2DTHA

The crystal structure of the orthorhombic form of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotin and adp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dthA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dthA01
3IKMB 4NOYA 4M7AC 4CH3A 3TUPA 3JCMg 5CAIA 5GAOr 3HFZA 3RKXA 4YRJA 1EFWA 2QHSA 4YDQA 3L4GA 4OLFA 3PZCA 5GANd 4TTVA 4Q15A 3JCMf 2ZNIA 2ZZGA 3SWNA 3EFRA 3RACA 4M77E 3TEHB 3V8KA 2DTIA 3SWNB 1EOVA 4KR2A 4XTZA 4DQ2A 3HRIA 3JB9F 3IKLA 2ZIMA 4L87A 5GANg 1Z7MA 4P73A 4RQEA 3RESA 2FB7A 4H2VA 4XU0A 2RHSB 1NYRA 4YRLA 3UGTA 4J6XA 2DQ0A 2RM4A 3RGLA 1B7YB 4XQ3A 2K57A 2G4CA 1NJ5A 1X54A 4M78D 3IG2A 1B7YA 4F7UA 1J5WA 4XTXA 4JRIA 3LSSA 5LJ3e 1BBWA 5ELOA 3FB9A 1SESA 1RIQA 4HT9A 2E1HA 3HSBA 2Q7HA 4Y91A 5ELNA 4RDXA 1JJCA 4YRNA 1LYLA 1W66A 3HXYA 2ZR2A 2EJFA 3A7RA 5C51B 1EQRA 4WF2A 3REXA 4TVWA 3VU3C 2QHVA 1X55A 4XU3A 4QVDA 2Q5HA 3NELA 2RA2A 1NYQA 2CJBA 1SERA 2P0LA 3A5YA 1KQ1A 2AKWA 2RHQA 4PJOB 4MMLA 1M8VA 1B70B 1NJ2A 4M7DC 1NJ6A 3M4PA 1LJOA 3HXXA 3MEYA 2ZNJA 4Q6GA 2RHQB 4PJOA 4XTUA 3VQWA 2ZCEA 4TVAA 2IY5B 3UH0A 1YFRA 2QHUA 2ZINA 4AH6A 2QTXA 4YRQA 1YCYA 4XU2A 2I4NA 1I4K1 5LJ5e 2EAYA 2P5IA 3JCMP 1QE0A 4C8QD 4XTVA 1YFTA 2XTIA 2DEQA 4HWSA 4H2TA 3L1AA 3HXVA 1X2HA 4YRKA 3HFZB 3JB9G 2DZCA 3L4GB 5GAN6 1X56A 4EMHA 3QHSA 3UFGA 5GAN2 4WI1A 4M77A 3V7SA 3REUA 4TVYA 4JLIA 1JBMA 4C8QC 1ADJA 4CS4A 4C8QG 4M7AD 3NENA 4M77B 5C52B 3JCMd 5GAN7 4PJOD 2ARTA 1E1OA 4HWTA 1NNHA 3V8JA 4HA8A 2CJ9A 2I2LA 4EX5A 4M7DD 2Y90A 4YRSA 11ASA 5DY9A 5GAMg 2EWNA 3QSUA 4XEOA 5I21A 1BBUA 5HGQA 4C8QE 1G5IA 3FJPA 4YRIA 5GAN5 3JCMJ 5GANj 4MMKA 4YCUA 4CS2A 3BJUA 4H2SA 2YLBA 3UGQA 5C53B 2ARSA 3A5ZA 4PNOA 5LJ3f 5GAMd 3ERRA 4ZTZB 3QO7A 3FIFA 3IALA 3BW1A 3JCMQ 2PMEA 4M78B 1SRYA 5KNNA 4M78A 3QUIA 4M78C 4EMGA 4M7DA 2Q5IA 2ZZEA 1N9WA 4YRCA 2I4LA 2DKGA 1HTTA 4QVCA 4P72C 3P8YA 2DTHA 4CH6A 4M75G 3RKWA 5GAN4 1L0WA 4NCXA 4NL3A 2CIMA 2Q7EA 4M7AE 2XGTA 3AHUA 2E5AA 2E65A 3I7FA 1WQ7A 4J5YA 5GANe 2J3MA 4YROA 5LJ3j 4YRGA 3E9IA 2AKWB 3V7CA 4M7AG 5GAOl 2ZT6A 4HWRA 4HVCA 5GMKh 3RERA 3HXZA 1BIAA 4M7DF 4TVAB 2IY5A 2ALYA 4YCVA 4H2XB 4P3PA 1EIYB 2VXEA 5GAMh 5GANh 4M77C 2ALYB 2ARUA 5K1PA 2QHTA 3JB9J 3M4GA 4H02A 4KQEA 2DXUA 2E64A 2ZGWA 3QNEA 2ZT7A 4RQFA 5GAMf 4UPAA 3A74A 4M78E 4RCCA 5LJ3d 3V8LA 4K87A 1Y96B 3A7AA 1N9RA 3RL6A 1QF6A 1IL2A 3HFVA 4PG3A 1Y96A 1WLEA 5GAN3 3JCMh 4XEMA 3QO5A 5GAMj 2FYKA 2C7IA 2DJZA 1ADYA 3JCMc 4X9DA 3HY1A 4A54A 4J15A 4C92G 1ATIA 5GMKm 2EL9A 4H2UA 3JCMV 4M75D 3HTZA 5GAOn 4A53A 4PJOG 2E10A 1I5LA 1C0AA 1WPYA 1H641 4P73C 4M75F 4F7UG 3HFNA 3VBBA 1USYC 1H4QA 4M78G 4BW9A 4DPGA 3JB9D 2CGHA 1HXDA 5GMKj 2I4OA 2EJ9A 4OP0A 5LJ5d 4M7AF 4M7DB 4PHCA 5E3IA 3HFOA 3DSQA 3LSQA 3P8TA 4P3NA 4M77D 3BY7A 2DTOA 4YRPA 3JB9I 3QTCA 4C92E 4LNSA 4YREA 2E41A 2ZIOA 4EMKB 2RD1A 3WQZA 4YRFA 4G84A 4EMKA 4WJ4A 4YCWA 3JCMe 4P71C 12ASA 4E51A 1EVKA 1ASYA 4P75A 4TQFA 3SWNC 4P75C 4EO4A 4YRMA 4M75E 3A32A 4H2XA 1NJ8A 3RUXA 4H2WA 1EIYA 1D3BA 1Z7NA 3L2ZA 4N0AC 1HK9A 3V7RA 1G51A 1U1SA 5F5WA 1N9SA 1U1TA 4BWAA 3P8VA 3PCOB 4J6YA 3BDUA 4H2YA 4XU1A 4TQDA 5GAMe 4C8QF 3GIBA 1YFSA 3RIRA 1WU7A 3E9HA 3PCOA 4M7DE 2ZT8A 1KMNA 3HXUA 4C92C 4C92F 4M75C 3HRKA 4J6WA 5K1XA 4YPFA 3JCMb 1GGMA 5GAOm 5LJ5j 4C92D 4ZTUB 2VXFA 4PJOF 5LJ3g 3VQXA 4YRTA 1M5Q1 4V2SA 4M77F 4P74C 4F7UF 1HC7A 3HXWA 1LOJA 1WNLA 1TH7A 4M78F 1KOGA 4YYEA 2JN0A 3JCMW 3PGGA 4O2DA 2YHTA 2VC8A 5GANf 3KFUA 1I81A 4ZIBA 4UP7A 5GAOp 1WQWA 2ZT5A 3A31A 1E24A 3TEHA 4RCBA 4CS3A 1H4SA 4JUVA 4RMFA 1FYFA 3NETA 1MGQA 1B76A 1B8AA 4XTWA 1WYDA 1G5HA 4X5OA 4EMKC 4X9CA 3QO3A 2RHSA 5LJ5f 1B34B 2YLCA 4PJOE 3W3SA 2C8MA 4JRKA 1B34A 2PMFA 4YRRA 2Q7GA 2ODRC 3EFSA 4UP8A 1I8FA 4F7UB 2DDZA 5LJ5g 1PYSA 4M7AB 5LJ5h 4P72A 3JB9H 1X2GA 4KR3A 1H4VB 4HWOA 4P74A 4N0AA 4M7AA 1PYSB 1LNXA 3NEMA 3OD1A 3RKYA 3TEGA 2ZXFA 1USYA 1KQ2A 4CH5A 1JJCB 2RB6A 1YGBA 3M4QA 3MF2A 2DQ3A 2DXTA 4C92B 4M75B 1YB3A 4WJ3M 4TWAA 5GMKi 3VQYA 4C92A 4M75A 4K88A 1KMMA 1NJ1A 4CH4A 1D3BB 1SETA 4XTYA 3G1ZA 2EJGA 2J3LA 3SB2A 2ZTGA 2E3CA 1B70A 4K86A 3ICAA 3BFMA 2CJAA 1E1TA 4UP9A 2DU7A 4M77G 4P3OA 2DZ9A 2ZR3A 1E22A 1EVLA 3A7UA 3JCMX 2I4MA 4C8QA 4NL2A 4HT8A 3RF1A 5GMKl 3QO8A 4C8QB 2AMCA 4G85A 3R07A 4P71A 1ASZA 4F7UE 2HNIA 2DVEA 2AMCB 3HY0A 2ODRD 3LC0A 1X01A 1BIBA 5GMKe 1VQZA 2ZZFA 5LJ3h 4M7DG 3CMQA 4YP0A 3VQVA 2DU5A 1JRIA 3INZA 5GAN8 5GAOq 4HWPA 1H4TA 3MF1A 4PJOC
chains in the Genus database with same CATH superfamily
5FLXE 3IKMB 3OW2A 5CKBA 4M7AC 3TUPA 3QJ6A 5CAIA 1OQKA 5GAOr 4J7FA 3L4GA 2RHZA 2YT6A 2XDDA 3OYNA 4TTVA 3PMTA 3CCQT 3PFSA 2ZNIA 1WJSA 3UT1A 3SWNA 1UFFA 2JTMA 2JS0A 3QBYA 3V8KA 4KR2A 1EOVA 3HRIA 2WSEE 3IKLA 3ULRB 5GANg 4KBMB 2LCSA 1DJ7B 1Q7YU 4H2VA 2X9HA 4XU0A 2W10A 1NYRA 3UGTA 1TWBA 1V76A 4RG2A 3CC2A 3CPFA 2PUOB 1VQMA 2K57A 3M0RA 3I5RA 1XJWB 1BBWA 4QVZA 2HQXA 2ABLA 1WFWA 3HP9A 3MEVA 1RIQA 1VQKA 1IGUA 1RAEB 2CREA 4Y91A 1BYMA 4LDUA 1W66A 3TSZA 2F5TX 2ECZA 3CCMQ 5C51B 2O4XB 3EG3A 1OU8A 2GGRA 4A4FA 2ZPBB 2QHVA 2F2WA 3C94A 4LDYA 4J9EA 4YTLA 4MZMA 4QQGA 1AZEA 1NEBA 1KQ1A 5FWCA 2AKWA 2RHQA 3C0CA 4FU6A 1BI3A 3OYCA 1VQMQ 4M7DC 2LQNA 4Q6GA 3G71T 2LNVA 4PJOA 3VQWA 2ZCEA 4TVAA 2IY5B 4QKUA 1M3AA 5IN1A 1ZA2B 3UH0A 3A8MB 3BDLA 1M90C 2YRCA 3A98A 3QWYA 1OPKA 1KHCA 4F14A 2BIVA 3P8DA 4GLKA 4C8QD 3JCMP 4KH1B 5CQXA 2ZPEB 4HCZA 4OMLA 2CP7A 4AT1B 1X2HA 5IAYA 2CZ6B 1TSFA 2DZCA 1X56A 1VQ4A 4EMHA 5GAN2 3QKJA 4WI1A 2AT1B 3V7SA 1X6OA 2SEMA 5FRNA 3U23A 4M77B 4PL6A 5C52B 4PJOD 1QKXA 2ARTA 1E1OA 3OA6A 3PT9A 2DA9A 1VQPT 1GCPA 2V1RA 2DD5A 11ASA 4LE9A 1BU1A 4XEOA 3VS6A 1Q81R 2OTJQ 2DMOA 2O88A 5HGQA 1KD1R 3FJPA 2F1LA 5GAN5 4YRIA 1N8RR 5GANj 3QWXX 1X6BA 1G3YA 3CCRQ 3JV3A 5KCOA 5GAMd 2CP0A 1SKUB 4DBRA 3LLRA 3BW1A 2PUKB 1M2VB 2HD0A 3IQLA 1W2BP 3J7AF 1QP2A 1Q81U 1GFDA 3A8LB 3X26B 2DF6A 3LH5A 4M7DA 2Q5IA 2ZZEA 1AZGB 2I4LA 4OMFB 2B86A 4NCXA 1MMGA 1SSHA 4ZGEB 3I35A 2JNGA 2E5AA 3I7FA 5GANe 3MEWA 5LJ3j 2VKNA 4LUDA 3V7CA 1OU9A 4M7AG 2J06A 4HVCA 5GMKh 3CCLT 5J26A 2DERA 1UJYA 1TG0A 1JB0E 2JS2A 3NMZC 4E7ZA 4P3PA 3CBOA 1PCXA 3OYLA 4M77C 2ALYB 3JB9J 3A8GB 4JRPA 4C0ZA 4KQEA 4KGZB 4ORZA 5LL6S 3EH2A 3RMQA 1W4SA 4A4HA 3QNEA 2O31A 3VS2A 2EGAA 5CCAA 1K9MR 4RCCA 1H3ZA 1D1AA 3T9NA 3UWNA 1N9RA 2F69A 1SHGA 1QF6A 3HFVA 1Y96A 2FPFA 4XEMA 2OX7A 2YUPA 3QO5A 2I0NA 3CCVQ 3MHXA 5GAMj 4GY5A 3CCST 4AFSC 4HCCA 3HY1A 1N6AA 2CZ7B 2DD4A 4C92G 1ATIA 1OX8A 4L6V5 3LYIA 2YDLA 3ZFJA 4OMQA 2JMCA 2ZCFB 4M75D 3HTZA 4DBQA 5IT9E 3ZL7C 5GAOn 1NBEB 1QLYA 3HPWA 1H641 1BBZA 1WGSA 3F70A 4F7UG 1MUZA 3CCLQ 2BE9B 3EAEA 1USYC 2EQMA 4KGXB 4M78G 4DPGA 2K3BA 3JB9D 2CGHA 3CBPA 1HXDA 1ZHIA 2ROTA 2I4OA 2ED0A 1QMCA 3OQ5A 5FW9A 4AMCA 3QIIA 2X4JA 1UGQB 3M55A 3HFOA 3P8TA 3LSQA 3JB9I 1Q82U 4C92E 3MP6A 2YWWA 4N4HA 5KYYB 1GCQC 3WQZA 1NYFA 4YRFA 1YHQA 1D0ZA 3CCJA 4G84A 4KUDK 2FZGB 3VKIA 3JCMe 1M90R 1ZUUA 2L2PA 4E51A 1EVKA 2A37A 1XQHA 4J9IA 4EO4A 4IUVA 1VQ5T 1QVGA 3CC2T 3I56Q 4HVUA 1NJ8A 3RUXA 3UATA 3CPWP 3I55T 1KC8R 4LDVA 4N0AC 1G51A 1VUBA 1U1SA 5F5WA 3UA6A 3WXMB 1WZOA 3CC7T 4H2YA 4C8QF 2VWFA 3RIRA 3O8VA 4L5GA 3PCOA 1GL5A 1KMNA 4J9CA 2LVMA 3HRKA 4J6WA 2RHIA 2DYBA 1XOVA 4YPFA 2JTFA 2RF0A 2EIFA 3SHWA 2KBTA 2DM1A 2F2XA 3CEYA 4PJOF 4YRTA 4P74C 3HRSA 1XNIA 5KYUB 2CP5A 1Q86R 1SEMA 1KOGA 3HKSA 5KYNA 2FZKB 2AZVA 2JN0A 3JCMW 1FMWA 3PGGA 1C6VX 4UP7A 1HD3A 3C12A 5C0MA 3OW2P 4M4ZA 1Y71A 4BDZA 1G3WA 1M9SA 1U3OA 3QYHB 4JUVA 1E6GA 4BD3A 1FYFA 3NETA 1B76A 2DX1A 2GCXA 2YRVA 1RLPC 1WXTA 4EMKC 4JS4A 5LJ5f 2L3QA 1JJ2A 4FSXA 1WDXA 4LNPA 4CRIA 2SRCA 1OV3A 2RO0A 1UB4A 3EGXA 1EZZB 4RMOA 7AT1B 4BE1A 2KMTA 2MPXC 2DDZA 2AKKA 2DPPB 4RKUE 2F2VA 5LJ5h 1X2GA 4KR3A 2D8HA 4ESRA 3QPHA 1IZ6A 3OD1A 2QDLA 4IUUA 4LD6A 1QWFA 4K11A 2RQRA 3CCVA 3TEGA 1YGBA 2DXTA 2IG0A 3VJPA 3ZEHA 1ZLMA 3VQYA 2V8IA 2PZ1A 4K88A 1VQ7T 1IHWA 1EFNA 1K8AR 3M59A 1N8RC 1K9MC 1D3BB 1SETA 3G1ZA 2EJGA 2EPDA 3VS7A 1JJ2S 4K86A 3BFMA 2L89A 2CJAA 1E1TA 2LQ8A 1VQLQ 3S3MA 4M77G 4P3OA 1CKBA 2ZR3A 2RHXA 2RQUA 1EVLA 4F16A 2KRMA 1D0XA 4OGEA 1ASZA 4G85A 3R07A 2JM9A 1I5OB 4LDWA 2DO3A 4IIMA 3LC0A 1BIBA 1VQZA 3M57A 2DU5A 1TXQA 3TEEA 1JRIA 5GAN8 3L2UA 3CMAT 2AK5A 5AT1B 4A4EA 3HFZA 4ZNXA 4YDQA 1UUEA 1X69A 4OLFA 4FM4B 4JLGA 4PK4A 4O5VA 2KROA 3QZ9B 3CC4Q 3JCMf 3H8ZA 2ZZGA 3OYHA 2C06A 1I1JA 1RAAB 2CT3A 2R5AA 4M77E 4OVAA 3OS0A 1K76A 1PKSA 3SWNB 4XTZA 2A8EA 1IO6A 1Q82R 1Z7MA 1H3HA 2YSQA 4RQEA 1YN8A 2RHSB 1UGSB 4J9BA 2HAXA 2YUQA 4PFZA 4MDWA 4YRLA 1OZ3A 2DQ0A 2RM4A 1VQ6T 3G6EA 3BE3A 3RGLA 1QW1A 2G4CA 2X3WD 2XKOC 1VQLT 5CQYA 2EQUA 4F7UA 3LSSA 5LJ3e 3FB9A 2H3EB 1SESA 1WHJA 4AFZC 4OB3B 2DL8A 1T0JA 2E1HA 2ZPFB 2XG8D 2FEIA 1JJCA 5KYWA 1LYLA 1PM3A 2KNBB 1X2KA 2CT4A 1JO8A 2EJFA 3A7RA 4R55A 1NLPC 1MV0B 1Z9QA 4WF2A 3M9QA 1NJIR 4X1VA 1KIKA 4QVDA 3NELA 1NYQA 2W0ZA 2CYZB 2P0LA 3TSWA 1M8VA 1NJ2A 1NJ6A 2RJEA 4KRTA 3MEYA 1M30A 2RHQB 1SG5A 1B07A 1YWOA 2O9SA 2G3RA 1W2BS 1VQNT 4JPBW 2L3PA 3CQTA 4ZGDB 1N5ZA 2ZINA 4AH6A 3ASKA 2QTXA 3PE0A 4RTWA 1YCYA 5KE3A 5KYXA 2EQIA 1G3TA 2OTJA 2V26A 4RTVA 2JXBA 2ATCB 1I4K1 2KR3A 2M1HA 2KI7A 5LJ5e 2RK2A 3SD4A 2P5IA 3KXTA 5FWBA 2E5KA 4D8DA 1YFTA 3LW5E 3CCRA 1XTDA 2HL3A 3G71A 4YRKA 1K8AC 2BZXA 2GF7A 3CCVT 2NUPB 4JLIA 4CS4A 4C8QC 1ADJA 3OYBA 3NENA 4HWTA 2IPOB 2CJ9A 1VQ8T 2QTVA 2Y90A 3E9FA 5DY9A 5GAMg 4LVLA 2WSCE 1BBUA 1GBQA 1YIJT 1IXDA 4C0DB 2OAUA 3PMIA 3OSVA 3TU4K 2G6FX 4CS2A 3BJUA 4H2SA 4J9DA 2YLBA 5C53B 1RADB 4GBQA 4PNOA 3ER0A 3A5ZA 2K5FA 5D6XA 2RI5A 4ZTZB 3OYKA 2JW4A 1VQNQ 3IALA 2PMEA 5C6SA 4M78B 5I2MA 2MIOA 1BCMA 2V8JA 4BY6B 1YI2T 2FL7A 1VQ9A 4JZ4A 4PLLA 3CBMA 1N9WA 1FX7A 4YRCA 4VUBA 4QVCA 2KVQG 1PRMC 2AKLA 3CCET 1L0WA 2NUTB 4EIKA 1UECA 4HVWA 2Q7EA 1CSKA 4M7AE 1X43A 5CKFA 2K5IA 3MP8A 4C0GA 2L3RA 3E9IA 3MEAA 2ZT6A 4HWRA 4HVVA 2GNCA 1BIAA 1PKTA 2A36A 4AG2C 1NJIU 2GTJA 4H2XB 4RTUA 1EIYB 2VXEA 1X2QA 5K1PA 2QA4A 2QHTA 1FWZA 3L2RA 4ME7A 3M0SA 4HXJA 2ZGWA 1W2BA 2CUBA 1AWWA 4DEXA 4UPAA 4BI4A 3A74A 4J9GA 4M78E 3MQZA 4E7SA 2VV5A 2LT1A 2JOYA 4LVIA 4JJCA 3CMET 4PG3A 1ZSZC 5GAN3 1HSQA 5A2QE 1RL2A 2D0QB 1YHQT 3G4SQ 3H0HA 2C7IA 4PJJA 2LX9A 4LD9K 2KAFA 2EYZA 2VGMA 4J15A 4IKFA 1UTIA 1LCKA 3EGUA 4AFQC 1M1KR 5GMKm 4RTZA 1ZBJA 1YJNT 4E6RA 2RQWA 3L2VA 5GJWB 4PJOG 1WPYA 2XMFA 2EGEA 1ZBXA 1G5VA 3OBYA 5A0DA 1KHIA 4RG8A 3M0QA 4CC4B 1YJWT 2YUNA 5GMKj 2EJ9A 2VVKA 2QAZA 2JMAA 1GFCA 1HJDA 2RH2A 4M77D 1I07A 2DILA 4YRPA 2NLUA 2E41A 5L8RE 2KRNA 5HCKA 1K0SA 1VQ4Q 4ZN1A 4LVMA 1ZA1B 1VOMA 1GRIA 4LDXA 2HQEA 4TQFA 4P75C 1S72T 4YRMA 2JZ2A 4LN2A 5A0GA 1VQ6A 1ZSZB 3GLXA 1Z7NA 2KYMA 3AT1B 3O5ZA 1KC8U 3H41A 2K7AA 4FW2A 4BWAA 3BDUA 4TQDA 1WXUA 2JJ9A 1YJWA 4R0KA 4ELYC 2ZT8A 1UG1A 2CH4W 2XICA 4C92C 2COWA 4C5GA 1KJWA 3URGA 2DYIA 3ME9A 1U06A 2VXFA 3S3OA 2RHUA 1MMNA 4V2SA 4M77F 2RPNA 2VB6A 4BI3A 2QA4Q 3PTAA 3VV0A 3HXWA 2KEAA 1IREB 4J83A 4M78F 4LVKA 1OZ2A 2DL4A 5HK3A 3OS1A 1JXMA 5D6YA 4O2DA 3OW2S 4II1A 1VQKT 5IHKA 2BKDN 1BI1A 2XK0A 1I81A 2Y4YA 4ZIBA 3EG9B 5GAOp 1WQWA 3CMEA 5DM7R 3A31A 1E24A 1OYXA 2ZZDA 3CCLA 3C4SA 3LWIA 2X51A 1H4SA 1Q86U 3OBWA 1G83A 4XTWA 2NUZA 1T0HA 2X4WA 1UHCA 3A8OB 3UA7A 3EHRA 3GOXA 3META 3NTHA 5HK0A 3QO3A 2JUFA 2ZPHB 1MMDA 1B34B 3W3SA 3P8BB 3UDCA 2PMFA 2CUDA 2DL7A 2ODRC 3CCSQ 1OEBA 3EGXB 1YBYA 3PIOA 5IHNA 2KSSA 4M7AB 4P72A 1AT1B 1M2OA 4HWOA 3OSSC 4P74A 3HRTA 3NEMA 1ZUYA 2J6FA 1X75C 1KQ2A 4WJ3M 4E47A 3EFOB 1RAIB 2BTTA 2OTLQ 3QYGB 2VYTA 2O4XA 1X27A 1FMKA 2V1QA 2CZ0B 5J3BA 1PSFA 4XTYA 3QJYA 2HQHA 2XHCA 2EQJA 4C5IA 3G6EQ 2DETA 5DLQE 1M90U 4AG1C 2K3YA 3PNWC 4C5HA 2KK4A 2EKOA 2FRYA 1VQPA 5J39A 1UJ0A 1KD1C 2K2MA 2MYSA 2LQKA 5FU7B 2M0OA 5IH2A 1IGQA 3FLGA 2MOXA 5GMKl 4P71A 1ZQ1A 1VQOT 3E9GA 3HY0A 5KE2A 2ODRD 2ENMA 1X01A 2ZZFA 2EYXA 2LX7A 3VYGA 5GAOq 3MF1A 5I2SA 4CC7A 2LDMA 1YITQ 2MWPA 2D0NA 1EFWA 4QT7A 2QHSA 1VQLA 3A8HB 1ZX6A 2CSQA 5GANd 4QQDA 1AHJB 3OYYA 2MK5A 2CH4A 3CXCP 3X20B 4A4GA 2DL5A 3RACA 3CCMT 3CC7Q 3TEHB 1D0YA 1TS9A 1UDLA 2GQIA 4L87A 1JXOA 2BZYA 2L0AA 2X3XD 3OYEA 1K73C 3RESA 4IUQA 1RI9A 4DBFA 4MDXA 1IRXA 1QVGS 4J6XA 3G71Q 1B7YB 3SDZA 4XQ3A 2X35A 4KULA 4M78D 3IG2A 1J5WA 4OF1A 4JRIA 4Z89A 1K9AA 1VIFA 4DEYA 2DFUA 2DAQA 2KDSA 4BY6C 4FCYA 1M1KU 3HTRA 4E2FB 1MNEA 3HSBA 2A3LA 2V8KA 2Q7HA 3KUFA 4RDXA 4PLIA 4C5EA 2JVVA 4FW1A 2ZR2A 3UF4A 2QXFA 1EQRA 2EYQA 3REXA 5FU7C 3VU3C 2Q5HA 3X24B 2RA2A 2CJBA 1KG1A 1TUCA 3A5YA 2LP5A 2E6NA 5CIUA 2RQVA 1B70B 3OB9A 3LX7A 1UGPB 1U5SA 3HXXA 1NE8A 1KK7A 4XTUA 1YJWQ 4OB1B 2FPEA 1YFRA 2QHUA 2RJDA 3J80E 2COYA 3OYIA 1X6GA 4YRQA 1JEGA 4XU2A 3M0PA 4Y28E 2I4NA 3OYFA 2EAYA 3EGDB 2O01E 3SEMA 4D6WA 2D1XA 2XTIA 2DEQA 4IUTA 4HWSA 4H2TA 2QQAA 3L1AA 3NTIA 1TU0B 1VIEA 3HXVA 1P92A 3JB9G 1YP5A 3L4GB 5GAN6 5KCHA 3UFGA 1R0BG 2PQWA 2RK1A 3OMGA 3REUA 1JBMA 3VUZA 4C8QG 2NUPA 2QEXQ 4E7LA 3JCMd 2FG0A 2O2OA 2I2LA 2FVUA 2PVOB 4EX5A 4YRSA 2K3XA 2OTLA 1J3TA 4PKCC 1YJNQ 3QSUA 5I21A 4JZ3A 2IVWA 5D7UA 4C8QE 3EG2A 1G2BA 3RBBB 2YRDA 4KGVB 1D1BA 2P84A 3JCMJ 2P4RA 1KQSA 4MMKA 2K6DA 4YCUA 2LRQA 1PSEA 3LGFA 4F17A 1GCQA 2J7IA 3UGQA 2VASA 3A5ZB 2D6FA 1Q7YC 3GBQA 3M56A 2QK0A 4M78A 4M78C 3LWHA 1K8AU 4ZTJA 4BB7A 1Y7XA 2DE0X 4P72C 1HTTA 2CP2A 4JRQA 2DTHA 4CH6A 8ATCB 5GAN4 1M1FA 4NL3A 2X4YA 3MKDA 4CI0C 4QQ6A 2XGTA 1WHKA 4IUPA 8AT1B 3AHUA 5M9OA 1QWEA 3EHQA 2NUTA 1WQ7A 4J5YA 1Z9ZA 2J3MA 1K73R 4YROA 2QDYB 3HHTB 2R57A 3TVTA 1KQSS 2P0PA 1M8MA 4BE2A 2AKWB 2R5MA 1YIJA 3RERA 1VYVA 3PVLA 4TVAB 1VQMT 2IY5A 2ROLA 1JU5C 1SPKA 4ZN3A 4YCVA 2PNIA 1UE9A 2HSPA 5GAMh 5GANh 1ACMB 1R0CB 3VRYA 3FRNA 4F04B 4ZTFA 5HKCA 2MF2A 2DXUA 2E64A 2ZT7A 2CP3A 2P0QA 5I22A 3TREA 1PRLC 3OYDA 4K87A 5ECAA 3A7AA 1K4US 3MPUB 3CC4A 1IL2A 1NZ9A 3G4SA 1WLEA 4TVRA 2XDPA 1SHFA 1MNDA 2QA4T 1RACB 1TUDA 2CDTA 2ED1A 2ESWA 2MMPA 1BCOA 3SFMA 2K9GA 2DJZA 2FO0A 3REBB 1ADYA 3JCMc 3D7SB 4X9DA 5KYUA 2C0OA 4LVJA 3G6ET 4A54A 3VS4A 1M3CA 1AWXA 3Q1JA 1H8KA 1M1GA 2EL9A 1KFZA 3S3NA 3JCMV 1NJIC 4BDYA 1UHFA 2QYZA 3NGPA 2E10A 1ABOA 1C0AA 4P73C 1OPLA 1QCNA 4M75F 5HY6A 2EYWA 1FMVA 3G1JA 3VBBA 4HCBA 2GFUA 3PVQA 4FT4A 1M2VA 2GFAA 3I55Q 1QCFA 4Z8AA 3REAB 2RQTA 1NPRA 3HRUA 4M7DB 4IURA 1Y57A 4MZTA 2L5QA 4P3NA 2HSEB 2M16A 2RI2A 4XAXB 4LNSA 4YREA 4EMKB 2QG9B 2FHDA 3DKMA 4WJ4A 4YCWA 1N8RU 4P71C 1OOTA 1MMAA 12ASA 1YIJQ 1A0NB 3WVEB 2OTLT 4P75A 3SWNC 2LCLA 4M75E 2LTOA 3A32A 5AYFA 1QVFS 5FU6B 1JQQA 3C95A 4OMPA 1Q7YR 2EW3A 1AD5A 3KBGA 2KT1A 1D3BA 2M9UA 1ZSZA 3L2ZA 2CS7A 2KE9A 2F5KA 1HK9A 2L3SA 4J7IA 5CO7A 1N9SA 4J9HA 3P8VA 4J6YA 4XU1A 4J8OA 5GAMe 2LJ0A 1YFSA 4B9WA 4IIOA 1WHHA 2ZAEA 1VQOQ 1OULA 3M53A 3MP1A 4BACA 4M75C 5CR2A 1H92A 3JCMb 2MI6A 4E7KA 2DBKA 2QGGA 5LJ5j 1RABB 3I55A 4ZTUB 2QEXA 2XDBA 2CZ1B 2AZSA 3GP8A 3MCAB 1YWPA 2XI9A 1YITT 1HC7A 1M4ZA 4BE0A 1QVFA 1LOJA 2O9VA 3I56T 2M0YA 1LVKA 3CXCA 4XK8E 3CCJT 2VC8A 4E7JA 1ZSGA 5GANf 4Q5WA 3E1SA 4C0DC 1VQOA 5GJVB 1TOVA 4RTTA 1KC8C 2DRKA 3EG9A 4UC4A 3QXEB 4A63B 3NPFA 3N5BB 3LH0A 1WYDA 4BI8B 1G5HA 1VQ6Q 4X9CA 2CSIA 2RHSA 1PHTA 2E6ZA 2E12A 1IHVA 3QG1A 4JRKA 2LZ6B 2M51A 2PU9B 1B34A 4YRRA 2Q7GA 3EFSA 4B9XA 4UP8A 4F7UB 1WHLA 1QCOA 5LJ5g 3CD6T 1AVZC 4HKEA 2QEXT 4PJNA 1I0CA 3DLLA 1PYSA 3CXCS 1G3SA 1PD0A 3M0TA 3MEUA 1H4VB 2A0FB 4N0AA 4M7AA 1LNXA 2KXCA 4ZGJB 3RKYA 1Y07A 3VS1A 1USYA 1Q82C 1JJCB 2HKQB 2M02A 3FEOA 3KFVA 4N4IA 1MV3A 3MF2A 4C92B 1EX4A 4M75B 1KSWA 4TWAA 2P0KA 5GMKi 4ANJA 2JT4A 3EFOA 2GBQA 3WVDB 2DBMA 2DRMA 2NWMA 2DL3A 3OMCA 2Y4XA 1WA7A 4FT2A 2E3CA 3VRZA 4A4KA 1VQPQ 1Q86C 2KGTA 3CCJQ 2J05A 1GXIE 1WX6A 2DU7A 2DJQA 1MHNA 1QKWA 2K4YA 2RNAA 2DZ9A 3A7UA 3JCMX 3FDRA 4C8QA 4NL2A 4HT8A 5CKHA 3RF1A 1YJ9T 3DLMA 2AMCA 2KYBA 3FC3A 4F7UE 3RDVA 1S1NA 2XIDA 2HNIA 1WI7A 1HYOA 2DVEA 4OB2B 5KYXB 3VS0A 1AWJA 3L42A 5GMKe 2PVGB 4M7DG 3CMQA 4YP0A 4DOVA 3INZA 4LXCA 5CKEA 4HWPA 3QDFA 1D1CA 4NOYA 1SRLA 2OI3A 4CH3A 3JCMg 2E3HA 3RKXA 3X28B 4YRJA 2EBPA 3CD6Q 2E3IA 3PZCA 1TUGB 2RJCA 3FJ5A 1K1ZA 2OAWA 4Q15A 1VA7A 3CCQQ 3EFRA 4FYWB 1UGVA 2XU8A 1VQNA 1ZUKA 2DTIA 4CC3A 4DQ2A 5DLOA 3JB9F 4DOWA 2ZIMA 4Y92A 4P73A 1KD1U 3L2WA 1WYXA 4FYXB 2FB7A 3OYAA 1RLQC 2YXYA 2P4TA 3H0IA 1FYNA 4JJNK 2E70A 4J9FA 4HCKA 1R8OB 1RAHB 2QI2A 3R6NA 1PD1A 1FXXA 1NJ5A 4L59A 1X54A 2FPDA 1B7YA 4XTXA 2LMJA 4WCIA 4E7IA 5ELOA 2VUBA 1KQSP 1AOJA 3CC4T 4HT9A 3CCEQ 5ELNA 1VQKQ 4YRNA 2LT4A 1O75A 3HXYA 3GNGA 2RHYA 1V29B 1BB9A 2MCNA 2DVJA 4TVWA 1X55A 4XU3A 1YCSB 2AIRB 5IXFA 3M5AA 2HDAA 1SERA 4OGCA 1VQ7Q 2LNHB 1ABQA 4FSSA 3CC2Q 4PJOB 4MMLA 4CC2A 3CD6A 2LJ1A 3M4PA 1LJOA 2ZNJA 1K0XA 1UGRB 1K73U 1T3LA 4ELZC 3CCEA 1NG2A 1W6XA 2H8HA 1O9SA 1T3SA 3JRZA 4B6MA 1VQ9T 1RUWA 3JAME 2WSFE 1WJQA 2IIMA 4AFUC 1QE0A 4XTVA 3EGDA 2LC4A 3P8HA 4EPCA 1Q81C 1ARKA 2EKHA 4FL6A 2HZYA 4JJDA 3HFZB 2CKKA 1TTHB 3QHSA 1YHQQ 2BUDA 2JTEA 2DLPA 4C0FA 4M77A 4TVYA 4M7AD 2D9TA 2KT8A 3LGLA 3VYHB 5GAN7 1AWOA 2EYYA 1F1BB 2HKNA 2B8AA 1W70A 3V8JA 4HA8A 1NNHA 1GBRA 4M7DD 1VQ5A 3QDRB 1WHGA 1C1AA 2EWNA 3JSCA 1QP3A 4FIBA 2OTJT 3CCUT 1G5IA 2J6KA 1LPLA 4WTOB 1B3QA 4OMOA 3CCRT 1SSFA 4DBHA 2ARSA 5LJ3f 4JDSA 3ERRA 1B7TA 4Z88A 4D8KA 1W1FA 2EGCA 2L8DA 2A7YA 3CMAA 3QO7A 3FIFA 2GQVA 3JCMQ 3OYJA 3CCQA 3PIPA 1SRYA 4ATOA 5KNNA 3OYGA 1V1CA 3QUIA 2WACA 4EMGA 1BK2A 3OS5A 4RUGA 5KYWB 2DKGA 3P8YA 1BI2A 5I11A 4M75G 3RKWA 2HL5C 2CIMA 1YITA 2QQRA 2E65A 3CCSA 4P5NA 4HT4A 2KXDA 4YRGA 2ZPGB 4FYVB 5GAOl 4PJLA 3G4ST 3RNJA 3NFCA 3HXZA 3ZBDA 4M7DF 2NS6A 2A08A 1C0MA 2ALYA 4EDUA 4KH0B 3CCMA 5L23A 2K2VA 2DXBA 2ARUA 3EG0A 2RMOA 2Z0WA 1RAGB 3A1PA 3M4GA 5FRMA 4H02A 3I56A 3CCUQ 4PJMA 1YJNA 1JJ2P 3MJXA 2HBPA 3TQ7P 3QZ5B 3DB3A 4X34A 4RQFA 1VQ8A 2MAMA 3M58A 5GAMf 1VQ7A 3V8LA 1E7OA 1R77A 4LUEA 2BE7D 5LJ3d 1Y96B 4PFPA 3RL6A 1RAFB 5FU6C 2DK3A 5CVIA 3CMAQ 3TCJA 3JCMh 4OB0B 1QVFP 2FYKA 4DA4A 3M54A 2RI3A 5IHIA 1VYUA 1WXBA 2J6OA 3UPUA 1Q95G 1M27C 1S72A 1SRMA 2XD0A 2E5QA 2QQBA 4H2UA 1QVPA 1SF9A 1QVGP 3E19A 4A53A 1OX9A 1I5LA 1U8RA 2C0TA 3HFNA 2R58A 1H4QA 4BW9A 2DIGA 3CC7A 2QQSA 3OYMA 3CMEQ 4OP0A 5LJ5d 4M7AF 2FRWA 4JJBA 1AEYA 2HMAA 1G8XA 2PTKA 4PHCA 1E6HA 5E3IA 3HL8A 3DSQA 6AT1B 3BY7A 1NPPA 1WJRA 2DTOA 5KYYA 3M0UA 2DIQA 3QTCA 3RMSA 2AHJB 1EIFA 3E2UA 2ZIOA 3GF5A 4KT0E 2RD1A 4EMKA 1D09B 2DNUA 2KQWA 1ASYA 2E4HA 1BKBA 2CP6A 2DXCA 1WHMA 2YUOA 4KUIA 4H2XA 2PVDB 4H2WA 1EIYA 3L2QA 4O6JA 2QGFB 2DEUA 3J81E 3H0FA 3M4YA 3V7RA 2MWOA 1U1TA 2JM8A 2BZ8A 3CPWS 3PCOB 3GIBA 2LJ3A 3S6WA 9ATCB 1WU7A 3E9HA 4M7DE 1M3BA 3HXUA 4C92F 2COZA 4RTXA 3NHNA 5K1XA 1H4TA 2OJ2A 4BUGA 1GGMA 3G7ZA 2NYSA 2KY9A 5GAOm 4C92D 4NS5A 5CKDA 5LJ3g 3VQXA 2RN8A 3VS3A 2X4XA 1M5Q1 3H9NA 3VS5A 1CKAA 2EQKA 4F7UF 1IB8A 2RJFA 3THKA 1NYGA 3I5SA 1WNLA 1PWTA 4N4GA 1TH7A 1YI2A 4YYEA 1NM7A 2D8JA 2GTOA 5FROA 5KH6A 1VQ8Q 2YHTA 4JS5A 2A28A 3KFUA 1RI0A 1YJ9A 2HBWA 2ZPIB 1K9MU 1VYTA 3EG1A 3OS2A 2FZCB 3H6ZA 3R6OA 2H3JA 2ZT5A 3TEHA 1QQJA 1YFNA 4RCBA 4CS3A 3OY9A 4RMFA 1MGQA 1B8AA 1UEBA 2KRSA 1PC0A 1N27A 1BI0A 4X5OA 1NEGA 1PNJA 2LQWA 3X25B 2K5LA 2YLCA 4PJOE 1Y0MA 1M1KC 2C8MA 4OMNA 1PG5B 5EC7A 5EG2A 3GNFB 1YI2Q 4R56A 1I8FA 2C0IA 4MZPA 2QQ9A 3DB4A 2LCCA 4GLMA 3JB9H 5IXBA 4RTYA 2EVRA 1PYSB 4E7HA 2VGNA 2ZXFA 2HCKA 4CH5A 1VQ4T 2RB6A 3M4QA 2DQ3A 1YB3A 3GPLA 5D6WA 5A0LA 4C92A 4M75A 2HEQA 1S72Q 1KMMA 1VQ5Q 1NJ1A 4CH4A 1OI1A 2EFIA 2J3LA 3EH1A 3NTKA 3SB2A 2ZTGA 3CCUA 1B70A 1WIEA 3MO8A 3ICAA 2K79A 4UP9A 3VUBA 1NLOC 1E22A 2I4MA 1WLPB 1YJ9Q 4OMMA 3QO8A 4C8QB 1YNZA 1VQ9Q 2AMCB 4FYYB 3CPWA 4Z02A 3I9QA 5LJ3h 4PFOA 3VQVA 3RR6A 2QASA 4QW2A 5CK9A 4PJOC
chains in the Genus database with same CATH topology
5FLXE 3IKMB 3OW2A 5CKBA 4M7AC 3TUPA 3QJ6A 5CAIA 5GAOr 4J7FA 3L4GA 2RHZA 2XDDA 3OYNA 4TTVA 3PMTA 3CCQT 3PFSA 2ZNIA 1WJSA 3UT1A 3SWNA 2JTMA 3QBYA 3V8KA 4KR2A 1EOVA 3HRIA 2WSEE 3IKLA 5GANg 4KBMB 1DJ7B 1Q7YU 4H2VA 4XU0A 1NYRA 3UGTA 4RG2A 3CC2A 3CPFA 2PUOB 1VQMA 2K57A 1BBWA 4QVZA 2HQXA 3HP9A 3MEVA 1RIQA 1VQKA 4Y91A 1BYMA 4LDUA 1W66A 2F5TX 5C51B 2O4XB 4A4FA 2ZPBB 2QHVA 3C94A 4LDYA 4YTLA 4MZMA 4QQGA 1KQ1A 2AKWA 2RHQA 4FU6A 1BI3A 3OYCA 4M7DC 4Q6GA 3G71T 2LNVA 4PJOA 3VQWA 2ZCEA 4TVAA 2IY5B 5IN1A 3UH0A 3A8MB 3BDLA 1M90C 1KHCA 2BIVA 3P8DA 4GLKA 4C8QD 3JCMP 5CQXA 2ZPEB 4HCZA 1X2HA 5IAYA 2CZ6B 2DZCA 1X56A 1VQ4A 4EMHA 5GAN2 3QKJA 4WI1A 3V7SA 1X6OA 5FRNA 4M77B 4PL6A 5C52B 4PJOD 2ARTA 1E1OA 3OA6A 3PT9A 1VQPT 2DD5A 11ASA 4XEOA 5HGQA 3FJPA 4YRIA 5GAN5 5GANj 1G3YA 5KCOA 5GAMd 3LLRA 3BW1A 2PUKB 2HD0A 3J7AF 1QP2A 1Q81U 3A8LB 3X26B 4M7DA 2Q5IA 2ZZEA 2I4LA 4OMFB 4NCXA 4ZGEB 2JNGA 2E5AA 3I7FA 5GANe 3MEWA 5LJ3j 3V7CA 4M7AG 4HVCA 5GMKh 3CCLT 5J26A 1JB0E 4P3PA 3CBOA 3OYLA 4M77C 2ALYB 3JB9J 3A8GB 4JRPA 4C0ZA 4KQEA 5LL6S 3RMQA 1W4SA 4A4HA 3QNEA 5CCAA 4RCCA 1H3ZA 3UWNA 3T9NA 1N9RA 2F69A 1QF6A 3HFVA 1Y96A 4XEMA 3QO5A 3MHXA 5GAMj 4GY5A 3CCST 4HCCA 3HY1A 1N6AA 2CZ7B 2DD4A 4C92G 1ATIA 4L6V5 3LYIA 3ZFJA 2ZCFB 4M75D 3HTZA 5IT9E 5GAOn 3HPWA 1H641 1WGSA 3F70A 4F7UG 3EAEA 1USYC 2EQMA 4M78G 4DPGA 3JB9D 2CGHA 3CBPA 1HXDA 1ZHIA 2I4OA 3OQ5A 3QIIA 2X4JA 1UGQB 3M55A 3HFOA 3P8TA 3LSQA 3JB9I 1Q82U 4C92E 3MP6A 4N4HA 3WQZA 4YRFA 1YHQA 3CCJA 4G84A 4KUDK 3VKIA 3JCMe 4E51A 1EVKA 1XQHA 4EO4A 4IUVA 1VQ5T 1QVGA 3CC2T 1NJ8A 3RUXA 3I55T 4LDVA 4N0AC 1G51A 1U1SA 1VUBA 5F5WA 3WXMB 3CC7T 4H2YA 4C8QF 3RIRA 3O8VA 4L5GA 3PCOA 1KMNA 2LVMA 3HRKA 4J6WA 2RHIA 1XOVA 4YPFA 2JTFA 2EIFA 3CEYA 4PJOF 4YRTA 4P74C 3HRSA 1XNIA 1KOGA 3HKSA 2JN0A 3JCMW 3PGGA 4UP7A 3C12A 5C0MA 1Y71A 4BDZA 1G3WA 1M9SA 3QYHB 4JUVA 4BD3A 1FYFA 3NETA 1B76A 2GCXA 2YRVA 4EMKC 4JS4A 5LJ5f 1JJ2A 4FSXA 4CRIA 2RO0A 1UB4A 4RMOA 4BE1A 2KMTA 2DDZA 2DPPB 4RKUE 5LJ5h 1X2GA 4KR3A 3QPHA 1IZ6A 3OD1A 4IUUA 4LD6A 3CCVA 3TEGA 1YGBA 2DXTA 2IG0A 3VJPA 3ZEHA 3VQYA 2V8IA 4K88A 1VQ7T 3M59A 1N8RC 1K9MC 1D3BB 1SETA 3G1ZA 2EJGA 1JJ2S 4K86A 3BFMA 2L89A 2CJAA 1E1TA 2LQ8A 3S3MA 4M77G 4P3OA 2ZR3A 2RHXA 1EVLA 4OGEA 1ASZA 4G85A 3R07A 4LDWA 2DO3A 3LC0A 1BIBA 1VQZA 3M57A 2DU5A 3TEEA 1JRIA 5GAN8 3L2UA 3CMAT 4A4EA 3HFZA 4YDQA 4OLFA 4FM4B 4JLGA 4O5VA 3QZ9B 3JCMf 3H8ZA 2ZZGA 3OYHA 2C06A 3OS0A 2R5AA 4M77E 4OVAA 3SWNB 4XTZA 2A8EA 1Z7MA 4RQEA 2RHSB 1UGSB 2HAXA 4MDWA 4YRLA 1OZ3A 2DQ0A 2RM4A 1VQ6T 3G6EA 3RGLA 1QW1A 2G4CA 2XKOC 1VQLT 5CQYA 2EQUA 4F7UA 3LSSA 5LJ3e 3FB9A 1SESA 4OB3B 2E1HA 2ZPFB 2XG8D 1JJCA 1LYLA 2EJFA 3A7RA 4R55A 4WF2A 3M9QA 4QVDA 3NELA 1NYQA 2CYZB 2P0LA 1M8VA 1NJ2A 1NJ6A 2RJEA 3MEYA 2RHQB 1VQNT 2G3RA 1W2BS 4ZGDB 2ZINA 4AH6A 3ASKA 2QTXA 1YCYA 5KE3A 1G3TA 2OTJA 1I4K1 2M1HA 5LJ5e 2RK2A 3SD4A 2P5IA 3KXTA 1YFTA 3LW5E 3CCRA 1XTDA 3G71A 4YRKA 1K8AC 2GF7A 3CCVT 4JLIA 4CS4A 4C8QC 1ADJA 3OYBA 3NENA 4HWTA 2CJ9A 1VQ8T 2Y90A 3E9FA 5DY9A 5GAMg 4LVLA 2WSCE 1BBUA 1YIJT 4C0DB 2OAUA 3PMIA 3OSVA 3TU4K 4CS2A 3BJUA 4H2SA 2YLBA 5C53B 3A5ZA 4PNOA 3ER0A 2K5FA 5D6XA 2RI5A 4ZTZB 3OYKA 3IALA 2PMEA 5C6SA 4M78B 5I2MA 2V8JA 4BY6B 1YI2T 2FL7A 1VQ9A 4PLLA 3CBMA 1N9WA 1FX7A 4YRCA 4VUBA 4QVCA 2KVQG 3CCET 1L0WA 2Q7EA 4M7AE 5CKFA 2K5IA 3MP8A 4C0GA 2L3RA 3E9IA 3MEAA 2ZT6A 4HWRA 1BIAA 1NJIU 4H2XB 1EIYB 2VXEA 5K1PA 2QA4A 2QHTA 1FWZA 3L2RA 4ME7A 2ZGWA 1W2BA 4UPAA 4BI4A 3A74A 4M78E 3MQZA 2VV5A 2LT1A 2JOYA 4LVIA 3CMET 4PG3A 5GAN3 5A2QE 1RL2A 2D0QB 1YHQT 2C7IA 2LX9A 4LD9K 2KAFA 2VGMA 4J15A 4IKFA 5GMKm 1YJNT 3L2VA 4PJOG 1WPYA 1ZBXA 1G5VA 3OBYA 5A0DA 1KHIA 4RG8A 1YJWT 5GMKj 2EJ9A 2RH2A 4M77D 4YRPA 2NLUA 2E41A 5L8RE 4ZN1A 4LVMA 4LDXA 2HQEA 4TQFA 4P75C 1S72T 4YRMA 2JZ2A 5A0GA 1VQ6A 3GLXA 1Z7NA 1KC8U 4BWAA 3BDUA 4TQDA 1YJWA 4ELYC 2ZT8A 2XICA 4C92C 4C5GA 3URGA 3ME9A 2VXFA 3S3OA 2RHUA 4V2SA 4M77F 4BI3A 3PTAA 3VV0A 3HXWA 1IREB 4J83A 4M78F 4LVKA 1OZ2A 5HK3A 3OS1A 5D6YA 4O2DA 3OW2S 4II1A 1VQKT 2BKDN 1BI1A 2XK0A 1I81A 2Y4YA 4ZIBA 5GAOp 1WQWA 3CMEA 5DM7R 3A31A 1E24A 1OYXA 2ZZDA 3CCLA 3C4SA 3LWIA 1H4SA 1Q86U 3OBWA 4XTWA 2X4WA 3A8OB 3GOXA 3META 3NTHA 5HK0A 3QO3A 2JUFA 2ZPHB 1B34B 3W3SA 3P8BB 3UDCA 2PMFA 2ODRC 1YBYA 3PIOA 2KSSA 4M7AB 4P72A 4HWOA 3OSSC 4P74A 3HRTA 3NEMA 1X75C 1KQ2A 4WJ3M 4E47A 3QYGB 2VYTA 2O4XA 2CZ0B 5J3BA 1PSFA 4XTYA 3QJYA 2XHCA 2EQJA 4C5IA 5DLQE 1M90U 2K3YA 3PNWC 4C5HA 2EKOA 2KK4A 1VQPA 5J39A 1KD1C 5FU7B 2LQKA 2M0OA 3FLGA 5GMKl 4P71A 1ZQ1A 1VQOT 3E9GA 3HY0A 5KE2A 2ODRD 1X01A 2ZZFA 3VYGA 5GAOq 3MF1A 5I2SA 2LDMA 2MWPA 1EFWA 2QHSA 1VQLA 3A8HB 5GANd 4QQDA 1AHJB 3OYYA 3X20B 4A4GA 3RACA 3CCMT 3TEHB 4L87A 3OYEA 1K73C 3RESA 4IUQA 4MDXA 1QVGS 4J6XA 1B7YB 3SDZA 4XQ3A 2X35A 4KULA 4M78D 3IG2A 1J5WA 4OF1A 4JRIA 1VIFA 2KDSA 2DAQA 4BY6C 1M1KU 3HSBA 2A3LA 2V8KA 2Q7HA 3KUFA 4RDXA 4PLIA 4C5EA 2JVVA 2ZR2A 2QXFA 1EQRA 2EYQA 3REXA 5FU7C 3VU3C 2Q5HA 3X24B 2RA2A 2CJBA 1KG1A 3A5YA 2E6NA 5CIUA 1B70B 3OB9A 3LX7A 1UGPB 3HXXA 1NE8A 4XTUA 4OB1B 1YFRA 2QHUA 2RJDA 3J80E 3OYIA 4YRQA 4XU2A 4Y28E 2I4NA 3OYFA 2EAYA 2O01E 4D6WA 2XTIA 2DEQA 4IUTA 4HWSA 4H2TA 2QQAA 3L1AA 3NTIA 1VIEA 3HXVA 1P92A 3JB9G 3L4GB 5GAN6 5KCHA 3UFGA 2PQWA 2RK1A 3OMGA 3REUA 1JBMA 3VUZA 4C8QG 4E7LA 3JCMd 2I2LA 2FVUA 2PVOB 4EX5A 4YRSA 2K3XA 2OTLA 4PKCC 3QSUA 5I21A 2IVWA 4C8QE 3JCMJ 1KQSA 4MMKA 4YCUA 2LRQA 1PSEA 3LGFA 3UGQA 3A5ZB 2D6FA 1Q7YC 3M56A 4M78A 4M78C 3LWHA 1K8AU 4ZTJA 4BB7A 1Y7XA 4P72C 1HTTA 4JRQA 2DTHA 4CH6A 5GAN4 1M1FA 4NL3A 2X4YA 4CI0C 4QQ6A 2XGTA 4IUPA 3AHUA 5M9OA 1WQ7A 4J5YA 2J3MA 4YROA 2QDYB 3HHTB 2R57A 1KQSS 2P0PA 4BE2A 2AKWB 2R5MA 1YIJA 3RERA 4TVAB 1VQMT 2IY5A 4ZN3A 4YCVA 5GAMh 5GANh 3FRNA 4ZTFA 5HKCA 2MF2A 2DXUA 2E64A 2ZT7A 2P0QA 3TREA 3OYDA 4K87A 3A7AA 3CC4A 1IL2A 1NZ9A 3G4SA 1WLEA 4TVRA 2XDPA 2QA4T 2MMPA 3SFMA 2DJZA 1ADYA 3JCMc 4LVJA 4X9DA 3G6ET 4A54A 3Q1JA 1M1GA 2EL9A 3S3NA 3JCMV 1NJIC 4BDYA 2E10A 1C0AA 4P73C 4M75F 5HY6A 3VBBA 4HCBA 2GFUA 4FT4A 2GFAA 1NPRA 3HRUA 4M7DB 4IURA 4MZTA 2L5QA 4P3NA 2M16A 2RI2A 4XAXB 4LNSA 4YREA 4EMKB 2FHDA 3DKMA 4WJ4A 4YCWA 1N8RU 4P71C 12ASA 3WVEB 2OTLT 4P75A 3SWNC 2LCLA 4M75E 2LTOA 3A32A 5AYFA 1QVFS 5FU6B 3C95A 3KBGA 1D3BA 2M9UA 3L2ZA 2CS7A 2F5KA 1HK9A 4J7IA 5CO7A 1N9SA 3P8VA 4J6YA 4XU1A 4J8OA 5GAMe 1YFSA 4B9WA 3M53A 3MP1A 4BACA 4M75C 5CR2A 3JCMb 2MI6A 4E7KA 5LJ5j 3I55A 4ZTUB 2QEXA 2XDBA 2CZ1B 3GP8A 1YITT 2XI9A 3MCAB 1HC7A 1M4ZA 4BE0A 1QVFA 1LOJA 3I56T 3CXCA 4XK8E 3CCJT 2VC8A 4E7JA 5GANf 4Q5WA 3E1SA 4C0DC 1VQOA 1KC8C 4UC4A 3QXEB 3N5BB 3LH0A 1WYDA 4BI8B 1G5HA 4X9CA 2RHSA 2E6ZA 2E12A 3QG1A 4JRKA 2PU9B 1B34A 4YRRA 2Q7GA 3EFSA 4UP8A 4B9XA 4F7UB 3CD6T 5LJ5g 4HKEA 2QEXT 3DLLA 1PYSA 3CXCS 1G3SA 3MEUA 1H4VB 4N0AA 4M7AA 1LNXA 4ZGJB 3RKYA 1Y07A 1USYA 1Q82C 1JJCB 3FEOA 4N4IA 3MF2A 4C92B 4M75B 4TWAA 2P0KA 5GMKi 3WVDB 3OMCA 2Y4XA 4FT2A 2E3CA 4A4KA 1Q86C 1GXIE 2DU7A 1MHNA 2K4YA 2DZ9A 3A7UA 3JCMX 3FDRA 4C8QA 4NL2A 4HT8A 5CKHA 3RF1A 1YJ9T 3DLMA 2AMCA 3FC3A 4F7UE 2XIDA 2HNIA 2DVEA 4OB2B 3L42A 5GMKe 2PVGB 4M7DG 3CMQA 4YP0A 4DOVA 3INZA 5CKEA 4HWPA 4NOYA 4CH3A 3JCMg 3X28B 3RKXA 4YRJA 3PZCA 2RJCA 4Q15A 3EFRA 2XU8A 1VQNA 2DTIA 4DQ2A 5DLOA 3JB9F 4DOWA 2ZIMA 4P73A 1KD1U 3L2WA 2FB7A 3OYAA 2P4TA 4JJNK 2E70A 1R8OB 2QI2A 1FXXA 1NJ5A 4L59A 1X54A 1B7YA 4XTXA 4E7IA 5ELOA 2VUBA 3CC4T 4HT9A 5ELNA 4YRNA 2LT4A 1O75A 3HXYA 3GNGA 2RHYA 1V29B 4TVWA 1X55A 4XU3A 3M5AA 1SERA 4OGCA 4PJOB 4MMLA 3CD6A 3M4PA 1LJOA 2ZNJA 1UGRB 1K73U 4ELZC 3CCEA 1O9SA 3JRZA 1VQ9T 3JAME 2WSFE 1WJQA 1QE0A 4XTVA 2LC4A 3P8HA 4EPCA 1Q81C 4FL6A 3HFZB 2CKKA 3QHSA 2BUDA 4C0FA 4M77A 4TVYA 4M7AD 2D9TA 3LGLA 3VYHB 5GAN7 2B8AA 1NNHA 3V8JA 4HA8A 4M7DD 1VQ5A 3QDRB 2EWNA 3JSCA 1QP3A 4FIBA 2OTJT 3CCUT 1G5IA 2ARSA 3CCRT 1SSFA 5LJ3f 4JDSA 3ERRA 3CMAA 2L8DA 2A7YA 3QO7A 3FIFA 2GQVA 3JCMQ 3OYJA 3CCQA 3PIPA 1SRYA 4ATOA 5KNNA 3OYGA 3QUIA 2WACA 4EMGA 3OS5A 2DKGA 3P8YA 1BI2A 4M75G 3RKWA 2CIMA 1YITA 2QQRA 2E65A 3CCSA 4P5NA 4HT4A 4YRGA 2ZPGB 5GAOl 3G4ST 3NFCA 3HXZA 3ZBDA 4M7DF 2NS6A 2ALYA 4EDUA 3CCMA 2K2VA 2DXBA 2ARUA 3M4GA 5FRMA 4H02A 3I56A 1YJNA 2HBPA 3QZ5B 3DB3A 4X34A 4RQFA 1VQ8A 2MAMA 3M58A 5GAMf 1VQ7A 3V8LA 5LJ3d 1Y96B 3RL6A 5FU6C 2DK3A 5CVIA 3TCJA 3JCMh 4OB0B 2FYKA 4DA4A 3M54A 2RI3A 3UPUA 1S72A 2XD0A 2E5QA 2QQBA 4H2UA 1QVPA 3E19A 4A53A 1I5LA 1U8RA 3HFNA 2R58A 1H4QA 4BW9A 2DIGA 3CC7A 2QQSA 3OYMA 4OP0A 5LJ5d 4M7AF 4PHCA 5E3IA 3HL8A 3DSQA 3BY7A 1NPPA 1WJRA 2DTOA 3QTCA 2DIQA 3RMSA 2AHJB 1EIFA 2ZIOA 3GF5A 4KT0E 2RD1A 4EMKA 2KQWA 1ASYA 1BKBA 2DXCA 4KUIA 4H2XA 2PVDB 4H2WA 1EIYA 3L2QA 4O6JA 3J81E 3M4YA 3V7RA 2MWOA 1U1TA 3CPWS 3PCOB 3GIBA 3S6WA 1WU7A 3E9HA 4M7DE 3HXUA 4C92F 5K1XA 1GGMA 4BUGA 3G7ZA 2KY9A 5GAOm 4C92D 4NS5A 5CKDA 5LJ3g 3VQXA 2X4XA 1M5Q1 2EQKA 4F7UF 2RJFA 1WNLA 4N4GA 1TH7A 1YI2A 4YYEA 5FROA 5KH6A 2YHTA 4JS5A 3KFUA 1RI0A 1YJ9A 2ZPIB 1K9MU 3OS2A 3H6ZA 3R6OA 2H3JA 2ZT5A 3TEHA 4RCBA 4CS3A 3OY9A 4RMFA 1MGQA 1B8AA 1UEBA 1N27A 1BI0A 4X5OA 3X25B 2K5LA 2YLCA 4PJOE 1M1KC 2C8MA 5EG2A 3GNFB 4R56A 1I8FA 4MZPA 2QQ9A 3DB4A 2LCCA 3JB9H 1PYSB 4E7HA 2VGNA 2ZXFA 4CH5A 1VQ4T 2RB6A 3M4QA 2DQ3A 1YB3A 3GPLA 5D6WA 5A0LA 4C92A 4M75A 1KMMA 1NJ1A 4CH4A 1OI1A 2EFIA 2J3LA 3SB2A 3NTKA 2ZTGA 3CCUA 1B70A 3ICAA 3MO8A 4UP9A 3VUBA 1E22A 2I4MA 3QO8A 4C8QB 2AMCB 3CPWA 4Z02A 5LJ3h 3VQVA 1H4TA 4QW2A 5CK9A 4PJOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKM B;  4NOY A;  4M7A C;  4CH3 A;  3TUP A;  3JCM g;  5CAI A;  5GAO r;  3HFZ A;  3RKX A;  4YRJ A;  1EFW A;  2QHS A;  4YDQ A;  3L4G A;  4OLF A;  3PZC A;  5GAN d;  4TTV A;  4Q15 A;  3JCM f;  2ZNI A;  2ZZG A;  3SWN A;  3EFR A;  3RAC A;  4M77 E;  3TEH B;  3V8K A;  2DTI A;  3SWN B;  1EOV A;  4KR2 A;  4XTZ A;  4DQ2 A;  3HRI A;  3JB9 F;  3IKL A;  2ZIM A;  4L87 A;  5GAN g;  1Z7M A;  4P73 A;  4RQE A;  3RES A;  2FB7 A;  4H2V A;  4XU0 A;  2RHS B;  1NYR A;  4YRL A;  3UGT A;  4J6X A;  2DQ0 A;  2RM4 A;  3RGL A;  1B7Y B;  4XQ3 A;  2K57 A;  2G4C A;  1NJ5 A;  1X54 A;  4M78 D;  3IG2 A;  1B7Y A;  4F7U A;  1J5W A;  4XTX A;  4JRI A;  3LSS A;  5LJ3 e;  1BBW A;  5ELO A;  3FB9 A;  1SES A;  1RIQ A;  4HT9 A;  2E1H A;  3HSB A;  2Q7H A;  4Y91 A;  5ELN A;  4RDX A;  1JJC A;  4YRN A;  1LYL A;  1W66 A;  3HXY A;  2ZR2 A;  2EJF A;  3A7R A;  5C51 B;  1EQR A;  4WF2 A;  3REX A;  4TVW A;  3VU3 C;  2QHV A;  1X55 A;  4XU3 A;  4QVD A;  2Q5H A;  3NEL A;  2RA2 A;  1NYQ A;  2CJB A;  1SER A;  2P0L A;  3A5Y A;  1KQ1 A;  2AKW A;  2RHQ A;  4PJO B;  4MML A;  1M8V A;  1B70 B;  1NJ2 A;  4M7D C;  1NJ6 A;  3M4P A;  1LJO A;  3HXX A;  3MEY A;  2ZNJ A;  4Q6G A;  2RHQ B;  4PJO A;  4XTU A;  3VQW A;  2ZCE A;  4TVA A;  2IY5 B;  3UH0 A;  1YFR A;  2QHU A;  2ZIN A;  4AH6 A;  2QTX A;  4YRQ A;  1YCY A;  4XU2 A;  2I4N A;  1I4K 1;  5LJ5 e;  2EAY A;  2P5I A;  3JCM P;  1QE0 A;  4C8Q D;  4XTV A;  1YFT A;  2XTI A;  2DEQ A;  4HWS A;  4H2T A;  3L1A A;  3HXV A;  1X2H A;  4YRK A;  3HFZ B;  3JB9 G;  2DZC A;  3L4G B;  5GAN 6;  1X56 A;  4EMH A;  3QHS A;  3UFG A;  5GAN 2;  4WI1 A;  4M77 A;  3V7S A;  3REU A;  4TVY A;  4JLI A;  1JBM A;  4C8Q C;  1ADJ A;  4CS4 A;  4C8Q G;  4M7A D;  3NEN A;  4M77 B;  5C52 B;  3JCM d;  5GAN 7;  4PJO D;  2ART A;  1E1O A;  4HWT A;  1NNH A;  3V8J A;  4HA8 A;  2CJ9 A;  2I2L A;  4EX5 A;  4M7D D;  2Y90 A;  4YRS A;  11AS A;  5DY9 A;  5GAM g;  2EWN A;  3QSU A;  4XEO A;  5I21 A;  1BBU A;  5HGQ A;  4C8Q E;  1G5I A;  3FJP A;  4YRI A;  5GAN 5;  3JCM J;  5GAN j;  4MMK A;  4YCU A;  4CS2 A;  3BJU A;  4H2S A;  2YLB A;  3UGQ A;  5C53 B;  2ARS A;  3A5Z A;  4PNO A;  5LJ3 f;  5GAM d;  3ERR A;  4ZTZ B;  3QO7 A;  3FIF A;  3IAL A;  3BW1 A;  3JCM Q;  2PME A;  4M78 B;  1SRY A;  5KNN A;  4M78 A;  3QUI A;  4M78 C;  4EMG A;  4M7D A;  2Q5I A;  2ZZE A;  1N9W A;  4YRC A;  2I4L A;  2DKG A;  1HTT A;  4QVC A;  4P72 C;  3P8Y A;  2DTH A;  4CH6 A;  4M75 G;  3RKW A;  5GAN 4;  1L0W A;  4NCX A;  4NL3 A;  2CIM A;  2Q7E A;  4M7A E;  2XGT A;  3AHU A;  2E5A A;  2E65 A;  3I7F A;  1WQ7 A;  4J5Y A;  5GAN e;  2J3M A;  4YRO A;  5LJ3 j;  4YRG A;  3E9I A;  2AKW B;  3V7C A;  4M7A G;  5GAO l;  2ZT6 A;  4HWR A;  4HVC A;  5GMK h;  3RER A;  3HXZ A;  1BIA A;  4M7D F;  4TVA B;  2IY5 A;  2ALY A;  4YCV A;  4H2X B;  4P3P A;  1EIY B;  2VXE A;  5GAM h;  5GAN h;  4M77 C;  2ALY B;  2ARU A;  5K1P A;  2QHT A;  3JB9 J;  3M4G A;  4H02 A;  4KQE A;  2DXU A;  2E64 A;  2ZGW A;  3QNE A;  2ZT7 A;  4RQF A;  5GAM f;  4UPA A;  3A74 A;  4M78 E;  4RCC A;  5LJ3 d;  3V8L A;  4K87 A;  1Y96 B;  3A7A A;  1N9R A;  3RL6 A;  1QF6 A;  1IL2 A;  3HFV A;  4PG3 A;  1Y96 A;  1WLE A;  5GAN 3;  3JCM h;  4XEM A;  3QO5 A;  5GAM j;  2FYK A;  2C7I A;  2DJZ A;  1ADY A;  3JCM c;  4X9D A;  3HY1 A;  4A54 A;  4J15 A;  4C92 G;  1ATI A;  5GMK m;  2EL9 A;  4H2U A;  3JCM V;  4M75 D;  3HTZ A;  5GAO n;  4A53 A;  4PJO G;  2E10 A;  1I5L A;  1C0A A;  1WPY A;  1H64 1;  4P73 C;  4M75 F;  4F7U G;  3HFN A;  3VBB A;  1USY C;  1H4Q A;  4M78 G;  4BW9 A;  4DPG A;  3JB9 D;  2CGH A;  1HXD A;  5GMK j;  2I4O A;  2EJ9 A;  4OP0 A;  5LJ5 d;  4M7A F;  4M7D B;  4PHC A;  5E3I A;  3HFO A;  3DSQ A;  3LSQ A;  3P8T A;  4P3N A;  4M77 D;  3BY7 A;  2DTO A;  4YRP A;  3JB9 I;  3QTC A;  4C92 E;  4LNS A;  4YRE A;  2E41 A;  2ZIO A;  4EMK B;  2RD1 A;  3WQZ A;  4YRF A;  4G84 A;  4EMK A;  4WJ4 A;  4YCW A;  3JCM e;  4P71 C;  12AS A;  4E51 A;  1EVK A;  1ASY A;  4P75 A;  4TQF A;  3SWN C;  4P75 C;  4EO4 A;  4YRM A;  4M75 E;  3A32 A;  4H2X A;  1NJ8 A;  3RUX A;  4H2W A;  1EIY A;  1D3B A;  1Z7N A;  3L2Z A;  4N0A C;  1HK9 A;  3V7R A;  1G51 A;  1U1S A;  5F5W A;  1N9S A;  1U1T A;  4BWA A;  3P8V A;  3PCO B;  4J6Y A;  3BDU A;  4H2Y A;  4XU1 A;  4TQD A;  5GAM e;  4C8Q F;  3GIB A;  1YFS A;  3RIR A;  1WU7 A;  3E9H A;  3PCO A;  4M7D E;  2ZT8 A;  1KMN A;  3HXU A;  4C92 C;  4C92 F;  4M75 C;  3HRK A;  4J6W A;  5K1X A;  4YPF A;  3JCM b;  1GGM A;  5GAO m;  5LJ5 j;  4C92 D;  4ZTU B;  2VXF A;  4PJO F;  5LJ3 g;  3VQX A;  4YRT A;  1M5Q 1;  4V2S A;  4M77 F;  4P74 C;  4F7U F;  1HC7 A;  3HXW A;  1LOJ A;  1WNL A;  1TH7 A;  4M78 F;  1KOG A;  4YYE A;  2JN0 A;  3JCM W;  3PGG A;  4O2D A;  2YHT A;  2VC8 A;  5GAN f;  3KFU A;  1I81 A;  4ZIB A;  4UP7 A;  5GAO p;  1WQW A;  2ZT5 A;  3A31 A;  1E24 A;  3TEH A;  4RCB A;  4CS3 A;  1H4S A;  4JUV A;  4RMF A;  1FYF A;  3NET A;  1MGQ A;  1B76 A;  1B8A A;  4XTW A;  1WYD A;  1G5H A;  4X5O A;  4EMK C;  4X9C A;  3QO3 A;  2RHS A;  5LJ5 f;  1B34 B;  2YLC A;  4PJO E;  3W3S A;  2C8M A;  4JRK A;  1B34 A;  2PMF A;  4YRR A;  2Q7G A;  2ODR C;  3EFS A;  4UP8 A;  1I8F A;  4F7U B;  2DDZ A;  5LJ5 g;  1PYS A;  4M7A B;  5LJ5 h;  4P72 A;  3JB9 H;  1X2G A;  4KR3 A;  1H4V B;  4HWO A;  4P74 A;  4N0A A;  4M7A A;  1PYS B;  1LNX A;  3NEM A;  3OD1 A;  3RKY A;  3TEG A;  2ZXF A;  1USY A;  1KQ2 A;  4CH5 A;  1JJC B;  2RB6 A;  1YGB A;  3M4Q A;  3MF2 A;  2DQ3 A;  2DXT A;  4C92 B;  4M75 B;  1YB3 A;  4WJ3 M;  4TWA A;  5GMK i;  3VQY A;  4C92 A;  4M75 A;  4K88 A;  1KMM A;  1NJ1 A;  4CH4 A;  1D3B B;  1SET A;  4XTY A;  3G1Z A;  2EJG A;  2J3L A;  3SB2 A;  2ZTG A;  2E3C A;  1B70 A;  4K86 A;  3ICA A;  3BFM A;  2CJA A;  1E1T A;  4UP9 A;  2DU7 A;  4M77 G;  4P3O A;  2DZ9 A;  2ZR3 A;  1E22 A;  1EVL A;  3A7U A;  3JCM X;  2I4M A;  4C8Q A;  4NL2 A;  4HT8 A;  3RF1 A;  5GMK l;  3QO8 A;  4C8Q B;  2AMC A;  4G85 A;  3R07 A;  4P71 A;  1ASZ A;  4F7U E;  2HNI A;  2DVE A;  2AMC B;  3HY0 A;  2ODR D;  3LC0 A;  1X01 A;  1BIB A;  5GMK e;  1VQZ A;  2ZZF A;  5LJ3 h;  4M7D G;  3CMQ A;  4YP0 A;  3VQV A;  2DU5 A;  1JRI A;  3INZ A;  5GAN 8;  5GAO q;  4HWP A;  1H4T A;  3MF1 A;  4PJO C; 
#chains in the Genus database with same CATH topology
 5FLX E;  3IKM B;  3OW2 A;  5CKB A;  4M7A C;  3TUP A;  3QJ6 A;  5CAI A;  1OQK A;  5GAO r;  4J7F A;  3L4G A;  2RHZ A;  2YT6 A;  2XDD A;  3OYN A;  4TTV A;  3PMT A;  3CCQ T;  3PFS A;  2ZNI A;  1WJS A;  3UT1 A;  3SWN A;  1UFF A;  2JTM A;  2JS0 A;  3QBY A;  3V8K A;  4KR2 A;  1EOV A;  3HRI A;  2WSE E;  3IKL A;  3ULR B;  5GAN g;  4KBM B;  2LCS A;  1DJ7 B;  1Q7Y U;  4H2V A;  2X9H A;  4XU0 A;  2W10 A;  1NYR A;  3UGT A;  1TWB A;  1V76 A;  4RG2 A;  3CC2 A;  3CPF A;  2PUO B;  1VQM A;  2K57 A;  3M0R A;  3I5R A;  1XJW B;  1BBW A;  4QVZ A;  2HQX A;  2ABL A;  1WFW A;  3HP9 A;  3MEV A;  1RIQ A;  1VQK A;  1IGU A;  1RAE B;  2CRE A;  4Y91 A;  1BYM A;  4LDU A;  1W66 A;  3TSZ A;  2F5T X;  2ECZ A;  3CCM Q;  5C51 B;  2O4X B;  3EG3 A;  1OU8 A;  2GGR A;  4A4F A;  2ZPB B;  2QHV A;  2F2W A;  3C94 A;  4LDY A;  4J9E A;  4YTL A;  4MZM A;  4QQG A;  1AZE A;  1NEB A;  1KQ1 A;  5FWC A;  2AKW A;  2RHQ A;  3C0C A;  4FU6 A;  1BI3 A;  3OYC A;  1VQM Q;  4M7D C;  2LQN A;  4Q6G A;  3G71 T;  2LNV A;  4PJO A;  3VQW A;  2ZCE A;  4TVA A;  2IY5 B;  4QKU A;  1M3A A;  5IN1 A;  1ZA2 B;  3UH0 A;  3A8M B;  3BDL A;  1M90 C;  2YRC A;  3A98 A;  3QWY A;  1OPK A;  1KHC A;  4F14 A;  2BIV A;  3P8D A;  4GLK A;  4C8Q D;  3JCM P;  4KH1 B;  5CQX A;  2ZPE B;  4HCZ A;  4OML A;  2CP7 A;  4AT1 B;  1X2H A;  5IAY A;  2CZ6 B;  1TSF A;  2DZC A;  1X56 A;  1VQ4 A;  4EMH A;  5GAN 2;  3QKJ A;  4WI1 A;  2AT1 B;  3V7S A;  1X6O A;  2SEM A;  5FRN A;  3U23 A;  4M77 B;  4PL6 A;  5C52 B;  4PJO D;  1QKX A;  2ART A;  1E1O A;  3OA6 A;  3PT9 A;  2DA9 A;  1VQP T;  1GCP A;  2V1R A;  2DD5 A;  11AS A;  4LE9 A;  1BU1 A;  4XEO A;  3VS6 A;  1Q81 R;  2OTJ Q;  2DMO A;  2O88 A;  5HGQ A;  1KD1 R;  3FJP A;  2F1L A;  5GAN 5;  4YRI A;  1N8R R;  5GAN j;  3QWX X;  1X6B A;  1G3Y A;  3CCR Q;  3JV3 A;  5KCO A;  5GAM d;  2CP0 A;  1SKU B;  4DBR A;  3LLR A;  3BW1 A;  2PUK B;  1M2V B;  2HD0 A;  3IQL A;  1W2B P;  3J7A F;  1QP2 A;  1Q81 U;  1GFD A;  3A8L B;  3X26 B;  2DF6 A;  3LH5 A;  4M7D A;  2Q5I A;  2ZZE A;  1AZG B;  2I4L A;  4OMF B;  2B86 A;  4NCX A;  1MMG A;  1SSH A;  4ZGE B;  3I35 A;  2JNG A;  2E5A A;  3I7F A;  5GAN e;  3MEW A;  5LJ3 j;  2VKN A;  4LUD A;  3V7C A;  1OU9 A;  4M7A G;  2J06 A;  4HVC A;  5GMK h;  3CCL T;  5J26 A;  2DER A;  1UJY A;  1TG0 A;  1JB0 E;  2JS2 A;  3NMZ C;  4E7Z A;  4P3P A;  3CBO A;  1PCX A;  3OYL A;  4M77 C;  2ALY B;  3JB9 J;  3A8G B;  4JRP A;  4C0Z A;  4KQE A;  4KGZ B;  4ORZ A;  5LL6 S;  3EH2 A;  3RMQ A;  1W4S A;  4A4H A;  3QNE A;  2O31 A;  3VS2 A;  2EGA A;  5CCA A;  1K9M R;  4RCC A;  1H3Z A;  1D1A A;  3T9N A;  3UWN A;  1N9R A;  2F69 A;  1SHG A;  1QF6 A;  3HFV A;  1Y96 A;  2FPF A;  4XEM A;  2OX7 A;  2YUP A;  3QO5 A;  2I0N A;  3CCV Q;  3MHX A;  5GAM j;  4GY5 A;  3CCS T;  4AFS C;  4HCC A;  3HY1 A;  1N6A A;  2CZ7 B;  2DD4 A;  4C92 G;  1ATI A;  1OX8 A;  4L6V 5;  3LYI A;  2YDL A;  3ZFJ A;  4OMQ A;  2JMC A;  2ZCF B;  4M75 D;  3HTZ A;  4DBQ A;  5IT9 E;  3ZL7 C;  5GAO n;  1NBE B;  1QLY A;  3HPW A;  1H64 1;  1BBZ A;  1WGS A;  3F70 A;  4F7U G;  1MUZ A;  3CCL Q;  2BE9 B;  3EAE A;  1USY C;  2EQM A;  4KGX B;  4M78 G;  4DPG A;  2K3B A;  3JB9 D;  2CGH A;  3CBP A;  1HXD A;  1ZHI A;  2ROT A;  2I4O A;  2ED0 A;  1QMC A;  3OQ5 A;  5FW9 A;  4AMC A;  3QII A;  2X4J A;  1UGQ B;  3M55 A;  3HFO A;  3P8T A;  3LSQ A;  3JB9 I;  1Q82 U;  4C92 E;  3MP6 A;  2YWW A;  4N4H A;  5KYY B;  1GCQ C;  3WQZ A;  1NYF A;  4YRF A;  1YHQ A;  1D0Z A;  3CCJ A;  4G84 A;  4KUD K;  2FZG B;  3VKI A;  3JCM e;  1M90 R;  1ZUU A;  2L2P A;  4E51 A;  1EVK A;  2A37 A;  1XQH A;  4J9I A;  4EO4 A;  4IUV A;  1VQ5 T;  1QVG A;  3CC2 T;  3I56 Q;  4HVU A;  1NJ8 A;  3RUX A;  3UAT A;  3CPW P;  3I55 T;  1KC8 R;  4LDV A;  4N0A C;  1G51 A;  1VUB A;  1U1S A;  5F5W A;  3UA6 A;  3WXM B;  1WZO A;  3CC7 T;  4H2Y A;  4C8Q F;  2VWF A;  3RIR A;  3O8V A;  4L5G A;  3PCO A;  1GL5 A;  1KMN A;  4J9C A;  2LVM A;  3HRK A;  4J6W A;  2RHI A;  2DYB A;  1XOV A;  4YPF A;  2JTF A;  2RF0 A;  2EIF A;  3SHW A;  2KBT A;  2DM1 A;  2F2X A;  3CEY A;  4PJO F;  4YRT A;  4P74 C;  3HRS A;  1XNI A;  5KYU B;  2CP5 A;  1Q86 R;  1SEM A;  1KOG A;  3HKS A;  5KYN A;  2FZK B;  2AZV A;  2JN0 A;  3JCM W;  1FMW A;  3PGG A;  1C6V X;  4UP7 A;  1HD3 A;  3C12 A;  5C0M A;  3OW2 P;  4M4Z A;  1Y71 A;  4BDZ A;  1G3W A;  1M9S A;  1U3O A;  3QYH B;  4JUV A;  1E6G A;  4BD3 A;  1FYF A;  3NET A;  1B76 A;  2DX1 A;  2GCX A;  2YRV A;  1RLP C;  1WXT A;  4EMK C;  4JS4 A;  5LJ5 f;  2L3Q A;  1JJ2 A;  4FSX A;  1WDX A;  4LNP A;  4CRI A;  2SRC A;  1OV3 A;  2RO0 A;  1UB4 A;  3EGX A;  1EZZ B;  4RMO A;  7AT1 B;  4BE1 A;  2KMT A;  2MPX C;  2DDZ A;  2AKK A;  2DPP B;  4RKU E;  2F2V A;  5LJ5 h;  1X2G A;  4KR3 A;  2D8H A;  4ESR A;  3QPH A;  1IZ6 A;  3OD1 A;  2QDL A;  4IUU A;  4LD6 A;  1QWF A;  4K11 A;  2RQR A;  3CCV A;  3TEG A;  1YGB A;  2DXT A;  2IG0 A;  3VJP A;  3ZEH A;  1ZLM A;  3VQY A;  2V8I A;  2PZ1 A;  4K88 A;  1VQ7 T;  1IHW A;  1EFN A;  1K8A R;  3M59 A;  1N8R C;  1K9M C;  1D3B B;  1SET A;  3G1Z A;  2EJG A;  2EPD A;  3VS7 A;  1JJ2 S;  4K86 A;  3BFM A;  2L89 A;  2CJA A;  1E1T A;  2LQ8 A;  1VQL Q;  3S3M A;  4M77 G;  4P3O A;  1CKB A;  2ZR3 A;  2RHX A;  2RQU A;  1EVL A;  4F16 A;  2KRM A;  1D0X A;  4OGE A;  1ASZ A;  4G85 A;  3R07 A;  2JM9 A;  1I5O B;  4LDW A;  2DO3 A;  4IIM A;  3LC0 A;  1BIB A;  1VQZ A;  3M57 A;  2DU5 A;  1TXQ A;  3TEE A;  1JRI A;  5GAN 8;  3L2U A;  3CMA T;  2AK5 A;  5AT1 B;  4A4E A;  3HFZ A;  4ZNX A;  4YDQ A;  1UUE A;  1X69 A;  4OLF A;  4FM4 B;  4JLG A;  4PK4 A;  4O5V A;  2KRO A;  3QZ9 B;  3CC4 Q;  3JCM f;  3H8Z A;  2ZZG A;  3OYH A;  2C06 A;  1I1J A;  1RAA B;  2CT3 A;  2R5A A;  4M77 E;  4OVA A;  3OS0 A;  1K76 A;  1PKS A;  3SWN B;  4XTZ A;  2A8E A;  1IO6 A;  1Q82 R;  1Z7M A;  1H3H A;  2YSQ A;  4RQE A;  1YN8 A;  2RHS B;  1UGS B;  4J9B A;  2HAX A;  2YUQ A;  4PFZ A;  4MDW A;  4YRL A;  1OZ3 A;  2DQ0 A;  2RM4 A;  1VQ6 T;  3G6E A;  3BE3 A;  3RGL A;  1QW1 A;  2G4C A;  2X3W D;  2XKO C;  1VQL T;  5CQY A;  2EQU A;  4F7U A;  3LSS A;  5LJ3 e;  3FB9 A;  2H3E B;  1SES A;  1WHJ A;  4AFZ C;  4OB3 B;  2DL8 A;  1T0J A;  2E1H A;  2ZPF B;  2XG8 D;  2FEI A;  1JJC A;  5KYW A;  1LYL A;  1PM3 A;  2KNB B;  1X2K A;  2CT4 A;  1JO8 A;  2EJF A;  3A7R A;  4R55 A;  1NLP C;  1MV0 B;  1Z9Q A;  4WF2 A;  3M9Q A;  1NJI R;  4X1V A;  1KIK A;  4QVD A;  3NEL A;  1NYQ A;  2W0Z A;  2CYZ B;  2P0L A;  3TSW A;  1M8V A;  1NJ2 A;  1NJ6 A;  2RJE A;  4KRT A;  3MEY A;  1M30 A;  2RHQ B;  1SG5 A;  1B07 A;  1YWO A;  2O9S A;  2G3R A;  1W2B S;  1VQN T;  4JPB W;  2L3P A;  3CQT A;  4ZGD B;  1N5Z A;  2ZIN A;  4AH6 A;  3ASK A;  2QTX A;  3PE0 A;  4RTW A;  1YCY A;  5KE3 A;  5KYX A;  2EQI A;  1G3T A;  2OTJ A;  2V26 A;  4RTV A;  2JXB A;  2ATC B;  1I4K 1;  2KR3 A;  2M1H A;  2KI7 A;  5LJ5 e;  2RK2 A;  3SD4 A;  2P5I A;  3KXT A;  5FWB A;  2E5K A;  4D8D A;  1YFT A;  3LW5 E;  3CCR A;  1XTD A;  2HL3 A;  3G71 A;  4YRK A;  1K8A C;  2BZX A;  2GF7 A;  3CCV T;  2NUP B;  4JLI A;  4CS4 A;  4C8Q C;  1ADJ A;  3OYB A;  3NEN A;  4HWT A;  2IPO B;  2CJ9 A;  1VQ8 T;  2QTV A;  2Y90 A;  3E9F A;  5DY9 A;  5GAM g;  4LVL A;  2WSC E;  1BBU A;  1GBQ A;  1YIJ T;  1IXD A;  4C0D B;  2OAU A;  3PMI A;  3OSV A;  3TU4 K;  2G6F X;  4CS2 A;  3BJU A;  4H2S A;  4J9D A;  2YLB A;  5C53 B;  1RAD B;  4GBQ A;  4PNO A;  3ER0 A;  3A5Z A;  2K5F A;  5D6X A;  2RI5 A;  4ZTZ B;  3OYK A;  2JW4 A;  1VQN Q;  3IAL A;  2PME A;  5C6S A;  4M78 B;  5I2M A;  2MIO A;  1BCM A;  2V8J A;  4BY6 B;  1YI2 T;  2FL7 A;  1VQ9 A;  4JZ4 A;  4PLL A;  3CBM A;  1N9W A;  1FX7 A;  4YRC A;  4VUB A;  4QVC A;  2KVQ G;  1PRM C;  2AKL A;  3CCE T;  1L0W A;  2NUT B;  4EIK A;  1UEC A;  4HVW A;  2Q7E A;  1CSK A;  4M7A E;  1X43 A;  5CKF A;  2K5I A;  3MP8 A;  4C0G A;  2L3R A;  3E9I A;  3MEA A;  2ZT6 A;  4HWR A;  4HVV A;  2GNC A;  1BIA A;  1PKT A;  2A36 A;  4AG2 C;  1NJI U;  2GTJ A;  4H2X B;  4RTU A;  1EIY B;  2VXE A;  1X2Q A;  5K1P A;  2QA4 A;  2QHT A;  1FWZ A;  3L2R A;  4ME7 A;  3M0S A;  4HXJ A;  2ZGW A;  1W2B A;  2CUB A;  1AWW A;  4DEX A;  4UPA A;  4BI4 A;  3A74 A;  4J9G A;  4M78 E;  3MQZ A;  4E7S A;  2VV5 A;  2LT1 A;  2JOY A;  4LVI A;  4JJC A;  3CME T;  4PG3 A;  1ZSZ C;  5GAN 3;  1HSQ A;  5A2Q E;  1RL2 A;  2D0Q B;  1YHQ T;  3G4S Q;  3H0H A;  2C7I A;  4PJJ A;  2LX9 A;  4LD9 K;  2KAF A;  2EYZ A;  2VGM A;  4J15 A;  4IKF A;  1UTI A;  1LCK A;  3EGU A;  4AFQ C;  1M1K R;  5GMK m;  4RTZ A;  1ZBJ A;  1YJN T;  4E6R A;  2RQW A;  3L2V A;  5GJW B;  4PJO G;  1WPY A;  2XMF A;  2EGE A;  1ZBX A;  1G5V A;  3OBY A;  5A0D A;  1KHI A;  4RG8 A;  3M0Q A;  4CC4 B;  1YJW T;  2YUN A;  5GMK j;  2EJ9 A;  2VVK A;  2QAZ A;  2JMA A;  1GFC A;  1HJD A;  2RH2 A;  4M77 D;  1I07 A;  2DIL A;  4YRP A;  2NLU A;  2E41 A;  5L8R E;  2KRN A;  5HCK A;  1K0S A;  1VQ4 Q;  4ZN1 A;  4LVM A;  1ZA1 B;  1VOM A;  1GRI A;  4LDX A;  2HQE A;  4TQF A;  4P75 C;  1S72 T;  4YRM A;  2JZ2 A;  4LN2 A;  5A0G A;  1VQ6 A;  1ZSZ B;  3GLX A;  1Z7N A;  2KYM A;  3AT1 B;  3O5Z A;  1KC8 U;  3H41 A;  2K7A A;  4FW2 A;  4BWA A;  3BDU A;  4TQD A;  1WXU A;  2JJ9 A;  1YJW A;  4R0K A;  4ELY C;  2ZT8 A;  1UG1 A;  2CH4 W;  2XIC A;  4C92 C;  2COW A;  4C5G A;  1KJW A;  3URG A;  2DYI A;  3ME9 A;  1U06 A;  2VXF A;  3S3O A;  2RHU A;  1MMN A;  4V2S A;  4M77 F;  2RPN A;  2VB6 A;  4BI3 A;  2QA4 Q;  3PTA A;  3VV0 A;  3HXW A;  2KEA A;  1IRE B;  4J83 A;  4M78 F;  4LVK A;  1OZ2 A;  2DL4 A;  5HK3 A;  3OS1 A;  1JXM A;  5D6Y A;  4O2D A;  3OW2 S;  4II1 A;  1VQK T;  5IHK A;  2BKD N;  1BI1 A;  2XK0 A;  1I81 A;  2Y4Y A;  4ZIB A;  3EG9 B;  5GAO p;  1WQW A;  3CME A;  5DM7 R;  3A31 A;  1E24 A;  1OYX A;  2ZZD A;  3CCL A;  3C4S A;  3LWI A;  2X51 A;  1H4S A;  1Q86 U;  3OBW A;  1G83 A;  4XTW A;  2NUZ A;  1T0H A;  2X4W A;  1UHC A;  3A8O B;  3UA7 A;  3EHR A;  3GOX A;  3MET A;  3NTH A;  5HK0 A;  3QO3 A;  2JUF A;  2ZPH B;  1MMD A;  1B34 B;  3W3S A;  3P8B B;  3UDC A;  2PMF A;  2CUD A;  2DL7 A;  2ODR C;  3CCS Q;  1OEB A;  3EGX B;  1YBY A;  3PIO A;  5IHN A;  2KSS A;  4M7A B;  4P72 A;  1AT1 B;  1M2O A;  4HWO A;  3OSS C;  4P74 A;  3HRT A;  3NEM A;  1ZUY A;  2J6F A;  1X75 C;  1KQ2 A;  4WJ3 M;  4E47 A;  3EFO B;  1RAI B;  2BTT A;  2OTL Q;  3QYG B;  2VYT A;  2O4X A;  1X27 A;  1FMK A;  2V1Q A;  2CZ0 B;  5J3B A;  1PSF A;  4XTY A;  3QJY A;  2HQH A;  2XHC A;  2EQJ A;  4C5I A;  3G6E Q;  2DET A;  5DLQ E;  1M90 U;  4AG1 C;  2K3Y A;  3PNW C;  4C5H A;  2KK4 A;  2EKO A;  2FRY A;  1VQP A;  5J39 A;  1UJ0 A;  1KD1 C;  2K2M A;  2MYS A;  2LQK A;  5FU7 B;  2M0O A;  5IH2 A;  1IGQ A;  3FLG A;  2MOX A;  5GMK l;  4P71 A;  1ZQ1 A;  1VQO T;  3E9G A;  3HY0 A;  5KE2 A;  2ODR D;  2ENM A;  1X01 A;  2ZZF A;  2EYX A;  2LX7 A;  3VYG A;  5GAO q;  3MF1 A;  5I2S A;  4CC7 A;  2LDM A;  1YIT Q;  2MWP A;  2D0N A;  1EFW A;  4QT7 A;  2QHS A;  1VQL A;  3A8H B;  1ZX6 A;  2CSQ A;  5GAN d;  4QQD A;  1AHJ B;  3OYY A;  2MK5 A;  2CH4 A;  3CXC P;  3X20 B;  4A4G A;  2DL5 A;  3RAC A;  3CCM T;  3CC7 Q;  3TEH B;  1D0Y A;  1TS9 A;  1UDL A;  2GQI A;  4L87 A;  1JXO A;  2BZY A;  2L0A A;  2X3X D;  3OYE A;  1K73 C;  3RES A;  4IUQ A;  1RI9 A;  4DBF A;  4MDX A;  1IRX A;  1QVG S;  4J6X A;  3G71 Q;  1B7Y B;  3SDZ A;  4XQ3 A;  2X35 A;  4KUL A;  4M78 D;  3IG2 A;  1J5W A;  4OF1 A;  4JRI A;  4Z89 A;  1K9A A;  1VIF A;  4DEY A;  2DFU A;  2DAQ A;  2KDS A;  4BY6 C;  4FCY A;  1M1K U;  3HTR A;  4E2F B;  1MNE A;  3HSB A;  2A3L A;  2V8K A;  2Q7H A;  3KUF A;  4RDX A;  4PLI A;  4C5E A;  2JVV A;  4FW1 A;  2ZR2 A;  3UF4 A;  2QXF A;  1EQR A;  2EYQ A;  3REX A;  5FU7 C;  3VU3 C;  2Q5H A;  3X24 B;  2RA2 A;  2CJB A;  1KG1 A;  1TUC A;  3A5Y A;  2LP5 A;  2E6N A;  5CIU A;  2RQV A;  1B70 B;  3OB9 A;  3LX7 A;  1UGP B;  1U5S A;  3HXX A;  1NE8 A;  1KK7 A;  4XTU A;  1YJW Q;  4OB1 B;  2FPE A;  1YFR A;  2QHU A;  2RJD A;  3J80 E;  2COY A;  3OYI A;  1X6G A;  4YRQ A;  1JEG A;  4XU2 A;  3M0P A;  4Y28 E;  2I4N A;  3OYF A;  2EAY A;  3EGD B;  2O01 E;  3SEM A;  4D6W A;  2D1X A;  2XTI A;  2DEQ A;  4IUT A;  4HWS A;  4H2T A;  2QQA A;  3L1A A;  3NTI A;  1TU0 B;  1VIE A;  3HXV A;  1P92 A;  3JB9 G;  1YP5 A;  3L4G B;  5GAN 6;  5KCH A;  3UFG A;  1R0B G;  2PQW A;  2RK1 A;  3OMG A;  3REU A;  1JBM A;  3VUZ A;  4C8Q G;  2NUP A;  2QEX Q;  4E7L A;  3JCM d;  2FG0 A;  2O2O A;  2I2L A;  2FVU A;  2PVO B;  4EX5 A;  4YRS A;  2K3X A;  2OTL A;  1J3T A;  4PKC C;  1YJN Q;  3QSU A;  5I21 A;  4JZ3 A;  2IVW A;  5D7U A;  4C8Q E;  3EG2 A;  1G2B A;  3RBB B;  2YRD A;  4KGV B;  1D1B A;  2P84 A;  3JCM J;  2P4R A;  1KQS A;  4MMK A;  2K6D A;  4YCU A;  2LRQ A;  1PSE A;  3LGF A;  4F17 A;  1GCQ A;  2J7I A;  3UGQ A;  2VAS A;  3A5Z B;  2D6F A;  1Q7Y C;  3GBQ A;  3M56 A;  2QK0 A;  4M78 A;  4M78 C;  3LWH A;  1K8A U;  4ZTJ A;  4BB7 A;  1Y7X A;  2DE0 X;  4P72 C;  1HTT A;  2CP2 A;  4JRQ A;  2DTH A;  4CH6 A;  8ATC B;  5GAN 4;  1M1F A;  4NL3 A;  2X4Y A;  3MKD A;  4CI0 C;  4QQ6 A;  2XGT A;  1WHK A;  4IUP A;  8AT1 B;  3AHU A;  5M9O A;  1QWE A;  3EHQ A;  2NUT A;  1WQ7 A;  4J5Y A;  1Z9Z A;  2J3M A;  1K73 R;  4YRO A;  2QDY B;  3HHT B;  2R57 A;  3TVT A;  1KQS S;  2P0P A;  1M8M A;  4BE2 A;  2AKW B;  2R5M A;  1YIJ A;  3RER A;  1VYV A;  3PVL A;  4TVA B;  1VQM T;  2IY5 A;  2ROL A;  1JU5 C;  1SPK A;  4ZN3 A;  4YCV A;  2PNI A;  1UE9 A;  2HSP A;  5GAM h;  5GAN h;  1ACM B;  1R0C B;  3VRY A;  3FRN A;  4F04 B;  4ZTF A;  5HKC A;  2MF2 A;  2DXU A;  2E64 A;  2ZT7 A;  2CP3 A;  2P0Q A;  5I22 A;  3TRE A;  1PRL C;  3OYD A;  4K87 A;  5ECA A;  3A7A A;  1K4U S;  3MPU B;  3CC4 A;  1IL2 A;  1NZ9 A;  3G4S A;  1WLE A;  4TVR A;  2XDP A;  1SHF A;  1MND A;  2QA4 T;  1RAC B;  1TUD A;  2CDT A;  2ED1 A;  2ESW A;  2MMP A;  1BCO A;  3SFM A;  2K9G A;  2DJZ A;  2FO0 A;  3REB B;  1ADY A;  3JCM c;  3D7S B;  4X9D A;  5KYU A;  2C0O A;  4LVJ A;  3G6E T;  4A54 A;  3VS4 A;  1M3C A;  1AWX A;  3Q1J A;  1H8K A;  1M1G A;  2EL9 A;  1KFZ A;  3S3N A;  3JCM V;  1NJI C;  4BDY A;  1UHF A;  2QYZ A;  3NGP A;  2E10 A;  1ABO A;  1C0A A;  4P73 C;  1OPL A;  1QCN A;  4M75 F;  5HY6 A;  2EYW A;  1FMV A;  3G1J A;  3VBB A;  4HCB A;  2GFU A;  3PVQ A;  4FT4 A;  1M2V A;  2GFA A;  3I55 Q;  1QCF A;  4Z8A A;  3REA B;  2RQT A;  1NPR A;  3HRU A;  4M7D B;  4IUR A;  1Y57 A;  4MZT A;  2L5Q A;  4P3N A;  2HSE B;  2M16 A;  2RI2 A;  4XAX B;  4LNS A;  4YRE A;  4EMK B;  2QG9 B;  2FHD A;  3DKM A;  4WJ4 A;  4YCW A;  1N8R U;  4P71 C;  1OOT A;  1MMA A;  12AS A;  1YIJ Q;  1A0N B;  3WVE B;  2OTL T;  4P75 A;  3SWN C;  2LCL A;  4M75 E;  2LTO A;  3A32 A;  5AYF A;  1QVF S;  5FU6 B;  1JQQ A;  3C95 A;  4OMP A;  1Q7Y R;  2EW3 A;  1AD5 A;  3KBG A;  2KT1 A;  1D3B A;  2M9U A;  1ZSZ A;  3L2Z A;  2CS7 A;  2KE9 A;  2F5K A;  1HK9 A;  2L3S A;  4J7I A;  5CO7 A;  1N9S A;  4J9H A;  3P8V A;  4J6Y A;  4XU1 A;  4J8O A;  5GAM e;  2LJ0 A;  1YFS A;  4B9W A;  4IIO A;  1WHH A;  2ZAE A;  1VQO Q;  1OUL A;  3M53 A;  3MP1 A;  4BAC A;  4M75 C;  5CR2 A;  1H92 A;  3JCM b;  2MI6 A;  4E7K A;  2DBK A;  2QGG A;  5LJ5 j;  1RAB B;  3I55 A;  4ZTU B;  2QEX A;  2XDB A;  2CZ1 B;  2AZS A;  3GP8 A;  3MCA B;  1YWP A;  2XI9 A;  1YIT T;  1HC7 A;  1M4Z A;  4BE0 A;  1QVF A;  1LOJ A;  2O9V A;  3I56 T;  2M0Y A;  1LVK A;  3CXC A;  4XK8 E;  3CCJ T;  2VC8 A;  4E7J A;  1ZSG A;  5GAN f;  4Q5W A;  3E1S A;  4C0D C;  1VQO A;  5GJV B;  1TOV A;  4RTT A;  1KC8 C;  2DRK A;  3EG9 A;  4UC4 A;  3QXE B;  4A63 B;  3NPF A;  3N5B B;  3LH0 A;  1WYD A;  4BI8 B;  1G5H A;  1VQ6 Q;  4X9C A;  2CSI A;  2RHS A;  1PHT A;  2E6Z A;  2E12 A;  1IHV A;  3QG1 A;  4JRK A;  2LZ6 B;  2M51 A;  2PU9 B;  1B34 A;  4YRR A;  2Q7G A;  3EFS A;  4B9X A;  4UP8 A;  4F7U B;  1WHL A;  1QCO A;  5LJ5 g;  3CD6 T;  1AVZ C;  4HKE A;  2QEX T;  4PJN A;  1I0C A;  3DLL A;  1PYS A;  3CXC S;  1G3S A;  1PD0 A;  3M0T A;  3MEU A;  1H4V B;  2A0F B;  4N0A A;  4M7A A;  1LNX A;  2KXC A;  4ZGJ B;  3RKY A;  1Y07 A;  3VS1 A;  1USY A;  1Q82 C;  1JJC B;  2HKQ B;  2M02 A;  3FEO A;  3KFV A;  4N4I A;  1MV3 A;  3MF2 A;  4C92 B;  1EX4 A;  4M75 B;  1KSW A;  4TWA A;  2P0K A;  5GMK i;  4ANJ A;  2JT4 A;  3EFO A;  2GBQ A;  3WVD B;  2DBM A;  2DRM A;  2NWM A;  2DL3 A;  3OMC A;  2Y4X A;  1WA7 A;  4FT2 A;  2E3C A;  3VRZ A;  4A4K A;  1VQP Q;  1Q86 C;  2KGT A;  3CCJ Q;  2J05 A;  1GXI E;  1WX6 A;  2DU7 A;  2DJQ A;  1MHN A;  1QKW A;  2K4Y A;  2RNA A;  2DZ9 A;  3A7U A;  3JCM X;  3FDR A;  4C8Q A;  4NL2 A;  4HT8 A;  5CKH A;  3RF1 A;  1YJ9 T;  3DLM A;  2AMC A;  2KYB A;  3FC3 A;  4F7U E;  3RDV A;  1S1N A;  2XID A;  2HNI A;  1WI7 A;  1HYO A;  2DVE A;  4OB2 B;  5KYX B;  3VS0 A;  1AWJ A;  3L42 A;  5GMK e;  2PVG B;  4M7D G;  3CMQ A;  4YP0 A;  4DOV A;  3INZ A;  4LXC A;  5CKE A;  4HWP A;  3QDF A;  1D1C A;  4NOY A;  1SRL A;  2OI3 A;  4CH3 A;  3JCM g;  2E3H A;  3RKX A;  3X28 B;  4YRJ A;  2EBP A;  3CD6 Q;  2E3I A;  3PZC A;  1TUG B;  2RJC A;  3FJ5 A;  1K1Z A;  2OAW A;  4Q15 A;  1VA7 A;  3CCQ Q;  3EFR A;  4FYW B;  1UGV A;  2XU8 A;  1VQN A;  1ZUK A;  2DTI A;  4CC3 A;  4DQ2 A;  5DLO A;  3JB9 F;  4DOW A;  2ZIM A;  4Y92 A;  4P73 A;  1KD1 U;  3L2W A;  1WYX A;  4FYX B;  2FB7 A;  3OYA A;  1RLQ C;  2YXY A;  2P4T A;  3H0I A;  1FYN A;  4JJN K;  2E70 A;  4J9F A;  4HCK A;  1R8O B;  1RAH B;  2QI2 A;  3R6N A;  1PD1 A;  1FXX A;  1NJ5 A;  4L59 A;  1X54 A;  2FPD A;  1B7Y A;  4XTX A;  2LMJ A;  4WCI A;  4E7I A;  5ELO A;  2VUB A;  1KQS P;  1AOJ A;  3CC4 T;  4HT9 A;  3CCE Q;  5ELN A;  1VQK Q;  4YRN A;  2LT4 A;  1O75 A;  3HXY A;  3GNG A;  2RHY A;  1V29 B;  1BB9 A;  2MCN A;  2DVJ A;  4TVW A;  1X55 A;  4XU3 A;  1YCS B;  2AIR B;  5IXF A;  3M5A A;  2HDA A;  1SER A;  4OGC A;  1VQ7 Q;  2LNH B;  1ABQ A;  4FSS A;  3CC2 Q;  4PJO B;  4MML A;  4CC2 A;  3CD6 A;  2LJ1 A;  3M4P A;  1LJO A;  2ZNJ A;  1K0X A;  1UGR B;  1K73 U;  1T3L A;  4ELZ C;  3CCE A;  1NG2 A;  1W6X A;  2H8H A;  1O9S A;  1T3S A;  3JRZ A;  4B6M A;  1VQ9 T;  1RUW A;  3JAM E;  2WSF E;  1WJQ A;  2IIM A;  4AFU C;  1QE0 A;  4XTV A;  3EGD A;  2LC4 A;  3P8H A;  4EPC A;  1Q81 C;  1ARK A;  2EKH A;  4FL6 A;  2HZY A;  4JJD A;  3HFZ B;  2CKK A;  1TTH B;  3QHS A;  1YHQ Q;  2BUD A;  2JTE A;  2DLP A;  4C0F A;  4M77 A;  4TVY A;  4M7A D;  2D9T A;  2KT8 A;  3LGL A;  3VYH B;  5GAN 7;  1AWO A;  2EYY A;  1F1B B;  2HKN A;  2B8A A;  1W70 A;  3V8J A;  4HA8 A;  1NNH A;  1GBR A;  4M7D D;  1VQ5 A;  3QDR B;  1WHG A;  1C1A A;  2EWN A;  3JSC A;  1QP3 A;  4FIB A;  2OTJ T;  3CCU T;  1G5I A;  2J6K A;  1LPL A;  4WTO B;  1B3Q A;  4OMO A;  3CCR T;  1SSF A;  4DBH A;  2ARS A;  5LJ3 f;  4JDS A;  3ERR A;  1B7T A;  4Z88 A;  4D8K A;  1W1F A;  2EGC A;  2L8D A;  2A7Y A;  3CMA A;  3QO7 A;  3FIF A;  2GQV A;  3JCM Q;  3OYJ A;  3CCQ A;  3PIP A;  1SRY A;  4ATO A;  5KNN A;  3OYG A;  1V1C A;  3QUI A;  2WAC A;  4EMG A;  1BK2 A;  3OS5 A;  4RUG A;  5KYW B;  2DKG A;  3P8Y A;  1BI2 A;  5I11 A;  4M75 G;  3RKW A;  2HL5 C;  2CIM A;  1YIT A;  2QQR A;  2E65 A;  3CCS A;  4P5N A;  4HT4 A;  2KXD A;  4YRG A;  2ZPG B;  4FYV B;  5GAO l;  4PJL A;  3G4S T;  3RNJ A;  3NFC A;  3HXZ A;  3ZBD A;  4M7D F;  2NS6 A;  2A08 A;  1C0M A;  2ALY A;  4EDU A;  4KH0 B;  3CCM A;  5L23 A;  2K2V A;  2DXB A;  2ARU A;  3EG0 A;  2RMO A;  2Z0W A;  1RAG B;  3A1P A;  3M4G A;  5FRM A;  4H02 A;  3I56 A;  3CCU Q;  4PJM A;  1YJN A;  1JJ2 P;  3MJX A;  2HBP A;  3TQ7 P;  3QZ5 B;  3DB3 A;  4X34 A;  4RQF A;  1VQ8 A;  2MAM A;  3M58 A;  5GAM f;  1VQ7 A;  3V8L A;  1E7O A;  1R77 A;  4LUE A;  2BE7 D;  5LJ3 d;  1Y96 B;  4PFP A;  3RL6 A;  1RAF B;  5FU6 C;  2DK3 A;  5CVI A;  3CMA Q;  3TCJ A;  3JCM h;  4OB0 B;  1QVF P;  2FYK A;  4DA4 A;  3M54 A;  2RI3 A;  5IHI A;  1VYU A;  1WXB A;  2J6O A;  3UPU A;  1Q95 G;  1M27 C;  1S72 A;  1SRM A;  2XD0 A;  2E5Q A;  2QQB A;  4H2U A;  1QVP A;  1SF9 A;  1QVG P;  3E19 A;  4A53 A;  1OX9 A;  1I5L A;  1U8R A;  2C0T A;  3HFN A;  2R58 A;  1H4Q A;  4BW9 A;  2DIG A;  3CC7 A;  2QQS A;  3OYM A;  3CME Q;  4OP0 A;  5LJ5 d;  4M7A F;  2FRW A;  4JJB A;  1AEY A;  2HMA A;  1G8X A;  2PTK A;  4PHC A;  1E6H A;  5E3I A;  3HL8 A;  3DSQ A;  6AT1 B;  3BY7 A;  1NPP A;  1WJR A;  2DTO A;  5KYY A;  3M0U A;  2DIQ A;  3QTC A;  3RMS A;  2AHJ B;  1EIF A;  3E2U A;  2ZIO A;  3GF5 A;  4KT0 E;  2RD1 A;  4EMK A;  1D09 B;  2DNU A;  2KQW A;  1ASY A;  2E4H A;  1BKB A;  2CP6 A;  2DXC A;  1WHM A;  2YUO A;  4KUI A;  4H2X A;  2PVD B;  4H2W A;  1EIY A;  3L2Q A;  4O6J A;  2QGF B;  2DEU A;  3J81 E;  3H0F A;  3M4Y A;  3V7R A;  2MWO A;  1U1T A;  2JM8 A;  2BZ8 A;  3CPW S;  3PCO B;  3GIB A;  2LJ3 A;  3S6W A;  9ATC B;  1WU7 A;  3E9H A;  4M7D E;  1M3B A;  3HXU A;  4C92 F;  2COZ A;  4RTX A;  3NHN A;  5K1X A;  1H4T A;  2OJ2 A;  4BUG A;  1GGM A;  3G7Z A;  2NYS A;  2KY9 A;  5GAO m;  4C92 D;  4NS5 A;  5CKD A;  5LJ3 g;  3VQX A;  2RN8 A;  3VS3 A;  2X4X A;  1M5Q 1;  3H9N A;  3VS5 A;  1CKA A;  2EQK A;  4F7U F;  1IB8 A;  2RJF A;  3THK A;  1NYG A;  3I5S A;  1WNL A;  1PWT A;  4N4G A;  1TH7 A;  1YI2 A;  4YYE A;  1NM7 A;  2D8J A;  2GTO A;  5FRO A;  5KH6 A;  1VQ8 Q;  2YHT A;  4JS5 A;  2A28 A;  3KFU A;  1RI0 A;  1YJ9 A;  2HBW A;  2ZPI B;  1K9M U;  1VYT A;  3EG1 A;  3OS2 A;  2FZC B;  3H6Z A;  3R6O A;  2H3J A;  2ZT5 A;  3TEH A;  1QQJ A;  1YFN A;  4RCB A;  4CS3 A;  3OY9 A;  4RMF A;  1MGQ A;  1B8A A;  1UEB A;  2KRS A;  1PC0 A;  1N27 A;  1BI0 A;  4X5O A;  1NEG A;  1PNJ A;  2LQW A;  3X25 B;  2K5L A;  2YLC A;  4PJO E;  1Y0M A;  1M1K C;  2C8M A;  4OMN A;  1PG5 B;  5EC7 A;  5EG2 A;  3GNF B;  1YI2 Q;  4R56 A;  1I8F A;  2C0I A;  4MZP A;  2QQ9 A;  3DB4 A;  2LCC A;  4GLM A;  3JB9 H;  5IXB A;  4RTY A;  2EVR A;  1PYS B;  4E7H A;  2VGN A;  2ZXF A;  2HCK A;  4CH5 A;  1VQ4 T;  2RB6 A;  3M4Q A;  2DQ3 A;  1YB3 A;  3GPL A;  5D6W A;  5A0L A;  4C92 A;  4M75 A;  2HEQ A;  1S72 Q;  1KMM A;  1VQ5 Q;  1NJ1 A;  4CH4 A;  1OI1 A;  2EFI A;  2J3L A;  3EH1 A;  3NTK A;  3SB2 A;  2ZTG A;  3CCU A;  1B70 A;  1WIE A;  3MO8 A;  3ICA A;  2K79 A;  4UP9 A;  3VUB A;  1NLO C;  1E22 A;  2I4M A;  1WLP B;  1YJ9 Q;  4OMM A;  3QO8 A;  4C8Q B;  1YNZ A;  1VQ9 Q;  2AMC B;  4FYY B;  3CPW A;  4Z02 A;  3I9Q A;  5LJ3 h;  4PFO A;  3VQV A;  3RR6 A;  2QAS A;  4QW2 A;  5CK9 A;  4PJO C; 
#chains in the Genus database with same CATH homology
 5FLX E;  3IKM B;  3OW2 A;  5CKB A;  4M7A C;  3TUP A;  3QJ6 A;  5CAI A;  5GAO r;  4J7F A;  3L4G A;  2RHZ A;  2XDD A;  3OYN A;  4TTV A;  3PMT A;  3CCQ T;  3PFS A;  2ZNI A;  1WJS A;  3UT1 A;  3SWN A;  2JTM A;  3QBY A;  3V8K A;  4KR2 A;  1EOV A;  3HRI A;  2WSE E;  3IKL A;  5GAN g;  4KBM B;  1DJ7 B;  1Q7Y U;  4H2V A;  4XU0 A;  1NYR A;  3UGT A;  4RG2 A;  3CC2 A;  3CPF A;  2PUO B;  1VQM A;  2K57 A;  1BBW A;  4QVZ A;  2HQX A;  3HP9 A;  3MEV A;  1RIQ A;  1VQK A;  4Y91 A;  1BYM A;  4LDU A;  1W66 A;  2F5T X;  5C51 B;  2O4X B;  4A4F A;  2ZPB B;  2QHV A;  3C94 A;  4LDY A;  4YTL A;  4MZM A;  4QQG A;  1KQ1 A;  2AKW A;  2RHQ A;  4FU6 A;  1BI3 A;  3OYC A;  4M7D C;  4Q6G A;  3G71 T;  2LNV A;  4PJO A;  3VQW A;  2ZCE A;  4TVA A;  2IY5 B;  5IN1 A;  3UH0 A;  3A8M B;  3BDL A;  1M90 C;  1KHC A;  2BIV A;  3P8D A;  4GLK A;  4C8Q D;  3JCM P;  5CQX A;  2ZPE B;  4HCZ A;  1X2H A;  5IAY A;  2CZ6 B;  2DZC A;  1X56 A;  1VQ4 A;  4EMH A;  5GAN 2;  3QKJ A;  4WI1 A;  3V7S A;  1X6O A;  5FRN A;  4M77 B;  4PL6 A;  5C52 B;  4PJO D;  2ART A;  1E1O A;  3OA6 A;  3PT9 A;  1VQP T;  2DD5 A;  11AS A;  4XEO A;  5HGQ A;  3FJP A;  4YRI A;  5GAN 5;  5GAN j;  1G3Y A;  5KCO A;  5GAM d;  3LLR A;  3BW1 A;  2PUK B;  2HD0 A;  3J7A F;  1QP2 A;  1Q81 U;  3A8L B;  3X26 B;  4M7D A;  2Q5I A;  2ZZE A;  2I4L A;  4OMF B;  4NCX A;  4ZGE B;  2JNG A;  2E5A A;  3I7F A;  5GAN e;  3MEW A;  5LJ3 j;  3V7C A;  4M7A G;  4HVC A;  5GMK h;  3CCL T;  5J26 A;  1JB0 E;  4P3P A;  3CBO A;  3OYL A;  4M77 C;  2ALY B;  3JB9 J;  3A8G B;  4JRP A;  4C0Z A;  4KQE A;  5LL6 S;  3RMQ A;  1W4S A;  4A4H A;  3QNE A;  5CCA A;  4RCC A;  1H3Z A;  3UWN A;  3T9N A;  1N9R A;  2F69 A;  1QF6 A;  3HFV A;  1Y96 A;  4XEM A;  3QO5 A;  3MHX A;  5GAM j;  4GY5 A;  3CCS T;  4HCC A;  3HY1 A;  1N6A A;  2CZ7 B;  2DD4 A;  4C92 G;  1ATI A;  4L6V 5;  3LYI A;  3ZFJ A;  2ZCF B;  4M75 D;  3HTZ A;  5IT9 E;  5GAO n;  3HPW A;  1H64 1;  1WGS A;  3F70 A;  4F7U G;  3EAE A;  1USY C;  2EQM A;  4M78 G;  4DPG A;  3JB9 D;  2CGH A;  3CBP A;  1HXD A;  1ZHI A;  2I4O A;  3OQ5 A;  3QII A;  2X4J A;  1UGQ B;  3M55 A;  3HFO A;  3P8T A;  3LSQ A;  3JB9 I;  1Q82 U;  4C92 E;  3MP6 A;  4N4H A;  3WQZ A;  4YRF A;  1YHQ A;  3CCJ A;  4G84 A;  4KUD K;  3VKI A;  3JCM e;  4E51 A;  1EVK A;  1XQH A;  4EO4 A;  4IUV A;  1VQ5 T;  1QVG A;  3CC2 T;  1NJ8 A;  3RUX A;  3I55 T;  4LDV A;  4N0A C;  1G51 A;  1U1S A;  1VUB A;  5F5W A;  3WXM B;  3CC7 T;  4H2Y A;  4C8Q F;  3RIR A;  3O8V A;  4L5G A;  3PCO A;  1KMN A;  2LVM A;  3HRK A;  4J6W A;  2RHI A;  1XOV A;  4YPF A;  2JTF A;  2EIF A;  3CEY A;  4PJO F;  4YRT A;  4P74 C;  3HRS A;  1XNI A;  1KOG A;  3HKS A;  2JN0 A;  3JCM W;  3PGG A;  4UP7 A;  3C12 A;  5C0M A;  1Y71 A;  4BDZ A;  1G3W A;  1M9S A;  3QYH B;  4JUV A;  4BD3 A;  1FYF A;  3NET A;  1B76 A;  2GCX A;  2YRV A;  4EMK C;  4JS4 A;  5LJ5 f;  1JJ2 A;  4FSX A;  4CRI A;  2RO0 A;  1UB4 A;  4RMO A;  4BE1 A;  2KMT A;  2DDZ A;  2DPP B;  4RKU E;  5LJ5 h;  1X2G A;  4KR3 A;  3QPH A;  1IZ6 A;  3OD1 A;  4IUU A;  4LD6 A;  3CCV A;  3TEG A;  1YGB A;  2DXT A;  2IG0 A;  3VJP A;  3ZEH A;  3VQY A;  2V8I A;  4K88 A;  1VQ7 T;  3M59 A;  1N8R C;  1K9M C;  1D3B B;  1SET A;  3G1Z A;  2EJG A;  1JJ2 S;  4K86 A;  3BFM A;  2L89 A;  2CJA A;  1E1T A;  2LQ8 A;  3S3M A;  4M77 G;  4P3O A;  2ZR3 A;  2RHX A;  1EVL A;  4OGE A;  1ASZ A;  4G85 A;  3R07 A;  4LDW A;  2DO3 A;  3LC0 A;  1BIB A;  1VQZ A;  3M57 A;  2DU5 A;  3TEE A;  1JRI A;  5GAN 8;  3L2U A;  3CMA T;  4A4E A;  3HFZ A;  4YDQ A;  4OLF A;  4FM4 B;  4JLG A;  4O5V A;  3QZ9 B;  3JCM f;  3H8Z A;  2ZZG A;  3OYH A;  2C06 A;  3OS0 A;  2R5A A;  4M77 E;  4OVA A;  3SWN B;  4XTZ A;  2A8E A;  1Z7M A;  4RQE A;  2RHS B;  1UGS B;  2HAX A;  4MDW A;  4YRL A;  1OZ3 A;  2DQ0 A;  2RM4 A;  1VQ6 T;  3G6E A;  3RGL A;  1QW1 A;  2G4C A;  2XKO C;  1VQL T;  5CQY A;  2EQU A;  4F7U A;  3LSS A;  5LJ3 e;  3FB9 A;  1SES A;  4OB3 B;  2E1H A;  2ZPF B;  2XG8 D;  1JJC A;  1LYL A;  2EJF A;  3A7R A;  4R55 A;  4WF2 A;  3M9Q A;  4QVD A;  3NEL A;  1NYQ A;  2CYZ B;  2P0L A;  1M8V A;  1NJ2 A;  1NJ6 A;  2RJE A;  3MEY A;  2RHQ B;  1VQN T;  2G3R A;  1W2B S;  4ZGD B;  2ZIN A;  4AH6 A;  3ASK A;  2QTX A;  1YCY A;  5KE3 A;  1G3T A;  2OTJ A;  1I4K 1;  2M1H A;  5LJ5 e;  2RK2 A;  3SD4 A;  2P5I A;  3KXT A;  1YFT A;  3LW5 E;  3CCR A;  1XTD A;  3G71 A;  4YRK A;  1K8A C;  2GF7 A;  3CCV T;  4JLI A;  4CS4 A;  4C8Q C;  1ADJ A;  3OYB A;  3NEN A;  4HWT A;  2CJ9 A;  1VQ8 T;  2Y90 A;  3E9F A;  5DY9 A;  5GAM g;  4LVL A;  2WSC E;  1BBU A;  1YIJ T;  4C0D B;  2OAU A;  3PMI A;  3OSV A;  3TU4 K;  4CS2 A;  3BJU A;  4H2S A;  2YLB A;  5C53 B;  3A5Z A;  4PNO A;  3ER0 A;  2K5F A;  5D6X A;  2RI5 A;  4ZTZ B;  3OYK A;  3IAL A;  2PME A;  5C6S A;  4M78 B;  5I2M A;  2V8J A;  4BY6 B;  1YI2 T;  2FL7 A;  1VQ9 A;  4PLL A;  3CBM A;  1N9W A;  1FX7 A;  4YRC A;  4VUB A;  4QVC A;  2KVQ G;  3CCE T;  1L0W A;  2Q7E A;  4M7A E;  5CKF A;  2K5I A;  3MP8 A;  4C0G A;  2L3R A;  3E9I A;  3MEA A;  2ZT6 A;  4HWR A;  1BIA A;  1NJI U;  4H2X B;  1EIY B;  2VXE A;  5K1P A;  2QA4 A;  2QHT A;  1FWZ A;  3L2R A;  4ME7 A;  2ZGW A;  1W2B A;  4UPA A;  4BI4 A;  3A74 A;  4M78 E;  3MQZ A;  2VV5 A;  2LT1 A;  2JOY A;  4LVI A;  3CME T;  4PG3 A;  5GAN 3;  5A2Q E;  1RL2 A;  2D0Q B;  1YHQ T;  2C7I A;  2LX9 A;  4LD9 K;  2KAF A;  2VGM A;  4J15 A;  4IKF A;  5GMK m;  1YJN T;  3L2V A;  4PJO G;  1WPY A;  1ZBX A;  1G5V A;  3OBY A;  5A0D A;  1KHI A;  4RG8 A;  1YJW T;  5GMK j;  2EJ9 A;  2RH2 A;  4M77 D;  4YRP A;  2NLU A;  2E41 A;  5L8R E;  4ZN1 A;  4LVM A;  4LDX A;  2HQE A;  4TQF A;  4P75 C;  1S72 T;  4YRM A;  2JZ2 A;  5A0G A;  1VQ6 A;  3GLX A;  1Z7N A;  1KC8 U;  4BWA A;  3BDU A;  4TQD A;  1YJW A;  4ELY C;  2ZT8 A;  2XIC A;  4C92 C;  4C5G A;  3URG A;  3ME9 A;  2VXF A;  3S3O A;  2RHU A;  4V2S A;  4M77 F;  4BI3 A;  3PTA A;  3VV0 A;  3HXW A;  1IRE B;  4J83 A;  4M78 F;  4LVK A;  1OZ2 A;  5HK3 A;  3OS1 A;  5D6Y A;  4O2D A;  3OW2 S;  4II1 A;  1VQK T;  2BKD N;  1BI1 A;  2XK0 A;  1I81 A;  2Y4Y A;  4ZIB A;  5GAO p;  1WQW A;  3CME A;  5DM7 R;  3A31 A;  1E24 A;  1OYX A;  2ZZD A;  3CCL A;  3C4S A;  3LWI A;  1H4S A;  1Q86 U;  3OBW A;  4XTW A;  2X4W A;  3A8O B;  3GOX A;  3MET A;  3NTH A;  5HK0 A;  3QO3 A;  2JUF A;  2ZPH B;  1B34 B;  3W3S A;  3P8B B;  3UDC A;  2PMF A;  2ODR C;  1YBY A;  3PIO A;  2KSS A;  4M7A B;  4P72 A;  4HWO A;  3OSS C;  4P74 A;  3HRT A;  3NEM A;  1X75 C;  1KQ2 A;  4WJ3 M;  4E47 A;  3QYG B;  2VYT A;  2O4X A;  2CZ0 B;  5J3B A;  1PSF A;  4XTY A;  3QJY A;  2XHC A;  2EQJ A;  4C5I A;  5DLQ E;  1M90 U;  2K3Y A;  3PNW C;  4C5H A;  2EKO A;  2KK4 A;  1VQP A;  5J39 A;  1KD1 C;  5FU7 B;  2LQK A;  2M0O A;  3FLG A;  5GMK l;  4P71 A;  1ZQ1 A;  1VQO T;  3E9G A;  3HY0 A;  5KE2 A;  2ODR D;  1X01 A;  2ZZF A;  3VYG A;  5GAO q;  3MF1 A;  5I2S A;  2LDM A;  2MWP A;  1EFW A;  2QHS A;  1VQL A;  3A8H B;  5GAN d;  4QQD A;  1AHJ B;  3OYY A;  3X20 B;  4A4G A;  3RAC A;  3CCM T;  3TEH B;  4L87 A;  3OYE A;  1K73 C;  3RES A;  4IUQ A;  4MDX A;  1QVG S;  4J6X A;  1B7Y B;  3SDZ A;  4XQ3 A;  2X35 A;  4KUL A;  4M78 D;  3IG2 A;  1J5W A;  4OF1 A;  4JRI A;  1VIF A;  2KDS A;  2DAQ A;  4BY6 C;  1M1K U;  3HSB A;  2A3L A;  2V8K A;  2Q7H A;  3KUF A;  4RDX A;  4PLI A;  4C5E A;  2JVV A;  2ZR2 A;  2QXF A;  1EQR A;  2EYQ A;  3REX A;  5FU7 C;  3VU3 C;  2Q5H A;  3X24 B;  2RA2 A;  2CJB A;  1KG1 A;  3A5Y A;  2E6N A;  5CIU A;  1B70 B;  3OB9 A;  3LX7 A;  1UGP B;  3HXX A;  1NE8 A;  4XTU A;  4OB1 B;  1YFR A;  2QHU A;  2RJD A;  3J80 E;  3OYI A;  4YRQ A;  4XU2 A;  4Y28 E;  2I4N A;  3OYF A;  2EAY A;  2O01 E;  4D6W A;  2XTI A;  2DEQ A;  4IUT A;  4HWS A;  4H2T A;  2QQA A;  3L1A A;  3NTI A;  1VIE A;  3HXV A;  1P92 A;  3JB9 G;  3L4G B;  5GAN 6;  5KCH A;  3UFG A;  2PQW A;  2RK1 A;  3OMG A;  3REU A;  1JBM A;  3VUZ A;  4C8Q G;  4E7L A;  3JCM d;  2I2L A;  2FVU A;  2PVO B;  4EX5 A;  4YRS A;  2K3X A;  2OTL A;  4PKC C;  3QSU A;  5I21 A;  2IVW A;  4C8Q E;  3JCM J;  1KQS A;  4MMK A;  4YCU A;  2LRQ A;  1PSE A;  3LGF A;  3UGQ A;  3A5Z B;  2D6F A;  1Q7Y C;  3M56 A;  4M78 A;  4M78 C;  3LWH A;  1K8A U;  4ZTJ A;  4BB7 A;  1Y7X A;  4P72 C;  1HTT A;  4JRQ A;  2DTH A;  4CH6 A;  5GAN 4;  1M1F A;  4NL3 A;  2X4Y A;  4CI0 C;  4QQ6 A;  2XGT A;  4IUP A;  3AHU A;  5M9O A;  1WQ7 A;  4J5Y A;  2J3M A;  4YRO A;  2QDY B;  3HHT B;  2R57 A;  1KQS S;  2P0P A;  4BE2 A;  2AKW B;  2R5M A;  1YIJ A;  3RER A;  4TVA B;  1VQM T;  2IY5 A;  4ZN3 A;  4YCV A;  5GAM h;  5GAN h;  3FRN A;  4ZTF A;  5HKC A;  2MF2 A;  2DXU A;  2E64 A;  2ZT7 A;  2P0Q A;  3TRE A;  3OYD A;  4K87 A;  3A7A A;  3CC4 A;  1IL2 A;  1NZ9 A;  3G4S A;  1WLE A;  4TVR A;  2XDP A;  2QA4 T;  2MMP A;  3SFM A;  2DJZ A;  1ADY A;  3JCM c;  4LVJ A;  4X9D A;  3G6E T;  4A54 A;  3Q1J A;  1M1G A;  2EL9 A;  3S3N A;  3JCM V;  1NJI C;  4BDY A;  2E10 A;  1C0A A;  4P73 C;  4M75 F;  5HY6 A;  3VBB A;  4HCB A;  2GFU A;  4FT4 A;  2GFA A;  1NPR A;  3HRU A;  4M7D B;  4IUR A;  4MZT A;  2L5Q A;  4P3N A;  2M16 A;  2RI2 A;  4XAX B;  4LNS A;  4YRE A;  4EMK B;  2FHD A;  3DKM A;  4WJ4 A;  4YCW A;  1N8R U;  4P71 C;  12AS A;  3WVE B;  2OTL T;  4P75 A;  3SWN C;  2LCL A;  4M75 E;  2LTO A;  3A32 A;  5AYF A;  1QVF S;  5FU6 B;  3C95 A;  3KBG A;  1D3B A;  2M9U A;  3L2Z A;  2CS7 A;  2F5K A;  1HK9 A;  4J7I A;  5CO7 A;  1N9S A;  3P8V A;  4J6Y A;  4XU1 A;  4J8O A;  5GAM e;  1YFS A;  4B9W A;  3M53 A;  3MP1 A;  4BAC A;  4M75 C;  5CR2 A;  3JCM b;  2MI6 A;  4E7K A;  5LJ5 j;  3I55 A;  4ZTU B;  2QEX A;  2XDB A;  2CZ1 B;  3GP8 A;  1YIT T;  2XI9 A;  3MCA B;  1HC7 A;  1M4Z A;  4BE0 A;  1QVF A;  1LOJ A;  3I56 T;  3CXC A;  4XK8 E;  3CCJ T;  2VC8 A;  4E7J A;  5GAN f;  4Q5W A;  3E1S A;  4C0D C;  1VQO A;  1KC8 C;  4UC4 A;  3QXE B;  3N5B B;  3LH0 A;  1WYD A;  4BI8 B;  1G5H A;  4X9C A;  2RHS A;  2E6Z A;  2E12 A;  3QG1 A;  4JRK A;  2PU9 B;  1B34 A;  4YRR A;  2Q7G A;  3EFS A;  4UP8 A;  4B9X A;  4F7U B;  3CD6 T;  5LJ5 g;  4HKE A;  2QEX T;  3DLL A;  1PYS A;  3CXC S;  1G3S A;  3MEU A;  1H4V B;  4N0A A;  4M7A A;  1LNX A;  4ZGJ B;  3RKY A;  1Y07 A;  1USY A;  1Q82 C;  1JJC B;  3FEO A;  4N4I A;  3MF2 A;  4C92 B;  4M75 B;  4TWA A;  2P0K A;  5GMK i;  3WVD B;  3OMC A;  2Y4X A;  4FT2 A;  2E3C A;  4A4K A;  1Q86 C;  1GXI E;  2DU7 A;  1MHN A;  2K4Y A;  2DZ9 A;  3A7U A;  3JCM X;  3FDR A;  4C8Q A;  4NL2 A;  4HT8 A;  5CKH A;  3RF1 A;  1YJ9 T;  3DLM A;  2AMC A;  3FC3 A;  4F7U E;  2XID A;  2HNI A;  2DVE A;  4OB2 B;  3L42 A;  5GMK e;  2PVG B;  4M7D G;  3CMQ A;  4YP0 A;  4DOV A;  3INZ A;  5CKE A;  4HWP A;  4NOY A;  4CH3 A;  3JCM g;  3X28 B;  3RKX A;  4YRJ A;  3PZC A;  2RJC A;  4Q15 A;  3EFR A;  2XU8 A;  1VQN A;  2DTI A;  4DQ2 A;  5DLO A;  3JB9 F;  4DOW A;  2ZIM A;  4P73 A;  1KD1 U;  3L2W A;  2FB7 A;  3OYA A;  2P4T A;  4JJN K;  2E70 A;  1R8O B;  2QI2 A;  1FXX A;  1NJ5 A;  4L59 A;  1X54 A;  1B7Y A;  4XTX A;  4E7I A;  5ELO A;  2VUB A;  3CC4 T;  4HT9 A;  5ELN A;  4YRN A;  2LT4 A;  1O75 A;  3HXY A;  3GNG A;  2RHY A;  1V29 B;  4TVW A;  1X55 A;  4XU3 A;  3M5A A;  1SER A;  4OGC A;  4PJO B;  4MML A;  3CD6 A;  3M4P A;  1LJO A;  2ZNJ A;  1UGR B;  1K73 U;  4ELZ C;  3CCE A;  1O9S A;  3JRZ A;  1VQ9 T;  3JAM E;  2WSF E;  1WJQ A;  1QE0 A;  4XTV A;  2LC4 A;  3P8H A;  4EPC A;  1Q81 C;  4FL6 A;  3HFZ B;  2CKK A;  3QHS A;  2BUD A;  4C0F A;  4M77 A;  4TVY A;  4M7A D;  2D9T A;  3LGL A;  3VYH B;  5GAN 7;  2B8A A;  1NNH A;  3V8J A;  4HA8 A;  4M7D D;  1VQ5 A;  3QDR B;  2EWN A;  3JSC A;  1QP3 A;  4FIB A;  2OTJ T;  3CCU T;  1G5I A;  2ARS A;  3CCR T;  1SSF A;  5LJ3 f;  4JDS A;  3ERR A;  3CMA A;  2L8D A;  2A7Y A;  3QO7 A;  3FIF A;  2GQV A;  3JCM Q;  3OYJ A;  3CCQ A;  3PIP A;  1SRY A;  4ATO A;  5KNN A;  3OYG A;  3QUI A;  2WAC A;  4EMG A;  3OS5 A;  2DKG A;  3P8Y A;  1BI2 A;  4M75 G;  3RKW A;  2CIM A;  1YIT A;  2QQR A;  2E65 A;  3CCS A;  4P5N A;  4HT4 A;  4YRG A;  2ZPG B;  5GAO l;  3G4S T;  3NFC A;  3HXZ A;  3ZBD A;  4M7D F;  2NS6 A;  2ALY A;  4EDU A;  3CCM A;  2K2V A;  2DXB A;  2ARU A;  3M4G A;  5FRM A;  4H02 A;  3I56 A;  1YJN A;  2HBP A;  3QZ5 B;  3DB3 A;  4X34 A;  4RQF A;  1VQ8 A;  2MAM A;  3M58 A;  5GAM f;  1VQ7 A;  3V8L A;  5LJ3 d;  1Y96 B;  3RL6 A;  5FU6 C;  2DK3 A;  5CVI A;  3TCJ A;  3JCM h;  4OB0 B;  2FYK A;  4DA4 A;  3M54 A;  2RI3 A;  3UPU A;  1S72 A;  2XD0 A;  2E5Q A;  2QQB A;  4H2U A;  1QVP A;  3E19 A;  4A53 A;  1I5L A;  1U8R A;  3HFN A;  2R58 A;  1H4Q A;  4BW9 A;  2DIG A;  3CC7 A;  2QQS A;  3OYM A;  4OP0 A;  5LJ5 d;  4M7A F;  4PHC A;  5E3I A;  3HL8 A;  3DSQ A;  3BY7 A;  1NPP A;  1WJR A;  2DTO A;  3QTC A;  2DIQ A;  3RMS A;  2AHJ B;  1EIF A;  2ZIO A;  3GF5 A;  4KT0 E;  2RD1 A;  4EMK A;  2KQW A;  1ASY A;  1BKB A;  2DXC A;  4KUI A;  4H2X A;  2PVD B;  4H2W A;  1EIY A;  3L2Q A;  4O6J A;  3J81 E;  3M4Y A;  3V7R A;  2MWO A;  1U1T A;  3CPW S;  3PCO B;  3GIB A;  3S6W A;  1WU7 A;  3E9H A;  4M7D E;  3HXU A;  4C92 F;  5K1X A;  1GGM A;  4BUG A;  3G7Z A;  2KY9 A;  5GAO m;  4C92 D;  4NS5 A;  5CKD A;  5LJ3 g;  3VQX A;  2X4X A;  1M5Q 1;  2EQK A;  4F7U F;  2RJF A;  1WNL A;  4N4G A;  1TH7 A;  1YI2 A;  4YYE A;  5FRO A;  5KH6 A;  2YHT A;  4JS5 A;  3KFU A;  1RI0 A;  1YJ9 A;  2ZPI B;  1K9M U;  3OS2 A;  3H6Z A;  3R6O A;  2H3J A;  2ZT5 A;  3TEH A;  4RCB A;  4CS3 A;  3OY9 A;  4RMF A;  1MGQ A;  1B8A A;  1UEB A;  1N27 A;  1BI0 A;  4X5O A;  3X25 B;  2K5L A;  2YLC A;  4PJO E;  1M1K C;  2C8M A;  5EG2 A;  3GNF B;  4R56 A;  1I8F A;  4MZP A;  2QQ9 A;  3DB4 A;  2LCC A;  3JB9 H;  1PYS B;  4E7H A;  2VGN A;  2ZXF A;  4CH5 A;  1VQ4 T;  2RB6 A;  3M4Q A;  2DQ3 A;  1YB3 A;  3GPL A;  5D6W A;  5A0L A;  4C92 A;  4M75 A;  1KMM A;  1NJ1 A;  4CH4 A;  1OI1 A;  2EFI A;  2J3L A;  3SB2 A;  3NTK A;  2ZTG A;  3CCU A;  1B70 A;  3ICA A;  3MO8 A;  4UP9 A;  3VUB A;  1E22 A;  2I4M A;  3QO8 A;  4C8Q B;  2AMC B;  3CPW A;  4Z02 A;  5LJ3 h;  3VQV A;  1H4T A;  4QW2 A;  5CK9 A;  4PJO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...