3OA6 A;  2E3I A;  2BZX A;  5KNN A;  4PJO G;  2G6F X;  3KXT A;  4FT2 A;  4M7A E;  3WQZ A;  2YUN A;  2Q5I A;  3GNG A;  2QDY B;  2LT1 A;  2DJZ A;  3PZC A;  1PSE A;  3E9H A;  3QYH B;  4TWA A;  3JCM d;  5KCH A;  1UEC A;  4BE0 A;  1M9S A;  3RUX A;  1TUD A;  3UH0 A;  2LNV A;  4MDX A;  1V29 B;  3QBY A;  3INZ A;  4F7U G;  1OQK A;  2ESW A;  2PZ1 A;  4B9X A;  2FHD A;  2XID A;  1YIJ A;  2E41 A;  3ME9 A;  8AT1 B;  5M9O A;  3PCO B;  2QK0 A;  1GCP A;  4E7I A;  3EFO B;  4BDZ A;  4OMP A;  4YCV A;  4M75 D;  3L2V A;  1M2O A;  1SG5 A;  1YIJ Q;  2JM9 A;  4IUT A;  1PCX A;  3FRN A;  4II1 A;  2DER A;  1KQS A;  3M59 A;  4RQE A;  2HL3 A;  5CIU A;  1M2V B;  4ZTJ A;  2KK4 A;  1BIB A;  2LTO A;  2PME A;  2VGM A;  3HTR A;  2DYI A;  3P8D A;  1ZSZ B;  3OS2 A;  4G85 A;  4H2W A;  1D1A A;  1AT1 B;  1QP3 A;  3REA B;  5J3B A;  4Z02 A;  1BI1 A;  4J9F A;  3CCJ T;  4EIK A;  4M75 F;  4H2S A;  1AWO A;  1S72 Q;  1M1G A;  5GMK m;  5L8R E;  4WF2 A;  5LL6 S;  1T0H A;  2HZY A;  1X6G A;  5IHN A;  4M7D D;  1WHL A;  2V8K A;  1VQ9 T;  1N5Z A;  2AKW A;  2ZR2 A;  4LNS A;  4JRP A;  1RAA B;  2X3W D;  2YSQ A;  2XG8 D;  3A5Z A;  2O31 A;  1RIQ A;  2KAF A;  4X5O A;  2CP3 A;  3HL8 A;  2KT8 A;  2EFI A;  3H8Z A;  3CCQ T;  1YJW T;  3A74 A;  3ICA A;  3TRE A;  2GCX A;  4M7D F;  4AFS C;  2E3C A;  1KFZ A;  2ODR D;  3MEA A;  1WDX A;  4UC4 A;  1WPY A;  5C6S A;  3HP9 A;  2DTO A;  3X26 B;  2ZXF A;  4P74 A;  4OMF B;  3VYH B;  2VYT A;  4J9C A;  3G4S T;  2HNI A;  3LH5 A;  1SSF A;  4E7S A;  3CBP A;  4JRQ A;  3EG3 A;  3TQ7 P;  4XK8 E;  2RQT A;  1N9R A;  3A8H B;  2ZPG B;  4M7A C;  2A08 A;  3JCM e;  3OYD A;  3OYF A;  4M7A G;  2MCN A;  1JJC B;  1M1K U;  3JCM W;  1VQ5 Q;  5CR2 A;  1NM7 A;  4EMH A;  1GBQ A;  2DIL A;  1GGM A;  2P4T A;  1M90 R;  2KXC A;  4KRT A;  4J6X A;  3LSS A;  1VQM A;  2KQW A;  1I81 A;  3VV0 A;  3NEN A;  4OB2 B;  4TQF A;  2CP5 A;  1Y96 B;  3QZ5 B;  5FU6 C;  4N0A A;  1VQM Q;  2KR3 A;  2YT6 A;  2BTT A;  4YRJ A;  4C8Q A;  4YRS A;  2DF6 A;  4L6V 5;  1WLE A;  1I5O B;  2PVO B;  4ZN1 A;  2AK5 A;  4PLL A;  3NTI A;  4B6M A;  2E3H A;  4Y28 E;  5IT9 E;  2CKK A;  1VYT A;  2DXU A;  4PG3 A;  1Q86 C;  4RMF A;  3QYG B;  4J9I A;  1MMN A;  4LVJ A;  1N27 A;  1AZG B;  1FMW A;  3FLG A;  4O2D A;  4CH4 A;  1BI0 A;  5LJ5 f;  1YP5 A;  2OJ2 A;  1N8R C;  4YPF A;  1R0B G;  4PKC C;  2OTL T;  1PRL C;  3HXX A;  1H3H A;  1HYO A;  2R58 A;  3OSS C;  2KE9 A;  4M75 B;  3CCL A;  1JRI A;  1OPL A;  1UGR B;  2J6F A;  2O9V A;  3QSU A;  1H8K A;  1NYF A;  1Q82 C;  4BI8 B;  2RQW A;  4ORZ A;  3BFM A;  3LGF A;  1QKW A;  3LC0 A;  1K73 C;  3CCL Q;  4HWT A;  3LWH A;  4TQD A;  3VQV A;  5KYU A;  3EGD A;  4H2U A;  4TVR A;  1ADJ A;  2LRQ A;  3OYJ A;  4DOV A;  4J9D A;  2DVJ A;  1SRM A;  4R56 A;  4DEY A;  2DX1 A;  2WSF E;  1VUB A;  1M5Q 1;  3PMI A;  3OY9 A;  1JEG A;  1H4S A;  4QQ6 A;  5K1X A;  1BB9 A;  4P75 C;  4M7D B;  3VJP A;  1EVL A;  2LDM A;  3OQ5 A;  2M0Y A;  4UPA A;  1NYG A;  1ZQ1 A;  4M78 D;  3VS1 A;  4C5E A;  5GMK h;  5KE3 A;  2EYW A;  1U1T A;  3EFR A;  3CC4 A;  4J5Y A;  2EPD A;  3JCM V;  1BI3 A;  2COW A;  3S3N A;  1JXO A;  3HKS A;  3N5B B;  2DBK A;  4CI0 C;  2O4X A;  1G8X A;  1NPR A;  1VQK A;  2CGH A;  3CC4 Q;  2F5T X;  2K9G A;  2VV5 A;  4JUV A;  4CC3 A;  1PKT A;  2JUF A;  5LJ3 h;  3NHN A;  2ZAE A;  1B70 B;  4M78 F;  1KMN A;  2QHS A;  2P84 A;  2I4M A;  1BI2 A;  1Q86 R;  1VQK Q;  3OYG A;  2EVR A;  1G5H A;  1P92 A;  1N8R R;  2ZT7 A;  4F04 B;  1VQ8 Q;  1RL2 A;  1ZBX A;  4A63 B;  4PJO A;  2VVK A;  2V8I A;  3J80 E;  2L8D A;  4CC2 A;  2QQB A;  1UUE A;  3UF4 A;  3QO8 A;  3VUB A;  1Q82 R;  2HQE A;  2CH4 W;  3CME T;  1QWE A;  1OUL A;  5FWB A;  1K73 R;  2J06 A;  1UE9 A;  4XTU A;  5GAN 7;  2XD0 A;  2DXT A;  3VS2 A;  1UGS B;  1Y0M A;  1WHM A;  2VUB A;  4X1V A;  4KR3 A;  2CUD A;  1H64 1;  3IQL A;  5ELO A;  1KMM A;  1VIE A;  3CCU T;  2K2V A;  3J7A F;  3R6O A;  4FU6 A;  3A8L B;  1K8A U;  3CMA A;  2HSE B;  2EAY A;  2DET A;  2XI9 A;  3P8V A;  4F7U A;  2D1X A;  3P8B B;  2DK3 A;  2DRM A;  4MDW A;  3NET A;  4YCU A;  1ADY A;  1K0X A;  3UGQ A;  2JT4 A;  4PL6 A;  2K4Y A;  2RQU A;  3HFN A;  1PKS A;  3G71 A;  1NYQ A;  1X27 A;  4C92 E;  4D6W A;  2DU7 A;  1C6V X;  4H2X B;  2JMA A;  4QQD A;  2IVW A;  3EHQ A;  1H4Q A;  1M3A A;  1ZA2 B;  2LCC A;  3V7S A;  2JW4 A;  3JCM P;  1NBE B;  3G71 Q;  5HKC A;  4OMQ A;  1W70 A;  1UDL A;  4PFZ A;  4KUI A;  4JDS A;  1ZHI A;  3I35 A;  3REU A;  4OLF A;  3A1P A;  2W10 A;  1RAE B;  4HWP A;  3EGX B;  2P0P A;  2OI3 A;  4MZM A;  2JTE A;  2WSE E;  1YJ9 A;  1K9M C;  3QWY A;  4IUQ A;  2E12 A;  5C0M A;  2COY A;  2DEU A;  2D6F A;  2RI3 A;  2D8H A;  1LYL A;  3OYB A;  2GTJ A;  3LLR A;  1YJ9 Q;  4E7H A;  1OOT A;  1PSF A;  1WYX A;  1IRX A;  1IRE B;  3TEH A;  1OV3 A;  4AFQ C;  5FRO A;  1O75 A;  4QQG A;  3LW5 E;  4BI4 A;  3CC7 T;  3EH2 A;  4J83 A;  4Q15 A;  1KOG A;  3BY7 A;  2X4X A;  4KBM B;  2HBP A;  4N4G A;  1PHT A;  3MCA B;  1R77 A;  5FRN A;  5ELN A;  4M77 E;  2NS6 A;  2LJ3 A;  3JB9 D;  1KJW A;  1ATI A;  1QQJ A;  4EDU A;  1YGB A;  3QO3 A;  4M78 B;  4M78 E;  2DL4 A;  1OU9 A;  2E6N A;  3G1J A;  4A53 A;  1QVG A;  3S6W A;  1VQZ A;  2E64 A;  1R0C B;  3SWN C;  3Q1J A;  2DL5 A;  4V2S A;  1VQN A;  5LJ3 d;  3I55 A;  4FYW B;  3M0R A;  3C0C A;  2ZIN A;  5FWC A;  2KNB B;  1B7Y B;  2L3Q A;  1SF9 A;  3JB9 F;  3ZL7 C;  1YI2 T;  5J26 A;  3RR6 A;  1VQN Q;  3I55 Q;  1X6B A;  3OMG A;  2P5I A;  2GFA A;  3QO5 A;  2DD4 A;  3VQW A;  2E10 A;  4MMK A;  5GAO n;  3VRZ A;  3H9N A;  4CRI A;  4M7A A;  1Q95 G;  3EG9 B;  1K9M R;  2RHQ B;  4RKU E;  4J6W A;  1KQ1 A;  1MHN A;  2KRO A;  5GAN f;  4YRT A;  3MP8 A;  2GTO A;  2YLC A;  3CBO A;  3RKW A;  2FEI A;  3A32 A;  4MML A;  2X4Y A;  2XU8 A;  2ED0 A;  5C53 B;  5FU7 C;  1MMG A;  1Y57 A;  2XMF A;  1PD0 A;  1YJN T;  1D0Y A;  1KC8 C;  2EJG A;  1BYM A;  4XU0 A;  2JS2 A;  2LQ8 A;  2CS7 A;  4FIB A;  5GAM h;  2L3S A;  1WJR A;  2RHX A;  2QHV A;  5KYW A;  4LD6 A;  1VQ6 T;  3VUZ A;  2X9H A;  4C92 C;  3BDL A;  4OB1 B;  4YRR A;  3M54 A;  4C92 G;  2ZR3 A;  1JJ2 S;  3O8V A;  1E24 A;  2LJ1 A;  12AS A;  2EYY A;  3E9I A;  3E19 A;  4KQE A;  1TTH B;  3HRT A;  2EKO A;  4EMK B;  1Y71 A;  3OB9 A;  2EW3 A;  2QG9 B;  3NTH A;  5CVI A;  1VQ4 A;  3TSZ A;  2YRC A;  5KCO A;  4RCC A;  3M0U A;  1KQS S;  4Y91 A;  2FYK A;  2PQW A;  3KFU A;  2LQK A;  3NPF A;  2DA9 A;  3OW2 S;  1VQ4 Q;  3V8J A;  3QDF A;  3V8L A;  2ZZF A;  1YIT A;  2E5A A;  4JRI A;  1X75 C;  1IHV A;  2JMC A;  4DEX A;  3QTC A;  2GGR A;  2YUO A;  1K0S A;  1G2B A;  5IN1 A;  5GAO q;  3MEU A;  3VS7 A;  3HXY A;  2FPE A;  1O9S A;  1Q7Y R;  4DOW A;  1YIT Q;  5GMK e;  1VQ7 A;  2QA4 T;  3HPW A;  2ABL A;  2IY5 B;  2QGF B;  3OS0 A;  4F14 A;  4TVY A;  3BJU A;  1HSQ A;  4M77 C;  4P75 A;  2DJQ A;  1G3T A;  2YRD A;  4CC7 A;  5LJ3 g;  1YCS B;  3VBB A;  5D6X A;  3V7R A;  1TU0 B;  1VQ7 Q;  4M77 G;  4H02 A;  1WJQ A;  2RN8 A;  1BCM A;  4P5N A;  2XHC A;  4LVI A;  4XEO A;  4XTV A;  2KEA A;  4J9B A;  4LE9 A;  4JS4 A;  11AS A;  4M78 G;  1KD1 R;  3VU3 C;  2BZY A;  3L1A A;  3WXM B;  3OYN A;  2PNI A;  3OYY A;  1JBM A;  5GAO m;  2QYZ A;  3PVQ A;  5GAN h;  1ABQ A;  3RKY A;  1RLP C;  4C5H A;  2BKD N;  5D6W A;  4IKF A;  1X2Q A;  3MP1 A;  1EIY B;  1YHQ A;  1NNH A;  2LC4 A;  1W2B P;  2DFU A;  4N4H A;  3G1Z A;  3HSB A;  1Y7X A;  1YFS A;  3VQX A;  2XDP A;  3I56 T;  2OTJ T;  2CP6 A;  2HQH A;  1S1N A;  5LJ5 g;  1U06 A;  1TUC A;  1VQP T;  1YHQ Q;  2KMT A;  3CC2 A;  2FZC B;  4RTV A;  3ASK A;  1JJ2 A;  1RAG B;  4PJL A;  4CS4 A;  1PC0 A;  3RDV A;  1I0C A;  4C0D B;  2V26 A;  5DY9 A;  2D0N A;  4ZGJ B;  2L89 A;  1SHF A;  4KH0 B;  4DPG A;  4PJN A;  4HVU A;  2O2O A;  2DIG A;  2XIC A;  2XK0 A;  2NUP A;  3CC2 Q;  2K3X A;  2CT3 A;  4L59 A;  3CXC A;  2CH4 A;  1BK2 A;  4HT8 A;  1EQR A;  1ZUY A;  2O01 E;  3SHW A;  5GAM d;  2EGA A;  3CCM T;  1E6H A;  1EFW A;  3NEM A;  1BCO A;  5I2S A;  2FZG B;  2EGC A;  2L3R A;  1SRL A;  3OW2 A;  1S72 A;  2R57 A;  2DXB A;  4P72 C;  4WJ3 M;  4LUE A;  1RUW A;  1WIE A;  1WYD A;  1WHH A;  2M51 A;  1IL2 A;  3M56 A;  3HFZ A;  3SDZ A;  2Z0W A;  3KBG A;  1C0M A;  3FIF A;  2HL5 C;  3OYI A;  3JB9 H;  1Q81 C;  2XGT A;  5KYX B;  2E1H A;  2KRN A;  4ZGE B;  3UGT A;  1B3Q A;  1WX6 A;  3KUF A;  1WXT A;  1HC7 A;  2RHY A;  2LCL A;  2QQ9 A;  3I5S A;  1Q86 U;  1B07 A;  2QEX A;  4A54 A;  4WJ4 A;  1W1F A;  3V8K A;  1QW1 A;  2ROL A;  3TCJ A;  4LXC A;  4RQF A;  4QW2 A;  3FDR A;  4ESR A;  1N8R U;  1WXU A;  3MO8 A;  5CKE A;  2HDA A;  2QI2 A;  3I5R A;  2QEX Q;  4JZ4 A;  1HD3 A;  3RMS A;  2KRM A;  1NJI C;  2DL7 A;  1XQH A;  4O5V A;  1AD5 A;  3CME Q;  1Q82 U;  1OX8 A;  1HXD A;  1E1O A;  2LVM A;  4BY6 C;  1HJD A;  4PJM A;  3CCR T;  1K73 U;  3CCV T;  5GAO r;  2EQJ A;  3I9Q A;  4FCY A;  1VQO T;  2JXB A;  3G6E A;  3PT9 A;  3E1S A;  1ZX6 A;  2K5L A;  5D6Y A;  1W2B A;  1PYS A;  2ARU A;  4P73 C;  2X3X D;  1UGV A;  7AT1 B;  3CCU Q;  4QVC A;  1OX9 A;  3L4G A;  2QAZ A;  2PUO B;  2AIR B;  1VQ5 A;  3CD6 T;  3JB9 G;  3G6E Q;  2DQ0 A;  1RAI B;  3DKM A;  3C94 A;  1I5L A;  3CCS T;  2YHT A;  3SWN A;  2DLP A;  1AVZ C;  1D0Z A;  2DDZ A;  3CPW P;  2NUZ A;  2DIQ A;  3VS6 A;  4HT4 A;  3GIB A;  1NE8 A;  4IUP A;  1DJ7 B;  4JJB A;  4JS5 A;  4VUB A;  2L5Q A;  1VIF A;  2L2P A;  4ELY C;  4DBF A;  4C8Q D;  1Q81 R;  1EFN A;  2V8J A;  4YTL A;  3UT1 A;  1I07 A;  1YNZ A;  2YWW A;  1WA7 A;  3VRY A;  2W0Z A;  4RDX A;  2RQV A;  1WXB A;  3CCE A;  2AZV A;  5GAM g;  3JSC A;  1UGP B;  2RH2 A;  2J7I A;  2YRV A;  2XDB A;  2Y4X A;  2L3P A;  2SRC A;  4C8Q F;  2RHS A;  1JO8 A;  1TOV A;  3E9F A;  3CCE Q;  2KYM A;  1RAB B;  4BE2 A;  2ZPH B;  4LVM A;  2DTH A;  2VAS A;  1NJI R;  2OAU A;  5GJV B;  2MIO A;  3HXU A;  3HXV A;  3VS0 A;  2DTI A;  4M75 E;  1VQL A;  3L2U A;  3GF5 A;  2MI6 A;  3URG A;  1ZSZ C;  4OMN A;  2RF0 A;  2J6O A;  3C4S A;  2WSC E;  3KFV A;  1W6X A;  1YWO A;  5D7U A;  4C92 A;  3BDU A;  1QVF P;  4AFZ C;  1WQW A;  2LNH B;  4X9C A;  1VQL Q;  4P3P A;  4PK4 A;  2K7A A;  4XTY A;  2A28 A;  2ED1 A;  4NS5 A;  3NFC A;  1K1Z A;  2R5A A;  2RPN A;  2FVU A;  1PNJ A;  1X6O A;  2KT1 A;  2A7Y A;  2AKW B;  3UWN A;  4FM4 B;  2QXF A;  4E7J A;  1M27 C;  3A5Z B;  1B34 A;  2AMC A;  2CP2 A;  3X25 B;  3P8H A;  1OZ3 A;  5GJW B;  1X54 A;  4M7D E;  4TTV A;  2JOY A;  3F70 A;  1TS9 A;  4MZT A;  1Z9Z A;  2FPF A;  3L42 A;  2LCS A;  1M30 A;  2LQW A;  4LN2 A;  3RER A;  2M9U A;  4UP9 A;  2DMO A;  2LP5 A;  1NJ6 A;  2JTM A;  3R07 A;  2C0I A;  1A0N B;  2RQR A;  4LDY A;  3MEW A;  4IUU A;  4H2Y A;  4LVK A;  2ZPI B;  5ECA A;  1YIJ T;  1K9M U;  2LX7 A;  2MF2 A;  1AWJ A;  1LVK A;  1RAF B;  2VWF A;  1WQ7 A;  4X9D A;  3GBQ A;  3CPW A;  1GFD A;  4BUG A;  1NJ5 A;  3HFV A;  1M8M A;  1LJO A;  1IHW A;  1V1C A;  2ZPF B;  2JZ2 A;  4OGE A;  1M1K C;  1VQ8 A;  3M0Q A;  1UHC A;  4M77 A;  5GAN g;  4PJO D;  4Q6G A;  2ALY A;  2KVQ G;  3THK A;  3JAM E;  2XTI A;  2RK1 A;  4GY5 A;  3OS1 A;  2R5M A;  2A8E A;  1VA7 A;  1I8F A;  4RTX A;  4Z89 A;  1K76 A;  1TG0 A;  4KGX B;  2RHU A;  4HCB A;  5E3I A;  1TUG B;  1QVG S;  1UTI A;  4HWS A;  4CC4 B;  3QNE A;  4PJO F;  3HXZ A;  4JLG A;  1L0W A;  1N9S A;  4NL2 A;  2HEQ A;  4AH6 A;  5I2M A;  3E9G A;  1B8A A;  3RF1 A;  5IXF A;  2FL7 A;  2KYB A;  3OYL A;  4K86 A;  1CSK A;  4PJJ A;  2RHI A;  5LJ5 h;  3JCM X;  1YB3 A;  3EHR A;  1D1C A;  4AFU C;  4HCZ A;  4C8Q B;  4N4I A;  2KY9 A;  4HWR A;  3RGL A;  1HK9 A;  4Z88 A;  4D8D A;  5CO7 A;  4OVA A;  1AOJ A;  1MV3 A;  3ZEH A;  3T9N A;  1UFF A;  4LDW A;  3JCM f;  2DYB A;  4EPC A;  3HFO A;  4YRF A;  2HBW A;  2I4N A;  4F7U F;  3PIP A;  1YN8 A;  2F1L A;  2DE0 X;  2ZT6 A;  2NYS A;  2DKG A;  2PMF A;  4RTT A;  4EX5 A;  1Q7Y U;  3QKJ A;  2QA4 Q;  2PVG B;  5CKH A;  1B76 A;  3P8Y A;  4M75 C;  1D3B B;  2X51 A;  2ART A;  4M75 G;  1SES A;  3IG2 A;  3RNJ A;  3A5Y A;  2HKQ B;  2QTX A;  1SEM A;  3NGP A;  4R55 A;  1QCO A; 
#chains in the Genus database with same CATH homology
 4P72 A;  1KC8 U;  3JCM J;  3CMQ A;  1GXI E;  1EVK A;  4A4K A;  1KD1 U;  2K5I A;  1ASY A;  5DM7 R;  1WNL A;  2J3L A;  1G5V A;  2ZIM A;  1VQM T;  3HY0 A;  3L2R A;  4M7D C;  4CH5 A;  3A31 A;  4OB0 B;  4M7D G;  4YRM A;  2A3L A;  2EQU A;  1EOV A;  3AHU A;  3BW1 A;  2Q7E A;  4YRO A;  1C0A A;  1OYX A;  2CJA A;  2DPP B;  3PFS A;  2ODR C;  1FWZ A;  5CK9 A;  4EO4 A;  2VXF A;  1RI0 A;  2Q5H A;  1NPP A;  3CPF A;  4IUR A;  4P3N A;  5HGQ A;  2MWP A;  5DLQ E;  1QVP A;  5GMK j;  4P73 A;  3CCL T;  2P0K A;  2ZZE A;  4M7A D;  1FXX A;  1G3W A;  4PJO B;  3REX A;  4E7K A;  2RJF A;  3CCJ A;  3GOX A;  1NYR A;  3S3M A;  4C5I A;  2CJB A;  3JB9 I;  1YFT A;  1M8V A;  4YYE A;  1K8A C;  4MZP A;  3JCM h;  3TEE A;  5LJ3 j;  2RM4 A;  3PMT A;  1BKB A;  2PUK B;  1VQ9 A;  2MWO A;  3QJ6 A;  4M7A F;  2JVV A;  5LJ5 d;  2YLB A;  4H2V A;  4YRC A;  2QQS A;  3M4P A;  1YJW A;  3CCQ A;  2JTF A;  4F7U B;  2E65 A;  2EQK A;  2ZZD A;  2DVE A;  3JCM Q;  3CC4 T;  4ZN3 A;  2MAM A;  4J8O A;  2JN0 A;  4XQ3 A;  4JRK A;  1I4K 1;  2RI5 A;  3RAC A;  3PCO A;  4C0Z A;  2BUD A;  3RKX A;  3FB9 A;  5GAN 4;  4RG2 A;  4K87 A;  4KR2 A;  1NJ2 A;  1VQK T;  1UB4 A;  1E22 A;  3J81 E;  4TVA B;  2H3J A;  3G4S A;  3QDR B;  4CS2 A;  5F5W A;  4LDU A;  3CXC S;  4YRE A;  3OYE A;  1N9W A;  2JNG A;  3IKL A;  3L2Z A;  1NJ8 A;  3A7U A;  3TEH B;  3NEL A;  4HA8 A;  4YCW A;  3OBY A;  3X28 B;  2RK2 A;  3HTZ A;  1G3Y A;  2DAQ A;  4O6J A;  2CZ1 B;  3MF1 A;  2CZ7 B;  5EG2 A;  5K1P A;  2DEQ A;  3DLL A;  1Q81 U;  3WVE B;  2EYQ A;  4C0F A;  3QO7 A;  3CMA T;  4M78 C;  3HRS A;  2C06 A;  4PHC A;  3QZ9 B;  5GAN 2;  2Y4Y A;  1QP2 A;  3GLX A;  5LJ3 e;  4UP7 A;  5AYF A;  3GP8 A;  3G71 T;  4HKE A;  4P71 C;  5GMK l;  2ZTG A;  2GFU A;  4LDX A;  1XNI A;  3TEG A;  2OTL A;  4EMG A;  3UPU A;  1H3Z A;  4HCC A;  3QUI A;  3V7C A;  3OMC A;  1NJI U;  4CH6 A;  3ERR A;  1W66 A;  3RIR A;  4FT4 A;  2DZC A;  1W2B S;  2J3M A;  1YJ9 T;  4M7A B;  3GNF B;  3UFG A;  1H4T A;  1BIA A;  2KDS A;  2ZNJ A;  2E6Z A;  3OD1 A;  2E70 A;  1JJC A;  2VXE A;  4K88 A;  3X24 B;  3FC3 A;  5LJ5 e;  2ARS A;  3OS5 A;  3IAL A;  2EL9 A;  2DQ3 A;  3OYK A;  1XOV A;  4C0G A;  2XKO C;  1Y96 A;  5FU6 B;  3LSQ A;  4YRK A;  5A2Q E;  3S3O A;  4DQ2 A;  4HWO A;  3VQY A;  3QII A;  4XAX B;  5CKF A;  4BW9 A;  3MEV A;  4ZGD B;  4RMO A;  4A4F A;  4CS3 A;  4BB7 A;  2QQA A;  4L5G A;  4WI1 A;  3W3S A;  3I7F A;  2CJ9 A;  4EMK C;  1VQN T;  3I55 T;  2VGN A;  3RES A;  4HVC A;  3IKM B;  1YFR A;  1X55 A;  1KG1 A;  5A0G A;  5GAM j;  4M75 A;  4ATO A;  2K57 A;  2M1H A;  4OP0 A;  4GLK A;  3LX7 A;  2K3Y A;  1QF6 A;  4ZTF A;  3UDC A;  1M90 C;  3P8T A;  3HRI A;  3CME A;  1SRY A;  3LWI A;  4TVW A;  4RCB A;  1FYF A;  4YDQ A;  1BBU A;  4NOY A;  1M4Z A;  4X34 A;  5FRM A;  3H6Z A;  3CCU A;  3DSQ A;  1QE0 A;  2ZT8 A;  1G3S A;  4M7D A;  3LYI A;  3MHX A;  3OYA A;  1UEB A;  2KSS A;  3M53 A;  2RJC A;  5GAN 8;  1AHJ B;  1EIF A;  3FJP A;  1FX7 A;  4NCX A;  3PNW C;  4KUD K;  1NZ9 A;  5GAN d;  2M0O A;  2GQV A;  5J39 A;  1Z7M A;  1B70 A;  5HK3 A;  4DA4 A;  3G7Z A;  3M4G A;  4XEM A;  3JCM g;  3CPW S;  3OSV A;  4J6Y A;  1VQ4 T;  3ZBD A;  4Q5W A;  3M5A A;  3JCM c;  5CAI A;  3HHT B;  3C95 A;  1HTT A;  2F5K A;  4LDV A;  2HD0 A;  3QG1 A;  4XTX A;  3OBW A;  2C7I A;  5LJ3 f;  1X2G A;  1YIT T;  4YRP A;  4C5G A;  4C0D C;  4XU1 A;  5GAN j;  3JCM b;  3CC7 A;  2FB7 A;  4YRQ A;  2RD1 A;  5GAM e;  2DU5 A;  4BWA A;  4ME7 A;  1VQ7 T;  2CZ0 B;  1KQ2 A;  5HY6 A;  4C92 D;  2QHT A;  2I2L A;  1IZ6 A;  4KT0 E;  1Z7N A;  3SB2 A;  3OYC A;  2PU9 B;  4BDY A;  3HFZ B;  4PNO A;  4H2X A;  3QXE B;  2QHU A;  1QVF S;  2DXC A;  4A4E A;  1YI2 A;  4C92 F;  5CQX A;  2RHZ A;  1N6A A;  1SET A;  1KHC A;  4A4H A;  1D3B A;  3LGL A;  2ZT5 A;  3VYG A;  3FEO A;  4CH3 A;  1YHQ T;  4QVZ A;  3A7R A;  2F69 A;  4BI3 A;  2G4C A;  3RMQ A;  4A4G A;  2IG0 A;  2MMP A;  2EWN A;  4NL3 A;  1USY C;  3CC2 T;  4XU3 A;  2DD5 A;  2XDD A;  2P0Q A;  5C51 B;  1E1T A;  1SER A;  4B9W A;  1YJN A;  3EAE A;  4M77 D;  5CCA A;  2D9T A;  1PYS B;  4LD9 K;  1VQ6 A;  2X4J A;  4LVL A;  3L4G B;  4H2T A;  5C52 B;  3HXW A;  2ZZG A;  4UP8 A;  4FSX A;  4M78 A;  1S72 T;  1XTD A;  4M77 F;  5GAN e;  3SWN B;  4IUV A;  1BBW A;  4P71 A;  3VKI A;  3MET A;  4YRL A;  2LT4 A;  1B7Y A;  5CQY A;  5GAN 6;  5KH6 A;  2WAC A;  4KUL A;  2QEX T;  1X56 A;  3LH0 A;  4C8Q E;  2ZCE A;  2RHQ A;  3MF2 A;  3M57 A;  3EFS A;  2RHS B;  2ZNI A;  1QVF A;  2QA4 A;  5A0L A;  1TH7 A;  1MGQ A;  5FU7 B;  2D0Q B;  3A8M B;  3JB9 J;  3A8G B;  2EQM A;  4G84 A;  5GAN 5;  4P3O A;  5IAY A;  3RL6 A;  3G6E T;  3CEY A;  3NTK A;  3A7A A;  2CYZ B;  1LNX A;  4C92 B;  1X01 A;  1JB0 E;  5A0D A;  4ZIB A;  4XTW A;  3OYH A;  1VQ5 T;  2PVD B;  1J5W A;  2GF7 A;  4BAC A;  3SD4 A;  3TU4 K;  4TVA A;  3MP6 A;  5GAM f;  4EMK A;  1Y07 A;  5CKD A;  3M9Q A;  4J7I A;  1ASZ A;  1B34 B;  2AMC B;  3PIO A;  3I56 A;  2OTJ A;  4XTZ A;  1VQP A;  2EJF A;  2DZ9 A;  1U8R A;  1R8O B;  2CIM A;  2ZPB B;  3PGG A;  3A8O B;  4JJN K;  2HAX A;  3CCE T;  1WU7 A;  3X20 B;  2G3R A;  2O4X B;  4P74 C;  5GMK i;  3GPL A;  3CCM A;  1YBY A;  2IY5 A;  4OB3 B;  3MQZ A;  4M77 B;  2ALY B;  2DO3 A;  2C8M A;  2ZPE B;  1VQL T;  4ELZ C;  4QVD A;  3QHS A;  4PJO E;  2I4O A;  3QPH A;  4JLI A;  2Q7H A;  3MEY A;  5GAN 3;  3PTA A;  2BIV A;  2RA2 A;  2RI2 A;  3CBM A;  3DB4 A;  2I4L A;  5CKB A;  5FLX E;  1EIY A;  1H4V B;  2AHJ B;  3M4Y A;  2Y90 A;  3HRU A;  4N0A C;  4C8Q C;  1Q7Y C;  2X35 A;  1M1F A;  3HRK A;  4F7U E;  1YCY A;  3ZFJ A;  3M58 A;  4C8Q G;  3DLM A;  1KHI A;  5KE2 A;  3L2Q A;  5HK0 A;  1W4S A;  3CCR A;  4YP0 A;  3CCV A;  1U1S A;  2Q7G A;  2RO0 A;  3DB3 A;  4XU2 A;  5GAO l;  1VQO A;  4HT9 A;  4E7L A;  3JRZ A;  1X2H A;  1OZ2 A;  1KD1 C;  5LJ5 j;  1G51 A;  4RG8 A;  4E47 A;  1VQ8 T;  1OI1 A;  4J7F A;  4E51 A;  2CZ6 B;  4YRG A;  3CD6 A;  3C12 A;  4OF1 A;  4ZTU B;  3SFM A;  3CCS A;  4BE1 A;  2EIF A;  4FL6 A;  2B8A A;  1WGS A;  5GAO p;  2ZGW A;  4L87 A;  4YRI A;  5I21 A;  5DLO A;  3WVD B;  2NLU A;  2P0L A;  1UGQ B;  4J15 A;  2QQR A;  4PLI A;  3M55 A;  3HY1 A;  1G5I A;  1LOJ A;  2HQX A;  4OGC A;  1USY A;  2RJE A;  2E5Q A;  1NJ1 A;  3TUP A;  4YRN A;  2RB6 A;  1M90 U;  2RJD A;  4BY6 B;  2K5F A;  1WJS A;  2ZCF B;  3M4Q A;  2LX9 A;  3QJY A;  2VC8 A;  4ZTZ B;  2ZIO A;  2M16 A;  2EJ9 A;  3L2W A;  3OYM A;  4BD3 A;  2X4W A;  4PJO C;  3ER0 A;  3OA6 A;  5KNN A;  4PJO G;  3KXT A;  4FT2 A;  4M7A E;  3WQZ A;  2Q5I A;  3GNG A;  2QDY B;  2LT1 A;  2DJZ A;  3PZC A;  1PSE A;  3E9H A;  3QYH B;  4TWA A;  3JCM d;  5KCH A;  4BE0 A;  1M9S A;  3RUX A;  3UH0 A;  2LNV A;  4MDX A;  1V29 B;  3QBY A;  3INZ A;  4F7U G;  4B9X A;  2FHD A;  2XID A;  1YIJ A;  2E41 A;  3ME9 A;  5M9O A;  3PCO B;  4E7I A;  4BDZ A;  4YCV A;  4M75 D;  3L2V A;  4IUT A;  4II1 A;  3FRN A;  1KQS A;  3M59 A;  4RQE A;  5CIU A;  4ZTJ A;  2KK4 A;  1BIB A;  2LTO A;  2PME A;  2VGM A;  3P8D A;  3OS2 A;  4G85 A;  4H2W A;  1QP3 A;  5J3B A;  4Z02 A;  1BI1 A;  3CCJ T;  4M75 F;  4H2S A;  1M1G A;  5GMK m;  5L8R E;  4WF2 A;  5LL6 S;  4M7D D;  2V8K A;  1VQ9 T;  2AKW A;  2ZR2 A;  4LNS A;  4JRP A;  2XG8 D;  3A5Z A;  1RIQ A;  2KAF A;  4X5O A;  3HL8 A;  2EFI A;  3H8Z A;  3CCQ T;  1YJW T;  3A74 A;  3ICA A;  3TRE A;  2GCX A;  4M7D F;  2E3C A;  2ODR D;  3MEA A;  4UC4 A;  1WPY A;  5C6S A;  3HP9 A;  2DTO A;  3X26 B;  2ZXF A;  4P74 A;  4OMF B;  3VYH B;  2VYT A;  3G4S T;  2HNI A;  1SSF A;  3CBP A;  4JRQ A;  4XK8 E;  1N9R A;  3A8H B;  2ZPG B;  4M7A C;  3JCM e;  3OYD A;  3OYF A;  4M7A G;  1JJC B;  1M1K U;  3JCM W;  5CR2 A;  4EMH A;  1GGM A;  2P4T A;  4J6X A;  3LSS A;  1VQM A;  2KQW A;  1I81 A;  3VV0 A;  3NEN A;  4OB2 B;  4TQF A;  1Y96 B;  3QZ5 B;  5FU6 C;  4N0A A;  4YRJ A;  4YRS A;  4C8Q A;  4L6V 5;  1WLE A;  2PVO B;  4ZN1 A;  4PLL A;  3NTI A;  4Y28 E;  5IT9 E;  2CKK A;  2DXU A;  4PG3 A;  1Q86 C;  4RMF A;  3QYG B;  4LVJ A;  1N27 A;  3FLG A;  4O2D A;  4CH4 A;  1BI0 A;  5LJ5 f;  4YPF A;  1N8R C;  4PKC C;  2OTL T;  3HXX A;  2R58 A;  3OSS C;  4M75 B;  3CCL A;  1JRI A;  1UGR B;  3QSU A;  1Q82 C;  4BI8 B;  3BFM A;  3LGF A;  3LC0 A;  1K73 C;  4HWT A;  3LWH A;  4TQD A;  3VQV A;  4H2U A;  4TVR A;  1ADJ A;  2LRQ A;  3OYJ A;  4DOV A;  4R56 A;  2WSF E;  1VUB A;  1M5Q 1;  3PMI A;  3OY9 A;  1H4S A;  4QQ6 A;  5K1X A;  4P75 C;  4M7D B;  3VJP A;  1EVL A;  2LDM A;  3OQ5 A;  4UPA A;  1ZQ1 A;  4M78 D;  5GMK h;  4C5E A;  5KE3 A;  1U1T A;  3EFR A;  3CC4 A;  4J5Y A;  3JCM V;  1BI3 A;  3S3N A;  3HKS A;  3N5B B;  4CI0 C;  2O4X A;  1NPR A;  1VQK A;  2CGH A;  2F5T X;  2VV5 A;  4JUV A;  2JUF A;  5LJ3 h;  1B70 B;  4M78 F;  1KMN A;  2QHS A;  2I4M A;  1BI2 A;  3OYG A;  1G5H A;  1P92 A;  2ZT7 A;  1RL2 A;  1ZBX A;  4PJO A;  2V8I A;  3J80 E;  2L8D A;  2QQB A;  3QO8 A;  3VUB A;  2HQE A;  3CME T;  4XTU A;  5GAN 7;  2XD0 A;  2DXT A;  1UGS B;  2VUB A;  4KR3 A;  1H64 1;  5ELO A;  1KMM A;  1VIE A;  3CCU T;  2K2V A;  3J7A F;  3R6O A;  4FU6 A;  3A8L B;  1K8A U;  3CMA A;  2EAY A;  3P8V A;  2XI9 A;  4F7U A;  3P8B B;  2DK3 A;  4MDW A;  3NET A;  4YCU A;  1ADY A;  3UGQ A;  4PL6 A;  2K4Y A;  3HFN A;  1NYQ A;  3G71 A;  4C92 E;  4D6W A;  2DU7 A;  4H2X B;  4QQD A;  2IVW A;  1H4Q A;  2LCC A;  3V7S A;  3JCM P;  5HKC A;  4KUI A;  4JDS A;  1ZHI A;  3REU A;  4OLF A;  4HWP A;  2P0P A;  4MZM A;  2WSE E;  1YJ9 A;  1K9M C;  4IUQ A;  2E12 A;  5C0M A;  2D6F A;  2RI3 A;  1LYL A;  3OYB A;  3LLR A;  4E7H A;  1PSF A;  1IRE B;  3TEH A;  5FRO A;  1O75 A;  4QQG A;  3LW5 E;  4BI4 A;  3CC7 T;  4J83 A;  4Q15 A;  1KOG A;  3BY7 A;  2X4X A;  4KBM B;  2HBP A;  4N4G A;  3MCA B;  5FRN A;  5ELN A;  4M77 E;  2NS6 A;  3JB9 D;  1ATI A;  4EDU A;  1YGB A;  3QO3 A;  4M78 B;  4M78 E;  2E6N A;  4A53 A;  1QVG A;  3S6W A;  1VQZ A;  2E64 A;  3SWN C;  3Q1J A;  4V2S A;  1VQN A;  5LJ3 d;  3I55 A;  2ZIN A;  1B7Y B;  3JB9 F;  1YI2 T;  5J26 A;  3OMG A;  2P5I A;  2GFA A;  3QO5 A;  2DD4 A;  3VQW A;  2E10 A;  4MMK A;  5GAO n;  4CRI A;  4M7A A;  2RHQ B;  4RKU E;  4J6W A;  1KQ1 A;  1MHN A;  5GAN f;  4YRT A;  3MP8 A;  2YLC A;  3CBO A;  3RKW A;  3A32 A;  4MML A;  2X4Y A;  2XU8 A;  5C53 B;  5FU7 C;  1YJN T;  1KC8 C;  2EJG A;  1BYM A;  4XU0 A;  2LQ8 A;  2CS7 A;  4FIB A;  5GAM h;  1WJR A;  2RHX A;  2QHV A;  1VQ6 T;  4LD6 A;  3VUZ A;  4C92 C;  3BDL A;  4OB1 B;  4YRR A;  3M54 A;  4C92 G;  2ZR3 A;  1JJ2 S;  3O8V A;  1E24 A;  12AS A;  3E9I A;  3E19 A;  4KQE A;  3HRT A;  2EKO A;  4EMK B;  1Y71 A;  3OB9 A;  3NTH A;  5CVI A;  1VQ4 A;  5KCO A;  4RCC A;  1KQS S;  4Y91 A;  2FYK A;  2PQW A;  3KFU A;  2LQK A;  3OW2 S;  2ZZF A;  3V8J A;  3V8L A;  1YIT A;  2E5A A;  4JRI A;  1X75 C;  3QTC A;  5IN1 A;  5GAO q;  3HXY A;  3MEU A;  1O9S A;  4DOW A;  5GMK e;  1VQ7 A;  2QA4 T;  3HPW A;  2IY5 B;  3OS0 A;  4TVY A;  3BJU A;  4M77 C;  4P75 A;  1G3T A;  5LJ3 g;  3VBB A;  5D6X A;  3V7R A;  4M77 G;  4H02 A;  1WJQ A;  4P5N A;  2XHC A;  4LVI A;  4XEO A;  4XTV A;  4JS4 A;  11AS A;  4M78 G;  3VU3 C;  3L1A A;  3WXM B;  3OYN A;  3OYY A;  1JBM A;  5GAO m;  5GAN h;  3RKY A;  4C5H A;  2BKD N;  5D6W A;  4IKF A;  3MP1 A;  1EIY B;  1YHQ A;  1NNH A;  2LC4 A;  4N4H A;  3G1Z A;  3HSB A;  1Y7X A;  1YFS A;  3VQX A;  2XDP A;  3I56 T;  2OTJ T;  5LJ5 g;  1VQP T;  2KMT A;  3CC2 A;  3ASK A;  1JJ2 A;  4CS4 A;  4C0D B;  5DY9 A;  4ZGJ B;  2L89 A;  4DPG A;  2DIG A;  2XIC A;  2XK0 A;  2K3X A;  4L59 A;  3CXC A;  4HT8 A;  1EQR A;  2O01 E;  5GAM d;  3CCM T;  1EFW A;  3NEM A;  5I2S A;  2L3R A;  3OW2 A;  1S72 A;  2R57 A;  2DXB A;  4P72 C;  4WJ3 M;  1WYD A;  1IL2 A;  3M56 A;  3HFZ A;  3SDZ A;  3KBG A;  3FIF A;  3OYI A;  3JB9 H;  1Q81 C;  2XGT A;  2E1H A;  4ZGE B;  3UGT A;  3KUF A;  1HC7 A;  2RHY A;  2LCL A;  2QQ9 A;  1Q86 U;  2QEX A;  4A54 A;  4WJ4 A;  3V8K A;  1QW1 A;  3TCJ A;  4RQF A;  4QW2 A;  3FDR A;  1N8R U;  3MO8 A;  5CKE A;  2QI2 A;  3RMS A;  1NJI C;  1XQH A;  4O5V A;  1Q82 U;  1E1O A;  1HXD A;  2LVM A;  4BY6 C;  3CCR T;  1K73 U;  3CCV T;  5GAO r;  2EQJ A;  1VQO T;  3G6E A;  3PT9 A;  2ARU A;  3E1S A;  2K5L A;  5D6Y A;  1W2B A;  1PYS A;  4P73 C;  4QVC A;  3L4G A;  2PUO B;  1VQ5 A;  3CD6 T;  3JB9 G;  2DQ0 A;  3DKM A;  3C94 A;  1I5L A;  3CCS T;  2YHT A;  3SWN A;  2DDZ A;  2DIQ A;  4HT4 A;  3GIB A;  1NE8 A;  4IUP A;  1DJ7 B;  4JS5 A;  4VUB A;  2L5Q A;  1VIF A;  4ELY C;  4C8Q D;  2V8J A;  4YTL A;  3UT1 A;  4RDX A;  3CCE A;  5GAM g;  3JSC A;  1UGP B;  2RH2 A;  2YRV A;  2XDB A;  2Y4X A;  4C8Q F;  2RHS A;  3E9F A;  4BE2 A;  2ZPH B;  4LVM A;  2DTH A;  2OAU A;  3HXU A;  3HXV A;  2DTI A;  4M75 E;  1VQL A;  3L2U A;  3GF5 A;  2MI6 A;  3URG A;  3C4S A;  2WSC E;  4C92 A;  3BDU A;  1WQW A;  4X9C A;  4P3P A;  4XTY A;  4NS5 A;  3NFC A;  2R5A A;  2FVU A;  1X6O A;  2AKW B;  2A7Y A;  3UWN A;  4FM4 B;  2QXF A;  4E7J A;  3A5Z B;  1B34 A;  2AMC A;  3X25 B;  3P8H A;  1OZ3 A;  1X54 A;  4M7D E;  4TTV A;  2JOY A;  3F70 A;  4MZT A;  3L42 A;  3RER A;  2M9U A;  4UP9 A;  1NJ6 A;  2JTM A;  3R07 A;  4LDY A;  3MEW A;  4IUU A;  4H2Y A;  4LVK A;  2ZPI B;  1YIJ T;  1K9M U;  2MF2 A;  1WQ7 A;  4X9D A;  3CPW A;  4BUG A;  1NJ5 A;  3HFV A;  1LJO A;  2ZPF B;  2JZ2 A;  4OGE A;  1M1K C;  1VQ8 A;  4M77 A;  5GAN g;  4PJO D;  4Q6G A;  2ALY A;  2KVQ G;  3JAM E;  2XTI A;  2RK1 A;  4GY5 A;  3OS1 A;  2R5M A;  2A8E A;  1I8F A;  2RHU A;  4HCB A;  5E3I A;  1QVG S;  4HWS A;  3QNE A;  4PJO F;  3HXZ A;  4JLG A;  1L0W A;  1N9S A;  4NL2 A;  4AH6 A;  5I2M A;  3E9G A;  1B8A A;  3RF1 A;  2FL7 A;  3OYL A;  4K86 A;  3JCM X;  2RHI A;  5LJ5 h;  1YB3 A;  4HCZ A;  4C8Q B;  4N4I A;  2KY9 A;  4HWR A;  3RGL A;  1HK9 A;  5CO7 A;  4OVA A;  3ZEH A;  3T9N A;  4LDW A;  3JCM f;  4EPC A;  3HFO A;  4YRF A;  2I4N A;  4F7U F;  3PIP A;  2ZT6 A;  2DKG A;  2PMF A;  4EX5 A;  1Q7Y U;  3QKJ A;  2PVG B;  5CKH A;  1B76 A;  3P8Y A;  4M75 C;  1D3B B;  2ART A;  4M75 G;  1SES A;  3IG2 A;  3A5Y A;  2QTX A;  4R55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...