2DTHA

The crystal structure of the orthorhombic form of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotin and adp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dthA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dthA01
2PMEA 3TEHA 3BW1A 1WU7A 4XU1A 2VXEA 1NJ1A 4XEOA 2CIMA 1HC7A 4PNOA 2E10A 4YCVA 1I8FA 4HT9A 3UGTA 2ARSA 5LJ3f 4G84A 3L4GB 4HWTA 2I4OA 4E51A 4M78F 5GMKi 5F5WA 4YREA 4EX5A 4M7AE 3JCMQ 2ZTGA 2ZZFA 2XGTA 2AMCB 1ASYA 5GAOp 4H2YA 4UP8A 1EVKA 4H2XB 2DZ9A 1PYSA 3BY7A 3L1AA 4H2WA 3JCMd 4PJOC 2ZINA 4DQ2A 1N9RA 4XTUA 4C8QG 3QO5A 4M75D 1GGMA 4N0AA 4WJ4A 4C92D 4M75B 4YRGA 4C92B 3E9IA 5LJ3j 2IY5B 3HRIA 4EMKA 3HFOA 3JB9G 4K87A 1IL2A 3HY1A 4X9DA 1M8VA 3RUXA 1ADYA 1NJ6A 3JCMg 4V2SA 4YRKA 1NNHA 4WI1A 4L87A 3HY0A 2RHQB 3PGGA 4P75A 4YRTA 1B70B 1I4K1 2VC8A 4PJOA 3REUA 5GAN5 1EFWA 4C8QA 1Y96B 5K1XA 4CH5A 1KQ1A 4YRJA 3NELA 4KR3A 3EFRA 2J3LA 5LJ5h 4CS2A 4M7DG 1SETA 4M7DC 4PG3A 2ZT6A 3UFGA 1EIYB 3M4GA 4XU0A 1HK9A 2DXUA 2ZXFA 2E1HA 5GAN3 3HXUA 4X9CA 4PJOF 4F7UB 4KQEA 1BIBA 3V8LA 5K1PA 5GAN4 12ASA 4C8QF 2I2LA 1JJCA 4TQDA 3PCOB 5LJ3e 5GMKm 3V7CA 4M7AD 4M78C 3JCMP 2ZIMA 4XTYA 4ZIBA 4NL2A 2QHVA 2E65A 4M7AB 2E41A 2RA2A 2CJAA 4K88A 4HT8A 5KNNA 2DJZA 4OLFA 4XU2A 3HXZA 3JB9F 2ALYB 1SRYA 3QO8A 5C51B 5LJ3d 1H4VB 4WF2A 1HXDA 4M77D 2RB6A 1I5LA 1NJ5A 4M7DA 2ZNJA 5GAMh 1NYQA 4TVYA 1L0WA 1J5WA 1BIAA 2DDZA 4O2DA 5GMKh 4YRRA 1BBUA 4RQEA 1YCYA 4QVDA 3ICAA 1U1TA 2C8MA 3ERRA 1U1SA 3JCMJ 1SERA 3TUPA 2EWNA 5HGQA 4JUVA 4X5OA 3A7RA 4MMLA 3VQWA 4XU3A 4YRQA 4TVWA 2DQ3A 4G85A 4P71C 1D3BB 2HNIA 4HVCA 4PJOE 4BW9A 3RKXA 3VQXA 4M7DF 1X56A 4N0AC 4XEMA 2Y90A 4C8QE 1G51A 1H4SA 1Z7NA 4M78B 2DXTA 5GAOm 4F7UE 4LNSA 2P0LA 4YRNA 4C92G 3TEHB 4EMKC 4TVAA 3VQYA 4YYEA 5LJ5f 4CS3A 3JCMe 2DTIA 3RACA 2Q5HA 3QTCA 3G1ZA 4KR2A 1TH7A 4NCXA 3HFZA 1YFTA 5C53B 5GANh 4P75C 1B8AA 3M4QA 4QVCA 3A5ZA 2PMFA 4XQ3A 4P71A 5GAN8 3A5YA 2DEQA 4EMHA 4Y91A 1B7YA 4C8QC 3A7AA 4YRCA 5CAIA 1E24A 1WQWA 3RESA 2E3CA 4H2SA 4C92A 3SB2A 4CH4A 1KOGA 2DZCA 4BWAA 4M7DE 5GAN2 1WNLA 4H2TA 4YDQA 5DY9A 4EO4A 3RKYA 3VBBA 3SWNA 4CH3A 5GAMf 4JLIA 4P72A 1KMMA 4UP9A 3LC0A 4XTVA 4EMKB 1B76A 2J3MA 5GAN6 3IALA 4AH6A 2Q7GA 4M78E 3HSBA 2E64A 5GMKl 2ODRC 2RHSB 2ZT8A 1SESA 4HWSA 4M7AG 2ZT5A 3NEMA 3OD1A 5E3IA 1KQ2A 3FIFA 3QUIA 4PJOD 2YLBA 3P8VA 1RIQA 1W66A 4PJOB 3LSQA 4YROA 3JB9I 3JCMW 4H02A 1X55A 4CS4A 4HA8A 4C8QB 2Q5IA 3P8TA 4YCWA 5GANg 1G5IA 3UGQA 4M77G 3RIRA 4J5YA 1WLEA 2RD1A 3HXXA 3GIBA 1MGQA 3JB9D 1NJ2A 5GMKj 2ZIOA 3JCMb 1ADJA 1YB3A 4YP0A 5ELNA 3V7RA 4P74A 2AKWA 2EJFA 4H2VA 1H4QA 3HXWA 3PCOA 2CJ9A 2XTIA 1ASZA 5GANf 3INZA 4UPAA 2QHUA 1JJCB 2DKGA 4YPFA 5LJ5d 4EMGA 5GAOl 3V8JA 1VQZA 1I81A 4TTVA 3M4PA 2DVEA 4M77A 4A53A 4M7DD 4TWAA 4TQFA 4M7DB 1G5HA 2ZR3A 1B34A 2VXFA 3JCMV 4H2UA 2ARUA 5LJ5g 3BFMA 1EVLA 2ZNIA 2ZR2A 4OP0A 1C0AA 5GANj 2QTXA 4M78D 2Q7EA 3IG2A 4YRSA 1H641 2DTOA 3EFSA 4J6YA 5GMKe 4M75G 4M77F 4M75C 3PZCA 1YFSA 4C92C 2EJGA 3A7UA 4UP7A 3QHSA 4ZTZB 4WJ3M 3BDUA 5GAMd 4JRIA 3HFVA 3FB9A 2ARTA 4ZTUB 4J6XA 3L4GA 1HTTA 3SWNC 4P3OA 3MF2A 4P72C 2FB7A 4K86A 2AMCA 4TVAB 1YFRA 2EJ9A 1NJ8A 1EOVA 4HWPA 2EL9A 1H4TA 2DQ0A 4H2XA 3W3SA 5GAMg 4DPGA 4HWOA 1JRIA 2ZT7A 4P73C 1WYDA 3HFZB 3A74A 4HWRA 1N9WA 5GAOq 1X2GA 1PYSB 4M75A 1NYRA 3L2ZA 1QE0A 5LJ5j 3RKWA 2IY5A 1B7YB 2YHTA 2E5AA 2QHSA 4MMKA 3QSUA 4PJOG 3IKMB 3A31A 5GANe 2G4CA 4Q6GA 1FYFA 1WPYA 1LJOA 2P5IA 4M77E 2K57A 3BJUA 3JCMX 1E1OA 4P3PA 4F7UG 2RHQA 5GAN7 4RDXA 1Z7MA 4P74C 4YCUA 5GANd 2CJBA 1B70A 1QF6A 3RF1A 2I4NA 4M75F 3SWNB 4C92F 1X01A 1E1TA 1EQRA 4P73A 4M7AC 1Y96A 3HXYA 2RHSA 3MEYA 2CGHA 4C8QD 2DU5A 3QO3A 2JN0A 3CMQA 4YRFA 5C52B 3QNEA 4PHCA 4J6WA 5GAMj 3VU3C 4M77C 5LJ3h 1EIYA 1E22A 1KMNA 3HXVA 3JCMf 1X54A 4F7UA 2ZZEA 5ELOA 2Q7HA 3UH0A 4CH6A 3E9HA 2YLCA 5LJ5e 3AHUA 3JB9J 3A32A 4RCCA 3V8KA 4M7AA 3RGLA 2FYKA 3I7FA 4YRMA 3QO7A 1USYC 2DU7A 4XTZA 2I4MA 3HRKA 5GAOn 2C7IA 4RMFA 2ODRD 2ZZGA 2ALYA 3HTZA 2RM4A 5GAOr 2AKWB 3NETA 4M75E 4M78G 3TEGA 4C92E 1LNXA 1ATIA 1M5Q1 3FJPA 3WQZA 4F7UF 3IKLA 3R07A 3KFUA 4RCBA 2EAYA 4J15A 4NOYA 2QHTA 1LOJA 4A54A 4YRIA 4RQFA 4M7AF 4NL3A 1N9SA 5I21A 4YRPA 2I4LA 4JRKA 1WQ7A 1YGBA 3RL6A 2ZCEA 4M77B 2DTHA 1LYLA 4Q15A 2ZGWA 3LSSA 3VQVA 3NENA 5GAMe 3RERA 1BBWA 1JBMA 3V7SA 1USYA 3P8YA 11ASA 1D3BA 3DSQA 4XTWA 3JB9H 1B34B 4P3NA 4YRLA 3REXA 5LJ3g 3HFNA 3JCMh 4M78A 4XTXA 1X2HA 3MF1A 3JCMc
chains in the Genus database with same CATH superfamily
2A8EA 2VXEA 2NS6A 2YUQA 4XEOA 2O9SA 1TSFA 1G3TA 4O5VA 1HC7A 2XDDA 1JJ2P 3CMAT 2E10A 1C0MA 1IO6A 5IXBA 4YCVA 2DEUA 4UC4A 3SDZA 4LVIA 5LJ3f 1I0CA 1NJIU 2LCCA 1VQ5Q 1HSQA 2I4OA 1G3SA 4M78F 5F5WA 1UB4A 1D0ZA 4FYYB 3JCMQ 3UPUA 2ZTGA 3FRNA 3A8OB 2RMOA 1ASYA 2ATCB 5GAOp 4QVZA 2DYBA 3NTHA 1C1AA 3JCMd 2P4RA 1N9RA 2ROLA 4N0AA 3LLRA 1UTIA 1YJWT 2RHZA 3REAB 3C12A 1ACMB 1FMKA 3E9IA 1QCFA 3X25B 1YHQT 2IY5B 2V1QA 3TSWA 1WHJA 4FT2A 1YJNT 3HY1A 4X9DA 2DNUA 5CIUA 5KE3A 4V2SA 3CXCA 4L87A 2RHQB 1KD1U 2KROA 3S3NA 4F17A 2VC8A 4PJOA 4RG8A 1YBYA 2FZCB 5GAN5 1VQKQ 2YRVA 1VQLQ 1OPKA 2C0IA 3C95A 1JXMA 3LH5A 5J39A 1UHFA 1YFNA 2X35A 1VQ9Q 3CBOA 5KYWB 2JT4A 4ZN1A 4M7DG 1MMAA 2CREA 3U23A 4JS5A 2O01E 2ZT6A 3UFGA 4PFZA 2DXUA 2DBKA 1RAEB 2ZXFA 2J6KA 2KT8A 3QJ6A 2E4HA 1BIBA 2NUZA 1Y57A 3AT1B 4A4FA 4F7UB 3CCST 4JZ4A 4C8QF 3CCJT 4LVMA 5GMKm 4M7AD 1KQSP 4ZIBA 4NL2A 2CH4A 2QHVA 1PSFA 2DJQA 1PHTA 4RTWA 4LUEA 3CCQA 4CI0C 3LYIA 1U5SA 2OAUA 2DJZA 4OLFA 2VVKA 2ALYB 1SRYA 2FPDA 4ZTFA 1PKSA 4DEXA 3J7AF 1HXDA 2QQAA 3LH0A 2RB6A 3OW2A 1I5LA 3I56T 5CR2A 5GAMh 1NYQA 3G6EQ 4TVYA 3M59A 1L0WA 1H8KA 4HXJA 4YRRA 1BIAA 2XIDA 4RQEA 5KYYB 3ZEHA 4QVDA 2C8MA 3QJYA 3MEUA 5HGQA 4JUVA 1YIJA 2OAWA 2NUPB 2J7IA 2DQ3A 4AG2C 2K5FA 2YRDA 3EFOA 3RKXA 3VQXA 4C8QE 3O5ZA 4ATOA 1VQ6A 4PL6A 4M78B 2LJ1A 2MYSA 2O88A 3I35A 3CCUQ 2P0LA 3OB9A 3SD4A 4EMKC 4ZTJA 4TVAA 4CC7A 3RR6A 4GLMA 4YYEA 4BI3A 3CCRT 3URGA 4CS3A 2DTIA 3RACA 4NS5A 1VQNQ 1HD3A 2WACA 4D8KA 5EG2A 4NCXA 4ZN3A 1YFTA 2RQRA 5GANh 4P75C 2BE7D 4QVCA 1LPLA 4MDXA 2DAQA 3TSZA 1TUGB 2DEQA 1Q86C 4Y91A 4J9CA 3PVQA 2D8JA 2GBQA 5CKFA 4K11A 7AT1B 2D8HA 1RACB 2IVWA 3CC4T 4C92A 3SB2A 4RTVA 1KOGA 2DZCA 1RAIB 5GAN2 1ZUKA 2M1HA 4KGVB 2B86A 2WSCE 1K8AR 2Y4YA 1M90R 2RHYA 3VS4A 2E6NA 2QDYB 5L23A 1UFFA 5GAMf 3EGXA 2J3MA 5GAN6 4C0FA 4ELYC 2YWWA 3HSBA 4C5HA 2BZYA 5GMKl 2EW3A 1G3WA 2AZSA 4HWSA 3FC3A 1OYXA 4M7AG 3NEMA 3OD1A 5E3IA 2RN8A 1SF9A 1KHIA 3QUIA 4PJOD 2G3RA 1VYTA 3QXEB 4LD9K 1RIQA 4YROA 3JB9I 3C0CA 3EH1A 4LN2A 1IHWA 4E7IA 1ZSZB 2RNAA 4BY6C 2L0AA 4C8QB 1WYXA 2Q5IA 3P8TA 2KVQG 5A0LA 3UGQA 1FYNA 3RIRA 3QZ5B 2QGGA 1PKTA 2A0FB 5LL6S 1HYOA 2DBMA 1KC8C 1VQOT 2ZIOA 2HD0A 4LE9A 5ELNA 1YJWA 4HVUA 3V7RA 4P74A 2AKWA 2EJFA 4H2VA 3PNWC 1WX6A 3HTRA 1JXOA 1YHQA 2JVVA 1SSHA 2CJ9A 2XTIA 2X4XA 2CDTA 1YJNA 1WHLA 2EGEA 1G2BA 4PFOA 5GANf 2QHUA 1WI7A 2F2VA 4FW2A 3T9NA 2LC4A 2DKGA 1VQPA 4DOVA 3CC7A 2V8IA 3OA6A 2X4WA 3DLLA 1VQZA 4TTVA 3MHXA 2NLUA 1AWJA 4TWAA 4BDZA 4OMPA 2VGNA 1E7OA 1NZ9A 2YSQA 1NPRA 1K73R 2RI5A 4A4GA 2DE0X 2P0KA 3BFMA 1UGRB 2AKKA 2JZ2A 1VQKT 1C0AA 1O9SA 3UF4A 4M78D 4E7HA 2K3YA 3EFSA 2YUPA 1R0BG 2W0ZA 4J7FA 2EJGA 1ZBXA 2PUOB 4FCYA 4ZTZB 3CCJA 1PRMC 3DLMA 3HFVA 4HT4A 2ARTA 4ZTUB 2JW4A 4J6XA 1HTTA 3SWNC 2LTOA 2DL4A 4OGCA 1XJWB 3CC2T 1OX8A 1UECA 1WXUA 1NJ8A 1NLOC 1K9MC 1VUBA 4H2XA 3I56A 5GAMg 8AT1B 4DPGA 4P73C 3HFZB 3CPWP 1N9WA 2DRKA 5IHNA 1I5OB 5IT9E 5HKCA 1ZA2B 3TU4K 3RKWA 2D0QB 1VQ4A 4PJOG 3CCET 1U3OA 1FYFA 1WPYA 4RMOA 1OULA 1OEBA 2P5IA 2JJ9A 1TOVA 1QVGS 2LT1A 5FRMA 4P3PA 4F7UG 4RDXA 1PNJA 1Q81R 4Q5WA 2K2MA 1BCOA 1QF6A 1AWWA 1E1TA 4OB0B 5GJVB 4M7AC 3QG1A 3VS7A 2EIFA 2RHSA 2HBPA 1GCPA 3CCUT 4C8QD 2COZA 2DU5A 1EZZB 2JN0A 3CMQA 2RK1A 1UEBA 4PHCA 3UWNA 3VU3C 2PQWA 1EIYA 2CT3A 2RJFA 1VIFA 4FYXB 2FZGB 1M1FA 2EQUA 3VS1A 3EHRA 3CCMA 2O4XA 3E9HA 2ZPEB 1ARKA 2FEIA 2CZ1B 3M4YA 4E7SA 3AHUA 1X2KA 3V8KA 4GY5A 4MDWA 3CCVQ 3QO7A 4C0ZA 5GAOn 4PLLA 2ODRD 3HTZA 3GLXA 5GAOr 5FWCA 1FMVA 1T3LA 4M78G 5IAYA 2G6FX 4JJDA 1N8RR 5FU7B 4A4HA 4X34A 1Q86U 3KFUA 1UUEA 1W2BP 2FVUA 1F1BB 2QHTA 4QQGA 4BY6B 2X9HA 4M7AF 2KI7A 2DPPB 1N9SA 2YRCA 2OI3A 3LGLA 5I21A 4NL3A 2HSEB 4JRKA 3A8LB 2ZCEA 1UDLA 3M0TA 2ZGWA 2FRYA 1BBWA 1VA7A 1JBMA 3V7SA 1VQ8T 1USYA 11ASA 2O2OA 4EDUA 3JB9H 1UHCA 4J9HA 4YRLA 4KGZB 2CT4A 4FSSA 4ZGDB 2LQWA 2E3HA 3G71T 3VRZA 1VQOA 4XTXA 2J6OA 4HCCA 1GFCA 2QXFA 1X2HA 1AD5A 1AWXA 1JJ2S 2F69A 1WA7A 2KAFA 3TEHA 2CP2A 2BIVA 4KUIA 1X43A 1RLPC 1AOJA 1ZA1B 4PNOA 4Z02A 2QA4T 2VKNA 2KXDA 2DYIA 4DBFA 2J06A 3CC7Q 1RI0A 2LX9A 2SRCA 2P84A 3L4GB 5ECAA 4AFSC 2Z0WA 4LDXA 9ATCB 3J81E 4YREA 4EX5A 4M7AE 3A1PA 1Z9QA 2LJ0A 1IZ6A 1AZEA 2AMCB 2YT6A 1KC8U 1T3SA 4OMMA 3RMQA 4UP8A 1QVFS 1EVKA 1QLYA 1EFNA 1FMWA 2DL3A 2QG9B 3M0RA 4PJOC 3LWHA 2KNBB 4XTUA 4DQ2A 4C8QG 3QO5A 3VUZA 1WFWA 1GGMA 1X75C 2CS7A 4WTOB 2J05A 1VQ7T 3SFMA 5LJ3j 4DBRA 3MPUB 3HFOA 1QVGP 1KSWA 1NJ6A 2MCNA 3P8DA 1R0CB 4KULA 3CMEA 2QDLA 2LZ6B 4R56A 2V8JA 3WXMB 2X3WD 3P8HA 3TEEA 1VQMA 1I4K1 5CKBA 2EYZA 3REUA 3QBYA 1Y96B 2OTLT 4YRJA 2HQEA 3VV0A 3NELA 4KR3A 2L3SA 3EFRA 5LJ5h 4LDWA 4BDYA 1YITT 1G83A 2DL8A 3FDRA 2YUNA 4ELZC 3G4ST 1HK9A 1KQSS 2A28A 4PJOF 4KQEA 1NJIR 3V8LA 5GAN4 1NYGA 3PCOB 5LJ3e 3V7CA 2OTJT 4M78C 3JCMP 2ZIMA 2AK5A 4M7AB 1K9MU 2E41A 1RAFB 4A4EA 2CJAA 3QDRB 3PIPA 5KNNA 2YUOA 4E7JA 3MEVA 3M0PA 2MF2A 1M27C 3NTKA 4OVAA 3VJPA 3QO8A 5LJ3d 2PVGB 4FYVB 4RTZA 3JV3A 3E9GA 2KY9A 5GMKh 3OYLA 1OPLA 3EGDB 1U1SA 3JCMJ 3MP8A 3CPFA 1RAGB 2HMAA 4X5OA 3VQWA 3CCMQ 4YRQA 4G85A 2DXCA 3QWXX 4PJOE 2KR3A 1KD1R 2LCLA 4BW9A 1TTHB 1X56A 4XEMA 2Y90A 4KGXB 1QMCA 1H4SA 3VS3A 5IN1A 3I55Q 2DXTA 3F70A 3EG1A 4F7UE 4LNSA 2XI9A 4YRNA 1SRLA 3CCVT 1WHMA 5LJ5f 2IIMA 3JCMe 2KRSA 4ME7A 1YWOA 1SSFA 3CD6Q 1TH7A 4KUDK 1SRMA 5CQXA 4JPBW 2CUBA 5C53B 1RABB 1B8AA 3M4QA 1JB0E 2PMFA 3A5YA 5I2MA 3OS0A 5IH2A 4LDYA 1ZSZC 5HCKA 4C8QC 4Y28E 5CAIA 1QVFP 2JOYA 2QTVA 1WQWA 2EKOA 4D8DA 2NUTB 1G3YA 1K8AC 1M90C 1VQ8A 4LVLA 3MCAB 3NPFA 2RJCA 3RESA 3M54A 2E3CA 2AIRB 1ZSGA 1UE9A 4HCKA 1UGQB 3JSCA 3G71A 1KFZA 2RHXA 2KYBA 5DY9A 3HHTB 4EO4A 4AFQC 2L3QA 3OYHA 4JLIA 5GJWB 2QEXA 4UP9A 2GFAA 2HEQA 4XTVA 2GF7A 2HBWA 2HKQB 3IALA 1M1GA 4AH6A 4X1VA 4M78E 2QA4A 4QQDA 4EPCA 3RNJA 2ODRC 1AVZC 1SESA 4JJBA 4CC4B 2ZT5A 4FM4B 1KQ2A 3C94A 1YI2Q 1NE8A 2EYWA 4PJOB 3LSQA 3JCMW 1VYUA 1JEGA 4CS4A 3Q1JA 1JQQA 4EIKA 2CYZB 1WLEA 3HXXA 1RAAB 3JB9D 2ED0A 5IXFA 1NJ2A 1S72Q 4LDUA 3JCMb 1ADJA 5L8RE 2FHDA 1VQ7A 1M4ZA 1YCSB 4C5GA 5KYUB 4BI8B 2LNVA 4R0KA 3X20B 1NM7A 4J7IA 2NYSA 2ZCFB 5EC7A 3MP6A 4UPAA 1MMNA 4PKCC 1X6GA 4PK4A 3CCLA 2KT1A 3V8JA 1QQJA 2F5TX 1I81A 3M4PA 2AKLA 4M77A 4J9BA 5J3BA 5I11A 3OS1A 2HSPA 2L89A 2OTLA 1Y71A 1UG1A 3QZ9B 1D09B 2ZR3A 2VXFA 2LVMA 3JCMV 2VASA 2ARUA 5LJ5g 5C6SA 2F5KA 2L2PA 1E6HA 1YITA 4BE2A 5GANj 1YJ9Q 4HKEA 2Q7EA 4RG2A 2IPOB 1Q7YC 2AT1B 3R6NA 2C0TA 3A7UA 3L2VA 3EFOB 4WJ3M 1OZ2A 3BDUA 5GAMd 2OTJA 2M9UA 1MHNA 5A0GA 2O31A 4P3OA 3MF2A 4AG1C 4P72C 4K86A 3EG0A 2O9VA 4TVAB 2EJ9A 2DILA 3CPWS 4LXCA 3VUBA 1WIEA 2XG8D 1TS9A 3DB4A 1ZUUA 2ZT7A 2M0YA 4HWRA 3E19A 5GAOq 1ZBJA 1PYSB 1M3BA 1BYMA 4M75A 4OMOA 2K3BA 4J9FA 1LCKA 1R8OB 3CXCP 2EYQA 1EX4A 4KH0B 3RDVA 5CKHA 4BI4A 3E2UA 5GANe 2G4CA 4Q6GA 1ZUYA 4FIBA 3P8BB 1Q81C 2A36A 1PD0A 2JMAA 3N5BB 1AT1B 4OB2B 3CMAA 4ZGEB 1Z7MA 3SHWA 4YCUA 3OYJA 5GANd 2PUKB 2CJBA 1B70A 4HVWA 3UATA 2E3IA 1EQRA 5FU7C 3EGXB 1KG1A 2L3RA 1GBQA 1QWEA 2EYYA 5D6YA 1VQ5T 3QO3A 2CP7A 2LP5A 3I9QA 2DD5A 3OQ5A 1IXDA 2E70A 4J6WA 4FW1A 2XHCA 3C4SA 3HXVA 2DL7A 1X54A 2KGTA 1MMDA 2JNGA 3OYBA 5ELOA 2Q7HA 1ZHIA 4CH6A 2DVJA 4R55A 2PTKA 3OW2P 2FYKA 2LMJA 4LUDA 3I7FA 1TUDA 3PMIA 3VS6A 1USYC 1BU1A 3CBMA 1IRXA 5KH6A 1M1KC 2C7IA 2F2XA 2PZ1A 2AHJB 1BI2A 3WVEB 3M5AA 2DLPA 2AKWB 3QIIA 1W2BS 2NWMA 4N4HA 3ZBDA 1K4US 2WSFE 2JS0A 3IKLA 2QI2A 3A8HB 3TVTA 1KIKA 4RTUA 4J15A 4NOYA 1O75A 4YRIA 4RQFA 2HQHA 1GL5A 4YRPA 1WQ7A 4FSXA 2ECZA 1KK7A 2MPXC 1GCQC 1VQLT 2RH2A 2WSEE 3RMSA 1D3BA 1QVPA 1U06A 1VQ9T 3DSQA 1YI2T 2XD0A 2GNCA 2BZXA 3CCSA 3UT1A 2LT4A 2RQVA 4YTLA 3CCQQ 4KRTA 1WU7A 4XU1A 1SKUB 1NJ1A 3ZL7C 2CIMA 4IURA 4A63B 3A98A 3UGTA 2BE9B 2V26A 4JDSA 3VKIA 4E51A 1WZOA 5GMKi 4KH1B 4XAXB 2D9TA 3JAME 4H2YA 3G6ET 1TUCA 1YIJQ 4N4GA 4H2XB 1Q82R 3H41A 3BY7A 3L1AA 5FW9A 2FZKB 1W6XA 2ZINA 4QKUA 3HRUA 4M75D 4WJ4A 4C92D 3A8MB 5D6XA 1VQ6Q 5J26A 4PJJA 6AT1B 1UJ0A 2DL5A 5AT1B 4E7ZA 2QYZA 1Q86R 1V1CA 3HRIA 4EMKA 3VS2A 4K87A 1IL2A 2XU8A 1YJ9T 3RUXA 1M8VA 1ADYA 4FU6A 4BUGA 3DKMA 4YRKA 3CCRA 4QT7A 2CH4W 4GLKA 4JS4A 3S3OA 1NNHA 4DEYA 3HRSA 1ABQA 5IHIA 4P75A 4HVVA 1Y07A 1EFWA 2MMPA 1VQNT 1AWOA 2HKNA 5K1XA 4CH5A 3JRZA 1BI0A 4HCBA 2MAMA 1Q7YU 1M3CA 2XDPA 1SETA 2ENMA 4ZNXA 3CC4A 2VYTA 1EIYB 3EGUA 3OSVA 2YDLA 5GAN3 3HXUA 4X9CA 2VGMA 5K1PA 2VB6A 12ASA 1JJCA 2O4XB 4TQDA 2DFUA 1M2VA 1JU5C 3CMAQ 4IKFA 1RL2A 2LCSA 2E65A 2HDAA 4L5GA 3S6WA 4K88A 4WCIA 3H0FA 2BZ8A 4HT8A 1KC8R 4XU2A 1RADB 5KYXB 2LX7A 3JB9F 5C51B 2EGCA 5DLQE 3QYHB 4WF2A 1RLQC 1H3HA 2H8HA 4M7DA 2ZNJA 3OYGA 1VQ5A 2EFIA 4RTXA 4O2DA 2DDZA 1GBRA 1FX7A 1W70A 2JTMA 1BBUA 1X6BA 4J83A 4BACA 1YCYA 1U1TA 5I22A 1Q81U 1GRIA 2LQNA 2ZPHB 1X6OA 1XQHA 1Y0MA 2CSQA 3EG9B 3TQ7P 1YJWQ 3A7RA 4MMLA 4XU3A 4TVWA 1YHQQ 4TVRA 1I07A 4A4KA 1YP5A 1YJNQ 4D6WA 2X4YA 4N0AC 4BE0A 2K2VA 3GPLA 4Z88A 4E47A 4LD6A 1NBEB 1Z7NA 1VQPQ 3VRYA 1BB9A 5HK3A 2FL7A 3OMGA 5GAOm 1D1BA 4IUTA 2DERA 4C92G 2JM9A 4E7KA 1M30A 3TEHB 3OYIA 2Y4XA 3H6ZA 1WJRA 2QQBA 2RF0A 8ATCB 1B3QA 2GTJA 2MIOA 4KR2A 2C0OA 3EH2A 2KQWA 5KCOA 2EGAA 3G7ZA 4OF1A 1NEGA 3HKSA 3A5ZA 3QKJA 4XQ3A 4P71A 1JJ2A 1B7YA 2RQUA 1VQKA 1E24A 4IUQA 1VQLA 1XOVA 3CEYA 1M1KU 1K9MR 2K7AA 4N4IA 3MKDA 1J3TA 1BBZA 1SG5A 4CH4A 3CCJQ 2KK4A 3I5RA 4JJCA 1KJWA 4H2TA 4YDQA 1KHCA 1W1FA 2X51A 1NYFA 4P5NA 4OB1B 3RKYA 1HJDA 1K0SA 2ZAEA 2RK2A 3SWNA 1IGUA 2RI2A 1KMMA 3PTAA 1B76A 1EIFA 3CC2A 2Q7GA 3GNFB 1FWZA 1K0XA 3I56Q 3FLGA 3LW5E 3CBPA 2L5QA 3KBGA 1PG5B 3FIFA 2EVRA 2MK5A 2KRMA 4L59A 2J6FA 3P8VA 2DMOA 1K76A 1W66A 2F1LA 2E12A 2DK3A 1X55A 1V29B 1ZLMA 1VQ4Q 1AHJB 1P92A 2LNHB 2KRNA 2RD1A 3CCEA 3L2UA 3LX7A 3OBYA 5KE2A 2DETA 5GMKj 3QYGB 1Z9ZA 1RI9A 4YP0A 2XKOC 3MEAA 4C0DC 2COYA 1H4QA 3HXWA 3PCOA 4IUPA 1AZGB 3H0HA 1ASZA 4FYWB 4E7LA 4J9GA 1QP3A 2DO3A 1X69A 1RUWA 5CKDA 3L42A 2QAZA 2CP5A 4RKUE 5LJ5d 3CCUA 4EMGA 3TREA 5GAOl 2LQ8A 1KQSA 2A37A 4M7DD 2A7YA 2JXBA 4TQFA 5C0MA 1B34A 3LGFA 2COWA 1N5ZA 1EVLA 3QDFA 2ZPBB 4OP0A 2ZR2A 4KT0E 5CKEA 2QTXA 4OMQA 3LWIA 4YRSA 3L2WA 2DTOA 4J6YA 1PSEA 2LRQA 2OJ2A 5GMKe 4M77F 1WLPB 4M75C 3PZCA 1IREB 4C92C 2R58A 1OOTA 4QW2A 1IGQA 2E5KA 4JRIA 3FB9A 3HPWA 2ZPFB 2YXYA 4XK8E 3MJXA 1YFRA 2ZZDA 1C6VX 4HWPA 2EL9A 2QQ9A 2ROTA 2AZVA 2XICA 2DQ0A 4DA4A 1NG2A 3M53A 1JRIA 1SEMA 1UGPB 3CXCS 3A74A 2DIGA 4DBQA 3META 1X2GA 3OSSC 2BTTA 5I2SA 1NYRA 2NUTA 1QE0A 1VQOQ 4RTYA 3I5SA 2IY5A 3ER0A 4MMKA 3IKMB 5FLXE 1PRLC 4M77E 3BJUA 2FPEA 2JTEA 2RHQA 1TXQA 5M9OA 4P74C 2R57A 2PVOB 3RF1A 4M75F 4LDVA 4C92F 1X01A 1YN8A 3L2QA 1VQPT 3CC7T 2CGHA 3PMTA 2DX1A 5KYWA 5KCHA 5C52B 3UA6A 5GAMj 1M8MA 2MWPA 3BDLA 2JUFA 1BI1A 4M4ZA 3JCMf 3OS2A 2MOXA 1WXTA 2DRMA 4OB3B 2KEAA 2XMFA 3OW2S 4F7UA 1PC0A 1SPKA 1VIEA 2SEMA 3GNGA 5FU6B 2GCXA 1T0HA 1M9SA 2CSIA 1MV0B 3JB9J 3A32A 4OMNA 3PIOA 5KYUA 1DJ7B 1XTDA 3REBB 2I4MA 3CMEQ 3HRKA 1AEYA 3PT9A 3OYFA 4RMFA 2ZZGA 2M16A 1GFDA 2ALYA 4OMFB 3NETA 4L6V5 4M75E 1VQMQ 4C92E 1LNXA 3TCJA 3CC2Q 1QKWA 1K73C 1M5Q1 3FJPA 2B8AA 1VYVA 3OYYA 3R07A 4RCBA 4Y92A 5DM7R 5KYYA 2KSSA 1OU8A 2I4LA 2QQRA 4M77B 2DTHA 4Q15A 3VQVA 2FG0A 2NUPA 2E5QA 3NENA 5GAMe 1WJSA 3RERA 3P8YA 3G4SA 3G1JA 4XTWA 3CCEQ 3QPHA 2CZ6B 2EYXA 4C0DB 1MMGA 5LJ3g 3HFNA 3A8GB 2K9GA 4M78A 1VQ4T 3HL8A 1FXXA 2PMEA 3BW1A 2RQWA 3H0IA 2ZPGB 2HAXA 1M3AA 2K4YA 1I8FA 4HT9A 2LJ3A 5HY6A 2ARSA 1OX9A 2QQSA 3GBQA 4C5IA 4G84A 4HWTA 2D0NA 4O6JA 3M55A 3DB3A 2ED1A 1Q82C 2HCKA 1OV3A 2HL3A 2ZZFA 2XGTA 1NPPA 2RPNA 3THKA 3X26B 2CKKA 2K5IA 2DZ9A 1PYSA 1MNEA 2F2WA 2M51A 3M0SA 2GQIA 4H2WA 3M57A 1I1JA 2RI3A 5HK0A 4BD3A 4M75B 4YRGA 4C92B 1E6GA 3CCMT 3MEWA 1VOMA 2KXCA 1MUZA 2QGFB 1PM3A 3CPWA 3JB9G 1N6AA 2DF6A 2H3JA 1QW1A 3JCMg 4JRQA 2KBTA 1WHHA 3M0UA 3OYDA 3CCVA 4F16A 3I55T 4WI1A 1D0YA 4RUGA 1W4SA 3HY0A 2L8DA 2ZPIB 3PGGA 4AMCA 4YRTA 1B70B 1TG0A 5AYFA 1N27A 1ZSZA 4C8QA 3OYEA 2DM1A 3CD6T 1KQ1A 4LVKA 4JLGA 1VQ8Q 2A3LA 4OGEA 3J80E 2J3LA 4CS2A 5IHKA 2EBPA 3KFVA 2XDBA 1D1CA 4M7DC 4PG3A 2JTFA 3NFCA 2LQKA 3G71Q 3M4GA 4XU0A 1IHVA 4VUBA 4J9DA 4MZMA 1N8RC 2E1HA 2EQJA 3QWYA 3X24B 2QEXQ 1BK2A 2R5MA 2GTOA 2I2LA 1PCXA 2I0NA 3EAEA 4XTYA 2QA4Q 3KUFA 4LVJA 1H92A 2RA2A 3EG3A 3M0QA 1RAHB 3O8VA 1MNDA 3HXZA 4J9EA 1K8AU 4JJNK 1M90U 1H4VB 4M77D 1NJ5A 1WDXA 2P4TA 2EPDA 4LNPA 2QK0A 1J5WA 2RJDA 4E6RA 2KMTA 1SHFA 3ICAA 3ERRA 2KDSA 1CKBA 1H3ZA 3L2RA 1SERA 3TUPA 1X2QA 2EWNA 1VQ7Q 1W2BA 2DA9A 3M56A 2W10A 4P71C 1D3BB 2HNIA 1V76A 3H8ZA 4HVCA 3BE3A 4M7DF 4KBMB 1PWTA 3OS5A 1S72T 1G51A 3OMCA 2X4JA 4DOWA 1Q95G 3OYNA 4Z8AA 3CCLQ 4AT1B 1ABOA 1X27A 3UA7A 2LDMA 4C0GA 1OU9A 3VQYA 2OX7A 2Q5HA 3IQLA 3CMET 3QTCA 3G1ZA 1Q7YR 2OTLQ 3HFZA 2ESWA 2MI6A 3H9NA 1VQMT 3VS0A 4DBHA 4PJMA 5GAN8 4MZTA 1YITQ 4EMHA 2HZYA 2D1XA 3A7AA 4YRCA 2X3XD 4FL6A 3G4SQ 1WJQA 1Y7XA 5D7UA 2IG0A 3OYMA 4H2SA 2JS2A 1GXIE 4BWAA 4M7DE 1D1AA 1YNZA 3VYHB 1WNLA 4FT4A 1K73U 2OTJQ 4II1A 3VBBA 1WHGA 4CH3A 2PNIA 4PFPA 4P72A 3VS5A 3LC0A 4EMKB 4CC3A 2CP0A 2BKDN 2E64A 3MP1A 4F14A 3KXTA 3OYKA 4J9IA 2RHSB 2ZT8A 3FJ5A 3PE0A 2RHIA 2EQKA 4J8OA 2R5AA 3ME9A 2BUDA 1QVGA 2YLBA 4BE1A 1BKBA 1NJIC 4ZGJB 3E9FA 4H02A 4MZPA 1SHGA 4HA8A 2VV5A 1M2OA 4YCWA 5GANg 1G5IA 2M02A 4M77G 4J5YA 2M0OA 3GIBA 1MGQA 2DIQA 1YB3A 3M9QA 1G5VA 4CC2A 4PJNA 4B6MA 4HCZA 2H3EB 3ZFJA 3X28B 3EHQA 3INZA 4CRIA 2XK0A 1Q82U 1JJCB 2P0PA 1M2VB 3NMZC 4B9WA 2EQMA 3OBWA 4YPFA 5KYXA 3I55A 3SEMA 2PU9B 1YWPA 1OI1A 5CVIA 2DVEA 1M1KR 1A0NB 4A53A 1KD1C 1UGVA 2KE9A 3CD6A 4M7DB 2A08A 1G5HA 3MQZA 4E2FB 4H2UA 2CZ7B 1JO8A 2CZ0B 2ZNIA 3EG9A 3FEOA 2VWFA 1NLPC 1WHKA 5CQYA 4IIOA 3IG2A 4JZ3A 1H641 4B9XA 1NEBA 4M75G 2GFUA 1YFSA 2K79A 1CKAA 1BI3A 3QHSA 3NGPA 4UP7A 1PD1A 2FO0A 1IB8A 5A0DA 3L4GA 3GF5A 2QASA 4F04B 2MWOA 2QEXT 2FB7A 3GOXA 4PLIA 2GQVA 2AMCA 5FWBA 1K1ZA 1EOVA 1CSKA 2VUBA 1T0JA 1H4TA 3PFSA 1GCQA 2JM8A 3OY9A 3W3SA 2EKHA 1QP2A 1TU0B 4HWOA 5KYNA 1WYDA 2K3XA 1ZX6A 1N8RU 4OMLA 1VQ9A 1UGSB 1XNIA 3A5ZB 1OZ3A 3L2ZA 1YI2A 1QKXA 3PVLA 3CCSQ 2HL5C 4ESRA 5LJ5j 5FU6C 1B7YB 2YHTA 2E5AA 2K6DA 2QHSA 3QSUA 3A31A 2V8KA 3GP8A 1LJOA 2GGRA 1UJYA 2K57A 3JCMX 4BB7A 1E1OA 1TWBA 1S72A 4C5EA 3M58A 5A2QE 1R77A 5GAN7 2C06A 1QVFA 1QCOA 3CCQT 3OYAA 2I4NA 3UDCA 3SWNB 4P73A 2ABLA 4QQ6A 2RHUA 1Y96A 4JRPA 3HXYA 3CQTA 3MEYA 5D6WA 4GBQA 3ASKA 3CCLT 2FPFA 1MV3A 3G6EA 3HP9A 4Z89A 4YRFA 3NHNA 3QNEA 3MO8A 4M77C 5LJ3h 2P0QA 3RBBB 2DD4A 1E22A 1LVKA 1KMNA 3EG2A 4IUUA 1YIJT 2RO0A 2FRWA 1K9AA 1QWFA 2ZZEA 3UH0A 3WVDB 2YLCA 5LJ5e 1B07A 5CCAA 2E6ZA 4RCCA 1VQ6T 2RJEA 4M7AA 3RGLA 1YJ9A 1G8XA 3CCRQ 4IIMA 4YRMA 1ZQ1A 1S1NA 2CP3A 3NTIA 2DU7A 4XTZA 3HRTA 5DLOA 2RM4A 5CO7A 4AFUC 3TEGA 2V1RA 1ATIA 1B7TA 1OQKA 3WQZA 4F7UF 2RQTA 2EAYA 1WGSA 1VQNA 2CP6A 4ANJA 3EGDA 1LOJA 4A54A 1D0XA 4AFZC 3CC4Q 1YGBA 3RL6A 4PJLA 4IUVA 2KYMA 1LYLA 3LSSA 2PVDB 4RTTA 2EQIA 3R6OA 1BCMA 2JMCA 2CUDA 5CK9A 1B34B 4P3NA 2D6FA 3REXA 1U8RA 1QCNA 3ULRB 2DXBA 3D7SB 3S3MA 5FRNA 3JCMh 3VYGA 2K5LA 4ORZA 1WXBA 3OYCA 3MF1A 3E1SA 3JCMc 2HQXA 2L3PA 5FROA
chains in the Genus database with same CATH topology
2A8EA 2VXEA 2NS6A 4XEOA 4O5VA 1G3TA 1HC7A 2XDDA 3CMAT 2E10A 4YCVA 4UC4A 3SDZA 4LVIA 5LJ3f 1NJIU 2LCCA 2I4OA 1G3SA 4M78F 5F5WA 1UB4A 3JCMQ 3UPUA 2ZTGA 3FRNA 3A8OB 1ASYA 5GAOp 4QVZA 3NTHA 3JCMd 1N9RA 4N0AA 3LLRA 1YJWT 2RHZA 3C12A 3E9IA 3X25B 1YHQT 2IY5B 4FT2A 1YJNT 3HY1A 4X9DA 5CIUA 5KE3A 4V2SA 3CXCA 4L87A 2RHQB 1KD1U 3S3NA 2VC8A 4PJOA 4RG8A 1YBYA 5GAN5 2YRVA 3C95A 5J39A 2X35A 3CBOA 4ZN1A 4M7DG 4JS5A 2O01E 2ZT6A 3UFGA 2DXUA 2ZXFA 3QJ6A 4F7UB 1BIBA 4A4FA 3CCST 4C8QF 3CCJT 4LVMA 5GMKm 4M7AD 4ZIBA 4NL2A 2QHVA 1PSFA 3CCQA 4CI0C 3LYIA 2OAUA 2DJZA 4OLFA 2ALYB 1SRYA 4ZTFA 3J7AF 1HXDA 2QQAA 3LH0A 2RB6A 3OW2A 1I5LA 3I56T 5CR2A 5GAMh 1NYQA 4TVYA 3M59A 1L0WA 4YRRA 1BIAA 2XIDA 4RQEA 3ZEHA 4QVDA 2C8MA 3QJYA 3MEUA 5HGQA 4JUVA 1YIJA 2DQ3A 2K5FA 3RKXA 3VQXA 4C8QE 4ATOA 1VQ6A 4PL6A 4M78B 2P0LA 3OB9A 3SD4A 4EMKC 4ZTJA 4TVAA 4YYEA 4BI3A 3CCRT 3URGA 4CS3A 2DTIA 3RACA 4NS5A 2WACA 5EG2A 4NCXA 4ZN3A 1YFTA 5GANh 4P75C 4QVCA 4MDXA 2DAQA 2DEQA 1Q86C 4Y91A 5CKFA 2IVWA 3CC4T 4C92A 3SB2A 1KOGA 2DZCA 5GAN2 2M1HA 2WSCE 2Y4YA 2RHYA 2E6NA 2QDYB 5GAMf 2J3MA 5GAN6 4C0FA 4ELYC 3HSBA 4C5HA 5GMKl 1G3WA 4HWSA 3FC3A 1OYXA 4M7AG 3NEMA 3OD1A 5E3IA 1KHIA 3QUIA 4PJOD 2G3RA 3QXEB 1RIQA 4LD9K 4YROA 3JB9I 4E7IA 4BY6C 4C8QB 2Q5IA 3P8TA 2KVQG 5A0LA 3UGQA 3RIRA 3QZ5B 5LL6S 1KC8C 1VQOT 2ZIOA 2HD0A 5ELNA 1YJWA 3V7RA 4P74A 2AKWA 2EJFA 4H2VA 3PNWC 1YHQA 2JVVA 2CJ9A 2XTIA 2X4XA 1YJNA 5GANf 2QHUA 3T9NA 2LC4A 2DKGA 1VQPA 4DOVA 3CC7A 2V8IA 3OA6A 2X4WA 3DLLA 1VQZA 4TTVA 3MHXA 2NLUA 4TWAA 4BDZA 2VGNA 1NZ9A 1NPRA 2RI5A 4A4GA 2P0KA 3BFMA 1UGRB 2JZ2A 1VQKT 1C0AA 1O9SA 4M78D 4E7HA 2K3YA 3EFSA 4J7FA 2EJGA 1ZBXA 2PUOB 4ZTZB 3CCJA 3DLMA 3HFVA 4HT4A 2ARTA 4ZTUB 4J6XA 1HTTA 3SWNC 2LTOA 4OGCA 3CC2T 1NJ8A 1K9MC 1VUBA 4H2XA 3I56A 5GAMg 4DPGA 4P73C 3HFZB 1N9WA 5IT9E 5HKCA 3TU4K 3RKWA 2D0QB 1VQ4A 4PJOG 3CCET 1FYFA 1WPYA 4RMOA 2P5IA 1QVGS 2LT1A 5FRMA 4P3PA 4F7UG 4RDXA 4Q5WA 1QF6A 1E1TA 4OB0B 4M7AC 3QG1A 2EIFA 2RHSA 2HBPA 3CCUT 4C8QD 2DU5A 2JN0A 3CMQA 2RK1A 1UEBA 4PHCA 3UWNA 3VU3C 2PQWA 1EIYA 2RJFA 1VIFA 1M1FA 2EQUA 3CCMA 2O4XA 3E9HA 2ZPEB 2CZ1B 3M4YA 3AHUA 3V8KA 4GY5A 4MDWA 3QO7A 4C0ZA 5GAOn 4PLLA 2ODRD 3HTZA 3GLXA 5GAOr 4M78G 5IAYA 5FU7B 4A4HA 4X34A 1Q86U 3KFUA 2FVUA 2QHTA 4QQGA 4BY6B 4M7AF 3LGLA 2DPPB 1N9SA 4NL3A 5I21A 4JRKA 3A8LB 2ZCEA 2ZGWA 1BBWA 1USYA 1JBMA 3V7SA 1VQ8T 11ASA 4EDUA 3JB9H 4YRLA 4ZGDB 3G71T 1VQOA 4XTXA 1X2HA 4HCCA 2QXFA 1JJ2S 2F69A 2KAFA 3TEHA 2BIVA 4KUIA 4PNOA 4Z02A 2QA4T 1RI0A 2LX9A 3L4GB 4LDXA 3J81E 4YREA 4EX5A 4M7AE 2AMCB 1IZ6A 1KC8U 3RMQA 4UP8A 1QVFS 1EVKA 4PJOC 3LWHA 4DQ2A 4XTUA 3QO5A 4C8QG 3VUZA 1GGMA 1X75C 2CS7A 1VQ7T 3SFMA 5LJ3j 3HFOA 1NJ6A 3P8DA 4KULA 3CMEA 4R56A 2V8JA 3WXMB 3P8HA 3TEEA 1VQMA 1I4K1 5CKBA 3REUA 3QBYA 1Y96B 2OTLT 4YRJA 2HQEA 3VV0A 3NELA 4KR3A 3EFRA 5LJ5h 4LDWA 4BDYA 1YITT 3FDRA 4ELZC 3G4ST 1HK9A 1KQSS 4PJOF 4KQEA 3V8LA 5GAN4 3PCOB 5LJ3e 3V7CA 2OTJT 4M78C 3JCMP 2ZIMA 4M7AB 1K9MU 2E41A 4A4EA 2CJAA 3QDRB 3PIPA 5KNNA 4E7JA 3MEVA 2MF2A 3NTKA 4OVAA 3VJPA 3QO8A 5LJ3d 2PVGB 3E9GA 2KY9A 5GMKh 3OYLA 1U1SA 3JCMJ 3MP8A 3CPFA 4X5OA 3VQWA 4YRQA 4G85A 2DXCA 4PJOE 4BW9A 2LCLA 1X56A 4XEMA 2Y90A 1H4SA 5IN1A 2DXTA 3F70A 4F7UE 4LNSA 2XI9A 4YRNA 3CCVT 5LJ5f 3JCMe 4ME7A 1SSFA 1TH7A 4KUDK 5CQXA 5C53B 1B8AA 3M4QA 1JB0E 2PMFA 3A5YA 5I2MA 3OS0A 4LDYA 4C8QC 4Y28E 5CAIA 2JOYA 1WQWA 2EKOA 1G3YA 1K8AC 1M90C 1VQ8A 4LVLA 3MCAB 2RJCA 3RESA 3M54A 2E3CA 1UGQB 3JSCA 3G71A 2RHXA 5DY9A 3HHTB 4EO4A 3OYHA 4JLIA 2QEXA 4UP9A 2GFAA 4XTVA 2GF7A 3IALA 1M1GA 4AH6A 4M78E 2QA4A 4QQDA 4EPCA 2ODRC 1SESA 2ZT5A 4FM4B 1KQ2A 3C94A 1NE8A 4PJOB 3LSQA 3JCMW 4CS4A 3Q1JA 2CYZB 1WLEA 3HXXA 3JB9D 1NJ2A 4LDUA 3JCMb 1ADJA 5L8RE 2FHDA 1VQ7A 1M4ZA 4C5GA 4BI8B 2LNVA 3X20B 4J7IA 2ZCFB 3MP6A 4UPAA 4PKCC 3CCLA 3V8JA 2F5TX 1I81A 3M4PA 4M77A 5J3BA 3OS1A 2L89A 2OTLA 1Y71A 3QZ9B 2ZR3A 2VXFA 2LVMA 3JCMV 2ARUA 5LJ5g 5C6SA 2F5KA 1YITA 4BE2A 5GANj 4HKEA 2Q7EA 4RG2A 1Q7YC 3A7UA 3L2VA 4WJ3M 1OZ2A 3BDUA 5GAMd 2OTJA 2M9UA 1MHNA 5A0GA 4P3OA 3MF2A 4P72C 4K86A 4TVAB 2EJ9A 3CPWS 3VUBA 2XG8D 3DB4A 2ZT7A 4HWRA 3E19A 5GAOq 1PYSB 1BYMA 4M75A 1R8OB 2EYQA 5CKHA 4BI4A 5GANe 2G4CA 4Q6GA 4FIBA 3P8BB 1Q81C 3N5BB 4OB2B 3CMAA 4ZGEB 1Z7MA 4YCUA 3OYJA 5GANd 2PUKB 2CJBA 1B70A 1EQRA 5FU7C 1KG1A 2L3RA 5D6YA 1VQ5T 3QO3A 3OQ5A 2DD5A 2E70A 4J6WA 2XHCA 3C4SA 3HXVA 1X54A 2JNGA 3OYBA 5ELOA 2Q7HA 1ZHIA 4CH6A 4R55A 2FYKA 3I7FA 3PMIA 1USYC 3CBMA 5KH6A 1M1KC 2C7IA 2AHJB 1BI2A 3WVEB 3M5AA 2AKWB 3QIIA 1W2BS 4N4HA 3ZBDA 2WSFE 3IKLA 2QI2A 3A8HB 4J15A 4NOYA 1O75A 4YRIA 4RQFA 4YRPA 1WQ7A 4FSXA 1VQLT 2RH2A 2WSEE 3RMSA 1D3BA 1QVPA 1VQ9T 3DSQA 1YI2T 2XD0A 3CCSA 3UT1A 2LT4A 4YTLA 1WU7A 4XU1A 1NJ1A 2CIMA 4IURA 3UGTA 4JDSA 3VKIA 4E51A 5GMKi 4XAXB 2D9TA 3JAME 4H2YA 3G6ET 4N4GA 4H2XB 3BY7A 3L1AA 2ZINA 3HRUA 4M75D 4WJ4A 4C92D 3A8MB 5D6XA 5J26A 3HRIA 4EMKA 4K87A 1IL2A 2XU8A 1YJ9T 3RUXA 1M8VA 1ADYA 4FU6A 4BUGA 3DKMA 4YRKA 3CCRA 4JS4A 4GLKA 3S3OA 1NNHA 3HRSA 4P75A 1Y07A 1EFWA 2MMPA 1VQNT 5K1XA 4CH5A 3JRZA 1BI0A 4HCBA 2MAMA 1Q7YU 2XDPA 1SETA 3CC4A 2VYTA 1EIYB 3OSVA 5GAN3 3HXUA 4X9CA 2VGMA 5K1PA 12ASA 1JJCA 2O4XB 4TQDA 4IKFA 1RL2A 2E65A 4L5GA 3S6WA 4K88A 4HT8A 4XU2A 3JB9F 5C51B 5DLQE 3QYHB 4WF2A 4M7DA 2ZNJA 3OYGA 1VQ5A 2EFIA 4O2DA 2DDZA 1FX7A 2JTMA 1BBUA 4J83A 4BACA 1YCYA 1U1TA 1Q81U 2ZPHB 1X6OA 1XQHA 3A7RA 4MMLA 4XU3A 4TVWA 4TVRA 4A4KA 4D6WA 2X4YA 4N0AC 4BE0A 2K2VA 3GPLA 4E47A 4LD6A 1Z7NA 5HK3A 2FL7A 3OMGA 5GAOm 4IUTA 4C92G 4E7KA 3TEHB 3OYIA 2Y4XA 3H6ZA 1WJRA 2QQBA 4KR2A 2KQWA 5KCOA 4OF1A 3G7ZA 3HKSA 3A5ZA 3QKJA 4XQ3A 4P71A 1JJ2A 1B7YA 1VQKA 1E24A 4IUQA 1VQLA 1XOVA 3CEYA 1M1KU 4N4IA 4CH4A 2KK4A 4H2TA 4YDQA 1KHCA 4P5NA 4OB1B 3RKYA 3SWNA 2RK2A 2RI2A 1KMMA 3PTAA 1B76A 1EIFA 3CC2A 2Q7GA 3GNFB 1FWZA 3FLGA 3LW5E 3CBPA 2L5QA 3KBGA 3FIFA 4L59A 3P8VA 1W66A 2E12A 2DK3A 1X55A 1V29B 1AHJB 1P92A 2RD1A 3CCEA 3L2UA 3LX7A 3OBYA 5KE2A 5GMKj 3QYGB 4YP0A 2XKOC 3MEAA 4C0DC 1H4QA 3HXWA 3PCOA 4IUPA 1ASZA 4E7LA 1QP3A 2DO3A 5CKDA 3L42A 4RKUE 5LJ5d 3CCUA 4EMGA 3TREA 5GAOl 2LQ8A 1KQSA 4M7DD 2A7YA 4TQFA 5C0MA 1B34A 3LGFA 1EVLA 2ZPBB 4OP0A 2ZR2A 4KT0E 5CKEA 2QTXA 3LWIA 4YRSA 3L2WA 2DTOA 4J6YA 1PSEA 2LRQA 5GMKe 4M77F 4M75C 3PZCA 1IREB 4C92C 2R58A 4QW2A 4JRIA 3FB9A 3HPWA 2ZPFB 4XK8E 1YFRA 2ZZDA 4HWPA 2EL9A 2QQ9A 2DQ0A 2XICA 4DA4A 3M53A 1JRIA 1UGPB 3CXCS 3A74A 2DIGA 3META 1X2GA 3OSSC 5I2SA 1NYRA 1QE0A 2IY5A 3ER0A 4MMKA 3IKMB 5FLXE 4M77E 3BJUA 2RHQA 5M9OA 4P74C 2R57A 2PVOB 3RF1A 4M75F 4LDVA 4C92F 1X01A 3L2QA 1VQPT 3CC7T 2CGHA 3PMTA 5KCHA 5C52B 5GAMj 2MWPA 3BDLA 2JUFA 1BI1A 3JCMf 3OS2A 4OB3B 3OW2S 4F7UA 5FU6B 1VIEA 3GNGA 2GCXA 1M9SA 3JB9J 3A32A 3PIOA 1DJ7B 1XTDA 2I4MA 3HRKA 3PT9A 3OYFA 4RMFA 2ZZGA 2M16A 2ALYA 4OMFB 3NETA 4L6V5 4M75E 4C92E 1LNXA 3TCJA 1K73C 1M5Q1 3FJPA 2B8AA 3OYYA 3R07A 4RCBA 5DM7R 2KSSA 2I4LA 2QQRA 4M77B 2DTHA 4Q15A 3VQVA 2E5QA 3NENA 5GAMe 1WJSA 3RERA 3P8YA 3G4SA 4XTWA 3QPHA 2CZ6B 4C0DB 5LJ3g 3HFNA 3A8GB 4M78A 1VQ4T 3HL8A 1FXXA 2PMEA 3BW1A 2ZPGB 2HAXA 2K4YA 1I8FA 4HT9A 5HY6A 2ARSA 2QQSA 4C5IA 4G84A 4HWTA 4O6JA 3M55A 3DB3A 1Q82C 2ZZFA 2XGTA 1NPPA 3X26B 2CKKA 2K5IA 2DZ9A 1PYSA 4H2WA 3M57A 2RI3A 5HK0A 4BD3A 4M75B 4YRGA 4C92B 3CCMT 3MEWA 3CPWA 3JB9G 1N6AA 2H3JA 1QW1A 3JCMg 4JRQA 3OYDA 3CCVA 3I55T 4WI1A 3HY0A 1W4SA 2L8DA 2ZPIB 3PGGA 4YRTA 1B70B 5AYFA 1N27A 4C8QA 3OYEA 3CD6T 1KQ1A 4LVKA 4JLGA 2A3LA 4OGEA 3J80E 2J3LA 4CS2A 2XDBA 4M7DC 4PG3A 2JTFA 3NFCA 2LQKA 3M4GA 4XU0A 4VUBA 4MZMA 1N8RC 2E1HA 2EQJA 3X24B 2R5MA 2I2LA 3EAEA 4XTYA 3KUFA 4LVJA 2RA2A 3O8VA 3HXZA 1H4VB 1K8AU 4JJNK 1M90U 4M77D 1NJ5A 2P4TA 1J5WA 2RJDA 2KMTA 3ICAA 3ERRA 2KDSA 1H3ZA 3L2RA 1SERA 3TUPA 2EWNA 1W2BA 3M56A 4P71C 1D3BB 2HNIA 3H8ZA 4HVCA 4M7DF 4KBMB 3OS5A 1S72T 1G51A 3OMCA 2X4JA 4DOWA 3OYNA 2LDMA 4C0GA 3VQYA 2Q5HA 3CMET 3QTCA 3G1ZA 3HFZA 2MI6A 1VQMT 5GAN8 4MZTA 4EMHA 3A7AA 4YRCA 4FL6A 1WJQA 1Y7XA 2IG0A 3OYMA 4H2SA 1GXIE 4BWAA 4M7DE 3VYHB 1WNLA 4FT4A 1K73U 4II1A 3VBBA 4CH3A 4P72A 3LC0A 4EMKB 2BKDN 2E64A 3MP1A 3KXTA 3OYKA 2RHSB 2ZT8A 2RHIA 2EQKA 4J8OA 2R5AA 3ME9A 2BUDA 1QVGA 2YLBA 4BE1A 1BKBA 1NJIC 4ZGJB 3E9FA 4H02A 4MZPA 4HA8A 2VV5A 4YCWA 5GANg 1G5IA 4M77G 4J5YA 2M0OA 3GIBA 1MGQA 2DIQA 1YB3A 3M9QA 1G5VA 4HCZA 3ZFJA 3X28B 3INZA 4CRIA 2XK0A 1Q82U 1JJCB 2P0PA 4B9WA 2EQMA 3OBWA 4YPFA 3I55A 2PU9B 1OI1A 5CVIA 2DVEA 4A53A 1KD1C 3CD6A 4M7DB 1G5HA 3MQZA 4H2UA 2CZ7B 2CZ0B 2ZNIA 3FEOA 5CQYA 3IG2A 1H641 4B9XA 4M75G 2GFUA 1YFSA 4UP7A 1BI3A 3QHSA 5A0DA 3L4GA 3GF5A 2MWOA 2QEXT 2FB7A 3GOXA 4PLIA 2GQVA 2AMCA 1EOVA 2VUBA 1H4TA 3PFSA 3OY9A 3W3SA 1QP2A 4HWOA 1WYDA 2K3XA 1N8RU 1VQ9A 1UGSB 1XNIA 3A5ZB 1OZ3A 3L2ZA 1YI2A 5LJ5j 5FU6C 1B7YB 2YHTA 2E5AA 2QHSA 3QSUA 3A31A 2V8KA 3GP8A 1LJOA 2K57A 3JCMX 4BB7A 1E1OA 1S72A 4C5EA 3M58A 5A2QE 2C06A 5GAN7 1QVFA 3CCQT 3OYAA 2I4NA 3UDCA 3SWNB 4P73A 4QQ6A 2RHUA 1Y96A 4JRPA 3HXYA 3MEYA 5D6WA 3ASKA 3CCLT 3G6EA 3HP9A 4YRFA 3QNEA 3MO8A 4M77C 5LJ3h 2P0QA 2DD4A 1E22A 1KMNA 4IUUA 1YIJT 2RO0A 2ZZEA 3UH0A 3WVDB 2YLCA 5LJ5e 5CCAA 2E6ZA 4RCCA 1VQ6T 2RJEA 4M7AA 3RGLA 1YJ9A 4YRMA 1ZQ1A 3NTIA 2DU7A 4XTZA 3HRTA 5DLOA 2RM4A 5CO7A 3TEGA 1ATIA 3WQZA 4F7UF 2EAYA 1WGSA 1VQNA 1LOJA 4A54A 1YGBA 3RL6A 4IUVA 1LYLA 3LSSA 2PVDB 3R6OA 5CK9A 1B34B 4P3NA 2D6FA 3REXA 1U8RA 2DXBA 3S3MA 5FRNA 3JCMh 3VYGA 2K5LA 3OYCA 3MF1A 3E1SA 3JCMc 2HQXA 5FROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PME A;  3TEH A;  3BW1 A;  1WU7 A;  4XU1 A;  2VXE A;  1NJ1 A;  4XEO A;  2CIM A;  1HC7 A;  4PNO A;  2E10 A;  4YCV A;  1I8F A;  4HT9 A;  3UGT A;  2ARS A;  5LJ3 f;  4G84 A;  3L4G B;  4HWT A;  2I4O A;  4E51 A;  4M78 F;  5GMK i;  5F5W A;  4YRE A;  4EX5 A;  4M7A E;  3JCM Q;  2ZTG A;  2ZZF A;  2XGT A;  2AMC B;  1ASY A;  5GAO p;  4H2Y A;  4UP8 A;  1EVK A;  4H2X B;  2DZ9 A;  1PYS A;  3BY7 A;  3L1A A;  4H2W A;  3JCM d;  4PJO C;  2ZIN A;  4DQ2 A;  1N9R A;  4XTU A;  4C8Q G;  3QO5 A;  4M75 D;  1GGM A;  4N0A A;  4WJ4 A;  4C92 D;  4M75 B;  4YRG A;  4C92 B;  3E9I A;  5LJ3 j;  2IY5 B;  3HRI A;  4EMK A;  3HFO A;  3JB9 G;  4K87 A;  1IL2 A;  3HY1 A;  4X9D A;  1M8V A;  3RUX A;  1ADY A;  1NJ6 A;  3JCM g;  4V2S A;  4YRK A;  1NNH A;  4WI1 A;  4L87 A;  3HY0 A;  2RHQ B;  3PGG A;  4P75 A;  4YRT A;  1B70 B;  1I4K 1;  2VC8 A;  4PJO A;  3REU A;  5GAN 5;  1EFW A;  4C8Q A;  1Y96 B;  5K1X A;  4CH5 A;  1KQ1 A;  4YRJ A;  3NEL A;  4KR3 A;  3EFR A;  2J3L A;  5LJ5 h;  4CS2 A;  4M7D G;  1SET A;  4M7D C;  4PG3 A;  2ZT6 A;  3UFG A;  1EIY B;  3M4G A;  4XU0 A;  1HK9 A;  2DXU A;  2ZXF A;  2E1H A;  5GAN 3;  3HXU A;  4X9C A;  4PJO F;  4F7U B;  4KQE A;  1BIB A;  3V8L A;  5K1P A;  5GAN 4;  12AS A;  4C8Q F;  2I2L A;  1JJC A;  4TQD A;  3PCO B;  5LJ3 e;  5GMK m;  3V7C A;  4M7A D;  4M78 C;  3JCM P;  2ZIM A;  4XTY A;  4ZIB A;  4NL2 A;  2QHV A;  2E65 A;  4M7A B;  2E41 A;  2RA2 A;  2CJA A;  4K88 A;  4HT8 A;  5KNN A;  2DJZ A;  4OLF A;  4XU2 A;  3HXZ A;  3JB9 F;  2ALY B;  1SRY A;  3QO8 A;  5C51 B;  5LJ3 d;  1H4V B;  4WF2 A;  1HXD A;  4M77 D;  2RB6 A;  1I5L A;  1NJ5 A;  4M7D A;  2ZNJ A;  5GAM h;  1NYQ A;  4TVY A;  1L0W A;  1J5W A;  1BIA A;  2DDZ A;  4O2D A;  5GMK h;  4YRR A;  1BBU A;  4RQE A;  1YCY A;  4QVD A;  3ICA A;  1U1T A;  2C8M A;  3ERR A;  1U1S A;  3JCM J;  1SER A;  3TUP A;  2EWN A;  5HGQ A;  4JUV A;  4X5O A;  3A7R A;  4MML A;  3VQW A;  4XU3 A;  4YRQ A;  4TVW A;  2DQ3 A;  4G85 A;  4P71 C;  1D3B B;  2HNI A;  4HVC A;  4PJO E;  4BW9 A;  3RKX A;  3VQX A;  4M7D F;  1X56 A;  4N0A C;  4XEM A;  2Y90 A;  4C8Q E;  1G51 A;  1H4S A;  1Z7N A;  4M78 B;  2DXT A;  5GAO m;  4F7U E;  4LNS A;  2P0L A;  4YRN A;  4C92 G;  3TEH B;  4EMK C;  4TVA A;  3VQY A;  4YYE A;  5LJ5 f;  4CS3 A;  3JCM e;  2DTI A;  3RAC A;  2Q5H A;  3QTC A;  3G1Z A;  4KR2 A;  1TH7 A;  4NCX A;  3HFZ A;  1YFT A;  5C53 B;  5GAN h;  4P75 C;  1B8A A;  3M4Q A;  4QVC A;  3A5Z A;  2PMF A;  4XQ3 A;  4P71 A;  5GAN 8;  3A5Y A;  2DEQ A;  4EMH A;  4Y91 A;  1B7Y A;  4C8Q C;  3A7A A;  4YRC A;  5CAI A;  1E24 A;  1WQW A;  3RES A;  2E3C A;  4H2S A;  4C92 A;  3SB2 A;  4CH4 A;  1KOG A;  2DZC A;  4BWA A;  4M7D E;  5GAN 2;  1WNL A;  4H2T A;  4YDQ A;  5DY9 A;  4EO4 A;  3RKY A;  3VBB A;  3SWN A;  4CH3 A;  5GAM f;  4JLI A;  4P72 A;  1KMM A;  4UP9 A;  3LC0 A;  4XTV A;  4EMK B;  1B76 A;  2J3M A;  5GAN 6;  3IAL A;  4AH6 A;  2Q7G A;  4M78 E;  3HSB A;  2E64 A;  5GMK l;  2ODR C;  2RHS B;  2ZT8 A;  1SES A;  4HWS A;  4M7A G;  2ZT5 A;  3NEM A;  3OD1 A;  5E3I A;  1KQ2 A;  3FIF A;  3QUI A;  4PJO D;  2YLB A;  3P8V A;  1RIQ A;  1W66 A;  4PJO B;  3LSQ A;  4YRO A;  3JB9 I;  3JCM W;  4H02 A;  1X55 A;  4CS4 A;  4HA8 A;  4C8Q B;  2Q5I A;  3P8T A;  4YCW A;  5GAN g;  1G5I A;  3UGQ A;  4M77 G;  3RIR A;  4J5Y A;  1WLE A;  2RD1 A;  3HXX A;  3GIB A;  1MGQ A;  3JB9 D;  1NJ2 A;  5GMK j;  2ZIO A;  3JCM b;  1ADJ A;  1YB3 A;  4YP0 A;  5ELN A;  3V7R A;  4P74 A;  2AKW A;  2EJF A;  4H2V A;  1H4Q A;  3HXW A;  3PCO A;  2CJ9 A;  2XTI A;  1ASZ A;  5GAN f;  3INZ A;  4UPA A;  2QHU A;  1JJC B;  2DKG A;  4YPF A;  5LJ5 d;  4EMG A;  5GAO l;  3V8J A;  1VQZ A;  1I81 A;  4TTV A;  3M4P A;  2DVE A;  4M77 A;  4A53 A;  4M7D D;  4TWA A;  4TQF A;  4M7D B;  1G5H A;  2ZR3 A;  1B34 A;  2VXF A;  3JCM V;  4H2U A;  2ARU A;  5LJ5 g;  3BFM A;  1EVL A;  2ZNI A;  2ZR2 A;  4OP0 A;  1C0A A;  5GAN j;  2QTX A;  4M78 D;  2Q7E A;  3IG2 A;  4YRS A;  1H64 1;  2DTO A;  3EFS A;  4J6Y A;  5GMK e;  4M75 G;  4M77 F;  4M75 C;  3PZC A;  1YFS A;  4C92 C;  2EJG A;  3A7U A;  4UP7 A;  3QHS A;  4ZTZ B;  4WJ3 M;  3BDU A;  5GAM d;  4JRI A;  3HFV A;  3FB9 A;  2ART A;  4ZTU B;  4J6X A;  3L4G A;  1HTT A;  3SWN C;  4P3O A;  3MF2 A;  4P72 C;  2FB7 A;  4K86 A;  2AMC A;  4TVA B;  1YFR A;  2EJ9 A;  1NJ8 A;  1EOV A;  4HWP A;  2EL9 A;  1H4T A;  2DQ0 A;  4H2X A;  3W3S A;  5GAM g;  4DPG A;  4HWO A;  1JRI A;  2ZT7 A;  4P73 C;  1WYD A;  3HFZ B;  3A74 A;  4HWR A;  1N9W A;  5GAO q;  1X2G A;  1PYS B;  4M75 A;  1NYR A;  3L2Z A;  1QE0 A;  5LJ5 j;  3RKW A;  2IY5 A;  1B7Y B;  2YHT A;  2E5A A;  2QHS A;  4MMK A;  3QSU A;  4PJO G;  3IKM B;  3A31 A;  5GAN e;  2G4C A;  4Q6G A;  1FYF A;  1WPY A;  1LJO A;  2P5I A;  4M77 E;  2K57 A;  3BJU A;  3JCM X;  1E1O A;  4P3P A;  4F7U G;  2RHQ A;  5GAN 7;  4RDX A;  1Z7M A;  4P74 C;  4YCU A;  5GAN d;  2CJB A;  1B70 A;  1QF6 A;  3RF1 A;  2I4N A;  4M75 F;  3SWN B;  4C92 F;  1X01 A;  1E1T A;  1EQR A;  4P73 A;  4M7A C;  1Y96 A;  3HXY A;  2RHS A;  3MEY A;  2CGH A;  4C8Q D;  2DU5 A;  3QO3 A;  2JN0 A;  3CMQ A;  4YRF A;  5C52 B;  3QNE A;  4PHC A;  4J6W A;  5GAM j;  3VU3 C;  4M77 C;  5LJ3 h;  1EIY A;  1E22 A;  1KMN A;  3HXV A;  3JCM f;  1X54 A;  4F7U A;  2ZZE A;  5ELO A;  2Q7H A;  3UH0 A;  4CH6 A;  3E9H A;  2YLC A;  5LJ5 e;  3AHU A;  3JB9 J;  3A32 A;  4RCC A;  3V8K A;  4M7A A;  3RGL A;  2FYK A;  3I7F A;  4YRM A;  3QO7 A;  1USY C;  2DU7 A;  4XTZ A;  2I4M A;  3HRK A;  5GAO n;  2C7I A;  4RMF A;  2ODR D;  2ZZG A;  2ALY A;  3HTZ A;  2RM4 A;  5GAO r;  2AKW B;  3NET A;  4M75 E;  4M78 G;  3TEG A;  4C92 E;  1LNX A;  1ATI A;  1M5Q 1;  3FJP A;  3WQZ A;  4F7U F;  3IKL A;  3R07 A;  3KFU A;  4RCB A;  2EAY A;  4J15 A;  4NOY A;  2QHT A;  1LOJ A;  4A54 A;  4YRI A;  4RQF A;  4M7A F;  4NL3 A;  1N9S A;  5I21 A;  4YRP A;  2I4L A;  4JRK A;  1WQ7 A;  1YGB A;  3RL6 A;  2ZCE A;  4M77 B;  2DTH A;  1LYL A;  4Q15 A;  2ZGW A;  3LSS A;  3VQV A;  3NEN A;  5GAM e;  3RER A;  1BBW A;  1JBM A;  3V7S A;  1USY A;  3P8Y A;  11AS A;  1D3B A;  3DSQ A;  4XTW A;  3JB9 H;  1B34 B;  4P3N A;  4YRL A;  3REX A;  5LJ3 g;  3HFN A;  3JCM h;  4M78 A;  4XTX A;  1X2H A;  3MF1 A;  3JCM c; 
#chains in the Genus database with same CATH topology
 2A8E A;  2VXE A;  2NS6 A;  2YUQ A;  4XEO A;  2O9S A;  1TSF A;  1G3T A;  4O5V A;  1HC7 A;  2XDD A;  1JJ2 P;  3CMA T;  2E10 A;  1C0M A;  1IO6 A;  5IXB A;  4YCV A;  2DEU A;  4UC4 A;  3SDZ A;  4LVI A;  5LJ3 f;  1I0C A;  1NJI U;  2LCC A;  1VQ5 Q;  1HSQ A;  2I4O A;  1G3S A;  4M78 F;  5F5W A;  1UB4 A;  1D0Z A;  4FYY B;  3JCM Q;  3UPU A;  2ZTG A;  3FRN A;  3A8O B;  2RMO A;  1ASY A;  2ATC B;  5GAO p;  4QVZ A;  2DYB A;  3NTH A;  1C1A A;  3JCM d;  2P4R A;  1N9R A;  2ROL A;  4N0A A;  3LLR A;  1UTI A;  1YJW T;  2RHZ A;  3REA B;  3C12 A;  1ACM B;  1FMK A;  3E9I A;  1QCF A;  3X25 B;  1YHQ T;  2IY5 B;  2V1Q A;  3TSW A;  1WHJ A;  4FT2 A;  1YJN T;  3HY1 A;  4X9D A;  2DNU A;  5CIU A;  5KE3 A;  4V2S A;  3CXC A;  4L87 A;  2RHQ B;  1KD1 U;  2KRO A;  3S3N A;  4F17 A;  2VC8 A;  4PJO A;  4RG8 A;  1YBY A;  2FZC B;  5GAN 5;  1VQK Q;  2YRV A;  1VQL Q;  1OPK A;  2C0I A;  3C95 A;  1JXM A;  3LH5 A;  5J39 A;  1UHF A;  1YFN A;  2X35 A;  1VQ9 Q;  3CBO A;  5KYW B;  2JT4 A;  4ZN1 A;  4M7D G;  1MMA A;  2CRE A;  3U23 A;  4JS5 A;  2O01 E;  2ZT6 A;  3UFG A;  4PFZ A;  2DXU A;  2DBK A;  1RAE B;  2ZXF A;  2J6K A;  2KT8 A;  3QJ6 A;  2E4H A;  1BIB A;  2NUZ A;  1Y57 A;  3AT1 B;  4A4F A;  4F7U B;  3CCS T;  4JZ4 A;  4C8Q F;  3CCJ T;  4LVM A;  5GMK m;  4M7A D;  1KQS P;  4ZIB A;  4NL2 A;  2CH4 A;  2QHV A;  1PSF A;  2DJQ A;  1PHT A;  4RTW A;  4LUE A;  3CCQ A;  4CI0 C;  3LYI A;  1U5S A;  2OAU A;  2DJZ A;  4OLF A;  2VVK A;  2ALY B;  1SRY A;  2FPD A;  4ZTF A;  1PKS A;  4DEX A;  3J7A F;  1HXD A;  2QQA A;  3LH0 A;  2RB6 A;  3OW2 A;  1I5L A;  3I56 T;  5CR2 A;  5GAM h;  1NYQ A;  3G6E Q;  4TVY A;  3M59 A;  1L0W A;  1H8K A;  4HXJ A;  4YRR A;  1BIA A;  2XID A;  4RQE A;  5KYY B;  3ZEH A;  4QVD A;  2C8M A;  3QJY A;  3MEU A;  5HGQ A;  4JUV A;  1YIJ A;  2OAW A;  2NUP B;  2J7I A;  2DQ3 A;  4AG2 C;  2K5F A;  2YRD A;  3EFO A;  3RKX A;  3VQX A;  4C8Q E;  3O5Z A;  4ATO A;  1VQ6 A;  4PL6 A;  4M78 B;  2LJ1 A;  2MYS A;  2O88 A;  3I35 A;  3CCU Q;  2P0L A;  3OB9 A;  3SD4 A;  4EMK C;  4ZTJ A;  4TVA A;  4CC7 A;  3RR6 A;  4GLM A;  4YYE A;  4BI3 A;  3CCR T;  3URG A;  4CS3 A;  2DTI A;  3RAC A;  4NS5 A;  1VQN Q;  1HD3 A;  2WAC A;  4D8K A;  5EG2 A;  4NCX A;  4ZN3 A;  1YFT A;  2RQR A;  5GAN h;  4P75 C;  2BE7 D;  4QVC A;  1LPL A;  4MDX A;  2DAQ A;  3TSZ A;  1TUG B;  2DEQ A;  1Q86 C;  4Y91 A;  4J9C A;  3PVQ A;  2D8J A;  2GBQ A;  5CKF A;  4K11 A;  7AT1 B;  2D8H A;  1RAC B;  2IVW A;  3CC4 T;  4C92 A;  3SB2 A;  4RTV A;  1KOG A;  2DZC A;  1RAI B;  5GAN 2;  1ZUK A;  2M1H A;  4KGV B;  2B86 A;  2WSC E;  1K8A R;  2Y4Y A;  1M90 R;  2RHY A;  3VS4 A;  2E6N A;  2QDY B;  5L23 A;  1UFF A;  5GAM f;  3EGX A;  2J3M A;  5GAN 6;  4C0F A;  4ELY C;  2YWW A;  3HSB A;  4C5H A;  2BZY A;  5GMK l;  2EW3 A;  1G3W A;  2AZS A;  4HWS A;  3FC3 A;  1OYX A;  4M7A G;  3NEM A;  3OD1 A;  5E3I A;  2RN8 A;  1SF9 A;  1KHI A;  3QUI A;  4PJO D;  2G3R A;  1VYT A;  3QXE B;  4LD9 K;  1RIQ A;  4YRO A;  3JB9 I;  3C0C A;  3EH1 A;  4LN2 A;  1IHW A;  4E7I A;  1ZSZ B;  2RNA A;  4BY6 C;  2L0A A;  4C8Q B;  1WYX A;  2Q5I A;  3P8T A;  2KVQ G;  5A0L A;  3UGQ A;  1FYN A;  3RIR A;  3QZ5 B;  2QGG A;  1PKT A;  2A0F B;  5LL6 S;  1HYO A;  2DBM A;  1KC8 C;  1VQO T;  2ZIO A;  2HD0 A;  4LE9 A;  5ELN A;  1YJW A;  4HVU A;  3V7R A;  4P74 A;  2AKW A;  2EJF A;  4H2V A;  3PNW C;  1WX6 A;  3HTR A;  1JXO A;  1YHQ A;  2JVV A;  1SSH A;  2CJ9 A;  2XTI A;  2X4X A;  2CDT A;  1YJN A;  1WHL A;  2EGE A;  1G2B A;  4PFO A;  5GAN f;  2QHU A;  1WI7 A;  2F2V A;  4FW2 A;  3T9N A;  2LC4 A;  2DKG A;  1VQP A;  4DOV A;  3CC7 A;  2V8I A;  3OA6 A;  2X4W A;  3DLL A;  1VQZ A;  4TTV A;  3MHX A;  2NLU A;  1AWJ A;  4TWA A;  4BDZ A;  4OMP A;  2VGN A;  1E7O A;  1NZ9 A;  2YSQ A;  1NPR A;  1K73 R;  2RI5 A;  4A4G A;  2DE0 X;  2P0K A;  3BFM A;  1UGR B;  2AKK A;  2JZ2 A;  1VQK T;  1C0A A;  1O9S A;  3UF4 A;  4M78 D;  4E7H A;  2K3Y A;  3EFS A;  2YUP A;  1R0B G;  2W0Z A;  4J7F A;  2EJG A;  1ZBX A;  2PUO B;  4FCY A;  4ZTZ B;  3CCJ A;  1PRM C;  3DLM A;  3HFV A;  4HT4 A;  2ART A;  4ZTU B;  2JW4 A;  4J6X A;  1HTT A;  3SWN C;  2LTO A;  2DL4 A;  4OGC A;  1XJW B;  3CC2 T;  1OX8 A;  1UEC A;  1WXU A;  1NJ8 A;  1NLO C;  1K9M C;  1VUB A;  4H2X A;  3I56 A;  5GAM g;  8AT1 B;  4DPG A;  4P73 C;  3HFZ B;  3CPW P;  1N9W A;  2DRK A;  5IHN A;  1I5O B;  5IT9 E;  5HKC A;  1ZA2 B;  3TU4 K;  3RKW A;  2D0Q B;  1VQ4 A;  4PJO G;  3CCE T;  1U3O A;  1FYF A;  1WPY A;  4RMO A;  1OUL A;  1OEB A;  2P5I A;  2JJ9 A;  1TOV A;  1QVG S;  2LT1 A;  5FRM A;  4P3P A;  4F7U G;  4RDX A;  1PNJ A;  1Q81 R;  4Q5W A;  2K2M A;  1BCO A;  1QF6 A;  1AWW A;  1E1T A;  4OB0 B;  5GJV B;  4M7A C;  3QG1 A;  3VS7 A;  2EIF A;  2RHS A;  2HBP A;  1GCP A;  3CCU T;  4C8Q D;  2COZ A;  2DU5 A;  1EZZ B;  2JN0 A;  3CMQ A;  2RK1 A;  1UEB A;  4PHC A;  3UWN A;  3VU3 C;  2PQW A;  1EIY A;  2CT3 A;  2RJF A;  1VIF A;  4FYX B;  2FZG B;  1M1F A;  2EQU A;  3VS1 A;  3EHR A;  3CCM A;  2O4X A;  3E9H A;  2ZPE B;  1ARK A;  2FEI A;  2CZ1 B;  3M4Y A;  4E7S A;  3AHU A;  1X2K A;  3V8K A;  4GY5 A;  4MDW A;  3CCV Q;  3QO7 A;  4C0Z A;  5GAO n;  4PLL A;  2ODR D;  3HTZ A;  3GLX A;  5GAO r;  5FWC A;  1FMV A;  1T3L A;  4M78 G;  5IAY A;  2G6F X;  4JJD A;  1N8R R;  5FU7 B;  4A4H A;  4X34 A;  1Q86 U;  3KFU A;  1UUE A;  1W2B P;  2FVU A;  1F1B B;  2QHT A;  4QQG A;  4BY6 B;  2X9H A;  4M7A F;  2KI7 A;  2DPP B;  1N9S A;  2YRC A;  2OI3 A;  3LGL A;  5I21 A;  4NL3 A;  2HSE B;  4JRK A;  3A8L B;  2ZCE A;  1UDL A;  3M0T A;  2ZGW A;  2FRY A;  1BBW A;  1VA7 A;  1JBM A;  3V7S A;  1VQ8 T;  1USY A;  11AS A;  2O2O A;  4EDU A;  3JB9 H;  1UHC A;  4J9H A;  4YRL A;  4KGZ B;  2CT4 A;  4FSS A;  4ZGD B;  2LQW A;  2E3H A;  3G71 T;  3VRZ A;  1VQO A;  4XTX A;  2J6O A;  4HCC A;  1GFC A;  2QXF A;  1X2H A;  1AD5 A;  1AWX A;  1JJ2 S;  2F69 A;  1WA7 A;  2KAF A;  3TEH A;  2CP2 A;  2BIV A;  4KUI A;  1X43 A;  1RLP C;  1AOJ A;  1ZA1 B;  4PNO A;  4Z02 A;  2QA4 T;  2VKN A;  2KXD A;  2DYI A;  4DBF A;  2J06 A;  3CC7 Q;  1RI0 A;  2LX9 A;  2SRC A;  2P84 A;  3L4G B;  5ECA A;  4AFS C;  2Z0W A;  4LDX A;  9ATC B;  3J81 E;  4YRE A;  4EX5 A;  4M7A E;  3A1P A;  1Z9Q A;  2LJ0 A;  1IZ6 A;  1AZE A;  2AMC B;  2YT6 A;  1KC8 U;  1T3S A;  4OMM A;  3RMQ A;  4UP8 A;  1QVF S;  1EVK A;  1QLY A;  1EFN A;  1FMW A;  2DL3 A;  2QG9 B;  3M0R A;  4PJO C;  3LWH A;  2KNB B;  4XTU A;  4DQ2 A;  4C8Q G;  3QO5 A;  3VUZ A;  1WFW A;  1GGM A;  1X75 C;  2CS7 A;  4WTO B;  2J05 A;  1VQ7 T;  3SFM A;  5LJ3 j;  4DBR A;  3MPU B;  3HFO A;  1QVG P;  1KSW A;  1NJ6 A;  2MCN A;  3P8D A;  1R0C B;  4KUL A;  3CME A;  2QDL A;  2LZ6 B;  4R56 A;  2V8J A;  3WXM B;  2X3W D;  3P8H A;  3TEE A;  1VQM A;  1I4K 1;  5CKB A;  2EYZ A;  3REU A;  3QBY A;  1Y96 B;  2OTL T;  4YRJ A;  2HQE A;  3VV0 A;  3NEL A;  4KR3 A;  2L3S A;  3EFR A;  5LJ5 h;  4LDW A;  4BDY A;  1YIT T;  1G83 A;  2DL8 A;  3FDR A;  2YUN A;  4ELZ C;  3G4S T;  1HK9 A;  1KQS S;  2A28 A;  4PJO F;  4KQE A;  1NJI R;  3V8L A;  5GAN 4;  1NYG A;  3PCO B;  5LJ3 e;  3V7C A;  2OTJ T;  4M78 C;  3JCM P;  2ZIM A;  2AK5 A;  4M7A B;  1K9M U;  2E41 A;  1RAF B;  4A4E A;  2CJA A;  3QDR B;  3PIP A;  5KNN A;  2YUO A;  4E7J A;  3MEV A;  3M0P A;  2MF2 A;  1M27 C;  3NTK A;  4OVA A;  3VJP A;  3QO8 A;  5LJ3 d;  2PVG B;  4FYV B;  4RTZ A;  3JV3 A;  3E9G A;  2KY9 A;  5GMK h;  3OYL A;  1OPL A;  3EGD B;  1U1S A;  3JCM J;  3MP8 A;  3CPF A;  1RAG B;  2HMA A;  4X5O A;  3VQW A;  3CCM Q;  4YRQ A;  4G85 A;  2DXC A;  3QWX X;  4PJO E;  2KR3 A;  1KD1 R;  2LCL A;  4BW9 A;  1TTH B;  1X56 A;  4XEM A;  2Y90 A;  4KGX B;  1QMC A;  1H4S A;  3VS3 A;  5IN1 A;  3I55 Q;  2DXT A;  3F70 A;  3EG1 A;  4F7U E;  4LNS A;  2XI9 A;  4YRN A;  1SRL A;  3CCV T;  1WHM A;  5LJ5 f;  2IIM A;  3JCM e;  2KRS A;  4ME7 A;  1YWO A;  1SSF A;  3CD6 Q;  1TH7 A;  4KUD K;  1SRM A;  5CQX A;  4JPB W;  2CUB A;  5C53 B;  1RAB B;  1B8A A;  3M4Q A;  1JB0 E;  2PMF A;  3A5Y A;  5I2M A;  3OS0 A;  5IH2 A;  4LDY A;  1ZSZ C;  5HCK A;  4C8Q C;  4Y28 E;  5CAI A;  1QVF P;  2JOY A;  2QTV A;  1WQW A;  2EKO A;  4D8D A;  2NUT B;  1G3Y A;  1K8A C;  1M90 C;  1VQ8 A;  4LVL A;  3MCA B;  3NPF A;  2RJC A;  3RES A;  3M54 A;  2E3C A;  2AIR B;  1ZSG A;  1UE9 A;  4HCK A;  1UGQ B;  3JSC A;  3G71 A;  1KFZ A;  2RHX A;  2KYB A;  5DY9 A;  3HHT B;  4EO4 A;  4AFQ C;  2L3Q A;  3OYH A;  4JLI A;  5GJW B;  2QEX A;  4UP9 A;  2GFA A;  2HEQ A;  4XTV A;  2GF7 A;  2HBW A;  2HKQ B;  3IAL A;  1M1G A;  4AH6 A;  4X1V A;  4M78 E;  2QA4 A;  4QQD A;  4EPC A;  3RNJ A;  2ODR C;  1AVZ C;  1SES A;  4JJB A;  4CC4 B;  2ZT5 A;  4FM4 B;  1KQ2 A;  3C94 A;  1YI2 Q;  1NE8 A;  2EYW A;  4PJO B;  3LSQ A;  3JCM W;  1VYU A;  1JEG A;  4CS4 A;  3Q1J A;  1JQQ A;  4EIK A;  2CYZ B;  1WLE A;  3HXX A;  1RAA B;  3JB9 D;  2ED0 A;  5IXF A;  1NJ2 A;  1S72 Q;  4LDU A;  3JCM b;  1ADJ A;  5L8R E;  2FHD A;  1VQ7 A;  1M4Z A;  1YCS B;  4C5G A;  5KYU B;  4BI8 B;  2LNV A;  4R0K A;  3X20 B;  1NM7 A;  4J7I A;  2NYS A;  2ZCF B;  5EC7 A;  3MP6 A;  4UPA A;  1MMN A;  4PKC C;  1X6G A;  4PK4 A;  3CCL A;  2KT1 A;  3V8J A;  1QQJ A;  2F5T X;  1I81 A;  3M4P A;  2AKL A;  4M77 A;  4J9B A;  5J3B A;  5I11 A;  3OS1 A;  2HSP A;  2L89 A;  2OTL A;  1Y71 A;  1UG1 A;  3QZ9 B;  1D09 B;  2ZR3 A;  2VXF A;  2LVM A;  3JCM V;  2VAS A;  2ARU A;  5LJ5 g;  5C6S A;  2F5K A;  2L2P A;  1E6H A;  1YIT A;  4BE2 A;  5GAN j;  1YJ9 Q;  4HKE A;  2Q7E A;  4RG2 A;  2IPO B;  1Q7Y C;  2AT1 B;  3R6N A;  2C0T A;  3A7U A;  3L2V A;  3EFO B;  4WJ3 M;  1OZ2 A;  3BDU A;  5GAM d;  2OTJ A;  2M9U A;  1MHN A;  5A0G A;  2O31 A;  4P3O A;  3MF2 A;  4AG1 C;  4P72 C;  4K86 A;  3EG0 A;  2O9V A;  4TVA B;  2EJ9 A;  2DIL A;  3CPW S;  4LXC A;  3VUB A;  1WIE A;  2XG8 D;  1TS9 A;  3DB4 A;  1ZUU A;  2ZT7 A;  2M0Y A;  4HWR A;  3E19 A;  5GAO q;  1ZBJ A;  1PYS B;  1M3B A;  1BYM A;  4M75 A;  4OMO A;  2K3B A;  4J9F A;  1LCK A;  1R8O B;  3CXC P;  2EYQ A;  1EX4 A;  4KH0 B;  3RDV A;  5CKH A;  4BI4 A;  3E2U A;  5GAN e;  2G4C A;  4Q6G A;  1ZUY A;  4FIB A;  3P8B B;  1Q81 C;  2A36 A;  1PD0 A;  2JMA A;  3N5B B;  1AT1 B;  4OB2 B;  3CMA A;  4ZGE B;  1Z7M A;  3SHW A;  4YCU A;  3OYJ A;  5GAN d;  2PUK B;  2CJB A;  1B70 A;  4HVW A;  3UAT A;  2E3I A;  1EQR A;  5FU7 C;  3EGX B;  1KG1 A;  2L3R A;  1GBQ A;  1QWE A;  2EYY A;  5D6Y A;  1VQ5 T;  3QO3 A;  2CP7 A;  2LP5 A;  3I9Q A;  2DD5 A;  3OQ5 A;  1IXD A;  2E70 A;  4J6W A;  4FW1 A;  2XHC A;  3C4S A;  3HXV A;  2DL7 A;  1X54 A;  2KGT A;  1MMD A;  2JNG A;  3OYB A;  5ELO A;  2Q7H A;  1ZHI A;  4CH6 A;  2DVJ A;  4R55 A;  2PTK A;  3OW2 P;  2FYK A;  2LMJ A;  4LUD A;  3I7F A;  1TUD A;  3PMI A;  3VS6 A;  1USY C;  1BU1 A;  3CBM A;  1IRX A;  5KH6 A;  1M1K C;  2C7I A;  2F2X A;  2PZ1 A;  2AHJ B;  1BI2 A;  3WVE B;  3M5A A;  2DLP A;  2AKW B;  3QII A;  1W2B S;  2NWM A;  4N4H A;  3ZBD A;  1K4U S;  2WSF E;  2JS0 A;  3IKL A;  2QI2 A;  3A8H B;  3TVT A;  1KIK A;  4RTU A;  4J15 A;  4NOY A;  1O75 A;  4YRI A;  4RQF A;  2HQH A;  1GL5 A;  4YRP A;  1WQ7 A;  4FSX A;  2ECZ A;  1KK7 A;  2MPX C;  1GCQ C;  1VQL T;  2RH2 A;  2WSE E;  3RMS A;  1D3B A;  1QVP A;  1U06 A;  1VQ9 T;  3DSQ A;  1YI2 T;  2XD0 A;  2GNC A;  2BZX A;  3CCS A;  3UT1 A;  2LT4 A;  2RQV A;  4YTL A;  3CCQ Q;  4KRT A;  1WU7 A;  4XU1 A;  1SKU B;  1NJ1 A;  3ZL7 C;  2CIM A;  4IUR A;  4A63 B;  3A98 A;  3UGT A;  2BE9 B;  2V26 A;  4JDS A;  3VKI A;  4E51 A;  1WZO A;  5GMK i;  4KH1 B;  4XAX B;  2D9T A;  3JAM E;  4H2Y A;  3G6E T;  1TUC A;  1YIJ Q;  4N4G A;  4H2X B;  1Q82 R;  3H41 A;  3BY7 A;  3L1A A;  5FW9 A;  2FZK B;  1W6X A;  2ZIN A;  4QKU A;  3HRU A;  4M75 D;  4WJ4 A;  4C92 D;  3A8M B;  5D6X A;  1VQ6 Q;  5J26 A;  4PJJ A;  6AT1 B;  1UJ0 A;  2DL5 A;  5AT1 B;  4E7Z A;  2QYZ A;  1Q86 R;  1V1C A;  3HRI A;  4EMK A;  3VS2 A;  4K87 A;  1IL2 A;  2XU8 A;  1YJ9 T;  3RUX A;  1M8V A;  1ADY A;  4FU6 A;  4BUG A;  3DKM A;  4YRK A;  3CCR A;  4QT7 A;  2CH4 W;  4GLK A;  4JS4 A;  3S3O A;  1NNH A;  4DEY A;  3HRS A;  1ABQ A;  5IHI A;  4P75 A;  4HVV A;  1Y07 A;  1EFW A;  2MMP A;  1VQN T;  1AWO A;  2HKN A;  5K1X A;  4CH5 A;  3JRZ A;  1BI0 A;  4HCB A;  2MAM A;  1Q7Y U;  1M3C A;  2XDP A;  1SET A;  2ENM A;  4ZNX A;  3CC4 A;  2VYT A;  1EIY B;  3EGU A;  3OSV A;  2YDL A;  5GAN 3;  3HXU A;  4X9C A;  2VGM A;  5K1P A;  2VB6 A;  12AS A;  1JJC A;  2O4X B;  4TQD A;  2DFU A;  1M2V A;  1JU5 C;  3CMA Q;  4IKF A;  1RL2 A;  2LCS A;  2E65 A;  2HDA A;  4L5G A;  3S6W A;  4K88 A;  4WCI A;  3H0F A;  2BZ8 A;  4HT8 A;  1KC8 R;  4XU2 A;  1RAD B;  5KYX B;  2LX7 A;  3JB9 F;  5C51 B;  2EGC A;  5DLQ E;  3QYH B;  4WF2 A;  1RLQ C;  1H3H A;  2H8H A;  4M7D A;  2ZNJ A;  3OYG A;  1VQ5 A;  2EFI A;  4RTX A;  4O2D A;  2DDZ A;  1GBR A;  1FX7 A;  1W70 A;  2JTM A;  1BBU A;  1X6B A;  4J83 A;  4BAC A;  1YCY A;  1U1T A;  5I22 A;  1Q81 U;  1GRI A;  2LQN A;  2ZPH B;  1X6O A;  1XQH A;  1Y0M A;  2CSQ A;  3EG9 B;  3TQ7 P;  1YJW Q;  3A7R A;  4MML A;  4XU3 A;  4TVW A;  1YHQ Q;  4TVR A;  1I07 A;  4A4K A;  1YP5 A;  1YJN Q;  4D6W A;  2X4Y A;  4N0A C;  4BE0 A;  2K2V A;  3GPL A;  4Z88 A;  4E47 A;  4LD6 A;  1NBE B;  1Z7N A;  1VQP Q;  3VRY A;  1BB9 A;  5HK3 A;  2FL7 A;  3OMG A;  5GAO m;  1D1B A;  4IUT A;  2DER A;  4C92 G;  2JM9 A;  4E7K A;  1M30 A;  3TEH B;  3OYI A;  2Y4X A;  3H6Z A;  1WJR A;  2QQB A;  2RF0 A;  8ATC B;  1B3Q A;  2GTJ A;  2MIO A;  4KR2 A;  2C0O A;  3EH2 A;  2KQW A;  5KCO A;  2EGA A;  3G7Z A;  4OF1 A;  1NEG A;  3HKS A;  3A5Z A;  3QKJ A;  4XQ3 A;  4P71 A;  1JJ2 A;  1B7Y A;  2RQU A;  1VQK A;  1E24 A;  4IUQ A;  1VQL A;  1XOV A;  3CEY A;  1M1K U;  1K9M R;  2K7A A;  4N4I A;  3MKD A;  1J3T A;  1BBZ A;  1SG5 A;  4CH4 A;  3CCJ Q;  2KK4 A;  3I5R A;  4JJC A;  1KJW A;  4H2T A;  4YDQ A;  1KHC A;  1W1F A;  2X51 A;  1NYF A;  4P5N A;  4OB1 B;  3RKY A;  1HJD A;  1K0S A;  2ZAE A;  2RK2 A;  3SWN A;  1IGU A;  2RI2 A;  1KMM A;  3PTA A;  1B76 A;  1EIF A;  3CC2 A;  2Q7G A;  3GNF B;  1FWZ A;  1K0X A;  3I56 Q;  3FLG A;  3LW5 E;  3CBP A;  2L5Q A;  3KBG A;  1PG5 B;  3FIF A;  2EVR A;  2MK5 A;  2KRM A;  4L59 A;  2J6F A;  3P8V A;  2DMO A;  1K76 A;  1W66 A;  2F1L A;  2E12 A;  2DK3 A;  1X55 A;  1V29 B;  1ZLM A;  1VQ4 Q;  1AHJ B;  1P92 A;  2LNH B;  2KRN A;  2RD1 A;  3CCE A;  3L2U A;  3LX7 A;  3OBY A;  5KE2 A;  2DET A;  5GMK j;  3QYG B;  1Z9Z A;  1RI9 A;  4YP0 A;  2XKO C;  3MEA A;  4C0D C;  2COY A;  1H4Q A;  3HXW A;  3PCO A;  4IUP A;  1AZG B;  3H0H A;  1ASZ A;  4FYW B;  4E7L A;  4J9G A;  1QP3 A;  2DO3 A;  1X69 A;  1RUW A;  5CKD A;  3L42 A;  2QAZ A;  2CP5 A;  4RKU E;  5LJ5 d;  3CCU A;  4EMG A;  3TRE A;  5GAO l;  2LQ8 A;  1KQS A;  2A37 A;  4M7D D;  2A7Y A;  2JXB A;  4TQF A;  5C0M A;  1B34 A;  3LGF A;  2COW A;  1N5Z A;  1EVL A;  3QDF A;  2ZPB B;  4OP0 A;  2ZR2 A;  4KT0 E;  5CKE A;  2QTX A;  4OMQ A;  3LWI A;  4YRS A;  3L2W A;  2DTO A;  4J6Y A;  1PSE A;  2LRQ A;  2OJ2 A;  5GMK e;  4M77 F;  1WLP B;  4M75 C;  3PZC A;  1IRE B;  4C92 C;  2R58 A;  1OOT A;  4QW2 A;  1IGQ A;  2E5K A;  4JRI A;  3FB9 A;  3HPW A;  2ZPF B;  2YXY A;  4XK8 E;  3MJX A;  1YFR A;  2ZZD A;  1C6V X;  4HWP A;  2EL9 A;  2QQ9 A;  2ROT A;  2AZV A;  2XIC A;  2DQ0 A;  4DA4 A;  1NG2 A;  3M53 A;  1JRI A;  1SEM A;  1UGP B;  3CXC S;  3A74 A;  2DIG A;  4DBQ A;  3MET A;  1X2G A;  3OSS C;  2BTT A;  5I2S A;  1NYR A;  2NUT A;  1QE0 A;  1VQO Q;  4RTY A;  3I5S A;  2IY5 A;  3ER0 A;  4MMK A;  3IKM B;  5FLX E;  1PRL C;  4M77 E;  3BJU A;  2FPE A;  2JTE A;  2RHQ A;  1TXQ A;  5M9O A;  4P74 C;  2R57 A;  2PVO B;  3RF1 A;  4M75 F;  4LDV A;  4C92 F;  1X01 A;  1YN8 A;  3L2Q A;  1VQP T;  3CC7 T;  2CGH A;  3PMT A;  2DX1 A;  5KYW A;  5KCH A;  5C52 B;  3UA6 A;  5GAM j;  1M8M A;  2MWP A;  3BDL A;  2JUF A;  1BI1 A;  4M4Z A;  3JCM f;  3OS2 A;  2MOX A;  1WXT A;  2DRM A;  4OB3 B;  2KEA A;  2XMF A;  3OW2 S;  4F7U A;  1PC0 A;  1SPK A;  1VIE A;  2SEM A;  3GNG A;  5FU6 B;  2GCX A;  1T0H A;  1M9S A;  2CSI A;  1MV0 B;  3JB9 J;  3A32 A;  4OMN A;  3PIO A;  5KYU A;  1DJ7 B;  1XTD A;  3REB B;  2I4M A;  3CME Q;  3HRK A;  1AEY A;  3PT9 A;  3OYF A;  4RMF A;  2ZZG A;  2M16 A;  1GFD A;  2ALY A;  4OMF B;  3NET A;  4L6V 5;  4M75 E;  1VQM Q;  4C92 E;  1LNX A;  3TCJ A;  3CC2 Q;  1QKW A;  1K73 C;  1M5Q 1;  3FJP A;  2B8A A;  1VYV A;  3OYY A;  3R07 A;  4RCB A;  4Y92 A;  5DM7 R;  5KYY A;  2KSS A;  1OU8 A;  2I4L A;  2QQR A;  4M77 B;  2DTH A;  4Q15 A;  3VQV A;  2FG0 A;  2NUP A;  2E5Q A;  3NEN A;  5GAM e;  1WJS A;  3RER A;  3P8Y A;  3G4S A;  3G1J A;  4XTW A;  3CCE Q;  3QPH A;  2CZ6 B;  2EYX A;  4C0D B;  1MMG A;  5LJ3 g;  3HFN A;  3A8G B;  2K9G A;  4M78 A;  1VQ4 T;  3HL8 A;  1FXX A;  2PME A;  3BW1 A;  2RQW A;  3H0I A;  2ZPG B;  2HAX A;  1M3A A;  2K4Y A;  1I8F A;  4HT9 A;  2LJ3 A;  5HY6 A;  2ARS A;  1OX9 A;  2QQS A;  3GBQ A;  4C5I A;  4G84 A;  4HWT A;  2D0N A;  4O6J A;  3M55 A;  3DB3 A;  2ED1 A;  1Q82 C;  2HCK A;  1OV3 A;  2HL3 A;  2ZZF A;  2XGT A;  1NPP A;  2RPN A;  3THK A;  3X26 B;  2CKK A;  2K5I A;  2DZ9 A;  1PYS A;  1MNE A;  2F2W A;  2M51 A;  3M0S A;  2GQI A;  4H2W A;  3M57 A;  1I1J A;  2RI3 A;  5HK0 A;  4BD3 A;  4M75 B;  4YRG A;  4C92 B;  1E6G A;  3CCM T;  3MEW A;  1VOM A;  2KXC A;  1MUZ A;  2QGF B;  1PM3 A;  3CPW A;  3JB9 G;  1N6A A;  2DF6 A;  2H3J A;  1QW1 A;  3JCM g;  4JRQ A;  2KBT A;  1WHH A;  3M0U A;  3OYD A;  3CCV A;  4F16 A;  3I55 T;  4WI1 A;  1D0Y A;  4RUG A;  1W4S A;  3HY0 A;  2L8D A;  2ZPI B;  3PGG A;  4AMC A;  4YRT A;  1B70 B;  1TG0 A;  5AYF A;  1N27 A;  1ZSZ A;  4C8Q A;  3OYE A;  2DM1 A;  3CD6 T;  1KQ1 A;  4LVK A;  4JLG A;  1VQ8 Q;  2A3L A;  4OGE A;  3J80 E;  2J3L A;  4CS2 A;  5IHK A;  2EBP A;  3KFV A;  2XDB A;  1D1C A;  4M7D C;  4PG3 A;  2JTF A;  3NFC A;  2LQK A;  3G71 Q;  3M4G A;  4XU0 A;  1IHV A;  4VUB A;  4J9D A;  4MZM A;  1N8R C;  2E1H A;  2EQJ A;  3QWY A;  3X24 B;  2QEX Q;  1BK2 A;  2R5M A;  2GTO A;  2I2L A;  1PCX A;  2I0N A;  3EAE A;  4XTY A;  2QA4 Q;  3KUF A;  4LVJ A;  1H92 A;  2RA2 A;  3EG3 A;  3M0Q A;  1RAH B;  3O8V A;  1MND A;  3HXZ A;  4J9E A;  1K8A U;  4JJN K;  1M90 U;  1H4V B;  4M77 D;  1NJ5 A;  1WDX A;  2P4T A;  2EPD A;  4LNP A;  2QK0 A;  1J5W A;  2RJD A;  4E6R A;  2KMT A;  1SHF A;  3ICA A;  3ERR A;  2KDS A;  1CKB A;  1H3Z A;  3L2R A;  1SER A;  3TUP A;  1X2Q A;  2EWN A;  1VQ7 Q;  1W2B A;  2DA9 A;  3M56 A;  2W10 A;  4P71 C;  1D3B B;  2HNI A;  1V76 A;  3H8Z A;  4HVC A;  3BE3 A;  4M7D F;  4KBM B;  1PWT A;  3OS5 A;  1S72 T;  1G51 A;  3OMC A;  2X4J A;  4DOW A;  1Q95 G;  3OYN A;  4Z8A A;  3CCL Q;  4AT1 B;  1ABO A;  1X27 A;  3UA7 A;  2LDM A;  4C0G A;  1OU9 A;  3VQY A;  2OX7 A;  2Q5H A;  3IQL A;  3CME T;  3QTC A;  3G1Z A;  1Q7Y R;  2OTL Q;  3HFZ A;  2ESW A;  2MI6 A;  3H9N A;  1VQM T;  3VS0 A;  4DBH A;  4PJM A;  5GAN 8;  4MZT A;  1YIT Q;  4EMH A;  2HZY A;  2D1X A;  3A7A A;  4YRC A;  2X3X D;  4FL6 A;  3G4S Q;  1WJQ A;  1Y7X A;  5D7U A;  2IG0 A;  3OYM A;  4H2S A;  2JS2 A;  1GXI E;  4BWA A;  4M7D E;  1D1A A;  1YNZ A;  3VYH B;  1WNL A;  4FT4 A;  1K73 U;  2OTJ Q;  4II1 A;  3VBB A;  1WHG A;  4CH3 A;  2PNI A;  4PFP A;  4P72 A;  3VS5 A;  3LC0 A;  4EMK B;  4CC3 A;  2CP0 A;  2BKD N;  2E64 A;  3MP1 A;  4F14 A;  3KXT A;  3OYK A;  4J9I A;  2RHS B;  2ZT8 A;  3FJ5 A;  3PE0 A;  2RHI A;  2EQK A;  4J8O A;  2R5A A;  3ME9 A;  2BUD A;  1QVG A;  2YLB A;  4BE1 A;  1BKB A;  1NJI C;  4ZGJ B;  3E9F A;  4H02 A;  4MZP A;  1SHG A;  4HA8 A;  2VV5 A;  1M2O A;  4YCW A;  5GAN g;  1G5I A;  2M02 A;  4M77 G;  4J5Y A;  2M0O A;  3GIB A;  1MGQ A;  2DIQ A;  1YB3 A;  3M9Q A;  1G5V A;  4CC2 A;  4PJN A;  4B6M A;  4HCZ A;  2H3E B;  3ZFJ A;  3X28 B;  3EHQ A;  3INZ A;  4CRI A;  2XK0 A;  1Q82 U;  1JJC B;  2P0P A;  1M2V B;  3NMZ C;  4B9W A;  2EQM A;  3OBW A;  4YPF A;  5KYX A;  3I55 A;  3SEM A;  2PU9 B;  1YWP A;  1OI1 A;  5CVI A;  2DVE A;  1M1K R;  1A0N B;  4A53 A;  1KD1 C;  1UGV A;  2KE9 A;  3CD6 A;  4M7D B;  2A08 A;  1G5H A;  3MQZ A;  4E2F B;  4H2U A;  2CZ7 B;  1JO8 A;  2CZ0 B;  2ZNI A;  3EG9 A;  3FEO A;  2VWF A;  1NLP C;  1WHK A;  5CQY A;  4IIO A;  3IG2 A;  4JZ3 A;  1H64 1;  4B9X A;  1NEB A;  4M75 G;  2GFU A;  1YFS A;  2K79 A;  1CKA A;  1BI3 A;  3QHS A;  3NGP A;  4UP7 A;  1PD1 A;  2FO0 A;  1IB8 A;  5A0D A;  3L4G A;  3GF5 A;  2QAS A;  4F04 B;  2MWO A;  2QEX T;  2FB7 A;  3GOX A;  4PLI A;  2GQV A;  2AMC A;  5FWB A;  1K1Z A;  1EOV A;  1CSK A;  2VUB A;  1T0J A;  1H4T A;  3PFS A;  1GCQ A;  2JM8 A;  3OY9 A;  3W3S A;  2EKH A;  1QP2 A;  1TU0 B;  4HWO A;  5KYN A;  1WYD A;  2K3X A;  1ZX6 A;  1N8R U;  4OML A;  1VQ9 A;  1UGS B;  1XNI A;  3A5Z B;  1OZ3 A;  3L2Z A;  1YI2 A;  1QKX A;  3PVL A;  3CCS Q;  2HL5 C;  4ESR A;  5LJ5 j;  5FU6 C;  1B7Y B;  2YHT A;  2E5A A;  2K6D A;  2QHS A;  3QSU A;  3A31 A;  2V8K A;  3GP8 A;  1LJO A;  2GGR A;  1UJY A;  2K57 A;  3JCM X;  4BB7 A;  1E1O A;  1TWB A;  1S72 A;  4C5E A;  3M58 A;  5A2Q E;  1R77 A;  5GAN 7;  2C06 A;  1QVF A;  1QCO A;  3CCQ T;  3OYA A;  2I4N A;  3UDC A;  3SWN B;  4P73 A;  2ABL A;  4QQ6 A;  2RHU A;  1Y96 A;  4JRP A;  3HXY A;  3CQT A;  3MEY A;  5D6W A;  4GBQ A;  3ASK A;  3CCL T;  2FPF A;  1MV3 A;  3G6E A;  3HP9 A;  4Z89 A;  4YRF A;  3NHN A;  3QNE A;  3MO8 A;  4M77 C;  5LJ3 h;  2P0Q A;  3RBB B;  2DD4 A;  1E22 A;  1LVK A;  1KMN A;  3EG2 A;  4IUU A;  1YIJ T;  2RO0 A;  2FRW A;  1K9A A;  1QWF A;  2ZZE A;  3UH0 A;  3WVD B;  2YLC A;  5LJ5 e;  1B07 A;  5CCA A;  2E6Z A;  4RCC A;  1VQ6 T;  2RJE A;  4M7A A;  3RGL A;  1YJ9 A;  1G8X A;  3CCR Q;  4IIM A;  4YRM A;  1ZQ1 A;  1S1N A;  2CP3 A;  3NTI A;  2DU7 A;  4XTZ A;  3HRT A;  5DLO A;  2RM4 A;  5CO7 A;  4AFU C;  3TEG A;  2V1R A;  1ATI A;  1B7T A;  1OQK A;  3WQZ A;  4F7U F;  2RQT A;  2EAY A;  1WGS A;  1VQN A;  2CP6 A;  4ANJ A;  3EGD A;  1LOJ A;  4A54 A;  1D0X A;  4AFZ C;  3CC4 Q;  1YGB A;  3RL6 A;  4PJL A;  4IUV A;  2KYM A;  1LYL A;  3LSS A;  2PVD B;  4RTT A;  2EQI A;  3R6O A;  1BCM A;  2JMC A;  2CUD A;  5CK9 A;  1B34 B;  4P3N A;  2D6F A;  3REX A;  1U8R A;  1QCN A;  3ULR B;  2DXB A;  3D7S B;  3S3M A;  5FRN A;  3JCM h;  3VYG A;  2K5L A;  4ORZ A;  1WXB A;  3OYC A;  3MF1 A;  3E1S A;  3JCM c;  2HQX A;  2L3P A;  5FRO A; 
#chains in the Genus database with same CATH homology
 2A8E A;  2VXE A;  2NS6 A;  4XEO A;  4O5V A;  1G3T A;  1HC7 A;  2XDD A;  3CMA T;  2E10 A;  4YCV A;  4UC4 A;  3SDZ A;  4LVI A;  5LJ3 f;  1NJI U;  2LCC A;  2I4O A;  1G3S A;  4M78 F;  5F5W A;  1UB4 A;  3JCM Q;  3UPU A;  2ZTG A;  3FRN A;  3A8O B;  1ASY A;  5GAO p;  4QVZ A;  3NTH A;  3JCM d;  1N9R A;  4N0A A;  3LLR A;  1YJW T;  2RHZ A;  3C12 A;  3E9I A;  3X25 B;  1YHQ T;  2IY5 B;  4FT2 A;  1YJN T;  3HY1 A;  4X9D A;  5CIU A;  5KE3 A;  4V2S A;  3CXC A;  4L87 A;  2RHQ B;  1KD1 U;  3S3N A;  2VC8 A;  4PJO A;  4RG8 A;  1YBY A;  5GAN 5;  2YRV A;  3C95 A;  5J39 A;  2X35 A;  3CBO A;  4ZN1 A;  4M7D G;  4JS5 A;  2O01 E;  2ZT6 A;  3UFG A;  2DXU A;  2ZXF A;  3QJ6 A;  4F7U B;  1BIB A;  4A4F A;  3CCS T;  4C8Q F;  3CCJ T;  4LVM A;  5GMK m;  4M7A D;  4ZIB A;  4NL2 A;  2QHV A;  1PSF A;  3CCQ A;  4CI0 C;  3LYI A;  2OAU A;  2DJZ A;  4OLF A;  2ALY B;  1SRY A;  4ZTF A;  3J7A F;  1HXD A;  2QQA A;  3LH0 A;  2RB6 A;  3OW2 A;  1I5L A;  3I56 T;  5CR2 A;  5GAM h;  1NYQ A;  4TVY A;  3M59 A;  1L0W A;  4YRR A;  1BIA A;  2XID A;  4RQE A;  3ZEH A;  4QVD A;  2C8M A;  3QJY A;  3MEU A;  5HGQ A;  4JUV A;  1YIJ A;  2DQ3 A;  2K5F A;  3RKX A;  3VQX A;  4C8Q E;  4ATO A;  1VQ6 A;  4PL6 A;  4M78 B;  2P0L A;  3OB9 A;  3SD4 A;  4EMK C;  4ZTJ A;  4TVA A;  4YYE A;  4BI3 A;  3CCR T;  3URG A;  4CS3 A;  2DTI A;  3RAC A;  4NS5 A;  2WAC A;  5EG2 A;  4NCX A;  4ZN3 A;  1YFT A;  5GAN h;  4P75 C;  4QVC A;  4MDX A;  2DAQ A;  2DEQ A;  1Q86 C;  4Y91 A;  5CKF A;  2IVW A;  3CC4 T;  4C92 A;  3SB2 A;  1KOG A;  2DZC A;  5GAN 2;  2M1H A;  2WSC E;  2Y4Y A;  2RHY A;  2E6N A;  2QDY B;  5GAM f;  2J3M A;  5GAN 6;  4C0F A;  4ELY C;  3HSB A;  4C5H A;  5GMK l;  1G3W A;  4HWS A;  3FC3 A;  1OYX A;  4M7A G;  3NEM A;  3OD1 A;  5E3I A;  1KHI A;  3QUI A;  4PJO D;  2G3R A;  3QXE B;  1RIQ A;  4LD9 K;  4YRO A;  3JB9 I;  4E7I A;  4BY6 C;  4C8Q B;  2Q5I A;  3P8T A;  2KVQ G;  5A0L A;  3UGQ A;  3RIR A;  3QZ5 B;  5LL6 S;  1KC8 C;  1VQO T;  2ZIO A;  2HD0 A;  5ELN A;  1YJW A;  3V7R A;  4P74 A;  2AKW A;  2EJF A;  4H2V A;  3PNW C;  1YHQ A;  2JVV A;  2CJ9 A;  2XTI A;  2X4X A;  1YJN A;  5GAN f;  2QHU A;  3T9N A;  2LC4 A;  2DKG A;  1VQP A;  4DOV A;  3CC7 A;  2V8I A;  3OA6 A;  2X4W A;  3DLL A;  1VQZ A;  4TTV A;  3MHX A;  2NLU A;  4TWA A;  4BDZ A;  2VGN A;  1NZ9 A;  1NPR A;  2RI5 A;  4A4G A;  2P0K A;  3BFM A;  1UGR B;  2JZ2 A;  1VQK T;  1C0A A;  1O9S A;  4M78 D;  4E7H A;  2K3Y A;  3EFS A;  4J7F A;  2EJG A;  1ZBX A;  2PUO B;  4ZTZ B;  3CCJ A;  3DLM A;  3HFV A;  4HT4 A;  2ART A;  4ZTU B;  4J6X A;  1HTT A;  3SWN C;  2LTO A;  4OGC A;  3CC2 T;  1NJ8 A;  1K9M C;  1VUB A;  4H2X A;  3I56 A;  5GAM g;  4DPG A;  4P73 C;  3HFZ B;  1N9W A;  5IT9 E;  5HKC A;  3TU4 K;  3RKW A;  2D0Q B;  1VQ4 A;  4PJO G;  3CCE T;  1FYF A;  1WPY A;  4RMO A;  2P5I A;  1QVG S;  2LT1 A;  5FRM A;  4P3P A;  4F7U G;  4RDX A;  4Q5W A;  1QF6 A;  1E1T A;  4OB0 B;  4M7A C;  3QG1 A;  2EIF A;  2RHS A;  2HBP A;  3CCU T;  4C8Q D;  2DU5 A;  2JN0 A;  3CMQ A;  2RK1 A;  1UEB A;  4PHC A;  3UWN A;  3VU3 C;  2PQW A;  1EIY A;  2RJF A;  1VIF A;  1M1F A;  2EQU A;  3CCM A;  2O4X A;  3E9H A;  2ZPE B;  2CZ1 B;  3M4Y A;  3AHU A;  3V8K A;  4GY5 A;  4MDW A;  3QO7 A;  4C0Z A;  5GAO n;  4PLL A;  2ODR D;  3HTZ A;  3GLX A;  5GAO r;  4M78 G;  5IAY A;  5FU7 B;  4A4H A;  4X34 A;  1Q86 U;  3KFU A;  2FVU A;  2QHT A;  4QQG A;  4BY6 B;  4M7A F;  3LGL A;  2DPP B;  1N9S A;  4NL3 A;  5I21 A;  4JRK A;  3A8L B;  2ZCE A;  2ZGW A;  1BBW A;  1USY A;  1JBM A;  3V7S A;  1VQ8 T;  11AS A;  4EDU A;  3JB9 H;  4YRL A;  4ZGD B;  3G71 T;  1VQO A;  4XTX A;  1X2H A;  4HCC A;  2QXF A;  1JJ2 S;  2F69 A;  2KAF A;  3TEH A;  2BIV A;  4KUI A;  4PNO A;  4Z02 A;  2QA4 T;  1RI0 A;  2LX9 A;  3L4G B;  4LDX A;  3J81 E;  4YRE A;  4EX5 A;  4M7A E;  2AMC B;  1IZ6 A;  1KC8 U;  3RMQ A;  4UP8 A;  1QVF S;  1EVK A;  4PJO C;  3LWH A;  4DQ2 A;  4XTU A;  3QO5 A;  4C8Q G;  3VUZ A;  1GGM A;  1X75 C;  2CS7 A;  1VQ7 T;  3SFM A;  5LJ3 j;  3HFO A;  1NJ6 A;  3P8D A;  4KUL A;  3CME A;  4R56 A;  2V8J A;  3WXM B;  3P8H A;  3TEE A;  1VQM A;  1I4K 1;  5CKB A;  3REU A;  3QBY A;  1Y96 B;  2OTL T;  4YRJ A;  2HQE A;  3VV0 A;  3NEL A;  4KR3 A;  3EFR A;  5LJ5 h;  4LDW A;  4BDY A;  1YIT T;  3FDR A;  4ELZ C;  3G4S T;  1HK9 A;  1KQS S;  4PJO F;  4KQE A;  3V8L A;  5GAN 4;  3PCO B;  5LJ3 e;  3V7C A;  2OTJ T;  4M78 C;  3JCM P;  2ZIM A;  4M7A B;  1K9M U;  2E41 A;  4A4E A;  2CJA A;  3QDR B;  3PIP A;  5KNN A;  4E7J A;  3MEV A;  2MF2 A;  3NTK A;  4OVA A;  3VJP A;  3QO8 A;  5LJ3 d;  2PVG B;  3E9G A;  2KY9 A;  5GMK h;  3OYL A;  1U1S A;  3JCM J;  3MP8 A;  3CPF A;  4X5O A;  3VQW A;  4YRQ A;  4G85 A;  2DXC A;  4PJO E;  4BW9 A;  2LCL A;  1X56 A;  4XEM A;  2Y90 A;  1H4S A;  5IN1 A;  2DXT A;  3F70 A;  4F7U E;  4LNS A;  2XI9 A;  4YRN A;  3CCV T;  5LJ5 f;  3JCM e;  4ME7 A;  1SSF A;  1TH7 A;  4KUD K;  5CQX A;  5C53 B;  1B8A A;  3M4Q A;  1JB0 E;  2PMF A;  3A5Y A;  5I2M A;  3OS0 A;  4LDY A;  4C8Q C;  4Y28 E;  5CAI A;  2JOY A;  1WQW A;  2EKO A;  1G3Y A;  1K8A C;  1M90 C;  1VQ8 A;  4LVL A;  3MCA B;  2RJC A;  3RES A;  3M54 A;  2E3C A;  1UGQ B;  3JSC A;  3G71 A;  2RHX A;  5DY9 A;  3HHT B;  4EO4 A;  3OYH A;  4JLI A;  2QEX A;  4UP9 A;  2GFA A;  4XTV A;  2GF7 A;  3IAL A;  1M1G A;  4AH6 A;  4M78 E;  2QA4 A;  4QQD A;  4EPC A;  2ODR C;  1SES A;  2ZT5 A;  4FM4 B;  1KQ2 A;  3C94 A;  1NE8 A;  4PJO B;  3LSQ A;  3JCM W;  4CS4 A;  3Q1J A;  2CYZ B;  1WLE A;  3HXX A;  3JB9 D;  1NJ2 A;  4LDU A;  3JCM b;  1ADJ A;  5L8R E;  2FHD A;  1VQ7 A;  1M4Z A;  4C5G A;  4BI8 B;  2LNV A;  3X20 B;  4J7I A;  2ZCF B;  3MP6 A;  4UPA A;  4PKC C;  3CCL A;  3V8J A;  2F5T X;  1I81 A;  3M4P A;  4M77 A;  5J3B A;  3OS1 A;  2L89 A;  2OTL A;  1Y71 A;  3QZ9 B;  2ZR3 A;  2VXF A;  2LVM A;  3JCM V;  2ARU A;  5LJ5 g;  5C6S A;  2F5K A;  1YIT A;  4BE2 A;  5GAN j;  4HKE A;  2Q7E A;  4RG2 A;  1Q7Y C;  3A7U A;  3L2V A;  4WJ3 M;  1OZ2 A;  3BDU A;  5GAM d;  2OTJ A;  2M9U A;  1MHN A;  5A0G A;  4P3O A;  3MF2 A;  4P72 C;  4K86 A;  4TVA B;  2EJ9 A;  3CPW S;  3VUB A;  2XG8 D;  3DB4 A;  2ZT7 A;  4HWR A;  3E19 A;  5GAO q;  1PYS B;  1BYM A;  4M75 A;  1R8O B;  2EYQ A;  5CKH A;  4BI4 A;  5GAN e;  2G4C A;  4Q6G A;  4FIB A;  3P8B B;  1Q81 C;  3N5B B;  4OB2 B;  3CMA A;  4ZGE B;  1Z7M A;  4YCU A;  3OYJ A;  5GAN d;  2PUK B;  2CJB A;  1B70 A;  1EQR A;  5FU7 C;  1KG1 A;  2L3R A;  5D6Y A;  1VQ5 T;  3QO3 A;  3OQ5 A;  2DD5 A;  2E70 A;  4J6W A;  2XHC A;  3C4S A;  3HXV A;  1X54 A;  2JNG A;  3OYB A;  5ELO A;  2Q7H A;  1ZHI A;  4CH6 A;  4R55 A;  2FYK A;  3I7F A;  3PMI A;  1USY C;  3CBM A;  5KH6 A;  1M1K C;  2C7I A;  2AHJ B;  1BI2 A;  3WVE B;  3M5A A;  2AKW B;  3QII A;  1W2B S;  4N4H A;  3ZBD A;  2WSF E;  3IKL A;  2QI2 A;  3A8H B;  4J15 A;  4NOY A;  1O75 A;  4YRI A;  4RQF A;  4YRP A;  1WQ7 A;  4FSX A;  1VQL T;  2RH2 A;  2WSE E;  3RMS A;  1D3B A;  1QVP A;  1VQ9 T;  3DSQ A;  1YI2 T;  2XD0 A;  3CCS A;  3UT1 A;  2LT4 A;  4YTL A;  1WU7 A;  4XU1 A;  1NJ1 A;  2CIM A;  4IUR A;  3UGT A;  4JDS A;  3VKI A;  4E51 A;  5GMK i;  4XAX B;  2D9T A;  3JAM E;  4H2Y A;  3G6E T;  4N4G A;  4H2X B;  3BY7 A;  3L1A A;  2ZIN A;  3HRU A;  4M75 D;  4WJ4 A;  4C92 D;  3A8M B;  5D6X A;  5J26 A;  3HRI A;  4EMK A;  4K87 A;  1IL2 A;  2XU8 A;  1YJ9 T;  3RUX A;  1M8V A;  1ADY A;  4FU6 A;  4BUG A;  3DKM A;  4YRK A;  3CCR A;  4JS4 A;  4GLK A;  3S3O A;  1NNH A;  3HRS A;  4P75 A;  1Y07 A;  1EFW A;  2MMP A;  1VQN T;  5K1X A;  4CH5 A;  3JRZ A;  1BI0 A;  4HCB A;  2MAM A;  1Q7Y U;  2XDP A;  1SET A;  3CC4 A;  2VYT A;  1EIY B;  3OSV A;  5GAN 3;  3HXU A;  4X9C A;  2VGM A;  5K1P A;  12AS A;  1JJC A;  2O4X B;  4TQD A;  4IKF A;  1RL2 A;  2E65 A;  4L5G A;  3S6W A;  4K88 A;  4HT8 A;  4XU2 A;  3JB9 F;  5C51 B;  5DLQ E;  3QYH B;  4WF2 A;  4M7D A;  2ZNJ A;  3OYG A;  1VQ5 A;  2EFI A;  4O2D A;  2DDZ A;  1FX7 A;  2JTM A;  1BBU A;  4J83 A;  4BAC A;  1YCY A;  1U1T A;  1Q81 U;  2ZPH B;  1X6O A;  1XQH A;  3A7R A;  4MML A;  4XU3 A;  4TVW A;  4TVR A;  4A4K A;  4D6W A;  2X4Y A;  4N0A C;  4BE0 A;  2K2V A;  3GPL A;  4E47 A;  4LD6 A;  1Z7N A;  5HK3 A;  2FL7 A;  3OMG A;  5GAO m;  4IUT A;  4C92 G;  4E7K A;  3TEH B;  3OYI A;  2Y4X A;  3H6Z A;  1WJR A;  2QQB A;  4KR2 A;  2KQW A;  5KCO A;  4OF1 A;  3G7Z A;  3HKS A;  3A5Z A;  3QKJ A;  4XQ3 A;  4P71 A;  1JJ2 A;  1B7Y A;  1VQK A;  1E24 A;  4IUQ A;  1VQL A;  1XOV A;  3CEY A;  1M1K U;  4N4I A;  4CH4 A;  2KK4 A;  4H2T A;  4YDQ A;  1KHC A;  4P5N A;  4OB1 B;  3RKY A;  3SWN A;  2RK2 A;  2RI2 A;  1KMM A;  3PTA A;  1B76 A;  1EIF A;  3CC2 A;  2Q7G A;  3GNF B;  1FWZ A;  3FLG A;  3LW5 E;  3CBP A;  2L5Q A;  3KBG A;  3FIF A;  4L59 A;  3P8V A;  1W66 A;  2E12 A;  2DK3 A;  1X55 A;  1V29 B;  1AHJ B;  1P92 A;  2RD1 A;  3CCE A;  3L2U A;  3LX7 A;  3OBY A;  5KE2 A;  5GMK j;  3QYG B;  4YP0 A;  2XKO C;  3MEA A;  4C0D C;  1H4Q A;  3HXW A;  3PCO A;  4IUP A;  1ASZ A;  4E7L A;  1QP3 A;  2DO3 A;  5CKD A;  3L42 A;  4RKU E;  5LJ5 d;  3CCU A;  4EMG A;  3TRE A;  5GAO l;  2LQ8 A;  1KQS A;  4M7D D;  2A7Y A;  4TQF A;  5C0M A;  1B34 A;  3LGF A;  1EVL A;  2ZPB B;  4OP0 A;  2ZR2 A;  4KT0 E;  5CKE A;  2QTX A;  3LWI A;  4YRS A;  3L2W A;  2DTO A;  4J6Y A;  1PSE A;  2LRQ A;  5GMK e;  4M77 F;  4M75 C;  3PZC A;  1IRE B;  4C92 C;  2R58 A;  4QW2 A;  4JRI A;  3FB9 A;  3HPW A;  2ZPF B;  4XK8 E;  1YFR A;  2ZZD A;  4HWP A;  2EL9 A;  2QQ9 A;  2DQ0 A;  2XIC A;  4DA4 A;  3M53 A;  1JRI A;  1UGP B;  3CXC S;  3A74 A;  2DIG A;  3MET A;  1X2G A;  3OSS C;  5I2S A;  1NYR A;  1QE0 A;  2IY5 A;  3ER0 A;  4MMK A;  3IKM B;  5FLX E;  4M77 E;  3BJU A;  2RHQ A;  5M9O A;  4P74 C;  2R57 A;  2PVO B;  3RF1 A;  4M75 F;  4LDV A;  4C92 F;  1X01 A;  3L2Q A;  1VQP T;  3CC7 T;  2CGH A;  3PMT A;  5KCH A;  5C52 B;  5GAM j;  2MWP A;  3BDL A;  2JUF A;  1BI1 A;  3JCM f;  3OS2 A;  4OB3 B;  3OW2 S;  4F7U A;  5FU6 B;  1VIE A;  3GNG A;  2GCX A;  1M9S A;  3JB9 J;  3A32 A;  3PIO A;  1DJ7 B;  1XTD A;  2I4M A;  3HRK A;  3PT9 A;  3OYF A;  4RMF A;  2ZZG A;  2M16 A;  2ALY A;  4OMF B;  3NET A;  4L6V 5;  4M75 E;  4C92 E;  1LNX A;  3TCJ A;  1K73 C;  1M5Q 1;  3FJP A;  2B8A A;  3OYY A;  3R07 A;  4RCB A;  5DM7 R;  2KSS A;  2I4L A;  2QQR A;  4M77 B;  2DTH A;  4Q15 A;  3VQV A;  2E5Q A;  3NEN A;  5GAM e;  1WJS A;  3RER A;  3P8Y A;  3G4S A;  4XTW A;  3QPH A;  2CZ6 B;  4C0D B;  5LJ3 g;  3HFN A;  3A8G B;  4M78 A;  1VQ4 T;  3HL8 A;  1FXX A;  2PME A;  3BW1 A;  2ZPG B;  2HAX A;  2K4Y A;  1I8F A;  4HT9 A;  5HY6 A;  2ARS A;  2QQS A;  4C5I A;  4G84 A;  4HWT A;  4O6J A;  3M55 A;  3DB3 A;  1Q82 C;  2ZZF A;  2XGT A;  1NPP A;  3X26 B;  2CKK A;  2K5I A;  2DZ9 A;  1PYS A;  4H2W A;  3M57 A;  2RI3 A;  5HK0 A;  4BD3 A;  4M75 B;  4YRG A;  4C92 B;  3CCM T;  3MEW A;  3CPW A;  3JB9 G;  1N6A A;  2H3J A;  1QW1 A;  3JCM g;  4JRQ A;  3OYD A;  3CCV A;  3I55 T;  4WI1 A;  3HY0 A;  1W4S A;  2L8D A;  2ZPI B;  3PGG A;  4YRT A;  1B70 B;  5AYF A;  1N27 A;  4C8Q A;  3OYE A;  3CD6 T;  1KQ1 A;  4LVK A;  4JLG A;  2A3L A;  4OGE A;  3J80 E;  2J3L A;  4CS2 A;  2XDB A;  4M7D C;  4PG3 A;  2JTF A;  3NFC A;  2LQK A;  3M4G A;  4XU0 A;  4VUB A;  4MZM A;  1N8R C;  2E1H A;  2EQJ A;  3X24 B;  2R5M A;  2I2L A;  3EAE A;  4XTY A;  3KUF A;  4LVJ A;  2RA2 A;  3O8V A;  3HXZ A;  1H4V B;  1K8A U;  4JJN K;  1M90 U;  4M77 D;  1NJ5 A;  2P4T A;  1J5W A;  2RJD A;  2KMT A;  3ICA A;  3ERR A;  2KDS A;  1H3Z A;  3L2R A;  1SER A;  3TUP A;  2EWN A;  1W2B A;  3M56 A;  4P71 C;  1D3B B;  2HNI A;  3H8Z A;  4HVC A;  4M7D F;  4KBM B;  3OS5 A;  1S72 T;  1G51 A;  3OMC A;  2X4J A;  4DOW A;  3OYN A;  2LDM A;  4C0G A;  3VQY A;  2Q5H A;  3CME T;  3QTC A;  3G1Z A;  3HFZ A;  2MI6 A;  1VQM T;  5GAN 8;  4MZT A;  4EMH A;  3A7A A;  4YRC A;  4FL6 A;  1WJQ A;  1Y7X A;  2IG0 A;  3OYM A;  4H2S A;  1GXI E;  4BWA A;  4M7D E;  3VYH B;  1WNL A;  4FT4 A;  1K73 U;  4II1 A;  3VBB A;  4CH3 A;  4P72 A;  3LC0 A;  4EMK B;  2BKD N;  2E64 A;  3MP1 A;  3KXT A;  3OYK A;  2RHS B;  2ZT8 A;  2RHI A;  2EQK A;  4J8O A;  2R5A A;  3ME9 A;  2BUD A;  1QVG A;  2YLB A;  4BE1 A;  1BKB A;  1NJI C;  4ZGJ B;  3E9F A;  4H02 A;  4MZP A;  4HA8 A;  2VV5 A;  4YCW A;  5GAN g;  1G5I A;  4M77 G;  4J5Y A;  2M0O A;  3GIB A;  1MGQ A;  2DIQ A;  1YB3 A;  3M9Q A;  1G5V A;  4HCZ A;  3ZFJ A;  3X28 B;  3INZ A;  4CRI A;  2XK0 A;  1Q82 U;  1JJC B;  2P0P A;  4B9W A;  2EQM A;  3OBW A;  4YPF A;  3I55 A;  2PU9 B;  1OI1 A;  5CVI A;  2DVE A;  4A53 A;  1KD1 C;  3CD6 A;  4M7D B;  1G5H A;  3MQZ A;  4H2U A;  2CZ7 B;  2CZ0 B;  2ZNI A;  3FEO A;  5CQY A;  3IG2 A;  1H64 1;  4B9X A;  4M75 G;  2GFU A;  1YFS A;  4UP7 A;  1BI3 A;  3QHS A;  5A0D A;  3L4G A;  3GF5 A;  2MWO A;  2QEX T;  2FB7 A;  3GOX A;  4PLI A;  2GQV A;  2AMC A;  1EOV A;  2VUB A;  1H4T A;  3PFS A;  3OY9 A;  3W3S A;  1QP2 A;  4HWO A;  1WYD A;  2K3X A;  1N8R U;  1VQ9 A;  1UGS B;  1XNI A;  3A5Z B;  1OZ3 A;  3L2Z A;  1YI2 A;  5LJ5 j;  5FU6 C;  1B7Y B;  2YHT A;  2E5A A;  2QHS A;  3QSU A;  3A31 A;  2V8K A;  3GP8 A;  1LJO A;  2K57 A;  3JCM X;  4BB7 A;  1E1O A;  1S72 A;  4C5E A;  3M58 A;  5A2Q E;  2C06 A;  5GAN 7;  1QVF A;  3CCQ T;  3OYA A;  2I4N A;  3UDC A;  3SWN B;  4P73 A;  4QQ6 A;  2RHU A;  1Y96 A;  4JRP A;  3HXY A;  3MEY A;  5D6W A;  3ASK A;  3CCL T;  3G6E A;  3HP9 A;  4YRF A;  3QNE A;  3MO8 A;  4M77 C;  5LJ3 h;  2P0Q A;  2DD4 A;  1E22 A;  1KMN A;  4IUU A;  1YIJ T;  2RO0 A;  2ZZE A;  3UH0 A;  3WVD B;  2YLC A;  5LJ5 e;  5CCA A;  2E6Z A;  4RCC A;  1VQ6 T;  2RJE A;  4M7A A;  3RGL A;  1YJ9 A;  4YRM A;  1ZQ1 A;  3NTI A;  2DU7 A;  4XTZ A;  3HRT A;  5DLO A;  2RM4 A;  5CO7 A;  3TEG A;  1ATI A;  3WQZ A;  4F7U F;  2EAY A;  1WGS A;  1VQN A;  1LOJ A;  4A54 A;  1YGB A;  3RL6 A;  4IUV A;  1LYL A;  3LSS A;  2PVD B;  3R6O A;  5CK9 A;  1B34 B;  4P3N A;  2D6F A;  3REX A;  1U8R A;  2DXB A;  3S3M A;  5FRN A;  3JCM h;  3VYG A;  2K5L A;  3OYC A;  3MF1 A;  3E1S A;  3JCM c;  2HQX A;  5FRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...