2DTHA

The crystal structure of the orthorhombic form of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotin and adp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dthA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dthA01
4M7DB 2I4OA 3HXVA 2DKGA 4O2DA 3UFGA 4H2XA 4A53A 4P72C 3RACA 5K1XA 4HWOA 1YFRA 5GAOq 3MF1A 4F7UB 4X9DA 5GMKi 1WYDA 3BFMA 4RCBA 4PJOA 4C92C 1EIYA 1NNHA 2DXUA 4QVCA 4TVYA 4HWSA 4M7AB 1X2HA 2E5AA 3MF2A 4YDQA 5LJ3f 5GANd 3L4GA 5GAMh 3WQZA 3BDUA 5I21A 3E9HA 2DTIA 1LNXA 3V7SA 4WF2A 3HFZA 4YRPA 3PZCA 1U1TA 4H2XB 1H4QA 4TTVA 3JB9F 1BBUA 1B7YA 3ERRA 3HXYA 4WJ4A 3HFOA 4MMKA 3V7CA 1KOGA 5GAMe 2EJGA 2DJZA 1LOJA 4V2SA 5KNNA 3SWNA 3NENA 1B8AA 5GAOr 3NEMA 4M7DG 1EFWA 1NJ2A 5GAN5 2J3MA 2ZXFA 3HFZB 3TUPA 4M75F 4F7UG 5ELNA 3M4GA 1ASZA 1B7YB 4YRIA 1MGQA 5GAN8 4M7AG 5GAN3 1QF6A 4M77C 2QHTA 4YRSA 1X01A 5DY9A 3SWNB 1Y96A 1L0WA 4EMGA 2CJAA 3RIRA 3UGQA 2ZNIA 3VU3C 5C53B 4M75E 3FIFA 2EJFA 4CS2A 4PG3A 5LJ3j 2YLBA 4XTYA 4H2VA 4ZIBA 3FJPA 4DPGA 2AMCA 4EMKC 1NYQA 2QHVA 4PJOF 1TH7A 3W3SA 4M78D 1IL2A 4YRQA 4M7AE 4P75A 2FB7A 5LJ5h 5LJ5d 4YPFA 2C7IA 1WPYA 2E41A 3HXXA 3P8TA 1Z7MA 4CH6A 4BWAA 4CS4A 5GAOm 2DU5A 3RKXA 1NJ6A 4H2TA 4H2YA 1G5HA 3HFNA 4HT9A 2AMCB 3A7RA 4PJOE 1WQWA 2ZZFA 4JLIA 3V7RA 3RGLA 2XTIA 1EOVA 4M78G 1N9WA 1JJCA 2Q5IA 2FYKA 3HTZA 3INZA 4M75A 5GMKh 3DSQA 3HXZA 2E1HA 3IKLA 4HWTA 4UP9A 1YFSA 4EO4A 4YCUA 2CJBA 2DZCA 5GANj 4H02A 3JCMd 3BY7A 3BW1A 1ASYA 2DTOA 4P71C 4UP8A 4AH6A 4C8QA 3V8LA 4TQFA 3I7FA 4TVWA 3HRKA 3OD1A 4P72A 1JJCB 5GMKe 1SETA 4TQDA 5GANg 5GAMg 2ODRD 4C92A 1B34A 4M75B 2G4CA 1C0AA 2EAYA 5GAOl 3UH0A 2DQ0A 3PGGA 3RUXA 4HT8A 1W66A 1E24A 3VQXA 4CH5A 3PCOA 1I8FA 4NL2A 4C8QB 2DTHA 3IALA 1SRYA 1U1SA 3REXA 1X55A 2RHSA 3QHSA 3JCMb 4M7DD 2QHUA 4C92B 1B34B 1NJ8A 3JB9G 5GAMd 3A74A 4K86A 4P73C 4G84A 2P0LA 1JBMA 4YRCA 4M7AD 1G51A 1WU7A 3PCOB 2P5IA 1HXDA 4J15A 4PJOB 1EIYB 2Q7HA 1YGBA 3P8YA 2ZT6A 1N9SA 2ZT5A 4M75G 4P3NA 2E65A 1J5WA 1QE0A 3L4GB 4M77A 1NJ1A 1NYRA 4J5YA 4XU3A 3HY0A 4YRRA 4C8QG 1H4TA 5LJ5j 4JRIA 3UGTA 1E1TA 1KQ1A 2E10A 4C92G 4C8QF 3JCMQ 2VXEA 4M77B 5LJ5g 2DXTA 3ICAA 4EMKA 4LNSA 3HXUA 4XTVA 4EMHA 1LYLA 4C92F 2RHQA 2ZIMA 5GANf 5GAMf 4XTWA 4KR2A 3RKYA 4PJOG 1M5Q1 3VQVA 4ZTUB 2ZNJA 2QHSA 1LJOA 2QTXA 3SWNC 4XEMA 4C8QE 3JCMW 4Y91A 1NJ5A 2Y90A 3A7UA 1Y96B 3VBBA 4G85A 2CJ9A 1X2GA 4M78C 4EMKB 1YCYA 3EFRA 4JUVA 4C92E 2RHQB 4MMLA 4OP0A 5HGQA 4TVAA 5GAOp 4OLFA 2ZR3A 3REUA 3JCMg 2PMFA 2IY5A 3V8JA 1KMMA 3MEYA 3QNEA 4YCWA 1KMNA 3L2ZA 4CH4A 2EL9A 4A54A 3FB9A 2DVEA 3HRIA 4P71A 4M77F 3LSQA 1ADJA 4XU1A 4TVAB 2ZT7A 3CMQA 4YRJA 2YLCA 2Q7GA 1M8VA 1I5LA 3M4PA 2RA2A 1PYSA 5GAMj 3NETA 3E9IA 2ZIOA 4X5OA 3RKWA 4N0AC 4H2WA 2E3CA 4KQEA 2HNIA 5LJ3h 3JB9D 3BJUA 3RESA 3HY1A 4M77E 4H2UA 1X56A 5C51B 3AHUA 3HSBA 1USYC 5GMKm 3A7AA 4XQ3A 4HA8A 3QO8A 1BIAA 5LJ5f 3QO7A 4PHCA 1KQ2A 4RMFA 2CGHA 4RDXA 2ODRC 2Q5HA 3A32A 1HC7A 5LJ3e 1I81A 4Q6GA 2ZTGA 4P73A 4M75D 4E51A 2DEQA 4J6WA 3A5ZA 4K88A 3IKMB 4M75C 4P74C 4JRKA 4XU2A 3R07A 4M7DC 4UP7A 3JCMP 3JCMV 4XTXA 4C8QD 2ZGWA 4K87A 2DQ3A 3KFUA 5CAIA 1VQZA 3A5YA 3QO3A 3L1AA 11ASA 2I4MA 4M7AC 4YROA 4C92D 1H4SA 3JCMf 2DDZA 4NCXA 4CH3A 5E3IA 2ARTA 2I2LA 1YFTA 2ZZGA 4J6YA 3GIBA 2RHSB 4H2SA 5GMKl 4KR3A 5GAN4 1HK9A 5GANh 3TEGA 4YREA 4PJOD 3JCMX 1YB3A 1BIBA 4PJOC 3VQYA 2ZR2A 2I4NA 1SERA 3JCMc 1ADYA 4RCCA 1E22A 4P3PA 4RQFA 4YRTA 4HWRA 5GANe 4X9CA 1E1OA 3RF1A 1D3BA 2J3LA 3HXWA 2E64A 2Q7EA 2ALYA 4TWAA 4QVDA 4RQEA 2JN0A 4M78A 5GAN2 4J6XA 1G5IA 1I4K1 4L87A 4M77D 4M7DF 1ATIA 4CS3A 4PNOA 1HTTA 5GMKj 4F7UF 5F5WA 5ELOA 4YRKA 1D3BB 3JB9I 4NL3A 4M7AF 2C8MA 2DZ9A 4NOYA 2ZCEA 2ALYB 3QO5A 3HFVA 3IG2A 3RL6A 3G1ZA 1WQ7A 4M78B 4YRLA 4YYEA 4YRFA 4M7DE 4Q15A 2PMEA 1B70A 4XTZA 5K1PA 3M4QA 5GAOn 2RB6A 2EJ9A 1Z7NA 1H641 4F7UE 1N9RA 4M77G 2AKWA 4P3OA 3QUIA 2VC8A 3SB2A 2ZINA 3NELA 4YRNA 5LJ3g 4N0AA 2RM4A 3RERA 1WLEA 1B76A 4WJ3M 1H4VB 1RIQA 4XEOA 1EVKA 1USYA 1SESA 1B70B 2ARUA 1JRIA 4P75C 2IY5B 2ARSA 1EQRA 2AKWB 5LJ5e 4HWPA 4WI1A 3JB9H 2CIMA 1X54A 4HVCA 5LJ3d 3VQWA 2XGTA 1WNLA 4YCVA 2ZT8A 1FYFA 3LSSA 3QSUA 4P74A 2K57A 4M78F 2ZZEA 1PYSB 1GGMA 3TEHA 2VXFA 4M7DA 3JCMh 3A31A 5GAN6 4YP0A 4EX5A 2RD1A 3V8KA 2I4LA 4DQ2A 4F7UA 1EVLA 5C52B 3QTCA 4YRMA 4XTUA 4YRGA 4M7AA 3JCMJ 2YHTA 4XU0A 2EWNA 12ASA 3EFSA 1BBWA 2DU7A 3P8VA 3LC0A 5GAN7 4ZTZB 3JCMe 4M78E 4UPAA 4BW9A 3JB9J 3TEHB 4C8QC
chains in the Genus database with same CATH superfamily
3HXVA 2I4OA 3VV0A 2Y4XA 4GY5A 3SFMA 4H2XA 3CMEQ 4P72C 4DOWA 4HWOA 1S72T 3THKA 3BFMA 4PJOA 4OMOA 4C92C 1EIYA 1G3SA 1ZBJA 1NNHA 3CCQQ 5IHNA 4TVYA 4JLGA 2HBWA 2DL3A 1JJ2S 2OAUA 4LNPA 2ZAEA 5I21A 3G71Q 1NYGA 1KC8R 1LNXA 1RI0A 4F04B 3HFZA 2ZPFB 3UA7A 1X6OA 1YNZA 3PZCA 4H2XB 1H4QA 3O8VA 2DF6A 3JB9F 4RG2A 1B7YA 1VYVA 3TSZA 4ELYC 4WJ4A 1SG5A 3VS4A 2KAFA 2DJZA 3MEWA 1B8AA 3UA6A 1X75C 3E19A 2ZXFA 2DA9A 3HFZB 4M75F 5ELNA 1B7YB 4QQ6A 2X4XA 1WHJA 1YITQ 1VQ6T 4M7AG 1QF6A 2EQUA 2EQMA 4DBFA 2DIQA 2BIVA 4MZMA 3CMET 1YBYA 3DB4A 4HCCA 3RIRA 4CC3A 1ZQ1A 3CCQT 4RMOA 1WHLA 3FIFA 3CCVT 1UFFA 2ZPBB 3HRUA 4H2VA 3G71T 3M9QA 1V1CA 3H8ZA 1ZUYA 2NWMA 4DPGA 2AMCA 1NYQA 1MHNA 5D6XA 1YWOA 2L3RA 3CD6A 1ZSGA 4JRPA 2E5KA 2BTTA 1K73U 5GAOm 2DU5A 2M1HA 4PJJA 2DJQA 3RKXA 3P8DA 2GNCA 2Y4YA 1VQKQ 2AMCB 1Q86C 2GCXA 1UE9A 1ZA1B 4PJOE 4R0KA 3VUBA 4PL6A 2XTIA 1VQ7Q 3FJ5A 3CPWP 4ZTJA 2KK4A 2Q5IA 1PD1A 1KJWA 4FW1A 3UPUA 4YCUA 2CJBA 1K9MU 1OQKA 5KE3A 5GANj 2C0IA 2PU9B 3BY7A 3E9GA 1IHVA 7AT1B 3BW1A 1SF9A 1QWEA 4C8QA 5I22A 2IIMA 3I7FA 2YRDA 2ATCB 1TU0B 4N4IA 2MWOA 3OS2A 4FL6A 2J6FA 2ODRD 1B34A 3CQTA 1QVGS 2G4CA 2KEAA 2EAYA 1YJWA 2DL4A 2EYYA 4AG1C 1GCPA 4HT8A 2OAWA 3VQXA 1I8FA 2LJ1A 3QZ5B 1ZBXA 4NL2A 4EDUA 4C8QB 5C6SA 1KD1R 2DTHA 2NS6A 2COYA 3EH2A 1VQKT 1UHCA 1UJ0A 2RJCA 3QHSA 3VYGA 2QHUA 4L6V5 3LGFA 1B34B 5KYUA 3OYJA 1JU5C 2BE7D 2P0LA 4J9GA 4YRCA 4EPCA 4M7AD 3EG3A 2EFIA 3ME9A 4WCIA 3PT9A 2HL5C 4KH1B 2C0TA 2EQIA 3AT1B 1FWZA 3O5ZA 3L4GB 5AYFA 5KYUB 4J9FA 3OYLA 4O5VA 5KE2A 3FC3A 4JJCA 4ESRA 1MUZA 2KXDA 2RQUA 1KC8C 3DKMA 3EGDA 1H4TA 5J3BA 5LJ5j 3MP8A 2QEXA 4LUDA 1XTDA 2KT8A 2QG9B 1K73R 3M0RA 2COWA 5LL6S 2LCCA 1E1TA 1KQ1A 2E10A 2MMPA 4C92G 1YP5A 2CYZB 2DL7A 3JV3A 2EW3A 4KUDK 3VS3A 1AWOA 2NLUA 3EG2A 2QQAA 4C92F 2ZIMA 3CCRQ 4B9XA 5GANf 4KR2A 3MJXA 4PJOG 2CH4A 1AOJA 3G4SA 5FRMA 2FEIA 1OZ2A 2CS7A 5FROA 2QHSA 3SWNC 5IXFA 4C8QE 5KYWA 1WXBA 3ASKA 4Y91A 1NJ5A 2XKOC 2Y90A 3KXTA 5CKDA 4G85A 4PJLA 2QASA 1YCYA 1ZSZA 4MMLA 2RMOA 1D0XA 3URGA 3OYHA 2RK2A 1M1FA 2K9GA 3JCMg 1T3LA 4ZGJB 3I9QA 2C06A 3S3NA 4CH4A 4Z88A 4A54A 3FB9A 2HL3A 2QQSA 2X3WD 2HDAA 1ZSZB 3I56A 3TEEA 2XD0A 5FWBA 1M1KC 1ADJA 4XU1A 2ZT7A 4FCYA 3CMQA 2M0OA 4YRJA 3VS1A 3CC7Q 1RUWA 5CQXA 3M4PA 3QWYA 4BY6C 5GAMj 3F70A 3VRZA 1KIKA 1Y57A 4LVLA 3HY1A 1UG1A 3HSBA 3NHNA 2QA4A 2PZ1A 5LJ5f 1KQ2A 4RMFA 1I0CA 1U3OA 3JRZA 1YHQA 4RDXA 2Q5HA 3CC4Q 4ZN1A 4FYVB 1HC7A 1TOVA 2PVOB 3A8GB 3KUFA 1SEMA 2PTKA 5LJ3e 5DLOA 2L5QA 4Q6GA 3TQ7P 3WVDB 3TVTA 5D6YA 3A5ZA 3QBYA 4A63B 5D6WA 1VOMA 2BZYA 1WHGA 1OULA 4M7DC 2E12A 3JCMP 2DD4A 4HVVA 1K0SA 4N4GA 4K87A 3A5YA 2DMOA 2IG0A 11ASA 1SKUB 4C92D 3D7SB 1KFZA 3CC7T 2WSCE 2CZ6B 3OB9A 4CH3A 2ARTA 1YFTA 2ZZGA 1RAIB 3GIBA 4F17A 2RHSB 1RACB 4KR3A 2RI2A 4RTZA 4BE1A 1VQ5A 2DPPB 2QDLA 3P8HA 2X3XD 4BI3A 4YREA 4PJOD 1WHHA 3JCMX 3L2QA 1Z9QA 2YRVA 1SSHA 2H8HA 1WYXA 1M2VA 1NEGA 1RI9A 2DL8A 2FRWA 1SERA 1OYXA 1YFNA 2O2OA 1UGPB 4PLIA 3JCMc 3CC4T 2H3JA 3A1PA 1OX8A 3EGXA 5GJWB 3CC2Q 2L8DA 1D3BA 2KE9A 5EG2A 3CPWA 4AFQC 1VQMA 3VS7A 4TWAA 2CUDA 3GBQA 4RQEA 1M2VB 2JN0A 4OMNA 2QQ9A 1RLPC 4BDZA 1K0XA 1I4K1 4C0ZA 2F69A 3QXEB 1PSFA 4CS3A 2F1LA 4A4GA 3EGXB 4J9EA 1PHTA 1K73C 2CZ7B 5GMKj 2RNAA 4F7UF 5ELOA 4YRKA 8AT1B 1D3BB 4IUUA 1BU1A 2B8AA 1N6AA 2DZ9A 3EHRA 4IUVA 3QO5A 1U06A 1BK2A 1WQ7A 1WI7A 2FPEA 4KGXB 1JXMA 1VQNA 4M7DE 5K1PA 2RB6A 5A0GA 1IO6A 2JXBA 4P3OA 3CCMT 1VQ9Q 3EAEA 3VS6A 1IREB 1K9MC 1D1AA 3GP8A 2FVUA 2C0OA 2KRMA 4OMMA 4Z02A 4N0AA 3CC2T 3NMZC 4LDXA 1BB9A 2GFAA 1GRIA 1H4VB 4XEOA 3CCSQ 1EVKA 1VQOQ 2OTLQ 2PVGB 1Q81R 4ELZC 1QQJA 2V1QA 1EQRA 1OPKA 4L59A 3CCLQ 4ATOA 2CIMA 1X54A 3M5AA 1Q95G 1SRLA 1WFWA 4KT0E 1X69A 2K5LA 4Y92A 2RQVA 1HD3A 3QSUA 4PKCC 4P74A 2D0NA 4PFZA 1OI1A 3RR6A 2K57A 3MP6A 4FYWB 2ZZEA 2BE9B 2VXFA 3A31A 1MNEA 2RD1A 2I4LA 2CP7A 1EVLA 3S6WA 2DYIA 1ARKA 3ZFJA 1YJNA 4XTUA 1I5OB 4M7AA 1MNDA 2RHYA 2M02A 2YHTA 4XU0A 1VQ9T 3CCLA 1BBWA 4JPBW 3P8VA 1OZ3A 4IUQA 2GF7A 3I55Q 4ZTZB 3JCMe 2CP5A 4BW9A 2G3RA 2KVQG 3JB9J 1M9SA 4X34A 2KQWA 4O2DA 1YI2A 5K1XA 1YCSB 3RACA 5GAOq 1VQOT 3MF1A 5GMKi 3G6EA 1WYDA 4RCBA 3PMIA 1O75A 2VGNA 2DXUA 4M7AB 1LCKA 4YDQA 5LJ3f 2LDMA 5GANd 3BDUA 4D8KA 3HKSA 4C0GA 4WF2A 4J7FA 1W6XA 4CC7A 1Q7YU 2ZPEB 3V7CA 2O9SA 2EJGA 1NLOC 2YRCA 1GCQC 1JXOA 2RF0A 4R55A 2DD5A 4DBRA 4J9DA 5GAOr 1N8RC 3NEMA 1VQ4A 4ORZA 4M7DG 1M3AA 1NJ2A 4ANJA 4K11A 3KFVA 2L0AA 3I55T 5IT9E 2D0QB 5GAN8 1R0BG 4M77C 3REAB 3CBOA 2X9HA 2W10A 2QHTA 4YRSA 1X01A 5DY9A 1CKBA 2J06A 2CZ1B 3VU3C 1VQ8Q 4M75E 3PMTA 1VQLQ 1KQSP 3EHQA 2FL7A 4XTYA 3HL8A 4E7HA 3CCJA 1Q86R 2LC4A 4QKUA 5FWCA 3VJPA 1YIJA 2JT4A 4MZPA 2QK0A 1YJ9A 3W3SA 4M7AE 4AG2C 3WXMB 4P75A 5IAYA 5LJ5d 4YPFA 1UEBA 2HKNA 2RPNA 1WHMA 2KY9A 1VQPA 1Z7MA 3CCEQ 4CS4A 4RTTA 4XK8E 4CC4B 4H2TA 2MAMA 2KMTA 1QKWA 1G5HA 3HFNA 3A7RA 1GBQA 3C4SA 3M0PA 2BUDA 4E7IA 3M59A 3M4YA 3CXCP 4F14A 1UDLA 4DOVA 4DBHA 1N9WA 1KHCA 2LT4A 5HCKA 3UT1A 3INZA 3CMAA 3IKLA 3UF4A 3MEAA 2E1HA 2L3PA 1RAFB 1KSWA 1VQ8T 3C12A 2DZCA 2EQKA 2XDBA 1VQLT 4KH0B 2LQ8A 4QQDA 3CCUT 4UP8A 4AH6A 3GPLA 4TQFA 1M1KU 3HRKA 3X20B 2KT1A 3NFCA 4P72A 1Q7YR 4IUPA 4HCKA 1RAHB 5GAMg 4C92A 1NEBA 1C0AA 2H3EB 2JTMA 1PWTA 2ED1A 4EIKA 5GAOl 2DQ0A 2YT6A 1E24A 2GQIA 3WVEB 4FYYB 3L2WA 4BI8B 4UC4A 2RQTA 3CCET 2YUPA 2LNHB 5FU7B 3OSVA 4LXCA 1U1SA 3H0HA 3JCMb 2O4XA 4M7DD 1H3ZA 4C92B 1NJ8A 3JB9G 5GAMd 1G3WA 5CKHA 4P73C 1FYNA 4OGEA 1WU7A 4WTOB 4J15A 1G83A 4PJOB 1EIYB 4KRTA 2Q7HA 2ZT6A 3DB3A 1YWPA 4M75G 1J5WA 1MMAA 2ROLA 4LDYA 4J83A 4A4KA 2HD0A 4QQGA 1NYRA 1M27C 2JTEA 1XOVA 4JJDA 2X51A 1QCFA 3CD6Q 3PVLA 5DLQE 4IURA 1EFNA 1VA7A 1G8XA 3QIIA 1HYOA 4JZ3A 2FHDA 4XTVA 4EMHA 5CK9A 2VGMA 1LYLA 3CCVA 3M0UA 3RKYA 3NGPA 1M5Q1 3DLMA 1I07A 2JS0A 4E47A 2VASA 1JQQA 2QTXA 2VB6A 3E9FA 3L2VA 4JJBA 2D1XA 1PRMC 4AT1B 2YUNA 2YXYA 3A7UA 3SEMA 1X2GA 4M78C 4C92E 3HRSA 1M1KR 1EIFA 1OPLA 2F2XA 5I2MA 4OP0A 4TVAA 2ZR3A 3REUA 4FT4A 3EH1A 3V8JA 1KMMA 1QVPA 2HZYA 4YCWA 3HHTB 2P84A 5KH6A 1SHFA 2BKDN 1YITT 3CD6T 1NG2A 1YJWQ 1X2KA 2DVEA 2MYSA 4M77F 2XHCA 3PNWC 3LSQA 4TVAB 2EKOA 4HT4A 2Q7GA 2K4YA 1NPRA 4JRQA 3VS5A 1PYSA 3PIOA 1BCOA 1QP3A 1CKAA 3VRYA 4X5OA 3RKWA 3HP9A 4H2WA 2A0FB 3A8HB 4RTXA 3LW5E 1NYFA 2HNIA 3JB9D 5C51B 4H2UA 2ESWA 1USYC 4FSXA 3QO7A 2M16A 1K1ZA 2CGHA 2VVKA 2JM8A 5KYNA 2FPDA 1TTHB 4PFPA 2FZKB 4M75D 4E51A 2LJ3A 4K88A 2DXCA 2O31A 4JRKA 1OU8A 4XU2A 1X27A 3J81E 1Q7YC 2QEXQ 3JCMV 1VQ7T 1YJWT 2OTJQ 2YWWA 1KQSA 1LPLA 1VQZA 3QO3A 2XMFA 1GFDA 4YROA 1IGQA 4A4FA 1KG1A 2LP5A 4J6YA 4H2SA 4KUIA 1U8RA 2VWFA 4C5GA 3G4SQ 1TWBA 5GANh 1K4US 3TEGA 3OMCA 3MHXA 2ZPIB 2KYBA 1YB3A 1BIBA 1U5SA 2EYXA 2VV5A 2V26A 2ZR2A 3MKDA 1C1AA 4JDSA 2OTJA 4IIOA 4HWRA 2RI3A 4X9CA 3CXCA 2YUOA 1BCMA 2CH4W 2J3LA 2KSSA 2Q7EA 3OW2P 3EGDB 2YUQA 3MCAB 5GAN2 4J6XA 4L87A 2K3YA 2QEXT 4M77D 4Z89A 4FU6A 1AVZC 1N8RU 1NPPA 2EKHA 4Y28E 3I56Q 1K9MR 2K2MA 3JB9I 2KDSA 1BBZA 2SEMA 2LRQA 2D9TA 3RBBB 2O88A 4NOYA 2ZCEA 1OX9A 3HFVA 3HPWA 2ENMA 3NTKA 3PVQA 4YYEA 1VYTA 3G4ST 2JMAA 4LD9K 2QGFB 4AFZC 3M4QA 5IXBA 2LQKA 5KYWB 1Z7NA 4F7UE 2COZA 2AKWA 2QA4Q 3OS0A 1W2BP 2ZINA 3NELA 4YRNA 2ZPHB 1YHQQ 1LVKA 2MPXC 3QJ6A 2LX7A 2D6FA 2QYZA 3CPWS 3EG0A 4OF1A 1G3YA 3CCRT 3EGUA 2AKWB 1NZ9A 3JB9H 4C5HA 4BY6B 5KYXA 4FSSA 2DLPA 2XGTA 4AFSC 1FMKA 3MO8A 4E7JA 2ZT8A 2RQWA 4HKEA 2AKLA 2RN8A 4M78F 1G3TA 2P0KA 1WXUA 4M7DA 4OB0B 5GAN6 3LLRA 2M0YA 1NLPC 3H41A 1VQ5Q 9ATCB 3ZL7C 3OYBA 2MIOA 2HQEA 1RLQC 3QTCA 4YRMA 2X4JA 1UTIA 1TUGB 4KBMB 3QYHB 2JOYA 2K5FA 3GLXA 2DX1A 3LC0A 4UPAA 1BI3A 2CUBA 2AHJB 2RJEA 4QT7A 4M7DB 5IH2A 2DFUA 3UFGA 4A53A 1ZUUA 4X9DA 1VQMQ 3A5ZB 4A4HA 2V8IA 1N8RR 4LUEA 3QJYA 2E5AA 3MF2A 1WIEA 2EGAA 3WQZA 5GAMh 2CP3A 3E9HA 1MMDA 2DTIA 1ZA2B 3UATA 1U1TA 4TTVA 3ERRA 3OS5A 1TSFA 2AK5A 1J3TA 1KOGA 3S3MA 1IRXA 1VQ5T 3NENA 2KGTA 1VQNQ 1TUCA 4C0DC 3RMQA 5GAN5 1XJWB 2R5MA 4CRIA 4F7UG 1ZHIA 3T9NA 4YRIA 1MGQA 6AT1B 1MV3A 2NUPA 5HK0A 1NJIU 4JZ4A 4IIMA 2RO0A 1ABQA 1Y96A 4EMGA 4GLMA 1M90U 4E7ZA 1DJ7B 2CP0A 2GTOA 3UGQA 1RAEB 2D8JA 5FRNA 4CS2A 4PG3A 2X4YA 5LJ3j 2YLBA 3OYEA 4R56A 4ZIBA 2NUPB 2EYWA 5CQYA 1X6GA 2W0ZA 4EMKC 4DEXA 2QHVA 1JO8A 1TH7A 4M78D 3CCMA 1IL2A 4YRQA 1M4ZA 3OS1A 3PFSA 2NUZA 1WPYA 1W2BS 2E41A 3HXXA 1WA7A 3HTRA 4CH6A 4BWAA 1VQNT 4LN2A 4J9HA 1YJNQ 1NJ6A 3LX7A 4H2YA 4MDWA 2ZZFA 1WQWA 2MCNA 4RKUE 1Z9ZA 2YSQA 3RMSA 5AT1B 1VIFA 1EOVA 3LWHA 1N5ZA 4E7SA 1K76A 1M3BA 1TG0A 4B6MA 2DIGA 1YI2Q 3CPFA 3JAME 2A28A 4M75A 3HRTA 5GMKh 3DSQA 3G6EQ 2RK1A 3FLGA 5CKEA 1YFSA 1IB8A 4UP9A 4EO4A 1IGUA 3LGLA 1IXDA 3A98A 3ULRB 3EG9A 2DTOA 2RHZA 2DVJA 4OB2B 4C5EA 4P71C 2QTVA 4C0FA 1SETA 4TQDA 4JJNK 4Q5WA 5GANg 2RI5A 3OW2A 4M75B 2CP2A 3OA6A 2LCLA 4OMPA 1W66A 5GJVB 5I11A 4CI0C 2DAQA 4LVJA 4CH5A 1UECA 3PCOA 3BE3A 3EG9B 3CCST 1QKXA 4PFOA 1OOTA 5IHIA 2OTLT 1VQ4Q 3CEYA 1YJNT 3IALA 1SRYA 2RQRA 1TS9A 2K79A 4XAXB 4BUGA 3CCLT 3NTHA 3M57A 2JZ2A 2R58A 2RJDA 2CZ0B 1GCQA 2DYBA 1M90R 4K86A 2KI7A 1JBMA 3L42A 1W4SA 3PCOB 4AFUC 1YI2T 1T0HA 3G6ET 5FU6C 2KNBB 3E1SA 1W2BA 1YGBA 3P8YA 2JS2A 4P3NA 2E65A 1QE0A 3UWNA 4M77A 2CT3A 2DM1A 3CCJQ 1R0CB 2LCSA 4XU3A 5L8RE 3X28B 2OX7A 4YRRA 3EG1A 1YIJQ 3CBMA 5IHKA 3OYKA 3OQ5A 1YJ9Q 3E2UA 1BI1A 3UGTA 1AHJB 1UHFA 1WGSA 2A36A 2HBPA 3JCMQ 1VQPQ 2VXEA 2ZZDA 4M77B 5LJ5g 2DXTA 2LTOA 1WXTA 3ICAA 1VQ4T 1PNJA 1P92A 4XTWA 4E2FB 1FMVA 2MI6A 2M9UA 3VQVA 4ZTUB 1M8MA 3CBPA 1LJOA 3VUZA 4XEMA 1PC0A 3JCMW 4RTWA 3VBBA 2E70A 3CMAQ 2CJ9A 2JUFA 2R5AA 3G7ZA 3EFRA 2P0QA 1WHKA 4PJMA 1T0JA 5HGQA 1R8OB 3M55A 2SRCA 1WJSA 3CCJT 1D0YA 3REBB 1PRLC 2CP6A 3QPHA 3OYGA 2IY5A 1W70A 1YIJT 3QNEA 1ACMB 1YJ9T 3OYYA 3L2ZA 5D7UA 3H0FA 2E4HA 1PG5B 3GF5A 4RTVA 1G5VA 2YLCA 1IZ6A 1Y71A 1M8VA 1I5LA 2XDDA 1R77A 3M53A 2ZIOA 4OMLA 2IPOB 4BI4A 2JJ9A 3CCUA 2O01E 4M77E 1X56A 1TUDA 2PQWA 3MEVA 3A7AA 5GMKm 4LE9A 4HA8A 3QO8A 1BIAA 4PHCA 1S1NA 3CMAT 4ZGEB 3A32A 2RHXA 2IVWA 2DETA 1Y7XA 1I81A 1ZLMA 2ZTGA 3FRNA 4P73A 5CKBA 1S72A 1ABOA 2DEQA 1VYUA 1PM3A 1PCXA 3IKMB 2LJ0A 2ED0A 2HEQA 3META 3KBGA 3OBYA 3R07A 4BE2A 4UP7A 4GLKA 1EX4A 1XQHA 2ZGWA 1VQ6Q 3KFUA 5CAIA 2VYTA 4J8OA 5FU7C 2LQWA 1V29B 1GBRA 2YDLA 2I4MA 1M1GA 1H4SA 1F1BB 2ABLA 3JCMf 4NCXA 8ATCB 5E3IA 4PLLA 2I2LA 4LVMA 2CSQA 2E3HA 2E5QA 2O4XB 4YTLA 3VS0A 3CCVQ 2ZPGB 2QGGA 1W1FA 3I5SA 4LVIA 1HSQA 3VS2A 1NJIC 5C0MA 4PJOC 3ER0A 1M90C 3MEUA 3VQYA 4FT2A 4KGVB 2I4NA 4LVKA 4RCCA 4A4EA 1Y07A 1VQ6A 2EYZA 1E22A 2JW4A 2K7AA 5GANe 1WJQA 2ZCFB 3PTAA 5FLXE 3CMEA 1K8AU 2E64A 2P0PA 1AEYA 1B07A 3CCQA 4QVDA 4HXJA 1XNIA 3OYMA 4M78A 1G5IA 1KD1U 2RHUA 1UGVA 2EGCA 3G71A 2XICA 2Z0WA 1ATIA 1KQSS 3M54A 1D0ZA 4ZNXA 1X6BA 4LDUA 1VUBA 4NL3A 4M7AF 5FW9A 3IG2A 4M78B 2RH2A 2XDPA 2DILA 4Q15A 2GTJA 1B70A 5GAOn 2EJ9A 3FDRA 4LD6A 1Q82C 1H641 2A7YA 4M77G 3H0IA 3QUIA 4ME7A 2BZXA 3SB2A 1YITA 5LJ3g 1QCOA 1RADB 4KULA 2WSFE 2X4WA 2GBQA 1GXIE 3CXCS 2RM4A 1WLEA 2JMCA 2KR3A 2JVVA 1USYA 1SESA 4FYXB 1B70B 3VKIA 1JRIA 1MMNA 1Y0MA 2ARSA 1N27A 1JJ2A 5LJ5e 2CSIA 1A0NB 1RL2A 4HWPA 4WI1A 2NUTA 4HVCA 1FMWA 2DO3A 5LJ3d 3VQWA 4BDYA 1FYFA 1D1CA 3LSSA 1FXXA 4TVRA 1B7TA 4OVAA 1PYSB 1GGMA 2K3XA 4KGZB 4EX5A 1X2QA 2P4RA 4F7UA 2NUTB 3P8BB 2L2PA 1SRMA 5J26A 3U23A 1K9AA 1VQKA 5A2QE 2JTFA 3EFSA 2DU7A 1K8AR 2J6OA 1VQ7A 4M78E 1AT1B 3ZEHA 3OYAA 4AMCA 5HKCA 4C8QC 4FM4B 2DKGA 2WSEE 4D8DA 5HY6A 1YFRA 2AT1B 4F7UB 1X43A 3J80E 2ROTA 4QVCA 4HWSA 1M2OA 2VKNA 1X2HA 3QG1A 2FO0A 2PUOB 1UGSB 3NPFA 2EVRA 3L4GA 1I1JA 3LH0A 5A0DA 3V7SA 1AWJA 4RTYA 4YRPA 3RNJA 1OEBA 1E6HA 1BBUA 3I35A 2LQNA 1D1BA 3HXYA 2L89A 5I2SA 3HFOA 3R6OA 4MMKA 5GAMe 2D8HA 4MDXA 2EYQA 3MP1A 1LOJA 4V2SA 5KNNA 3SWNA 4FIBA 2P4TA 2WACA 4JS5A 2FZCB 1EFWA 2J3MA 1NBEB 3TUPA 2OI3A 4BE0A 2EPDA 3M4GA 1ASZA 5CCAA 2HCKA 4J9BA 3PIPA 2OTJT 3UDCA 1PSEA 2CREA 2E6NA 3X26B 3SD4A 5GAN3 2CKKA 1OV3A 2CT4A 2EGEA 1E6GA 3RDVA 3SWNB 1L0WA 2EIFA 1D09B 2CJAA 1AD5A 2ZNIA 3TSWA 3OYDA 5C53B 4J9IA 2EJFA 2MF2A 1MV0B 1PKTA 4HVUA 3FJPA 2HAXA 2KYMA 3GOXA 4PJOF 3SDZA 5ECAA 3A8LB 1QVGA 1UJYA 2I0NA 2FB7A 1IHWA 2KROA 5LJ5h 2XI9A 5KYYA 2C7IA 1QW1A 2KBTA 1JEGA 3P8TA 2RHIA 3X25B 4ZTFA 1UB4A 2PNIA 3CCRA 5L23A 4HT9A 4E7KA 3H6ZA 1WZOA 4J9CA 4JLIA 4PK4A 1ZSZC 3V7RA 4RG8A 3RGLA 4IUTA 4M78G 5KYYB 2HKQB 3I56T 1JJCA 1H3HA 1G2BA 1BI0A 2HSEB 2FYKA 2PVDB 3HTZA 3BDLA 3HXZA 1QVFP 4HWTA 1WDXA 1C0MA 2AZVA 1M3CA 1TXQA 4H02A 3JCMd 1UGRB 2LMJA 1ASYA 3DLLA 3V8LA 5KYXB 4TVWA 3M58A 3OD1A 4M4ZA 1JJCB 5GMKe 2QA4T 4OB3B 1C6VX 1YHQT 3UH0A 2DBMA 3PGGA 4ZN3A 3RUXA 2DRMA 2DERA 3LYIA 3ZBDA 1GL5A 2A3LA 3C0CA 4II1A 4BB7A 2CDTA 2XK0A 3CC7A 1SSFA 4FW2A 2L3SA 3REXA 1BI2A 1RABB 1X55A 2RHSA 5CKFA 2HMAA 1PKSA 1Q81U 3A74A 3TREA 4G84A 3VYHB 1K8AC 1G51A 2E3IA 3TCJA 3TU4K 2P5IA 1HXDA 3CC4A 2LX9A 1KD1C 1N9SA 3J7AF 2ZT5A 4LDWA 2XIDA 4HCBA 3R6NA 2JM9A 4Z8AA 1NJ1A 2E6ZA 3HY0A 4J5YA 2F2VA 2DL5A 4JS4A 2QQRA 1SPKA 4B9WA 4C0DB 4C8QG 1NM7A 3CCMQ 3OW2S 3N5BB 1RAAB 4JRIA 2LNVA 4MZTA 1O9SA 4F16A 3GNFB 4DEYA 4O6JA 5J39A 3M0TA 4C8QF 2K3BA 3IQLA 1VQMT 4EMKA 1H92A 4LNSA 3HXUA 1YN8A 2RHQA 5GAMf 2LVMA 3MPUB 3LWIA 2ZNJA 5IN1A 1QLYA 2KXCA 3C94A 4ZGDB 5HK3A 4X1VA 1Y96B 3A8MB 3Q1JA 1KHIA 2QXFA 1ZX6A 4EMKB 1B3QA 4JUVA 4N4HA 2RHQB 3CC2A 2QI2A 2RJFA 5GAOp 4OGCA 2ECZA 2GQVA 4P5NA 4OLFA 4L5GA 1RAGB 2PMFA 3MEYA 1KMNA 2EL9A 1CSKA 2HQHA 4RUGA 3HRIA 5KCOA 4P71A 1AWXA 4OMFB 1Q82U 3JSCA 3OYNA 3SHWA 2DK3A 2DEUA 2EQJA 4BACA 3OYFA 2RA2A 1AZEA 4VUBA 3NETA 3E9IA 1QVFS 1E7OA 4N0AC 2E3CA 4KQEA 5LJ3h 3BJUA 3RESA 3AHUA 4XQ3A 2F5KA 1VQ9A 2EBPA 1Q86U 4IKFA 2ODRC 2XU8A 1KK7A 1T3SA 2A37A 3OMGA 5DM7R 3CCSA 1VQOA 1OU9A 2AIRB 2OTLA 2FZGB 3QZ9B 4J6WA 4M75C 2HSPA 2K2VA 2X35A 4GBQA 3QDFA 4P74C 2FG0A 1WX6A 2O9VA 1NJIR 4XTXA 4C8QD 2DQ3A 2MK5A 2A08A 2GGRA 4C5IA 3L1AA 1SHGA 4QW2A 2DRKA 1UGQB 4M7AC 1JJ2P 2KRSA 2NYSA 2DDZA 2BZ8A 4OB1B 2PUKB 3M0SA 5GMKl 5FU6B 2XG8D 5GAN4 1HK9A 3EFOA 2F5TX 2MOXA 3NTIA 2J7IA 2K5IA 3GNGA 4BD3A 1EZZB 1BKBA 1QCNA 3OY9A 3MQZA 1M30A 1AZGB 3I55A 2FPFA 1ADYA 4RTUA 4P3PA 4RQFA 2DBKA 3OSSC 4YRTA 1GFCA 3OYIA 4PJNA 4J7IA 4D6WA 1E1OA 3RF1A 1UUEA 3EFOB 2LT1A 3X24B 3HXWA 2ALYA 1QVFA 4DBQA 4HVWA 2QQBA 2G6FX 4HCZA 1Q82R 4M7DF 2V1RA 4E7LA 3OYCA 4PNOA 1HTTA 3FEOA 5F5WA 5CR2A 1KC8U 2C8MA 2F2WA 2ALYB 3C95A 2R57A 3RL6A 3G1ZA 1PD0A 5CIUA 2M51A 4YRLA 2OJ2A 4YRFA 5A0LA 2HQXA 3CCUQ 2K6DA 2KRNA 2PMEA 2V8KA 4XTZA 1V76A 1MMGA 4DA4A 2DXBA 5EC7A 1HJDA 1N9RA 3M0QA 3G1JA 2AZSA 2V8JA 3I5RA 5KCHA 1BYMA 2VC8A 4E6RA 3QWXX 4CC2A 1NE8A 2DE0X 3M56A 2VUBA 1QWFA 1VQPT 1H8KA 4OMQA 1ZUKA 3RERA 1B76A 4WJ3M 1RIQA 3QDRB 1S72Q 5CVIA 2ARUA 1VQ8A 3L2RA 4P75C 2IY5B 1WJRA 2L3QA 1JB0E 3LH5A 1VQLA 1QMCA 3A8OB 3PE0A 3OBWA 1WLPB 2QDYB 1FX7A 3QKJA 2DNUA 3S3OA 4LDVA 2J6KA 3QYGB 1WNLA 1QP2A 4YCVA 2QAZA 5M9OA 2AKKA 2FRYA 3TEHA 2JNGA 3JCMh 2A8EA 4YP0A 4QVZA 2B86A 1Q81C 3H9NA 3V8KA 3CCEA 1AWWA 5CO7A 4DQ2A 1VIEA 5C52B 3L2UA 1QVGP 4NS5A 4YRGA 2J05A 2MWPA 3JCMJ 2EWNA 12ASA 5GAN7 2GFUA 2LZ6B 3TEHB
chains in the Genus database with same CATH topology
3HXVA 2I4OA 3VV0A 2Y4XA 4GY5A 3SFMA 4H2XA 4P72C 4DOWA 4HWOA 1S72T 3BFMA 4PJOA 4C92C 1EIYA 1G3SA 1NNHA 4TVYA 4JLGA 1JJ2S 2OAUA 5I21A 1LNXA 1RI0A 3HFZA 2ZPFB 1X6OA 3PZCA 4H2XB 1H4QA 3O8VA 3JB9F 4RG2A 1B7YA 4ELYC 4WJ4A 2KAFA 2DJZA 3MEWA 1B8AA 1X75C 3E19A 2ZXFA 3HFZB 4M75F 5ELNA 1B7YB 4QQ6A 2X4XA 1VQ6T 4M7AG 1QF6A 2EQUA 2EQMA 2DIQA 2BIVA 4MZMA 3CMET 1YBYA 3DB4A 4HCCA 3RIRA 1ZQ1A 3CCQT 4RMOA 3FIFA 3CCVT 2ZPBB 3HRUA 4H2VA 3G71T 3M9QA 3H8ZA 4DPGA 2AMCA 1NYQA 1MHNA 5D6XA 2L3RA 3CD6A 4JRPA 1K73U 5GAOm 2DU5A 2M1HA 3RKXA 3P8DA 2Y4YA 2AMCB 1Q86C 2GCXA 4PJOE 3VUBA 4PL6A 2XTIA 4ZTJA 2KK4A 2Q5IA 3UPUA 4YCUA 2CJBA 1K9MU 5KE3A 5GANj 2PU9B 3BY7A 3E9GA 3BW1A 4C8QA 3I7FA 4N4IA 2MWOA 3OS2A 4FL6A 2ODRD 1B34A 1QVGS 2G4CA 2EAYA 1YJWA 4HT8A 3VQXA 1I8FA 3QZ5B 1ZBXA 4NL2A 4EDUA 4C8QB 5C6SA 2DTHA 2NS6A 1VQKT 2RJCA 3QHSA 3VYGA 2QHUA 4L6V5 3LGFA 1B34B 3OYJA 2P0LA 4YRCA 4EPCA 4M7AD 2EFIA 3ME9A 3PT9A 1FWZA 3L4GB 5AYFA 3OYLA 4O5VA 5KE2A 3FC3A 1KC8C 3DKMA 1H4TA 5J3BA 5LJ5j 3MP8A 2QEXA 1XTDA 5LL6S 2LCCA 1E1TA 1KQ1A 2E10A 2MMPA 4C92G 2CYZB 4KUDK 2NLUA 2QQAA 4C92F 2ZIMA 4B9XA 5GANf 4KR2A 4PJOG 3G4SA 5FRMA 1OZ2A 2CS7A 5FROA 2QHSA 3SWNC 4C8QE 3ASKA 4Y91A 1NJ5A 2XKOC 2Y90A 3KXTA 5CKDA 4G85A 1YCYA 4MMLA 3URGA 3OYHA 2RK2A 1M1FA 3JCMg 4ZGJB 2C06A 3S3NA 4CH4A 4A54A 3FB9A 2QQSA 3I56A 3TEEA 2XD0A 1M1KC 1ADJA 4XU1A 2ZT7A 3CMQA 2M0OA 4YRJA 5CQXA 3M4PA 4BY6C 5GAMj 3F70A 4LVLA 3HY1A 3HSBA 2QA4A 5LJ5f 1KQ2A 4RMFA 3JRZA 1YHQA 4RDXA 2Q5HA 4ZN1A 1HC7A 2PVOB 3A8GB 3KUFA 5LJ3e 5DLOA 2L5QA 4Q6GA 3WVDB 5D6YA 3A5ZA 3QBYA 5D6WA 4M7DC 2E12A 3JCMP 2DD4A 4N4GA 4K87A 3A5YA 2IG0A 11ASA 4C92D 3CC7T 2WSCE 2CZ6B 3OB9A 4CH3A 2ARTA 1YFTA 2ZZGA 3GIBA 2RHSB 4KR3A 2RI2A 4BE1A 1VQ5A 2DPPB 3P8HA 4BI3A 4YREA 4PJOD 3JCMX 3L2QA 2YRVA 1SERA 1OYXA 3JCMc 1UGPB 4PLIA 3CC4T 2H3JA 2L8DA 1D3BA 5EG2A 3CPWA 1VQMA 4TWAA 4RQEA 2JN0A 2QQ9A 4BDZA 1I4K1 4C0ZA 2F69A 3QXEB 1PSFA 4CS3A 4A4GA 1K73C 2CZ7B 5GMKj 4F7UF 5ELOA 4YRKA 1D3BB 4IUUA 2B8AA 1N6AA 2DZ9A 4IUVA 3QO5A 1WQ7A 1VQNA 4M7DE 5K1PA 2RB6A 5A0GA 4P3OA 3CCMT 3EAEA 1K9MC 1IREB 3GP8A 2FVUA 4Z02A 4N0AA 3CC2T 4LDXA 2GFAA 1H4VB 4XEOA 1EVKA 2PVGB 4ELZC 1EQRA 4L59A 4ATOA 2CIMA 1X54A 3M5AA 4KT0E 2K5LA 3QSUA 4PKCC 4P74A 1OI1A 2K57A 3MP6A 2ZZEA 2VXFA 3A31A 2RD1A 2I4LA 1EVLA 3S6WA 3ZFJA 1YJNA 4XTUA 4M7AA 2RHYA 2YHTA 4XU0A 1VQ9T 3CCLA 1BBWA 3P8VA 1OZ3A 4IUQA 2GF7A 4ZTZB 3JCMe 4BW9A 2G3RA 3JB9J 2KVQG 1M9SA 4X34A 2KQWA 4O2DA 1YI2A 5K1XA 3RACA 5GAOq 1VQOT 3MF1A 5GMKi 3G6EA 1WYDA 4RCBA 3PMIA 1O75A 2VGNA 2DXUA 4M7AB 4YDQA 5LJ3f 2LDMA 5GANd 3BDUA 3HKSA 4C0GA 4WF2A 4J7FA 1Q7YU 2ZPEB 3V7CA 2EJGA 4R55A 2DD5A 5GAOr 1N8RC 3NEMA 1VQ4A 4M7DG 1NJ2A 3I55T 5IT9E 2D0QB 5GAN8 4M77C 3CBOA 2QHTA 4YRSA 1X01A 5DY9A 2CZ1B 3VU3C 4M75E 3PMTA 2FL7A 4XTYA 3HL8A 4E7HA 3CCJA 2LC4A 3VJPA 1YIJA 4MZPA 1YJ9A 3W3SA 4M7AE 4P75A 3WXMB 5IAYA 5LJ5d 4YPFA 1UEBA 2KY9A 1VQPA 1Z7MA 4CS4A 4XK8E 4H2TA 2MAMA 2KMTA 1G5HA 3HFNA 3A7RA 3C4SA 2BUDA 4E7IA 3M59A 3M4YA 4DOVA 1N9WA 1KHCA 2LT4A 3UT1A 3INZA 3CMAA 3IKLA 3MEAA 2E1HA 1VQ8T 3C12A 2DZCA 2EQKA 2XDBA 1VQLT 2LQ8A 4QQDA 3CCUT 4UP8A 4AH6A 3GPLA 4TQFA 1M1KU 3HRKA 3X20B 3NFCA 4P72A 4IUPA 5GAMg 4C92A 1C0AA 2JTMA 5GAOl 2DQ0A 1E24A 3WVEB 3L2WA 4BI8B 4UC4A 3CCET 5FU7B 3OSVA 1U1SA 3JCMb 4M7DD 2O4XA 1H3ZA 4C92B 1NJ8A 3JB9G 5GAMd 1G3WA 5CKHA 4P73C 4OGEA 1WU7A 4J15A 4PJOB 1EIYB 2Q7HA 2ZT6A 3DB3A 4M75G 1J5WA 4LDYA 4J83A 4A4KA 2HD0A 4QQGA 1NYRA 1XOVA 5DLQE 4IURA 3QIIA 2FHDA 4XTVA 4EMHA 5CK9A 2VGMA 1LYLA 3CCVA 3RKYA 1M5Q1 3DLMA 4E47A 2QTXA 3E9FA 3L2VA 3A7UA 1X2GA 4M78C 4C92E 3HRSA 1EIFA 5I2MA 4OP0A 4TVAA 2ZR3A 3REUA 4FT4A 3V8JA 1KMMA 1QVPA 4YCWA 3HHTB 5KH6A 2BKDN 1YITT 3CD6T 2DVEA 4M77F 2XHCA 3PNWC 3LSQA 4TVAB 2EKOA 4HT4A 2Q7GA 2K4YA 1NPRA 4JRQA 1PYSA 3PIOA 1QP3A 4X5OA 3RKWA 3HP9A 4H2WA 3A8HB 3LW5E 2HNIA 3JB9D 5C51B 4H2UA 1USYC 4FSXA 3QO7A 2M16A 2CGHA 4M75D 4E51A 4K88A 2DXCA 4JRKA 4XU2A 3J81E 1Q7YC 3JCMV 1VQ7T 1YJWT 1KQSA 1VQZA 3QO3A 4YROA 4A4FA 1KG1A 4J6YA 4H2SA 4KUIA 1U8RA 4C5GA 5GANh 3TEGA 3OMCA 3MHXA 2ZPIB 1YB3A 1BIBA 2VV5A 2ZR2A 2OTJA 4JDSA 4HWRA 2RI3A 4X9CA 3CXCA 2J3LA 2KSSA 2Q7EA 3MCAB 5GAN2 4J6XA 4L87A 2K3YA 2QEXT 4M77D 4FU6A 1N8RU 1NPPA 4Y28E 3JB9I 2KDSA 2LRQA 2D9TA 4NOYA 2ZCEA 3HFVA 3HPWA 3NTKA 4YYEA 3G4ST 4LD9K 3M4QA 2LQKA 1Z7NA 4F7UE 2AKWA 3OS0A 2ZINA 3NELA 4YRNA 2ZPHB 3QJ6A 2D6FA 3CPWS 4OF1A 1G3YA 3CCRT 2AKWB 1NZ9A 3JB9H 4C5HA 4BY6B 2XGTA 3MO8A 4E7JA 2ZT8A 4HKEA 4M78F 1G3TA 2P0KA 4M7DA 4OB0B 5GAN6 3LLRA 3OYBA 2HQEA 3QTCA 4YRMA 2X4JA 4KBMB 3QYHB 2JOYA 2K5FA 3GLXA 3LC0A 4UPAA 1BI3A 2RJEA 2AHJB 4M7DB 3UFGA 4A53A 4X9DA 3A5ZB 4A4HA 2V8IA 3QJYA 2E5AA 3MF2A 3WQZA 5GAMh 3E9HA 2DTIA 1U1TA 4TTVA 3ERRA 3OS5A 1KOGA 3S3MA 1VQ5T 3NENA 4C0DC 3RMQA 5GAN5 2R5MA 4CRIA 4F7UG 1ZHIA 3T9NA 4YRIA 1MGQA 5HK0A 1NJIU 2RO0A 1Y96A 4EMGA 1M90U 1DJ7B 3UGQA 5FRNA 4CS2A 4PG3A 2X4YA 5LJ3j 2YLBA 3OYEA 4R56A 4ZIBA 5CQYA 4EMKC 2QHVA 1TH7A 3CCMA 4M78D 1IL2A 4YRQA 1M4ZA 3OS1A 3PFSA 1WPYA 1W2BS 2E41A 3HXXA 4CH6A 4BWAA 1VQNT 1NJ6A 3LX7A 4H2YA 4MDWA 2ZZFA 1WQWA 4RKUE 3RMSA 1VIFA 1EOVA 3LWHA 2DIGA 3CPFA 3JAME 4M75A 3HRTA 5GMKh 3DSQA 4UP9A 2RK1A 3FLGA 5CKEA 1YFSA 4EO4A 3LGLA 2DTOA 2RHZA 4OB2B 4P71C 4C5EA 4C0FA 1SETA 4TQDA 4JJNK 4Q5WA 5GANg 2RI5A 3OW2A 4M75B 3OA6A 2LCLA 1W66A 4CI0C 2DAQA 4LVJA 4CH5A 3PCOA 3CCST 2OTLT 3CEYA 1YJNT 3IALA 1SRYA 4XAXB 4BUGA 3CCLT 3NTHA 3M57A 2JZ2A 2R58A 2RJDA 2CZ0B 4K86A 1JBMA 3L42A 1W4SA 3PCOB 1YI2T 3G6ET 5FU6C 3E1SA 1W2BA 1YGBA 3P8YA 4P3NA 2E65A 1QE0A 3UWNA 4M77A 4XU3A 5L8RE 3X28B 4YRRA 3CBMA 3OYKA 3OQ5A 1BI1A 3UGTA 1AHJB 1WGSA 2HBPA 3JCMQ 2VXEA 2ZZDA 4M77B 5LJ5g 2DXTA 2LTOA 3ICAA 1VQ4T 1P92A 4XTWA 2MI6A 2M9UA 3VQVA 4ZTUB 3CBPA 1LJOA 3VUZA 4XEMA 3JCMW 3VBBA 2E70A 2CJ9A 2JUFA 2R5AA 3G7ZA 3EFRA 2P0QA 5HGQA 1R8OB 3M55A 1WJSA 3CCJT 3QPHA 3OYGA 2IY5A 1YIJT 3QNEA 1YJ9T 3OYYA 3L2ZA 3GF5A 1G5VA 2YLCA 1IZ6A 1Y71A 1M8VA 1I5LA 2XDDA 3M53A 2ZIOA 4BI4A 3CCUA 2O01E 4M77E 1X56A 2PQWA 3MEVA 3A7AA 5GMKm 4HA8A 3QO8A 1BIAA 4PHCA 3CMAT 4ZGEB 3A32A 2RHXA 2IVWA 1Y7XA 1I81A 2ZTGA 4P73A 3FRNA 5CKBA 1S72A 2DEQA 3IKMB 3META 3KBGA 3OBYA 3R07A 4BE2A 4UP7A 4GLKA 1XQHA 2ZGWA 3KFUA 5CAIA 2VYTA 4J8OA 5FU7C 1V29B 2I4MA 1M1GA 1H4SA 3JCMf 4NCXA 5E3IA 4PLLA 2I2LA 4LVMA 2E5QA 2O4XB 4YTLA 2ZPGB 4LVIA 1NJIC 5C0MA 4PJOC 3ER0A 1M90C 3MEUA 3VQYA 4FT2A 2I4NA 4LVKA 4RCCA 4A4EA 1Y07A 1VQ6A 1E22A 5GANe 1WJQA 2ZCFB 3PTAA 5FLXE 3CMEA 1K8AU 2E64A 2P0PA 3CCQA 4QVDA 1XNIA 3OYMA 4M78A 1G5IA 1KD1U 2RHUA 3G71A 2XICA 1ATIA 1KQSS 3M54A 4LDUA 1VUBA 4NL3A 4M7AF 3IG2A 4M78B 2RH2A 2XDPA 4Q15A 1B70A 5GAOn 2EJ9A 3FDRA 4LD6A 1Q82C 1H641 2A7YA 4M77G 3QUIA 4ME7A 3SB2A 1YITA 5LJ3g 4KULA 2WSFE 2X4WA 1GXIE 3CXCS 2RM4A 1WLEA 2JVVA 1USYA 1SESA 1B70B 3VKIA 1JRIA 2ARSA 1N27A 1JJ2A 5LJ5e 1RL2A 4HWPA 4WI1A 4HVCA 2DO3A 5LJ3d 3VQWA 4BDYA 1FYFA 3LSSA 1FXXA 4TVRA 4OVAA 1PYSB 1GGMA 2K3XA 4EX5A 4F7UA 3P8BB 5J26A 1VQKA 5A2QE 2JTFA 3EFSA 2DU7A 1VQ7A 4M78E 3OYAA 3ZEHA 5HKCA 4C8QC 4FM4B 2DKGA 2WSEE 5HY6A 1YFRA 4F7UB 3J80E 4QVCA 4HWSA 1X2HA 3QG1A 2PUOB 1UGSB 3L4GA 3LH0A 5A0DA 3V7SA 4YRPA 1BBUA 3HXYA 2L89A 5I2SA 3HFOA 3R6OA 4MMKA 5GAMe 4MDXA 2EYQA 3MP1A 1LOJA 4V2SA 5KNNA 3SWNA 4FIBA 2P4TA 2WACA 4JS5A 1EFWA 2J3MA 3TUPA 4BE0A 3M4GA 1ASZA 5CCAA 2OTJT 3PIPA 3UDCA 1PSEA 2E6NA 3X26B 5GAN3 3SD4A 2CKKA 3SWNB 1L0WA 2EIFA 2CJAA 2ZNIA 3OYDA 5C53B 2EJFA 2MF2A 3FJPA 2HAXA 3GOXA 4PJOF 3SDZA 3A8LB 1QVGA 2FB7A 5LJ5h 2XI9A 2C7IA 1QW1A 3P8TA 2RHIA 3X25B 4ZTFA 1UB4A 3CCRA 4HT9A 4E7KA 3H6ZA 4JLIA 3V7RA 4RG8A 3RGLA 4IUTA 4M78G 3I56T 1JJCA 1BI0A 2FYKA 2PVDB 3HTZA 3BDLA 3HXZA 4HWTA 4H02A 3JCMd 1UGRB 1ASYA 3DLLA 3V8LA 4TVWA 3M58A 3OD1A 1JJCB 5GMKe 2QA4T 4OB3B 1YHQT 3UH0A 3PGGA 4ZN3A 3RUXA 3LYIA 3ZBDA 2A3LA 4II1A 4BB7A 2XK0A 3CC7A 1SSFA 3REXA 1BI2A 1X55A 2RHSA 5CKFA 1Q81U 3A74A 3TREA 4G84A 3VYHB 1K8AC 1G51A 3TCJA 3TU4K 2P5IA 1HXDA 3CC4A 2LX9A 1KD1C 1N9SA 3J7AF 2ZT5A 4LDWA 2XIDA 4HCBA 1NJ1A 2E6ZA 3HY0A 4J5YA 4JS4A 2QQRA 4B9WA 4C0DB 4C8QG 3OW2S 3N5BB 4JRIA 2LNVA 4MZTA 1O9SA 3GNFB 4O6JA 5J39A 4C8QF 1VQMT 4EMKA 4LNSA 3HXUA 2RHQA 5GAMf 2LVMA 3LWIA 2ZNJA 5IN1A 3C94A 4ZGDB 5HK3A 1Y96B 3A8MB 3Q1JA 1KHIA 2QXFA 4EMKB 4JUVA 4N4HA 2RHQB 3CC2A 2QI2A 2RJFA 5GAOp 4OGCA 2GQVA 4P5NA 4OLFA 4L5GA 2PMFA 3MEYA 1KMNA 2EL9A 3HRIA 5KCOA 4P71A 4OMFB 1Q82U 3JSCA 3OYNA 2DK3A 2EQJA 4BACA 3OYFA 2RA2A 4VUBA 3NETA 3E9IA 1QVFS 4N0AC 2E3CA 4KQEA 5LJ3h 3BJUA 3RESA 3AHUA 4XQ3A 2F5KA 1VQ9A 1Q86U 4IKFA 2ODRC 2XU8A 3OMGA 5DM7R 3CCSA 1VQOA 2OTLA 3QZ9B 4J6WA 4M75C 2K2VA 2X35A 4P74C 4XTXA 4C8QD 2DQ3A 4C5IA 3L1AA 4QW2A 1UGQB 4M7AC 2DDZA 4OB1B 2PUKB 5GMKl 5FU6B 2XG8D 5GAN4 1HK9A 2F5TX 3NTIA 2K5IA 3GNGA 4BD3A 1BKBA 3OY9A 3MQZA 3I55A 1ADYA 4P3PA 4RQFA 3OSSC 4YRTA 3OYIA 4J7IA 4D6WA 1E1OA 3RF1A 2LT1A 3X24B 3HXWA 2ALYA 1QVFA 2QQBA 4HCZA 4M7DF 4E7LA 3OYCA 4PNOA 1HTTA 3FEOA 5F5WA 5CR2A 1KC8U 2C8MA 2ALYB 3C95A 2R57A 3RL6A 3G1ZA 5CIUA 4YRLA 4YRFA 5A0LA 2HQXA 2PMEA 2V8KA 4XTZA 4DA4A 2DXBA 1N9RA 2V8JA 5KCHA 1BYMA 2VC8A 1NE8A 3M56A 2VUBA 1VQPT 3RERA 1B76A 4WJ3M 1RIQA 3QDRB 5CVIA 2ARUA 1VQ8A 3L2RA 4P75C 2IY5B 1WJRA 1JB0E 1VQLA 3A8OB 3OBWA 2QDYB 1FX7A 3QKJA 3S3OA 4LDVA 3QYGB 1WNLA 1QP2A 4YCVA 5M9OA 3TEHA 2JNGA 3JCMh 2A8EA 4YP0A 4QVZA 1Q81C 3V8KA 3CCEA 5CO7A 4DQ2A 1VIEA 5C52B 3L2UA 4NS5A 4YRGA 2MWPA 3JCMJ 2EWNA 12ASA 5GAN7 2GFUA 3TEHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D B;  2I4O A;  3HXV A;  2DKG A;  4O2D A;  3UFG A;  4H2X A;  4A53 A;  4P72 C;  3RAC A;  5K1X A;  4HWO A;  1YFR A;  5GAO q;  3MF1 A;  4F7U B;  4X9D A;  5GMK i;  1WYD A;  3BFM A;  4RCB A;  4PJO A;  4C92 C;  1EIY A;  1NNH A;  2DXU A;  4QVC A;  4TVY A;  4HWS A;  4M7A B;  1X2H A;  2E5A A;  3MF2 A;  4YDQ A;  5LJ3 f;  5GAN d;  3L4G A;  5GAM h;  3WQZ A;  3BDU A;  5I21 A;  3E9H A;  2DTI A;  1LNX A;  3V7S A;  4WF2 A;  3HFZ A;  4YRP A;  3PZC A;  1U1T A;  4H2X B;  1H4Q A;  4TTV A;  3JB9 F;  1BBU A;  1B7Y A;  3ERR A;  3HXY A;  4WJ4 A;  3HFO A;  4MMK A;  3V7C A;  1KOG A;  5GAM e;  2EJG A;  2DJZ A;  1LOJ A;  4V2S A;  5KNN A;  3SWN A;  3NEN A;  1B8A A;  5GAO r;  3NEM A;  4M7D G;  1EFW A;  1NJ2 A;  5GAN 5;  2J3M A;  2ZXF A;  3HFZ B;  3TUP A;  4M75 F;  4F7U G;  5ELN A;  3M4G A;  1ASZ A;  1B7Y B;  4YRI A;  1MGQ A;  5GAN 8;  4M7A G;  5GAN 3;  1QF6 A;  4M77 C;  2QHT A;  4YRS A;  1X01 A;  5DY9 A;  3SWN B;  1Y96 A;  1L0W A;  4EMG A;  2CJA A;  3RIR A;  3UGQ A;  2ZNI A;  3VU3 C;  5C53 B;  4M75 E;  3FIF A;  2EJF A;  4CS2 A;  4PG3 A;  5LJ3 j;  2YLB A;  4XTY A;  4H2V A;  4ZIB A;  3FJP A;  4DPG A;  2AMC A;  4EMK C;  1NYQ A;  2QHV A;  4PJO F;  1TH7 A;  3W3S A;  4M78 D;  1IL2 A;  4YRQ A;  4M7A E;  4P75 A;  2FB7 A;  5LJ5 h;  5LJ5 d;  4YPF A;  2C7I A;  1WPY A;  2E41 A;  3HXX A;  3P8T A;  1Z7M A;  4CH6 A;  4BWA A;  4CS4 A;  5GAO m;  2DU5 A;  3RKX A;  1NJ6 A;  4H2T A;  4H2Y A;  1G5H A;  3HFN A;  4HT9 A;  2AMC B;  3A7R A;  4PJO E;  1WQW A;  2ZZF A;  4JLI A;  3V7R A;  3RGL A;  2XTI A;  1EOV A;  4M78 G;  1N9W A;  1JJC A;  2Q5I A;  2FYK A;  3HTZ A;  3INZ A;  4M75 A;  5GMK h;  3DSQ A;  3HXZ A;  2E1H A;  3IKL A;  4HWT A;  4UP9 A;  1YFS A;  4EO4 A;  4YCU A;  2CJB A;  2DZC A;  5GAN j;  4H02 A;  3JCM d;  3BY7 A;  3BW1 A;  1ASY A;  2DTO A;  4P71 C;  4UP8 A;  4AH6 A;  4C8Q A;  3V8L A;  4TQF A;  3I7F A;  4TVW A;  3HRK A;  3OD1 A;  4P72 A;  1JJC B;  5GMK e;  1SET A;  4TQD A;  5GAN g;  5GAM g;  2ODR D;  4C92 A;  1B34 A;  4M75 B;  2G4C A;  1C0A A;  2EAY A;  5GAO l;  3UH0 A;  2DQ0 A;  3PGG A;  3RUX A;  4HT8 A;  1W66 A;  1E24 A;  3VQX A;  4CH5 A;  3PCO A;  1I8F A;  4NL2 A;  4C8Q B;  2DTH A;  3IAL A;  1SRY A;  1U1S A;  3REX A;  1X55 A;  2RHS A;  3QHS A;  3JCM b;  4M7D D;  2QHU A;  4C92 B;  1B34 B;  1NJ8 A;  3JB9 G;  5GAM d;  3A74 A;  4K86 A;  4P73 C;  4G84 A;  2P0L A;  1JBM A;  4YRC A;  4M7A D;  1G51 A;  1WU7 A;  3PCO B;  2P5I A;  1HXD A;  4J15 A;  4PJO B;  1EIY B;  2Q7H A;  1YGB A;  3P8Y A;  2ZT6 A;  1N9S A;  2ZT5 A;  4M75 G;  4P3N A;  2E65 A;  1J5W A;  1QE0 A;  3L4G B;  4M77 A;  1NJ1 A;  1NYR A;  4J5Y A;  4XU3 A;  3HY0 A;  4YRR A;  4C8Q G;  1H4T A;  5LJ5 j;  4JRI A;  3UGT A;  1E1T A;  1KQ1 A;  2E10 A;  4C92 G;  4C8Q F;  3JCM Q;  2VXE A;  4M77 B;  5LJ5 g;  2DXT A;  3ICA A;  4EMK A;  4LNS A;  3HXU A;  4XTV A;  4EMH A;  1LYL A;  4C92 F;  2RHQ A;  2ZIM A;  5GAN f;  5GAM f;  4XTW A;  4KR2 A;  3RKY A;  4PJO G;  1M5Q 1;  3VQV A;  4ZTU B;  2ZNJ A;  2QHS A;  1LJO A;  2QTX A;  3SWN C;  4XEM A;  4C8Q E;  3JCM W;  4Y91 A;  1NJ5 A;  2Y90 A;  3A7U A;  1Y96 B;  3VBB A;  4G85 A;  2CJ9 A;  1X2G A;  4M78 C;  4EMK B;  1YCY A;  3EFR A;  4JUV A;  4C92 E;  2RHQ B;  4MML A;  4OP0 A;  5HGQ A;  4TVA A;  5GAO p;  4OLF A;  2ZR3 A;  3REU A;  3JCM g;  2PMF A;  2IY5 A;  3V8J A;  1KMM A;  3MEY A;  3QNE A;  4YCW A;  1KMN A;  3L2Z A;  4CH4 A;  2EL9 A;  4A54 A;  3FB9 A;  2DVE A;  3HRI A;  4P71 A;  4M77 F;  3LSQ A;  1ADJ A;  4XU1 A;  4TVA B;  2ZT7 A;  3CMQ A;  4YRJ A;  2YLC A;  2Q7G A;  1M8V A;  1I5L A;  3M4P A;  2RA2 A;  1PYS A;  5GAM j;  3NET A;  3E9I A;  2ZIO A;  4X5O A;  3RKW A;  4N0A C;  4H2W A;  2E3C A;  4KQE A;  2HNI A;  5LJ3 h;  3JB9 D;  3BJU A;  3RES A;  3HY1 A;  4M77 E;  4H2U A;  1X56 A;  5C51 B;  3AHU A;  3HSB A;  1USY C;  5GMK m;  3A7A A;  4XQ3 A;  4HA8 A;  3QO8 A;  1BIA A;  5LJ5 f;  3QO7 A;  4PHC A;  1KQ2 A;  4RMF A;  2CGH A;  4RDX A;  2ODR C;  2Q5H A;  3A32 A;  1HC7 A;  5LJ3 e;  1I81 A;  4Q6G A;  2ZTG A;  4P73 A;  4M75 D;  4E51 A;  2DEQ A;  4J6W A;  3A5Z A;  4K88 A;  3IKM B;  4M75 C;  4P74 C;  4JRK A;  4XU2 A;  3R07 A;  4M7D C;  4UP7 A;  3JCM P;  3JCM V;  4XTX A;  4C8Q D;  2ZGW A;  4K87 A;  2DQ3 A;  3KFU A;  5CAI A;  1VQZ A;  3A5Y A;  3QO3 A;  3L1A A;  11AS A;  2I4M A;  4M7A C;  4YRO A;  4C92 D;  1H4S A;  3JCM f;  2DDZ A;  4NCX A;  4CH3 A;  5E3I A;  2ART A;  2I2L A;  1YFT A;  2ZZG A;  4J6Y A;  3GIB A;  2RHS B;  4H2S A;  5GMK l;  4KR3 A;  5GAN 4;  1HK9 A;  5GAN h;  3TEG A;  4YRE A;  4PJO D;  3JCM X;  1YB3 A;  1BIB A;  4PJO C;  3VQY A;  2ZR2 A;  2I4N A;  1SER A;  3JCM c;  1ADY A;  4RCC A;  1E22 A;  4P3P A;  4RQF A;  4YRT A;  4HWR A;  5GAN e;  4X9C A;  1E1O A;  3RF1 A;  1D3B A;  2J3L A;  3HXW A;  2E64 A;  2Q7E A;  2ALY A;  4TWA A;  4QVD A;  4RQE A;  2JN0 A;  4M78 A;  5GAN 2;  4J6X A;  1G5I A;  1I4K 1;  4L87 A;  4M77 D;  4M7D F;  1ATI A;  4CS3 A;  4PNO A;  1HTT A;  5GMK j;  4F7U F;  5F5W A;  5ELO A;  4YRK A;  1D3B B;  3JB9 I;  4NL3 A;  4M7A F;  2C8M A;  2DZ9 A;  4NOY A;  2ZCE A;  2ALY B;  3QO5 A;  3HFV A;  3IG2 A;  3RL6 A;  3G1Z A;  1WQ7 A;  4M78 B;  4YRL A;  4YYE A;  4YRF A;  4M7D E;  4Q15 A;  2PME A;  1B70 A;  4XTZ A;  5K1P A;  3M4Q A;  5GAO n;  2RB6 A;  2EJ9 A;  1Z7N A;  1H64 1;  4F7U E;  1N9R A;  4M77 G;  2AKW A;  4P3O A;  3QUI A;  2VC8 A;  3SB2 A;  2ZIN A;  3NEL A;  4YRN A;  5LJ3 g;  4N0A A;  2RM4 A;  3RER A;  1WLE A;  1B76 A;  4WJ3 M;  1H4V B;  1RIQ A;  4XEO A;  1EVK A;  1USY A;  1SES A;  1B70 B;  2ARU A;  1JRI A;  4P75 C;  2IY5 B;  2ARS A;  1EQR A;  2AKW B;  5LJ5 e;  4HWP A;  4WI1 A;  3JB9 H;  2CIM A;  1X54 A;  4HVC A;  5LJ3 d;  3VQW A;  2XGT A;  1WNL A;  4YCV A;  2ZT8 A;  1FYF A;  3LSS A;  3QSU A;  4P74 A;  2K57 A;  4M78 F;  2ZZE A;  1PYS B;  1GGM A;  3TEH A;  2VXF A;  4M7D A;  3JCM h;  3A31 A;  5GAN 6;  4YP0 A;  4EX5 A;  2RD1 A;  3V8K A;  2I4L A;  4DQ2 A;  4F7U A;  1EVL A;  5C52 B;  3QTC A;  4YRM A;  4XTU A;  4YRG A;  4M7A A;  3JCM J;  2YHT A;  4XU0 A;  2EWN A;  12AS A;  3EFS A;  1BBW A;  2DU7 A;  3P8V A;  3LC0 A;  5GAN 7;  4ZTZ B;  3JCM e;  4M78 E;  4UPA A;  4BW9 A;  3JB9 J;  3TEH B;  4C8Q C; 
#chains in the Genus database with same CATH topology
 3HXV A;  2I4O A;  3VV0 A;  2Y4X A;  4GY5 A;  3SFM A;  4H2X A;  3CME Q;  4P72 C;  4DOW A;  4HWO A;  1S72 T;  3THK A;  3BFM A;  4PJO A;  4OMO A;  4C92 C;  1EIY A;  1G3S A;  1ZBJ A;  1NNH A;  3CCQ Q;  5IHN A;  4TVY A;  4JLG A;  2HBW A;  2DL3 A;  1JJ2 S;  2OAU A;  4LNP A;  2ZAE A;  5I21 A;  3G71 Q;  1NYG A;  1KC8 R;  1LNX A;  1RI0 A;  4F04 B;  3HFZ A;  2ZPF B;  3UA7 A;  1X6O A;  1YNZ A;  3PZC A;  4H2X B;  1H4Q A;  3O8V A;  2DF6 A;  3JB9 F;  4RG2 A;  1B7Y A;  1VYV A;  3TSZ A;  4ELY C;  4WJ4 A;  1SG5 A;  3VS4 A;  2KAF A;  2DJZ A;  3MEW A;  1B8A A;  3UA6 A;  1X75 C;  3E19 A;  2ZXF A;  2DA9 A;  3HFZ B;  4M75 F;  5ELN A;  1B7Y B;  4QQ6 A;  2X4X A;  1WHJ A;  1YIT Q;  1VQ6 T;  4M7A G;  1QF6 A;  2EQU A;  2EQM A;  4DBF A;  2DIQ A;  2BIV A;  4MZM A;  3CME T;  1YBY A;  3DB4 A;  4HCC A;  3RIR A;  4CC3 A;  1ZQ1 A;  3CCQ T;  4RMO A;  1WHL A;  3FIF A;  3CCV T;  1UFF A;  2ZPB B;  3HRU A;  4H2V A;  3G71 T;  3M9Q A;  1V1C A;  3H8Z A;  1ZUY A;  2NWM A;  4DPG A;  2AMC A;  1NYQ A;  1MHN A;  5D6X A;  1YWO A;  2L3R A;  3CD6 A;  1ZSG A;  4JRP A;  2E5K A;  2BTT A;  1K73 U;  5GAO m;  2DU5 A;  2M1H A;  4PJJ A;  2DJQ A;  3RKX A;  3P8D A;  2GNC A;  2Y4Y A;  1VQK Q;  2AMC B;  1Q86 C;  2GCX A;  1UE9 A;  1ZA1 B;  4PJO E;  4R0K A;  3VUB A;  4PL6 A;  2XTI A;  1VQ7 Q;  3FJ5 A;  3CPW P;  4ZTJ A;  2KK4 A;  2Q5I A;  1PD1 A;  1KJW A;  4FW1 A;  3UPU A;  4YCU A;  2CJB A;  1K9M U;  1OQK A;  5KE3 A;  5GAN j;  2C0I A;  2PU9 B;  3BY7 A;  3E9G A;  1IHV A;  7AT1 B;  3BW1 A;  1SF9 A;  1QWE A;  4C8Q A;  5I22 A;  2IIM A;  3I7F A;  2YRD A;  2ATC B;  1TU0 B;  4N4I A;  2MWO A;  3OS2 A;  4FL6 A;  2J6F A;  2ODR D;  1B34 A;  3CQT A;  1QVG S;  2G4C A;  2KEA A;  2EAY A;  1YJW A;  2DL4 A;  2EYY A;  4AG1 C;  1GCP A;  4HT8 A;  2OAW A;  3VQX A;  1I8F A;  2LJ1 A;  3QZ5 B;  1ZBX A;  4NL2 A;  4EDU A;  4C8Q B;  5C6S A;  1KD1 R;  2DTH A;  2NS6 A;  2COY A;  3EH2 A;  1VQK T;  1UHC A;  1UJ0 A;  2RJC A;  3QHS A;  3VYG A;  2QHU A;  4L6V 5;  3LGF A;  1B34 B;  5KYU A;  3OYJ A;  1JU5 C;  2BE7 D;  2P0L A;  4J9G A;  4YRC A;  4EPC A;  4M7A D;  3EG3 A;  2EFI A;  3ME9 A;  4WCI A;  3PT9 A;  2HL5 C;  4KH1 B;  2C0T A;  2EQI A;  3AT1 B;  1FWZ A;  3O5Z A;  3L4G B;  5AYF A;  5KYU B;  4J9F A;  3OYL A;  4O5V A;  5KE2 A;  3FC3 A;  4JJC A;  4ESR A;  1MUZ A;  2KXD A;  2RQU A;  1KC8 C;  3DKM A;  3EGD A;  1H4T A;  5J3B A;  5LJ5 j;  3MP8 A;  2QEX A;  4LUD A;  1XTD A;  2KT8 A;  2QG9 B;  1K73 R;  3M0R A;  2COW A;  5LL6 S;  2LCC A;  1E1T A;  1KQ1 A;  2E10 A;  2MMP A;  4C92 G;  1YP5 A;  2CYZ B;  2DL7 A;  3JV3 A;  2EW3 A;  4KUD K;  3VS3 A;  1AWO A;  2NLU A;  3EG2 A;  2QQA A;  4C92 F;  2ZIM A;  3CCR Q;  4B9X A;  5GAN f;  4KR2 A;  3MJX A;  4PJO G;  2CH4 A;  1AOJ A;  3G4S A;  5FRM A;  2FEI A;  1OZ2 A;  2CS7 A;  5FRO A;  2QHS A;  3SWN C;  5IXF A;  4C8Q E;  5KYW A;  1WXB A;  3ASK A;  4Y91 A;  1NJ5 A;  2XKO C;  2Y90 A;  3KXT A;  5CKD A;  4G85 A;  4PJL A;  2QAS A;  1YCY A;  1ZSZ A;  4MML A;  2RMO A;  1D0X A;  3URG A;  3OYH A;  2RK2 A;  1M1F A;  2K9G A;  3JCM g;  1T3L A;  4ZGJ B;  3I9Q A;  2C06 A;  3S3N A;  4CH4 A;  4Z88 A;  4A54 A;  3FB9 A;  2HL3 A;  2QQS A;  2X3W D;  2HDA A;  1ZSZ B;  3I56 A;  3TEE A;  2XD0 A;  5FWB A;  1M1K C;  1ADJ A;  4XU1 A;  2ZT7 A;  4FCY A;  3CMQ A;  2M0O A;  4YRJ A;  3VS1 A;  3CC7 Q;  1RUW A;  5CQX A;  3M4P A;  3QWY A;  4BY6 C;  5GAM j;  3F70 A;  3VRZ A;  1KIK A;  1Y57 A;  4LVL A;  3HY1 A;  1UG1 A;  3HSB A;  3NHN A;  2QA4 A;  2PZ1 A;  5LJ5 f;  1KQ2 A;  4RMF A;  1I0C A;  1U3O A;  3JRZ A;  1YHQ A;  4RDX A;  2Q5H A;  3CC4 Q;  4ZN1 A;  4FYV B;  1HC7 A;  1TOV A;  2PVO B;  3A8G B;  3KUF A;  1SEM A;  2PTK A;  5LJ3 e;  5DLO A;  2L5Q A;  4Q6G A;  3TQ7 P;  3WVD B;  3TVT A;  5D6Y A;  3A5Z A;  3QBY A;  4A63 B;  5D6W A;  1VOM A;  2BZY A;  1WHG A;  1OUL A;  4M7D C;  2E12 A;  3JCM P;  2DD4 A;  4HVV A;  1K0S A;  4N4G A;  4K87 A;  3A5Y A;  2DMO A;  2IG0 A;  11AS A;  1SKU B;  4C92 D;  3D7S B;  1KFZ A;  3CC7 T;  2WSC E;  2CZ6 B;  3OB9 A;  4CH3 A;  2ART A;  1YFT A;  2ZZG A;  1RAI B;  3GIB A;  4F17 A;  2RHS B;  1RAC B;  4KR3 A;  2RI2 A;  4RTZ A;  4BE1 A;  1VQ5 A;  2DPP B;  2QDL A;  3P8H A;  2X3X D;  4BI3 A;  4YRE A;  4PJO D;  1WHH A;  3JCM X;  3L2Q A;  1Z9Q A;  2YRV A;  1SSH A;  2H8H A;  1WYX A;  1M2V A;  1NEG A;  1RI9 A;  2DL8 A;  2FRW A;  1SER A;  1OYX A;  1YFN A;  2O2O A;  1UGP B;  4PLI A;  3JCM c;  3CC4 T;  2H3J A;  3A1P A;  1OX8 A;  3EGX A;  5GJW B;  3CC2 Q;  2L8D A;  1D3B A;  2KE9 A;  5EG2 A;  3CPW A;  4AFQ C;  1VQM A;  3VS7 A;  4TWA A;  2CUD A;  3GBQ A;  4RQE A;  1M2V B;  2JN0 A;  4OMN A;  2QQ9 A;  1RLP C;  4BDZ A;  1K0X A;  1I4K 1;  4C0Z A;  2F69 A;  3QXE B;  1PSF A;  4CS3 A;  2F1L A;  4A4G A;  3EGX B;  4J9E A;  1PHT A;  1K73 C;  2CZ7 B;  5GMK j;  2RNA A;  4F7U F;  5ELO A;  4YRK A;  8AT1 B;  1D3B B;  4IUU A;  1BU1 A;  2B8A A;  1N6A A;  2DZ9 A;  3EHR A;  4IUV A;  3QO5 A;  1U06 A;  1BK2 A;  1WQ7 A;  1WI7 A;  2FPE A;  4KGX B;  1JXM A;  1VQN A;  4M7D E;  5K1P A;  2RB6 A;  5A0G A;  1IO6 A;  2JXB A;  4P3O A;  3CCM T;  1VQ9 Q;  3EAE A;  3VS6 A;  1IRE B;  1K9M C;  1D1A A;  3GP8 A;  2FVU A;  2C0O A;  2KRM A;  4OMM A;  4Z02 A;  4N0A A;  3CC2 T;  3NMZ C;  4LDX A;  1BB9 A;  2GFA A;  1GRI A;  1H4V B;  4XEO A;  3CCS Q;  1EVK A;  1VQO Q;  2OTL Q;  2PVG B;  1Q81 R;  4ELZ C;  1QQJ A;  2V1Q A;  1EQR A;  1OPK A;  4L59 A;  3CCL Q;  4ATO A;  2CIM A;  1X54 A;  3M5A A;  1Q95 G;  1SRL A;  1WFW A;  4KT0 E;  1X69 A;  2K5L A;  4Y92 A;  2RQV A;  1HD3 A;  3QSU A;  4PKC C;  4P74 A;  2D0N A;  4PFZ A;  1OI1 A;  3RR6 A;  2K57 A;  3MP6 A;  4FYW B;  2ZZE A;  2BE9 B;  2VXF A;  3A31 A;  1MNE A;  2RD1 A;  2I4L A;  2CP7 A;  1EVL A;  3S6W A;  2DYI A;  1ARK A;  3ZFJ A;  1YJN A;  4XTU A;  1I5O B;  4M7A A;  1MND A;  2RHY A;  2M02 A;  2YHT A;  4XU0 A;  1VQ9 T;  3CCL A;  1BBW A;  4JPB W;  3P8V A;  1OZ3 A;  4IUQ A;  2GF7 A;  3I55 Q;  4ZTZ B;  3JCM e;  2CP5 A;  4BW9 A;  2G3R A;  2KVQ G;  3JB9 J;  1M9S A;  4X34 A;  2KQW A;  4O2D A;  1YI2 A;  5K1X A;  1YCS B;  3RAC A;  5GAO q;  1VQO T;  3MF1 A;  5GMK i;  3G6E A;  1WYD A;  4RCB A;  3PMI A;  1O75 A;  2VGN A;  2DXU A;  4M7A B;  1LCK A;  4YDQ A;  5LJ3 f;  2LDM A;  5GAN d;  3BDU A;  4D8K A;  3HKS A;  4C0G A;  4WF2 A;  4J7F A;  1W6X A;  4CC7 A;  1Q7Y U;  2ZPE B;  3V7C A;  2O9S A;  2EJG A;  1NLO C;  2YRC A;  1GCQ C;  1JXO A;  2RF0 A;  4R55 A;  2DD5 A;  4DBR A;  4J9D A;  5GAO r;  1N8R C;  3NEM A;  1VQ4 A;  4ORZ A;  4M7D G;  1M3A A;  1NJ2 A;  4ANJ A;  4K11 A;  3KFV A;  2L0A A;  3I55 T;  5IT9 E;  2D0Q B;  5GAN 8;  1R0B G;  4M77 C;  3REA B;  3CBO A;  2X9H A;  2W10 A;  2QHT A;  4YRS A;  1X01 A;  5DY9 A;  1CKB A;  2J06 A;  2CZ1 B;  3VU3 C;  1VQ8 Q;  4M75 E;  3PMT A;  1VQL Q;  1KQS P;  3EHQ A;  2FL7 A;  4XTY A;  3HL8 A;  4E7H A;  3CCJ A;  1Q86 R;  2LC4 A;  4QKU A;  5FWC A;  3VJP A;  1YIJ A;  2JT4 A;  4MZP A;  2QK0 A;  1YJ9 A;  3W3S A;  4M7A E;  4AG2 C;  3WXM B;  4P75 A;  5IAY A;  5LJ5 d;  4YPF A;  1UEB A;  2HKN A;  2RPN A;  1WHM A;  2KY9 A;  1VQP A;  1Z7M A;  3CCE Q;  4CS4 A;  4RTT A;  4XK8 E;  4CC4 B;  4H2T A;  2MAM A;  2KMT A;  1QKW A;  1G5H A;  3HFN A;  3A7R A;  1GBQ A;  3C4S A;  3M0P A;  2BUD A;  4E7I A;  3M59 A;  3M4Y A;  3CXC P;  4F14 A;  1UDL A;  4DOV A;  4DBH A;  1N9W A;  1KHC A;  2LT4 A;  5HCK A;  3UT1 A;  3INZ A;  3CMA A;  3IKL A;  3UF4 A;  3MEA A;  2E1H A;  2L3P A;  1RAF B;  1KSW A;  1VQ8 T;  3C12 A;  2DZC A;  2EQK A;  2XDB A;  1VQL T;  4KH0 B;  2LQ8 A;  4QQD A;  3CCU T;  4UP8 A;  4AH6 A;  3GPL A;  4TQF A;  1M1K U;  3HRK A;  3X20 B;  2KT1 A;  3NFC A;  4P72 A;  1Q7Y R;  4IUP A;  4HCK A;  1RAH B;  5GAM g;  4C92 A;  1NEB A;  1C0A A;  2H3E B;  2JTM A;  1PWT A;  2ED1 A;  4EIK A;  5GAO l;  2DQ0 A;  2YT6 A;  1E24 A;  2GQI A;  3WVE B;  4FYY B;  3L2W A;  4BI8 B;  4UC4 A;  2RQT A;  3CCE T;  2YUP A;  2LNH B;  5FU7 B;  3OSV A;  4LXC A;  1U1S A;  3H0H A;  3JCM b;  2O4X A;  4M7D D;  1H3Z A;  4C92 B;  1NJ8 A;  3JB9 G;  5GAM d;  1G3W A;  5CKH A;  4P73 C;  1FYN A;  4OGE A;  1WU7 A;  4WTO B;  4J15 A;  1G83 A;  4PJO B;  1EIY B;  4KRT A;  2Q7H A;  2ZT6 A;  3DB3 A;  1YWP A;  4M75 G;  1J5W A;  1MMA A;  2ROL A;  4LDY A;  4J83 A;  4A4K A;  2HD0 A;  4QQG A;  1NYR A;  1M27 C;  2JTE A;  1XOV A;  4JJD A;  2X51 A;  1QCF A;  3CD6 Q;  3PVL A;  5DLQ E;  4IUR A;  1EFN A;  1VA7 A;  1G8X A;  3QII A;  1HYO A;  4JZ3 A;  2FHD A;  4XTV A;  4EMH A;  5CK9 A;  2VGM A;  1LYL A;  3CCV A;  3M0U A;  3RKY A;  3NGP A;  1M5Q 1;  3DLM A;  1I07 A;  2JS0 A;  4E47 A;  2VAS A;  1JQQ A;  2QTX A;  2VB6 A;  3E9F A;  3L2V A;  4JJB A;  2D1X A;  1PRM C;  4AT1 B;  2YUN A;  2YXY A;  3A7U A;  3SEM A;  1X2G A;  4M78 C;  4C92 E;  3HRS A;  1M1K R;  1EIF A;  1OPL A;  2F2X A;  5I2M A;  4OP0 A;  4TVA A;  2ZR3 A;  3REU A;  4FT4 A;  3EH1 A;  3V8J A;  1KMM A;  1QVP A;  2HZY A;  4YCW A;  3HHT B;  2P84 A;  5KH6 A;  1SHF A;  2BKD N;  1YIT T;  3CD6 T;  1NG2 A;  1YJW Q;  1X2K A;  2DVE A;  2MYS A;  4M77 F;  2XHC A;  3PNW C;  3LSQ A;  4TVA B;  2EKO A;  4HT4 A;  2Q7G A;  2K4Y A;  1NPR A;  4JRQ A;  3VS5 A;  1PYS A;  3PIO A;  1BCO A;  1QP3 A;  1CKA A;  3VRY A;  4X5O A;  3RKW A;  3HP9 A;  4H2W A;  2A0F B;  3A8H B;  4RTX A;  3LW5 E;  1NYF A;  2HNI A;  3JB9 D;  5C51 B;  4H2U A;  2ESW A;  1USY C;  4FSX A;  3QO7 A;  2M16 A;  1K1Z A;  2CGH A;  2VVK A;  2JM8 A;  5KYN A;  2FPD A;  1TTH B;  4PFP A;  2FZK B;  4M75 D;  4E51 A;  2LJ3 A;  4K88 A;  2DXC A;  2O31 A;  4JRK A;  1OU8 A;  4XU2 A;  1X27 A;  3J81 E;  1Q7Y C;  2QEX Q;  3JCM V;  1VQ7 T;  1YJW T;  2OTJ Q;  2YWW A;  1KQS A;  1LPL A;  1VQZ A;  3QO3 A;  2XMF A;  1GFD A;  4YRO A;  1IGQ A;  4A4F A;  1KG1 A;  2LP5 A;  4J6Y A;  4H2S A;  4KUI A;  1U8R A;  2VWF A;  4C5G A;  3G4S Q;  1TWB A;  5GAN h;  1K4U S;  3TEG A;  3OMC A;  3MHX A;  2ZPI B;  2KYB A;  1YB3 A;  1BIB A;  1U5S A;  2EYX A;  2VV5 A;  2V26 A;  2ZR2 A;  3MKD A;  1C1A A;  4JDS A;  2OTJ A;  4IIO A;  4HWR A;  2RI3 A;  4X9C A;  3CXC A;  2YUO A;  1BCM A;  2CH4 W;  2J3L A;  2KSS A;  2Q7E A;  3OW2 P;  3EGD B;  2YUQ A;  3MCA B;  5GAN 2;  4J6X A;  4L87 A;  2K3Y A;  2QEX T;  4M77 D;  4Z89 A;  4FU6 A;  1AVZ C;  1N8R U;  1NPP A;  2EKH A;  4Y28 E;  3I56 Q;  1K9M R;  2K2M A;  3JB9 I;  2KDS A;  1BBZ A;  2SEM A;  2LRQ A;  2D9T A;  3RBB B;  2O88 A;  4NOY A;  2ZCE A;  1OX9 A;  3HFV A;  3HPW A;  2ENM A;  3NTK A;  3PVQ A;  4YYE A;  1VYT A;  3G4S T;  2JMA A;  4LD9 K;  2QGF B;  4AFZ C;  3M4Q A;  5IXB A;  2LQK A;  5KYW B;  1Z7N A;  4F7U E;  2COZ A;  2AKW A;  2QA4 Q;  3OS0 A;  1W2B P;  2ZIN A;  3NEL A;  4YRN A;  2ZPH B;  1YHQ Q;  1LVK A;  2MPX C;  3QJ6 A;  2LX7 A;  2D6F A;  2QYZ A;  3CPW S;  3EG0 A;  4OF1 A;  1G3Y A;  3CCR T;  3EGU A;  2AKW B;  1NZ9 A;  3JB9 H;  4C5H A;  4BY6 B;  5KYX A;  4FSS A;  2DLP A;  2XGT A;  4AFS C;  1FMK A;  3MO8 A;  4E7J A;  2ZT8 A;  2RQW A;  4HKE A;  2AKL A;  2RN8 A;  4M78 F;  1G3T A;  2P0K A;  1WXU A;  4M7D A;  4OB0 B;  5GAN 6;  3LLR A;  2M0Y A;  1NLP C;  3H41 A;  1VQ5 Q;  9ATC B;  3ZL7 C;  3OYB A;  2MIO A;  2HQE A;  1RLQ C;  3QTC A;  4YRM A;  2X4J A;  1UTI A;  1TUG B;  4KBM B;  3QYH B;  2JOY A;  2K5F A;  3GLX A;  2DX1 A;  3LC0 A;  4UPA A;  1BI3 A;  2CUB A;  2AHJ B;  2RJE A;  4QT7 A;  4M7D B;  5IH2 A;  2DFU A;  3UFG A;  4A53 A;  1ZUU A;  4X9D A;  1VQM Q;  3A5Z B;  4A4H A;  2V8I A;  1N8R R;  4LUE A;  3QJY A;  2E5A A;  3MF2 A;  1WIE A;  2EGA A;  3WQZ A;  5GAM h;  2CP3 A;  3E9H A;  1MMD A;  2DTI A;  1ZA2 B;  3UAT A;  1U1T A;  4TTV A;  3ERR A;  3OS5 A;  1TSF A;  2AK5 A;  1J3T A;  1KOG A;  3S3M A;  1IRX A;  1VQ5 T;  3NEN A;  2KGT A;  1VQN Q;  1TUC A;  4C0D C;  3RMQ A;  5GAN 5;  1XJW B;  2R5M A;  4CRI A;  4F7U G;  1ZHI A;  3T9N A;  4YRI A;  1MGQ A;  6AT1 B;  1MV3 A;  2NUP A;  5HK0 A;  1NJI U;  4JZ4 A;  4IIM A;  2RO0 A;  1ABQ A;  1Y96 A;  4EMG A;  4GLM A;  1M90 U;  4E7Z A;  1DJ7 B;  2CP0 A;  2GTO A;  3UGQ A;  1RAE B;  2D8J A;  5FRN A;  4CS2 A;  4PG3 A;  2X4Y A;  5LJ3 j;  2YLB A;  3OYE A;  4R56 A;  4ZIB A;  2NUP B;  2EYW A;  5CQY A;  1X6G A;  2W0Z A;  4EMK C;  4DEX A;  2QHV A;  1JO8 A;  1TH7 A;  4M78 D;  3CCM A;  1IL2 A;  4YRQ A;  1M4Z A;  3OS1 A;  3PFS A;  2NUZ A;  1WPY A;  1W2B S;  2E41 A;  3HXX A;  1WA7 A;  3HTR A;  4CH6 A;  4BWA A;  1VQN T;  4LN2 A;  4J9H A;  1YJN Q;  1NJ6 A;  3LX7 A;  4H2Y A;  4MDW A;  2ZZF A;  1WQW A;  2MCN A;  4RKU E;  1Z9Z A;  2YSQ A;  3RMS A;  5AT1 B;  1VIF A;  1EOV A;  3LWH A;  1N5Z A;  4E7S A;  1K76 A;  1M3B A;  1TG0 A;  4B6M A;  2DIG A;  1YI2 Q;  3CPF A;  3JAM E;  2A28 A;  4M75 A;  3HRT A;  5GMK h;  3DSQ A;  3G6E Q;  2RK1 A;  3FLG A;  5CKE A;  1YFS A;  1IB8 A;  4UP9 A;  4EO4 A;  1IGU A;  3LGL A;  1IXD A;  3A98 A;  3ULR B;  3EG9 A;  2DTO A;  2RHZ A;  2DVJ A;  4OB2 B;  4C5E A;  4P71 C;  2QTV A;  4C0F A;  1SET A;  4TQD A;  4JJN K;  4Q5W A;  5GAN g;  2RI5 A;  3OW2 A;  4M75 B;  2CP2 A;  3OA6 A;  2LCL A;  4OMP A;  1W66 A;  5GJV B;  5I11 A;  4CI0 C;  2DAQ A;  4LVJ A;  4CH5 A;  1UEC A;  3PCO A;  3BE3 A;  3EG9 B;  3CCS T;  1QKX A;  4PFO A;  1OOT A;  5IHI A;  2OTL T;  1VQ4 Q;  3CEY A;  1YJN T;  3IAL A;  1SRY A;  2RQR A;  1TS9 A;  2K79 A;  4XAX B;  4BUG A;  3CCL T;  3NTH A;  3M57 A;  2JZ2 A;  2R58 A;  2RJD A;  2CZ0 B;  1GCQ A;  2DYB A;  1M90 R;  4K86 A;  2KI7 A;  1JBM A;  3L42 A;  1W4S A;  3PCO B;  4AFU C;  1YI2 T;  1T0H A;  3G6E T;  5FU6 C;  2KNB B;  3E1S A;  1W2B A;  1YGB A;  3P8Y A;  2JS2 A;  4P3N A;  2E65 A;  1QE0 A;  3UWN A;  4M77 A;  2CT3 A;  2DM1 A;  3CCJ Q;  1R0C B;  2LCS A;  4XU3 A;  5L8R E;  3X28 B;  2OX7 A;  4YRR A;  3EG1 A;  1YIJ Q;  3CBM A;  5IHK A;  3OYK A;  3OQ5 A;  1YJ9 Q;  3E2U A;  1BI1 A;  3UGT A;  1AHJ B;  1UHF A;  1WGS A;  2A36 A;  2HBP A;  3JCM Q;  1VQP Q;  2VXE A;  2ZZD A;  4M77 B;  5LJ5 g;  2DXT A;  2LTO A;  1WXT A;  3ICA A;  1VQ4 T;  1PNJ A;  1P92 A;  4XTW A;  4E2F B;  1FMV A;  2MI6 A;  2M9U A;  3VQV A;  4ZTU B;  1M8M A;  3CBP A;  1LJO A;  3VUZ A;  4XEM A;  1PC0 A;  3JCM W;  4RTW A;  3VBB A;  2E70 A;  3CMA Q;  2CJ9 A;  2JUF A;  2R5A A;  3G7Z A;  3EFR A;  2P0Q A;  1WHK A;  4PJM A;  1T0J A;  5HGQ A;  1R8O B;  3M55 A;  2SRC A;  1WJS A;  3CCJ T;  1D0Y A;  3REB B;  1PRL C;  2CP6 A;  3QPH A;  3OYG A;  2IY5 A;  1W70 A;  1YIJ T;  3QNE A;  1ACM B;  1YJ9 T;  3OYY A;  3L2Z A;  5D7U A;  3H0F A;  2E4H A;  1PG5 B;  3GF5 A;  4RTV A;  1G5V A;  2YLC A;  1IZ6 A;  1Y71 A;  1M8V A;  1I5L A;  2XDD A;  1R77 A;  3M53 A;  2ZIO A;  4OML A;  2IPO B;  4BI4 A;  2JJ9 A;  3CCU A;  2O01 E;  4M77 E;  1X56 A;  1TUD A;  2PQW A;  3MEV A;  3A7A A;  5GMK m;  4LE9 A;  4HA8 A;  3QO8 A;  1BIA A;  4PHC A;  1S1N A;  3CMA T;  4ZGE B;  3A32 A;  2RHX A;  2IVW A;  2DET A;  1Y7X A;  1I81 A;  1ZLM A;  2ZTG A;  3FRN A;  4P73 A;  5CKB A;  1S72 A;  1ABO A;  2DEQ A;  1VYU A;  1PM3 A;  1PCX A;  3IKM B;  2LJ0 A;  2ED0 A;  2HEQ A;  3MET A;  3KBG A;  3OBY A;  3R07 A;  4BE2 A;  4UP7 A;  4GLK A;  1EX4 A;  1XQH A;  2ZGW A;  1VQ6 Q;  3KFU A;  5CAI A;  2VYT A;  4J8O A;  5FU7 C;  2LQW A;  1V29 B;  1GBR A;  2YDL A;  2I4M A;  1M1G A;  1H4S A;  1F1B B;  2ABL A;  3JCM f;  4NCX A;  8ATC B;  5E3I A;  4PLL A;  2I2L A;  4LVM A;  2CSQ A;  2E3H A;  2E5Q A;  2O4X B;  4YTL A;  3VS0 A;  3CCV Q;  2ZPG B;  2QGG A;  1W1F A;  3I5S A;  4LVI A;  1HSQ A;  3VS2 A;  1NJI C;  5C0M A;  4PJO C;  3ER0 A;  1M90 C;  3MEU A;  3VQY A;  4FT2 A;  4KGV B;  2I4N A;  4LVK A;  4RCC A;  4A4E A;  1Y07 A;  1VQ6 A;  2EYZ A;  1E22 A;  2JW4 A;  2K7A A;  5GAN e;  1WJQ A;  2ZCF B;  3PTA A;  5FLX E;  3CME A;  1K8A U;  2E64 A;  2P0P A;  1AEY A;  1B07 A;  3CCQ A;  4QVD A;  4HXJ A;  1XNI A;  3OYM A;  4M78 A;  1G5I A;  1KD1 U;  2RHU A;  1UGV A;  2EGC A;  3G71 A;  2XIC A;  2Z0W A;  1ATI A;  1KQS S;  3M54 A;  1D0Z A;  4ZNX A;  1X6B A;  4LDU A;  1VUB A;  4NL3 A;  4M7A F;  5FW9 A;  3IG2 A;  4M78 B;  2RH2 A;  2XDP A;  2DIL A;  4Q15 A;  2GTJ A;  1B70 A;  5GAO n;  2EJ9 A;  3FDR A;  4LD6 A;  1Q82 C;  1H64 1;  2A7Y A;  4M77 G;  3H0I A;  3QUI A;  4ME7 A;  2BZX A;  3SB2 A;  1YIT A;  5LJ3 g;  1QCO A;  1RAD B;  4KUL A;  2WSF E;  2X4W A;  2GBQ A;  1GXI E;  3CXC S;  2RM4 A;  1WLE A;  2JMC A;  2KR3 A;  2JVV A;  1USY A;  1SES A;  4FYX B;  1B70 B;  3VKI A;  1JRI A;  1MMN A;  1Y0M A;  2ARS A;  1N27 A;  1JJ2 A;  5LJ5 e;  2CSI A;  1A0N B;  1RL2 A;  4HWP A;  4WI1 A;  2NUT A;  4HVC A;  1FMW A;  2DO3 A;  5LJ3 d;  3VQW A;  4BDY A;  1FYF A;  1D1C A;  3LSS A;  1FXX A;  4TVR A;  1B7T A;  4OVA A;  1PYS B;  1GGM A;  2K3X A;  4KGZ B;  4EX5 A;  1X2Q A;  2P4R A;  4F7U A;  2NUT B;  3P8B B;  2L2P A;  1SRM A;  5J26 A;  3U23 A;  1K9A A;  1VQK A;  5A2Q E;  2JTF A;  3EFS A;  2DU7 A;  1K8A R;  2J6O A;  1VQ7 A;  4M78 E;  1AT1 B;  3ZEH A;  3OYA A;  4AMC A;  5HKC A;  4C8Q C;  4FM4 B;  2DKG A;  2WSE E;  4D8D A;  5HY6 A;  1YFR A;  2AT1 B;  4F7U B;  1X43 A;  3J80 E;  2ROT A;  4QVC A;  4HWS A;  1M2O A;  2VKN A;  1X2H A;  3QG1 A;  2FO0 A;  2PUO B;  1UGS B;  3NPF A;  2EVR A;  3L4G A;  1I1J A;  3LH0 A;  5A0D A;  3V7S A;  1AWJ A;  4RTY A;  4YRP A;  3RNJ A;  1OEB A;  1E6H A;  1BBU A;  3I35 A;  2LQN A;  1D1B A;  3HXY A;  2L89 A;  5I2S A;  3HFO A;  3R6O A;  4MMK A;  5GAM e;  2D8H A;  4MDX A;  2EYQ A;  3MP1 A;  1LOJ A;  4V2S A;  5KNN A;  3SWN A;  4FIB A;  2P4T A;  2WAC A;  4JS5 A;  2FZC B;  1EFW A;  2J3M A;  1NBE B;  3TUP A;  2OI3 A;  4BE0 A;  2EPD A;  3M4G A;  1ASZ A;  5CCA A;  2HCK A;  4J9B A;  3PIP A;  2OTJ T;  3UDC A;  1PSE A;  2CRE A;  2E6N A;  3X26 B;  3SD4 A;  5GAN 3;  2CKK A;  1OV3 A;  2CT4 A;  2EGE A;  1E6G A;  3RDV A;  3SWN B;  1L0W A;  2EIF A;  1D09 B;  2CJA A;  1AD5 A;  2ZNI A;  3TSW A;  3OYD A;  5C53 B;  4J9I A;  2EJF A;  2MF2 A;  1MV0 B;  1PKT A;  4HVU A;  3FJP A;  2HAX A;  2KYM A;  3GOX A;  4PJO F;  3SDZ A;  5ECA A;  3A8L B;  1QVG A;  1UJY A;  2I0N A;  2FB7 A;  1IHW A;  2KRO A;  5LJ5 h;  2XI9 A;  5KYY A;  2C7I A;  1QW1 A;  2KBT A;  1JEG A;  3P8T A;  2RHI A;  3X25 B;  4ZTF A;  1UB4 A;  2PNI A;  3CCR A;  5L23 A;  4HT9 A;  4E7K A;  3H6Z A;  1WZO A;  4J9C A;  4JLI A;  4PK4 A;  1ZSZ C;  3V7R A;  4RG8 A;  3RGL A;  4IUT A;  4M78 G;  5KYY B;  2HKQ B;  3I56 T;  1JJC A;  1H3H A;  1G2B A;  1BI0 A;  2HSE B;  2FYK A;  2PVD B;  3HTZ A;  3BDL A;  3HXZ A;  1QVF P;  4HWT A;  1WDX A;  1C0M A;  2AZV A;  1M3C A;  1TXQ A;  4H02 A;  3JCM d;  1UGR B;  2LMJ A;  1ASY A;  3DLL A;  3V8L A;  5KYX B;  4TVW A;  3M58 A;  3OD1 A;  4M4Z A;  1JJC B;  5GMK e;  2QA4 T;  4OB3 B;  1C6V X;  1YHQ T;  3UH0 A;  2DBM A;  3PGG A;  4ZN3 A;  3RUX A;  2DRM A;  2DER A;  3LYI A;  3ZBD A;  1GL5 A;  2A3L A;  3C0C A;  4II1 A;  4BB7 A;  2CDT A;  2XK0 A;  3CC7 A;  1SSF A;  4FW2 A;  2L3S A;  3REX A;  1BI2 A;  1RAB B;  1X55 A;  2RHS A;  5CKF A;  2HMA A;  1PKS A;  1Q81 U;  3A74 A;  3TRE A;  4G84 A;  3VYH B;  1K8A C;  1G51 A;  2E3I A;  3TCJ A;  3TU4 K;  2P5I A;  1HXD A;  3CC4 A;  2LX9 A;  1KD1 C;  1N9S A;  3J7A F;  2ZT5 A;  4LDW A;  2XID A;  4HCB A;  3R6N A;  2JM9 A;  4Z8A A;  1NJ1 A;  2E6Z A;  3HY0 A;  4J5Y A;  2F2V A;  2DL5 A;  4JS4 A;  2QQR A;  1SPK A;  4B9W A;  4C0D B;  4C8Q G;  1NM7 A;  3CCM Q;  3OW2 S;  3N5B B;  1RAA B;  4JRI A;  2LNV A;  4MZT A;  1O9S A;  4F16 A;  3GNF B;  4DEY A;  4O6J A;  5J39 A;  3M0T A;  4C8Q F;  2K3B A;  3IQL A;  1VQM T;  4EMK A;  1H92 A;  4LNS A;  3HXU A;  1YN8 A;  2RHQ A;  5GAM f;  2LVM A;  3MPU B;  3LWI A;  2ZNJ A;  5IN1 A;  1QLY A;  2KXC A;  3C94 A;  4ZGD B;  5HK3 A;  4X1V A;  1Y96 B;  3A8M B;  3Q1J A;  1KHI A;  2QXF A;  1ZX6 A;  4EMK B;  1B3Q A;  4JUV A;  4N4H A;  2RHQ B;  3CC2 A;  2QI2 A;  2RJF A;  5GAO p;  4OGC A;  2ECZ A;  2GQV A;  4P5N A;  4OLF A;  4L5G A;  1RAG B;  2PMF A;  3MEY A;  1KMN A;  2EL9 A;  1CSK A;  2HQH A;  4RUG A;  3HRI A;  5KCO A;  4P71 A;  1AWX A;  4OMF B;  1Q82 U;  3JSC A;  3OYN A;  3SHW A;  2DK3 A;  2DEU A;  2EQJ A;  4BAC A;  3OYF A;  2RA2 A;  1AZE A;  4VUB A;  3NET A;  3E9I A;  1QVF S;  1E7O A;  4N0A C;  2E3C A;  4KQE A;  5LJ3 h;  3BJU A;  3RES A;  3AHU A;  4XQ3 A;  2F5K A;  1VQ9 A;  2EBP A;  1Q86 U;  4IKF A;  2ODR C;  2XU8 A;  1KK7 A;  1T3S A;  2A37 A;  3OMG A;  5DM7 R;  3CCS A;  1VQO A;  1OU9 A;  2AIR B;  2OTL A;  2FZG B;  3QZ9 B;  4J6W A;  4M75 C;  2HSP A;  2K2V A;  2X35 A;  4GBQ A;  3QDF A;  4P74 C;  2FG0 A;  1WX6 A;  2O9V A;  1NJI R;  4XTX A;  4C8Q D;  2DQ3 A;  2MK5 A;  2A08 A;  2GGR A;  4C5I A;  3L1A A;  1SHG A;  4QW2 A;  2DRK A;  1UGQ B;  4M7A C;  1JJ2 P;  2KRS A;  2NYS A;  2DDZ A;  2BZ8 A;  4OB1 B;  2PUK B;  3M0S A;  5GMK l;  5FU6 B;  2XG8 D;  5GAN 4;  1HK9 A;  3EFO A;  2F5T X;  2MOX A;  3NTI A;  2J7I A;  2K5I A;  3GNG A;  4BD3 A;  1EZZ B;  1BKB A;  1QCN A;  3OY9 A;  3MQZ A;  1M30 A;  1AZG B;  3I55 A;  2FPF A;  1ADY A;  4RTU A;  4P3P A;  4RQF A;  2DBK A;  3OSS C;  4YRT A;  1GFC A;  3OYI A;  4PJN A;  4J7I A;  4D6W A;  1E1O A;  3RF1 A;  1UUE A;  3EFO B;  2LT1 A;  3X24 B;  3HXW A;  2ALY A;  1QVF A;  4DBQ A;  4HVW A;  2QQB A;  2G6F X;  4HCZ A;  1Q82 R;  4M7D F;  2V1R A;  4E7L A;  3OYC A;  4PNO A;  1HTT A;  3FEO A;  5F5W A;  5CR2 A;  1KC8 U;  2C8M A;  2F2W A;  2ALY B;  3C95 A;  2R57 A;  3RL6 A;  3G1Z A;  1PD0 A;  5CIU A;  2M51 A;  4YRL A;  2OJ2 A;  4YRF A;  5A0L A;  2HQX A;  3CCU Q;  2K6D A;  2KRN A;  2PME A;  2V8K A;  4XTZ A;  1V76 A;  1MMG A;  4DA4 A;  2DXB A;  5EC7 A;  1HJD A;  1N9R A;  3M0Q A;  3G1J A;  2AZS A;  2V8J A;  3I5R A;  5KCH A;  1BYM A;  2VC8 A;  4E6R A;  3QWX X;  4CC2 A;  1NE8 A;  2DE0 X;  3M56 A;  2VUB A;  1QWF A;  1VQP T;  1H8K A;  4OMQ A;  1ZUK A;  3RER A;  1B76 A;  4WJ3 M;  1RIQ A;  3QDR B;  1S72 Q;  5CVI A;  2ARU A;  1VQ8 A;  3L2R A;  4P75 C;  2IY5 B;  1WJR A;  2L3Q A;  1JB0 E;  3LH5 A;  1VQL A;  1QMC A;  3A8O B;  3PE0 A;  3OBW A;  1WLP B;  2QDY B;  1FX7 A;  3QKJ A;  2DNU A;  3S3O A;  4LDV A;  2J6K A;  3QYG B;  1WNL A;  1QP2 A;  4YCV A;  2QAZ A;  5M9O A;  2AKK A;  2FRY A;  3TEH A;  2JNG A;  3JCM h;  2A8E A;  4YP0 A;  4QVZ A;  2B86 A;  1Q81 C;  3H9N A;  3V8K A;  3CCE A;  1AWW A;  5CO7 A;  4DQ2 A;  1VIE A;  5C52 B;  3L2U A;  1QVG P;  4NS5 A;  4YRG A;  2J05 A;  2MWP A;  3JCM J;  2EWN A;  12AS A;  5GAN 7;  2GFU A;  2LZ6 B;  3TEH B; 
#chains in the Genus database with same CATH homology
 3HXV A;  2I4O A;  3VV0 A;  2Y4X A;  4GY5 A;  3SFM A;  4H2X A;  4P72 C;  4DOW A;  4HWO A;  1S72 T;  3BFM A;  4PJO A;  4C92 C;  1EIY A;  1G3S A;  1NNH A;  4TVY A;  4JLG A;  1JJ2 S;  2OAU A;  5I21 A;  1LNX A;  1RI0 A;  3HFZ A;  2ZPF B;  1X6O A;  3PZC A;  4H2X B;  1H4Q A;  3O8V A;  3JB9 F;  4RG2 A;  1B7Y A;  4ELY C;  4WJ4 A;  2KAF A;  2DJZ A;  3MEW A;  1B8A A;  1X75 C;  3E19 A;  2ZXF A;  3HFZ B;  4M75 F;  5ELN A;  1B7Y B;  4QQ6 A;  2X4X A;  1VQ6 T;  4M7A G;  1QF6 A;  2EQU A;  2EQM A;  2DIQ A;  2BIV A;  4MZM A;  3CME T;  1YBY A;  3DB4 A;  4HCC A;  3RIR A;  1ZQ1 A;  3CCQ T;  4RMO A;  3FIF A;  3CCV T;  2ZPB B;  3HRU A;  4H2V A;  3G71 T;  3M9Q A;  3H8Z A;  4DPG A;  2AMC A;  1NYQ A;  1MHN A;  5D6X A;  2L3R A;  3CD6 A;  4JRP A;  1K73 U;  5GAO m;  2DU5 A;  2M1H A;  3RKX A;  3P8D A;  2Y4Y A;  2AMC B;  1Q86 C;  2GCX A;  4PJO E;  3VUB A;  4PL6 A;  2XTI A;  4ZTJ A;  2KK4 A;  2Q5I A;  3UPU A;  4YCU A;  2CJB A;  1K9M U;  5KE3 A;  5GAN j;  2PU9 B;  3BY7 A;  3E9G A;  3BW1 A;  4C8Q A;  3I7F A;  4N4I A;  2MWO A;  3OS2 A;  4FL6 A;  2ODR D;  1B34 A;  1QVG S;  2G4C A;  2EAY A;  1YJW A;  4HT8 A;  3VQX A;  1I8F A;  3QZ5 B;  1ZBX A;  4NL2 A;  4EDU A;  4C8Q B;  5C6S A;  2DTH A;  2NS6 A;  1VQK T;  2RJC A;  3QHS A;  3VYG A;  2QHU A;  4L6V 5;  3LGF A;  1B34 B;  3OYJ A;  2P0L A;  4YRC A;  4EPC A;  4M7A D;  2EFI A;  3ME9 A;  3PT9 A;  1FWZ A;  3L4G B;  5AYF A;  3OYL A;  4O5V A;  5KE2 A;  3FC3 A;  1KC8 C;  3DKM A;  1H4T A;  5J3B A;  5LJ5 j;  3MP8 A;  2QEX A;  1XTD A;  5LL6 S;  2LCC A;  1E1T A;  1KQ1 A;  2E10 A;  2MMP A;  4C92 G;  2CYZ B;  4KUD K;  2NLU A;  2QQA A;  4C92 F;  2ZIM A;  4B9X A;  5GAN f;  4KR2 A;  4PJO G;  3G4S A;  5FRM A;  1OZ2 A;  2CS7 A;  5FRO A;  2QHS A;  3SWN C;  4C8Q E;  3ASK A;  4Y91 A;  1NJ5 A;  2XKO C;  2Y90 A;  3KXT A;  5CKD A;  4G85 A;  1YCY A;  4MML A;  3URG A;  3OYH A;  2RK2 A;  1M1F A;  3JCM g;  4ZGJ B;  2C06 A;  3S3N A;  4CH4 A;  4A54 A;  3FB9 A;  2QQS A;  3I56 A;  3TEE A;  2XD0 A;  1M1K C;  1ADJ A;  4XU1 A;  2ZT7 A;  3CMQ A;  2M0O A;  4YRJ A;  5CQX A;  3M4P A;  4BY6 C;  5GAM j;  3F70 A;  4LVL A;  3HY1 A;  3HSB A;  2QA4 A;  5LJ5 f;  1KQ2 A;  4RMF A;  3JRZ A;  1YHQ A;  4RDX A;  2Q5H A;  4ZN1 A;  1HC7 A;  2PVO B;  3A8G B;  3KUF A;  5LJ3 e;  5DLO A;  2L5Q A;  4Q6G A;  3WVD B;  5D6Y A;  3A5Z A;  3QBY A;  5D6W A;  4M7D C;  2E12 A;  3JCM P;  2DD4 A;  4N4G A;  4K87 A;  3A5Y A;  2IG0 A;  11AS A;  4C92 D;  3CC7 T;  2WSC E;  2CZ6 B;  3OB9 A;  4CH3 A;  2ART A;  1YFT A;  2ZZG A;  3GIB A;  2RHS B;  4KR3 A;  2RI2 A;  4BE1 A;  1VQ5 A;  2DPP B;  3P8H A;  4BI3 A;  4YRE A;  4PJO D;  3JCM X;  3L2Q A;  2YRV A;  1SER A;  1OYX A;  3JCM c;  1UGP B;  4PLI A;  3CC4 T;  2H3J A;  2L8D A;  1D3B A;  5EG2 A;  3CPW A;  1VQM A;  4TWA A;  4RQE A;  2JN0 A;  2QQ9 A;  4BDZ A;  1I4K 1;  4C0Z A;  2F69 A;  3QXE B;  1PSF A;  4CS3 A;  4A4G A;  1K73 C;  2CZ7 B;  5GMK j;  4F7U F;  5ELO A;  4YRK A;  1D3B B;  4IUU A;  2B8A A;  1N6A A;  2DZ9 A;  4IUV A;  3QO5 A;  1WQ7 A;  1VQN A;  4M7D E;  5K1P A;  2RB6 A;  5A0G A;  4P3O A;  3CCM T;  3EAE A;  1K9M C;  1IRE B;  3GP8 A;  2FVU A;  4Z02 A;  4N0A A;  3CC2 T;  4LDX A;  2GFA A;  1H4V B;  4XEO A;  1EVK A;  2PVG B;  4ELZ C;  1EQR A;  4L59 A;  4ATO A;  2CIM A;  1X54 A;  3M5A A;  4KT0 E;  2K5L A;  3QSU A;  4PKC C;  4P74 A;  1OI1 A;  2K57 A;  3MP6 A;  2ZZE A;  2VXF A;  3A31 A;  2RD1 A;  2I4L A;  1EVL A;  3S6W A;  3ZFJ A;  1YJN A;  4XTU A;  4M7A A;  2RHY A;  2YHT A;  4XU0 A;  1VQ9 T;  3CCL A;  1BBW A;  3P8V A;  1OZ3 A;  4IUQ A;  2GF7 A;  4ZTZ B;  3JCM e;  4BW9 A;  2G3R A;  3JB9 J;  2KVQ G;  1M9S A;  4X34 A;  2KQW A;  4O2D A;  1YI2 A;  5K1X A;  3RAC A;  5GAO q;  1VQO T;  3MF1 A;  5GMK i;  3G6E A;  1WYD A;  4RCB A;  3PMI A;  1O75 A;  2VGN A;  2DXU A;  4M7A B;  4YDQ A;  5LJ3 f;  2LDM A;  5GAN d;  3BDU A;  3HKS A;  4C0G A;  4WF2 A;  4J7F A;  1Q7Y U;  2ZPE B;  3V7C A;  2EJG A;  4R55 A;  2DD5 A;  5GAO r;  1N8R C;  3NEM A;  1VQ4 A;  4M7D G;  1NJ2 A;  3I55 T;  5IT9 E;  2D0Q B;  5GAN 8;  4M77 C;  3CBO A;  2QHT A;  4YRS A;  1X01 A;  5DY9 A;  2CZ1 B;  3VU3 C;  4M75 E;  3PMT A;  2FL7 A;  4XTY A;  3HL8 A;  4E7H A;  3CCJ A;  2LC4 A;  3VJP A;  1YIJ A;  4MZP A;  1YJ9 A;  3W3S A;  4M7A E;  4P75 A;  3WXM B;  5IAY A;  5LJ5 d;  4YPF A;  1UEB A;  2KY9 A;  1VQP A;  1Z7M A;  4CS4 A;  4XK8 E;  4H2T A;  2MAM A;  2KMT A;  1G5H A;  3HFN A;  3A7R A;  3C4S A;  2BUD A;  4E7I A;  3M59 A;  3M4Y A;  4DOV A;  1N9W A;  1KHC A;  2LT4 A;  3UT1 A;  3INZ A;  3CMA A;  3IKL A;  3MEA A;  2E1H A;  1VQ8 T;  3C12 A;  2DZC A;  2EQK A;  2XDB A;  1VQL T;  2LQ8 A;  4QQD A;  3CCU T;  4UP8 A;  4AH6 A;  3GPL A;  4TQF A;  1M1K U;  3HRK A;  3X20 B;  3NFC A;  4P72 A;  4IUP A;  5GAM g;  4C92 A;  1C0A A;  2JTM A;  5GAO l;  2DQ0 A;  1E24 A;  3WVE B;  3L2W A;  4BI8 B;  4UC4 A;  3CCE T;  5FU7 B;  3OSV A;  1U1S A;  3JCM b;  4M7D D;  2O4X A;  1H3Z A;  4C92 B;  1NJ8 A;  3JB9 G;  5GAM d;  1G3W A;  5CKH A;  4P73 C;  4OGE A;  1WU7 A;  4J15 A;  4PJO B;  1EIY B;  2Q7H A;  2ZT6 A;  3DB3 A;  4M75 G;  1J5W A;  4LDY A;  4J83 A;  4A4K A;  2HD0 A;  4QQG A;  1NYR A;  1XOV A;  5DLQ E;  4IUR A;  3QII A;  2FHD A;  4XTV A;  4EMH A;  5CK9 A;  2VGM A;  1LYL A;  3CCV A;  3RKY A;  1M5Q 1;  3DLM A;  4E47 A;  2QTX A;  3E9F A;  3L2V A;  3A7U A;  1X2G A;  4M78 C;  4C92 E;  3HRS A;  1EIF A;  5I2M A;  4OP0 A;  4TVA A;  2ZR3 A;  3REU A;  4FT4 A;  3V8J A;  1KMM A;  1QVP A;  4YCW A;  3HHT B;  5KH6 A;  2BKD N;  1YIT T;  3CD6 T;  2DVE A;  4M77 F;  2XHC A;  3PNW C;  3LSQ A;  4TVA B;  2EKO A;  4HT4 A;  2Q7G A;  2K4Y A;  1NPR A;  4JRQ A;  1PYS A;  3PIO A;  1QP3 A;  4X5O A;  3RKW A;  3HP9 A;  4H2W A;  3A8H B;  3LW5 E;  2HNI A;  3JB9 D;  5C51 B;  4H2U A;  1USY C;  4FSX A;  3QO7 A;  2M16 A;  2CGH A;  4M75 D;  4E51 A;  4K88 A;  2DXC A;  4JRK A;  4XU2 A;  3J81 E;  1Q7Y C;  3JCM V;  1VQ7 T;  1YJW T;  1KQS A;  1VQZ A;  3QO3 A;  4YRO A;  4A4F A;  1KG1 A;  4J6Y A;  4H2S A;  4KUI A;  1U8R A;  4C5G A;  5GAN h;  3TEG A;  3OMC A;  3MHX A;  2ZPI B;  1YB3 A;  1BIB A;  2VV5 A;  2ZR2 A;  2OTJ A;  4JDS A;  4HWR A;  2RI3 A;  4X9C A;  3CXC A;  2J3L A;  2KSS A;  2Q7E A;  3MCA B;  5GAN 2;  4J6X A;  4L87 A;  2K3Y A;  2QEX T;  4M77 D;  4FU6 A;  1N8R U;  1NPP A;  4Y28 E;  3JB9 I;  2KDS A;  2LRQ A;  2D9T A;  4NOY A;  2ZCE A;  3HFV A;  3HPW A;  3NTK A;  4YYE A;  3G4S T;  4LD9 K;  3M4Q A;  2LQK A;  1Z7N A;  4F7U E;  2AKW A;  3OS0 A;  2ZIN A;  3NEL A;  4YRN A;  2ZPH B;  3QJ6 A;  2D6F A;  3CPW S;  4OF1 A;  1G3Y A;  3CCR T;  2AKW B;  1NZ9 A;  3JB9 H;  4C5H A;  4BY6 B;  2XGT A;  3MO8 A;  4E7J A;  2ZT8 A;  4HKE A;  4M78 F;  1G3T A;  2P0K A;  4M7D A;  4OB0 B;  5GAN 6;  3LLR A;  3OYB A;  2HQE A;  3QTC A;  4YRM A;  2X4J A;  4KBM B;  3QYH B;  2JOY A;  2K5F A;  3GLX A;  3LC0 A;  4UPA A;  1BI3 A;  2RJE A;  2AHJ B;  4M7D B;  3UFG A;  4A53 A;  4X9D A;  3A5Z B;  4A4H A;  2V8I A;  3QJY A;  2E5A A;  3MF2 A;  3WQZ A;  5GAM h;  3E9H A;  2DTI A;  1U1T A;  4TTV A;  3ERR A;  3OS5 A;  1KOG A;  3S3M A;  1VQ5 T;  3NEN A;  4C0D C;  3RMQ A;  5GAN 5;  2R5M A;  4CRI A;  4F7U G;  1ZHI A;  3T9N A;  4YRI A;  1MGQ A;  5HK0 A;  1NJI U;  2RO0 A;  1Y96 A;  4EMG A;  1M90 U;  1DJ7 B;  3UGQ A;  5FRN A;  4CS2 A;  4PG3 A;  2X4Y A;  5LJ3 j;  2YLB A;  3OYE A;  4R56 A;  4ZIB A;  5CQY A;  4EMK C;  2QHV A;  1TH7 A;  3CCM A;  4M78 D;  1IL2 A;  4YRQ A;  1M4Z A;  3OS1 A;  3PFS A;  1WPY A;  1W2B S;  2E41 A;  3HXX A;  4CH6 A;  4BWA A;  1VQN T;  1NJ6 A;  3LX7 A;  4H2Y A;  4MDW A;  2ZZF A;  1WQW A;  4RKU E;  3RMS A;  1VIF A;  1EOV A;  3LWH A;  2DIG A;  3CPF A;  3JAM E;  4M75 A;  3HRT A;  5GMK h;  3DSQ A;  4UP9 A;  2RK1 A;  3FLG A;  5CKE A;  1YFS A;  4EO4 A;  3LGL A;  2DTO A;  2RHZ A;  4OB2 B;  4P71 C;  4C5E A;  4C0F A;  1SET A;  4TQD A;  4JJN K;  4Q5W A;  5GAN g;  2RI5 A;  3OW2 A;  4M75 B;  3OA6 A;  2LCL A;  1W66 A;  4CI0 C;  2DAQ A;  4LVJ A;  4CH5 A;  3PCO A;  3CCS T;  2OTL T;  3CEY A;  1YJN T;  3IAL A;  1SRY A;  4XAX B;  4BUG A;  3CCL T;  3NTH A;  3M57 A;  2JZ2 A;  2R58 A;  2RJD A;  2CZ0 B;  4K86 A;  1JBM A;  3L42 A;  1W4S A;  3PCO B;  1YI2 T;  3G6E T;  5FU6 C;  3E1S A;  1W2B A;  1YGB A;  3P8Y A;  4P3N A;  2E65 A;  1QE0 A;  3UWN A;  4M77 A;  4XU3 A;  5L8R E;  3X28 B;  4YRR A;  3CBM A;  3OYK A;  3OQ5 A;  1BI1 A;  3UGT A;  1AHJ B;  1WGS A;  2HBP A;  3JCM Q;  2VXE A;  2ZZD A;  4M77 B;  5LJ5 g;  2DXT A;  2LTO A;  3ICA A;  1VQ4 T;  1P92 A;  4XTW A;  2MI6 A;  2M9U A;  3VQV A;  4ZTU B;  3CBP A;  1LJO A;  3VUZ A;  4XEM A;  3JCM W;  3VBB A;  2E70 A;  2CJ9 A;  2JUF A;  2R5A A;  3G7Z A;  3EFR A;  2P0Q A;  5HGQ A;  1R8O B;  3M55 A;  1WJS A;  3CCJ T;  3QPH A;  3OYG A;  2IY5 A;  1YIJ T;  3QNE A;  1YJ9 T;  3OYY A;  3L2Z A;  3GF5 A;  1G5V A;  2YLC A;  1IZ6 A;  1Y71 A;  1M8V A;  1I5L A;  2XDD A;  3M53 A;  2ZIO A;  4BI4 A;  3CCU A;  2O01 E;  4M77 E;  1X56 A;  2PQW A;  3MEV A;  3A7A A;  5GMK m;  4HA8 A;  3QO8 A;  1BIA A;  4PHC A;  3CMA T;  4ZGE B;  3A32 A;  2RHX A;  2IVW A;  1Y7X A;  1I81 A;  2ZTG A;  4P73 A;  3FRN A;  5CKB A;  1S72 A;  2DEQ A;  3IKM B;  3MET A;  3KBG A;  3OBY A;  3R07 A;  4BE2 A;  4UP7 A;  4GLK A;  1XQH A;  2ZGW A;  3KFU A;  5CAI A;  2VYT A;  4J8O A;  5FU7 C;  1V29 B;  2I4M A;  1M1G A;  1H4S A;  3JCM f;  4NCX A;  5E3I A;  4PLL A;  2I2L A;  4LVM A;  2E5Q A;  2O4X B;  4YTL A;  2ZPG B;  4LVI A;  1NJI C;  5C0M A;  4PJO C;  3ER0 A;  1M90 C;  3MEU A;  3VQY A;  4FT2 A;  2I4N A;  4LVK A;  4RCC A;  4A4E A;  1Y07 A;  1VQ6 A;  1E22 A;  5GAN e;  1WJQ A;  2ZCF B;  3PTA A;  5FLX E;  3CME A;  1K8A U;  2E64 A;  2P0P A;  3CCQ A;  4QVD A;  1XNI A;  3OYM A;  4M78 A;  1G5I A;  1KD1 U;  2RHU A;  3G71 A;  2XIC A;  1ATI A;  1KQS S;  3M54 A;  4LDU A;  1VUB A;  4NL3 A;  4M7A F;  3IG2 A;  4M78 B;  2RH2 A;  2XDP A;  4Q15 A;  1B70 A;  5GAO n;  2EJ9 A;  3FDR A;  4LD6 A;  1Q82 C;  1H64 1;  2A7Y A;  4M77 G;  3QUI A;  4ME7 A;  3SB2 A;  1YIT A;  5LJ3 g;  4KUL A;  2WSF E;  2X4W A;  1GXI E;  3CXC S;  2RM4 A;  1WLE A;  2JVV A;  1USY A;  1SES A;  1B70 B;  3VKI A;  1JRI A;  2ARS A;  1N27 A;  1JJ2 A;  5LJ5 e;  1RL2 A;  4HWP A;  4WI1 A;  4HVC A;  2DO3 A;  5LJ3 d;  3VQW A;  4BDY A;  1FYF A;  3LSS A;  1FXX A;  4TVR A;  4OVA A;  1PYS B;  1GGM A;  2K3X A;  4EX5 A;  4F7U A;  3P8B B;  5J26 A;  1VQK A;  5A2Q E;  2JTF A;  3EFS A;  2DU7 A;  1VQ7 A;  4M78 E;  3OYA A;  3ZEH A;  5HKC A;  4C8Q C;  4FM4 B;  2DKG A;  2WSE E;  5HY6 A;  1YFR A;  4F7U B;  3J80 E;  4QVC A;  4HWS A;  1X2H A;  3QG1 A;  2PUO B;  1UGS B;  3L4G A;  3LH0 A;  5A0D A;  3V7S A;  4YRP A;  1BBU A;  3HXY A;  2L89 A;  5I2S A;  3HFO A;  3R6O A;  4MMK A;  5GAM e;  4MDX A;  2EYQ A;  3MP1 A;  1LOJ A;  4V2S A;  5KNN A;  3SWN A;  4FIB A;  2P4T A;  2WAC A;  4JS5 A;  1EFW A;  2J3M A;  3TUP A;  4BE0 A;  3M4G A;  1ASZ A;  5CCA A;  2OTJ T;  3PIP A;  3UDC A;  1PSE A;  2E6N A;  3X26 B;  5GAN 3;  3SD4 A;  2CKK A;  3SWN B;  1L0W A;  2EIF A;  2CJA A;  2ZNI A;  3OYD A;  5C53 B;  2EJF A;  2MF2 A;  3FJP A;  2HAX A;  3GOX A;  4PJO F;  3SDZ A;  3A8L B;  1QVG A;  2FB7 A;  5LJ5 h;  2XI9 A;  2C7I A;  1QW1 A;  3P8T A;  2RHI A;  3X25 B;  4ZTF A;  1UB4 A;  3CCR A;  4HT9 A;  4E7K A;  3H6Z A;  4JLI A;  3V7R A;  4RG8 A;  3RGL A;  4IUT A;  4M78 G;  3I56 T;  1JJC A;  1BI0 A;  2FYK A;  2PVD B;  3HTZ A;  3BDL A;  3HXZ A;  4HWT A;  4H02 A;  3JCM d;  1UGR B;  1ASY A;  3DLL A;  3V8L A;  4TVW A;  3M58 A;  3OD1 A;  1JJC B;  5GMK e;  2QA4 T;  4OB3 B;  1YHQ T;  3UH0 A;  3PGG A;  4ZN3 A;  3RUX A;  3LYI A;  3ZBD A;  2A3L A;  4II1 A;  4BB7 A;  2XK0 A;  3CC7 A;  1SSF A;  3REX A;  1BI2 A;  1X55 A;  2RHS A;  5CKF A;  1Q81 U;  3A74 A;  3TRE A;  4G84 A;  3VYH B;  1K8A C;  1G51 A;  3TCJ A;  3TU4 K;  2P5I A;  1HXD A;  3CC4 A;  2LX9 A;  1KD1 C;  1N9S A;  3J7A F;  2ZT5 A;  4LDW A;  2XID A;  4HCB A;  1NJ1 A;  2E6Z A;  3HY0 A;  4J5Y A;  4JS4 A;  2QQR A;  4B9W A;  4C0D B;  4C8Q G;  3OW2 S;  3N5B B;  4JRI A;  2LNV A;  4MZT A;  1O9S A;  3GNF B;  4O6J A;  5J39 A;  4C8Q F;  1VQM T;  4EMK A;  4LNS A;  3HXU A;  2RHQ A;  5GAM f;  2LVM A;  3LWI A;  2ZNJ A;  5IN1 A;  3C94 A;  4ZGD B;  5HK3 A;  1Y96 B;  3A8M B;  3Q1J A;  1KHI A;  2QXF A;  4EMK B;  4JUV A;  4N4H A;  2RHQ B;  3CC2 A;  2QI2 A;  2RJF A;  5GAO p;  4OGC A;  2GQV A;  4P5N A;  4OLF A;  4L5G A;  2PMF A;  3MEY A;  1KMN A;  2EL9 A;  3HRI A;  5KCO A;  4P71 A;  4OMF B;  1Q82 U;  3JSC A;  3OYN A;  2DK3 A;  2EQJ A;  4BAC A;  3OYF A;  2RA2 A;  4VUB A;  3NET A;  3E9I A;  1QVF S;  4N0A C;  2E3C A;  4KQE A;  5LJ3 h;  3BJU A;  3RES A;  3AHU A;  4XQ3 A;  2F5K A;  1VQ9 A;  1Q86 U;  4IKF A;  2ODR C;  2XU8 A;  3OMG A;  5DM7 R;  3CCS A;  1VQO A;  2OTL A;  3QZ9 B;  4J6W A;  4M75 C;  2K2V A;  2X35 A;  4P74 C;  4XTX A;  4C8Q D;  2DQ3 A;  4C5I A;  3L1A A;  4QW2 A;  1UGQ B;  4M7A C;  2DDZ A;  4OB1 B;  2PUK B;  5GMK l;  5FU6 B;  2XG8 D;  5GAN 4;  1HK9 A;  2F5T X;  3NTI A;  2K5I A;  3GNG A;  4BD3 A;  1BKB A;  3OY9 A;  3MQZ A;  3I55 A;  1ADY A;  4P3P A;  4RQF A;  3OSS C;  4YRT A;  3OYI A;  4J7I A;  4D6W A;  1E1O A;  3RF1 A;  2LT1 A;  3X24 B;  3HXW A;  2ALY A;  1QVF A;  2QQB A;  4HCZ A;  4M7D F;  4E7L A;  3OYC A;  4PNO A;  1HTT A;  3FEO A;  5F5W A;  5CR2 A;  1KC8 U;  2C8M A;  2ALY B;  3C95 A;  2R57 A;  3RL6 A;  3G1Z A;  5CIU A;  4YRL A;  4YRF A;  5A0L A;  2HQX A;  2PME A;  2V8K A;  4XTZ A;  4DA4 A;  2DXB A;  1N9R A;  2V8J A;  5KCH A;  1BYM A;  2VC8 A;  1NE8 A;  3M56 A;  2VUB A;  1VQP T;  3RER A;  1B76 A;  4WJ3 M;  1RIQ A;  3QDR B;  5CVI A;  2ARU A;  1VQ8 A;  3L2R A;  4P75 C;  2IY5 B;  1WJR A;  1JB0 E;  1VQL A;  3A8O B;  3OBW A;  2QDY B;  1FX7 A;  3QKJ A;  3S3O A;  4LDV A;  3QYG B;  1WNL A;  1QP2 A;  4YCV A;  5M9O A;  3TEH A;  2JNG A;  3JCM h;  2A8E A;  4YP0 A;  4QVZ A;  1Q81 C;  3V8K A;  3CCE A;  5CO7 A;  4DQ2 A;  1VIE A;  5C52 B;  3L2U A;  4NS5 A;  4YRG A;  2MWP A;  3JCM J;  2EWN A;  12AS A;  5GAN 7;  2GFU A;  3TEH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...