2DTIA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, pyrophosphate and mn(2+)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 69
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dtiA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dtiA01
2RB6A 4M7AF 5K1XA 1Y96B 4JRIA 2E41A 1NYQA 4P72C 1X2GA 1X56A 4M77D 4M77A 1QE0A 2ZR3A 3HY0A 1I81A 1WQWA 1LOJA 2ZZGA 4C8QD 4C8QA 3LC0A 2DTIA 5GMKm 2J3MA 4M7DC 3A74A 2RM4A 4M7DG 2CIMA 4UP8A 2E1HA 1HTTA 3EFSA 4C92C 2PMEA 1MGQA 4C92G 3TUPA 4XTXA 4F7UF 5LJ3e 3PCOB 2ZGWA 4H2TA 3A5ZA 1ASYA 2ARTA 3JB9D 5LJ5j 3IKMB 3LSQA 1X2HA 4M75F 4P71C 2DEQA 3QO5A 3JCMh 2DQ3A 2DU5A 3CMQA 4WI1A 1NNHA 4K88A 3V8LA 1C0AA 2RD1A 3WQZA 4A53A 5LJ3g 4CH3A 5GAOp 2QHVA 5LJ3d 2CJAA 1WLEA 4EMHA 3JB9H 4HVCA 2PMFA 3QSUA 3UGQA 2ZIMA 4YRGA 2VXFA 3W3SA 2ZTGA 2QTXA 4LNSA 5GAN5 3RACA 2I2LA 3PGGA 3HY1A 4PJOD 4M78F 5GANg 4YRCA 2AKWB 4P3PA 4P71A 2JN0A 4RQEA 1ASZA 3A7UA 2I4LA 2YLCA 4MMLA 2E65A 2ODRC 4YRTA 5DY9A 4HWSA 2Q5IA 1YB3A 4M7AD 1EVLA 4P3NA 3VBBA 1B70B 5GAN4 4H2YA 2RHSA 2DTOA 4P75C 4EO4A 4XU0A 4RCCA 4WJ4A 1WU7A 5ELOA 4M77E 4AH6A 4CH6A 1H4SA 4BWAA 4M77B 2EAYA 2ZNIA 3KFUA 5I21A 2ZZEA 4C8QE 4YPFA 1Z7MA 1BIBA 5GANh 4PNOA 4C8QB 4HWPA 4CH5A 4F7UA 5GAMg 4P3OA 5C51B 4J6WA 4XTUA 1B7YA 1YFTA 3FB9A 2DXTA 2ZT7A 4M75D 3HFVA 2Q7HA 2IY5B 4M77C 4M77G 2DVEA 1NYRA 5GMKe 5GAN8 1H641 3IKLA 11ASA 1W66A 3QHSA 3QO7A 4C8QC 4C8QG 1G5IA 1HC7A 1KOGA 3A32A 2AKWA 5LJ5e 3VQXA 1LJOA 1EVKA 4H2WA 3GIBA 3HFOA 3JCMV 1X55A 4H2XB 4H2UA 4YRMA 1YCYA 4NL2A 5GAMh 4RQFA 1H4QA 3MEYA 4M78D 4M78A 1SRYA 5C52B 4PJOE 1VQZA 2Q5HA 3MF1A 3VQVA 4P73A 4EMGA 5LJ5g 3MF2A 3V7RA 1KQ1A 4H2VA 1YFRA 5LJ5d 1KMNA 4YCUA 1ADJA 3EFRA 2ALYA 1QF6A 4UPAA 3HSBA 4UP7A 2C7IA 4JRKA 2FYKA 1I5LA 1M8VA 3HXWA 1KMMA 1LNXA 4M7AE 4RCBA 3DSQA 4H02A 2QHSA 3HFNA 5F5WA 4M7AB 4TQDA 3RESA 2RHSB 3RERA 3BY7A 2ZR2A 2P0LA 1SESA 2IY5A 3NEMA 4KR3A 2EL9A 1YGBA 3V7SA 3SWNB 4YP0A 4JUVA 4F7UE 3JCMf 3NENA 5GAOn 1LYLA 1NJ8A 1E24A 1GGMA 4M7AC 4F7UB 1I4K1 4XTWA 3RKWA 1WNLA 4M75E 1B7YB 1EQRA 1H4TA 3E9HA 1BBWA 4H2XA 2ZT5A 1JBMA 4M75B 4XU2A 3BW1A 4OP0A 3ERRA 3JCMc 5GAN7 1ATIA 4ZTUB 3NETA 4K87A 5GAOl 4TVWA 4O2DA 3REUA 3HXYA 4YRKA 1TH7A 3SWNC 4PJOA 2RHQB 3JCMQ 4F7UG 4HA8A 1B76A 1USYC 5GAN2 3BFMA 5E3IA 4M75C 4M75G 4N0AA 4CS4A 1U1TA 4XU1A 2XTIA 1NJ6A 4M78E 5LJ3h 2DZ9A 2E64A 4M7AA 4PHCA 4M78B 4E51A 5LJ3f 1JRIA 1ADYA 2DDZA 4YDQA 4CS3A 4YCWA 4V2SA 3VU3C 4YRFA 3UH0A 1EIYA 1SETA 4YRPA 5LJ3j 2ALYB 3SWNA 1IL2A 4PG3A 5KNNA 3BDUA 4NL3A 1PYSA 2HNIA 4K86A 4Y91A 4XEMA 4XTYA 3QNEA 3AHUA 2Q7EA 1G5HA 2ZNJA 4M78C 5GANf 2I4OA 5ELNA 4M78G 2K57A 1USYA 4WJ3M 2ARSA 3A7AA 2ZT6A 4X5OA 4P73C 2ZIOA 1D3BB 4M75A 5CAIA 3A31A 12ASA 3JCMb 5GANj 4YRSA 2DZCA 2AMCB 1I8FA 3A7RA 4A54A 3I7FA 2DU7A 4G84A 2EWNA 4J15A 4EX5A 3JB9J 2RHQA 2DTHA 3BJUA 3UFGA 2ZINA 2VC8A 1NJ1A 3QO8A 2Y90A 1X54A 1H4VB 1YFSA 2DXUA 2DQ0A 4TVAB 4EMKB 3RGLA 2E5AA 3JB9G 4KQEA 4YRQA 2I4MA 3RKYA 2EJGA 1N9SA 4XU3A 5GAMf 1JJCA 4M7DF 1M5Q1 3PZCA 4TTVA 4H2SA 4PJOB 3JCMe 4C92F 4P74A 5C53B 3V7CA 5GAMj 3HXZA 3JB9I 4YYEA 3TEHA 2YLBA 4EMKC 3HXXA 3R07A 3JCMW 3HXUA 5GMKl 4RDXA 3A5YA 1N9RA 4BW9A 4YREA 5GAOr 2CJ9A 3RL6A 4PJOC 1D3BA 5GMKh 4J5YA 4PJOG 4HWTA 4YRIA 3JCMd 2RA2A 2AMCA 1EIYB 4MMKA 2ZXFA 4N0AC 4OLFA 2EJFA 4YRRA 5LJ5h 1X01A 5GMKj 1PYSB 5GAN3 4M7AG 4CS2A 1BIAA 5LJ5f 4L87A 3HRIA 2CJBA 4DPGA 4J6XA 4TVAA 4EMKA 3FIFA 2J3LA 4Q15A 3RF1A 4YRJA 3V8JA 1L0WA 4XTVA 1G51A 3P8YA 3LSSA 4YRLA 2G4CA 1J5WA 1B34A 1N9WA 4JLIA 1WYDA 4P72A 2CGHA 1Z7NA 5GAOq 4HWOA 3M4PA 4ZTZB 4YRNA 5GANe 3JCMP 5K1PA 2E3CA 3E9IA 2C8MA 3RKXA 3VQYA 4M7DD 4M7DA 3RUXA 2E10A 4NOYA 1E22A 5GAN6 4QVDA 5GAOm 4C92D 4C92A 4YROA 1JJCB 1Y96A 4G85A 4NCXA 4X9CA 2DKGA 1U1SA 1HK9A 2ARUA 1KQ2A 2VXEA 1E1OA 5GANd 3P8TA 3UGTA 2XGTA 4M77F 3TEHB 4TWAA 4HWRA 2ZZFA 3L4GB 3REXA 3TEGA 4X9DA 2QHTA 1FYFA 3FJPA 1HXDA 3HFZB 1RIQA 4C8QF 4J6YA 3IG2A 4RMFA 4TQFA 4CH4A 5GAMe 3PCOA 2I4NA 4Q6GA 4QVCA 2P5IA 3HRKA 2FB7A 3VQWA 4P74C 4YCVA 5GMKi 1WPYA 1NJ2A 2ZCEA 3JB9F 5HGQA 3M4QA 4UP9A 2DJZA 2EJ9A 1SERA 1B8AA 2YHTA 3RIRA 3NELA 4HT9A 3HXVA 2ZT8A 3SB2A 3IALA 5GAMd 2QHUA 3QO3A 3P8VA 4WF2A 3M4GA 3OD1A 3ICAA 1EFWA 3L1AA 4HT8A 2ODRD 1WQ7A 3L2ZA 4XEOA 3INZA 3QUIA 4P75A 4XTZA 3V8KA 4KR2A 1B34B 3JCMJ 1NJ5A 4TVYA 1E1TA 4DQ2A 4PJOF 2Q7GA 3QTCA 3JCMX 3L4GA 4XQ3A 1EOVA 4M7DE 4ZIBA 3G1ZA 3HTZA 3HFZA 4C92E 4M7DB 1B70A 3JCMg 1BBUA 4C92B
chains in the Genus database with same CATH superfamily
2RB6A 4M7AF 3UDCA 1OV3A 4M77D 1YI2Q 2ZR3A 3S3OA 2YRDA 3OYFA 4OMLA 1WQWA 2ZZGA 5FWBA 4BE2A 4C8QA 2J3MA 2CIMA 2O4XA 2D6FA 2R58A 4C92C 1MGQA 3VS6A 4C92G 4XTXA 3TUPA 4F7UF 3KFVA 1ZLMA 2CP0A 2E6NA 2ZGWA 3MP6A 4CC4B 1T0HA 3JB9D 1SHGA 2JMAA 1Y07A 5CQYA 1GCQA 1M8MA 3JCMh 2DQ3A 2O31A 3M0QA 1BCMA 1OX9A 2KRMA 1QVFA 3OBYA 2F2VA 4K88A 4A53A 1GFCA 3OY9A 5EG2A 2HD0A 2DPPB 1SHFA 5LJ3d 2CJAA 4LDUA 4HVCA 4HVVA 1KQSA 3LGFA 3GNGA 3F70A 2L3QA 3W3SA 2ZTGA 1ZSGA 3G71A 2JW4A 2L8DA 2V8JA 2L3PA 2QTXA 4LNSA 2RQVA 3MHXA 1K8AU 5GAN5 3HY1A 3QZ9B 1VQOA 3G71Q 2EKHA 1QQJA 3CQTA 4KT0E 4P3PA 2DIGA 1BYMA 4RQEA 1VQOQ 1ASZA 3A7UA 2I4LA 2YLCA 1WI7A 5CIUA 1WJSA 2E65A 2QXFA 4YRTA 1R8OB 2CZ7B 2B86A 5KCOA 3G4ST 1EVLA 4P3NA 1SRMA 2RHSA 3ULRB 4XU0A 3UT1A 1Q86U 2RQRA 2EFIA 2EQIA 2HDAA 4B6MA 3OS1A 4JS4A 1IB8A 4M77B 7AT1B 3PIPA 4LVLA 1Q82C 2KNBB 3QIIA 1Z7MA 1KD1U 4PNOA 1G8XA 2L2PA 1K0SA 1SSFA 4UC4A 1BI3A 2FZKB 5C51B 2XI9A 3SHWA 3QG1A 2YUQA 2EQKA 4C5GA 1YFTA 2F5TX 2DLPA 1GL5A 5HKCA 1M9SA 1OU8A 4M77C 3CC7A 2DVEA 4M77G 1NYRA 2RI2A 3IKLA 5DLQE 1G3WA 3CC7Q 2EYQA 1FMKA 4WTOB 2CSIA 4FU6A 2H3EB 1UECA 1RAHB 2K2VA 2OTLA 3GIBA 2QK0A 1TWBA 1X55A 4H2UA 4YRMA 1YCYA 2KY9A 4NL2A 5GAMh 2OTLQ 3VS4A 3OYEA 4BI3A 1QP2A 1M90R 1SRYA 4PJOE 1BKBA 3KBGA 5FROA 2FZCB 1V76A 3VKIA 2R57A 3VRZA 4P73A 3MF2A 4OB0B 2BTTA 4AMCA 1KMNA 4YCUA 2ALYA 3NFCA 1Q7YU 2MWPA 4BE1A 2C7IA 2RHZA 3CD6T 4PFZA 3ME9A 5AT1B 4M7AE 2QQ9A 2LTOA 4PLIA 2RJFA 3RERA 3O5ZA 4E47A 3TVTA 3TSZA 3NEMA 1O9SA 4MZTA 2GFUA 1M90C 4N4HA 2DD5A 4KUDK 2O88A 3CCUT 1YGBA 3CCQA 2BE7D 2KT1A 2O9VA 4KGZB 4F7UE 3NENA 5IXBA 1MMNA 3PMTA 1E24A 4E7HA 3CCQQ 2X3XD 1I4K1 2Y4YA 1VQ8A 1GRIA 4OMFB 1EQRA 4J9BA 3E9HA 1WYXA 2O01E 3M0SA 1R0CB 2E5QA 3CMAT 4XU2A 1YIJT 3BW1A 1VQ8Q 3L2QA 4WCIA 5CCAA 2XK0A 3REUA 2QQAA 4FYWB 2IVWA 5DLOA 4LVJA 2HSPA 5I2SA 2A37A 5GAN2 3M53A 1OU9A 3C94A 5C6SA 3OMCA 1NJ6A 4Y28E 1VYVA 4HXJA 2M9UA 2K4YA 2DDZA 1TTHB 3EGDB 5HK3A 4YRFA 2L0AA 4Z02A 5KYYB 1VQNA 2PNIA 4Z8AA 4E7KA 3CPWA 3QJYA 5LJ3j 2FL7A 1KQSS 1VQNQ 3JSCA 4OMOA 3X26B 4JJNK 4LVKA 4RTWA 1V29B 3BDUA 1PYSA 4XEMA 4R56A 1G5HA 2I4OA 2J6KA 4WJ3M 3MEWA 1HJDA 1K0XA 3QKJA 5CAIA 4DOWA 2X35A 2RQUA 5GANj 12ASA 1WHGA 2AMCB 1QVGA 3CCEA 2DU7A 4G84A 4EX5A 3EGUA 2RI3A 1QW1A 2DTHA 1H92A 3CCMT 3CCEQ 3UFGA 3M9QA 2ZINA 5A0LA 1NJ1A 1W4SA 4QT7A 3EG1A 2KXDA 1QCNA 3EG2A 4YRQA 2I4MA 2CS7A 3LGLA 1X2QA 1N9SA 3EGDA 1AHJB 3TSWA 5KYYA 2QEXA 4P74A 2A08A 3V7CA 4GLKA 2QAZA 2DMOA 1RI9A 2ABLA 3CXCA 3R07A 2QEXQ 4RDXA 3QZ5B 3M55A 4BW9A 3G1JA 5KCHA 1M90U 1X6BA 4J5YA 1AZEA 2XDBA 2AMCA 1RACB 2ZPGB 3DB3A 1OX8A 3REBB 1OZ2A 3X25B 2ZXFA 2ECZA 3GLXA 2RN8A 1ACMB 2EJFA 5CKHA 2O9SA 5EC7A 2OTJT 2HCKA 3M59A 2CP7A 1AD5A 1YBYA 4DBHA 1BIAA 4JDSA 5LJ5f 4L87A 1QKWA 3ZL7C 4LVMA 4A4HA 2XG8D 4DPGA 1MMGA 3HTRA 4FT2A 3HKSA 3E9GA 3M5AA 1VQMT 3H41A 1ZSZB 1N5ZA 4HCKA 1S72A 3QWYA 3LSSA 4PFPA 1B34A 5IAYA 2BZYA 4JLIA 4RTXA 4P72A 2EGAA 1S72Q 1Z7NA 4BE0A 5GANe 1DJ7B 1NPPA 5KYWA 3E9IA 4HKEA 5FRMA 1MUZA 2EQJA 4RTVA 1ZSZC 4M7DD 1E22A 4RTZA 4QVDA 5GAOm 1BCOA 4YROA 2LNHB 2W10A 3VUBA 3P8DA 4L6V5 1VYUA 1ARKA 1YI2T 3P8TA 4RG2A 4E6RA 2DL7A 3TEGA 2KYMA 4KH0B 3L42A 1FYFA 1HXDA 2I0NA 2XMFA 1YJNT 1RIQA 2HKNA 3IG2A 4Y92A 1YJ9A 4TQFA 1TXQA 3PCOA 4Q6GA 2DXCA 4N4GA 1YJ9Q 3DLMA 1AZGB 1T0JA 2DJQA 5HGQA 2EYXA 3FEOA 2HBPA 2K2MA 1SERA 3OSVA 2GNCA 1K73R 3HXVA 1QMCA 4IUUA 2MMPA 2LJ1A 4FYVB 2LQNA 4E7ZA 3I55A 4ANJA 3QO3A 3P8VA 1IGQA 3OD1A 1D0YA 2QQBA 1HSQA 5FRNA 2ODRD 3JAME 3I55Q 3HPWA 1IHVA 3HRTA 2JOYA 2P4RA 4XTZA 2DK3A 3G71T 3WVDB 3QTCA 4HVWA 3G7ZA 3GP8A 3LYIA 2AK5A 1VQOT 4II1A 1X75C 2LX9A 1QVGS 1PC0A 2K3BA 1TS9A 4JZ4A 4N4IA 1XTDA 3CCSA 4M7DB 3CCJA 3JCMg 4CC2A 3H0IA 2HBWA 2JM9A 3CCSQ 5K1XA 1TU0B 5IHNA 1X2GA 1OI1A 3CCJQ 1QE0A 3PIOA 2EBPA 3NMZC 4OVAA 1YJWA 4DEXA 1YWPA 2JM8A 3E2UA 4C8QD 2DL5A 3LC0A 2DTIA 2DL4A 5GMKm 4M7DC 4M7DG 1YJWQ 4OB1B 1UGPB 1WA7A 2E1HA 1HTTA 3RNJA 1ABOA 3CCVA 2PMEA 1ZUYA 2PTKA 2LQWA 1MMDA 3CCVQ 3LSQA 2LT4A 1PD1A 1ZBJA 4DBRA 2ESWA 2RHUA 3CMEQ 2HZYA 3CC7T 4WI1A 2PU9B 4EIKA 1OQKA 4QQGA 3V8LA 2CH4A 4HVUA 5CKEA 2BZ8A 5GAOp 2NUZA 2PVDB 3EG9A 2QHVA 1WLEA 3JB9H 3QSUA 1VUBA 3Q1JA 3UGQA 4OB2B 4YRGA 1TUDA 2OTLT 1KHIA 2JZ2A 1MHNA 3RACA 2I2LA 2JTFA 3PGGA 1WXTA 2F2WA 2G3RA 2AHJB 4M78F 3BE3A 2IG0A 3VRYA 3A98A 2E3HA 2JN0A 2K7AA 4MMLA 1R77A 2COZA 3CCLA 1VQPA 2R5MA 3HHTB 2ODRC 1IO6A 5DY9A 4HWSA 2Q5IA 1WZOA 1YB3A 1OZ3A 3QWXX 1G3YA 5GAN4 4P75C 3CCLQ 1JJ2S 3I35A 2P84A 3M0RA 1VQPQ 2JS0A 3LWIA 2E4HA 1H4SA 4BWAA 2EAYA 3KFUA 2ZZEA 1WJRA 2RNAA 4YPFA 1BIBA 5GANh 2YSQA 4C8QB 4HWPA 4CH5A 4F7UA 5GAMg 2QA4T 1AOJA 4P3OA 2O4XB 1RI0A 2DXTA 1VQKT 4M75D 3HFVA 2B8AA 2F1LA 3UPUA 1VQ8T 4CRIA 5KYUB 5GAN8 3M56A 4LDXA 4LVIA 3PT9A 1VQ7A 11ASA 1IRXA 1CKBA 2P4TA 4A4EA 2K5FA 1RAAB 2CZ0B 4KGVB 1QLYA 4C8QC 4C8QG 1G5IA 1HC7A 2FO0A 5DM7R 1VQ7Q 1O75A 1K73U 1NYGA 3VQXA 1PKTA 1EVKA 3I5SA 4P5NA 3JCMV 1TG0A 2PQWA 3M0TA 3QYHB 4RQFA 4D8DA 3H6ZA 2M16A 3SDZA 1UG1A 1RADB 1UFFA 2DM1A 2Q5HA 3VQVA 1VIFA 3N5BB 3P8BB 4X1VA 4EMGA 2L3RA 4DA4A 1KIKA 4ATOA 1WLPB 4H2VA 4BY6B 5LJ5d 1ADJA 3EFRA 1VQNT 4UPAA 4UP7A 4JRKA 1YHQA 4RCBA 1XNIA 3HFNA 1GCPA 4AG2C 4FW1A 1I1JA 2RHSB 1YHQQ 3TREA 3EH1A 2A7YA 1SESA 3CCRA 4BY6C 1WGSA 5FW9A 4F16A 4CI0C 5KYUA 2EL9A 1AWWA 2BKDN 3CCRQ 1WHMA 3SWNB 3PVLA 5IHKA 5GAOn 2Y4XA 3CCET 2VV5A 1WNLA 1JXOA 2VB6A 2MYSA 3OW2A 1BBWA 4ELZC 2ZT5A 1JBMA 4M75B 1GBQA 4PJNA 3OYJA 3ERRA 3JCMc 1ATIA 3TU4K 4ZTUB 3TQ7P 4O2DA 1RAIB 1FXXA 2VVKA 3SWNC 3THKA 4LE9A 2LVMA 1BI0A 4MZPA 1Q82R 1JU5C 2KK4A 1USYC 3BFMA 5IN1A 5E3IA 4M75C 2NS6A 4M75G 4N0AA 3EGXB 2QEXT 4CS4A 2GTJA 1U1TA 1WX6A 5KYXA 2SRCA 3RMSA 4M78E 1K9MR 1J3TA 3RDVA 1JRIA 1ADYA 3S6WA 4YCWA 3OYNA 1EX4A 1SETA 1E6HA 4Q5WA 3FDRA 2ALYB 2CP6A 3SWNA 4PG3A 4FYXB 4NL3A 4L5GA 3GPLA 4XTYA 4C0GA 3AHUA 2Q7EA 2ZNJA 3QJ6A 1USYA 3A7AA 2BUDA 1IHWA 4P73C 1D3BB 4M75A 1K9MC 2HQEA 3A31A 1D1AA 3OSSC 3JCMb 4YRSA 2DZCA 1I5OB 2XU8A 1OPKA 2J6FA 3REAB 3I7FA 1QVPA 2EWNA 2KAFA 3OYYA 4GBQA 1K4US 1QKXA 1S72T 5I22A 1QVGP 2LJ0A 1X54A 3SEMA 3EGXA 1T3LA 4EMKB 4TVAB 3JB9G 4Z89A 4KQEA 2JT4A 1SRLA 3I56A 3MEVA 4NS5A 2VASA 2RO0A 1U5SA 2M51A 1JJCA 1AT1B 2LX7A 1WDXA 3UA7A 3CC2A 2VGNA 1PSFA 1FMVA 4C92F 4J9GA 3I56Q 4Z88A 5C53B 1B7TA 3HXZA 2HMAA 1RAEB 2FEIA 4LD6A 3CC2Q 4EMKC 4E7SA 1VQ5A 3VS7A 1M3CA 2X4JA 4MZMA 2E3IA 3I9QA 2XDDA 1VQ5Q 3A8LB 4IUTA 1D3BA 2KT8A 2ZPHB 4HWTA 1M4ZA 2CDTA 3JCMd 4CC7A 1YJ9T 2Z0WA 4MMKA 2CUBA 4DOVA 2KMTA 4YRRA 2ZPIB 4RG8A 2XIDA 2DRMA 5GMKj 2YUOA 1PYSB 1WHLA 4J9EA 1C0MA 1I0CA 8ATCB 3OYBA 2JJ9A 2P0KA 2MIOA 4J6XA 1NE8A 4TVAA 4EMKA 2LDMA 3FIFA 2FPEA 2VGMA 2ZCFB 4QW2A 3I55T 2D8JA 2QGGA 1G51A 3CPFA 2LT1A 3P8YA 4C5IA 2CZ6B 2G4CA 1T3SA 2HL5C 2KSSA 3OYIA 4HWOA 5GAOq 3JCMP 4O6JA 5CR2A 5K1PA 2E3CA 2M0OA 3VQYA 4ZNXA 1JJ2P 2E10A 4NOYA 2XHCA 1QVFS 1Y96A 4G85A 1X69A 3CCST 1KC8R 1HK9A 1M27C 1NM7A 1Q82U 2RK2A 1KQ2A 2EYYA 3CCJT 1N8RR 3UGTA 1RLPC 4M77F 3RBBB 2JMCA 4PJLA 4HWRA 4JJCA 3G6EQ 4IUVA 4X9DA 2QHTA 3TEEA 3X28B 1YJWT 3FJPA 1K9MU 2AKLA 4RMFA 4CH4A 2LCSA 3OB9A 2WSEE 4P74C 1AWJA 2HL3A 4OMQA 5GMKi 1OYXA 1NJ2A 3JB9F 1KC8C 1N8RC 1B8AA 2YHTA 2JXBA 4J9FA 2IPOB 4K11A 3M0PA 3UWNA 2RJCA 4DEYA 1WHKA 1GXIE 5GAMd 2QHUA 5D6XA 3VUZA 4O5VA 3FC3A 3M4GA 1NPRA 1JQQA 2HKQB 2P0QA 4EDUA 2DYBA 2HQXA 2LRQA 1Y71A 2XICA 4XEOA 3QUIA 2DL8A 1KG1A 3LX7A 1B34B 1NJ5A 4TVYA 1SF9A 2DAQA 1E1TA 2EQMA 4TVRA 4D6WA 2Q7GA 4DBQA 2G6FX 1EZZB 3FJ5A 2AZSA 3C95A 4PFOA 5KYWB 4XQ3A 1X6OA 3G1ZA 2J7IA 4C92E 1B70A 3EG0A 3MO8A 2KROA 1ZQ1A 3PE0A 1VQPT 4JRIA 1NYQA 1X27A 4P72C 2D0QB 3HY0A 1PD0A 2OJ2A 1VQ9A 3LW5E 3MP8A 4J9DA 1LOJA 5LL6S 1D09B 5A0DA 2FG0A 1BB9A 1VQ9Q 4LD9K 2RM4A 4UP8A 3EFSA 3QYGB 5LJ3e 3PCOB 1ASYA 2K9GA 3IKMB 2DRKA 2X4WA 3QO5A 1PRLC 3NGPA 3QXEB 2D8HA 1NNHA 3ASKA 1PRMC 1VQ4A 1VQ7T 5LJ3g 1G2BA 2PVOB 1PCXA 3PVQA 1VQ4Q 4QQDA 4JLGA 1LVKA 4C0ZA 2ZIMA 2VXFA 1VOMA 2M1HA 1G3TA 4LDYA 4PJJA 4PJOD 4ZTJA 5GANg 1BI1A 2BZXA 1TUCA 2AKWB 2ATCB 4ZGEB 2ZPFB 5D6WA 1A0NB 2WACA 1EFNA 3M58A 5FWCA 4PLLA 2FVUA 3NTHA 4M7AD 5A2QE 4H2YA 4EO4A 1UGRB 1YHQT 1B3QA 4WJ4A 1P92A 5I11A 1WU7A 5ELOA 4M77E 4AH6A 1KC8U 2ZNIA 4DBFA 5I21A 4J83A 4ESRA 2X4XA 4FYYB 3CCRT 4OGCA 2YDLA 4OMPA 4J6WA 1B7YA 1MV3A 3OYGA 4B9WA 3CPWS 2WSCE 1AEYA 4A4GA 1RLQC 2OX7A 3GOXA 2LZ6B 4BB7A 3QHSA 3QO7A 2EW3A 3QDRB 1SKUB 2AKWA 4FM4B 2NWMA 2O2OA 2F69A 2WSFE 4H2WA 3HFOA 3EG9B 5KYNA 2RI5A 5KE2A 3FLGA 2XKOC 4J9CA 1H4QA 1MV0B 1UHFA 4M78A 3OYCA 1VQZA 1YP5A 3MF1A 3MCAB 1JXMA 1BK2A 3V7RA 2RJDA 1CSKA 1KQ1A 1JO8A 1PSEA 3SD4A 4E7IA 5CKDA 1QF6A 2GBQA 2DBMA 4BI8B 4F17A 1LPLA 4EPCA 4L59A 1I5LA 1M8VA 2MK5A 3DSQA 4H02A 2QHSA 3A8OB 5F5WA 4M7AB 3M54A 1D0XA 4CC3A 2YRVA 1VQLA 3BY7A 2ZR2A 1MMAA 2P0LA 2V8IA 1KHCA 1BI2A 2KVQG 3CMEA 3CBMA 1OULA 4KR3A 2YUNA 1VQLQ 3CXCS 1RAGB 2YT6A 4YP0A 1GFDA 2XD0A 4JUVA 2RHYA 3JCMf 1HYOA 1LYLA 2KRSA 3EAEA 1NJ8A 1UB4A 4M7AC 1SPKA 4F7UB 1OPLA 3RKWA 2LCCA 5A0GA 1NEBA 4HCZA 4BACA 1H4TA 4J9HA 5KH6A 2AIRB 3VS2A 4OP0A 2W0ZA 1QVFP 1WIEA 5GAN7 1U8RA 3NETA 5GAOl 3HXYA 4YRKA 1TH7A 2HQHA 4A4KA 4JS5A 2IIMA 1M1FA 4JRQA 4PJOA 1AVZC 4F7UG 3NTIA 4HA8A 3I56T 1YCSB 1KQSP 1ABQA 1B76A 3IQLA 2X51A 1D0ZA 3RR6A 2GGRA 3CC2T 4XU1A 4E7LA 1UJ0A 2XTIA 3MEUA 1HD3A 5LJ3h 4M7AA 1Q81R 1VQ5T 4E51A 3EHQA 2DEUA 4LDWA 4YDQA 4CS3A 1TSFA 3VU3C 5CQXA 2DFUA 2DILA 2DA9A 1N6AA 1EIYA 1EIFA 2GQIA 1S1NA 2RQTA 3PMIA 4IIMA 1VYTA 5KNNA 2HNIA 3EFOB 3QNEA 1W1FA 3CCQT 1PNJA 2FZGB 2K5LA 5ELNA 2K57A 2C06A 2DBKA 1Q81C 1VQ6A 2OTJA 2MF2A 1I8FA 1RUWA 4C0FA 1UE9A 2DXBA 1VQ6Q 2OTJQ 1KK7A 2DYIA 1G83A 3HRUA 2KYBA 1KD1C 2GTOA 2VC8A 3E1SA 2K6DA 2KDSA 1KFZA 3QO8A 2QI2A 1UHCA 4RTYA 4JZ3A 1YFSA 2DQ0A 3RGLA 2PVGB 2E5AA 2KXCA 3VV0A 3H0HA 3EH2A 4FSXA 4AFQC 3RKYA 1QCOA 5GAMf 4ZGDB 4M7DF 2FPDA 1M5Q1 4TTVA 4H2SA 5L8RE 4KRTA 3D7SB 1NYFA 3CBOA 1M3AA 4YYEA 2JUFA 2R5AA 4ZTFA 3TEHA 2YLBA 3L2VA 3EFOA 1ZBXA 5GMKl 4C0DB 3GF5A 5KYXB 1NZ9A 3JV3A 3MEAA 5GAOr 3E9FA 2DX1A 2CJ9A 1ZX6A 1W2BA 1K9AA 2HEQA 1WHJA 4BUGA 3UF4A 3CBPA 1E7OA 3QBYA 2KI7A 5C0MA 5HY6A 3OS5A 3MP1A 1PWTA 4MDXA 4AFSC 4N0AC 1YJNA 1RL2A 4J9IA 4IUQA 4C0DC 4LUDA 4GLMA 3VYHB 1Q7YC 5GAN3 1FX7A 2C0TA 1YJNQ 1V1CA 3META 1N27A 1QCFA 2CJBA 4LXCA 2KBTA 5M9OA 1NLOC 2EPDA 2CKKA 3V8JA 3WXMB 1L0WA 4XTVA 2DIQA 3PTAA 1M2OA 4B9XA 4KULA 4F14A 4KUIA 2FPFA 1J5WA 1IXDA 2QDLA 3M4PA 1XQHA 4YRNA 4HCCA 1JB0E 2DL3A 1PKSA 2GQVA 6AT1B 2X4YA 4OGEA 4RKUE 3RUXA 1JEGA 4KGXB 3FRNA 5FU7B 4C92A 4RTTA 1JJCB 4NCXA 3L2RA 4X9CA 2DKGA 1U1SA 2P0PA 4OB3B 2ARUA 2NUPB 3U23A 2BE9B 1XJWB 5GANd 2MOXA 1I07A 1FWZA 3PNWC 4TWAA 2ZZFA 1QWFA 4FW2A 3REXA 1FMWA 1K1ZA 2H3JA 1VQ9T 5FU7C 4JJDA 1NJIR 4C8QF 5J3BA 3CPWP 1SG5A 2AZVA 2QQRA 1Q81U 3MPUB 2I4NA 2RF0A 4QVCA 2P5IA 3VQWA 1YN8A 2FB7A 3CEYA 3ZFJA 2DD4A 3TCJA 4LUEA 3C12A 1H3HA 2LC4A 4ELYC 4UP9A 2DJZA 3P8HA 2EYZA 5I2MA 4E7JA 1M2VB 3RIRA 3NELA 1NG2A 1XOVA 2V26A 4HT9A 2CYZB 1RAFB 4IIOA 2VYTA 1UDLA 3A8HB 4ZGJB 4E2FB 2EGCA 2ZAEA 1VQ4T 3A5ZB 1NJIC 2EKOA 3RMQA 3L1AA 4AT1B 1X2KA 3INZA 3I5RA 4BDYA 2SEMA 3V8KA 3CC4A 4KR2A 1SEMA 2NUPA 3VS0A 4DQ2A 2LMJA 3CC4Q 1EOVA 3S3MA 2YWWA 4M7DE 1UEBA 4BDZA 4ZIBA 3HTZA 1IGUA 2LQKA 3VS3A 1H3ZA 5HK0A 3S3NA 2RJEA 1Y96B 2KEAA 2E41A 2J06A 3CXCP 3OQ5A 2J05A 3HL8A 3DB4A 1X56A 4M77A 1ZA1B 3A8GB 2EVRA 1I81A 3EG3A 1M2VA 3M4YA 3A74A 3H9NA 3R6NA 4C5HA 1ZHIA 2JNGA 4H2TA 3UA6A 3A5ZA 4PL6A 1Z9QA 2ARTA 3X24B 5LJ5j 2XDPA 2JTMA 1X2HA 4M75F 2KE9A 4P71C 1X43A 2DEQA 3VYGA 2QA4A 3C4SA 2DETA 1IZ6A 8AT1B 3OYMA 2DU5A 2V8KA 2VWFA 3CMQA 1VQKA 3OS2A 1C0AA 2RD1A 2QA4Q 3WQZA 4CH3A 2DE0X 2FRYA 1W2BS 1VQKQ 2CT4A 4EMHA 2PMFA 1OEBA 1YITA 2RQWA 3H0FA 2LP5A 2M0YA 1QP3A 3OS0A 1YITQ 4YRCA 2NYSA 3OW2S 4QVZA 3G6EA 2LCLA 4P71A 3AT1B 2AT1B 4OF1A 4KBMB 2GFAA 3OYAA 3VBBA 1B70B 2DTOA 2MPXC 2D1XA 4RCCA 4CH6A 5IH2A 1M1GA 4C5EA 3CCVT 2ZPBB 1VQLT 3WVEB 3A8MB 5HCKA 4C8QE 4ZN3A 4HT4A 3CMET 2PUOB 2ENMA 4GY5A 1BU1A 2X9HA 1R0BG 2JTEA 2JVVA 4XTUA 2MI6A 5GJVB 1NJIU 3FB9A 1G5VA 2ZT7A 2Q7HA 2NLUA 3E19A 2IY5B 3DLLA 5GJWB 1YNZA 2QYZA 5GMKe 4JRPA 1UTIA 2L5QA 1H641 1K76A 1W66A 4RTUA 4AG1C 4M4ZA 1SSHA 3A32A 1KOGA 2KR3A 3OYHA 2A0FB 4ME7A 5LJ5e 2A28A 1LJOA 4ZN1A 2KQWA 1TOVA 4H2XB 3LH0A 4LNPA 2QTVA 3OYKA 2CP2A 2MWOA 3J81E 2AKKA 3MEYA 2MAMA 4M78D 5C52B 3CCLT 1X6GA 2NUTB 2COWA 1F1BB 5LJ5g 4R55A 1W70A 4PJMA 1YFRA 3O8VA 3G4SA 2QQSA 4AFZC 3HSBA 2FYKA 1UUEA 3HXWA 1KMMA 1LNXA 4YTLA 1U06A 2E70A 2RPNA 4BI4A 1D1CA 4ORZA 3G4SQ 4FCYA 5FU6B 4TQDA 1ZA2B 3RESA 1C1AA 5CK9A 2RK1A 1Q95G 2IY5A 3MJXA 2M02A 2ROTA 3V7SA 2A3LA 2EQUA 2RHXA 2OAWA 4IUPA 4XK8E 1VQ6T 2JS2A 1BBZA 1GGMA 5FU6C 4J7IA 3BDLA 4XTWA 3OYDA 5KE3A 1PG5B 1KJWA 3MKDA 4M75E 1B7YB 4H2XA 4A4FA 2EYWA 4K87A 4TVWA 4FSSA 3DKMA 3QPHA 2NUTA 3VS5A 3NPFA 4FL6A 2RHQB 3JCMQ 4LDVA 3KUFA 1JJ2A 1ZUKA 2KRNA 2ZZDA 9ATCB 3OBWA 1G3SA 3KXTA 3VS1A 3J80E 3J7AF 1LCKA 2C0IA 4F04B 1M1KR 2EGEA 4IURA 2DZ9A 1Y0MA 2E64A 1Y57A 4PHCA 2ZPEB 4M78B 2PZ1A 5LJ3f 1WHHA 1D1BA 4V2SA 3UH0A 2HSEB 1PM3A 2LNVA 3CD6A 4YRPA 1WXBA 2J6OA 5CO7A 1N8RU 4X34A 2CUDA 3CD6Q 1IL2A 4K86A 4Y91A 3A1PA 1UJYA 1QWEA 4M78C 5GANf 4M78G 1Z9ZA 1M1KC 2ARSA 3CCUA 2ZT6A 4X5OA 2ZIOA 3OYLA 3LLRA 3OA6A 3HRSA 4XAXB 4VUBA 4LN2A 3GBQA 3A7RA 5CVIA 3CCUQ 1ZSZA 3C0CA 4A54A 3VJPA 4J15A 3JB9J 2VUBA 2RHQA 3BJUA 2QGFB 1VIEA 4A63B 3CMAA 1YIJA 5CKFA 5D7UA 2Y90A 2F2XA 5FLXE 1H4VB 1C6VX 2E12A 2DXUA 5D6YA 3CMAQ 1YIJQ 4BD3A 2X3WD 4JPBW 1NEGA 5L23A 2YUPA 2EJGA 2BIVA 2FHDA 4XU3A 4MDWA 4AFUC 5IXFA 3PZCA 2FRWA 4PJOB 3L2WA 3JCMe 5GAMj 3JB9I 4R0KA 2DF6A 3HXXA 1K73C 3SFMA 2CT3A 3JCMW 1VA7A 3HXUA 4FT4A 1FYNA 3A5YA 1N9RA 1OOTA 4YREA 1M30A 1WXUA 3T9NA 4PJOC 5GMKh 3RL6A 4PJOG 4J7FA 4YRIA 4RMOA 1IREB 2K3XA 2RA2A 1EIYB 2GCXA 3LWHA 1H8KA 1YWOA 4OLFA 2OI3A 2LJ3A 2K5IA 2QASA 1M3BA 2PUKB 4IKFA 5LJ5h 1X01A 1W2BP 1CKAA 2C0OA 1NBEB 4M7AG 4CS2A 4FIBA 3HRIA 3H8ZA 2QG9B 3HP9A 1GBRA 2D9TA 2CZ1B 2J3LA 4Q15A 3RF1A 5J26A 2LQ8A 4YRJA 3CCMA 1MNDA 1B07A 1K8AR 1RABB 2E5KA 1E6GA 2D0NA 2YRCA 4YRLA 4PK4A 3OW2P 2E6ZA 5J39A 3CCMQ 1Y7XA 3M57A 1N9WA 1WYDA 1YFNA 2CGHA 3R6OA 2DERA 4ZTZB 2CREA 3PFSA 1UGQB 3M0UA 3CC4T 3JRZA 2C8MA 3QDFA 3RKXA 2L3SA 1NLPC 1AWOA 3ZBDA 4M7DA 4QKUA 5GAN6 4JJBA 4C92D 1UGSB 1Q86R 2ED0A 1W6XA 2QDYB 5IT9E 3GNFB 1AWXA 2CSQA 2RMOA 1K8AC 2HAXA 3URGA 1WFWA 1PHTA 3MQZA 2VXEA 3NTKA 3ZEHA 1E1OA 2RH2A 2XGTA 1WJQA 4QQ6A 2A8EA 2A36A 1KD1R 3TEHB 2ROLA 3L4GB 2H8HA 2EIFA 5AYFA 1M1KU 2CP3A 4PKCC 3HFZB 5ECAA 1KSWA 4J6YA 1U3OA 5GAMe 3HRKA 1MNEA 2CP5A 2V1QA 2KGTA 4YCVA 1Q86C 1WPYA 3UATA 2ZCEA 2ED1A 2YXYA 4OMNA 2DVJA 3M4QA 2EJ9A 1TUGB 4D8KA 3LH5A 2GF7A 2VKNA 3L2UA 2COYA 1ZUUA 2ZT8A 3SB2A 3IALA 1VQMA 2DO3A 4WF2A 3ICAA 1EFWA 2RHIA 2OAUA 4HT8A 1UGVA 3NHNA 1WQ7A 1VQMQ 3L2ZA 2F5KA 4P75A 1YITT 2K3YA 3JCMJ 2K79A 4KH1B 4PJOF 3JCMX 1Q7YR 2MCNA 2DNUA 5IHIA 4HCBA 3ER0A 3L4GA 3X20B 3OMGA 4RUGA 4J8OA 2L89A 3G6ET 1GCQC 3EHRA 4OMMA 3HFZA 2V1RA 1YI2A 2CH4W 1BBUA 5CKBA 4C92B
chains in the Genus database with same CATH topology
2RB6A 4M7AF 3UDCA 4M77D 2ZR3A 3S3OA 3OYFA 1WQWA 2ZZGA 4BE2A 4C8QA 2J3MA 2CIMA 2O4XA 2D6FA 2R58A 4C92C 1MGQA 4C92G 3TUPA 4XTXA 4F7UF 2E6NA 2ZGWA 3MP6A 3JB9D 1Y07A 5CQYA 3JCMh 2DQ3A 1QVFA 3OBYA 4K88A 4A53A 3OY9A 5EG2A 2HD0A 2DPPB 5LJ3d 2CJAA 4LDUA 4HVCA 1KQSA 3LGFA 3GNGA 3F70A 3W3SA 2ZTGA 3G71A 2V8JA 2L8DA 2QTXA 4LNSA 3MHXA 1K8AU 5GAN5 3HY1A 3QZ9B 1VQOA 4P3PA 4KT0E 2DIGA 1BYMA 4RQEA 1ASZA 3A7UA 2I4LA 2YLCA 5CIUA 1WJSA 2E65A 2QXFA 4YRTA 1R8OB 2CZ7B 5KCOA 3G4ST 1EVLA 4P3NA 2RHSA 4XU0A 3UT1A 1Q86U 2EFIA 3OS1A 4JS4A 4M77B 3PIPA 4LVLA 1Q82C 3QIIA 1Z7MA 1KD1U 4PNOA 1SSFA 4UC4A 1BI3A 5C51B 2XI9A 3QG1A 1YFTA 2EQKA 4C5GA 2F5TX 5HKCA 1M9SA 3CC7A 4M77C 2DVEA 4M77G 1NYRA 2RI2A 3IKLA 5DLQE 1G3WA 2EYQA 4FU6A 2K2VA 2OTLA 3GIBA 1X55A 4H2UA 4YRMA 1YCYA 2KY9A 4NL2A 5GAMh 3OYEA 4BI3A 1QP2A 1SRYA 4PJOE 1BKBA 3KBGA 5FROA 3VKIA 2R57A 4P73A 3MF2A 4OB0B 1KMNA 4YCUA 2ALYA 3NFCA 1Q7YU 2MWPA 4BE1A 2C7IA 2RHZA 3CD6T 3ME9A 4M7AE 2QQ9A 2LTOA 4PLIA 2RJFA 3RERA 4E47A 3NEMA 1O9SA 4MZTA 2GFUA 1M90C 4N4HA 2DD5A 4KUDK 3CCUT 1YGBA 3CCQA 4F7UE 3NENA 3PMTA 1E24A 4E7HA 1I4K1 2Y4YA 1VQ8A 4OMFB 1EQRA 3E9HA 2O01E 2E5QA 3CMAT 4XU2A 1YIJT 3BW1A 3L2QA 5CCAA 2XK0A 3REUA 2QQAA 2IVWA 5DLOA 4LVJA 5I2SA 5GAN2 3M53A 3C94A 5C6SA 3OMCA 1NJ6A 4Y28E 2M9UA 2K4YA 2DDZA 5HK3A 4YRFA 4Z02A 1VQNA 4E7KA 3CPWA 3QJYA 5LJ3j 2FL7A 1KQSS 3JSCA 3X26B 4JJNK 4LVKA 1V29B 3BDUA 1PYSA 4XEMA 4R56A 1G5HA 2I4OA 4WJ3M 3MEWA 3QKJA 5CAIA 4DOWA 2X35A 12ASA 5GANj 2AMCB 1QVGA 3CCEA 2DU7A 4G84A 4EX5A 2RI3A 1QW1A 2DTHA 3CCMT 3UFGA 3M9QA 2ZINA 5A0LA 1NJ1A 1W4SA 4YRQA 2I4MA 2CS7A 3LGLA 1N9SA 1AHJB 2QEXA 4P74A 3V7CA 4GLKA 3CXCA 3R07A 4RDXA 3QZ5B 3M55A 4BW9A 5KCHA 1M90U 4J5YA 2XDBA 2AMCA 2ZPGB 3DB3A 1OZ2A 3X25B 2ZXFA 3GLXA 2EJFA 5CKHA 2OTJT 3M59A 1YBYA 1BIAA 4JDSA 5LJ5f 4L87A 4LVMA 4A4HA 2XG8D 4DPGA 4FT2A 3HKSA 3E9GA 3M5AA 1VQMT 1S72A 3LSSA 1B34A 5IAYA 4JLIA 4P72A 1Z7NA 4BE0A 5GANe 1DJ7B 1NPPA 3E9IA 4HKEA 5FRMA 2EQJA 4M7DD 1E22A 5GAOm 4QVDA 4YROA 3VUBA 3P8DA 4L6V5 1YI2T 3P8TA 4RG2A 3TEGA 1FYFA 3L42A 1HXDA 1RIQA 1YJNT 3IG2A 1YJ9A 4TQFA 3PCOA 4Q6GA 2DXCA 4N4GA 3DLMA 5HGQA 3FEOA 2HBPA 1SERA 3OSVA 3HXVA 4IUUA 2MMPA 3I55A 3QO3A 3P8VA 3OD1A 2QQBA 2ODRD 5FRNA 3JAME 3HPWA 3HRTA 2JOYA 4XTZA 2DK3A 3G71T 3WVDB 3QTCA 3G7ZA 3GP8A 3LYIA 1VQOT 4II1A 1X75C 2LX9A 1QVGS 4N4IA 1XTDA 3CCSA 4M7DB 3CCJA 3JCMg 5K1XA 1X2GA 1OI1A 1QE0A 3PIOA 4OVAA 1YJWA 4C8QD 3LC0A 2DTIA 5GMKm 4M7DC 4M7DG 4OB1B 1UGPB 2E1HA 1HTTA 3CCVA 2PMEA 3LSQA 2LT4A 2RHUA 3CC7T 4WI1A 2PU9B 4QQGA 3V8LA 5CKEA 5GAOp 2PVDB 2QHVA 1WLEA 3JB9H 3QSUA 1VUBA 3Q1JA 3UGQA 4OB2B 4YRGA 2OTLT 1KHIA 2JZ2A 1MHNA 3RACA 2I2LA 2JTFA 3PGGA 2G3RA 2AHJB 4M78F 2IG0A 2JN0A 4MMLA 3CCLA 1VQPA 2R5MA 3HHTB 2ODRC 5DY9A 4HWSA 2Q5IA 1YB3A 1OZ3A 1G3YA 5GAN4 4P75C 1JJ2S 3LWIA 1H4SA 4BWAA 2EAYA 3KFUA 2ZZEA 1WJRA 4YPFA 1BIBA 5GANh 4C8QB 4HWPA 4CH5A 4F7UA 5GAMg 2QA4T 4P3OA 2O4XB 1RI0A 2DXTA 1VQKT 4M75D 3HFVA 2B8AA 3UPUA 1VQ8T 4CRIA 5GAN8 3M56A 4LDXA 4LVIA 3PT9A 1VQ7A 11ASA 4A4EA 2P4TA 2K5FA 2CZ0B 4C8QC 4C8QG 1G5IA 1HC7A 5DM7R 1O75A 1K73U 3VQXA 1EVKA 4P5NA 3JCMV 2PQWA 3QYHB 4RQFA 3H6ZA 2M16A 3SDZA 2Q5HA 3VQVA 1VIFA 3N5BB 3P8BB 4EMGA 2L3RA 4DA4A 4ATOA 4H2VA 4BY6B 5LJ5d 1ADJA 3EFRA 1VQNT 4UPAA 4UP7A 4JRKA 1YHQA 4RCBA 1XNIA 3HFNA 2RHSB 3TREA 2A7YA 1SESA 3CCRA 4BY6C 1WGSA 4CI0C 2EL9A 2BKDN 3SWNB 5GAOn 2Y4XA 3CCET 2VV5A 1WNLA 3OW2A 1BBWA 4ELZC 2ZT5A 1JBMA 4M75B 3OYJA 3ERRA 3JCMc 1ATIA 3TU4K 4ZTUB 4O2DA 1FXXA 3SWNC 2LVMA 1BI0A 4MZPA 2KK4A 1USYC 3BFMA 5IN1A 5E3IA 4M75C 2NS6A 4M75G 4N0AA 2QEXT 4CS4A 1U1TA 3RMSA 4M78E 1JRIA 1ADYA 3S6WA 4YCWA 3OYNA 1SETA 4Q5WA 3FDRA 2ALYB 3SWNA 4PG3A 4NL3A 4L5GA 3GPLA 4XTYA 4C0GA 3AHUA 2Q7EA 2ZNJA 3QJ6A 1USYA 3A7AA 2BUDA 4P73C 1D3BB 4M75A 1K9MC 2HQEA 3A31A 3OSSC 3JCMb 4YRSA 2DZCA 2XU8A 3I7FA 1QVPA 2EWNA 2KAFA 3OYYA 1S72T 1X54A 4TVAB 4EMKB 3JB9G 4KQEA 3I56A 3MEVA 4NS5A 2RO0A 1JJCA 3CC2A 2VGNA 1PSFA 4C92F 5C53B 3HXZA 4LD6A 4EMKC 1VQ5A 2X4JA 4MZMA 2XDDA 3A8LB 2ZPHB 1D3BA 4IUTA 4HWTA 1M4ZA 3JCMd 1YJ9T 4MMKA 4DOVA 2KMTA 4YRRA 2ZPIB 4RG8A 2XIDA 5GMKj 1PYSB 3OYBA 2P0KA 4J6XA 1NE8A 4TVAA 4EMKA 2LDMA 3FIFA 2VGMA 2ZCFB 4QW2A 3I55T 1G51A 3CPFA 2LT1A 3P8YA 4C5IA 2CZ6B 2G4CA 2KSSA 3OYIA 4HWOA 5GAOq 3JCMP 4O6JA 5CR2A 5K1PA 2E3CA 2M0OA 3VQYA 2E10A 4NOYA 2XHCA 1QVFS 1Y96A 4G85A 3CCST 1HK9A 1Q82U 2RK2A 1KQ2A 3CCJT 3UGTA 4M77F 4HWRA 4IUVA 4X9DA 2QHTA 3TEEA 3X28B 1YJWT 3FJPA 1K9MU 4RMFA 4CH4A 3OB9A 2WSEE 4P74C 5GMKi 1OYXA 1NJ2A 3JB9F 1KC8C 1N8RC 1B8AA 2YHTA 3UWNA 2RJCA 1GXIE 5GAMd 2QHUA 5D6XA 3VUZA 4O5VA 3FC3A 3M4GA 1NPRA 2P0QA 4EDUA 2HQXA 2LRQA 2XICA 1Y71A 4XEOA 3QUIA 1KG1A 3LX7A 1B34B 1NJ5A 4TVYA 2DAQA 1E1TA 2EQMA 4TVRA 4D6WA 2Q7GA 3C95A 4XQ3A 1X6OA 3G1ZA 4C92E 1B70A 3MO8A 1ZQ1A 1VQPT 4JRIA 1NYQA 4P72C 2D0QB 3HY0A 1VQ9A 3LW5E 3MP8A 5LL6S 1LOJA 5A0DA 4LD9K 2RM4A 4UP8A 3EFSA 3QYGB 5LJ3e 3PCOB 1ASYA 3IKMB 2X4WA 3QO5A 3QXEB 1NNHA 3ASKA 1VQ4A 1VQ7T 5LJ3g 2PVOB 4QQDA 4JLGA 4C0ZA 2ZIMA 2VXFA 2M1HA 1G3TA 4LDYA 4PJOD 4ZTJA 5GANg 1BI1A 2AKWB 4ZGEB 2ZPFB 5D6WA 2WACA 3M58A 4PLLA 2FVUA 3NTHA 4M7AD 5A2QE 4H2YA 4EO4A 1UGRB 1YHQT 4WJ4A 1P92A 1WU7A 5ELOA 4M77E 4AH6A 1KC8U 2ZNIA 5I21A 4J83A 2X4XA 3CCRT 4OGCA 4J6WA 1B7YA 3OYGA 4B9WA 3CPWS 2WSCE 4A4GA 3GOXA 4BB7A 3QHSA 3QO7A 3QDRB 2AKWA 4FM4B 2F69A 2WSFE 4H2WA 3HFOA 2RI5A 5KE2A 3FLGA 2XKOC 1H4QA 4M78A 3OYCA 1VQZA 3MF1A 3MCAB 3V7RA 2RJDA 1KQ1A 1PSEA 3SD4A 4E7IA 5CKDA 1QF6A 4BI8B 4EPCA 4L59A 1I5LA 1M8VA 3DSQA 4H02A 2QHSA 3A8OB 5F5WA 4M7AB 3M54A 2YRVA 1VQLA 3BY7A 2ZR2A 2P0LA 2V8IA 1KHCA 1BI2A 2KVQG 3CMEA 3CBMA 4KR3A 3CXCS 4YP0A 2XD0A 4JUVA 2RHYA 3JCMf 1LYLA 3EAEA 1NJ8A 1UB4A 4M7AC 4F7UB 3RKWA 2LCCA 5A0GA 4HCZA 4BACA 1H4TA 5KH6A 4OP0A 1U8RA 5GAN7 3NETA 5GAOl 3HXYA 4YRKA 1TH7A 4A4KA 4JS5A 1M1FA 4JRQA 4PJOA 4F7UG 3NTIA 4HA8A 3I56T 1B76A 3CC2T 4XU1A 4E7LA 2XTIA 3MEUA 5LJ3h 4M7AA 1VQ5T 4E51A 4LDWA 4YDQA 4CS3A 3VU3C 5CQXA 1N6AA 1EIYA 1EIFA 3PMIA 5KNNA 2HNIA 3QNEA 3CCQT 2K5LA 5ELNA 2K57A 2C06A 1Q81C 1VQ6A 2OTJA 2MF2A 1I8FA 4C0FA 2DXBA 3HRUA 1KD1C 2VC8A 3E1SA 2KDSA 3QO8A 2QI2A 1YFSA 2DQ0A 3RGLA 2PVGB 2E5AA 3VV0A 4FSXA 3RKYA 5GAMf 4ZGDB 4M7DF 1M5Q1 4TTVA 4H2SA 5L8RE 3CBOA 4YYEA 2JUFA 2R5AA 4ZTFA 3TEHA 2YLBA 3L2VA 1ZBXA 5GMKl 4C0DB 3GF5A 1NZ9A 3MEAA 5GAOr 3E9FA 2CJ9A 1W2BA 4BUGA 3CBPA 3QBYA 5C0MA 5HY6A 3OS5A 3MP1A 4MDXA 4N0AC 1YJNA 1RL2A 4IUQA 4C0DC 3VYHB 1Q7YC 5GAN3 1FX7A 3META 1N27A 2CJBA 5M9OA 2CKKA 3V8JA 3WXMB 1L0WA 4XTVA 2DIQA 3PTAA 4B9XA 4KULA 4KUIA 1J5WA 3M4PA 1XQHA 4YRNA 4HCCA 1JB0E 2GQVA 2X4YA 4OGEA 4RKUE 3RUXA 3FRNA 5FU7B 4C92A 1JJCB 4NCXA 3L2RA 4X9CA 2DKGA 1U1SA 2P0PA 4OB3B 2ARUA 5GANd 1FWZA 3PNWC 4TWAA 2ZZFA 3REXA 2H3JA 1VQ9T 5FU7C 4C8QF 5J3BA 2QQRA 1Q81U 2I4NA 4QVCA 2P5IA 3VQWA 2FB7A 3CEYA 3ZFJA 2DD4A 3TCJA 3C12A 2LC4A 4ELYC 4UP9A 2DJZA 3P8HA 5I2MA 4E7JA 3RIRA 3NELA 1XOVA 4HT9A 2CYZB 2VYTA 3A8HB 4ZGJB 1VQ4T 3A5ZB 1NJIC 2EKOA 3RMQA 3L1AA 3INZA 4BDYA 3V8KA 3CC4A 4KR2A 4DQ2A 1EOVA 3S3MA 4M7DE 1UEBA 4BDZA 4ZIBA 3HTZA 2LQKA 1H3ZA 5HK0A 3S3NA 2RJEA 1Y96B 2E41A 3OQ5A 3HL8A 3DB4A 1X56A 4M77A 3A8GB 1I81A 3M4YA 3A74A 4C5HA 1ZHIA 2JNGA 4H2TA 3A5ZA 4PL6A 2ARTA 3X24B 5LJ5j 2XDPA 2JTMA 1X2HA 4M75F 4P71C 3VYGA 2DEQA 2QA4A 3C4SA 1IZ6A 3OYMA 2DU5A 2V8KA 3CMQA 1VQKA 3OS2A 1C0AA 2RD1A 3WQZA 4CH3A 1W2BS 4EMHA 2PMFA 1YITA 1QP3A 3OS0A 4YRCA 3OW2S 4QVZA 3G6EA 2LCLA 4P71A 4OF1A 4KBMB 2GFAA 3OYAA 3VBBA 1B70B 2DTOA 4RCCA 4CH6A 1M1GA 4C5EA 3CCVT 2ZPBB 1VQLT 3WVEB 3A8MB 4C8QE 4ZN3A 4HT4A 3CMET 2PUOB 4GY5A 2JVVA 4XTUA 2MI6A 1NJIU 3FB9A 1G5VA 2ZT7A 2Q7HA 2NLUA 3E19A 2IY5B 3DLLA 5GMKe 4JRPA 2L5QA 1H641 1W66A 1KOGA 3A32A 3OYHA 4ME7A 5LJ5e 1LJOA 4ZN1A 2KQWA 4H2XB 3LH0A 3OYKA 2MWOA 3J81E 3MEYA 2MAMA 4M78D 5C52B 3CCLT 5LJ5g 4R55A 1YFRA 3O8VA 3G4SA 2QQSA 3HSBA 2FYKA 3HXWA 1KMMA 1LNXA 4YTLA 2E70A 4BI4A 5FU6B 4TQDA 3RESA 5CK9A 2RK1A 2IY5A 3V7SA 2A3LA 2EQUA 2RHXA 4IUPA 4XK8E 1VQ6T 1GGMA 5FU6C 4J7IA 3BDLA 4XTWA 3OYDA 5KE3A 4M75E 1B7YB 4H2XA 4A4FA 4K87A 4TVWA 3DKMA 3QPHA 4FL6A 2RHQB 3JCMQ 4LDVA 3KUFA 1JJ2A 2ZZDA 3OBWA 1G3SA 3KXTA 3J80E 3J7AF 4IURA 2DZ9A 2E64A 4PHCA 2ZPEB 4M78B 5LJ3f 4V2SA 3UH0A 2LNVA 3CD6A 4YRPA 5CO7A 1N8RU 4X34A 1IL2A 4K86A 4Y91A 4M78C 5GANf 4M78G 1M1KC 2ARSA 3CCUA 2ZT6A 4X5OA 2ZIOA 3OYLA 3LLRA 3OA6A 3HRSA 4XAXB 4VUBA 3A7RA 5CVIA 4A54A 3VJPA 4J15A 3JB9J 2VUBA 2RHQA 3BJUA 1VIEA 3CMAA 1YIJA 5CKFA 2Y90A 5FLXE 1H4VB 2E12A 2DXUA 5D6YA 4BD3A 2EJGA 2BIVA 2FHDA 4XU3A 4MDWA 3PZCA 4PJOB 3L2WA 3JCMe 5GAMj 3JB9I 3HXXA 1K73C 3SFMA 3JCMW 3HXUA 4FT4A 3A5YA 1N9RA 4YREA 3T9NA 4PJOC 5GMKh 3RL6A 4PJOG 4J7FA 4YRIA 4RMOA 1IREB 2K3XA 2RA2A 1EIYB 2GCXA 3LWHA 4OLFA 2K5IA 2PUKB 4IKFA 5LJ5h 1X01A 4M7AG 4CS2A 4FIBA 3HRIA 3H8ZA 3HP9A 2D9TA 2CZ1B 2J3LA 4Q15A 3RF1A 5J26A 2LQ8A 4YRJA 3CCMA 4YRLA 2E6ZA 5J39A 1Y7XA 3M57A 1N9WA 1WYDA 2CGHA 3R6OA 4ZTZB 3PFSA 1UGQB 3CC4T 3JRZA 2C8MA 3RKXA 3ZBDA 4M7DA 5GAN6 4C92D 1UGSB 2QDYB 5IT9E 3GNFB 1K8AC 2HAXA 3URGA 3MQZA 2VXEA 3NTKA 3ZEHA 1E1OA 2RH2A 2XGTA 1WJQA 4QQ6A 2A8EA 3TEHB 3L4GB 2EIFA 5AYFA 1M1KU 4PKCC 3HFZB 4J6YA 5GAMe 3HRKA 4YCVA 1Q86C 1WPYA 2ZCEA 3M4QA 2EJ9A 2GF7A 3L2UA 2ZT8A 3SB2A 3IALA 1VQMA 2DO3A 4WF2A 3ICAA 1EFWA 2RHIA 2OAUA 4HT8A 1WQ7A 3L2ZA 2F5KA 4P75A 1YITT 2K3YA 3JCMJ 4PJOF 3JCMX 4HCBA 3ER0A 3L4GA 3X20B 3OMGA 4J8OA 2L89A 3G6ET 3HFZA 1YI2A 1BBUA 5CKBA 4C92B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RB6 A;  4M7A F;  5K1X A;  1Y96 B;  4JRI A;  2E41 A;  1NYQ A;  4P72 C;  1X2G A;  1X56 A;  4M77 D;  4M77 A;  1QE0 A;  2ZR3 A;  3HY0 A;  1I81 A;  1WQW A;  1LOJ A;  2ZZG A;  4C8Q D;  4C8Q A;  3LC0 A;  2DTI A;  5GMK m;  2J3M A;  4M7D C;  3A74 A;  2RM4 A;  4M7D G;  2CIM A;  4UP8 A;  2E1H A;  1HTT A;  3EFS A;  4C92 C;  2PME A;  1MGQ A;  4C92 G;  3TUP A;  4XTX A;  4F7U F;  5LJ3 e;  3PCO B;  2ZGW A;  4H2T A;  3A5Z A;  1ASY A;  2ART A;  3JB9 D;  5LJ5 j;  3IKM B;  3LSQ A;  1X2H A;  4M75 F;  4P71 C;  2DEQ A;  3QO5 A;  3JCM h;  2DQ3 A;  2DU5 A;  3CMQ A;  4WI1 A;  1NNH A;  4K88 A;  3V8L A;  1C0A A;  2RD1 A;  3WQZ A;  4A53 A;  5LJ3 g;  4CH3 A;  5GAO p;  2QHV A;  5LJ3 d;  2CJA A;  1WLE A;  4EMH A;  3JB9 H;  4HVC A;  2PMF A;  3QSU A;  3UGQ A;  2ZIM A;  4YRG A;  2VXF A;  3W3S A;  2ZTG A;  2QTX A;  4LNS A;  5GAN 5;  3RAC A;  2I2L A;  3PGG A;  3HY1 A;  4PJO D;  4M78 F;  5GAN g;  4YRC A;  2AKW B;  4P3P A;  4P71 A;  2JN0 A;  4RQE A;  1ASZ A;  3A7U A;  2I4L A;  2YLC A;  4MML A;  2E65 A;  2ODR C;  4YRT A;  5DY9 A;  4HWS A;  2Q5I A;  1YB3 A;  4M7A D;  1EVL A;  4P3N A;  3VBB A;  1B70 B;  5GAN 4;  4H2Y A;  2RHS A;  2DTO A;  4P75 C;  4EO4 A;  4XU0 A;  4RCC A;  4WJ4 A;  1WU7 A;  5ELO A;  4M77 E;  4AH6 A;  4CH6 A;  1H4S A;  4BWA A;  4M77 B;  2EAY A;  2ZNI A;  3KFU A;  5I21 A;  2ZZE A;  4C8Q E;  4YPF A;  1Z7M A;  1BIB A;  5GAN h;  4PNO A;  4C8Q B;  4HWP A;  4CH5 A;  4F7U A;  5GAM g;  4P3O A;  5C51 B;  4J6W A;  4XTU A;  1B7Y A;  1YFT A;  3FB9 A;  2DXT A;  2ZT7 A;  4M75 D;  3HFV A;  2Q7H A;  2IY5 B;  4M77 C;  4M77 G;  2DVE A;  1NYR A;  5GMK e;  5GAN 8;  1H64 1;  3IKL A;  11AS A;  1W66 A;  3QHS A;  3QO7 A;  4C8Q C;  4C8Q G;  1G5I A;  1HC7 A;  1KOG A;  3A32 A;  2AKW A;  5LJ5 e;  3VQX A;  1LJO A;  1EVK A;  4H2W A;  3GIB A;  3HFO A;  3JCM V;  1X55 A;  4H2X B;  4H2U A;  4YRM A;  1YCY A;  4NL2 A;  5GAM h;  4RQF A;  1H4Q A;  3MEY A;  4M78 D;  4M78 A;  1SRY A;  5C52 B;  4PJO E;  1VQZ A;  2Q5H A;  3MF1 A;  3VQV A;  4P73 A;  4EMG A;  5LJ5 g;  3MF2 A;  3V7R A;  1KQ1 A;  4H2V A;  1YFR A;  5LJ5 d;  1KMN A;  4YCU A;  1ADJ A;  3EFR A;  2ALY A;  1QF6 A;  4UPA A;  3HSB A;  4UP7 A;  2C7I A;  4JRK A;  2FYK A;  1I5L A;  1M8V A;  3HXW A;  1KMM A;  1LNX A;  4M7A E;  4RCB A;  3DSQ A;  4H02 A;  2QHS A;  3HFN A;  5F5W A;  4M7A B;  4TQD A;  3RES A;  2RHS B;  3RER A;  3BY7 A;  2ZR2 A;  2P0L A;  1SES A;  2IY5 A;  3NEM A;  4KR3 A;  2EL9 A;  1YGB A;  3V7S A;  3SWN B;  4YP0 A;  4JUV A;  4F7U E;  3JCM f;  3NEN A;  5GAO n;  1LYL A;  1NJ8 A;  1E24 A;  1GGM A;  4M7A C;  4F7U B;  1I4K 1;  4XTW A;  3RKW A;  1WNL A;  4M75 E;  1B7Y B;  1EQR A;  1H4T A;  3E9H A;  1BBW A;  4H2X A;  2ZT5 A;  1JBM A;  4M75 B;  4XU2 A;  3BW1 A;  4OP0 A;  3ERR A;  3JCM c;  5GAN 7;  1ATI A;  4ZTU B;  3NET A;  4K87 A;  5GAO l;  4TVW A;  4O2D A;  3REU A;  3HXY A;  4YRK A;  1TH7 A;  3SWN C;  4PJO A;  2RHQ B;  3JCM Q;  4F7U G;  4HA8 A;  1B76 A;  1USY C;  5GAN 2;  3BFM A;  5E3I A;  4M75 C;  4M75 G;  4N0A A;  4CS4 A;  1U1T A;  4XU1 A;  2XTI A;  1NJ6 A;  4M78 E;  5LJ3 h;  2DZ9 A;  2E64 A;  4M7A A;  4PHC A;  4M78 B;  4E51 A;  5LJ3 f;  1JRI A;  1ADY A;  2DDZ A;  4YDQ A;  4CS3 A;  4YCW A;  4V2S A;  3VU3 C;  4YRF A;  3UH0 A;  1EIY A;  1SET A;  4YRP A;  5LJ3 j;  2ALY B;  3SWN A;  1IL2 A;  4PG3 A;  5KNN A;  3BDU A;  4NL3 A;  1PYS A;  2HNI A;  4K86 A;  4Y91 A;  4XEM A;  4XTY A;  3QNE A;  3AHU A;  2Q7E A;  1G5H A;  2ZNJ A;  4M78 C;  5GAN f;  2I4O A;  5ELN A;  4M78 G;  2K57 A;  1USY A;  4WJ3 M;  2ARS A;  3A7A A;  2ZT6 A;  4X5O A;  4P73 C;  2ZIO A;  1D3B B;  4M75 A;  5CAI A;  3A31 A;  12AS A;  3JCM b;  5GAN j;  4YRS A;  2DZC A;  2AMC B;  1I8F A;  3A7R A;  4A54 A;  3I7F A;  2DU7 A;  4G84 A;  2EWN A;  4J15 A;  4EX5 A;  3JB9 J;  2RHQ A;  2DTH A;  3BJU A;  3UFG A;  2ZIN A;  2VC8 A;  1NJ1 A;  3QO8 A;  2Y90 A;  1X54 A;  1H4V B;  1YFS A;  2DXU A;  2DQ0 A;  4TVA B;  4EMK B;  3RGL A;  2E5A A;  3JB9 G;  4KQE A;  4YRQ A;  2I4M A;  3RKY A;  2EJG A;  1N9S A;  4XU3 A;  5GAM f;  1JJC A;  4M7D F;  1M5Q 1;  3PZC A;  4TTV A;  4H2S A;  4PJO B;  3JCM e;  4C92 F;  4P74 A;  5C53 B;  3V7C A;  5GAM j;  3HXZ A;  3JB9 I;  4YYE A;  3TEH A;  2YLB A;  4EMK C;  3HXX A;  3R07 A;  3JCM W;  3HXU A;  5GMK l;  4RDX A;  3A5Y A;  1N9R A;  4BW9 A;  4YRE A;  5GAO r;  2CJ9 A;  3RL6 A;  4PJO C;  1D3B A;  5GMK h;  4J5Y A;  4PJO G;  4HWT A;  4YRI A;  3JCM d;  2RA2 A;  2AMC A;  1EIY B;  4MMK A;  2ZXF A;  4N0A C;  4OLF A;  2EJF A;  4YRR A;  5LJ5 h;  1X01 A;  5GMK j;  1PYS B;  5GAN 3;  4M7A G;  4CS2 A;  1BIA A;  5LJ5 f;  4L87 A;  3HRI A;  2CJB A;  4DPG A;  4J6X A;  4TVA A;  4EMK A;  3FIF A;  2J3L A;  4Q15 A;  3RF1 A;  4YRJ A;  3V8J A;  1L0W A;  4XTV A;  1G51 A;  3P8Y A;  3LSS A;  4YRL A;  2G4C A;  1J5W A;  1B34 A;  1N9W A;  4JLI A;  1WYD A;  4P72 A;  2CGH A;  1Z7N A;  5GAO q;  4HWO A;  3M4P A;  4ZTZ B;  4YRN A;  5GAN e;  3JCM P;  5K1P A;  2E3C A;  3E9I A;  2C8M A;  3RKX A;  3VQY A;  4M7D D;  4M7D A;  3RUX A;  2E10 A;  4NOY A;  1E22 A;  5GAN 6;  4QVD A;  5GAO m;  4C92 D;  4C92 A;  4YRO A;  1JJC B;  1Y96 A;  4G85 A;  4NCX A;  4X9C A;  2DKG A;  1U1S A;  1HK9 A;  2ARU A;  1KQ2 A;  2VXE A;  1E1O A;  5GAN d;  3P8T A;  3UGT A;  2XGT A;  4M77 F;  3TEH B;  4TWA A;  4HWR A;  2ZZF A;  3L4G B;  3REX A;  3TEG A;  4X9D A;  2QHT A;  1FYF A;  3FJP A;  1HXD A;  3HFZ B;  1RIQ A;  4C8Q F;  4J6Y A;  3IG2 A;  4RMF A;  4TQF A;  4CH4 A;  5GAM e;  3PCO A;  2I4N A;  4Q6G A;  4QVC A;  2P5I A;  3HRK A;  2FB7 A;  3VQW A;  4P74 C;  4YCV A;  5GMK i;  1WPY A;  1NJ2 A;  2ZCE A;  3JB9 F;  5HGQ A;  3M4Q A;  4UP9 A;  2DJZ A;  2EJ9 A;  1SER A;  1B8A A;  2YHT A;  3RIR A;  3NEL A;  4HT9 A;  3HXV A;  2ZT8 A;  3SB2 A;  3IAL A;  5GAM d;  2QHU A;  3QO3 A;  3P8V A;  4WF2 A;  3M4G A;  3OD1 A;  3ICA A;  1EFW A;  3L1A A;  4HT8 A;  2ODR D;  1WQ7 A;  3L2Z A;  4XEO A;  3INZ A;  3QUI A;  4P75 A;  4XTZ A;  3V8K A;  4KR2 A;  1B34 B;  3JCM J;  1NJ5 A;  4TVY A;  1E1T A;  4DQ2 A;  4PJO F;  2Q7G A;  3QTC A;  3JCM X;  3L4G A;  4XQ3 A;  1EOV A;  4M7D E;  4ZIB A;  3G1Z A;  3HTZ A;  3HFZ A;  4C92 E;  4M7D B;  1B70 A;  3JCM g;  1BBU A;  4C92 B; 
#chains in the Genus database with same CATH topology
 2RB6 A;  4M7A F;  3UDC A;  1OV3 A;  4M77 D;  1YI2 Q;  2ZR3 A;  3S3O A;  2YRD A;  3OYF A;  4OML A;  1WQW A;  2ZZG A;  5FWB A;  4BE2 A;  4C8Q A;  2J3M A;  2CIM A;  2O4X A;  2D6F A;  2R58 A;  4C92 C;  1MGQ A;  3VS6 A;  4C92 G;  4XTX A;  3TUP A;  4F7U F;  3KFV A;  1ZLM A;  2CP0 A;  2E6N A;  2ZGW A;  3MP6 A;  4CC4 B;  1T0H A;  3JB9 D;  1SHG A;  2JMA A;  1Y07 A;  5CQY A;  1GCQ A;  1M8M A;  3JCM h;  2DQ3 A;  2O31 A;  3M0Q A;  1BCM A;  1OX9 A;  2KRM A;  1QVF A;  3OBY A;  2F2V A;  4K88 A;  4A53 A;  1GFC A;  3OY9 A;  5EG2 A;  2HD0 A;  2DPP B;  1SHF A;  5LJ3 d;  2CJA A;  4LDU A;  4HVC A;  4HVV A;  1KQS A;  3LGF A;  3GNG A;  3F70 A;  2L3Q A;  3W3S A;  2ZTG A;  1ZSG A;  3G71 A;  2JW4 A;  2L8D A;  2V8J A;  2L3P A;  2QTX A;  4LNS A;  2RQV A;  3MHX A;  1K8A U;  5GAN 5;  3HY1 A;  3QZ9 B;  1VQO A;  3G71 Q;  2EKH A;  1QQJ A;  3CQT A;  4KT0 E;  4P3P A;  2DIG A;  1BYM A;  4RQE A;  1VQO Q;  1ASZ A;  3A7U A;  2I4L A;  2YLC A;  1WI7 A;  5CIU A;  1WJS A;  2E65 A;  2QXF A;  4YRT A;  1R8O B;  2CZ7 B;  2B86 A;  5KCO A;  3G4S T;  1EVL A;  4P3N A;  1SRM A;  2RHS A;  3ULR B;  4XU0 A;  3UT1 A;  1Q86 U;  2RQR A;  2EFI A;  2EQI A;  2HDA A;  4B6M A;  3OS1 A;  4JS4 A;  1IB8 A;  4M77 B;  7AT1 B;  3PIP A;  4LVL A;  1Q82 C;  2KNB B;  3QII A;  1Z7M A;  1KD1 U;  4PNO A;  1G8X A;  2L2P A;  1K0S A;  1SSF A;  4UC4 A;  1BI3 A;  2FZK B;  5C51 B;  2XI9 A;  3SHW A;  3QG1 A;  2YUQ A;  2EQK A;  4C5G A;  1YFT A;  2F5T X;  2DLP A;  1GL5 A;  5HKC A;  1M9S A;  1OU8 A;  4M77 C;  3CC7 A;  2DVE A;  4M77 G;  1NYR A;  2RI2 A;  3IKL A;  5DLQ E;  1G3W A;  3CC7 Q;  2EYQ A;  1FMK A;  4WTO B;  2CSI A;  4FU6 A;  2H3E B;  1UEC A;  1RAH B;  2K2V A;  2OTL A;  3GIB A;  2QK0 A;  1TWB A;  1X55 A;  4H2U A;  4YRM A;  1YCY A;  2KY9 A;  4NL2 A;  5GAM h;  2OTL Q;  3VS4 A;  3OYE A;  4BI3 A;  1QP2 A;  1M90 R;  1SRY A;  4PJO E;  1BKB A;  3KBG A;  5FRO A;  2FZC B;  1V76 A;  3VKI A;  2R57 A;  3VRZ A;  4P73 A;  3MF2 A;  4OB0 B;  2BTT A;  4AMC A;  1KMN A;  4YCU A;  2ALY A;  3NFC A;  1Q7Y U;  2MWP A;  4BE1 A;  2C7I A;  2RHZ A;  3CD6 T;  4PFZ A;  3ME9 A;  5AT1 B;  4M7A E;  2QQ9 A;  2LTO A;  4PLI A;  2RJF A;  3RER A;  3O5Z A;  4E47 A;  3TVT A;  3TSZ A;  3NEM A;  1O9S A;  4MZT A;  2GFU A;  1M90 C;  4N4H A;  2DD5 A;  4KUD K;  2O88 A;  3CCU T;  1YGB A;  3CCQ A;  2BE7 D;  2KT1 A;  2O9V A;  4KGZ B;  4F7U E;  3NEN A;  5IXB A;  1MMN A;  3PMT A;  1E24 A;  4E7H A;  3CCQ Q;  2X3X D;  1I4K 1;  2Y4Y A;  1VQ8 A;  1GRI A;  4OMF B;  1EQR A;  4J9B A;  3E9H A;  1WYX A;  2O01 E;  3M0S A;  1R0C B;  2E5Q A;  3CMA T;  4XU2 A;  1YIJ T;  3BW1 A;  1VQ8 Q;  3L2Q A;  4WCI A;  5CCA A;  2XK0 A;  3REU A;  2QQA A;  4FYW B;  2IVW A;  5DLO A;  4LVJ A;  2HSP A;  5I2S A;  2A37 A;  5GAN 2;  3M53 A;  1OU9 A;  3C94 A;  5C6S A;  3OMC A;  1NJ6 A;  4Y28 E;  1VYV A;  4HXJ A;  2M9U A;  2K4Y A;  2DDZ A;  1TTH B;  3EGD B;  5HK3 A;  4YRF A;  2L0A A;  4Z02 A;  5KYY B;  1VQN A;  2PNI A;  4Z8A A;  4E7K A;  3CPW A;  3QJY A;  5LJ3 j;  2FL7 A;  1KQS S;  1VQN Q;  3JSC A;  4OMO A;  3X26 B;  4JJN K;  4LVK A;  4RTW A;  1V29 B;  3BDU A;  1PYS A;  4XEM A;  4R56 A;  1G5H A;  2I4O A;  2J6K A;  4WJ3 M;  3MEW A;  1HJD A;  1K0X A;  3QKJ A;  5CAI A;  4DOW A;  2X35 A;  2RQU A;  5GAN j;  12AS A;  1WHG A;  2AMC B;  1QVG A;  3CCE A;  2DU7 A;  4G84 A;  4EX5 A;  3EGU A;  2RI3 A;  1QW1 A;  2DTH A;  1H92 A;  3CCM T;  3CCE Q;  3UFG A;  3M9Q A;  2ZIN A;  5A0L A;  1NJ1 A;  1W4S A;  4QT7 A;  3EG1 A;  2KXD A;  1QCN A;  3EG2 A;  4YRQ A;  2I4M A;  2CS7 A;  3LGL A;  1X2Q A;  1N9S A;  3EGD A;  1AHJ B;  3TSW A;  5KYY A;  2QEX A;  4P74 A;  2A08 A;  3V7C A;  4GLK A;  2QAZ A;  2DMO A;  1RI9 A;  2ABL A;  3CXC A;  3R07 A;  2QEX Q;  4RDX A;  3QZ5 B;  3M55 A;  4BW9 A;  3G1J A;  5KCH A;  1M90 U;  1X6B A;  4J5Y A;  1AZE A;  2XDB A;  2AMC A;  1RAC B;  2ZPG B;  3DB3 A;  1OX8 A;  3REB B;  1OZ2 A;  3X25 B;  2ZXF A;  2ECZ A;  3GLX A;  2RN8 A;  1ACM B;  2EJF A;  5CKH A;  2O9S A;  5EC7 A;  2OTJ T;  2HCK A;  3M59 A;  2CP7 A;  1AD5 A;  1YBY A;  4DBH A;  1BIA A;  4JDS A;  5LJ5 f;  4L87 A;  1QKW A;  3ZL7 C;  4LVM A;  4A4H A;  2XG8 D;  4DPG A;  1MMG A;  3HTR A;  4FT2 A;  3HKS A;  3E9G A;  3M5A A;  1VQM T;  3H41 A;  1ZSZ B;  1N5Z A;  4HCK A;  1S72 A;  3QWY A;  3LSS A;  4PFP A;  1B34 A;  5IAY A;  2BZY A;  4JLI A;  4RTX A;  4P72 A;  2EGA A;  1S72 Q;  1Z7N A;  4BE0 A;  5GAN e;  1DJ7 B;  1NPP A;  5KYW A;  3E9I A;  4HKE A;  5FRM A;  1MUZ A;  2EQJ A;  4RTV A;  1ZSZ C;  4M7D D;  1E22 A;  4RTZ A;  4QVD A;  5GAO m;  1BCO A;  4YRO A;  2LNH B;  2W10 A;  3VUB A;  3P8D A;  4L6V 5;  1VYU A;  1ARK A;  1YI2 T;  3P8T A;  4RG2 A;  4E6R A;  2DL7 A;  3TEG A;  2KYM A;  4KH0 B;  3L42 A;  1FYF A;  1HXD A;  2I0N A;  2XMF A;  1YJN T;  1RIQ A;  2HKN A;  3IG2 A;  4Y92 A;  1YJ9 A;  4TQF A;  1TXQ A;  3PCO A;  4Q6G A;  2DXC A;  4N4G A;  1YJ9 Q;  3DLM A;  1AZG B;  1T0J A;  2DJQ A;  5HGQ A;  2EYX A;  3FEO A;  2HBP A;  2K2M A;  1SER A;  3OSV A;  2GNC A;  1K73 R;  3HXV A;  1QMC A;  4IUU A;  2MMP A;  2LJ1 A;  4FYV B;  2LQN A;  4E7Z A;  3I55 A;  4ANJ A;  3QO3 A;  3P8V A;  1IGQ A;  3OD1 A;  1D0Y A;  2QQB A;  1HSQ A;  5FRN A;  2ODR D;  3JAM E;  3I55 Q;  3HPW A;  1IHV A;  3HRT A;  2JOY A;  2P4R A;  4XTZ A;  2DK3 A;  3G71 T;  3WVD B;  3QTC A;  4HVW A;  3G7Z A;  3GP8 A;  3LYI A;  2AK5 A;  1VQO T;  4II1 A;  1X75 C;  2LX9 A;  1QVG S;  1PC0 A;  2K3B A;  1TS9 A;  4JZ4 A;  4N4I A;  1XTD A;  3CCS A;  4M7D B;  3CCJ A;  3JCM g;  4CC2 A;  3H0I A;  2HBW A;  2JM9 A;  3CCS Q;  5K1X A;  1TU0 B;  5IHN A;  1X2G A;  1OI1 A;  3CCJ Q;  1QE0 A;  3PIO A;  2EBP A;  3NMZ C;  4OVA A;  1YJW A;  4DEX A;  1YWP A;  2JM8 A;  3E2U A;  4C8Q D;  2DL5 A;  3LC0 A;  2DTI A;  2DL4 A;  5GMK m;  4M7D C;  4M7D G;  1YJW Q;  4OB1 B;  1UGP B;  1WA7 A;  2E1H A;  1HTT A;  3RNJ A;  1ABO A;  3CCV A;  2PME A;  1ZUY A;  2PTK A;  2LQW A;  1MMD A;  3CCV Q;  3LSQ A;  2LT4 A;  1PD1 A;  1ZBJ A;  4DBR A;  2ESW A;  2RHU A;  3CME Q;  2HZY A;  3CC7 T;  4WI1 A;  2PU9 B;  4EIK A;  1OQK A;  4QQG A;  3V8L A;  2CH4 A;  4HVU A;  5CKE A;  2BZ8 A;  5GAO p;  2NUZ A;  2PVD B;  3EG9 A;  2QHV A;  1WLE A;  3JB9 H;  3QSU A;  1VUB A;  3Q1J A;  3UGQ A;  4OB2 B;  4YRG A;  1TUD A;  2OTL T;  1KHI A;  2JZ2 A;  1MHN A;  3RAC A;  2I2L A;  2JTF A;  3PGG A;  1WXT A;  2F2W A;  2G3R A;  2AHJ B;  4M78 F;  3BE3 A;  2IG0 A;  3VRY A;  3A98 A;  2E3H A;  2JN0 A;  2K7A A;  4MML A;  1R77 A;  2COZ A;  3CCL A;  1VQP A;  2R5M A;  3HHT B;  2ODR C;  1IO6 A;  5DY9 A;  4HWS A;  2Q5I A;  1WZO A;  1YB3 A;  1OZ3 A;  3QWX X;  1G3Y A;  5GAN 4;  4P75 C;  3CCL Q;  1JJ2 S;  3I35 A;  2P84 A;  3M0R A;  1VQP Q;  2JS0 A;  3LWI A;  2E4H A;  1H4S A;  4BWA A;  2EAY A;  3KFU A;  2ZZE A;  1WJR A;  2RNA A;  4YPF A;  1BIB A;  5GAN h;  2YSQ A;  4C8Q B;  4HWP A;  4CH5 A;  4F7U A;  5GAM g;  2QA4 T;  1AOJ A;  4P3O A;  2O4X B;  1RI0 A;  2DXT A;  1VQK T;  4M75 D;  3HFV A;  2B8A A;  2F1L A;  3UPU A;  1VQ8 T;  4CRI A;  5KYU B;  5GAN 8;  3M56 A;  4LDX A;  4LVI A;  3PT9 A;  1VQ7 A;  11AS A;  1IRX A;  1CKB A;  2P4T A;  4A4E A;  2K5F A;  1RAA B;  2CZ0 B;  4KGV B;  1QLY A;  4C8Q C;  4C8Q G;  1G5I A;  1HC7 A;  2FO0 A;  5DM7 R;  1VQ7 Q;  1O75 A;  1K73 U;  1NYG A;  3VQX A;  1PKT A;  1EVK A;  3I5S A;  4P5N A;  3JCM V;  1TG0 A;  2PQW A;  3M0T A;  3QYH B;  4RQF A;  4D8D A;  3H6Z A;  2M16 A;  3SDZ A;  1UG1 A;  1RAD B;  1UFF A;  2DM1 A;  2Q5H A;  3VQV A;  1VIF A;  3N5B B;  3P8B B;  4X1V A;  4EMG A;  2L3R A;  4DA4 A;  1KIK A;  4ATO A;  1WLP B;  4H2V A;  4BY6 B;  5LJ5 d;  1ADJ A;  3EFR A;  1VQN T;  4UPA A;  4UP7 A;  4JRK A;  1YHQ A;  4RCB A;  1XNI A;  3HFN A;  1GCP A;  4AG2 C;  4FW1 A;  1I1J A;  2RHS B;  1YHQ Q;  3TRE A;  3EH1 A;  2A7Y A;  1SES A;  3CCR A;  4BY6 C;  1WGS A;  5FW9 A;  4F16 A;  4CI0 C;  5KYU A;  2EL9 A;  1AWW A;  2BKD N;  3CCR Q;  1WHM A;  3SWN B;  3PVL A;  5IHK A;  5GAO n;  2Y4X A;  3CCE T;  2VV5 A;  1WNL A;  1JXO A;  2VB6 A;  2MYS A;  3OW2 A;  1BBW A;  4ELZ C;  2ZT5 A;  1JBM A;  4M75 B;  1GBQ A;  4PJN A;  3OYJ A;  3ERR A;  3JCM c;  1ATI A;  3TU4 K;  4ZTU B;  3TQ7 P;  4O2D A;  1RAI B;  1FXX A;  2VVK A;  3SWN C;  3THK A;  4LE9 A;  2LVM A;  1BI0 A;  4MZP A;  1Q82 R;  1JU5 C;  2KK4 A;  1USY C;  3BFM A;  5IN1 A;  5E3I A;  4M75 C;  2NS6 A;  4M75 G;  4N0A A;  3EGX B;  2QEX T;  4CS4 A;  2GTJ A;  1U1T A;  1WX6 A;  5KYX A;  2SRC A;  3RMS A;  4M78 E;  1K9M R;  1J3T A;  3RDV A;  1JRI A;  1ADY A;  3S6W A;  4YCW A;  3OYN A;  1EX4 A;  1SET A;  1E6H A;  4Q5W A;  3FDR A;  2ALY B;  2CP6 A;  3SWN A;  4PG3 A;  4FYX B;  4NL3 A;  4L5G A;  3GPL A;  4XTY A;  4C0G A;  3AHU A;  2Q7E A;  2ZNJ A;  3QJ6 A;  1USY A;  3A7A A;  2BUD A;  1IHW A;  4P73 C;  1D3B B;  4M75 A;  1K9M C;  2HQE A;  3A31 A;  1D1A A;  3OSS C;  3JCM b;  4YRS A;  2DZC A;  1I5O B;  2XU8 A;  1OPK A;  2J6F A;  3REA B;  3I7F A;  1QVP A;  2EWN A;  2KAF A;  3OYY A;  4GBQ A;  1K4U S;  1QKX A;  1S72 T;  5I22 A;  1QVG P;  2LJ0 A;  1X54 A;  3SEM A;  3EGX A;  1T3L A;  4EMK B;  4TVA B;  3JB9 G;  4Z89 A;  4KQE A;  2JT4 A;  1SRL A;  3I56 A;  3MEV A;  4NS5 A;  2VAS A;  2RO0 A;  1U5S A;  2M51 A;  1JJC A;  1AT1 B;  2LX7 A;  1WDX A;  3UA7 A;  3CC2 A;  2VGN A;  1PSF A;  1FMV A;  4C92 F;  4J9G A;  3I56 Q;  4Z88 A;  5C53 B;  1B7T A;  3HXZ A;  2HMA A;  1RAE B;  2FEI A;  4LD6 A;  3CC2 Q;  4EMK C;  4E7S A;  1VQ5 A;  3VS7 A;  1M3C A;  2X4J A;  4MZM A;  2E3I A;  3I9Q A;  2XDD A;  1VQ5 Q;  3A8L B;  4IUT A;  1D3B A;  2KT8 A;  2ZPH B;  4HWT A;  1M4Z A;  2CDT A;  3JCM d;  4CC7 A;  1YJ9 T;  2Z0W A;  4MMK A;  2CUB A;  4DOV A;  2KMT A;  4YRR A;  2ZPI B;  4RG8 A;  2XID A;  2DRM A;  5GMK j;  2YUO A;  1PYS B;  1WHL A;  4J9E A;  1C0M A;  1I0C A;  8ATC B;  3OYB A;  2JJ9 A;  2P0K A;  2MIO A;  4J6X A;  1NE8 A;  4TVA A;  4EMK A;  2LDM A;  3FIF A;  2FPE A;  2VGM A;  2ZCF B;  4QW2 A;  3I55 T;  2D8J A;  2QGG A;  1G51 A;  3CPF A;  2LT1 A;  3P8Y A;  4C5I A;  2CZ6 B;  2G4C A;  1T3S A;  2HL5 C;  2KSS A;  3OYI A;  4HWO A;  5GAO q;  3JCM P;  4O6J A;  5CR2 A;  5K1P A;  2E3C A;  2M0O A;  3VQY A;  4ZNX A;  1JJ2 P;  2E10 A;  4NOY A;  2XHC A;  1QVF S;  1Y96 A;  4G85 A;  1X69 A;  3CCS T;  1KC8 R;  1HK9 A;  1M27 C;  1NM7 A;  1Q82 U;  2RK2 A;  1KQ2 A;  2EYY A;  3CCJ T;  1N8R R;  3UGT A;  1RLP C;  4M77 F;  3RBB B;  2JMC A;  4PJL A;  4HWR A;  4JJC A;  3G6E Q;  4IUV A;  4X9D A;  2QHT A;  3TEE A;  3X28 B;  1YJW T;  3FJP A;  1K9M U;  2AKL A;  4RMF A;  4CH4 A;  2LCS A;  3OB9 A;  2WSE E;  4P74 C;  1AWJ A;  2HL3 A;  4OMQ A;  5GMK i;  1OYX A;  1NJ2 A;  3JB9 F;  1KC8 C;  1N8R C;  1B8A A;  2YHT A;  2JXB A;  4J9F A;  2IPO B;  4K11 A;  3M0P A;  3UWN A;  2RJC A;  4DEY A;  1WHK A;  1GXI E;  5GAM d;  2QHU A;  5D6X A;  3VUZ A;  4O5V A;  3FC3 A;  3M4G A;  1NPR A;  1JQQ A;  2HKQ B;  2P0Q A;  4EDU A;  2DYB A;  2HQX A;  2LRQ A;  1Y71 A;  2XIC A;  4XEO A;  3QUI A;  2DL8 A;  1KG1 A;  3LX7 A;  1B34 B;  1NJ5 A;  4TVY A;  1SF9 A;  2DAQ A;  1E1T A;  2EQM A;  4TVR A;  4D6W A;  2Q7G A;  4DBQ A;  2G6F X;  1EZZ B;  3FJ5 A;  2AZS A;  3C95 A;  4PFO A;  5KYW B;  4XQ3 A;  1X6O A;  3G1Z A;  2J7I A;  4C92 E;  1B70 A;  3EG0 A;  3MO8 A;  2KRO A;  1ZQ1 A;  3PE0 A;  1VQP T;  4JRI A;  1NYQ A;  1X27 A;  4P72 C;  2D0Q B;  3HY0 A;  1PD0 A;  2OJ2 A;  1VQ9 A;  3LW5 E;  3MP8 A;  4J9D A;  1LOJ A;  5LL6 S;  1D09 B;  5A0D A;  2FG0 A;  1BB9 A;  1VQ9 Q;  4LD9 K;  2RM4 A;  4UP8 A;  3EFS A;  3QYG B;  5LJ3 e;  3PCO B;  1ASY A;  2K9G A;  3IKM B;  2DRK A;  2X4W A;  3QO5 A;  1PRL C;  3NGP A;  3QXE B;  2D8H A;  1NNH A;  3ASK A;  1PRM C;  1VQ4 A;  1VQ7 T;  5LJ3 g;  1G2B A;  2PVO B;  1PCX A;  3PVQ A;  1VQ4 Q;  4QQD A;  4JLG A;  1LVK A;  4C0Z A;  2ZIM A;  2VXF A;  1VOM A;  2M1H A;  1G3T A;  4LDY A;  4PJJ A;  4PJO D;  4ZTJ A;  5GAN g;  1BI1 A;  2BZX A;  1TUC A;  2AKW B;  2ATC B;  4ZGE B;  2ZPF B;  5D6W A;  1A0N B;  2WAC A;  1EFN A;  3M58 A;  5FWC A;  4PLL A;  2FVU A;  3NTH A;  4M7A D;  5A2Q E;  4H2Y A;  4EO4 A;  1UGR B;  1YHQ T;  1B3Q A;  4WJ4 A;  1P92 A;  5I11 A;  1WU7 A;  5ELO A;  4M77 E;  4AH6 A;  1KC8 U;  2ZNI A;  4DBF A;  5I21 A;  4J83 A;  4ESR A;  2X4X A;  4FYY B;  3CCR T;  4OGC A;  2YDL A;  4OMP A;  4J6W A;  1B7Y A;  1MV3 A;  3OYG A;  4B9W A;  3CPW S;  2WSC E;  1AEY A;  4A4G A;  1RLQ C;  2OX7 A;  3GOX A;  2LZ6 B;  4BB7 A;  3QHS A;  3QO7 A;  2EW3 A;  3QDR B;  1SKU B;  2AKW A;  4FM4 B;  2NWM A;  2O2O A;  2F69 A;  2WSF E;  4H2W A;  3HFO A;  3EG9 B;  5KYN A;  2RI5 A;  5KE2 A;  3FLG A;  2XKO C;  4J9C A;  1H4Q A;  1MV0 B;  1UHF A;  4M78 A;  3OYC A;  1VQZ A;  1YP5 A;  3MF1 A;  3MCA B;  1JXM A;  1BK2 A;  3V7R A;  2RJD A;  1CSK A;  1KQ1 A;  1JO8 A;  1PSE A;  3SD4 A;  4E7I A;  5CKD A;  1QF6 A;  2GBQ A;  2DBM A;  4BI8 B;  4F17 A;  1LPL A;  4EPC A;  4L59 A;  1I5L A;  1M8V A;  2MK5 A;  3DSQ A;  4H02 A;  2QHS A;  3A8O B;  5F5W A;  4M7A B;  3M54 A;  1D0X A;  4CC3 A;  2YRV A;  1VQL A;  3BY7 A;  2ZR2 A;  1MMA A;  2P0L A;  2V8I A;  1KHC A;  1BI2 A;  2KVQ G;  3CME A;  3CBM A;  1OUL A;  4KR3 A;  2YUN A;  1VQL Q;  3CXC S;  1RAG B;  2YT6 A;  4YP0 A;  1GFD A;  2XD0 A;  4JUV A;  2RHY A;  3JCM f;  1HYO A;  1LYL A;  2KRS A;  3EAE A;  1NJ8 A;  1UB4 A;  4M7A C;  1SPK A;  4F7U B;  1OPL A;  3RKW A;  2LCC A;  5A0G A;  1NEB A;  4HCZ A;  4BAC A;  1H4T A;  4J9H A;  5KH6 A;  2AIR B;  3VS2 A;  4OP0 A;  2W0Z A;  1QVF P;  1WIE A;  5GAN 7;  1U8R A;  3NET A;  5GAO l;  3HXY A;  4YRK A;  1TH7 A;  2HQH A;  4A4K A;  4JS5 A;  2IIM A;  1M1F A;  4JRQ A;  4PJO A;  1AVZ C;  4F7U G;  3NTI A;  4HA8 A;  3I56 T;  1YCS B;  1KQS P;  1ABQ A;  1B76 A;  3IQL A;  2X51 A;  1D0Z A;  3RR6 A;  2GGR A;  3CC2 T;  4XU1 A;  4E7L A;  1UJ0 A;  2XTI A;  3MEU A;  1HD3 A;  5LJ3 h;  4M7A A;  1Q81 R;  1VQ5 T;  4E51 A;  3EHQ A;  2DEU A;  4LDW A;  4YDQ A;  4CS3 A;  1TSF A;  3VU3 C;  5CQX A;  2DFU A;  2DIL A;  2DA9 A;  1N6A A;  1EIY A;  1EIF A;  2GQI A;  1S1N A;  2RQT A;  3PMI A;  4IIM A;  1VYT A;  5KNN A;  2HNI A;  3EFO B;  3QNE A;  1W1F A;  3CCQ T;  1PNJ A;  2FZG B;  2K5L A;  5ELN A;  2K57 A;  2C06 A;  2DBK A;  1Q81 C;  1VQ6 A;  2OTJ A;  2MF2 A;  1I8F A;  1RUW A;  4C0F A;  1UE9 A;  2DXB A;  1VQ6 Q;  2OTJ Q;  1KK7 A;  2DYI A;  1G83 A;  3HRU A;  2KYB A;  1KD1 C;  2GTO A;  2VC8 A;  3E1S A;  2K6D A;  2KDS A;  1KFZ A;  3QO8 A;  2QI2 A;  1UHC A;  4RTY A;  4JZ3 A;  1YFS A;  2DQ0 A;  3RGL A;  2PVG B;  2E5A A;  2KXC A;  3VV0 A;  3H0H A;  3EH2 A;  4FSX A;  4AFQ C;  3RKY A;  1QCO A;  5GAM f;  4ZGD B;  4M7D F;  2FPD A;  1M5Q 1;  4TTV A;  4H2S A;  5L8R E;  4KRT A;  3D7S B;  1NYF A;  3CBO A;  1M3A A;  4YYE A;  2JUF A;  2R5A A;  4ZTF A;  3TEH A;  2YLB A;  3L2V A;  3EFO A;  1ZBX A;  5GMK l;  4C0D B;  3GF5 A;  5KYX B;  1NZ9 A;  3JV3 A;  3MEA A;  5GAO r;  3E9F A;  2DX1 A;  2CJ9 A;  1ZX6 A;  1W2B A;  1K9A A;  2HEQ A;  1WHJ A;  4BUG A;  3UF4 A;  3CBP A;  1E7O A;  3QBY A;  2KI7 A;  5C0M A;  5HY6 A;  3OS5 A;  3MP1 A;  1PWT A;  4MDX A;  4AFS C;  4N0A C;  1YJN A;  1RL2 A;  4J9I A;  4IUQ A;  4C0D C;  4LUD A;  4GLM A;  3VYH B;  1Q7Y C;  5GAN 3;  1FX7 A;  2C0T A;  1YJN Q;  1V1C A;  3MET A;  1N27 A;  1QCF A;  2CJB A;  4LXC A;  2KBT A;  5M9O A;  1NLO C;  2EPD A;  2CKK A;  3V8J A;  3WXM B;  1L0W A;  4XTV A;  2DIQ A;  3PTA A;  1M2O A;  4B9X A;  4KUL A;  4F14 A;  4KUI A;  2FPF A;  1J5W A;  1IXD A;  2QDL A;  3M4P A;  1XQH A;  4YRN A;  4HCC A;  1JB0 E;  2DL3 A;  1PKS A;  2GQV A;  6AT1 B;  2X4Y A;  4OGE A;  4RKU E;  3RUX A;  1JEG A;  4KGX B;  3FRN A;  5FU7 B;  4C92 A;  4RTT A;  1JJC B;  4NCX A;  3L2R A;  4X9C A;  2DKG A;  1U1S A;  2P0P A;  4OB3 B;  2ARU A;  2NUP B;  3U23 A;  2BE9 B;  1XJW B;  5GAN d;  2MOX A;  1I07 A;  1FWZ A;  3PNW C;  4TWA A;  2ZZF A;  1QWF A;  4FW2 A;  3REX A;  1FMW A;  1K1Z A;  2H3J A;  1VQ9 T;  5FU7 C;  4JJD A;  1NJI R;  4C8Q F;  5J3B A;  3CPW P;  1SG5 A;  2AZV A;  2QQR A;  1Q81 U;  3MPU B;  2I4N A;  2RF0 A;  4QVC A;  2P5I A;  3VQW A;  1YN8 A;  2FB7 A;  3CEY A;  3ZFJ A;  2DD4 A;  3TCJ A;  4LUE A;  3C12 A;  1H3H A;  2LC4 A;  4ELY C;  4UP9 A;  2DJZ A;  3P8H A;  2EYZ A;  5I2M A;  4E7J A;  1M2V B;  3RIR A;  3NEL A;  1NG2 A;  1XOV A;  2V26 A;  4HT9 A;  2CYZ B;  1RAF B;  4IIO A;  2VYT A;  1UDL A;  3A8H B;  4ZGJ B;  4E2F B;  2EGC A;  2ZAE A;  1VQ4 T;  3A5Z B;  1NJI C;  2EKO A;  3RMQ A;  3L1A A;  4AT1 B;  1X2K A;  3INZ A;  3I5R A;  4BDY A;  2SEM A;  3V8K A;  3CC4 A;  4KR2 A;  1SEM A;  2NUP A;  3VS0 A;  4DQ2 A;  2LMJ A;  3CC4 Q;  1EOV A;  3S3M A;  2YWW A;  4M7D E;  1UEB A;  4BDZ A;  4ZIB A;  3HTZ A;  1IGU A;  2LQK A;  3VS3 A;  1H3Z A;  5HK0 A;  3S3N A;  2RJE A;  1Y96 B;  2KEA A;  2E41 A;  2J06 A;  3CXC P;  3OQ5 A;  2J05 A;  3HL8 A;  3DB4 A;  1X56 A;  4M77 A;  1ZA1 B;  3A8G B;  2EVR A;  1I81 A;  3EG3 A;  1M2V A;  3M4Y A;  3A74 A;  3H9N A;  3R6N A;  4C5H A;  1ZHI A;  2JNG A;  4H2T A;  3UA6 A;  3A5Z A;  4PL6 A;  1Z9Q A;  2ART A;  3X24 B;  5LJ5 j;  2XDP A;  2JTM A;  1X2H A;  4M75 F;  2KE9 A;  4P71 C;  1X43 A;  2DEQ A;  3VYG A;  2QA4 A;  3C4S A;  2DET A;  1IZ6 A;  8AT1 B;  3OYM A;  2DU5 A;  2V8K A;  2VWF A;  3CMQ A;  1VQK A;  3OS2 A;  1C0A A;  2RD1 A;  2QA4 Q;  3WQZ A;  4CH3 A;  2DE0 X;  2FRY A;  1W2B S;  1VQK Q;  2CT4 A;  4EMH A;  2PMF A;  1OEB A;  1YIT A;  2RQW A;  3H0F A;  2LP5 A;  2M0Y A;  1QP3 A;  3OS0 A;  1YIT Q;  4YRC A;  2NYS A;  3OW2 S;  4QVZ A;  3G6E A;  2LCL A;  4P71 A;  3AT1 B;  2AT1 B;  4OF1 A;  4KBM B;  2GFA A;  3OYA A;  3VBB A;  1B70 B;  2DTO A;  2MPX C;  2D1X A;  4RCC A;  4CH6 A;  5IH2 A;  1M1G A;  4C5E A;  3CCV T;  2ZPB B;  1VQL T;  3WVE B;  3A8M B;  5HCK A;  4C8Q E;  4ZN3 A;  4HT4 A;  3CME T;  2PUO B;  2ENM A;  4GY5 A;  1BU1 A;  2X9H A;  1R0B G;  2JTE A;  2JVV A;  4XTU A;  2MI6 A;  5GJV B;  1NJI U;  3FB9 A;  1G5V A;  2ZT7 A;  2Q7H A;  2NLU A;  3E19 A;  2IY5 B;  3DLL A;  5GJW B;  1YNZ A;  2QYZ A;  5GMK e;  4JRP A;  1UTI A;  2L5Q A;  1H64 1;  1K76 A;  1W66 A;  4RTU A;  4AG1 C;  4M4Z A;  1SSH A;  3A32 A;  1KOG A;  2KR3 A;  3OYH A;  2A0F B;  4ME7 A;  5LJ5 e;  2A28 A;  1LJO A;  4ZN1 A;  2KQW A;  1TOV A;  4H2X B;  3LH0 A;  4LNP A;  2QTV A;  3OYK A;  2CP2 A;  2MWO A;  3J81 E;  2AKK A;  3MEY A;  2MAM A;  4M78 D;  5C52 B;  3CCL T;  1X6G A;  2NUT B;  2COW A;  1F1B B;  5LJ5 g;  4R55 A;  1W70 A;  4PJM A;  1YFR A;  3O8V A;  3G4S A;  2QQS A;  4AFZ C;  3HSB A;  2FYK A;  1UUE A;  3HXW A;  1KMM A;  1LNX A;  4YTL A;  1U06 A;  2E70 A;  2RPN A;  4BI4 A;  1D1C A;  4ORZ A;  3G4S Q;  4FCY A;  5FU6 B;  4TQD A;  1ZA2 B;  3RES A;  1C1A A;  5CK9 A;  2RK1 A;  1Q95 G;  2IY5 A;  3MJX A;  2M02 A;  2ROT A;  3V7S A;  2A3L A;  2EQU A;  2RHX A;  2OAW A;  4IUP A;  4XK8 E;  1VQ6 T;  2JS2 A;  1BBZ A;  1GGM A;  5FU6 C;  4J7I A;  3BDL A;  4XTW A;  3OYD A;  5KE3 A;  1PG5 B;  1KJW A;  3MKD A;  4M75 E;  1B7Y B;  4H2X A;  4A4F A;  2EYW A;  4K87 A;  4TVW A;  4FSS A;  3DKM A;  3QPH A;  2NUT A;  3VS5 A;  3NPF A;  4FL6 A;  2RHQ B;  3JCM Q;  4LDV A;  3KUF A;  1JJ2 A;  1ZUK A;  2KRN A;  2ZZD A;  9ATC B;  3OBW A;  1G3S A;  3KXT A;  3VS1 A;  3J80 E;  3J7A F;  1LCK A;  2C0I A;  4F04 B;  1M1K R;  2EGE A;  4IUR A;  2DZ9 A;  1Y0M A;  2E64 A;  1Y57 A;  4PHC A;  2ZPE B;  4M78 B;  2PZ1 A;  5LJ3 f;  1WHH A;  1D1B A;  4V2S A;  3UH0 A;  2HSE B;  1PM3 A;  2LNV A;  3CD6 A;  4YRP A;  1WXB A;  2J6O A;  5CO7 A;  1N8R U;  4X34 A;  2CUD A;  3CD6 Q;  1IL2 A;  4K86 A;  4Y91 A;  3A1P A;  1UJY A;  1QWE A;  4M78 C;  5GAN f;  4M78 G;  1Z9Z A;  1M1K C;  2ARS A;  3CCU A;  2ZT6 A;  4X5O A;  2ZIO A;  3OYL A;  3LLR A;  3OA6 A;  3HRS A;  4XAX B;  4VUB A;  4LN2 A;  3GBQ A;  3A7R A;  5CVI A;  3CCU Q;  1ZSZ A;  3C0C A;  4A54 A;  3VJP A;  4J15 A;  3JB9 J;  2VUB A;  2RHQ A;  3BJU A;  2QGF B;  1VIE A;  4A63 B;  3CMA A;  1YIJ A;  5CKF A;  5D7U A;  2Y90 A;  2F2X A;  5FLX E;  1H4V B;  1C6V X;  2E12 A;  2DXU A;  5D6Y A;  3CMA Q;  1YIJ Q;  4BD3 A;  2X3W D;  4JPB W;  1NEG A;  5L23 A;  2YUP A;  2EJG A;  2BIV A;  2FHD A;  4XU3 A;  4MDW A;  4AFU C;  5IXF A;  3PZC A;  2FRW A;  4PJO B;  3L2W A;  3JCM e;  5GAM j;  3JB9 I;  4R0K A;  2DF6 A;  3HXX A;  1K73 C;  3SFM A;  2CT3 A;  3JCM W;  1VA7 A;  3HXU A;  4FT4 A;  1FYN A;  3A5Y A;  1N9R A;  1OOT A;  4YRE A;  1M30 A;  1WXU A;  3T9N A;  4PJO C;  5GMK h;  3RL6 A;  4PJO G;  4J7F A;  4YRI A;  4RMO A;  1IRE B;  2K3X A;  2RA2 A;  1EIY B;  2GCX A;  3LWH A;  1H8K A;  1YWO A;  4OLF A;  2OI3 A;  2LJ3 A;  2K5I A;  2QAS A;  1M3B A;  2PUK B;  4IKF A;  5LJ5 h;  1X01 A;  1W2B P;  1CKA A;  2C0O A;  1NBE B;  4M7A G;  4CS2 A;  4FIB A;  3HRI A;  3H8Z A;  2QG9 B;  3HP9 A;  1GBR A;  2D9T A;  2CZ1 B;  2J3L A;  4Q15 A;  3RF1 A;  5J26 A;  2LQ8 A;  4YRJ A;  3CCM A;  1MND A;  1B07 A;  1K8A R;  1RAB B;  2E5K A;  1E6G A;  2D0N A;  2YRC A;  4YRL A;  4PK4 A;  3OW2 P;  2E6Z A;  5J39 A;  3CCM Q;  1Y7X A;  3M57 A;  1N9W A;  1WYD A;  1YFN A;  2CGH A;  3R6O A;  2DER A;  4ZTZ B;  2CRE A;  3PFS A;  1UGQ B;  3M0U A;  3CC4 T;  3JRZ A;  2C8M A;  3QDF A;  3RKX A;  2L3S A;  1NLP C;  1AWO A;  3ZBD A;  4M7D A;  4QKU A;  5GAN 6;  4JJB A;  4C92 D;  1UGS B;  1Q86 R;  2ED0 A;  1W6X A;  2QDY B;  5IT9 E;  3GNF B;  1AWX A;  2CSQ A;  2RMO A;  1K8A C;  2HAX A;  3URG A;  1WFW A;  1PHT A;  3MQZ A;  2VXE A;  3NTK A;  3ZEH A;  1E1O A;  2RH2 A;  2XGT A;  1WJQ A;  4QQ6 A;  2A8E A;  2A36 A;  1KD1 R;  3TEH B;  2ROL A;  3L4G B;  2H8H A;  2EIF A;  5AYF A;  1M1K U;  2CP3 A;  4PKC C;  3HFZ B;  5ECA A;  1KSW A;  4J6Y A;  1U3O A;  5GAM e;  3HRK A;  1MNE A;  2CP5 A;  2V1Q A;  2KGT A;  4YCV A;  1Q86 C;  1WPY A;  3UAT A;  2ZCE A;  2ED1 A;  2YXY A;  4OMN A;  2DVJ A;  3M4Q A;  2EJ9 A;  1TUG B;  4D8K A;  3LH5 A;  2GF7 A;  2VKN A;  3L2U A;  2COY A;  1ZUU A;  2ZT8 A;  3SB2 A;  3IAL A;  1VQM A;  2DO3 A;  4WF2 A;  3ICA A;  1EFW A;  2RHI A;  2OAU A;  4HT8 A;  1UGV A;  3NHN A;  1WQ7 A;  1VQM Q;  3L2Z A;  2F5K A;  4P75 A;  1YIT T;  2K3Y A;  3JCM J;  2K79 A;  4KH1 B;  4PJO F;  3JCM X;  1Q7Y R;  2MCN A;  2DNU A;  5IHI A;  4HCB A;  3ER0 A;  3L4G A;  3X20 B;  3OMG A;  4RUG A;  4J8O A;  2L89 A;  3G6E T;  1GCQ C;  3EHR A;  4OMM A;  3HFZ A;  2V1R A;  1YI2 A;  2CH4 W;  1BBU A;  5CKB A;  4C92 B; 
#chains in the Genus database with same CATH homology
 2RB6 A;  4M7A F;  3UDC A;  4M77 D;  2ZR3 A;  3S3O A;  3OYF A;  1WQW A;  2ZZG A;  4BE2 A;  4C8Q A;  2J3M A;  2CIM A;  2O4X A;  2D6F A;  2R58 A;  4C92 C;  1MGQ A;  4C92 G;  3TUP A;  4XTX A;  4F7U F;  2E6N A;  2ZGW A;  3MP6 A;  3JB9 D;  1Y07 A;  5CQY A;  3JCM h;  2DQ3 A;  1QVF A;  3OBY A;  4K88 A;  4A53 A;  3OY9 A;  5EG2 A;  2HD0 A;  2DPP B;  5LJ3 d;  2CJA A;  4LDU A;  4HVC A;  1KQS A;  3LGF A;  3GNG A;  3F70 A;  3W3S A;  2ZTG A;  3G71 A;  2V8J A;  2L8D A;  2QTX A;  4LNS A;  3MHX A;  1K8A U;  5GAN 5;  3HY1 A;  3QZ9 B;  1VQO A;  4P3P A;  4KT0 E;  2DIG A;  1BYM A;  4RQE A;  1ASZ A;  3A7U A;  2I4L A;  2YLC A;  5CIU A;  1WJS A;  2E65 A;  2QXF A;  4YRT A;  1R8O B;  2CZ7 B;  5KCO A;  3G4S T;  1EVL A;  4P3N A;  2RHS A;  4XU0 A;  3UT1 A;  1Q86 U;  2EFI A;  3OS1 A;  4JS4 A;  4M77 B;  3PIP A;  4LVL A;  1Q82 C;  3QII A;  1Z7M A;  1KD1 U;  4PNO A;  1SSF A;  4UC4 A;  1BI3 A;  5C51 B;  2XI9 A;  3QG1 A;  1YFT A;  2EQK A;  4C5G A;  2F5T X;  5HKC A;  1M9S A;  3CC7 A;  4M77 C;  2DVE A;  4M77 G;  1NYR A;  2RI2 A;  3IKL A;  5DLQ E;  1G3W A;  2EYQ A;  4FU6 A;  2K2V A;  2OTL A;  3GIB A;  1X55 A;  4H2U A;  4YRM A;  1YCY A;  2KY9 A;  4NL2 A;  5GAM h;  3OYE A;  4BI3 A;  1QP2 A;  1SRY A;  4PJO E;  1BKB A;  3KBG A;  5FRO A;  3VKI A;  2R57 A;  4P73 A;  3MF2 A;  4OB0 B;  1KMN A;  4YCU A;  2ALY A;  3NFC A;  1Q7Y U;  2MWP A;  4BE1 A;  2C7I A;  2RHZ A;  3CD6 T;  3ME9 A;  4M7A E;  2QQ9 A;  2LTO A;  4PLI A;  2RJF A;  3RER A;  4E47 A;  3NEM A;  1O9S A;  4MZT A;  2GFU A;  1M90 C;  4N4H A;  2DD5 A;  4KUD K;  3CCU T;  1YGB A;  3CCQ A;  4F7U E;  3NEN A;  3PMT A;  1E24 A;  4E7H A;  1I4K 1;  2Y4Y A;  1VQ8 A;  4OMF B;  1EQR A;  3E9H A;  2O01 E;  2E5Q A;  3CMA T;  4XU2 A;  1YIJ T;  3BW1 A;  3L2Q A;  5CCA A;  2XK0 A;  3REU A;  2QQA A;  2IVW A;  5DLO A;  4LVJ A;  5I2S A;  5GAN 2;  3M53 A;  3C94 A;  5C6S A;  3OMC A;  1NJ6 A;  4Y28 E;  2M9U A;  2K4Y A;  2DDZ A;  5HK3 A;  4YRF A;  4Z02 A;  1VQN A;  4E7K A;  3CPW A;  3QJY A;  5LJ3 j;  2FL7 A;  1KQS S;  3JSC A;  3X26 B;  4JJN K;  4LVK A;  1V29 B;  3BDU A;  1PYS A;  4XEM A;  4R56 A;  1G5H A;  2I4O A;  4WJ3 M;  3MEW A;  3QKJ A;  5CAI A;  4DOW A;  2X35 A;  12AS A;  5GAN j;  2AMC B;  1QVG A;  3CCE A;  2DU7 A;  4G84 A;  4EX5 A;  2RI3 A;  1QW1 A;  2DTH A;  3CCM T;  3UFG A;  3M9Q A;  2ZIN A;  5A0L A;  1NJ1 A;  1W4S A;  4YRQ A;  2I4M A;  2CS7 A;  3LGL A;  1N9S A;  1AHJ B;  2QEX A;  4P74 A;  3V7C A;  4GLK A;  3CXC A;  3R07 A;  4RDX A;  3QZ5 B;  3M55 A;  4BW9 A;  5KCH A;  1M90 U;  4J5Y A;  2XDB A;  2AMC A;  2ZPG B;  3DB3 A;  1OZ2 A;  3X25 B;  2ZXF A;  3GLX A;  2EJF A;  5CKH A;  2OTJ T;  3M59 A;  1YBY A;  1BIA A;  4JDS A;  5LJ5 f;  4L87 A;  4LVM A;  4A4H A;  2XG8 D;  4DPG A;  4FT2 A;  3HKS A;  3E9G A;  3M5A A;  1VQM T;  1S72 A;  3LSS A;  1B34 A;  5IAY A;  4JLI A;  4P72 A;  1Z7N A;  4BE0 A;  5GAN e;  1DJ7 B;  1NPP A;  3E9I A;  4HKE A;  5FRM A;  2EQJ A;  4M7D D;  1E22 A;  5GAO m;  4QVD A;  4YRO A;  3VUB A;  3P8D A;  4L6V 5;  1YI2 T;  3P8T A;  4RG2 A;  3TEG A;  1FYF A;  3L42 A;  1HXD A;  1RIQ A;  1YJN T;  3IG2 A;  1YJ9 A;  4TQF A;  3PCO A;  4Q6G A;  2DXC A;  4N4G A;  3DLM A;  5HGQ A;  3FEO A;  2HBP A;  1SER A;  3OSV A;  3HXV A;  4IUU A;  2MMP A;  3I55 A;  3QO3 A;  3P8V A;  3OD1 A;  2QQB A;  2ODR D;  5FRN A;  3JAM E;  3HPW A;  3HRT A;  2JOY A;  4XTZ A;  2DK3 A;  3G71 T;  3WVD B;  3QTC A;  3G7Z A;  3GP8 A;  3LYI A;  1VQO T;  4II1 A;  1X75 C;  2LX9 A;  1QVG S;  4N4I A;  1XTD A;  3CCS A;  4M7D B;  3CCJ A;  3JCM g;  5K1X A;  1X2G A;  1OI1 A;  1QE0 A;  3PIO A;  4OVA A;  1YJW A;  4C8Q D;  3LC0 A;  2DTI A;  5GMK m;  4M7D C;  4M7D G;  4OB1 B;  1UGP B;  2E1H A;  1HTT A;  3CCV A;  2PME A;  3LSQ A;  2LT4 A;  2RHU A;  3CC7 T;  4WI1 A;  2PU9 B;  4QQG A;  3V8L A;  5CKE A;  5GAO p;  2PVD B;  2QHV A;  1WLE A;  3JB9 H;  3QSU A;  1VUB A;  3Q1J A;  3UGQ A;  4OB2 B;  4YRG A;  2OTL T;  1KHI A;  2JZ2 A;  1MHN A;  3RAC A;  2I2L A;  2JTF A;  3PGG A;  2G3R A;  2AHJ B;  4M78 F;  2IG0 A;  2JN0 A;  4MML A;  3CCL A;  1VQP A;  2R5M A;  3HHT B;  2ODR C;  5DY9 A;  4HWS A;  2Q5I A;  1YB3 A;  1OZ3 A;  1G3Y A;  5GAN 4;  4P75 C;  1JJ2 S;  3LWI A;  1H4S A;  4BWA A;  2EAY A;  3KFU A;  2ZZE A;  1WJR A;  4YPF A;  1BIB A;  5GAN h;  4C8Q B;  4HWP A;  4CH5 A;  4F7U A;  5GAM g;  2QA4 T;  4P3O A;  2O4X B;  1RI0 A;  2DXT A;  1VQK T;  4M75 D;  3HFV A;  2B8A A;  3UPU A;  1VQ8 T;  4CRI A;  5GAN 8;  3M56 A;  4LDX A;  4LVI A;  3PT9 A;  1VQ7 A;  11AS A;  4A4E A;  2P4T A;  2K5F A;  2CZ0 B;  4C8Q C;  4C8Q G;  1G5I A;  1HC7 A;  5DM7 R;  1O75 A;  1K73 U;  3VQX A;  1EVK A;  4P5N A;  3JCM V;  2PQW A;  3QYH B;  4RQF A;  3H6Z A;  2M16 A;  3SDZ A;  2Q5H A;  3VQV A;  1VIF A;  3N5B B;  3P8B B;  4EMG A;  2L3R A;  4DA4 A;  4ATO A;  4H2V A;  4BY6 B;  5LJ5 d;  1ADJ A;  3EFR A;  1VQN T;  4UPA A;  4UP7 A;  4JRK A;  1YHQ A;  4RCB A;  1XNI A;  3HFN A;  2RHS B;  3TRE A;  2A7Y A;  1SES A;  3CCR A;  4BY6 C;  1WGS A;  4CI0 C;  2EL9 A;  2BKD N;  3SWN B;  5GAO n;  2Y4X A;  3CCE T;  2VV5 A;  1WNL A;  3OW2 A;  1BBW A;  4ELZ C;  2ZT5 A;  1JBM A;  4M75 B;  3OYJ A;  3ERR A;  3JCM c;  1ATI A;  3TU4 K;  4ZTU B;  4O2D A;  1FXX A;  3SWN C;  2LVM A;  1BI0 A;  4MZP A;  2KK4 A;  1USY C;  3BFM A;  5IN1 A;  5E3I A;  4M75 C;  2NS6 A;  4M75 G;  4N0A A;  2QEX T;  4CS4 A;  1U1T A;  3RMS A;  4M78 E;  1JRI A;  1ADY A;  3S6W A;  4YCW A;  3OYN A;  1SET A;  4Q5W A;  3FDR A;  2ALY B;  3SWN A;  4PG3 A;  4NL3 A;  4L5G A;  3GPL A;  4XTY A;  4C0G A;  3AHU A;  2Q7E A;  2ZNJ A;  3QJ6 A;  1USY A;  3A7A A;  2BUD A;  4P73 C;  1D3B B;  4M75 A;  1K9M C;  2HQE A;  3A31 A;  3OSS C;  3JCM b;  4YRS A;  2DZC A;  2XU8 A;  3I7F A;  1QVP A;  2EWN A;  2KAF A;  3OYY A;  1S72 T;  1X54 A;  4TVA B;  4EMK B;  3JB9 G;  4KQE A;  3I56 A;  3MEV A;  4NS5 A;  2RO0 A;  1JJC A;  3CC2 A;  2VGN A;  1PSF A;  4C92 F;  5C53 B;  3HXZ A;  4LD6 A;  4EMK C;  1VQ5 A;  2X4J A;  4MZM A;  2XDD A;  3A8L B;  2ZPH B;  1D3B A;  4IUT A;  4HWT A;  1M4Z A;  3JCM d;  1YJ9 T;  4MMK A;  4DOV A;  2KMT A;  4YRR A;  2ZPI B;  4RG8 A;  2XID A;  5GMK j;  1PYS B;  3OYB A;  2P0K A;  4J6X A;  1NE8 A;  4TVA A;  4EMK A;  2LDM A;  3FIF A;  2VGM A;  2ZCF B;  4QW2 A;  3I55 T;  1G51 A;  3CPF A;  2LT1 A;  3P8Y A;  4C5I A;  2CZ6 B;  2G4C A;  2KSS A;  3OYI A;  4HWO A;  5GAO q;  3JCM P;  4O6J A;  5CR2 A;  5K1P A;  2E3C A;  2M0O A;  3VQY A;  2E10 A;  4NOY A;  2XHC A;  1QVF S;  1Y96 A;  4G85 A;  3CCS T;  1HK9 A;  1Q82 U;  2RK2 A;  1KQ2 A;  3CCJ T;  3UGT A;  4M77 F;  4HWR A;  4IUV A;  4X9D A;  2QHT A;  3TEE A;  3X28 B;  1YJW T;  3FJP A;  1K9M U;  4RMF A;  4CH4 A;  3OB9 A;  2WSE E;  4P74 C;  5GMK i;  1OYX A;  1NJ2 A;  3JB9 F;  1KC8 C;  1N8R C;  1B8A A;  2YHT A;  3UWN A;  2RJC A;  1GXI E;  5GAM d;  2QHU A;  5D6X A;  3VUZ A;  4O5V A;  3FC3 A;  3M4G A;  1NPR A;  2P0Q A;  4EDU A;  2HQX A;  2LRQ A;  2XIC A;  1Y71 A;  4XEO A;  3QUI A;  1KG1 A;  3LX7 A;  1B34 B;  1NJ5 A;  4TVY A;  2DAQ A;  1E1T A;  2EQM A;  4TVR A;  4D6W A;  2Q7G A;  3C95 A;  4XQ3 A;  1X6O A;  3G1Z A;  4C92 E;  1B70 A;  3MO8 A;  1ZQ1 A;  1VQP T;  4JRI A;  1NYQ A;  4P72 C;  2D0Q B;  3HY0 A;  1VQ9 A;  3LW5 E;  3MP8 A;  5LL6 S;  1LOJ A;  5A0D A;  4LD9 K;  2RM4 A;  4UP8 A;  3EFS A;  3QYG B;  5LJ3 e;  3PCO B;  1ASY A;  3IKM B;  2X4W A;  3QO5 A;  3QXE B;  1NNH A;  3ASK A;  1VQ4 A;  1VQ7 T;  5LJ3 g;  2PVO B;  4QQD A;  4JLG A;  4C0Z A;  2ZIM A;  2VXF A;  2M1H A;  1G3T A;  4LDY A;  4PJO D;  4ZTJ A;  5GAN g;  1BI1 A;  2AKW B;  4ZGE B;  2ZPF B;  5D6W A;  2WAC A;  3M58 A;  4PLL A;  2FVU A;  3NTH A;  4M7A D;  5A2Q E;  4H2Y A;  4EO4 A;  1UGR B;  1YHQ T;  4WJ4 A;  1P92 A;  1WU7 A;  5ELO A;  4M77 E;  4AH6 A;  1KC8 U;  2ZNI A;  5I21 A;  4J83 A;  2X4X A;  3CCR T;  4OGC A;  4J6W A;  1B7Y A;  3OYG A;  4B9W A;  3CPW S;  2WSC E;  4A4G A;  3GOX A;  4BB7 A;  3QHS A;  3QO7 A;  3QDR B;  2AKW A;  4FM4 B;  2F69 A;  2WSF E;  4H2W A;  3HFO A;  2RI5 A;  5KE2 A;  3FLG A;  2XKO C;  1H4Q A;  4M78 A;  3OYC A;  1VQZ A;  3MF1 A;  3MCA B;  3V7R A;  2RJD A;  1KQ1 A;  1PSE A;  3SD4 A;  4E7I A;  5CKD A;  1QF6 A;  4BI8 B;  4EPC A;  4L59 A;  1I5L A;  1M8V A;  3DSQ A;  4H02 A;  2QHS A;  3A8O B;  5F5W A;  4M7A B;  3M54 A;  2YRV A;  1VQL A;  3BY7 A;  2ZR2 A;  2P0L A;  2V8I A;  1KHC A;  1BI2 A;  2KVQ G;  3CME A;  3CBM A;  4KR3 A;  3CXC S;  4YP0 A;  2XD0 A;  4JUV A;  2RHY A;  3JCM f;  1LYL A;  3EAE A;  1NJ8 A;  1UB4 A;  4M7A C;  4F7U B;  3RKW A;  2LCC A;  5A0G A;  4HCZ A;  4BAC A;  1H4T A;  5KH6 A;  4OP0 A;  1U8R A;  5GAN 7;  3NET A;  5GAO l;  3HXY A;  4YRK A;  1TH7 A;  4A4K A;  4JS5 A;  1M1F A;  4JRQ A;  4PJO A;  4F7U G;  3NTI A;  4HA8 A;  3I56 T;  1B76 A;  3CC2 T;  4XU1 A;  4E7L A;  2XTI A;  3MEU A;  5LJ3 h;  4M7A A;  1VQ5 T;  4E51 A;  4LDW A;  4YDQ A;  4CS3 A;  3VU3 C;  5CQX A;  1N6A A;  1EIY A;  1EIF A;  3PMI A;  5KNN A;  2HNI A;  3QNE A;  3CCQ T;  2K5L A;  5ELN A;  2K57 A;  2C06 A;  1Q81 C;  1VQ6 A;  2OTJ A;  2MF2 A;  1I8F A;  4C0F A;  2DXB A;  3HRU A;  1KD1 C;  2VC8 A;  3E1S A;  2KDS A;  3QO8 A;  2QI2 A;  1YFS A;  2DQ0 A;  3RGL A;  2PVG B;  2E5A A;  3VV0 A;  4FSX A;  3RKY A;  5GAM f;  4ZGD B;  4M7D F;  1M5Q 1;  4TTV A;  4H2S A;  5L8R E;  3CBO A;  4YYE A;  2JUF A;  2R5A A;  4ZTF A;  3TEH A;  2YLB A;  3L2V A;  1ZBX A;  5GMK l;  4C0D B;  3GF5 A;  1NZ9 A;  3MEA A;  5GAO r;  3E9F A;  2CJ9 A;  1W2B A;  4BUG A;  3CBP A;  3QBY A;  5C0M A;  5HY6 A;  3OS5 A;  3MP1 A;  4MDX A;  4N0A C;  1YJN A;  1RL2 A;  4IUQ A;  4C0D C;  3VYH B;  1Q7Y C;  5GAN 3;  1FX7 A;  3MET A;  1N27 A;  2CJB A;  5M9O A;  2CKK A;  3V8J A;  3WXM B;  1L0W A;  4XTV A;  2DIQ A;  3PTA A;  4B9X A;  4KUL A;  4KUI A;  1J5W A;  3M4P A;  1XQH A;  4YRN A;  4HCC A;  1JB0 E;  2GQV A;  2X4Y A;  4OGE A;  4RKU E;  3RUX A;  3FRN A;  5FU7 B;  4C92 A;  1JJC B;  4NCX A;  3L2R A;  4X9C A;  2DKG A;  1U1S A;  2P0P A;  4OB3 B;  2ARU A;  5GAN d;  1FWZ A;  3PNW C;  4TWA A;  2ZZF A;  3REX A;  2H3J A;  1VQ9 T;  5FU7 C;  4C8Q F;  5J3B A;  2QQR A;  1Q81 U;  2I4N A;  4QVC A;  2P5I A;  3VQW A;  2FB7 A;  3CEY A;  3ZFJ A;  2DD4 A;  3TCJ A;  3C12 A;  2LC4 A;  4ELY C;  4UP9 A;  2DJZ A;  3P8H A;  5I2M A;  4E7J A;  3RIR A;  3NEL A;  1XOV A;  4HT9 A;  2CYZ B;  2VYT A;  3A8H B;  4ZGJ B;  1VQ4 T;  3A5Z B;  1NJI C;  2EKO A;  3RMQ A;  3L1A A;  3INZ A;  4BDY A;  3V8K A;  3CC4 A;  4KR2 A;  4DQ2 A;  1EOV A;  3S3M A;  4M7D E;  1UEB A;  4BDZ A;  4ZIB A;  3HTZ A;  2LQK A;  1H3Z A;  5HK0 A;  3S3N A;  2RJE A;  1Y96 B;  2E41 A;  3OQ5 A;  3HL8 A;  3DB4 A;  1X56 A;  4M77 A;  3A8G B;  1I81 A;  3M4Y A;  3A74 A;  4C5H A;  1ZHI A;  2JNG A;  4H2T A;  3A5Z A;  4PL6 A;  2ART A;  3X24 B;  5LJ5 j;  2XDP A;  2JTM A;  1X2H A;  4M75 F;  4P71 C;  3VYG A;  2DEQ A;  2QA4 A;  3C4S A;  1IZ6 A;  3OYM A;  2DU5 A;  2V8K A;  3CMQ A;  1VQK A;  3OS2 A;  1C0A A;  2RD1 A;  3WQZ A;  4CH3 A;  1W2B S;  4EMH A;  2PMF A;  1YIT A;  1QP3 A;  3OS0 A;  4YRC A;  3OW2 S;  4QVZ A;  3G6E A;  2LCL A;  4P71 A;  4OF1 A;  4KBM B;  2GFA A;  3OYA A;  3VBB A;  1B70 B;  2DTO A;  4RCC A;  4CH6 A;  1M1G A;  4C5E A;  3CCV T;  2ZPB B;  1VQL T;  3WVE B;  3A8M B;  4C8Q E;  4ZN3 A;  4HT4 A;  3CME T;  2PUO B;  4GY5 A;  2JVV A;  4XTU A;  2MI6 A;  1NJI U;  3FB9 A;  1G5V A;  2ZT7 A;  2Q7H A;  2NLU A;  3E19 A;  2IY5 B;  3DLL A;  5GMK e;  4JRP A;  2L5Q A;  1H64 1;  1W66 A;  1KOG A;  3A32 A;  3OYH A;  4ME7 A;  5LJ5 e;  1LJO A;  4ZN1 A;  2KQW A;  4H2X B;  3LH0 A;  3OYK A;  2MWO A;  3J81 E;  3MEY A;  2MAM A;  4M78 D;  5C52 B;  3CCL T;  5LJ5 g;  4R55 A;  1YFR A;  3O8V A;  3G4S A;  2QQS A;  3HSB A;  2FYK A;  3HXW A;  1KMM A;  1LNX A;  4YTL A;  2E70 A;  4BI4 A;  5FU6 B;  4TQD A;  3RES A;  5CK9 A;  2RK1 A;  2IY5 A;  3V7S A;  2A3L A;  2EQU A;  2RHX A;  4IUP A;  4XK8 E;  1VQ6 T;  1GGM A;  5FU6 C;  4J7I A;  3BDL A;  4XTW A;  3OYD A;  5KE3 A;  4M75 E;  1B7Y B;  4H2X A;  4A4F A;  4K87 A;  4TVW A;  3DKM A;  3QPH A;  4FL6 A;  2RHQ B;  3JCM Q;  4LDV A;  3KUF A;  1JJ2 A;  2ZZD A;  3OBW A;  1G3S A;  3KXT A;  3J80 E;  3J7A F;  4IUR A;  2DZ9 A;  2E64 A;  4PHC A;  2ZPE B;  4M78 B;  5LJ3 f;  4V2S A;  3UH0 A;  2LNV A;  3CD6 A;  4YRP A;  5CO7 A;  1N8R U;  4X34 A;  1IL2 A;  4K86 A;  4Y91 A;  4M78 C;  5GAN f;  4M78 G;  1M1K C;  2ARS A;  3CCU A;  2ZT6 A;  4X5O A;  2ZIO A;  3OYL A;  3LLR A;  3OA6 A;  3HRS A;  4XAX B;  4VUB A;  3A7R A;  5CVI A;  4A54 A;  3VJP A;  4J15 A;  3JB9 J;  2VUB A;  2RHQ A;  3BJU A;  1VIE A;  3CMA A;  1YIJ A;  5CKF A;  2Y90 A;  5FLX E;  1H4V B;  2E12 A;  2DXU A;  5D6Y A;  4BD3 A;  2EJG A;  2BIV A;  2FHD A;  4XU3 A;  4MDW A;  3PZC A;  4PJO B;  3L2W A;  3JCM e;  5GAM j;  3JB9 I;  3HXX A;  1K73 C;  3SFM A;  3JCM W;  3HXU A;  4FT4 A;  3A5Y A;  1N9R A;  4YRE A;  3T9N A;  4PJO C;  5GMK h;  3RL6 A;  4PJO G;  4J7F A;  4YRI A;  4RMO A;  1IRE B;  2K3X A;  2RA2 A;  1EIY B;  2GCX A;  3LWH A;  4OLF A;  2K5I A;  2PUK B;  4IKF A;  5LJ5 h;  1X01 A;  4M7A G;  4CS2 A;  4FIB A;  3HRI A;  3H8Z A;  3HP9 A;  2D9T A;  2CZ1 B;  2J3L A;  4Q15 A;  3RF1 A;  5J26 A;  2LQ8 A;  4YRJ A;  3CCM A;  4YRL A;  2E6Z A;  5J39 A;  1Y7X A;  3M57 A;  1N9W A;  1WYD A;  2CGH A;  3R6O A;  4ZTZ B;  3PFS A;  1UGQ B;  3CC4 T;  3JRZ A;  2C8M A;  3RKX A;  3ZBD A;  4M7D A;  5GAN 6;  4C92 D;  1UGS B;  2QDY B;  5IT9 E;  3GNF B;  1K8A C;  2HAX A;  3URG A;  3MQZ A;  2VXE A;  3NTK A;  3ZEH A;  1E1O A;  2RH2 A;  2XGT A;  1WJQ A;  4QQ6 A;  2A8E A;  3TEH B;  3L4G B;  2EIF A;  5AYF A;  1M1K U;  4PKC C;  3HFZ B;  4J6Y A;  5GAM e;  3HRK A;  4YCV A;  1Q86 C;  1WPY A;  2ZCE A;  3M4Q A;  2EJ9 A;  2GF7 A;  3L2U A;  2ZT8 A;  3SB2 A;  3IAL A;  1VQM A;  2DO3 A;  4WF2 A;  3ICA A;  1EFW A;  2RHI A;  2OAU A;  4HT8 A;  1WQ7 A;  3L2Z A;  2F5K A;  4P75 A;  1YIT T;  2K3Y A;  3JCM J;  4PJO F;  3JCM X;  4HCB A;  3ER0 A;  3L4G A;  3X20 B;  3OMG A;  4J8O A;  2L89 A;  3G6E T;  3HFZ A;  1YI2 A;  1BBU A;  5CKB A;  4C92 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...