2DTIA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, pyrophosphate and mn(2+)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
total genus 69
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dtiA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dtiA01
5LJ3f 1YFTA 4M7DF 2IY5B 1BIBA 2YHTA 4OLFA 3SWNA 4WF2A 2I4LA 4XTZA 5LJ5g 4C8QD 1X2HA 3E9IA 4G84A 3ICAA 1NYRA 2EWNA 3V7SA 4TTVA 3SWNC 4OP0A 1VQZA 2EJ9A 3JB9D 4RDXA 1JRIA 2VXFA 5GANf 3A5ZA 4EX5A 2DTOA 4N0AC 3JB9F 2CIMA 4M7DE 3R07A 2C8MA 3A7RA 3HXVA 4P75A 3JCMe 4H2VA 2E41A 4L87A 5C53B 1EIYB 3PZCA 4DQ2A 2P0LA 5GANh 3QNEA 4J6XA 4CS2A 5I21A 2ARSA 3JCMW 1M5Q1 2ZT5A 4CS3A 2I4NA 5GAN3 4C8QB 4XU0A 4YCVA 3REUA 3QO8A 1X56A 4YYEA 3JCMQ 1B70A 2DTHA 1NNHA 3L2ZA 2YLBA 4P71C 1ASYA 4V2SA 4WI1A 2ARUA 4E51A 4H2XB 1NYQA 4TQFA 3JCMc 4J15A 3V8LA 1D3BB 2DKGA 3VQWA 1WQ7A 4YRMA 3VQVA 4TVAB 3A5YA 1YB3A 3L4GB 4QVDA 4YRQA 3HFVA 1HK9A 1EVKA 4M7DG 1B7YA 2RD1A 3TEHA 3RKWA 4RMFA 2E1HA 1W66A 3ERRA 1HC7A 12ASA 2AKWB 2Y90A 1WPYA 4JRKA 4YRIA 4M77A 1HTTA 4H2UA 2PMFA 1H4SA 1EVLA 3LSSA 2ZIMA 4JUVA 4H2XA 4TQDA 3HY1A 3TEGA 1B76A 4M75A 3NEMA 3NELA 1SRYA 4HWSA 2EJGA 3FJPA 4X9DA 2EJFA 5GANe 1YFSA 4UP7A 1H641 3QSUA 3IALA 4F7UG 3V7RA 4C8QA 4NL2A 5GMKm 4H2TA 2ZZGA 11ASA 2J3MA 4YREA 4ZTUB 1E24A 3HXXA 5GMKh 1WQWA 2EAYA 3A74A 3L4GA 4WJ4A 4K88A 3JCMd 1EIYA 4J6YA 2DEQA 4PJOE 4JRIA 4YCUA 2ZNJA 4PJOC 1N9WA 4YRNA 4PJOB 2ALYB 1SERA 4TVAA 3BY7A 4ZIBA 5GAOn 1TH7A 3INZA 1M8VA 4M77E 3PCOA 4F7UA 3P8YA 4M77F 2FB7A 3LC0A 4P74C 5LJ3d 4MMKA 4RQFA 3QTCA 4HA8A 4BW9A 5DY9A 1EQRA 3QO3A 4M7AD 3JCMh 3A32A 2DXTA 1Y96B 4C8QC 5GMKj 2CJ9A 2DDZA 1C0AA 4P72C 5GAMg 3RKYA 2XGTA 5GAMh 4LNSA 4M7AE 1LYLA 3A7AA 5ELOA 4F7UB 3JCMg 1B34A 4M75G 3HFZA 2VXEA 1E1TA 2CJBA 1JJCB 1B70B 3RL6A 2ALYA 3HFOA 3I7FA 2ODRC 5GMKl 1H4VB 4YRKA 4UP9A 1L0WA 5GAOq 4C8QF 3PGGA 4MMLA 2QHVA 2ZGWA 1NJ5A 2DVEA 2E64A 1QE0A 4XEOA 4J5YA 3HY0A 3G1ZA 1B7YB 4M75D 4M75E 1Y96A 1X55A 4M7AF 2Q7GA 3TEHB 4HWPA 4G85A 1WNLA 2DZCA 4M75F 5CAIA 1BIAA 4PJOF 4M78C 1SETA 3JB9I 1NJ2A 2Q5IA 4H02A 5GAN5 1GGMA 2PMEA 4Y91A 4ZTZB 5F5WA 3P8TA 2FYKA 3REXA 3CMQA 1BBWA 2ZZFA 3WQZA 4M77B 3RKXA 3V8KA 3BW1A 2AKWA 3HTZA 2ZT7A 4PHCA 2P5IA 3UFGA 1H4QA 3HRIA 1H4TA 1N9SA 2RHSB 4YROA 3VQYA 2ZR2A 2VC8A 1Z7MA 5GAOr 3M4QA 4C92D 4DPGA 2AMCB 4M77G 3HRKA 2K57A 3HXWA 1I81A 3P8VA 2ARTA 5LJ5j 2C7IA 2Q7HA 4XTXA 4M7AG 3BJUA 1WLEA 1E22A 3KFUA 4A53A 4YRCA 5E3IA 4M78B 4XTYA 3VU3C 1LOJA 4A54A 4EMGA 4RCCA 5GAN4 3IKLA 1USYC 4O2DA 4NCXA 2DJZA 4H2YA 4P73C 4M7AC 3NENA 3M4PA 4Q6GA 4M77D 3RERA 4P71A 3QHSA 4M78G 2AMCA 3HXYA 4XU3A 4C92C 1KQ2A 4AH6A 2RHQB 4PG3A 1N9RA 4H2SA 3RGLA 4XU2A 4CH6A 4YP0A 4CH5A 4M7DB 2DXUA 4YRLA 1RIQA 2DQ3A 2QHTA 4P3NA 4PJOA 5LJ3j 3A7UA 3IKMB 4TVWA 3UH0A 5GAOp 2E5AA 3A31A 4RQEA 4XQ3A 2DU5A 1I4K1 4KR2A 3JCMb 4M78D 3NETA 1YCYA 4M78A 4TWAA 2ZXFA 4QVCA 4EMHA 1KQ1A 4EO4A 4YDQA 4M75C 4F7UE 4XEMA 2I4OA 2JN0A 4M7AB 1B34B 5KNNA 3IG2A 4F7UF 4N0AA 4TVYA 1ATIA 4J6WA 4NOYA 1WYDA 1JJCA 4C92B 4UPAA 5GANg 4EMKB 5GAMd 4HT9A 3VBBA 1EFWA 1LNXA 1D3BA 4YCWA 2ZINA 2ODRD 5GAMe 3SB2A 1KMMA 4M7DC 1JBMA 4HWRA 1HXDA 2QTXA 1I5LA 1ADYA 5LJ3g 4YRSA 5LJ5f 4CH4A 5GMKe 4UP8A 4C92G 2CGHA 2ZT8A 1IL2A 5GMKi 4HWOA 1SESA 2E65A 4XTWA 5LJ5h 1X54A 1J5WA 1YFRA 4K87A 4EMKC 4P3PA 2E10A 1I8FA 1ADJA 4C92E 3JCMP 2DZ9A 3UGQA 5GANj 4HWTA 4XTUA 5GAN2 4EMKA 2Q5HA 2IY5A 4C92A 3JB9J 1ASZA 3VQXA 1KOGA 3L1AA 5LJ5e 4PJOG 4JLIA 2QHSA 4P74A 3V7CA 2DQ0A 1G51A 1QF6A 4M7AA 1KMNA 1YGBA 3MF1A 4YRFA 2ZT6A 2RHSA 1WU7A 3RACA 3JCMJ 4P72A 3DSQA 2E3CA 4P73A 4HVCA 1B8AA 4PJOD 4X5OA 3RIRA 4WJ3M 2RM4A 5GAMj 5LJ5d 5K1XA 5GAN7 3RF1A 1BBUA 3HFZB 2ZCEA 3EFRA 3LSQA 2Q7EA 1NJ1A 4RCBA 2XTIA 3FB9A 2DU7A 4P3OA 1USYA 1NJ8A 5GAN6 4CS4A 3BDUA 5GAMf 4XTVA 4YRGA 2ZNIA 2RHQA 3TUPA 2I2LA 3E9HA 3V8JA 2I4MA 3QO7A 3JCMV 3JCMf 2ZZEA 4KQEA 4M78E 2QHUA 5GAOm 3M4GA 4M78F 3JCMX 1FYFA 5LJ3e 2HNIA 3JB9G 4PNOA 1Z7NA 1X01A 4NL3A 1U1SA 5GANd 4M7DD 2G4CA 4C8QE 3QO5A 4YRPA 3UGTA 3FIFA 1EOVA 1X2GA 4P75C 3HSBA 2EL9A 2RB6A 4YRJA 4K86A 1E1OA 1PYSA 3JB9H 3HXZA 4M7DA 4YRRA 2YLCA 5C52B 4H2WA 4BWAA 3BFMA 4YPFA 5C51B 1MGQA 3AHUA 1NJ6A 1LJOA 4M75B 5GAOl 3HXUA 2J3LA 3GIBA 5K1PA 3RUXA 4CH3A 2CJAA 4YRTA 3PCOB 3SWNB 5HGQA 3MF2A 3QUIA 4X9CA 5ELNA 1G5HA 4C8QG 4C92F 1U1TA 5GAN8 4KR3A 2RA2A 3OD1A 2ZTGA 3EFSA 2ZR3A 3W3SA 3RESA 4M77C 5LJ3h 4HT8A 3MEYA 4Q15A 4XU1A 3HFNA 2DTIA 1PYSB 2ZIOA 1G5IA
chains in the Genus database with same CATH superfamily
5LJ3f 4M7DF 5HKCA 1BIBA 4LE9A 2BE7D 4IURA 3CPFA 5GJWB 1X69A 4FYVB 3CCQQ 2YRVA 1X2HA 2K2MA 1Z9ZA 3E9IA 4G84A 3CCLQ 2BTTA 1VQKT 1NYRA 3PFSA 1VQZA 1KHIA 3JB9D 4RDXA 5GANf 4KH0B 1NJIU 4M7DE 1JEGA 3A7RA 3JCMe 1KQSS 2E41A 2VGMA 3OS5A 1CSKA 1GFDA 1XOVA 3PZCA 4PFZA 4C0ZA 2P0LA 2ROTA 2K5FA 8AT1B 4X34A 4LDXA 2ZT5A 4OMLA 3OMGA 4CS3A 4PLLA 4J9IA 2HQEA 3J80E 2PTKA 3FC3A 1UTIA 4C5IA 5IXFA 4OVAA 1ZA2B 1RAFB 1VIFA 3JCMQ 2O01E 4P71C 3CCQA 4E51A 3GF5A 2V8JA 4J7FA 2B86A 5IH2A 1FMWA 4J15A 3V8LA 2DKGA 2EGCA 3VQVA 2B8AA 1YB3A 2D8JA 1Q7YC 3TVTA 1SSHA 1EVKA 3DB3A 4JJDA 3M0TA 3OS1A 1QCNA 3TEHA 3RKWA 1VQLT 1VIEA 3I55A 2JM9A 2Y90A 4YRIA 1HTTA 2JZ2A 1VQMA 3NGPA 4JUVA 4H2XA 1UB4A 1X43A 1SRYA 4HWSA 3FJPA 1X2QA 1M4ZA 2KY9A 5GANe 3A8LB 2EQIA 4F7UG 3GNFB 1V1CA 1N27A 4ELZC 1HD3A 5EC7A 4ZTUB 3LW5E 2Y4XA 5GMKh 2XKOC 4K88A 3G1JA 3G6ET 4J6YA 1EIYA 2HCKA 4PJOE 1W1FA 2ZNJA 2DL8A 4YRNA 2XMFA 4ZTJA 4FCYA 1SERA 1VQ9T 4BE1A 4ZIBA 1LCKA 2R5AA 1NJIR 2OTJA 3OBWA 1SHGA 2IG0A 2GQVA 4IKFA 2K3YA 4P74C 1KFZA 4MMKA 1ZSZC 3QTCA 3CPWS 4KRTA 3X20B 3QO3A 2LCSA 3JCMh 1CKBA 5GJVB 3A32A 5GMKj 2CJ9A 2DDZA 1I1JA 2ZPHB 1BI2A 4P72C 1R8OB 5HY6A 2LZ6B 2JS2A 2XGTA 1PHTA 3CC4T 1OOTA 4LNSA 1ZBXA 1MNEA 3A7AA 4F7UB 2DX1A 1BI0A 1QLYA 3E1SA 4AFZC 4PJLA 2NUZA 3CEYA 3CMAA 2CJBA 1JJCB 1VQ6Q 1VQOA 5I2SA 3RL6A 1QVGA 1WXTA 1AWJA 4ME7A 3SHWA 1ACMB 1PKSA 3M53A 1XTDA 2FL7A 3CCMT 2F69A 3BE3A 4UP9A 4CC4B 1L0WA 2M0YA 5GAOq 3PGGA 2KXCA 1D1AA 4MMLA 4YTLA 2CP5A 2VWFA 1BI1A 4ZGJB 1QE0A 1WFWA 2XG8D 3KUFA 1VA7A 2PUOB 3TSWA 3CXCS 4E7KA 3TEHB 3OW2S 1X55A 4G85A 2DZCA 4M75F 4PK4A 5CAIA 1A0NB 1VQMQ 1K8AC 2GF7A 3QJYA 4Z02A 1YJNA 4ZTZB 1MUZA 2BZ8A 4JJCA 3REXA 3C12A 1BBWA 1ZLMA 3M0PA 4M77B 1UGSB 2K6DA 2AKWA 4O6JA 4BACA 3UFGA 5IT9E 3EG2A 1H4QA 1H4TA 2RHSB 2AZSA 5GAOr 1YJWT 4DPGA 2KK4A 2P0QA 4E7SA 1QVGS 2K57A 4IUVA 1I81A 2AMCB 3HRKA 3P8VA 2C7IA 5LJ5j 4WTOB 4FM4B 2DL3A 1E22A 4ZTFA 3OYFA 3KFUA 2DFUA 3LGLA 2KYBA 2ZPBB 2DRMA 1YJNT 3MP8A 4M78B 4XTYA 4A54A 5CVIA 5ECAA 2EYQA 5GAN4 4ZGDB 2KI7A 4P73C 4M7AC 3NENA 4Q6GA 4B9XA 1G5VA 2RHYA 3RERA 3HXYA 1N8RC 2XK0A 3EG0A 4PG3A 3GP8A 2RMOA 1ZUUA 3H8ZA 2DBKA 5J39A 2DXUA 4YRLA 1EX4A 2KMTA 1Q82U 1BCMA 1Q86U 4FSXA 1VQ5T 2WSFE 3CQTA 1AWXA 3EGDB 3CCST 3UH0A 3A31A 1T3LA 4XQ3A 1I5OB 1U8RA 1YCYA 1KJWA 3QZ9B 4M78A 4TWAA 2ZXFA 4YDQA 1KD1U 2K79A 4XEMA 5DLOA 1B34B 5KNNA 1JB0E 4N0AA 4TVYA 3JV3A 4NOYA 1WYDA 1JJCA 4MZTA 5CCAA 4EMKB 2YRCA 4OB2B 2KQWA 1D3BA 4LNPA 2CUDA 2QASA 3VUZA 2RHXA 3R6NA 5FU6C 1ZA1B 5FU6B 1I5LA 5LJ5f 5GMKe 2ENMA 1WJQA 1KSWA 3CD6T 2EVRA 2J05A 1UE9A 3FDRA 2MCNA 1X54A 2ED1A 3G4SA 1RI9A 4E2FB 2QK0A 4CRIA 1ADJA 1D0XA 3OYCA 1QVFS 4C92E 1GRIA 2ATCB 2DZ9A 2PQWA 1IB8A 3OYJA 1K1ZA 4XTUA 4KUIA 4A63B 3O5ZA 2OTLT 5HK0A 1K73R 2Q5HA 1TUGB 2MWOA 1YJ9T 1ASZA 3L1AA 3L42A 2QHSA 2K5IA 2A3LA 3V7CA 4M7AA 1VQNT 3MF1A 1WDXA 4A4GA 3L2WA 1VQOT 3D7SB 2ZT6A 2OTLQ 1M2VA 3JSCA 3JCMJ 4AMCA 2K2VA 2D0NA 3CMET 4HVCA 3IQLA 3RIRA 3EFOB 2RM4A 1Q82C 1Q86C 2QQAA 2V8IA 3EFRA 3LSQA 4MZPA 2EQJA 2DU7A 2EQKA 5GAN6 3X28B 2WACA 2JMCA 2HEQA 2DXBA 2WSEE 3QO7A 5FRNA 4HCKA 1C0MA 5FRMA 2X3WD 3JCMf 4KQEA 4BI8B 1WHLA 1Q82R 1Q86R 5GAOm 1VQ9Q 1FYFA 2COWA 3PIPA 1N5ZA 1JU5C 4NL3A 1YP5A 3R6OA 3J7AF 2JXBA 4F04B 2G4CA 1M1KR 1EOVA 1X2GA 2PVDB 1VQ4T 2EL9A 4YRJA 4K86A 3CCSA 1QKXA 4Q5WA 3H41A 2X4XA 2ZCFB 3OYMA 2V1RA 3OSVA 2M02A 2KT8A 4OB0B 3BFMA 1AWOA 4YPFA 4BWAA 4BI3A 3OYDA 2ZPEB 1D1BA 1AZGB 3UA6A 1NJ6A 4IUUA 2J3LA 5K1PA 1OEBA 2CZ6B 2NWMA 4HCZA 4YRTA 4JZ4A 3PCOB 1BB9A 3JRZA 2R5MA 4BB7A 3QYHB 1RUWA 3F70A 2RJDA 3ER0A 4C92F 1KC8U 2RA2A 2ZTGA 3ZFJA 5D7UA 4Z89A 2ZR3A 2GQIA 3RESA 4M77C 2COZA 4HT4A 4J9HA 1TUDA 3MEYA 4Q15A 4KULA 4DBQA 3HFNA 1VYVA 4LDWA 1G5IA 4RTUA 1YFTA 1VYTA 2YT6A 4PJJA 3VS6A 2YHTA 2KRMA 3SWNA 3E9GA 1ZBJA 2RHIA 2C0IA 3I35A 4FW1A 4AFSC 2AIRB 2HAXA 3CCRT 1MMGA 4TTVA 3SWNC 4AFQC 2KR3A 4IIOA 3A5ZA 2DTOA 4N0AC 3JB9F 2CIMA 3CBMA 3R07A 2HZYA 2RJCA 5C53B 4L87A 2K5LA 3MQZA 3OYGA 2YRDA 1SRLA 2E12A 5I21A 2ARSA 3A1PA 3OYIA 3X26B 1FXXA 1VQLA 3E19A 1M5Q1 2O31A 1M90C 2LC4A 3UATA 2R58A 4YCVA 3KBGA 3QO8A 1X56A 4YYEA 2MMPA 3T9NA 2IPOB 1PD1A 1SHFA 4FT4A 3RMQA 4WI1A 5KYYB 2FEIA 2CSIA 1YJ9A 3SDZA 2FZCB 1UDLA 2MPXC 3G7ZA 1WQ7A 4BE2A 2QYZA 1VQLQ 3VQWA 4YRMA 2K7AA 1PM3A 3L4GB 1OPKA 2LT4A 4QVDA 4YRQA 1VQ9A 1R77A 1PG5B 2E5QA 2RD1A 3I9QA 3NFCA 3JAME 3ERRA 2QGFB 2X4WA 4LVIA 5CK9A 4JRKA 2LCLA 1YN8A 4H2UA 2XHCA 5DM7R 5I11A 2NS6A 3LSSA 2X9HA 2X35A 3M0UA 2QTVA 4M75A 3CC7T 4JJNK 2X51A 2RHUA 2E6NA 2HQXA 3QSUA 1VQPA 3IALA 3GLXA 4NL2A 2KRSA 5GMKm 1WIEA 2LT1A 3EG1A 4H2TA 2XIDA 1KD1C 11ASA 1J3TA 2RHZA 1K76A 2CS7A 1HSQA 3JCMd 2EKOA 3CCEA 2GCXA 4JRIA 2JS0A 4PJOC 3CCET 4LVJA 3TQ7P 5D6YA 4PJOB 2V26A 1M30A 4FYYB 6AT1B 1YBYA 5GAOn 2EPDA 2QEXA 1VQ7Q 3INZA 1S72T 3PCOA 4TVRA 1RI0A 3VYHB 1YHQQ 5KCHA 4M77F 2OAWA 4QW2A 2L8DA 2RF0A 3X25B 1NYFA 1UGRB 5DY9A 1S72Q 4C5GA 4M7AD 2QAZA 3H9NA 1OYXA 2DXTA 1C0AA 2MK5A 1NYGA 5L8RE 2CT4A 2O2OA 1X6BA 3QWYA 1E6HA 2A36A 2LQWA 4LD6A 3RKYA 3SEMA 4F17A 3LGFA 2PVGB 1MMNA 2DIGA 2EKHA 3WXMB 3AT1B 5ELOA 1NZ9A 1TWBA 2RQRA 1M90R 2JW4A 4M75G 5D6WA 1KC8R 3HFZA 2VXEA 2GFAA 1K8AR 4Y92A 3OA6A 4B6MA 3CMEQ 2EQMA 2CP6A 2ALYA 1OI1A 3HFOA 3X24B 2ODRC 2DVJA 1H4VB 5FU7B 5KYXA 2QQSA 3META 2DL7A 2KROA 3SD4A 1NJ5A 3I56Q 1W6XA 1U5SA 4J5YA 2ZPGB 1YJWA 3Q1JA 3CCLA 2DYBA 1B7YB 1Y96A 4M7AF 4HCBA 4A4EA 1WNLA 1BIAA 4PJOF 4M78C 1K0SA 5FWCA 2Q5IA 2LQ8A 1GGMA 4II1A 2O4XA 3QIIA 4ELYC 2X3XD 1TSFA 2COYA 3MHXA 2GTJA 4GLMA 2MAMA 4MZMA 2ZR2A 2VC8A 3M4QA 4C92D 3PNWC 1D0ZA 5AYFA 4FYXB 2AHJB 4LDVA 4PKCC 1UEBA 4J8OA 3OBYA 1WLEA 3L2VA 2X4YA 5E3IA 2FHDA 3O8VA 4LVLA 1ZUKA 1LOJA 1TXQA 2VV5A 4CI0C 2O9VA 1USYC 4O2DA 4NCXA 4RTTA 4H2YA 2LNHB 4RG8A 4C0DC 4LDUA 4M77D 4P71A 2QA4A 3QHSA 2BKDN 4M78G 2AMCA 1WGSA 4XU3A 2Z0WA 2DPPB 2RHQB 2QA4T 1IRXA 1Y57A 3RGLA 2WSCE 3SFMA 2CYZB 3OW2P 4JRPA 2DQ3A 3OYHA 4P3NA 1FYNA 1AD5A 5LJ3j 3RDVA 3OYAA 3IKMB 1K73U 4TVWA 2RJEA 3HTRA 5GAOp 4JRQA 4HCCA 4KR2A 2JOYA 3NETA 1TTHB 3M5AA 4FT2A 1IZ6A 1NLPC 1KQ1A 2FPEA 4JLGA 4M75C 2VASA 2JN0A 2F2XA 2I4OA 5D6XA 3LLRA 2JTMA 1ATIA 2VUBA 4C92B 1C6VX 1YI2T 3CBOA 5J3BA 2JTFA 4YCWA 3CD6Q 1JQQA 1G2BA 4RKUE 2VGNA 1HXDA 2QTXA 1ZSZA 5LJ3g 4CH4A 1TG0A 2ZT8A 1IL2A 1YITT 5HK3A 1Q7YU 2O88A 3CCQT 2XICA 3QKJA 3CCLT 1KD1R 1OX9A 2E10A 1T0HA 1Q81R 5C6SA 1SKUB 1K4US 1OX8A 3UGQA 5GANj 3ULRB 1VQNQ 1LVKA 3MPUB 4HWTA 2KDSA 1DJ7B 4CC3A 1KOGA 2L3PA 1V29B 4PJOG 1Y7XA 4JLIA 2XD0A 4P74A 5FU7C 2DQ0A 1G51A 3C95A 2E4HA 4YRFA 2CP2A 4E6RA 2RHSA 2A08A 3L2UA 3I56A 3EHQA 2MF2A 1VQMT 3MP6A 1E7OA 3CC4A 2OJ2A 3GNGA 3S6WA 2NLUA 1VQKQ 4RTXA 3EG9A 1C1AA 1RLQC 2M1HA 2E3CA 2ZPFB 3HRUA 1B8AA 4GBQA 2JVVA 5K1XA 3RF1A 1WHHA 3HFZB 3CCMA 1Y0MA 2YUOA 3EGXA 1ZX6A 2V8KA 2XTIA 2CZ7B 1USYA 1X2KA 4OMNA 3VUBA 2GBQA 1P92A 5GAMf 1M1KC 2F5KA 1ZHIA 1VQ8Q 2ZNIA 1QW1A 1WZOA 2RI2A 3N5BB 1G3WA 2E3IA 1G83A 4M78E 1WHJA 2RN8A 4D8DA 2QI2A 2HL3A 3JCMX 5CKBA 2FG0A 1JJ2A 3UWNA 5A0GA 5LJ3e 4PNOA 2E3HA 1Z7NA 2P4TA 3CCJA 4YRPA 3FIFA 3NTKA 4P75C 1QP2A 3QXEB 3KXTA 1KG1A 2HD0A 4PFPA 1Q81C 3OS0A 2DJQA 5IAYA 1PYSA 1RAIB 1MHNA 4M7DA 3G6EQ 4BDZA 2XDDA 2YUPA 2YLCA 2K4YA 3GBQA 5C52B 1JJ2S 2XU8A 4AFUC 2RH2A 3EGXB 3NMZC 3M58A 5A0DA 4C5HA 3ZEHA 5GAOl 3HXUA 4GLKA 3OYNA 3CCJT 2CZ1B 1K73C 2OTJQ 1ARKA 3UPUA 2FPFA 4Z88A 3SWNB 4OB3B 5HGQA 3OYBA 1RAAB 4X9CA 5ELNA 2BE9B 1G5HA 1QCOA 2J6KA 2X4JA 2FZKB 4KR3A 3HKSA 2JUFA 2NUPB 1NPPA 3W3SA 2JMAA 5KYUA 1OV3A 3QWXX 2KSSA 3TU4K 4JJBA 3A8OB 1XJWB 2DTIA 1PYSB 5A2QE 2IY5B 2HBWA 4IUTA 4QQ6A 4WF2A 2M51A 3LWIA 2I4LA 1VQ6T 4C8QD 1RADB 5KYYA 5FW9A 1WJSA 1UJYA 2EFIA 2ESWA 2NYSA 4E7ZA 2KT1A 3P8HA 3MCAB 2EWNA 1VQNA 2EJ9A 2L3QA 1UJ0A 1JRIA 2D9TA 2VXFA 2C8MA 3HXVA 1QVFP 4WCIA 1G8XA 3CPWA 4OF1A 2NUPA 1IGUA 5GANh 3QNEA 2H3EB 3M9QA 3M54A 4IUPA 3UF4A 3VS2A 1VQOQ 1ABQA 2HSEB 3OMCA 5GAN3 1U3OA 1GCQA 4LXCA 2JTEA 3REUA 2DIQA 1IHVA 1VQ7A 1AZEA 2ED0A 2CUBA 4D8KA 4ATOA 1B70A 2A37A 2DTHA 3L2ZA 4V2SA 2DE0X 1SSFA 3MEUA 3LH5A 1N6AA 3QBYA 1BU1A 3HFVA 1HK9A 1UGPB 2PU9B 2DNUA 1MMAA 4ESRA 1O75A 2CREA 3PVLA 1YIJA 1XNIA 5CKDA 4KGVB 3ME9A 1HC7A 12ASA 1WPYA 1QCFA 2C06A 2PMFA 1H4SA 4R56A 3P8BB 4Y28E 1VQ8A 3MEAA 1EVLA 2ZIMA 3CXCP 2GNCA 1B76A 2ABLA 1H3HA 2DM1A 3QDFA 2FRYA 2M0OA 4HVVA 4AT1B 2EJFA 4HVUA 2L89A 2MIOA 2RJFA 1AVZC 4KUDK 2KYMA 2M16A 2LDMA 3TREA 2PNIA 2J7IA 4C8QA 1ZSZB 2LX9A 1WQWA 3A74A 3ZBDA 1UUEA 1G3YA 4YCUA 2YUQA 3CMAQ 3L2RA 2ALYB 3CCSQ 1NJIC 3TEEA 1KK7A 1TH7A 2P0KA 4ORZA 1YFNA 3LYIA 3G4ST 2YSQA 4J7IA 4M77E 1EFNA 5CQXA 3NTIA 3EG9B 1UG1A 1RACB 2FB7A 3OSSC 1QVGP 2DERA 3CPWP 2P4RA 4BW9A 3G4SQ 1EQRA 1VQ4A 4DBFA 2KBTA 1QWFA 1V76A 1Y96B 4C8QC 4FU6A 5GAMg 2RQWA 3CBPA 1YJ9Q 2LMJA 2F1LA 5GAMh 4KGXB 4J9EA 1U06A 5L23A 3OW2A 2E70A 1B34A 1WX6A 3UDCA 1WXBA 1JXMA 3OYEA 2RI3A 2JJ9A 1X75C 5KYWB 3I56T 2RK2A 3M0SA 2BUDA 3OYYA 1QQJA 3WVEB 4E7HA 1N8RU 1VQ5A 4C8QF 4ANJA 2ZGWA 1ZSGA 3EHRA 1YWOA 2DVEA 2CDTA 2E64A 3FLGA 3DB4A 5AT1B 3VS3A 2BZYA 2JM8A 1CKAA 2KXDA 3G1ZA 4M75D 3GOXA 2Q7GA 2PZ1A 4HWPA 1VQPT 4PJMA 1JXOA 2XDPA 3JB9I 4C0GA 5GAN5 2PMEA 4Y91A 1SEMA 4Z8AA 2FYKA 3CCUQ 1PKTA 1AWWA 3WQZA 2HL5C 1VOMA 2QGGA 4PHCA 2C0TA 2P5IA 2AT1B 3VRZA 2FVUA 1N9SA 1QMCA 2QEXT 3VQYA 3DLMA 1QWEA 2LJ0A 4M77G 3HXWA 2Q7HA 1I0CA 1WI7A 4C0FA 3BJUA 2QEXQ 3I5SA 1BBZA 4YRCA 2RNAA 4EPCA 3PMTA 4BE0A 4AG1C 5CKFA 1NE8A 1PNJA 4RCCA 3IKLA 1YI2A 2QG9B 4QQGA 1OZ2A 4E47A 2DL4A 4PL6A 2ZAEA 4DOWA 8ATCB 2RK1A 4C92C 4EDUA 1KQ2A 2HMAA 4L59A 5M9OA 1N9RA 4XU2A 3CD6A 1YITA 1RIQA 2QHTA 4J83A 3REBB 2DRKA 2W10A 3FEOA 3PT9A 4EIKA 1QKWA 3A7UA 2H3JA 2E5AA 4RQEA 2EYZA 2E5KA 3JCMb 2FRWA 1TUCA 2XI9A 2RQVA 4EMHA 3EGUA 3CC4Q 4QT7A 2HSPA 2AK5A 4KT0E 4F7UE 4E7IA 3L2QA 3IG2A 3VRYA 2QQRA 1NPRA 1VQ6A 4J9DA 2DETA 4HT9A 5GAMd 3M57A 1LNXA 1AEYA 2VKNA 3LH0A 3THKA 4LUDA 3RNJA 3CCMQ 2ZINA 2ROLA 5IN1A 2R57A 1IHWA 1KMMA 4M7DC 4HWRA 4YRSA 2YXYA 1NEBA 5GMKi 4HWOA 2CH4W 2E65A 4LVMA 5A0LA 4XTWA 4NS5A 1SG5A 5CKEA 3VS0A 3CCRQ 3M4YA 4EMKC 1FMKA 2LJ1A 1PRMC 3M59A 1KQSP 4OB1B 4GY5A 2LQNA 1M1FA 1M2OA 4DA4A 1G3TA 2L5QA 2C0OA 3A5ZB 4XAXB 4C92A 1GCQC 3JB9J 3HPWA 1KMNA 2VB6A 1HJDA 1YGBA 1QP3A 2KAFA 5IXBA 1PCXA 3NTHA 3VKIA 4R0KA 4P73A 1X6GA 4PJOD 4X5OA 2HQHA 4QVZA 1UGQB 2CSQA 5LJ5d 1VQ8T 5GAN7 1YJNQ 5HCKA 1M3BA 1BBUA 2ZCEA 4RMOA 2LJ3A 9ATCB 1NJ1A 2A28A 1UFFA 1ZQ1A 2O4XB 2DA9A 4P3OA 4CS4A 3BDUA 4XTVA 1YJWQ 2RHQA 3JCMV 2A8EA 2ZZEA 2V1QA 3CMAT 1PSEA 4B9WA 1VQKA 4L5GA 2M9UA 3EFOA 4XK8E 4M78F 1YNZA 2KNBB 2ECZA 1M2VB 4AG2C 2LTOA 3QO5A 4QQDA 2D6FA 4HKEA 1FX7A 4RTYA 2NUTA 3G71A 2EW3A 3HXZA 2DMOA 2EBPA 3VJPA 3G71T 4HVWA 3VS1A 1K9MC 5IHIA 3RBBB 1MGQA 3CC7Q 1WHGA 1H92A 1MMDA 2MYSA 3GIBA 3RUXA 4CH3A 4DEXA 1MV0B 3OY9A 1NLOC 1IO6A 2L0AA 2L2PA 1WHKA 2CJAA 3TCJA 1M3AA 1RL2A 1SPKA 3MF2A 1YCSB 3QUIA 2CZ0B 4IIMA 3PTAA 2HKQB 4C8QG 1K8AU 1MV3A 2DAQA 3UT1A 2GGRA 1D1CA 1PRLC 5LJ3h 2LQKA 1KC8C 2J6OA 5FROA 4HT8A 4OMMA 3CC2A 2ZIOA 1KIKA 2QQBA 3A8GB 3A98A 4L6V5 2D1XA 2BZXA 4FIBA 1B07A 5LL6S 4OLFA 4RTWA 4XTZA 1T3SA 1M9SA 1M8MA 5LJ5g 4JS5A 1QVPA 3EG3A 1IXDA 2RI5A 2G3RA 2DYIA 3ICAA 2L3SA 3V7SA 4OP0A 3NPFA 2H8HA 2I0NA 3HRTA 4KGZB 1R0BG 4EX5A 4K11A 4P75A 3HRSA 1EIYB 4J9BA 4H2VA 4HXJA 4DQ2A 2OI3A 1NBEB 3EH1A 4J6XA 4CS2A 1VUBA 1M1KU 1AHJB 1RAGB 3TSZA 1M1GA 3JCMW 3S3OA 1MNDA 2I4NA 5EG2A 4C8QB 2FZGB 4XU0A 4KBMB 4X1VA 1WJRA 3OB9A 1HYOA 2HDAA 5KYWA 3H0HA 1K9MU 1NNHA 1RABB 3CXCA 2YLBA 1ASYA 2ARUA 4H2XB 2YDLA 2J06A 1BYMA 3JCMc 1NYQA 2EYXA 3RR6A 2DBMA 4TQFA 2QDYB 4M4ZA 1D3BB 2GTOA 2DL5A 3VS4A 2DILA 4TVAB 3A5YA 3HHTB 2LP5A 5IHNA 3S3NA 4LN2A 1PC0A 4M7DG 4ZNXA 3FJ5A 1B7YA 4RMFA 2E1HA 1W66A 2MOXA 2RPNA 3C94A 3ASKA 2AKWB 4M77A 4DBRA 2YWWA 2NUTB 3P8DA 3I55T 4TQDA 2LVMA 1WHMA 4LVKA 3HY1A 3TEGA 3NEMA 4C5EA 3NELA 3CCVQ 2YUNA 2EJGA 2KGTA 4OGCA 4X9DA 3M0QA 3M0RA 3MKDA 1YFSA 3I55Q 4UP7A 4A4HA 1H641 5IHKA 4P5NA 2P84A 3BDLA 3V7RA 2QA4Q 2ZZGA 2J3MA 4YREA 4WJ4A 1E24A 3HXXA 3L4GA 2EAYA 1EZZB 1XQHA 1WA7A 2DEQA 2ZPIB 3KFVA 3DLLA 3RMSA 3MO8A 1N9WA 3M56A 1RAEB 2HKNA 1UECA 4N4GA 4TVAA 1RAHB 1PWTA 1Y07A 2D8HA 3BY7A 1W4SA 4JDSA 3QJ6A 1M8VA 3H0IA 4F7UA 3CCJQ 3GPLA 3P8YA 5FWBA 2DLPA 2W0ZA 2OTJT 1Z9QA 4FYWB 3LC0A 3OS2A 5LJ3d 5CQYA 4RQFA 1B3QA 4FSSA 4HA8A 1VQ4Q 3EH2A 2QXFA 3S3MA 2O9SA 2K3BA 1ZUYA 3G6EA 3C4SA 4F14A 1X6OA 2CP7A 1Q81U 4M7AE 1LYLA 1BI3A 3JCMg 1OULA 2EYWA 1YITQ 2CP0A 1E1TA 1RLPC 2P0PA 2RQTA 1B70B 1PD0A 2PUKB 4KH1B 4N4HA 4LD9K 4OGEA 3VV0A 3I7FA 2AKLA 5GMKl 4YRKA 1D0YA 1OU8A 2FPDA 2QHVA 4FW2A 1VQPQ 1SRMA 4CC7A 3PVQA 1H3ZA 3MP1A 1LPLA 4XEOA 3HY0A 3ZL7C 5KE2A 4M75E 4MDWA 2EIFA 1GL5A 2VVKA 1PSFA 3CCUT 1VYUA 1WLPB 1FWZA 1NM7A 1NG2A 1SETA 4D6WA 2LX7A 1NJ2A 1GCPA 4H02A 2L3RA 3WVDB 5FLXE 5F5WA 3QG1A 1QVFA 3P8TA 3CMQA 3NHNA 2ZZFA 2IIMA 5KCOA 3RKXA 3V8KA 3BW1A 3HTZA 3E9FA 3REAB 4BI4A 2ZT7A 2K9GA 3VS7A 3HRIA 5KYXB 4C0DB 4YROA 2IVWA 2BIVA 1BCOA 1Z7MA 1AT1B 1WYXA 1M3CA 3G71Q 1FMVA 4ZGEB 2ARTA 2VYTA 2HBPA 3M55A 4OMQA 4XTXA 4M7AG 4DEYA 2F2VA 5CIUA 3EGDA 2EYYA 4A53A 4BY6B 2JT4A 4FL6A 1T0JA 3VU3C 2GFUA 1BKBA 2ZZDA 4OMPA 4EMGA 5CKHA 3HL8A 4JS4A 3CCEQ 2DJZA 4IUQA 1ABOA 2DO3A 3M4PA 2D0QB 3A8MB 2CKKA 4AH6A 1IREB 1D09B 4H2SA 5KYNA 3QYGB 4CH6A 4YP0A 1TS9A 4CH5A 4M7DB 4ZN3A 3LWHA 2DD5A 1G3SA 3QDRB 3I5RA 1YIJT 2EGEA 4PJOA 5CR2A 3H0FA 2DK3A 2OX7A 2SRCA 4JPBW 2DU5A 1I4K1 1H8KA 4A4FA 4M78D 1UGVA 1YIJQ 4OMFB 4QVCA 1VQ5Q 4EO4A 2CP3A 1OPLA 4LDYA 4UC4A 4M7AB 4DOVA 5I2MA 4F7UF 1KQSA 4J6WA 1I07A 4OMOA 4UPAA 5GANg 3VBBA 1EFWA 2ODRD 2XDBA 1IGQA 5KYUB 3VYGA 5GAMe 1BK2A 4J9GA 3SB2A 5C0MA 1JBMA 1Q95G 4RG2A 3H6ZA 3MEWA 1M27C 1ADYA 1S1NA 4UP8A 3OYKA 4C92G 4BDYA 4PLIA 2CGHA 3C0CA 4JZ3A 2DXCA 1OQKA 1SESA 1UHFA 1VQ7T 3HP9A 2KEAA 5LJ5h 1S72A 1J5WA 3URGA 1YHQT 3QZ5B 1YFRA 4DBHA 4K87A 1M90U 2DD4A 4ZN1A 3VS5A 4P3PA 1I8FA 1OZ3A 1YHQA 4PFOA 3JCMP 3OYLA 2DEUA 4BD3A 3U23A 4J9FA 5GAN2 4EMKA 1Q7YR 2IY5A 4RTZA 3VQXA 5LJ5e 1TU0B 5KH6A 3CCRA 1QF6A 1WXUA 3PE0A 4VUBA 2LCCA 1WU7A 5J26A 2MI6A 7AT1B 1W2BP 1W2BS 1GBRA 3RACA 1KHCA 1JJ2P 4P72A 1W70A 4A4KA 3DSQA 3LX7A 4WJ3M 1SF9A 2KE9A 3CCVT 2AKKA 5GAMj 3J81E 5DLQE 1YWPA 3PMIA 5CO7A 1Y71A 3CMEA 4J9CA 2AZVA 3CCVA 2Q7EA 4RCBA 3FB9A 2SEMA 1NJ8A 2RQUA 2J6FA 4QKUA 4YRGA 2QDLA 3TUPA 2I2LA 3DKMA 3E9HA 3V8JA 2I4MA 2JNGA 2F5TX 1E6GA 4LUEA 2QHUA 1UHCA 5I22A 2OTLA 3MJXA 2KVQG 3M4GA 1X27A 3PIOA 1GXIE 2RO0A 3OQ5A 2HNIA 3JB9G 1NEGA 4O5VA 1X01A 1U1SA 5GANd 4M7DD 1EIFA 3MEVA 3E2UA 4C8QE 1JO8A 3UGTA 1GFCA 1OU9A 2DF6A 4BY6C 4F16A 2EGAA 3HSBA 2RB6A 2G6FX 3CC2T 1E1OA 3QPHA 3JB9H 3A8HB 3EAEA 1K0XA 2A7YA 1AOJA 2FO0A 4YRRA 4H2WA 2CT3A 1YI2Q 1R0CB 2A0FB 3CC2Q 4MDXA 5C51B 2Y4YA 3AHUA 1LJOA 2OAUA 2QQ9A 4M75B 3CCUA 1W2BA 1K9MR 2E6ZA 3FRNA 4E7JA 1N8RR 2LNVA 2PVOB 2KRNA 4RUGA 5KE3A 1TOVA 2LRQA 4E7LA 3UA7A 1K9AA 1U1TA 5GAN8 2CH4A 4RTVA 1B7TA 4CC2A 3OD1A 4PJNA 2EQUA 3EFSA 1F1BB 2K3XA 4N4IA 4BUGA 3CC7A 4XU1A 2F2WA 1GBQA 4R55A 2MWPA 1O9SA
chains in the Genus database with same CATH topology
5LJ3f 4M7DF 5HKCA 1BIBA 4IURA 3CPFA 2YRVA 1X2HA 3E9IA 4G84A 1VQKT 1NYRA 3PFSA 1VQZA 1KHIA 3JB9D 4RDXA 5GANf 1NJIU 4M7DE 3A7RA 3JCMe 1KQSS 2E41A 2VGMA 3OS5A 3PZCA 1XOVA 4C0ZA 2P0LA 2K5FA 4X34A 4LDXA 2ZT5A 4CS3A 3OMGA 4PLLA 2HQEA 3J80E 3FC3A 4C5IA 4OVAA 1VIFA 3JCMQ 2O01E 4P71C 3CCQA 4E51A 3GF5A 2V8JA 4J7FA 4J15A 3V8LA 2DKGA 3VQVA 2B8AA 1YB3A 1Q7YC 1EVKA 3DB3A 3OS1A 3TEHA 3RKWA 1VQLT 1VIEA 3I55A 2Y90A 4YRIA 1HTTA 2JZ2A 1VQMA 4JUVA 4H2XA 1UB4A 1SRYA 4HWSA 3FJPA 1M4ZA 2KY9A 5GANe 3A8LB 4F7UG 3GNFB 1N27A 4ELZC 4ZTUB 3LW5E 2Y4XA 5GMKh 2XKOC 4K88A 3G6ET 4J6YA 1EIYA 4PJOE 2ZNJA 4YRNA 4ZTJA 1SERA 1VQ9T 4BE1A 4ZIBA 2R5AA 2OTJA 3OBWA 2IG0A 2GQVA 4IKFA 2K3YA 4P74C 4MMKA 3QTCA 3CPWS 3X20B 3QO3A 3JCMh 3A32A 5GMKj 2CJ9A 2DDZA 2ZPHB 4P72C 1BI2A 1R8OB 5HY6A 2XGTA 3CC4T 4LNSA 1ZBXA 3A7AA 4F7UB 1BI0A 3E1SA 3CEYA 3CMAA 2CJBA 1JJCB 1VQOA 5I2SA 3RL6A 1QVGA 4ME7A 3M53A 1XTDA 2FL7A 3CCMT 2F69A 4UP9A 1L0WA 5GAOq 3PGGA 4MMLA 4YTLA 1BI1A 4ZGJB 1QE0A 2XG8D 3KUFA 2PUOB 4E7KA 3CXCS 3TEHB 3OW2S 1X55A 4G85A 2DZCA 4M75F 5CAIA 1K8AC 2GF7A 3QJYA 4Z02A 1YJNA 4ZTZB 3REXA 3C12A 1BBWA 4M77B 1UGSB 2AKWA 4O6JA 4BACA 3UFGA 5IT9E 1H4QA 1H4TA 2RHSB 5GAOr 1YJWT 4DPGA 2AMCB 2P0QA 2KK4A 1QVGS 2K57A 4IUVA 1I81A 3HRKA 3P8VA 2C7IA 5LJ5j 4FM4B 1E22A 4ZTFA 3OYFA 3KFUA 3LGLA 2ZPBB 1YJNT 3MP8A 4M78B 4XTYA 4A54A 5CVIA 2EYQA 5GAN4 4ZGDB 4P73C 4M7AC 3NENA 4Q6GA 4B9XA 1G5VA 2RHYA 3RERA 3HXYA 1N8RC 2XK0A 4PG3A 3GP8A 3H8ZA 5J39A 2DXUA 4YRLA 2KMTA 1Q82U 1Q86U 4FSXA 1VQ5T 2WSFE 3CCST 3UH0A 3A31A 4XQ3A 1U8RA 1YCYA 3QZ9B 4M78A 4TWAA 2ZXFA 4YDQA 1KD1U 4XEMA 5DLOA 1B34B 5KNNA 1JB0E 4N0AA 4TVYA 4NOYA 1WYDA 1JJCA 4MZTA 5CCAA 4EMKB 4OB2B 2KQWA 1D3BA 3VUZA 2RHXA 5FU6C 5FU6B 1I5LA 5LJ5f 5GMKe 1WJQA 3CD6T 3FDRA 1X54A 3G4SA 4CRIA 1ADJA 3OYCA 1QVFS 4C92E 2DZ9A 2PQWA 3OYJA 4XTUA 4KUIA 2OTLT 5HK0A 2Q5HA 2MWOA 1YJ9T 1ASZA 3L1AA 3L42A 2QHSA 2K5IA 2A3LA 3V7CA 4M7AA 1VQNT 3MF1A 1VQOT 4A4GA 3L2WA 2ZT6A 3JSCA 3JCMJ 2K2VA 3CMET 4HVCA 3RIRA 2RM4A 1Q82C 1Q86C 2QQAA 2V8IA 3EFRA 3LSQA 4MZPA 2EQJA 2DU7A 2EQKA 5GAN6 3X28B 2WACA 2DXBA 2WSEE 3QO7A 5FRNA 5FRMA 3JCMf 4KQEA 4BI8B 5GAOm 1FYFA 3PIPA 4NL3A 3R6OA 3J7AF 2G4CA 1X2GA 1EOVA 2PVDB 1VQ4T 2EL9A 4YRJA 4K86A 3CCSA 4Q5WA 2X4XA 2ZCFB 3OYMA 3OSVA 4OB0B 4BWAA 3BFMA 4YPFA 4BI3A 3OYDA 2ZPEB 1NJ6A 4IUUA 2J3LA 5K1PA 2CZ6B 4HCZA 4YRTA 3PCOB 3JRZA 2R5MA 4BB7A 3QYHB 3F70A 2RJDA 3ER0A 4C92F 1KC8U 2RA2A 2ZTGA 3ZFJA 2ZR3A 3RESA 4M77C 4HT4A 3MEYA 4Q15A 4KULA 3HFNA 4LDWA 1G5IA 1YFTA 2YHTA 3SWNA 3E9GA 2RHIA 2HAXA 3CCRT 4TTVA 3SWNC 3A5ZA 2DTOA 4N0AC 3JB9F 2CIMA 3CBMA 3R07A 2RJCA 5C53B 4L87A 2K5LA 3MQZA 3OYGA 2E12A 5I21A 2ARSA 3OYIA 3X26B 1FXXA 1VQLA 3E19A 1M5Q1 1M90C 2LC4A 2R58A 4YCVA 3KBGA 3QO8A 1X56A 4YYEA 2MMPA 3T9NA 4FT4A 3RMQA 4WI1A 1YJ9A 3SDZA 3G7ZA 4BE2A 1WQ7A 3VQWA 4YRMA 3L4GB 2LT4A 4QVDA 4YRQA 1VQ9A 2E5QA 2RD1A 3NFCA 3JAME 3ERRA 2X4WA 4LVIA 5CK9A 4JRKA 2LCLA 4H2UA 2XHCA 5DM7R 2NS6A 3LSSA 2X35A 4M75A 3CC7T 4JJNK 2RHUA 2E6NA 2HQXA 3QSUA 1VQPA 3IALA 3GLXA 4NL2A 5GMKm 2LT1A 4H2TA 2XIDA 1KD1C 11ASA 2RHZA 2CS7A 3JCMd 3CCEA 2EKOA 2GCXA 4JRIA 4PJOC 3CCET 4LVJA 5D6YA 4PJOB 1YBYA 5GAOn 2QEXA 3INZA 1S72T 3PCOA 4TVRA 1RI0A 3VYHB 5KCHA 4M77F 4QW2A 2L8DA 3X25B 1UGRB 5DY9A 4C5GA 4M7AD 1OYXA 2DXTA 1C0AA 5L8RE 4LD6A 3RKYA 3LGFA 2PVGB 2DIGA 3WXMB 5ELOA 1NZ9A 4M75G 5D6WA 3HFZA 2VXEA 2GFAA 3OA6A 2EQMA 2ALYA 1OI1A 3HFOA 3X24B 2ODRC 1H4VB 5FU7B 2QQSA 3META 3SD4A 1NJ5A 4J5YA 2ZPGB 1YJWA 3Q1JA 3CCLA 1B7YB 1Y96A 4M7AF 4HCBA 4A4EA 1WNLA 1BIAA 4PJOF 4M78C 2Q5IA 2LQ8A 1GGMA 4II1A 2O4XA 3QIIA 4ELYC 3MHXA 2MAMA 4MZMA 2ZR2A 2VC8A 3M4QA 4C92D 3PNWC 5AYFA 2AHJB 4LDVA 4PKCC 4J8OA 3OBYA 1WLEA 3L2VA 2X4YA 5E3IA 2FHDA 3O8VA 4LVLA 1LOJA 4CI0C 2VV5A 1USYC 4O2DA 4NCXA 4H2YA 4RG8A 4C0DC 4LDUA 4M77D 4P71A 2QA4A 3QHSA 2BKDN 4M78G 2AMCA 1WGSA 4XU3A 2DPPB 2RHQB 2QA4T 3RGLA 2WSCE 3SFMA 2CYZB 4JRPA 2DQ3A 3OYHA 4P3NA 5LJ3j 3OYAA 3IKMB 1K73U 4TVWA 2RJEA 5GAOp 4JRQA 4HCCA 4KR2A 2JOYA 3NETA 3M5AA 4FT2A 1IZ6A 1KQ1A 4JLGA 4M75C 2I4OA 2JN0A 5D6XA 3LLRA 2JTMA 1ATIA 2VUBA 4C92B 1YI2T 3CBOA 5J3BA 2JTFA 4YCWA 4RKUE 2VGNA 1HXDA 2QTXA 5LJ3g 4CH4A 2ZT8A 1IL2A 1YITT 5HK3A 1Q7YU 3CCQT 2XICA 3QKJA 3CCLT 2E10A 5C6SA 3UGQA 5GANj 4HWTA 2KDSA 1DJ7B 1KOGA 1V29B 4PJOG 1Y7XA 4JLIA 4P74A 2XD0A 5FU7C 2DQ0A 1G51A 3C95A 4YRFA 2RHSA 3L2UA 3I56A 2MF2A 1VQMT 3MP6A 3CC4A 3GNGA 3S6WA 2NLUA 2M1HA 2E3CA 2ZPFB 3HRUA 1B8AA 2JVVA 5K1XA 3RF1A 3HFZB 3CCMA 2V8KA 2XTIA 2CZ7B 1USYA 3VUBA 1P92A 5GAMf 1M1KC 2F5KA 1ZHIA 2ZNIA 1QW1A 2RI2A 3N5BB 1G3WA 4M78E 2QI2A 3JCMX 5CKBA 1JJ2A 3UWNA 5A0GA 5LJ3e 4PNOA 1Z7NA 2P4TA 2MWPA 3CCJA 4YRPA 3FIFA 3NTKA 4P75C 1QP2A 3QXEB 3KXTA 1KG1A 2HD0A 1Q81C 3OS0A 5IAYA 1PYSA 1MHNA 4M7DA 4BDZA 2XDDA 2YLCA 2K4YA 5C52B 1JJ2S 2XU8A 2RH2A 3M58A 5A0DA 4C5HA 3ZEHA 5GAOl 3HXUA 4GLKA 3OYNA 3CCJT 2CZ1B 1K73C 3UPUA 3SWNB 4OB3B 5HGQA 3OYBA 4X9CA 5ELNA 1G5HA 2X4JA 4KR3A 3HKSA 2JUFA 1NPPA 3W3SA 2KSSA 3TU4K 3A8OB 2DTIA 1PYSB 5A2QE 2IY5B 4IUTA 4QQ6A 4WF2A 3LWIA 2I4LA 1VQ6T 4C8QD 1WJSA 2EFIA 3P8HA 3MCAB 2EWNA 1VQNA 2EJ9A 1JRIA 2D9TA 2VXFA 2C8MA 3HXVA 3CPWA 4OF1A 5GANh 3QNEA 3M9QA 3M54A 4IUPA 3OMCA 5GAN3 3REUA 2DIQA 1VQ7A 4ATOA 1B70A 2DTHA 3L2ZA 4V2SA 1SSFA 3MEUA 1N6AA 3QBYA 3HFVA 1HK9A 1UGPB 2PU9B 1O75A 1YIJA 1XNIA 5CKDA 3ME9A 1HC7A 12ASA 1WPYA 2C06A 2PMFA 1H4SA 4R56A 3P8BB 4Y28E 1VQ8A 3MEAA 1EVLA 2ZIMA 1B76A 2M0OA 2EJFA 2L89A 2RJFA 4KUDK 2M16A 2LDMA 3TREA 4C8QA 2LX9A 1WQWA 3A74A 3ZBDA 1G3YA 4YCUA 3L2RA 2ALYB 1NJIC 3TEEA 1TH7A 2P0KA 3LYIA 3G4ST 4J7IA 4M77E 5CQXA 3NTIA 2FB7A 3OSSC 4BW9A 1EQRA 1VQ4A 1Y96B 4C8QC 4FU6A 5GAMg 3CBPA 5GAMh 3OW2A 2E70A 1B34A 3UDCA 3OYEA 2RI3A 1X75C 3I56T 2RK2A 2BUDA 3OYYA 3WVEB 4E7HA 1N8RU 1VQ5A 4C8QF 2ZGWA 2DVEA 2E64A 3FLGA 3DB4A 3G1ZA 4M75D 3GOXA 2Q7GA 4HWPA 1VQPT 2XDPA 3JB9I 4C0GA 5GAN5 2PMEA 4Y91A 2FYKA 3WQZA 4PHCA 2P5IA 2FVUA 1N9SA 2QEXT 3VQYA 3DLMA 4M77G 3HXWA 2Q7HA 4C0FA 3BJUA 4YRCA 4EPCA 3PMTA 4BE0A 5CKFA 1NE8A 4RCCA 3IKLA 1YI2A 4QQGA 1OZ2A 4E47A 4PL6A 4DOWA 2RK1A 4C92C 4EDUA 1KQ2A 4L59A 5M9OA 1N9RA 4XU2A 3CD6A 1YITA 1RIQA 2QHTA 4J83A 3FEOA 3PT9A 3A7UA 2H3JA 2E5AA 4RQEA 3JCMb 2XI9A 4EMHA 4KT0E 4F7UE 4E7IA 3L2QA 3IG2A 2QQRA 1NPRA 1VQ6A 4HT9A 5GAMd 3M57A 1LNXA 3LH0A 2ZINA 5IN1A 2R57A 1KMMA 4M7DC 4HWRA 4YRSA 5GMKi 4HWOA 2E65A 4LVMA 5A0LA 4XTWA 4NS5A 5CKEA 3M4YA 4EMKC 3M59A 4OB1B 4GY5A 1M1FA 4DA4A 1G3TA 2L5QA 3A5ZB 4XAXB 4C92A 3JB9J 3HPWA 1KMNA 1YGBA 1QP3A 2KAFA 3NTHA 3VKIA 4P73A 4PJOD 4X5OA 4QVZA 1UGQB 5LJ5d 1VQ8T 5GAN7 1BBUA 2ZCEA 4RMOA 1NJ1A 1ZQ1A 2O4XB 4P3OA 4CS4A 3BDUA 4XTVA 2RHQA 3JCMV 2A8EA 2ZZEA 3CMAT 1PSEA 4B9WA 1VQKA 4L5GA 2M9UA 4XK8E 4M78F 2LTOA 3QO5A 4QQDA 2D6FA 4HKEA 1FX7A 3G71A 3HXZA 3VJPA 3G71T 1K9MC 1MGQA 3GIBA 3RUXA 4CH3A 3OY9A 2CJAA 3TCJA 1RL2A 3MF2A 3QUIA 2CZ0B 3PTAA 4C8QG 1K8AU 2DAQA 3UT1A 5LJ3h 2LQKA 1KC8C 5FROA 4HT8A 3CC2A 2ZIOA 2QQBA 3A8GB 4L6V5 4FIBA 5LL6S 4OLFA 4XTZA 5LJ5g 1M9SA 4JS5A 1QVPA 2RI5A 2G3RA 3ICAA 3V7SA 4OP0A 3HRTA 4EX5A 4P75A 3HRSA 1EIYB 4H2VA 4DQ2A 4J6XA 4CS2A 1VUBA 1M1KU 1AHJB 1M1GA 3JCMW 3S3OA 2I4NA 5EG2A 4C8QB 4XU0A 4KBMB 1WJRA 3OB9A 1K9MU 1NNHA 3CXCA 2YLBA 1ASYA 2ARUA 4H2XB 1BYMA 1NYQA 3JCMc 4TQFA 2QDYB 1D3BB 4TVAB 3A5YA 3HHTB 3S3NA 4M7DG 1B7YA 4RMFA 2E1HA 1W66A 3C94A 3ASKA 2AKWB 4M77A 3I55T 3P8DA 4TQDA 2LVMA 4LVKA 3HY1A 3TEGA 3NEMA 4C5EA 3NELA 2EJGA 4OGCA 4X9DA 1YFSA 4UP7A 4A4HA 1H641 4P5NA 3BDLA 3V7RA 2ZZGA 2J3MA 4YREA 4WJ4A 1E24A 3HXXA 3L4GA 2EAYA 1XQHA 2DEQA 2ZPIB 3DLLA 3RMSA 3MO8A 1N9WA 3M56A 4N4GA 4TVAA 1Y07A 3BY7A 1W4SA 4JDSA 3QJ6A 1M8VA 4F7UA 3GPLA 3P8YA 2OTJT 3LC0A 3OS2A 5LJ3d 5CQYA 4RQFA 4HA8A 2QXFA 3S3MA 3G6EA 3C4SA 1X6OA 1Q81U 4M7AE 1LYLA 1BI3A 3JCMg 1E1TA 2P0PA 1B70B 2PUKB 4N4HA 4LD9K 4OGEA 3VV0A 3I7FA 5GMKl 4YRKA 2QHVA 1H3ZA 3MP1A 4XEOA 3HY0A 5KE2A 4M75E 4MDWA 2EIFA 1PSFA 3CCUT 1FWZA 1SETA 4D6WA 1NJ2A 4H02A 2L3RA 3WVDB 5FLXE 5F5WA 3QG1A 1QVFA 3P8TA 3CMQA 2ZZFA 5KCOA 3RKXA 3V8KA 3BW1A 3HTZA 3E9FA 4BI4A 2ZT7A 3HRIA 4C0DB 4YROA 2IVWA 2BIVA 1Z7MA 4ZGEB 2ARTA 2VYTA 2HBPA 3M55A 4XTXA 4M7AG 5CIUA 4A53A 4BY6B 4FL6A 3VU3C 2GFUA 1BKBA 2ZZDA 4EMGA 5CKHA 3HL8A 4JS4A 2DJZA 4IUQA 2DO3A 3M4PA 2D0QB 3A8MB 2CKKA 4AH6A 1IREB 4H2SA 3QYGB 4CH6A 4YP0A 4CH5A 4M7DB 4ZN3A 3LWHA 2DD5A 1G3SA 3QDRB 1YIJT 4PJOA 5CR2A 2DK3A 2DU5A 1I4K1 4A4FA 4M78D 4OMFB 4QVCA 4EO4A 4LDYA 4UC4A 4M7AB 4DOVA 5I2MA 4F7UF 1KQSA 4J6WA 4UPAA 5GANg 3VBBA 1EFWA 2ODRD 2XDBA 3VYGA 5GAMe 3SB2A 5C0MA 1JBMA 4RG2A 3H6ZA 3MEWA 1ADYA 4UP8A 3OYKA 4C92G 4BDYA 4PLIA 2CGHA 2DXCA 1SESA 1VQ7T 3HP9A 5LJ5h 1S72A 1J5WA 3URGA 1YHQT 3QZ5B 1YFRA 4K87A 1M90U 2DD4A 4ZN1A 4P3PA 1I8FA 1OZ3A 1YHQA 3JCMP 3OYLA 4BD3A 5GAN2 4EMKA 2IY5A 3VQXA 5LJ5e 5KH6A 3CCRA 1QF6A 4VUBA 2LCCA 1WU7A 5J26A 2MI6A 1W2BS 3RACA 1KHCA 4P72A 4A4KA 3DSQA 3LX7A 4WJ3M 3CCVT 5GAMj 3J81E 5DLQE 3PMIA 5CO7A 1Y71A 3CMEA 3CCVA 2Q7EA 4RCBA 3FB9A 1NJ8A 4YRGA 3TUPA 2I2LA 3DKMA 3E9HA 3V8JA 2I4MA 2JNGA 2F5TX 2QHUA 2OTLA 2KVQG 3M4GA 3PIOA 1GXIE 2RO0A 3OQ5A 2HNIA 3JB9G 4O5VA 1X01A 1U1SA 5GANd 4M7DD 1EIFA 3MEVA 4C8QE 3UGTA 4BY6C 3HSBA 2RB6A 3CC2T 1E1OA 3QPHA 3JB9H 3A8HB 3EAEA 2A7YA 4YRRA 4H2WA 5C51B 4MDXA 2Y4YA 3AHUA 1LJOA 2OAUA 2QQ9A 4M75B 3CCUA 1W2BA 2E6ZA 3FRNA 4E7JA 2LNVA 2PVOB 5KE3A 2LRQA 4E7LA 1U1TA 5GAN8 3OD1A 2EQUA 3EFSA 2K3XA 4N4IA 4BUGA 3CC7A 4XU1A 4R55A 1UEBA 1O9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ3 f;  1YFT A;  4M7D F;  2IY5 B;  1BIB A;  2YHT A;  4OLF A;  3SWN A;  4WF2 A;  2I4L A;  4XTZ A;  5LJ5 g;  4C8Q D;  1X2H A;  3E9I A;  4G84 A;  3ICA A;  1NYR A;  2EWN A;  3V7S A;  4TTV A;  3SWN C;  4OP0 A;  1VQZ A;  2EJ9 A;  3JB9 D;  4RDX A;  1JRI A;  2VXF A;  5GAN f;  3A5Z A;  4EX5 A;  2DTO A;  4N0A C;  3JB9 F;  2CIM A;  4M7D E;  3R07 A;  2C8M A;  3A7R A;  3HXV A;  4P75 A;  3JCM e;  4H2V A;  2E41 A;  4L87 A;  5C53 B;  1EIY B;  3PZC A;  4DQ2 A;  2P0L A;  5GAN h;  3QNE A;  4J6X A;  4CS2 A;  5I21 A;  2ARS A;  3JCM W;  1M5Q 1;  2ZT5 A;  4CS3 A;  2I4N A;  5GAN 3;  4C8Q B;  4XU0 A;  4YCV A;  3REU A;  3QO8 A;  1X56 A;  4YYE A;  3JCM Q;  1B70 A;  2DTH A;  1NNH A;  3L2Z A;  2YLB A;  4P71 C;  1ASY A;  4V2S A;  4WI1 A;  2ARU A;  4E51 A;  4H2X B;  1NYQ A;  4TQF A;  3JCM c;  4J15 A;  3V8L A;  1D3B B;  2DKG A;  3VQW A;  1WQ7 A;  4YRM A;  3VQV A;  4TVA B;  3A5Y A;  1YB3 A;  3L4G B;  4QVD A;  4YRQ A;  3HFV A;  1HK9 A;  1EVK A;  4M7D G;  1B7Y A;  2RD1 A;  3TEH A;  3RKW A;  4RMF A;  2E1H A;  1W66 A;  3ERR A;  1HC7 A;  12AS A;  2AKW B;  2Y90 A;  1WPY A;  4JRK A;  4YRI A;  4M77 A;  1HTT A;  4H2U A;  2PMF A;  1H4S A;  1EVL A;  3LSS A;  2ZIM A;  4JUV A;  4H2X A;  4TQD A;  3HY1 A;  3TEG A;  1B76 A;  4M75 A;  3NEM A;  3NEL A;  1SRY A;  4HWS A;  2EJG A;  3FJP A;  4X9D A;  2EJF A;  5GAN e;  1YFS A;  4UP7 A;  1H64 1;  3QSU A;  3IAL A;  4F7U G;  3V7R A;  4C8Q A;  4NL2 A;  5GMK m;  4H2T A;  2ZZG A;  11AS A;  2J3M A;  4YRE A;  4ZTU B;  1E24 A;  3HXX A;  5GMK h;  1WQW A;  2EAY A;  3A74 A;  3L4G A;  4WJ4 A;  4K88 A;  3JCM d;  1EIY A;  4J6Y A;  2DEQ A;  4PJO E;  4JRI A;  4YCU A;  2ZNJ A;  4PJO C;  1N9W A;  4YRN A;  4PJO B;  2ALY B;  1SER A;  4TVA A;  3BY7 A;  4ZIB A;  5GAO n;  1TH7 A;  3INZ A;  1M8V A;  4M77 E;  3PCO A;  4F7U A;  3P8Y A;  4M77 F;  2FB7 A;  3LC0 A;  4P74 C;  5LJ3 d;  4MMK A;  4RQF A;  3QTC A;  4HA8 A;  4BW9 A;  5DY9 A;  1EQR A;  3QO3 A;  4M7A D;  3JCM h;  3A32 A;  2DXT A;  1Y96 B;  4C8Q C;  5GMK j;  2CJ9 A;  2DDZ A;  1C0A A;  4P72 C;  5GAM g;  3RKY A;  2XGT A;  5GAM h;  4LNS A;  4M7A E;  1LYL A;  3A7A A;  5ELO A;  4F7U B;  3JCM g;  1B34 A;  4M75 G;  3HFZ A;  2VXE A;  1E1T A;  2CJB A;  1JJC B;  1B70 B;  3RL6 A;  2ALY A;  3HFO A;  3I7F A;  2ODR C;  5GMK l;  1H4V B;  4YRK A;  4UP9 A;  1L0W A;  5GAO q;  4C8Q F;  3PGG A;  4MML A;  2QHV A;  2ZGW A;  1NJ5 A;  2DVE A;  2E64 A;  1QE0 A;  4XEO A;  4J5Y A;  3HY0 A;  3G1Z A;  1B7Y B;  4M75 D;  4M75 E;  1Y96 A;  1X55 A;  4M7A F;  2Q7G A;  3TEH B;  4HWP A;  4G85 A;  1WNL A;  2DZC A;  4M75 F;  5CAI A;  1BIA A;  4PJO F;  4M78 C;  1SET A;  3JB9 I;  1NJ2 A;  2Q5I A;  4H02 A;  5GAN 5;  1GGM A;  2PME A;  4Y91 A;  4ZTZ B;  5F5W A;  3P8T A;  2FYK A;  3REX A;  3CMQ A;  1BBW A;  2ZZF A;  3WQZ A;  4M77 B;  3RKX A;  3V8K A;  3BW1 A;  2AKW A;  3HTZ A;  2ZT7 A;  4PHC A;  2P5I A;  3UFG A;  1H4Q A;  3HRI A;  1H4T A;  1N9S A;  2RHS B;  4YRO A;  3VQY A;  2ZR2 A;  2VC8 A;  1Z7M A;  5GAO r;  3M4Q A;  4C92 D;  4DPG A;  2AMC B;  4M77 G;  3HRK A;  2K57 A;  3HXW A;  1I81 A;  3P8V A;  2ART A;  5LJ5 j;  2C7I A;  2Q7H A;  4XTX A;  4M7A G;  3BJU A;  1WLE A;  1E22 A;  3KFU A;  4A53 A;  4YRC A;  5E3I A;  4M78 B;  4XTY A;  3VU3 C;  1LOJ A;  4A54 A;  4EMG A;  4RCC A;  5GAN 4;  3IKL A;  1USY C;  4O2D A;  4NCX A;  2DJZ A;  4H2Y A;  4P73 C;  4M7A C;  3NEN A;  3M4P A;  4Q6G A;  4M77 D;  3RER A;  4P71 A;  3QHS A;  4M78 G;  2AMC A;  3HXY A;  4XU3 A;  4C92 C;  1KQ2 A;  4AH6 A;  2RHQ B;  4PG3 A;  1N9R A;  4H2S A;  3RGL A;  4XU2 A;  4CH6 A;  4YP0 A;  4CH5 A;  4M7D B;  2DXU A;  4YRL A;  1RIQ A;  2DQ3 A;  2QHT A;  4P3N A;  4PJO A;  5LJ3 j;  3A7U A;  3IKM B;  4TVW A;  3UH0 A;  5GAO p;  2E5A A;  3A31 A;  4RQE A;  4XQ3 A;  2DU5 A;  1I4K 1;  4KR2 A;  3JCM b;  4M78 D;  3NET A;  1YCY A;  4M78 A;  4TWA A;  2ZXF A;  4QVC A;  4EMH A;  1KQ1 A;  4EO4 A;  4YDQ A;  4M75 C;  4F7U E;  4XEM A;  2I4O A;  2JN0 A;  4M7A B;  1B34 B;  5KNN A;  3IG2 A;  4F7U F;  4N0A A;  4TVY A;  1ATI A;  4J6W A;  4NOY A;  1WYD A;  1JJC A;  4C92 B;  4UPA A;  5GAN g;  4EMK B;  5GAM d;  4HT9 A;  3VBB A;  1EFW A;  1LNX A;  1D3B A;  4YCW A;  2ZIN A;  2ODR D;  5GAM e;  3SB2 A;  1KMM A;  4M7D C;  1JBM A;  4HWR A;  1HXD A;  2QTX A;  1I5L A;  1ADY A;  5LJ3 g;  4YRS A;  5LJ5 f;  4CH4 A;  5GMK e;  4UP8 A;  4C92 G;  2CGH A;  2ZT8 A;  1IL2 A;  5GMK i;  4HWO A;  1SES A;  2E65 A;  4XTW A;  5LJ5 h;  1X54 A;  1J5W A;  1YFR A;  4K87 A;  4EMK C;  4P3P A;  2E10 A;  1I8F A;  1ADJ A;  4C92 E;  3JCM P;  2DZ9 A;  3UGQ A;  5GAN j;  4HWT A;  4XTU A;  5GAN 2;  4EMK A;  2Q5H A;  2IY5 A;  4C92 A;  3JB9 J;  1ASZ A;  3VQX A;  1KOG A;  3L1A A;  5LJ5 e;  4PJO G;  4JLI A;  2QHS A;  4P74 A;  3V7C A;  2DQ0 A;  1G51 A;  1QF6 A;  4M7A A;  1KMN A;  1YGB A;  3MF1 A;  4YRF A;  2ZT6 A;  2RHS A;  1WU7 A;  3RAC A;  3JCM J;  4P72 A;  3DSQ A;  2E3C A;  4P73 A;  4HVC A;  1B8A A;  4PJO D;  4X5O A;  3RIR A;  4WJ3 M;  2RM4 A;  5GAM j;  5LJ5 d;  5K1X A;  5GAN 7;  3RF1 A;  1BBU A;  3HFZ B;  2ZCE A;  3EFR A;  3LSQ A;  2Q7E A;  1NJ1 A;  4RCB A;  2XTI A;  3FB9 A;  2DU7 A;  4P3O A;  1USY A;  1NJ8 A;  5GAN 6;  4CS4 A;  3BDU A;  5GAM f;  4XTV A;  4YRG A;  2ZNI A;  2RHQ A;  3TUP A;  2I2L A;  3E9H A;  3V8J A;  2I4M A;  3QO7 A;  3JCM V;  3JCM f;  2ZZE A;  4KQE A;  4M78 E;  2QHU A;  5GAO m;  3M4G A;  4M78 F;  3JCM X;  1FYF A;  5LJ3 e;  2HNI A;  3JB9 G;  4PNO A;  1Z7N A;  1X01 A;  4NL3 A;  1U1S A;  5GAN d;  4M7D D;  2G4C A;  4C8Q E;  3QO5 A;  4YRP A;  3UGT A;  3FIF A;  1EOV A;  1X2G A;  4P75 C;  3HSB A;  2EL9 A;  2RB6 A;  4YRJ A;  4K86 A;  1E1O A;  1PYS A;  3JB9 H;  3HXZ A;  4M7D A;  4YRR A;  2YLC A;  5C52 B;  4H2W A;  4BWA A;  3BFM A;  4YPF A;  5C51 B;  1MGQ A;  3AHU A;  1NJ6 A;  1LJO A;  4M75 B;  5GAO l;  3HXU A;  2J3L A;  3GIB A;  5K1P A;  3RUX A;  4CH3 A;  2CJA A;  4YRT A;  3PCO B;  3SWN B;  5HGQ A;  3MF2 A;  3QUI A;  4X9C A;  5ELN A;  1G5H A;  4C8Q G;  4C92 F;  1U1T A;  5GAN 8;  4KR3 A;  2RA2 A;  3OD1 A;  2ZTG A;  3EFS A;  2ZR3 A;  3W3S A;  3RES A;  4M77 C;  5LJ3 h;  4HT8 A;  3MEY A;  4Q15 A;  4XU1 A;  3HFN A;  2DTI A;  1PYS B;  2ZIO A;  1G5I A; 
#chains in the Genus database with same CATH topology
 5LJ3 f;  4M7D F;  5HKC A;  1BIB A;  4LE9 A;  2BE7 D;  4IUR A;  3CPF A;  5GJW B;  1X69 A;  4FYV B;  3CCQ Q;  2YRV A;  1X2H A;  2K2M A;  1Z9Z A;  3E9I A;  4G84 A;  3CCL Q;  2BTT A;  1VQK T;  1NYR A;  3PFS A;  1VQZ A;  1KHI A;  3JB9 D;  4RDX A;  5GAN f;  4KH0 B;  1NJI U;  4M7D E;  1JEG A;  3A7R A;  3JCM e;  1KQS S;  2E41 A;  2VGM A;  3OS5 A;  1CSK A;  1GFD A;  1XOV A;  3PZC A;  4PFZ A;  4C0Z A;  2P0L A;  2ROT A;  2K5F A;  8AT1 B;  4X34 A;  4LDX A;  2ZT5 A;  4OML A;  3OMG A;  4CS3 A;  4PLL A;  4J9I A;  2HQE A;  3J80 E;  2PTK A;  3FC3 A;  1UTI A;  4C5I A;  5IXF A;  4OVA A;  1ZA2 B;  1RAF B;  1VIF A;  3JCM Q;  2O01 E;  4P71 C;  3CCQ A;  4E51 A;  3GF5 A;  2V8J A;  4J7F A;  2B86 A;  5IH2 A;  1FMW A;  4J15 A;  3V8L A;  2DKG A;  2EGC A;  3VQV A;  2B8A A;  1YB3 A;  2D8J A;  1Q7Y C;  3TVT A;  1SSH A;  1EVK A;  3DB3 A;  4JJD A;  3M0T A;  3OS1 A;  1QCN A;  3TEH A;  3RKW A;  1VQL T;  1VIE A;  3I55 A;  2JM9 A;  2Y90 A;  4YRI A;  1HTT A;  2JZ2 A;  1VQM A;  3NGP A;  4JUV A;  4H2X A;  1UB4 A;  1X43 A;  1SRY A;  4HWS A;  3FJP A;  1X2Q A;  1M4Z A;  2KY9 A;  5GAN e;  3A8L B;  2EQI A;  4F7U G;  3GNF B;  1V1C A;  1N27 A;  4ELZ C;  1HD3 A;  5EC7 A;  4ZTU B;  3LW5 E;  2Y4X A;  5GMK h;  2XKO C;  4K88 A;  3G1J A;  3G6E T;  4J6Y A;  1EIY A;  2HCK A;  4PJO E;  1W1F A;  2ZNJ A;  2DL8 A;  4YRN A;  2XMF A;  4ZTJ A;  4FCY A;  1SER A;  1VQ9 T;  4BE1 A;  4ZIB A;  1LCK A;  2R5A A;  1NJI R;  2OTJ A;  3OBW A;  1SHG A;  2IG0 A;  2GQV A;  4IKF A;  2K3Y A;  4P74 C;  1KFZ A;  4MMK A;  1ZSZ C;  3QTC A;  3CPW S;  4KRT A;  3X20 B;  3QO3 A;  2LCS A;  3JCM h;  1CKB A;  5GJV B;  3A32 A;  5GMK j;  2CJ9 A;  2DDZ A;  1I1J A;  2ZPH B;  1BI2 A;  4P72 C;  1R8O B;  5HY6 A;  2LZ6 B;  2JS2 A;  2XGT A;  1PHT A;  3CC4 T;  1OOT A;  4LNS A;  1ZBX A;  1MNE A;  3A7A A;  4F7U B;  2DX1 A;  1BI0 A;  1QLY A;  3E1S A;  4AFZ C;  4PJL A;  2NUZ A;  3CEY A;  3CMA A;  2CJB A;  1JJC B;  1VQ6 Q;  1VQO A;  5I2S A;  3RL6 A;  1QVG A;  1WXT A;  1AWJ A;  4ME7 A;  3SHW A;  1ACM B;  1PKS A;  3M53 A;  1XTD A;  2FL7 A;  3CCM T;  2F69 A;  3BE3 A;  4UP9 A;  4CC4 B;  1L0W A;  2M0Y A;  5GAO q;  3PGG A;  2KXC A;  1D1A A;  4MML A;  4YTL A;  2CP5 A;  2VWF A;  1BI1 A;  4ZGJ B;  1QE0 A;  1WFW A;  2XG8 D;  3KUF A;  1VA7 A;  2PUO B;  3TSW A;  3CXC S;  4E7K A;  3TEH B;  3OW2 S;  1X55 A;  4G85 A;  2DZC A;  4M75 F;  4PK4 A;  5CAI A;  1A0N B;  1VQM Q;  1K8A C;  2GF7 A;  3QJY A;  4Z02 A;  1YJN A;  4ZTZ B;  1MUZ A;  2BZ8 A;  4JJC A;  3REX A;  3C12 A;  1BBW A;  1ZLM A;  3M0P A;  4M77 B;  1UGS B;  2K6D A;  2AKW A;  4O6J A;  4BAC A;  3UFG A;  5IT9 E;  3EG2 A;  1H4Q A;  1H4T A;  2RHS B;  2AZS A;  5GAO r;  1YJW T;  4DPG A;  2KK4 A;  2P0Q A;  4E7S A;  1QVG S;  2K57 A;  4IUV A;  1I81 A;  2AMC B;  3HRK A;  3P8V A;  2C7I A;  5LJ5 j;  4WTO B;  4FM4 B;  2DL3 A;  1E22 A;  4ZTF A;  3OYF A;  3KFU A;  2DFU A;  3LGL A;  2KYB A;  2ZPB B;  2DRM A;  1YJN T;  3MP8 A;  4M78 B;  4XTY A;  4A54 A;  5CVI A;  5ECA A;  2EYQ A;  5GAN 4;  4ZGD B;  2KI7 A;  4P73 C;  4M7A C;  3NEN A;  4Q6G A;  4B9X A;  1G5V A;  2RHY A;  3RER A;  3HXY A;  1N8R C;  2XK0 A;  3EG0 A;  4PG3 A;  3GP8 A;  2RMO A;  1ZUU A;  3H8Z A;  2DBK A;  5J39 A;  2DXU A;  4YRL A;  1EX4 A;  2KMT A;  1Q82 U;  1BCM A;  1Q86 U;  4FSX A;  1VQ5 T;  2WSF E;  3CQT A;  1AWX A;  3EGD B;  3CCS T;  3UH0 A;  3A31 A;  1T3L A;  4XQ3 A;  1I5O B;  1U8R A;  1YCY A;  1KJW A;  3QZ9 B;  4M78 A;  4TWA A;  2ZXF A;  4YDQ A;  1KD1 U;  2K79 A;  4XEM A;  5DLO A;  1B34 B;  5KNN A;  1JB0 E;  4N0A A;  4TVY A;  3JV3 A;  4NOY A;  1WYD A;  1JJC A;  4MZT A;  5CCA A;  4EMK B;  2YRC A;  4OB2 B;  2KQW A;  1D3B A;  4LNP A;  2CUD A;  2QAS A;  3VUZ A;  2RHX A;  3R6N A;  5FU6 C;  1ZA1 B;  5FU6 B;  1I5L A;  5LJ5 f;  5GMK e;  2ENM A;  1WJQ A;  1KSW A;  3CD6 T;  2EVR A;  2J05 A;  1UE9 A;  3FDR A;  2MCN A;  1X54 A;  2ED1 A;  3G4S A;  1RI9 A;  4E2F B;  2QK0 A;  4CRI A;  1ADJ A;  1D0X A;  3OYC A;  1QVF S;  4C92 E;  1GRI A;  2ATC B;  2DZ9 A;  2PQW A;  1IB8 A;  3OYJ A;  1K1Z A;  4XTU A;  4KUI A;  4A63 B;  3O5Z A;  2OTL T;  5HK0 A;  1K73 R;  2Q5H A;  1TUG B;  2MWO A;  1YJ9 T;  1ASZ A;  3L1A A;  3L42 A;  2QHS A;  2K5I A;  2A3L A;  3V7C A;  4M7A A;  1VQN T;  3MF1 A;  1WDX A;  4A4G A;  3L2W A;  1VQO T;  3D7S B;  2ZT6 A;  2OTL Q;  1M2V A;  3JSC A;  3JCM J;  4AMC A;  2K2V A;  2D0N A;  3CME T;  4HVC A;  3IQL A;  3RIR A;  3EFO B;  2RM4 A;  1Q82 C;  1Q86 C;  2QQA A;  2V8I A;  3EFR A;  3LSQ A;  4MZP A;  2EQJ A;  2DU7 A;  2EQK A;  5GAN 6;  3X28 B;  2WAC A;  2JMC A;  2HEQ A;  2DXB A;  2WSE E;  3QO7 A;  5FRN A;  4HCK A;  1C0M A;  5FRM A;  2X3W D;  3JCM f;  4KQE A;  4BI8 B;  1WHL A;  1Q82 R;  1Q86 R;  5GAO m;  1VQ9 Q;  1FYF A;  2COW A;  3PIP A;  1N5Z A;  1JU5 C;  4NL3 A;  1YP5 A;  3R6O A;  3J7A F;  2JXB A;  4F04 B;  2G4C A;  1M1K R;  1EOV A;  1X2G A;  2PVD B;  1VQ4 T;  2EL9 A;  4YRJ A;  4K86 A;  3CCS A;  1QKX A;  4Q5W A;  3H41 A;  2X4X A;  2ZCF B;  3OYM A;  2V1R A;  3OSV A;  2M02 A;  2KT8 A;  4OB0 B;  3BFM A;  1AWO A;  4YPF A;  4BWA A;  4BI3 A;  3OYD A;  2ZPE B;  1D1B A;  1AZG B;  3UA6 A;  1NJ6 A;  4IUU A;  2J3L A;  5K1P A;  1OEB A;  2CZ6 B;  2NWM A;  4HCZ A;  4YRT A;  4JZ4 A;  3PCO B;  1BB9 A;  3JRZ A;  2R5M A;  4BB7 A;  3QYH B;  1RUW A;  3F70 A;  2RJD A;  3ER0 A;  4C92 F;  1KC8 U;  2RA2 A;  2ZTG A;  3ZFJ A;  5D7U A;  4Z89 A;  2ZR3 A;  2GQI A;  3RES A;  4M77 C;  2COZ A;  4HT4 A;  4J9H A;  1TUD A;  3MEY A;  4Q15 A;  4KUL A;  4DBQ A;  3HFN A;  1VYV A;  4LDW A;  1G5I A;  4RTU A;  1YFT A;  1VYT A;  2YT6 A;  4PJJ A;  3VS6 A;  2YHT A;  2KRM A;  3SWN A;  3E9G A;  1ZBJ A;  2RHI A;  2C0I A;  3I35 A;  4FW1 A;  4AFS C;  2AIR B;  2HAX A;  3CCR T;  1MMG A;  4TTV A;  3SWN C;  4AFQ C;  2KR3 A;  4IIO A;  3A5Z A;  2DTO A;  4N0A C;  3JB9 F;  2CIM A;  3CBM A;  3R07 A;  2HZY A;  2RJC A;  5C53 B;  4L87 A;  2K5L A;  3MQZ A;  3OYG A;  2YRD A;  1SRL A;  2E12 A;  5I21 A;  2ARS A;  3A1P A;  3OYI A;  3X26 B;  1FXX A;  1VQL A;  3E19 A;  1M5Q 1;  2O31 A;  1M90 C;  2LC4 A;  3UAT A;  2R58 A;  4YCV A;  3KBG A;  3QO8 A;  1X56 A;  4YYE A;  2MMP A;  3T9N A;  2IPO B;  1PD1 A;  1SHF A;  4FT4 A;  3RMQ A;  4WI1 A;  5KYY B;  2FEI A;  2CSI A;  1YJ9 A;  3SDZ A;  2FZC B;  1UDL A;  2MPX C;  3G7Z A;  1WQ7 A;  4BE2 A;  2QYZ A;  1VQL Q;  3VQW A;  4YRM A;  2K7A A;  1PM3 A;  3L4G B;  1OPK A;  2LT4 A;  4QVD A;  4YRQ A;  1VQ9 A;  1R77 A;  1PG5 B;  2E5Q A;  2RD1 A;  3I9Q A;  3NFC A;  3JAM E;  3ERR A;  2QGF B;  2X4W A;  4LVI A;  5CK9 A;  4JRK A;  2LCL A;  1YN8 A;  4H2U A;  2XHC A;  5DM7 R;  5I11 A;  2NS6 A;  3LSS A;  2X9H A;  2X35 A;  3M0U A;  2QTV A;  4M75 A;  3CC7 T;  4JJN K;  2X51 A;  2RHU A;  2E6N A;  2HQX A;  3QSU A;  1VQP A;  3IAL A;  3GLX A;  4NL2 A;  2KRS A;  5GMK m;  1WIE A;  2LT1 A;  3EG1 A;  4H2T A;  2XID A;  1KD1 C;  11AS A;  1J3T A;  2RHZ A;  1K76 A;  2CS7 A;  1HSQ A;  3JCM d;  2EKO A;  3CCE A;  2GCX A;  4JRI A;  2JS0 A;  4PJO C;  3CCE T;  4LVJ A;  3TQ7 P;  5D6Y A;  4PJO B;  2V26 A;  1M30 A;  4FYY B;  6AT1 B;  1YBY A;  5GAO n;  2EPD A;  2QEX A;  1VQ7 Q;  3INZ A;  1S72 T;  3PCO A;  4TVR A;  1RI0 A;  3VYH B;  1YHQ Q;  5KCH A;  4M77 F;  2OAW A;  4QW2 A;  2L8D A;  2RF0 A;  3X25 B;  1NYF A;  1UGR B;  5DY9 A;  1S72 Q;  4C5G A;  4M7A D;  2QAZ A;  3H9N A;  1OYX A;  2DXT A;  1C0A A;  2MK5 A;  1NYG A;  5L8R E;  2CT4 A;  2O2O A;  1X6B A;  3QWY A;  1E6H A;  2A36 A;  2LQW A;  4LD6 A;  3RKY A;  3SEM A;  4F17 A;  3LGF A;  2PVG B;  1MMN A;  2DIG A;  2EKH A;  3WXM B;  3AT1 B;  5ELO A;  1NZ9 A;  1TWB A;  2RQR A;  1M90 R;  2JW4 A;  4M75 G;  5D6W A;  1KC8 R;  3HFZ A;  2VXE A;  2GFA A;  1K8A R;  4Y92 A;  3OA6 A;  4B6M A;  3CME Q;  2EQM A;  2CP6 A;  2ALY A;  1OI1 A;  3HFO A;  3X24 B;  2ODR C;  2DVJ A;  1H4V B;  5FU7 B;  5KYX A;  2QQS A;  3MET A;  2DL7 A;  2KRO A;  3SD4 A;  1NJ5 A;  3I56 Q;  1W6X A;  1U5S A;  4J5Y A;  2ZPG B;  1YJW A;  3Q1J A;  3CCL A;  2DYB A;  1B7Y B;  1Y96 A;  4M7A F;  4HCB A;  4A4E A;  1WNL A;  1BIA A;  4PJO F;  4M78 C;  1K0S A;  5FWC A;  2Q5I A;  2LQ8 A;  1GGM A;  4II1 A;  2O4X A;  3QII A;  4ELY C;  2X3X D;  1TSF A;  2COY A;  3MHX A;  2GTJ A;  4GLM A;  2MAM A;  4MZM A;  2ZR2 A;  2VC8 A;  3M4Q A;  4C92 D;  3PNW C;  1D0Z A;  5AYF A;  4FYX B;  2AHJ B;  4LDV A;  4PKC C;  1UEB A;  4J8O A;  3OBY A;  1WLE A;  3L2V A;  2X4Y A;  5E3I A;  2FHD A;  3O8V A;  4LVL A;  1ZUK A;  1LOJ A;  1TXQ A;  2VV5 A;  4CI0 C;  2O9V A;  1USY C;  4O2D A;  4NCX A;  4RTT A;  4H2Y A;  2LNH B;  4RG8 A;  4C0D C;  4LDU A;  4M77 D;  4P71 A;  2QA4 A;  3QHS A;  2BKD N;  4M78 G;  2AMC A;  1WGS A;  4XU3 A;  2Z0W A;  2DPP B;  2RHQ B;  2QA4 T;  1IRX A;  1Y57 A;  3RGL A;  2WSC E;  3SFM A;  2CYZ B;  3OW2 P;  4JRP A;  2DQ3 A;  3OYH A;  4P3N A;  1FYN A;  1AD5 A;  5LJ3 j;  3RDV A;  3OYA A;  3IKM B;  1K73 U;  4TVW A;  2RJE A;  3HTR A;  5GAO p;  4JRQ A;  4HCC A;  4KR2 A;  2JOY A;  3NET A;  1TTH B;  3M5A A;  4FT2 A;  1IZ6 A;  1NLP C;  1KQ1 A;  2FPE A;  4JLG A;  4M75 C;  2VAS A;  2JN0 A;  2F2X A;  2I4O A;  5D6X A;  3LLR A;  2JTM A;  1ATI A;  2VUB A;  4C92 B;  1C6V X;  1YI2 T;  3CBO A;  5J3B A;  2JTF A;  4YCW A;  3CD6 Q;  1JQQ A;  1G2B A;  4RKU E;  2VGN A;  1HXD A;  2QTX A;  1ZSZ A;  5LJ3 g;  4CH4 A;  1TG0 A;  2ZT8 A;  1IL2 A;  1YIT T;  5HK3 A;  1Q7Y U;  2O88 A;  3CCQ T;  2XIC A;  3QKJ A;  3CCL T;  1KD1 R;  1OX9 A;  2E10 A;  1T0H A;  1Q81 R;  5C6S A;  1SKU B;  1K4U S;  1OX8 A;  3UGQ A;  5GAN j;  3ULR B;  1VQN Q;  1LVK A;  3MPU B;  4HWT A;  2KDS A;  1DJ7 B;  4CC3 A;  1KOG A;  2L3P A;  1V29 B;  4PJO G;  1Y7X A;  4JLI A;  2XD0 A;  4P74 A;  5FU7 C;  2DQ0 A;  1G51 A;  3C95 A;  2E4H A;  4YRF A;  2CP2 A;  4E6R A;  2RHS A;  2A08 A;  3L2U A;  3I56 A;  3EHQ A;  2MF2 A;  1VQM T;  3MP6 A;  1E7O A;  3CC4 A;  2OJ2 A;  3GNG A;  3S6W A;  2NLU A;  1VQK Q;  4RTX A;  3EG9 A;  1C1A A;  1RLQ C;  2M1H A;  2E3C A;  2ZPF B;  3HRU A;  1B8A A;  4GBQ A;  2JVV A;  5K1X A;  3RF1 A;  1WHH A;  3HFZ B;  3CCM A;  1Y0M A;  2YUO A;  3EGX A;  1ZX6 A;  2V8K A;  2XTI A;  2CZ7 B;  1USY A;  1X2K A;  4OMN A;  3VUB A;  2GBQ A;  1P92 A;  5GAM f;  1M1K C;  2F5K A;  1ZHI A;  1VQ8 Q;  2ZNI A;  1QW1 A;  1WZO A;  2RI2 A;  3N5B B;  1G3W A;  2E3I A;  1G83 A;  4M78 E;  1WHJ A;  2RN8 A;  4D8D A;  2QI2 A;  2HL3 A;  3JCM X;  5CKB A;  2FG0 A;  1JJ2 A;  3UWN A;  5A0G A;  5LJ3 e;  4PNO A;  2E3H A;  1Z7N A;  2P4T A;  3CCJ A;  4YRP A;  3FIF A;  3NTK A;  4P75 C;  1QP2 A;  3QXE B;  3KXT A;  1KG1 A;  2HD0 A;  4PFP A;  1Q81 C;  3OS0 A;  2DJQ A;  5IAY A;  1PYS A;  1RAI B;  1MHN A;  4M7D A;  3G6E Q;  4BDZ A;  2XDD A;  2YUP A;  2YLC A;  2K4Y A;  3GBQ A;  5C52 B;  1JJ2 S;  2XU8 A;  4AFU C;  2RH2 A;  3EGX B;  3NMZ C;  3M58 A;  5A0D A;  4C5H A;  3ZEH A;  5GAO l;  3HXU A;  4GLK A;  3OYN A;  3CCJ T;  2CZ1 B;  1K73 C;  2OTJ Q;  1ARK A;  3UPU A;  2FPF A;  4Z88 A;  3SWN B;  4OB3 B;  5HGQ A;  3OYB A;  1RAA B;  4X9C A;  5ELN A;  2BE9 B;  1G5H A;  1QCO A;  2J6K A;  2X4J A;  2FZK B;  4KR3 A;  3HKS A;  2JUF A;  2NUP B;  1NPP A;  3W3S A;  2JMA A;  5KYU A;  1OV3 A;  3QWX X;  2KSS A;  3TU4 K;  4JJB A;  3A8O B;  1XJW B;  2DTI A;  1PYS B;  5A2Q E;  2IY5 B;  2HBW A;  4IUT A;  4QQ6 A;  4WF2 A;  2M51 A;  3LWI A;  2I4L A;  1VQ6 T;  4C8Q D;  1RAD B;  5KYY A;  5FW9 A;  1WJS A;  1UJY A;  2EFI A;  2ESW A;  2NYS A;  4E7Z A;  2KT1 A;  3P8H A;  3MCA B;  2EWN A;  1VQN A;  2EJ9 A;  2L3Q A;  1UJ0 A;  1JRI A;  2D9T A;  2VXF A;  2C8M A;  3HXV A;  1QVF P;  4WCI A;  1G8X A;  3CPW A;  4OF1 A;  2NUP A;  1IGU A;  5GAN h;  3QNE A;  2H3E B;  3M9Q A;  3M54 A;  4IUP A;  3UF4 A;  3VS2 A;  1VQO Q;  1ABQ A;  2HSE B;  3OMC A;  5GAN 3;  1U3O A;  1GCQ A;  4LXC A;  2JTE A;  3REU A;  2DIQ A;  1IHV A;  1VQ7 A;  1AZE A;  2ED0 A;  2CUB A;  4D8K A;  4ATO A;  1B70 A;  2A37 A;  2DTH A;  3L2Z A;  4V2S A;  2DE0 X;  1SSF A;  3MEU A;  3LH5 A;  1N6A A;  3QBY A;  1BU1 A;  3HFV A;  1HK9 A;  1UGP B;  2PU9 B;  2DNU A;  1MMA A;  4ESR A;  1O75 A;  2CRE A;  3PVL A;  1YIJ A;  1XNI A;  5CKD A;  4KGV B;  3ME9 A;  1HC7 A;  12AS A;  1WPY A;  1QCF A;  2C06 A;  2PMF A;  1H4S A;  4R56 A;  3P8B B;  4Y28 E;  1VQ8 A;  3MEA A;  1EVL A;  2ZIM A;  3CXC P;  2GNC A;  1B76 A;  2ABL A;  1H3H A;  2DM1 A;  3QDF A;  2FRY A;  2M0O A;  4HVV A;  4AT1 B;  2EJF A;  4HVU A;  2L89 A;  2MIO A;  2RJF A;  1AVZ C;  4KUD K;  2KYM A;  2M16 A;  2LDM A;  3TRE A;  2PNI A;  2J7I A;  4C8Q A;  1ZSZ B;  2LX9 A;  1WQW A;  3A74 A;  3ZBD A;  1UUE A;  1G3Y A;  4YCU A;  2YUQ A;  3CMA Q;  3L2R A;  2ALY B;  3CCS Q;  1NJI C;  3TEE A;  1KK7 A;  1TH7 A;  2P0K A;  4ORZ A;  1YFN A;  3LYI A;  3G4S T;  2YSQ A;  4J7I A;  4M77 E;  1EFN A;  5CQX A;  3NTI A;  3EG9 B;  1UG1 A;  1RAC B;  2FB7 A;  3OSS C;  1QVG P;  2DER A;  3CPW P;  2P4R A;  4BW9 A;  3G4S Q;  1EQR A;  1VQ4 A;  4DBF A;  2KBT A;  1QWF A;  1V76 A;  1Y96 B;  4C8Q C;  4FU6 A;  5GAM g;  2RQW A;  3CBP A;  1YJ9 Q;  2LMJ A;  2F1L A;  5GAM h;  4KGX B;  4J9E A;  1U06 A;  5L23 A;  3OW2 A;  2E70 A;  1B34 A;  1WX6 A;  3UDC A;  1WXB A;  1JXM A;  3OYE A;  2RI3 A;  2JJ9 A;  1X75 C;  5KYW B;  3I56 T;  2RK2 A;  3M0S A;  2BUD A;  3OYY A;  1QQJ A;  3WVE B;  4E7H A;  1N8R U;  1VQ5 A;  4C8Q F;  4ANJ A;  2ZGW A;  1ZSG A;  3EHR A;  1YWO A;  2DVE A;  2CDT A;  2E64 A;  3FLG A;  3DB4 A;  5AT1 B;  3VS3 A;  2BZY A;  2JM8 A;  1CKA A;  2KXD A;  3G1Z A;  4M75 D;  3GOX A;  2Q7G A;  2PZ1 A;  4HWP A;  1VQP T;  4PJM A;  1JXO A;  2XDP A;  3JB9 I;  4C0G A;  5GAN 5;  2PME A;  4Y91 A;  1SEM A;  4Z8A A;  2FYK A;  3CCU Q;  1PKT A;  1AWW A;  3WQZ A;  2HL5 C;  1VOM A;  2QGG A;  4PHC A;  2C0T A;  2P5I A;  2AT1 B;  3VRZ A;  2FVU A;  1N9S A;  1QMC A;  2QEX T;  3VQY A;  3DLM A;  1QWE A;  2LJ0 A;  4M77 G;  3HXW A;  2Q7H A;  1I0C A;  1WI7 A;  4C0F A;  3BJU A;  2QEX Q;  3I5S A;  1BBZ A;  4YRC A;  2RNA A;  4EPC A;  3PMT A;  4BE0 A;  4AG1 C;  5CKF A;  1NE8 A;  1PNJ A;  4RCC A;  3IKL A;  1YI2 A;  2QG9 B;  4QQG A;  1OZ2 A;  4E47 A;  2DL4 A;  4PL6 A;  2ZAE A;  4DOW A;  8ATC B;  2RK1 A;  4C92 C;  4EDU A;  1KQ2 A;  2HMA A;  4L59 A;  5M9O A;  1N9R A;  4XU2 A;  3CD6 A;  1YIT A;  1RIQ A;  2QHT A;  4J83 A;  3REB B;  2DRK A;  2W10 A;  3FEO A;  3PT9 A;  4EIK A;  1QKW A;  3A7U A;  2H3J A;  2E5A A;  4RQE A;  2EYZ A;  2E5K A;  3JCM b;  2FRW A;  1TUC A;  2XI9 A;  2RQV A;  4EMH A;  3EGU A;  3CC4 Q;  4QT7 A;  2HSP A;  2AK5 A;  4KT0 E;  4F7U E;  4E7I A;  3L2Q A;  3IG2 A;  3VRY A;  2QQR A;  1NPR A;  1VQ6 A;  4J9D A;  2DET A;  4HT9 A;  5GAM d;  3M57 A;  1LNX A;  1AEY A;  2VKN A;  3LH0 A;  3THK A;  4LUD A;  3RNJ A;  3CCM Q;  2ZIN A;  2ROL A;  5IN1 A;  2R57 A;  1IHW A;  1KMM A;  4M7D C;  4HWR A;  4YRS A;  2YXY A;  1NEB A;  5GMK i;  4HWO A;  2CH4 W;  2E65 A;  4LVM A;  5A0L A;  4XTW A;  4NS5 A;  1SG5 A;  5CKE A;  3VS0 A;  3CCR Q;  3M4Y A;  4EMK C;  1FMK A;  2LJ1 A;  1PRM C;  3M59 A;  1KQS P;  4OB1 B;  4GY5 A;  2LQN A;  1M1F A;  1M2O A;  4DA4 A;  1G3T A;  2L5Q A;  2C0O A;  3A5Z B;  4XAX B;  4C92 A;  1GCQ C;  3JB9 J;  3HPW A;  1KMN A;  2VB6 A;  1HJD A;  1YGB A;  1QP3 A;  2KAF A;  5IXB A;  1PCX A;  3NTH A;  3VKI A;  4R0K A;  4P73 A;  1X6G A;  4PJO D;  4X5O A;  2HQH A;  4QVZ A;  1UGQ B;  2CSQ A;  5LJ5 d;  1VQ8 T;  5GAN 7;  1YJN Q;  5HCK A;  1M3B A;  1BBU A;  2ZCE A;  4RMO A;  2LJ3 A;  9ATC B;  1NJ1 A;  2A28 A;  1UFF A;  1ZQ1 A;  2O4X B;  2DA9 A;  4P3O A;  4CS4 A;  3BDU A;  4XTV A;  1YJW Q;  2RHQ A;  3JCM V;  2A8E A;  2ZZE A;  2V1Q A;  3CMA T;  1PSE A;  4B9W A;  1VQK A;  4L5G A;  2M9U A;  3EFO A;  4XK8 E;  4M78 F;  1YNZ A;  2KNB B;  2ECZ A;  1M2V B;  4AG2 C;  2LTO A;  3QO5 A;  4QQD A;  2D6F A;  4HKE A;  1FX7 A;  4RTY A;  2NUT A;  3G71 A;  2EW3 A;  3HXZ A;  2DMO A;  2EBP A;  3VJP A;  3G71 T;  4HVW A;  3VS1 A;  1K9M C;  5IHI A;  3RBB B;  1MGQ A;  3CC7 Q;  1WHG A;  1H92 A;  1MMD A;  2MYS A;  3GIB A;  3RUX A;  4CH3 A;  4DEX A;  1MV0 B;  3OY9 A;  1NLO C;  1IO6 A;  2L0A A;  2L2P A;  1WHK A;  2CJA A;  3TCJ A;  1M3A A;  1RL2 A;  1SPK A;  3MF2 A;  1YCS B;  3QUI A;  2CZ0 B;  4IIM A;  3PTA A;  2HKQ B;  4C8Q G;  1K8A U;  1MV3 A;  2DAQ A;  3UT1 A;  2GGR A;  1D1C A;  1PRL C;  5LJ3 h;  2LQK A;  1KC8 C;  2J6O A;  5FRO A;  4HT8 A;  4OMM A;  3CC2 A;  2ZIO A;  1KIK A;  2QQB A;  3A8G B;  3A98 A;  4L6V 5;  2D1X A;  2BZX A;  4FIB A;  1B07 A;  5LL6 S;  4OLF A;  4RTW A;  4XTZ A;  1T3S A;  1M9S A;  1M8M A;  5LJ5 g;  4JS5 A;  1QVP A;  3EG3 A;  1IXD A;  2RI5 A;  2G3R A;  2DYI A;  3ICA A;  2L3S A;  3V7S A;  4OP0 A;  3NPF A;  2H8H A;  2I0N A;  3HRT A;  4KGZ B;  1R0B G;  4EX5 A;  4K11 A;  4P75 A;  3HRS A;  1EIY B;  4J9B A;  4H2V A;  4HXJ A;  4DQ2 A;  2OI3 A;  1NBE B;  3EH1 A;  4J6X A;  4CS2 A;  1VUB A;  1M1K U;  1AHJ B;  1RAG B;  3TSZ A;  1M1G A;  3JCM W;  3S3O A;  1MND A;  2I4N A;  5EG2 A;  4C8Q B;  2FZG B;  4XU0 A;  4KBM B;  4X1V A;  1WJR A;  3OB9 A;  1HYO A;  2HDA A;  5KYW A;  3H0H A;  1K9M U;  1NNH A;  1RAB B;  3CXC A;  2YLB A;  1ASY A;  2ARU A;  4H2X B;  2YDL A;  2J06 A;  1BYM A;  3JCM c;  1NYQ A;  2EYX A;  3RR6 A;  2DBM A;  4TQF A;  2QDY B;  4M4Z A;  1D3B B;  2GTO A;  2DL5 A;  3VS4 A;  2DIL A;  4TVA B;  3A5Y A;  3HHT B;  2LP5 A;  5IHN A;  3S3N A;  4LN2 A;  1PC0 A;  4M7D G;  4ZNX A;  3FJ5 A;  1B7Y A;  4RMF A;  2E1H A;  1W66 A;  2MOX A;  2RPN A;  3C94 A;  3ASK A;  2AKW B;  4M77 A;  4DBR A;  2YWW A;  2NUT B;  3P8D A;  3I55 T;  4TQD A;  2LVM A;  1WHM A;  4LVK A;  3HY1 A;  3TEG A;  3NEM A;  4C5E A;  3NEL A;  3CCV Q;  2YUN A;  2EJG A;  2KGT A;  4OGC A;  4X9D A;  3M0Q A;  3M0R A;  3MKD A;  1YFS A;  3I55 Q;  4UP7 A;  4A4H A;  1H64 1;  5IHK A;  4P5N A;  2P84 A;  3BDL A;  3V7R A;  2QA4 Q;  2ZZG A;  2J3M A;  4YRE A;  4WJ4 A;  1E24 A;  3HXX A;  3L4G A;  2EAY A;  1EZZ B;  1XQH A;  1WA7 A;  2DEQ A;  2ZPI B;  3KFV A;  3DLL A;  3RMS A;  3MO8 A;  1N9W A;  3M56 A;  1RAE B;  2HKN A;  1UEC A;  4N4G A;  4TVA A;  1RAH B;  1PWT A;  1Y07 A;  2D8H A;  3BY7 A;  1W4S A;  4JDS A;  3QJ6 A;  1M8V A;  3H0I A;  4F7U A;  3CCJ Q;  3GPL A;  3P8Y A;  5FWB A;  2DLP A;  2W0Z A;  2OTJ T;  1Z9Q A;  4FYW B;  3LC0 A;  3OS2 A;  5LJ3 d;  5CQY A;  4RQF A;  1B3Q A;  4FSS A;  4HA8 A;  1VQ4 Q;  3EH2 A;  2QXF A;  3S3M A;  2O9S A;  2K3B A;  1ZUY A;  3G6E A;  3C4S A;  4F14 A;  1X6O A;  2CP7 A;  1Q81 U;  4M7A E;  1LYL A;  1BI3 A;  3JCM g;  1OUL A;  2EYW A;  1YIT Q;  2CP0 A;  1E1T A;  1RLP C;  2P0P A;  2RQT A;  1B70 B;  1PD0 A;  2PUK B;  4KH1 B;  4N4H A;  4LD9 K;  4OGE A;  3VV0 A;  3I7F A;  2AKL A;  5GMK l;  4YRK A;  1D0Y A;  1OU8 A;  2FPD A;  2QHV A;  4FW2 A;  1VQP Q;  1SRM A;  4CC7 A;  3PVQ A;  1H3Z A;  3MP1 A;  1LPL A;  4XEO A;  3HY0 A;  3ZL7 C;  5KE2 A;  4M75 E;  4MDW A;  2EIF A;  1GL5 A;  2VVK A;  1PSF A;  3CCU T;  1VYU A;  1WLP B;  1FWZ A;  1NM7 A;  1NG2 A;  1SET A;  4D6W A;  2LX7 A;  1NJ2 A;  1GCP A;  4H02 A;  2L3R A;  3WVD B;  5FLX E;  5F5W A;  3QG1 A;  1QVF A;  3P8T A;  3CMQ A;  3NHN A;  2ZZF A;  2IIM A;  5KCO A;  3RKX A;  3V8K A;  3BW1 A;  3HTZ A;  3E9F A;  3REA B;  4BI4 A;  2ZT7 A;  2K9G A;  3VS7 A;  3HRI A;  5KYX B;  4C0D B;  4YRO A;  2IVW A;  2BIV A;  1BCO A;  1Z7M A;  1AT1 B;  1WYX A;  1M3C A;  3G71 Q;  1FMV A;  4ZGE B;  2ART A;  2VYT A;  2HBP A;  3M55 A;  4OMQ A;  4XTX A;  4M7A G;  4DEY A;  2F2V A;  5CIU A;  3EGD A;  2EYY A;  4A53 A;  4BY6 B;  2JT4 A;  4FL6 A;  1T0J A;  3VU3 C;  2GFU A;  1BKB A;  2ZZD A;  4OMP A;  4EMG A;  5CKH A;  3HL8 A;  4JS4 A;  3CCE Q;  2DJZ A;  4IUQ A;  1ABO A;  2DO3 A;  3M4P A;  2D0Q B;  3A8M B;  2CKK A;  4AH6 A;  1IRE B;  1D09 B;  4H2S A;  5KYN A;  3QYG B;  4CH6 A;  4YP0 A;  1TS9 A;  4CH5 A;  4M7D B;  4ZN3 A;  3LWH A;  2DD5 A;  1G3S A;  3QDR B;  3I5R A;  1YIJ T;  2EGE A;  4PJO A;  5CR2 A;  3H0F A;  2DK3 A;  2OX7 A;  2SRC A;  4JPB W;  2DU5 A;  1I4K 1;  1H8K A;  4A4F A;  4M78 D;  1UGV A;  1YIJ Q;  4OMF B;  4QVC A;  1VQ5 Q;  4EO4 A;  2CP3 A;  1OPL A;  4LDY A;  4UC4 A;  4M7A B;  4DOV A;  5I2M A;  4F7U F;  1KQS A;  4J6W A;  1I07 A;  4OMO A;  4UPA A;  5GAN g;  3VBB A;  1EFW A;  2ODR D;  2XDB A;  1IGQ A;  5KYU B;  3VYG A;  5GAM e;  1BK2 A;  4J9G A;  3SB2 A;  5C0M A;  1JBM A;  1Q95 G;  4RG2 A;  3H6Z A;  3MEW A;  1M27 C;  1ADY A;  1S1N A;  4UP8 A;  3OYK A;  4C92 G;  4BDY A;  4PLI A;  2CGH A;  3C0C A;  4JZ3 A;  2DXC A;  1OQK A;  1SES A;  1UHF A;  1VQ7 T;  3HP9 A;  2KEA A;  5LJ5 h;  1S72 A;  1J5W A;  3URG A;  1YHQ T;  3QZ5 B;  1YFR A;  4DBH A;  4K87 A;  1M90 U;  2DD4 A;  4ZN1 A;  3VS5 A;  4P3P A;  1I8F A;  1OZ3 A;  1YHQ A;  4PFO A;  3JCM P;  3OYL A;  2DEU A;  4BD3 A;  3U23 A;  4J9F A;  5GAN 2;  4EMK A;  1Q7Y R;  2IY5 A;  4RTZ A;  3VQX A;  5LJ5 e;  1TU0 B;  5KH6 A;  3CCR A;  1QF6 A;  1WXU A;  3PE0 A;  4VUB A;  2LCC A;  1WU7 A;  5J26 A;  2MI6 A;  7AT1 B;  1W2B P;  1W2B S;  1GBR A;  3RAC A;  1KHC A;  1JJ2 P;  4P72 A;  1W70 A;  4A4K A;  3DSQ A;  3LX7 A;  4WJ3 M;  1SF9 A;  2KE9 A;  3CCV T;  2AKK A;  5GAM j;  3J81 E;  5DLQ E;  1YWP A;  3PMI A;  5CO7 A;  1Y71 A;  3CME A;  4J9C A;  2AZV A;  3CCV A;  2Q7E A;  4RCB A;  3FB9 A;  2SEM A;  1NJ8 A;  2RQU A;  2J6F A;  4QKU A;  4YRG A;  2QDL A;  3TUP A;  2I2L A;  3DKM A;  3E9H A;  3V8J A;  2I4M A;  2JNG A;  2F5T X;  1E6G A;  4LUE A;  2QHU A;  1UHC A;  5I22 A;  2OTL A;  3MJX A;  2KVQ G;  3M4G A;  1X27 A;  3PIO A;  1GXI E;  2RO0 A;  3OQ5 A;  2HNI A;  3JB9 G;  1NEG A;  4O5V A;  1X01 A;  1U1S A;  5GAN d;  4M7D D;  1EIF A;  3MEV A;  3E2U A;  4C8Q E;  1JO8 A;  3UGT A;  1GFC A;  1OU9 A;  2DF6 A;  4BY6 C;  4F16 A;  2EGA A;  3HSB A;  2RB6 A;  2G6F X;  3CC2 T;  1E1O A;  3QPH A;  3JB9 H;  3A8H B;  3EAE A;  1K0X A;  2A7Y A;  1AOJ A;  2FO0 A;  4YRR A;  4H2W A;  2CT3 A;  1YI2 Q;  1R0C B;  2A0F B;  3CC2 Q;  4MDX A;  5C51 B;  2Y4Y A;  3AHU A;  1LJO A;  2OAU A;  2QQ9 A;  4M75 B;  3CCU A;  1W2B A;  1K9M R;  2E6Z A;  3FRN A;  4E7J A;  1N8R R;  2LNV A;  2PVO B;  2KRN A;  4RUG A;  5KE3 A;  1TOV A;  2LRQ A;  4E7L A;  3UA7 A;  1K9A A;  1U1T A;  5GAN 8;  2CH4 A;  4RTV A;  1B7T A;  4CC2 A;  3OD1 A;  4PJN A;  2EQU A;  3EFS A;  1F1B B;  2K3X A;  4N4I A;  4BUG A;  3CC7 A;  4XU1 A;  2F2W A;  1GBQ A;  4R55 A;  2MWP A;  1O9S A; 
#chains in the Genus database with same CATH homology
 5LJ3 f;  4M7D F;  5HKC A;  1BIB A;  4IUR A;  3CPF A;  2YRV A;  1X2H A;  3E9I A;  4G84 A;  1VQK T;  1NYR A;  3PFS A;  1VQZ A;  1KHI A;  3JB9 D;  4RDX A;  5GAN f;  1NJI U;  4M7D E;  3A7R A;  3JCM e;  1KQS S;  2E41 A;  2VGM A;  3OS5 A;  3PZC A;  1XOV A;  4C0Z A;  2P0L A;  2K5F A;  4X34 A;  4LDX A;  2ZT5 A;  4CS3 A;  3OMG A;  4PLL A;  2HQE A;  3J80 E;  3FC3 A;  4C5I A;  4OVA A;  1VIF A;  3JCM Q;  2O01 E;  4P71 C;  3CCQ A;  4E51 A;  3GF5 A;  2V8J A;  4J7F A;  4J15 A;  3V8L A;  2DKG A;  3VQV A;  2B8A A;  1YB3 A;  1Q7Y C;  1EVK A;  3DB3 A;  3OS1 A;  3TEH A;  3RKW A;  1VQL T;  1VIE A;  3I55 A;  2Y90 A;  4YRI A;  1HTT A;  2JZ2 A;  1VQM A;  4JUV A;  4H2X A;  1UB4 A;  1SRY A;  4HWS A;  3FJP A;  1M4Z A;  2KY9 A;  5GAN e;  3A8L B;  4F7U G;  3GNF B;  1N27 A;  4ELZ C;  4ZTU B;  3LW5 E;  2Y4X A;  5GMK h;  2XKO C;  4K88 A;  3G6E T;  4J6Y A;  1EIY A;  4PJO E;  2ZNJ A;  4YRN A;  4ZTJ A;  1SER A;  1VQ9 T;  4BE1 A;  4ZIB A;  2R5A A;  2OTJ A;  3OBW A;  2IG0 A;  2GQV A;  4IKF A;  2K3Y A;  4P74 C;  4MMK A;  3QTC A;  3CPW S;  3X20 B;  3QO3 A;  3JCM h;  3A32 A;  5GMK j;  2CJ9 A;  2DDZ A;  2ZPH B;  4P72 C;  1BI2 A;  1R8O B;  5HY6 A;  2XGT A;  3CC4 T;  4LNS A;  1ZBX A;  3A7A A;  4F7U B;  1BI0 A;  3E1S A;  3CEY A;  3CMA A;  2CJB A;  1JJC B;  1VQO A;  5I2S A;  3RL6 A;  1QVG A;  4ME7 A;  3M53 A;  1XTD A;  2FL7 A;  3CCM T;  2F69 A;  4UP9 A;  1L0W A;  5GAO q;  3PGG A;  4MML A;  4YTL A;  1BI1 A;  4ZGJ B;  1QE0 A;  2XG8 D;  3KUF A;  2PUO B;  4E7K A;  3CXC S;  3TEH B;  3OW2 S;  1X55 A;  4G85 A;  2DZC A;  4M75 F;  5CAI A;  1K8A C;  2GF7 A;  3QJY A;  4Z02 A;  1YJN A;  4ZTZ B;  3REX A;  3C12 A;  1BBW A;  4M77 B;  1UGS B;  2AKW A;  4O6J A;  4BAC A;  3UFG A;  5IT9 E;  1H4Q A;  1H4T A;  2RHS B;  5GAO r;  1YJW T;  4DPG A;  2AMC B;  2P0Q A;  2KK4 A;  1QVG S;  2K57 A;  4IUV A;  1I81 A;  3HRK A;  3P8V A;  2C7I A;  5LJ5 j;  4FM4 B;  1E22 A;  4ZTF A;  3OYF A;  3KFU A;  3LGL A;  2ZPB B;  1YJN T;  3MP8 A;  4M78 B;  4XTY A;  4A54 A;  5CVI A;  2EYQ A;  5GAN 4;  4ZGD B;  4P73 C;  4M7A C;  3NEN A;  4Q6G A;  4B9X A;  1G5V A;  2RHY A;  3RER A;  3HXY A;  1N8R C;  2XK0 A;  4PG3 A;  3GP8 A;  3H8Z A;  5J39 A;  2DXU A;  4YRL A;  2KMT A;  1Q82 U;  1Q86 U;  4FSX A;  1VQ5 T;  2WSF E;  3CCS T;  3UH0 A;  3A31 A;  4XQ3 A;  1U8R A;  1YCY A;  3QZ9 B;  4M78 A;  4TWA A;  2ZXF A;  4YDQ A;  1KD1 U;  4XEM A;  5DLO A;  1B34 B;  5KNN A;  1JB0 E;  4N0A A;  4TVY A;  4NOY A;  1WYD A;  1JJC A;  4MZT A;  5CCA A;  4EMK B;  4OB2 B;  2KQW A;  1D3B A;  3VUZ A;  2RHX A;  5FU6 C;  5FU6 B;  1I5L A;  5LJ5 f;  5GMK e;  1WJQ A;  3CD6 T;  3FDR A;  1X54 A;  3G4S A;  4CRI A;  1ADJ A;  3OYC A;  1QVF S;  4C92 E;  2DZ9 A;  2PQW A;  3OYJ A;  4XTU A;  4KUI A;  2OTL T;  5HK0 A;  2Q5H A;  2MWO A;  1YJ9 T;  1ASZ A;  3L1A A;  3L42 A;  2QHS A;  2K5I A;  2A3L A;  3V7C A;  4M7A A;  1VQN T;  3MF1 A;  1VQO T;  4A4G A;  3L2W A;  2ZT6 A;  3JSC A;  3JCM J;  2K2V A;  3CME T;  4HVC A;  3RIR A;  2RM4 A;  1Q82 C;  1Q86 C;  2QQA A;  2V8I A;  3EFR A;  3LSQ A;  4MZP A;  2EQJ A;  2DU7 A;  2EQK A;  5GAN 6;  3X28 B;  2WAC A;  2DXB A;  2WSE E;  3QO7 A;  5FRN A;  5FRM A;  3JCM f;  4KQE A;  4BI8 B;  5GAO m;  1FYF A;  3PIP A;  4NL3 A;  3R6O A;  3J7A F;  2G4C A;  1X2G A;  1EOV A;  2PVD B;  1VQ4 T;  2EL9 A;  4YRJ A;  4K86 A;  3CCS A;  4Q5W A;  2X4X A;  2ZCF B;  3OYM A;  3OSV A;  4OB0 B;  4BWA A;  3BFM A;  4YPF A;  4BI3 A;  3OYD A;  2ZPE B;  1NJ6 A;  4IUU A;  2J3L A;  5K1P A;  2CZ6 B;  4HCZ A;  4YRT A;  3PCO B;  3JRZ A;  2R5M A;  4BB7 A;  3QYH B;  3F70 A;  2RJD A;  3ER0 A;  4C92 F;  1KC8 U;  2RA2 A;  2ZTG A;  3ZFJ A;  2ZR3 A;  3RES A;  4M77 C;  4HT4 A;  3MEY A;  4Q15 A;  4KUL A;  3HFN A;  4LDW A;  1G5I A;  1YFT A;  2YHT A;  3SWN A;  3E9G A;  2RHI A;  2HAX A;  3CCR T;  4TTV A;  3SWN C;  3A5Z A;  2DTO A;  4N0A C;  3JB9 F;  2CIM A;  3CBM A;  3R07 A;  2RJC A;  5C53 B;  4L87 A;  2K5L A;  3MQZ A;  3OYG A;  2E12 A;  5I21 A;  2ARS A;  3OYI A;  3X26 B;  1FXX A;  1VQL A;  3E19 A;  1M5Q 1;  1M90 C;  2LC4 A;  2R58 A;  4YCV A;  3KBG A;  3QO8 A;  1X56 A;  4YYE A;  2MMP A;  3T9N A;  4FT4 A;  3RMQ A;  4WI1 A;  1YJ9 A;  3SDZ A;  3G7Z A;  4BE2 A;  1WQ7 A;  3VQW A;  4YRM A;  3L4G B;  2LT4 A;  4QVD A;  4YRQ A;  1VQ9 A;  2E5Q A;  2RD1 A;  3NFC A;  3JAM E;  3ERR A;  2X4W A;  4LVI A;  5CK9 A;  4JRK A;  2LCL A;  4H2U A;  2XHC A;  5DM7 R;  2NS6 A;  3LSS A;  2X35 A;  4M75 A;  3CC7 T;  4JJN K;  2RHU A;  2E6N A;  2HQX A;  3QSU A;  1VQP A;  3IAL A;  3GLX A;  4NL2 A;  5GMK m;  2LT1 A;  4H2T A;  2XID A;  1KD1 C;  11AS A;  2RHZ A;  2CS7 A;  3JCM d;  3CCE A;  2EKO A;  2GCX A;  4JRI A;  4PJO C;  3CCE T;  4LVJ A;  5D6Y A;  4PJO B;  1YBY A;  5GAO n;  2QEX A;  3INZ A;  1S72 T;  3PCO A;  4TVR A;  1RI0 A;  3VYH B;  5KCH A;  4M77 F;  4QW2 A;  2L8D A;  3X25 B;  1UGR B;  5DY9 A;  4C5G A;  4M7A D;  1OYX A;  2DXT A;  1C0A A;  5L8R E;  4LD6 A;  3RKY A;  3LGF A;  2PVG B;  2DIG A;  3WXM B;  5ELO A;  1NZ9 A;  4M75 G;  5D6W A;  3HFZ A;  2VXE A;  2GFA A;  3OA6 A;  2EQM A;  2ALY A;  1OI1 A;  3HFO A;  3X24 B;  2ODR C;  1H4V B;  5FU7 B;  2QQS A;  3MET A;  3SD4 A;  1NJ5 A;  4J5Y A;  2ZPG B;  1YJW A;  3Q1J A;  3CCL A;  1B7Y B;  1Y96 A;  4M7A F;  4HCB A;  4A4E A;  1WNL A;  1BIA A;  4PJO F;  4M78 C;  2Q5I A;  2LQ8 A;  1GGM A;  4II1 A;  2O4X A;  3QII A;  4ELY C;  3MHX A;  2MAM A;  4MZM A;  2ZR2 A;  2VC8 A;  3M4Q A;  4C92 D;  3PNW C;  5AYF A;  2AHJ B;  4LDV A;  4PKC C;  4J8O A;  3OBY A;  1WLE A;  3L2V A;  2X4Y A;  5E3I A;  2FHD A;  3O8V A;  4LVL A;  1LOJ A;  4CI0 C;  2VV5 A;  1USY C;  4O2D A;  4NCX A;  4H2Y A;  4RG8 A;  4C0D C;  4LDU A;  4M77 D;  4P71 A;  2QA4 A;  3QHS A;  2BKD N;  4M78 G;  2AMC A;  1WGS A;  4XU3 A;  2DPP B;  2RHQ B;  2QA4 T;  3RGL A;  2WSC E;  3SFM A;  2CYZ B;  4JRP A;  2DQ3 A;  3OYH A;  4P3N A;  5LJ3 j;  3OYA A;  3IKM B;  1K73 U;  4TVW A;  2RJE A;  5GAO p;  4JRQ A;  4HCC A;  4KR2 A;  2JOY A;  3NET A;  3M5A A;  4FT2 A;  1IZ6 A;  1KQ1 A;  4JLG A;  4M75 C;  2I4O A;  2JN0 A;  5D6X A;  3LLR A;  2JTM A;  1ATI A;  2VUB A;  4C92 B;  1YI2 T;  3CBO A;  5J3B A;  2JTF A;  4YCW A;  4RKU E;  2VGN A;  1HXD A;  2QTX A;  5LJ3 g;  4CH4 A;  2ZT8 A;  1IL2 A;  1YIT T;  5HK3 A;  1Q7Y U;  3CCQ T;  2XIC A;  3QKJ A;  3CCL T;  2E10 A;  5C6S A;  3UGQ A;  5GAN j;  4HWT A;  2KDS A;  1DJ7 B;  1KOG A;  1V29 B;  4PJO G;  1Y7X A;  4JLI A;  4P74 A;  2XD0 A;  5FU7 C;  2DQ0 A;  1G51 A;  3C95 A;  4YRF A;  2RHS A;  3L2U A;  3I56 A;  2MF2 A;  1VQM T;  3MP6 A;  3CC4 A;  3GNG A;  3S6W A;  2NLU A;  2M1H A;  2E3C A;  2ZPF B;  3HRU A;  1B8A A;  2JVV A;  5K1X A;  3RF1 A;  3HFZ B;  3CCM A;  2V8K A;  2XTI A;  2CZ7 B;  1USY A;  3VUB A;  1P92 A;  5GAM f;  1M1K C;  2F5K A;  1ZHI A;  2ZNI A;  1QW1 A;  2RI2 A;  3N5B B;  1G3W A;  4M78 E;  2QI2 A;  3JCM X;  5CKB A;  1JJ2 A;  3UWN A;  5A0G A;  5LJ3 e;  4PNO A;  1Z7N A;  2P4T A;  2MWP A;  3CCJ A;  4YRP A;  3FIF A;  3NTK A;  4P75 C;  1QP2 A;  3QXE B;  3KXT A;  1KG1 A;  2HD0 A;  1Q81 C;  3OS0 A;  5IAY A;  1PYS A;  1MHN A;  4M7D A;  4BDZ A;  2XDD A;  2YLC A;  2K4Y A;  5C52 B;  1JJ2 S;  2XU8 A;  2RH2 A;  3M58 A;  5A0D A;  4C5H A;  3ZEH A;  5GAO l;  3HXU A;  4GLK A;  3OYN A;  3CCJ T;  2CZ1 B;  1K73 C;  3UPU A;  3SWN B;  4OB3 B;  5HGQ A;  3OYB A;  4X9C A;  5ELN A;  1G5H A;  2X4J A;  4KR3 A;  3HKS A;  2JUF A;  1NPP A;  3W3S A;  2KSS A;  3TU4 K;  3A8O B;  2DTI A;  1PYS B;  5A2Q E;  2IY5 B;  4IUT A;  4QQ6 A;  4WF2 A;  3LWI A;  2I4L A;  1VQ6 T;  4C8Q D;  1WJS A;  2EFI A;  3P8H A;  3MCA B;  2EWN A;  1VQN A;  2EJ9 A;  1JRI A;  2D9T A;  2VXF A;  2C8M A;  3HXV A;  3CPW A;  4OF1 A;  5GAN h;  3QNE A;  3M9Q A;  3M54 A;  4IUP A;  3OMC A;  5GAN 3;  3REU A;  2DIQ A;  1VQ7 A;  4ATO A;  1B70 A;  2DTH A;  3L2Z A;  4V2S A;  1SSF A;  3MEU A;  1N6A A;  3QBY A;  3HFV A;  1HK9 A;  1UGP B;  2PU9 B;  1O75 A;  1YIJ A;  1XNI A;  5CKD A;  3ME9 A;  1HC7 A;  12AS A;  1WPY A;  2C06 A;  2PMF A;  1H4S A;  4R56 A;  3P8B B;  4Y28 E;  1VQ8 A;  3MEA A;  1EVL A;  2ZIM A;  1B76 A;  2M0O A;  2EJF A;  2L89 A;  2RJF A;  4KUD K;  2M16 A;  2LDM A;  3TRE A;  4C8Q A;  2LX9 A;  1WQW A;  3A74 A;  3ZBD A;  1G3Y A;  4YCU A;  3L2R A;  2ALY B;  1NJI C;  3TEE A;  1TH7 A;  2P0K A;  3LYI A;  3G4S T;  4J7I A;  4M77 E;  5CQX A;  3NTI A;  2FB7 A;  3OSS C;  4BW9 A;  1EQR A;  1VQ4 A;  1Y96 B;  4C8Q C;  4FU6 A;  5GAM g;  3CBP A;  5GAM h;  3OW2 A;  2E70 A;  1B34 A;  3UDC A;  3OYE A;  2RI3 A;  1X75 C;  3I56 T;  2RK2 A;  2BUD A;  3OYY A;  3WVE B;  4E7H A;  1N8R U;  1VQ5 A;  4C8Q F;  2ZGW A;  2DVE A;  2E64 A;  3FLG A;  3DB4 A;  3G1Z A;  4M75 D;  3GOX A;  2Q7G A;  4HWP A;  1VQP T;  2XDP A;  3JB9 I;  4C0G A;  5GAN 5;  2PME A;  4Y91 A;  2FYK A;  3WQZ A;  4PHC A;  2P5I A;  2FVU A;  1N9S A;  2QEX T;  3VQY A;  3DLM A;  4M77 G;  3HXW A;  2Q7H A;  4C0F A;  3BJU A;  4YRC A;  4EPC A;  3PMT A;  4BE0 A;  5CKF A;  1NE8 A;  4RCC A;  3IKL A;  1YI2 A;  4QQG A;  1OZ2 A;  4E47 A;  4PL6 A;  4DOW A;  2RK1 A;  4C92 C;  4EDU A;  1KQ2 A;  4L59 A;  5M9O A;  1N9R A;  4XU2 A;  3CD6 A;  1YIT A;  1RIQ A;  2QHT A;  4J83 A;  3FEO A;  3PT9 A;  3A7U A;  2H3J A;  2E5A A;  4RQE A;  3JCM b;  2XI9 A;  4EMH A;  4KT0 E;  4F7U E;  4E7I A;  3L2Q A;  3IG2 A;  2QQR A;  1NPR A;  1VQ6 A;  4HT9 A;  5GAM d;  3M57 A;  1LNX A;  3LH0 A;  2ZIN A;  5IN1 A;  2R57 A;  1KMM A;  4M7D C;  4HWR A;  4YRS A;  5GMK i;  4HWO A;  2E65 A;  4LVM A;  5A0L A;  4XTW A;  4NS5 A;  5CKE A;  3M4Y A;  4EMK C;  3M59 A;  4OB1 B;  4GY5 A;  1M1F A;  4DA4 A;  1G3T A;  2L5Q A;  3A5Z B;  4XAX B;  4C92 A;  3JB9 J;  3HPW A;  1KMN A;  1YGB A;  1QP3 A;  2KAF A;  3NTH A;  3VKI A;  4P73 A;  4PJO D;  4X5O A;  4QVZ A;  1UGQ B;  5LJ5 d;  1VQ8 T;  5GAN 7;  1BBU A;  2ZCE A;  4RMO A;  1NJ1 A;  1ZQ1 A;  2O4X B;  4P3O A;  4CS4 A;  3BDU A;  4XTV A;  2RHQ A;  3JCM V;  2A8E A;  2ZZE A;  3CMA T;  1PSE A;  4B9W A;  1VQK A;  4L5G A;  2M9U A;  4XK8 E;  4M78 F;  2LTO A;  3QO5 A;  4QQD A;  2D6F A;  4HKE A;  1FX7 A;  3G71 A;  3HXZ A;  3VJP A;  3G71 T;  1K9M C;  1MGQ A;  3GIB A;  3RUX A;  4CH3 A;  3OY9 A;  2CJA A;  3TCJ A;  1RL2 A;  3MF2 A;  3QUI A;  2CZ0 B;  3PTA A;  4C8Q G;  1K8A U;  2DAQ A;  3UT1 A;  5LJ3 h;  2LQK A;  1KC8 C;  5FRO A;  4HT8 A;  3CC2 A;  2ZIO A;  2QQB A;  3A8G B;  4L6V 5;  4FIB A;  5LL6 S;  4OLF A;  4XTZ A;  5LJ5 g;  1M9S A;  4JS5 A;  1QVP A;  2RI5 A;  2G3R A;  3ICA A;  3V7S A;  4OP0 A;  3HRT A;  4EX5 A;  4P75 A;  3HRS A;  1EIY B;  4H2V A;  4DQ2 A;  4J6X A;  4CS2 A;  1VUB A;  1M1K U;  1AHJ B;  1M1G A;  3JCM W;  3S3O A;  2I4N A;  5EG2 A;  4C8Q B;  4XU0 A;  4KBM B;  1WJR A;  3OB9 A;  1K9M U;  1NNH A;  3CXC A;  2YLB A;  1ASY A;  2ARU A;  4H2X B;  1BYM A;  1NYQ A;  3JCM c;  4TQF A;  2QDY B;  1D3B B;  4TVA B;  3A5Y A;  3HHT B;  3S3N A;  4M7D G;  1B7Y A;  4RMF A;  2E1H A;  1W66 A;  3C94 A;  3ASK A;  2AKW B;  4M77 A;  3I55 T;  3P8D A;  4TQD A;  2LVM A;  4LVK A;  3HY1 A;  3TEG A;  3NEM A;  4C5E A;  3NEL A;  2EJG A;  4OGC A;  4X9D A;  1YFS A;  4UP7 A;  4A4H A;  1H64 1;  4P5N A;  3BDL A;  3V7R A;  2ZZG A;  2J3M A;  4YRE A;  4WJ4 A;  1E24 A;  3HXX A;  3L4G A;  2EAY A;  1XQH A;  2DEQ A;  2ZPI B;  3DLL A;  3RMS A;  3MO8 A;  1N9W A;  3M56 A;  4N4G A;  4TVA A;  1Y07 A;  3BY7 A;  1W4S A;  4JDS A;  3QJ6 A;  1M8V A;  4F7U A;  3GPL A;  3P8Y A;  2OTJ T;  3LC0 A;  3OS2 A;  5LJ3 d;  5CQY A;  4RQF A;  4HA8 A;  2QXF A;  3S3M A;  3G6E A;  3C4S A;  1X6O A;  1Q81 U;  4M7A E;  1LYL A;  1BI3 A;  3JCM g;  1E1T A;  2P0P A;  1B70 B;  2PUK B;  4N4H A;  4LD9 K;  4OGE A;  3VV0 A;  3I7F A;  5GMK l;  4YRK A;  2QHV A;  1H3Z A;  3MP1 A;  4XEO A;  3HY0 A;  5KE2 A;  4M75 E;  4MDW A;  2EIF A;  1PSF A;  3CCU T;  1FWZ A;  1SET A;  4D6W A;  1NJ2 A;  4H02 A;  2L3R A;  3WVD B;  5FLX E;  5F5W A;  3QG1 A;  1QVF A;  3P8T A;  3CMQ A;  2ZZF A;  5KCO A;  3RKX A;  3V8K A;  3BW1 A;  3HTZ A;  3E9F A;  4BI4 A;  2ZT7 A;  3HRI A;  4C0D B;  4YRO A;  2IVW A;  2BIV A;  1Z7M A;  4ZGE B;  2ART A;  2VYT A;  2HBP A;  3M55 A;  4XTX A;  4M7A G;  5CIU A;  4A53 A;  4BY6 B;  4FL6 A;  3VU3 C;  2GFU A;  1BKB A;  2ZZD A;  4EMG A;  5CKH A;  3HL8 A;  4JS4 A;  2DJZ A;  4IUQ A;  2DO3 A;  3M4P A;  2D0Q B;  3A8M B;  2CKK A;  4AH6 A;  1IRE B;  4H2S A;  3QYG B;  4CH6 A;  4YP0 A;  4CH5 A;  4M7D B;  4ZN3 A;  3LWH A;  2DD5 A;  1G3S A;  3QDR B;  1YIJ T;  4PJO A;  5CR2 A;  2DK3 A;  2DU5 A;  1I4K 1;  4A4F A;  4M78 D;  4OMF B;  4QVC A;  4EO4 A;  4LDY A;  4UC4 A;  4M7A B;  4DOV A;  5I2M A;  4F7U F;  1KQS A;  4J6W A;  4UPA A;  5GAN g;  3VBB A;  1EFW A;  2ODR D;  2XDB A;  3VYG A;  5GAM e;  3SB2 A;  5C0M A;  1JBM A;  4RG2 A;  3H6Z A;  3MEW A;  1ADY A;  4UP8 A;  3OYK A;  4C92 G;  4BDY A;  4PLI A;  2CGH A;  2DXC A;  1SES A;  1VQ7 T;  3HP9 A;  5LJ5 h;  1S72 A;  1J5W A;  3URG A;  1YHQ T;  3QZ5 B;  1YFR A;  4K87 A;  1M90 U;  2DD4 A;  4ZN1 A;  4P3P A;  1I8F A;  1OZ3 A;  1YHQ A;  3JCM P;  3OYL A;  4BD3 A;  5GAN 2;  4EMK A;  2IY5 A;  3VQX A;  5LJ5 e;  5KH6 A;  3CCR A;  1QF6 A;  4VUB A;  2LCC A;  1WU7 A;  5J26 A;  2MI6 A;  1W2B S;  3RAC A;  1KHC A;  4P72 A;  4A4K A;  3DSQ A;  3LX7 A;  4WJ3 M;  3CCV T;  5GAM j;  3J81 E;  5DLQ E;  3PMI A;  5CO7 A;  1Y71 A;  3CME A;  3CCV A;  2Q7E A;  4RCB A;  3FB9 A;  1NJ8 A;  4YRG A;  3TUP A;  2I2L A;  3DKM A;  3E9H A;  3V8J A;  2I4M A;  2JNG A;  2F5T X;  2QHU A;  2OTL A;  2KVQ G;  3M4G A;  3PIO A;  1GXI E;  2RO0 A;  3OQ5 A;  2HNI A;  3JB9 G;  4O5V A;  1X01 A;  1U1S A;  5GAN d;  4M7D D;  1EIF A;  3MEV A;  4C8Q E;  3UGT A;  4BY6 C;  3HSB A;  2RB6 A;  3CC2 T;  1E1O A;  3QPH A;  3JB9 H;  3A8H B;  3EAE A;  2A7Y A;  4YRR A;  4H2W A;  5C51 B;  4MDX A;  2Y4Y A;  3AHU A;  1LJO A;  2OAU A;  2QQ9 A;  4M75 B;  3CCU A;  1W2B A;  2E6Z A;  3FRN A;  4E7J A;  2LNV A;  2PVO B;  5KE3 A;  2LRQ A;  4E7L A;  1U1T A;  5GAN 8;  3OD1 A;  2EQU A;  3EFS A;  2K3X A;  4N4I A;  4BUG A;  3CC7 A;  4XU1 A;  4R55 A;  1UEB A;  1O9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...