2DTIA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, pyrophosphate and mn(2+)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
total genus 69
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dtiA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dtiA01
4M78A 4C92F 1QF6A 2J3MA 2RM4A 2ZNJA 3FIFA 3BFMA 3ICAA 5GAMd 5GAOl 4EMKC 2PMEA 4M7DE 2CIMA 4EMKA 3QO3A 4YROA 3PZCA 4H2SA 4F7UE 4P3NA 1BBWA 1WLEA 1WNLA 2CGHA 1JJCB 4JLIA 2AMCA 2E65A 3QNEA 5GAN3 1YFTA 4A54A 2ALYB 4YRNA 2YHTA 4M7DA 4NCXA 2E1HA 4H2WA 4XTWA 1Y96B 4J6WA 1VQZA 4PG3A 3REUA 5GMKj 3ERRA 3VU3C 4M77D 5GANg 3UGTA 3V7CA 4M75G 5GAN8 5GAMh 4KQEA 3JCMg 4XTYA 4YRMA 4Y91A 4M75D 2E64A 3JB9D 5GAN5 5ELOA 11ASA 2C8MA 4XTZA 4XU0A 4C92G 2ZR3A 3DSQA 2DXTA 1X2HA 1B34B 3RF1A 2K57A 1NJ2A 4YRRA 2DZ9A 1ATIA 3V7RA 2I4NA 1G5HA 4M78F 5LJ3j 5GAN2 4H2TA 3RIRA 1I4K1 2DU5A 3JCMV 2FB7A 1H4SA 3I7FA 3RACA 4XU1A 4M75C 4JRIA 3IKMB 3BW1A 3QSUA 4TWAA 1SETA 3EFSA 1WQ7A 5LJ3d 3P8YA 3RKWA 1B70B 2ZZFA 2JN0A 5GMKm 3IG2A 2DKGA 4C8QE 4G85A 3M4PA 3JB9F 4M75B 1TH7A 3QUIA 4M75F 5DY9A 4AH6A 3TUPA 4H2YA 1I5LA 4P75A 4M7AB 2QHVA 4E51A 3HXWA 5GANh 4M7AA 1G51A 2DVEA 2ZIOA 3A5ZA 3SWNA 4P74C 2ARTA 1KMMA 3HFVA 4OP0A 1B70A 4M77E 1FYFA 2CJAA 1KOGA 5C52B 1LYLA 2Q5IA 4Q15A 5LJ5g 2ARUA 2YLBA 4TTVA 3HY1A 4CH4A 3PGGA 4BW9A 4HA8A 3RUXA 4DPGA 1EOVA 4PJOC 4M77A 3INZA 1EVLA 1PYSB 3OD1A 3JB9G 3HRIA 3HXVA 5GAOr 1NJ6A 1B8AA 5GANd 3JB9J 4C8QF 3UH0A 3JCMd 4PNOA 3QO8A 5GANf 1YB3A 2RHSA 3E9IA 4F7UF 1HK9A 2E3CA 4M7DG 1ASZA 2C7IA 1B34A 4Q6GA 1ADYA 2RD1A 3JCMX 4C92C 1WPYA 4JRKA 1G5IA 4F7UB 12ASA 1N9RA 4HWOA 2QHTA 4YP0A 4PJOG 4UP8A 4P3PA 3SWNC 4XQ3A 4CS2A 2ALYA 1E24A 4XTUA 2J3LA 4C8QD 4EX5A 3RL6A 2ODRD 5LJ5j 2I2LA 1BIBA 5GAMf 3JCMb 3A7UA 2AMCB 4K86A 2Q5HA 2ZCEA 1BBUA 4M7DC 3PCOA 2RA2A 1YFSA 1JBMA 3JCMc 4C92E 4C8QA 3VBBA 2E41A 4M77C 2ZZEA 2VXFA 1GGMA 3L4GA 1N9SA 3MEYA 4M7AD 4M78B 3HFZB 5GANj 1NJ1A 3MF1A 2DU7A 4XEOA 1JRIA 2I4LA 3NELA 4J6YA 4HWRA 1X54A 3VQWA 3KFUA 2XTIA 1KQ1A 4HT9A 3R07A 5GAOm 5ELNA 1NNHA 4A53A 1LJOA 4YYEA 1H4QA 4KR2A 4C92A 2ZGWA 3HXXA 3M4GA 4V2SA 3A32A 4ZTZB 4M7AC 1I8FA 3HFNA 4P73C 4CH6A 5GAN4 3L1AA 4YRQA 2RB6A 2DTHA 4HT8A 5LJ3g 4RDXA 3RERA 3FB9A 1W66A 1E1TA 1USYA 2PMFA 3NETA 2I4MA 3HY0A 4P71C 3JCMf 3V8JA 1USYC 2I4OA 2VC8A 4XEMA 3HFZA 4M7AE 3P8VA 4F7UG 4WI1A 2E5AA 3VQVA 1X55A 2EJFA 1HC7A 4EMHA 4TVYA 3TEHB 4M77G 4YREA 2YLCA 1H4TA 5K1XA 2HNIA 4PJOB 5KNNA 4P73A 4CS3A 4RQFA 3PCOB 4M78G 1E1OA 2ZTGA 3RKXA 4J6XA 4RCBA 4XTXA 4C92D 3HSBA 3UGQA 4XTVA 2P5IA 4TVAB 1SERA 3QO5A 1MGQA 5GMKe 2QHSA 5GMKh 5GANe 1SRYA 2EL9A 2ZZGA 3QTCA 5C51B 4UP9A 2Y90A 3JCMe 5CAIA 4UPAA 4M78C 1D3BB 3V7SA 5GMKl 5LJ5h 1SESA 4NL3A 2ZT5A 3W3SA 2E10A 1C0AA 1H4VB 2DTOA 3MF2A 4PHCA 4LNSA 4YRGA 5F5WA 1RIQA 2G4CA 5GAOp 1NYRA 2DDZA 3A7RA 3A31A 3HXUA 2RHQA 3FJPA 2ZT8A 3JCMW 3QHSA 5LJ5f 2IY5A 4M77F 4QVDA 4EMGA 3IKLA 2ARSA 1Z7MA 2AKWB 1X2GA 3L4GB 1KQ2A 4RMFA 3G1ZA 4ZTUB 4M77B 3LSSA 4KR3A 3JB9H 4MMLA 1U1TA 3M4QA 1PYSA 2QHUA 4UP7A 3E9HA 3JCMh 3LC0A 3P8TA 5E3IA 4RCCA 1B7YB 4PJOF 4YRKA 4P72A 4K87A 4EO4A 4WJ4A 4YRPA 4XU3A 4YRTA 2DQ3A 2FYKA 3SWNB 3HXZA 2RHQB 1ASYA 3L2ZA 3HFOA 1U1SA 2DXUA 5HGQA 3IALA 1X56A 4TQFA 2P0LA 2ZXFA 4O2DA 4RQEA 4TVWA 3RESA 3WQZA 3RGLA 4NOYA 1WYDA 3BY7A 2CJ9A 2ZINA 2Q7GA 4C8QG 5K1PA 4YRFA 4H02A 4XU2A 4L87A 1L0WA 1B7YA 4J5YA 2RHSB 4N0AA 4WF2A 3HRKA 4YCWA 1M8VA 2QTXA 1EFWA 1JJCA 3JB9I 3JCMJ 5LJ5e 5GAN7 1ADJA 2Q7EA 4EMKB 1BIAA 4X9DA 3REXA 4HWPA 2AKWA 4PJOA 4H2UA 4M7AG 3V8LA 3VQXA 2Q7HA 3TEHA 5I21A 2DTIA 2EWNA 1EQRA 2EJ9A 3NEMA 4X9CA 4M75E 1H641 5LJ3h 1HTTA 5GAN6 2IY5B 4M78E 4PJOE 2DQ0A 5GAMg 3A74A 4MMKA 2EAYA 1YFRA 3A5YA 1NJ8A 1QE0A 1X01A 3QO7A 4YRLA 1EIYB 2XGTA 3A7AA 2ZT7A 1YGBA 2CJBA 1NYQA 5GAMe 4M75A 4P75C 4QVCA 5LJ3f 1D3BA 4HWTA 3UFGA 1Y96A 4YRCA 5GAMj 3BJUA 1E22A 2ZNIA 4P71A 4H2XB 4TVAA 4YCUA 4M7DD 4N0AC 3AHUA 3VQYA 3TEGA 4X5OA 1EVKA 4HWSA 4C8QC 5C53B 3JCMP 4NL2A 1N9WA 3SB2A 2ODRC 1I81A 4CS4A 1YCYA 2EJGA 4JUVA 4CH3A 4P74A 2ZT6A 4M78D 4YRJA 2DEQA 4DQ2A 2VXEA 4C8QB 2ZIMA 3CMQA 1B76A 3JCMQ 4J15A 4YDQA 2ZR2A 2DJZA 5GMKi 4YCVA 5GAOn 4TQDA 3LSQA 4YRSA 1LNXA 4P72C 4H2XA 3EFRA 4CH5A 4YPFA 1J5WA 4H2VA 4WJ3M 4OLFA 5LJ5d 1WQWA 4BWAA 3HTZA 1NJ5A 4P3OA 3V8KA 5GAOq 1HXDA 4PJOD 1EIYA 4HVCA 1WU7A 4F7UA 4M7DB 3RKYA 4C92B 4M7DF 1KMNA 4YRIA 3BDUA 4M7AF 4K88A 1LOJA 1Z7NA 5LJ3e 3GIBA 4G84A 1M5Q1 3NENA 1IL2A 3HXYA 2DZCA 4ZIBA
chains in the Genus database with same CATH superfamily
1X6GA 4M78A 4C92F 2DL4A 2RM4A 4LDXA 3FIFA 2F69A 3ICAA 2K5FA 4EMKC 2X35A 1SEMA 4EMKA 4YROA 3M9QA 1G83A 1OQKA 4C5EA 1RAEB 1WNLA 2E65A 3QNEA 1KK7A 1MV0B 2IIMA 3UA6A 2QI2A 4FT2A 5KYWB 2QTVA 4NCXA 2E1HA 1ZX6A 4Q5WA 4XTWA 4H2WA 2ZPFB 4J6WA 5HK0A 3I56T 4PG3A 2R5AA 1VQ7T 3CD6Q 3BDLA 1FWZA 1I5OB 1YWOA 2FVUA 4M75G 5GAN8 2JW4A 3JCMg 3R6OA 2E70A 2MWPA 5CVIA 2E12A 3EG9B 2FPFA 2HL3A 3MEUA 1YIJT 4XU0A 3CXCP 3DSQA 2YRCA 1X2HA 3QYHB 1I0CA 1IGQA 1BI1A 1JXOA 2HQEA 1OI1A 3URGA 3UT1A 4YRRA 1ATIA 4FYVB 4GLMA 2I4NA 4E7LA 1G5HA 2QQBA 2JS0A 4DBRA 1I4K1 3CCLA 2ZPIB 1YCSB 1NLOC 2K3XA 3I7FA 2HQXA 3D7SB 2FRYA 4JS5A 3BW1A 2BKDN 1D1AA 3QSUA 5I2SA 3EGXA 2AK5A 1YP5A 1X27A 4PJJA 1SETA 3EFSA 5A0DA 1UHFA 4J9BA 2ZZFA 3PMTA 2F2VA 5GMKm 3CCEQ 1YJ9Q 3LWHA 2NS6A 3VS6A 4AG2C 1VQ8Q 2DA9A 3QJYA 5FRMA 5DY9A 2GFAA 4P75A 4E51A 4KH0B 4JLGA 1G51A 3VRYA 2ZIOA 4QQ6A 3OW2P 4P74C 4JDSA 2K2MA 3H0IA 1B70A 1FYFA 1W4SA 3E9FA 3CCST 2CJAA 1KOGA 5C52B 3OMCA 4Q15A 3IQLA 4TTVA 2J6FA 3G4SA 4BW9A 6AT1B 3RUXA 2FZGB 2KK4A 1D1CA 3FLGA 1EOVA 3INZA 2GCXA 2K5IA 2AT1B 3HXVA 5GAOr 2OTJT 4C8QF 3UH0A 3JCMd 2OTLA 5FRNA 1PKSA 1UTIA 1WHGA 1YB3A 2RHSA 3CCMT 4AG1C 2X4WA 1C6VX 2C7IA 2R5MA 2RD1A 3JCMX 5CK9A 1WPYA 2AHJB 1N9RA 1MUZA 2SEMA 2CZ6B 1QVGA 4YP0A 1YN8A 4J8OA 1F1BB 3M0RA 3MKDA 1ACMB 4E7ZA 3SWNC 5HK3A 2KBTA 2ALYA 2RPNA 5FU7C 1E24A 2EVRA 2J3LA 4C8QD 5AYFA 3RL6A 2CP2A 5KYWA 1ABQA 2KYBA 2V8IA 2I2LA 3QG1A 1K8AC 3X28B 2AMCB 1W1FA 2DL5A 4JS4A 1BBUA 2K7AA 1MV3A 2RA2A 4Z89A 1JBMA 3QWXX 1YFSA 2RQRA 3L2RA 4C8QA 3DKMA 4BI3A 1SHGA 1G3TA 3CMAT 3QWYA 1X69A 2DE0X 3EG3A 2ESWA 1AWXA 1NJ1A 4JZ4A 1NPPA 1AWOA 2QDYB 3CCJA 1X54A 3L42A 2XTIA 1UECA 1B7TA 5GAOm 1ZBXA 4LD9K 1OYXA 2ABLA 1OU9A 3VRZA 2A8EA 4KR2A 2ZGWA 2M0OA 4V2SA 2PQWA 4X1VA 1I8FA 2GGRA 3PVQA 4LVKA 3REAB 1QVPA 4FIBA 5GAN4 3L1AA 1RUWA 3CPWS 5LJ3g 5CKEA 2HD0A 1Y07A 2JTEA 5C6SA 2NUZA 1USYA 2RO0A 1WYXA 1M1GA 1USYC 4JJDA 2D8JA 3CPWP 2EJFA 1HC7A 2JT4A 3M58A 2KMTA 4TVYA 5CCAA 3CCRA 4C0ZA 2LCLA 1H4TA 2HNIA 3PT9A 2KY9A 4XK8E 3CCQA 2NWMA 3TVTA 3PCOB 4M78G 1QVFA 1WJSA 3RKXA 2CS7A 3UGQA 3E1SA 5D6WA 1M90C 2MMPA 5GMKe 1TS9A 1SRYA 3HTRA 4BY6B 3TCJA 1G5VA 5CAIA 1GRIA 2QYZA 4UPAA 4CC3A 2RF0A 5LJ5h 3CC7T 3M0SA 3OYMA 1H4VB 1C0AA 1U8RA 3G71T 3MF2A 4PHCA 3UA7A 3CCQT 5F5WA 2DO3A 4LVMA 2M16A 3CC4Q 1NYRA 2EGAA 2X9HA 4QKUA 1YHQT 4QVZA 5IAYA 2ECZA 3A7RA 2V1QA 1NEBA 1UUEA 1QKXA 4J9CA 3QDFA 4QVDA 1WXUA 1Q7YR 4EMGA 4F17A 2SRCA 3E9GA 3FC3A 1XTDA 1X2GA 1KQ2A 1X2QA 3CCQQ 1HJDA 4KR3A 3M4QA 4AFUC 2IVWA 2NUPA 2KXDA 2Z0WA 3E9HA 3LGLA 3LC0A 5E3IA 2ED1A 4YRKA 2NUTB 2ROLA 4MZTA 1R0CB 1IB8A 3LH5A 1EIFA 1Y0MA 4P72A 4GLKA 3NPFA 3MP6A 3OW2A 1TOVA 4XU3A 3C4SA 1YJWA 3SWNB 3HXZA 3CCRT 4E2FB 1ASYA 3EG1A 3L2ZA 2DXUA 2M51A 3IALA 2P0LA 4E7IA 3A8LB 2OTJA 4RQEA 4EDUA 4TVWA 4LDUA 1NJIU 1QW1A 3HHTB 4OMLA 4EIKA 3VKIA 1JEGA 4YRFA 4DBHA 3ZBDA 2RHSB 4WF2A 5GJWB 1TUGB 3OB9A 1EFWA 3OS5A 2LZ6B 2DL7A 5FW9A 3X25B 3OW2S 4QT7A 2PUKB 1K4US 2KI7A 2ZPGB 5GAN7 1ADJA 1OU8A 1VYTA 4RTWA 1BIAA 2EBPA 4EMKB 2XG8D 1GXIE 3VQXA 2Q7HA 2IPOB 2EJ9A 4X9CA 5CKHA 2DXCA 1H641 2PNIA 4KUIA 4HT4A 3FRNA 2WSEE 2YRDA 5GAN6 1K73C 2IY5B 1Z9QA 4M78E 3EHRA 1OULA 4RTTA 1T0JA 1YFRA 1QE0A 8ATCB 4HCCA 2J6OA 2ZT7A 1YGBA 1AHJB 3HL8A 4HCZA 3CCMQ 2XKOC 2DEUA 1Q81U 4HWTA 3FEOA 4YRCA 2QEXT 3MPUB 2ENMA 2EQJA 3P8BB 1VQKQ 5KCHA 3LGFA 2ED0A 2DETA 1UB4A 1RAIB 2LJ0A 2WSFE 2O31A 4BE0A 4M7DD 3AHUA 4B9XA 3VYHB 2P0QA 4C8QC 1OPKA 3VS2A 3JCMP 1X6OA 4RG8A 1CSKA 2EJGA 4JUVA 1D0ZA 3CCVQ 1BBZA 4YRJA 3CMQA 2YUOA 2KRSA 5GMKi 2LNVA 2JS2A 4PKCC 3OYJA 4ZGDB 1VQ9T 4TQDA 3EH1A 4P72C 3G4ST 4H2XA 1ZSGA 2HKNA 2YSQA 1GL5A 4H2VA 1QVGS 1OZ2A 3CCJT 1NJ5A 1WZOA 4Z02A 5LL6S 3RMSA 1EIYA 4F7UA 4M7DF 1EZZB 2VYTA 3BDUA 3PFSA 1UGVA 3CBMA 4FW2A 2DRMA 2DZCA 3C95A 2JTMA 4N4IA 3M0TA 3BFMA 2AKLA 2MIOA 3RDVA 2PMEA 2E3IA 2CIMA 1Q82R 2E6NA 3T9NA 3JV3A 4LN2A 3GBQA 1WLEA 4VUBA 1JJCB 1KHCA 3HPWA 4LNPA 2FEIA 4BE2A 1YFTA 1KHIA 2FG0A 4R55A 1FMKA 5GMKj 3ERRA 3VU3C 4M77D 1UFFA 5GANg 3C0CA 1MNDA 4KQEA 3QPHA 4YRMA 4PLIA 4Y91A 2HDAA 1WHMA 2LJ1A 8AT1B 2E64A 5GAN5 1M2VA 2IG0A 4OB2B 2DXTA 2PVOB 3TEEA 1LPLA 1BI3A 1V29B 4OB0B 3RF1A 2DMOA 3EGDB 4LDVA 3RR6A 1FMWA 4M78F 1Z9ZA 2HBPA 3MJXA 3I56A 3AT1B 3L2UA 1QVFS 4F04B 3H9NA 3OYKA 3RACA 2CZ1B 2M02A 1YJWT 3I55A 4OB3B 1WX6A 4TWAA 4FSSA 2OAWA 5LJ3d 2XDBA 4K11A 1B70B 1UG1A 1PNJA 4FYWB 5D6YA 2EGEA 2P4RA 1D0XA 2KRNA 1K0XA 1SSHA 2EKOA 3JB9F 3OYLA 1I5LA 4M7AB 1ZUKA 1NLPC 2P0KA 4M7AA 1WLPB 4GY5A 3S3NA 1S72A 2OI3A 2ARTA 1KMMA 1KD1R 2KYMA 1HD3A 1Q81C 1JU5C 3H41A 4M77E 5FROA 3ER0A 3GP8A 4OMNA 3G6EA 3CMAQ 3QBYA 2YLBA 1NBEB 2E6ZA 3VS7A 3QKJA 2FPDA 2WACA 4HA8A 2QQ9A 2X51A 4J9DA 3NMZC 4PJOC 4CC2A 1EVLA 1PYSB 2FZCB 2JXBA 4LVIA 3OYAA 2R58A 4LXCA 5GANd 2K5LA 4PJMA 2P4TA 4PNOA 3MQZA 2RI3A 2ZPHB 1MMGA 2XDPA 3CC2Q 2JTFA 4MDWA 4M7DG 4Y28E 4D6WA 3HKSA 1N8RU 4C92C 3VS3A 2YUQA 4JRKA 5KYXB 1KQSS 2BZXA 1G5IA 12ASA 2JOYA 3CCVT 2ZAEA 4HWOA 2QQSA 2MAMA 3PMIA 3RNJA 2E5QA 1QCFA 4PJOG 4UP8A 4P3PA 1K73R 1LVKA 2VKNA 3OS1A 1H3HA 4HVVA 1AWWA 2KVQG 5GAMf 3JCMb 2VUBA 4C5IA 4FW1A 1RI9A 2H3JA 2VV5A 1RAHB 2DD4A 1IHVA 2ZCFB 4E7KA 2ZZEA 3NGPA 3PVLA 4N4HA 1S72T 4M78B 4J9HA 2CYZB 2GFUA 2VGNA 3MF1A 1VQ5T 2C0TA 1ZSZC 4JRPA 2QQRA 2MCNA 3VQWA 1WIEA 2HSPA 3EAEA 5A2QE 1KQ1A 1M2VB 2GTOA 4J7FA 4HT9A 2JM8A 1NNHA 4A53A 1LJOA 4YYEA 3HRSA 4C92A 2CUBA 2RI2A 1E7OA 3QXEB 1D0YA 2K3BA 2OTJQ 3CCSQ 1OEBA 3WVEB 2X4YA 1WJRA 1JJ2S 2DNUA 2RB6A 2EPDA 3VS5A 2GF7A 3RERA 1W66A 4WTOB 2JVVA 1YJWQ 4KH1B 3HY0A 1ZQ1A 2K4YA 1GBRA 2VC8A 4C5GA 1K9MU 5KCOA 1OX8A 3M53A 3P8VA 4F7UG 1KQSA 3CBPA 3CCUA 1IREB 4EMHA 1Q82U 2QASA 4M77G 4YREA 1OZ3A 1RAGB 5K1XA 5KYUA 4RQFA 4CS3A 2DAQA 1CKAA 1E1OA 1IO6A 1CKBA 2QGFB 4J6XA 2XK0A 3HSBA 4TVAB 2LX7A 3QO5A 3CC7A 3QTCA 5GMKh 1ZSZB 2EFIA 3M57A 3JCMe 2KEAA 2QXFA 1MNEA 4BUGA 3SFMA 1W70A 3V7SA 5GMKl 1WHJA 2ZT5A 1B07A 2AKKA 2DTOA 2W0ZA 1GFDA 2RQWA 3HRTA 3U23A 2MI6A 3VS4A 3ZL7C 3OS2A 2DDZA 3A1PA 4BD3A 3OYYA 3UPUA 3HXUA 4J9FA 4PL6A 2PU9B 2M1HA 3FJPA 2ZT8A 3QHSA 1GBQA 4M77F 5EG2A 1MHNA 1VQKA 1UGPB 4JJBA 2L8DA 2AZSA 4FT4A 3RBBB 1YJNQ 2AKWB 1VQ4A 1AWJA 4RMFA 1PRMC 3G1ZA 1ZLMA 1VQMA 4M77B 4MMLA 1C0MA 4HVUA 4ZN3A 1YITQ 1M1KU 2LQWA 1TXQA 5FWBA 4RCCA 1VQNT 1YHQA 2DL8A 3I5SA 4ZN1A 1B7YB 4K87A 4J83A 3EGDA 4YRTA 2FYKA 1TUCA 3PNWC 4C0GA 5CQYA 2BZYA 3WVDB 2L89A 1VQ6A 3HFOA 3H6ZA 1K8AU 1VQKT 4F14A 5KYYB 1KC8R 4KUDK 1W2BA 3WQZA 2AIRB 4QW2A 2BTTA 3RGLA 4NOYA 4P5NA 3BY7A 1VQMT 1PKTA 2HBWA 4C8QG 4BB7A 2XICA 1PD0A 1B7YA 4J5YA 4N0AA 3CQTA 1M8VA 2QEXQ 2QTXA 1VQ7A 1JJCA 1KIKA 2JUFA 3CCVA 5LJ5e 2BE7D 5FLXE 1H92A 4X9DA 3G6ET 1U5SA 3REXA 4BDZA 2AKWA 4KGZB 1WA7A 3TEHA 2CP6A 1Y7XA 2COYA 2BIVA 3CCET 2EWNA 4C0DB 3CBOA 2HCKA 3A8MB 4M75E 5LJ3h 3S3OA 2HMAA 2L2PA 5KE3A 2DQ0A 3N5BB 5GAMg 3A74A 1AZGB 2L3QA 3A5YA 1NJ8A 3QO7A 2XMFA 2Y4YA 3ME9A 4M75A 2FHDA 4QVCA 2EQMA 2P0PA 3UFGA 1Y96A 4RTVA 4HCBA 2DBMA 1YJ9T 1JO8A 3LX7A 3L2WA 5GAMj 1E22A 4C0FA 4PK4A 4H2XB 3G71Q 4TVAA 4KULA 4OGEA 1ZA2B 5L8RE 4ESRA 4HKEA 3LYIA 2RJDA 2AZVA 2M0YA 1LCKA 5C53B 2DYBA 4IUTA 4FM4B 1I81A 2LQKA 4CS4A 1YCYA 3JAME 4P74A 2ZT6A 4M78D 2DEQA 1M1KR 2DJZA 1UGQB 3M59A 1M27C 2K79A 3SDZA 4BACA 4Z88A 2CT4A 4YCVA 1M4ZA 5GAOn 3J81E 4L5GA 2M9UA 2CDTA 5FU6B 4ZTFA 4YPFA 2QK0A 2VWFA 1YWPA 4MDXA 1JJ2P 4BWAA 1PD1A 3HTZA 2XD0A 2BZ8A 4P3OA 2E3HA 4ATOA 3X26B 4KGVB 3ZEHA 4ELYC 4RTYA 4M7DB 3RKYA 1K1ZA 4YRIA 1LOJA 3ZFJA 2RJEA 1UJYA 1IL2A 3HXYA 4DOVA 4ZIBA 1QF6A 1WHHA 3QZ5B 2RK1A 4PJLA 5GAMd 2L3SA 5GAOl 3L2QA 1VQOT 4PFPA 2K6DA 3HRUA 2JJ9A 3QO3A 1JQQA 1UJ0A 3PZCA 3CCLQ 3A8HB 5FU6C 4AMCA 4AFSC 5DLOA 4P3NA 2CGHA 3JSCA 1VOMA 1RAAB 3CPWA 1OOTA 1WXBA 4JLIA 1VQPT 2OX7A 4IUQA 2DX1A 2AMCA 2LX9A 5GAN3 4O5VA 2EQIA 4LUDA 3RMQA 1K9MC 4A54A 2KT1A 2YHTA 4E7HA 1VQZA 1M1KC 1KD1C 3NTHA 1U3OA 3UGTA 3CC4A 3V7CA 1YITT 5GAMh 4LE9A 4XTYA 1I1JA 4M75D 3VYGA 5ELOA 4DBQA 2FPEA 2ZR3A 4HCKA 3PIPA 1SF9A 1PWTA 4E7JA 3THKA 3OSVA 5M9OA 3SEMA 3CMEA 5FU7B 1FMVA 5LJ3j 2PUOB 2CUDA 1WGSA 4IKFA 3CC4T 2FB7A 1H4SA 2EYZA 4QQDA 1G3SA 2MF2A 4PJNA 2DFUA 4M75C 4JRIA 1V1CA 3IKMB 1YI2Q 1M8MA 1NPRA 1SRLA 2D0QB 3NHNA 2CT3A 4PFOA 4OGCA 1TTHB 2RHIA 1WQ7A 3P8YA 5D7UA 4E47A 1M90U 1UHCA 3IG2A 3O8VA 2D6FA 1ZUYA 2DKGA 4C8QE 4G85A 1PHTA 3M4PA 2ZZDA 3CC2T 1TH7A 4AH6A 4M75F 3TUPA 1QVGP 2QHVA 1RLPC 3HXWA 3CMET 2DVEA 5IXBA 3I5RA 3SWNA 4XAXB 4OP0A 1IRXA 4LUEA 5IHNA 2F1LA 1LYLA 2RMOA 3UF4A 4J7IA 2Q5IA 1AOJA 3M5AA 2ARUA 1NG2A 3BE3A 1ZUUA 2FO0A 3HY1A 4JZ3A 1QKWA 4CH4A 3PGGA 1FYNA 1T3LA 3EGXB 4J9IA 5C0MA 3OD1A 2PVGB 1UGRB 1YJ9A 3S3MA 2Y4XA 3QO8A 5GANf 1GFCA 2LT4A 5A0LA 3E9IA 4F7UF 2E3CA 5ECAA 3OYCA 1ASZA 1G2BA 1ADYA 1N5ZA 3DB3A 1BI2A 3CXCS 3LLRA 1Q86C 2HL5C 3PIOA 4AFZC 3CCMA 1W2BS 3WXMB 3DLLA 4ZTJA 2QHTA 1BKBA 2RHYA 1SRMA 2R57A 4CS2A 4RMOA 1YBYA 2EKHA 4EX5A 2LCCA 3A8OB 2ODRD 1BIBA 4NS5A 3A7UA 4MZMA 4EPCA 2D8HA 1VQ6T 2LQ8A 2Q5HA 2ZCEA 1VIFA 1J3TA 3PCOA 3META 3JCMc 1BK2A 2E41A 3JRZA 4M77C 5KYUB 2VXFA 3L4GA 2FZKB 3I9QA 4M7AD 1PRLC 5HKCA 1N27A 3X20B 2KDSA 3VJPA 3TSWA 1IGUA 3HFZB 3QYGB 3TREA 1K73U 2DU7A 1VQ7Q 3CD6T 1JRIA 4XEOA 4B9WA 2I4LA 1M30A 3OYHA 4J6YA 1YIJA 4HWRA 3KFUA 1H4QA 4AT1B 3P8HA 3C12A 3HXXA 5D6XA 3M4GA 2CH4W 3OYGA 2EQKA 3A32A 4M7AC 3CCLT 3M0UA 3UATA 3UWNA 4F16A 4A4EA 4HT8A 4RG2A 3CCEA 2O9VA 1TG0A 1N8RC 1VQNA 2PMFA 1MMDA 2I4MA 1WHKA 4P71C 3JCMf 3V8JA 2E4HA 1FX7A 2HEQA 3HFZA 4WI1A 2E5AA 3VQVA 1I07A 3H8ZA 1QP3A 1YI2A 2ZPEB 1ARKA 3TEHB 1YITA 2RN8A 2YLCA 3NTKA 5KNNA 3G7ZA 5KYNA 4P73A 1R0BG 1VQMQ 3MEAA 5CO7A 3CMEQ 2J05A 4XTXA 4FL6A 1X6BA 4XTVA 2P5IA 1SERA 2JNGA 3CCJQ 1YIJQ 2LC4A 3OA6A 2QHSA 2ZZGA 5GANe 5C51B 3P8DA 2YUNA 2DXBA 3F70A 4M78C 1VQPA 1SESA 1RACB 3EHQA 1H3ZA 4A4FA 2EYWA 4CI0C 4LNSA 4YRGA 2LMJA 4DA4A 3I55T 5GAOp 2DPPB 1KJWA 2EYQA 3CD6A 2GQVA 3J7AF 2RHQA 1VQ4T 3L2VA 3MCAB 5LJ5f 2JZ2A 2LQNA 2VASA 1NYFA 3FJ5A 1SG5A 1GCPA 2EGCA 3L4GB 2KT8A 2RJCA 2EYXA 2EYYA 4ZTUB 1QCNA 1U1TA 1PYSA 2QHUA 4UP7A 4LDWA 3JCMh 1Y71A 1PSFA 1E6GA 3VUZA 4PJOF 1FXXA 5GJVB 1Q7YC 4EO4A 1WXTA 4B6MA 1YI2T 1WDXA 3OYIA 3A8GB 3A5ZB 4OMMA 5FWCA 1X56A 2PTKA 4O2DA 3OQ5A 4L59A 3RESA 1VQOQ 2D1XA 3OMGA 2HZYA 1WYDA 3X24B 2GNCA 3CXCA 4A63B 4H02A 3GLXA 2OAUA 1L0WA 1UDLA 4YCWA 3HRKA 3M0QA 5I11A 2A3LA 2K9GA 1RADB 2HKQB 2JM9A 2KE9A 3JB9I 1Q7YU 3EG0A 2CSIA 2MYSA 1K76A 1VQ8A 2YDLA 3FDRA 4PJOA 1OPLA 3QIIA 3V8LA 2A37A 2RK2A 1KQSP 2LDMA 2XU8A 1EQRA 3NEMA 2V8JA 1HTTA 2RI5A 2W10A 3LH0A 4MMKA 2EAYA 3HP9A 2ATCB 1KC8U 2HSEB 2VGMA 1X01A 3O5ZA 1JXMA 3A7AA 1X75C 1QLYA 2CJBA 1QP2A 1NYQA 4RTZA 2G3RA 3KBGA 4BE1A 2D0NA 1RL2A 4KBMB 3NFCA 1NJIR 2CP5A 1QVFP 4IUVA 2RQTA 4P71A 4LVJA 4J9EA 1SHFA 3TEGA 4X5OA 2OTLQ 1Q86R 1SKUB 1KC8C 2O01E 4MZPA 4OB1B 4NL2A 1W6XA 3SB2A 2ODRC 5CKDA 2DM1A 1HYOA 3KFVA 1VQ9Q 2RHXA 4DQ2A 3EGUA 3G4SQ 1B76A 4J15A 2ZR2A 1AT1B 4JPBW 4CC4B 3CC7Q 1AZEA 1V76A 3OYNA 1QMCA 3LSQA 4E6RA 3GOXA 4LVLA 3EG9A 2CP7A 3CCUT 4CH5A 2DVJA 3DLMA 3UDCA 3A98A 4WJ3M 1R8OB 1S72Q 4OMOA 2QAZA 3KUFA 3V8KA 5GAOq 1PG5B 1VQ5Q 1WU7A 3OYEA 1M3BA 1RAFB 2F5TX 4C92B 7AT1B 4M7AF 4K88A 4A4GA 5LJ3e 2DBKA 4G84A 1PCXA 4FSXA 4ZNXA 3G71A 1XJWB 4C0DC 1YHQQ 2VB6A 5HY6A 2J3MA 3OBWA 4C5HA 2ZNJA 2L5QA 2QA4Q 2A0FB 1VQLT 4M7DE 2V26A 4HVWA 3M54A 2CZ0B 4H2SA 4F7UE 2O88A 2RJFA 1VQ4Q 1BBWA 1X2KA 2J6KA 1TSFA 1GCQA 3VUBA 1PC0A 1JJ2A 4RKUE 2F2XA 4BI8B 1YFNA 2ALYB 4YRNA 3VV0A 4M7DA 1PM3A 3GPLA 4N4GA 4ELZC 1Y96B 3REUA 1X43A 4IIOA 2DYIA 1UGSB 1XQHA 2MOXA 3M55A 4KRTA 4ME7A 4GBQA 4ORZA 3ASKA 3JB9D 11ASA 2C8MA 1JB0E 4XTZA 1EX4A 1WFWA 2QG9B 4C92G 2KR3A 1VQLA 1SSFA 3E2UA 1B34B 2K57A 1NJ2A 3EFOB 2P84A 2DZ9A 2KNBB 2NLUA 1OX9A 3DB4A 3V7RA 4ANJA 2QGGA 5GAN2 3Q1JA 4H2TA 3RIRA 1YNZA 2DU5A 1WI7A 3JCMV 3KXTA 2EQUA 1BCOA 1O75A 3OYFA 4XU1A 3MO8A 2WSCE 2XDDA 4FYXB 1BCMA 5IXFA 1QWFA 2MPXC 2X3WD 2O2OA 1HSQA 3CC2A 3RKWA 2C0IA 1MMAA 1UE9A 2JN0A 2RNAA 4CC7A 1EFNA 1U06A 3OSSC 3GF5A 2LNHB 5KYYA 2YXYA 2OTLT 4M75B 2CP0A 3QUIA 4DOWA 2XHCA 4UC4A 4H2YA 1G3YA 1BI0A 1H8KA 1W2BP 5GANh 2O4XB 5KYXA 5J39A 3A5ZA 3I56Q 1TUDA 2COWA 1YJNA 3HFVA 2H8HA 5KE2A 3M56A 3OBYA 5A0GA 1ZA1B 5LJ5g 2GBQA 4PLLA 2DRKA 2GQIA 1K0SA 3CPFA 4DPGA 2LP5A 4M77A 2NUPB 5IH2A 2KSSA 3JB9G 3HRIA 1O9SA 1NJ6A 1B8AA 1VQ6Q 4D8DA 3JB9J 3TQ7P 2L0AA 1HK9A 2I0NA 5IHKA 1VQ8T 2DERA 1NE8A 4FU6A 1B34A 4Q6GA 1NYGA 4FCYA 1VUBA 4F7UB 5DLQE 4PFZA 4RTXA 3E19A 1E6HA 5L23A 3S6WA 4M4ZA 4R56A 4XQ3A 3OS0A 1NZ9A 4XTUA 5CQXA 4BY6C 2X3XD 2KGTA 1OV3A 5LJ5j 2KAFA 2LJ3A 2MK5A 1RLQC 2V8KA 1NEGA 1VA7A 2KXCA 4IIMA 4A4KA 2BUDA 2DIGA 4K86A 2C0OA 5IT9E 1AD5A 4M7DC 1KD1U 1IXDA 2LRQA 4DEYA 4C92E 4ZGJB 1M90R 1VQ5A 3MP1A 3PTAA 3VBBA 1GGMA 9ATCB 1N9SA 4DEXA 1C1AA 3QZ9B 3MEYA 1M1FA 1N8RR 3M0PA 5GANj 2QEXA 1M9SA 2V1RA 3NELA 2J06A 4LDYA 5EC7A 3G6EQ 3CMAA 2A7YA 3R07A 1M3AA 5ELNA 1BU1A 5I22A 4AFQC 2C06A 4DBFA 2FL7A 2KQWA 1VYVA 2LT1A 5CR2A 1VQOA 4ZTZB 2J7IA 3HFNA 2QA4A 2CKKA 4RTUA 4P73C 4CH6A 4YRQA 1AVZC 2QQAA 3CCUQ 2DTHA 4RDXA 3C94A 3FB9A 1E1TA 2CH4A 3LW5E 1Q95G 3NETA 2CZ7B 3CEYA 2I4OA 1UEBA 2RHUA 4RUGA 4XEMA 3NTIA 2XI9A 4M7AE 1X55A 2YUPA 1WHLA 4HXJA 1BYMA 4LD6A 4PJOB 2LTOA 4TVRA 2D9TA 1NJIC 2O9SA 1R77A 1QWEA 5CKBA 2ZTGA 2DL3A 2XIDA 4RCBA 4C92D 2QA4T 4IURA 4X34A 3H0HA 1MGQA 4OMPA 2EL9A 2A08A 2CSQA 4UP9A 2Y90A 1VIEA 1PSEA 1Q82C 1D3BB 4IUUA 4NL3A 4FYYB 3W3SA 2E10A 2LCSA 4OMQA 1RIQA 2G6FX 2G4CA 1Y57A 1VQPQ 4O6JA 3A31A 1IZ6A 2PVDB 3G1JA 2OJ2A 4BDYA 3JCMW 4J9GA 3J80E 2IY5A 2K2VA 2DK3A 1A0NB 3IKLA 2ARSA 2NYSA 4QQGA 1Z7MA 3LSSA 3JB9H 2B8AA 1ZBJA 2EW3A 3TSZA 2K3YA 1RABB 3P8TA 1YJNT 1Q86U 2QDLA 2F2WA 1ZHIA 4ZGEB 2DILA 3M4YA 1K8AR 2DLPA 4WJ4A 4YRPA 2DQ3A 1VQNQ 1VYUA 3I35A 2RHQB 2O4XA 4CRIA 2YT6A 2DJQA 2LVMA 2L3PA 3QJ6A 3MP8A 1U1SA 5HGQA 1TWBA 1XNIA 5KH6A 5IHIA 4TQFA 1WJQA 5CIUA 3CCSA 2CP3A 2ZXFA 2E5KA 4Z8AA 2DIQA 3VS1A 4OF1A 1GCQC 2CJ9A 2ZINA 2Q7GA 3GNFB 5K1PA 2YWWA 4XU2A 2RQUA 2YRVA 4L87A 3OYDA 5J3BA 1IHWA 2HQHA 1MMNA 2NUTA 3JCMJ 2GTJA 2KRMA 1S1NA 1QCOA 2RH2A 2DF6A 2Q7EA 1Q81R 3SD4A 3TU4K 4HWPA 4H2UA 4M7AG 2PZ1A 4R0KA 4KT0E 5I21A 2DTIA 3EFOA 1TU0B 1D09B 2B86A 2A28A 2EIFA 3MEVA 3PE0A 1N6AA 1AEYA 3MHXA 4PJOE 3I55Q 4OMFB 4YRLA 1EIYB 5HCKA 4JRQA 3EG2A 3GNGA 4OVAA 5AT1B 2XGTA 1T0HA 1M2OA 3OYBA 5GAMe 4P75C 2MWOA 5LJ3f 1D3BA 3CCRQ 3ULRB 3H0FA 5DM7R 4A4HA 3BJUA 1ZSZA 2ZNIA 1BB9A 3QDRB 2BE9B 1KG1A 1T3SA 5I2MA 3EH2A 3OY9A 4YCUA 4L6V5 4N0AC 1VQLQ 3VQYA 4KGXB 2ROTA 2RHZA 1EVKA 2A36A 2RQVA 1P92A 4HWSA 1KSWA 4IUPA 2JMAA 1N9WA 2FRWA 4Y92A 1K9MR 3LWIA 1XOVA 4CH3A 3REBB 2VXEA 4C8QB 1ABOA 2ZIMA 3JCMQ 4YDQA 4WCIA 5CKFA 2KROA 2X4XA 4YTLA 2HAXA 2VVKA 4D8KA 1D1BA 2CREA 1B3QA 2L3RA 1K9AA 4BI4A 2COZA 4YRSA 1LNXA 4E7SA 3VS0A 3R6NA 2DD5A 3EFRA 1J5WA 2X4JA 4OLFA 5LJ5d 1WQWA 1RI0A 1DJ7B 1VQ9A 2JMCA 4JJCA 5IN1A 1HXDA 1G3WA 1M3CA 4JJNK 4PJOD 1NM7A 1SPKA 4HVCA 1G8XA 1KMNA 1QQJA 3SHWA 1KFZA 2ZPBB 1Z7NA 2F5KA 5J26A 3GIBA 1M5Q1 3NENA 2H3EB 4II1A 3MEWA
chains in the Genus database with same CATH topology
4M78A 4C92F 2RM4A 4LDXA 3FIFA 2F69A 3ICAA 2K5FA 4EMKC 2X35A 4EMKA 4YROA 3M9QA 4C5EA 1WNLA 2E65A 3QNEA 2QI2A 4FT2A 4NCXA 2E1HA 4H2WA 4Q5WA 4XTWA 2ZPFB 4J6WA 5HK0A 3I56T 4PG3A 2R5AA 1VQ7T 3BDLA 1FWZA 2FVUA 4M75G 5GAN8 3JCMg 3R6OA 2E70A 2MWPA 5CVIA 2E12A 3MEUA 1YIJT 4XU0A 3DSQA 1X2HA 3QYHB 1BI1A 2HQEA 1OI1A 3URGA 3UT1A 4YRRA 1ATIA 2I4NA 4E7LA 1G5HA 2QQBA 1I4K1 3CCLA 2ZPIB 2K3XA 3I7FA 2HQXA 4JS5A 3BW1A 2BKDN 3QSUA 5I2SA 1SETA 3EFSA 5A0DA 2ZZFA 3PMTA 5GMKm 3LWHA 2NS6A 5FRMA 3QJYA 5DY9A 2GFAA 4P75A 4E51A 4JLGA 1G51A 2ZIOA 4QQ6A 4P74C 4JDSA 1B70A 1FYFA 1W4SA 3E9FA 3CCST 2CJAA 1KOGA 5C52B 3OMCA 4Q15A 4TTVA 3G4SA 4BW9A 3RUXA 2KK4A 3FLGA 1EOVA 3INZA 2GCXA 2K5IA 3HXVA 5GAOr 2OTJT 4C8QF 3UH0A 3JCMd 2OTLA 5FRNA 1YB3A 2RHSA 3CCMT 2X4WA 2C7IA 2R5MA 2RD1A 3JCMX 5CK9A 1WPYA 2AHJB 1N9RA 2CZ6B 1QVGA 4YP0A 4J8OA 3SWNC 5HK3A 2ALYA 1E24A 5FU7C 2J3LA 4C8QD 5AYFA 3RL6A 2V8IA 3QG1A 2I2LA 1K8AC 3X28B 2AMCB 4JS4A 1BBUA 2RA2A 1YFSA 1JBMA 3L2RA 4C8QA 3DKMA 4BI3A 1G3TA 3CMAT 1NJ1A 1NPPA 2QDYB 3CCJA 1X54A 3L42A 2XTIA 5GAOm 1ZBXA 4LD9K 1OYXA 2A8EA 4KR2A 2ZGWA 2M0OA 4V2SA 2PQWA 1I8FA 4LVKA 1QVPA 4FIBA 5GAN4 3L1AA 3CPWS 5LJ3g 5CKEA 2HD0A 1Y07A 5C6SA 1USYA 2RO0A 1M1GA 1USYC 2EJFA 1HC7A 3M58A 2KMTA 4TVYA 5CCAA 3CCRA 4C0ZA 2LCLA 1H4TA 2HNIA 3PT9A 2KY9A 4XK8E 3CCQA 3PCOB 4M78G 1QVFA 1WJSA 3RKXA 2CS7A 3UGQA 3E1SA 5D6WA 1M90C 2MMPA 5GMKe 1SRYA 4BY6B 3TCJA 1G5VA 5CAIA 4UPAA 5LJ5h 3CC7T 3OYMA 1H4VB 1C0AA 1U8RA 3G71T 3MF2A 4PHCA 3CCQT 5F5WA 2DO3A 4LVMA 2M16A 1NYRA 1YHQT 4QVZA 5IAYA 3A7RA 4QVDA 4EMGA 3E9GA 3FC3A 1XTDA 1X2GA 1KQ2A 4KR3A 3M4QA 2IVWA 3E9HA 3LGLA 3LC0A 5E3IA 4YRKA 4MZTA 4P72A 1EIFA 4GLKA 3MP6A 3OW2A 4XU3A 3C4SA 1YJWA 3SWNB 3HXZA 3CCRT 1ASYA 3L2ZA 2DXUA 3IALA 2P0LA 4E7IA 3A8LB 2OTJA 4RQEA 4EDUA 4TVWA 4LDUA 1NJIU 1QW1A 3HHTB 3VKIA 4YRFA 3ZBDA 2RHSB 4WF2A 3OB9A 1EFWA 3OS5A 3X25B 3OW2S 2PUKB 2ZPGB 5GAN7 1ADJA 4EMKB 1BIAA 2XG8D 1GXIE 3VQXA 2Q7HA 2EJ9A 4X9CA 2DXCA 4KUIA 1H641 5CKHA 4HT4A 3FRNA 2WSEE 5GAN6 1K73C 2IY5B 4M78E 1YFRA 1QE0A 4HCCA 2ZT7A 1YGBA 1AHJB 3HL8A 4HCZA 2XKOC 1Q81U 4HWTA 3FEOA 4YRCA 2QEXT 2EQJA 3P8BB 5KCHA 3LGFA 1UB4A 2WSFE 4BE0A 4M7DD 3AHUA 4B9XA 3VYHB 2P0QA 4C8QC 3JCMP 1X6OA 4RG8A 2EJGA 4JUVA 4YRJA 3CMQA 5GMKi 2LNVA 1VQ9T 4TQDA 4PKCC 4ZGDB 3OYJA 4P72C 3G4ST 4H2XA 4H2VA 1QVGS 1OZ2A 3CCJT 1NJ5A 4Z02A 5LL6S 3RMSA 1EIYA 4F7UA 4M7DF 2VYTA 3BDUA 3PFSA 3CBMA 2DZCA 3C95A 2JTMA 4N4IA 3BFMA 2PMEA 2CIMA 2E6NA 3T9NA 1WLEA 4VUBA 1JJCB 1KHCA 3HPWA 4BE2A 1YFTA 1KHIA 4R55A 5GMKj 3ERRA 3VU3C 4M77D 5GANg 4KQEA 3QPHA 4YRMA 4PLIA 4Y91A 2E64A 5GAN5 2IG0A 4OB2B 2DXTA 2PVOB 3TEEA 1BI3A 1V29B 4OB0B 3RF1A 4LDVA 4M78F 2HBPA 3I56A 1QVFS 3L2UA 3OYKA 3RACA 2CZ1B 1YJWT 3I55A 4OB3B 4TWAA 5LJ3d 2XDBA 1B70B 5D6YA 2EKOA 3JB9F 3OYLA 1I5LA 4M7AB 2P0KA 4M7AA 1S72A 4GY5A 3S3NA 2ARTA 1KMMA 1Q81C 4M77E 5FROA 3ER0A 3GP8A 3G6EA 3QBYA 2YLBA 2E6ZA 3QKJA 2WACA 4HA8A 2QQ9A 4PJOC 1EVLA 1PYSB 4LVIA 3OYAA 2R58A 5GANd 2K5LA 2P4TA 4PNOA 3MQZA 2RI3A 2ZPHB 2XDPA 2JTFA 4MDWA 4M7DG 4Y28E 4D6WA 3HKSA 1N8RU 4C92C 4JRKA 1KQSS 1G5IA 12ASA 2JOYA 3CCVT 4HWOA 2QQSA 2MAMA 3PMIA 2E5QA 4PJOG 4UP8A 4P3PA 3OS1A 2KVQG 5GAMf 3JCMb 2VUBA 4C5IA 2H3JA 2VV5A 2DD4A 2ZCFB 4E7KA 2ZZEA 4N4HA 1S72T 4M78B 2CYZB 2GFUA 2VGNA 3MF1A 1VQ5T 4JRPA 2QQRA 3VQWA 3EAEA 5A2QE 1KQ1A 4J7FA 4HT9A 1NNHA 4A53A 1LJOA 4YYEA 3HRSA 4C92A 2RI2A 3QXEB 3WVEB 2X4YA 1WJRA 1JJ2S 2RB6A 2GF7A 3RERA 1W66A 2JVVA 3HY0A 1ZQ1A 2K4YA 2VC8A 4C5GA 1K9MU 5KCOA 3M53A 3P8VA 4F7UG 1KQSA 3CBPA 3CCUA 1IREB 4EMHA 1Q82U 4M77G 4YREA 1OZ3A 5K1XA 4RQFA 4CS3A 2DAQA 1E1OA 4J6XA 2XK0A 3HSBA 4TVAB 3QO5A 3CC7A 3QTCA 5GMKh 2EFIA 3M57A 3JCMe 2QXFA 4BUGA 3SFMA 3V7SA 5GMKl 2ZT5A 2DTOA 3HRTA 2MI6A 3OS2A 2DDZA 4BD3A 3OYYA 3UPUA 3HXUA 4PL6A 2PU9B 2M1HA 3FJPA 2ZT8A 3QHSA 4M77F 5EG2A 1MHNA 1VQKA 1UGPB 2L8DA 4FT4A 2AKWB 1VQ4A 4RMFA 3G1ZA 1VQMA 4M77B 4MMLA 4ZN3A 1M1KU 4RCCA 1VQNT 1YHQA 4ZN1A 1B7YB 4K87A 4J83A 4YRTA 2FYKA 3PNWC 4C0GA 5CQYA 3WVDB 2L89A 1VQ6A 3HFOA 3H6ZA 1K8AU 1VQKT 4KUDK 1W2BA 3WQZA 4QW2A 3RGLA 4NOYA 4P5NA 3BY7A 1VQMT 4C8QG 4BB7A 2XICA 1B7YA 4J5YA 4N0AA 1M8VA 2QTXA 1VQ7A 1JJCA 2JUFA 3CCVA 5LJ5e 5FLXE 4X9DA 3G6ET 3REXA 4BDZA 2AKWA 3TEHA 1Y7XA 2BIVA 3CCET 2EWNA 4C0DB 3CBOA 3A8MB 4M75E 5LJ3h 3S3OA 5KE3A 2DQ0A 3N5BB 5GAMg 3A74A 3A5YA 1NJ8A 3QO7A 2Y4YA 3ME9A 4M75A 2FHDA 4QVCA 2EQMA 2P0PA 3UFGA 1Y96A 4HCBA 1YJ9T 3LX7A 3L2WA 5GAMj 1E22A 4C0FA 4H2XB 4TVAA 4KULA 4OGEA 5L8RE 4HKEA 3LYIA 2RJDA 5C53B 4IUTA 4FM4B 1I81A 2LQKA 4CS4A 1YCYA 3JAME 4P74A 2ZT6A 4M78D 2DEQA 2DJZA 1UGQB 3M59A 3SDZA 4BACA 4YCVA 1M4ZA 5GAOn 3J81E 4L5GA 2M9UA 5FU6B 4ZTFA 4YPFA 4MDXA 4BWAA 3HTZA 2XD0A 4P3OA 4ATOA 3X26B 3ZEHA 4ELYC 4M7DB 3RKYA 4YRIA 1LOJA 3ZFJA 2RJEA 1IL2A 3HXYA 4DOVA 4ZIBA 1QF6A 3QZ5B 2RK1A 5GAMd 5GAOl 3L2QA 1VQOT 3HRUA 3QO3A 3PZCA 3A8HB 5FU6C 5DLOA 4P3NA 2CGHA 3JSCA 3CPWA 4JLIA 1VQPT 4IUQA 2AMCA 2LX9A 5GAN3 4O5VA 3RMQA 1K9MC 4A54A 2YHTA 4E7HA 1VQZA 1M1KC 1KD1C 3NTHA 3UGTA 3CC4A 3V7CA 1YITT 5GAMh 4XTYA 4M75D 3VYGA 5ELOA 2ZR3A 3PIPA 4E7JA 3OSVA 5M9OA 3CMEA 5FU7B 5LJ3j 2PUOB 1WGSA 4IKFA 3CC4T 2FB7A 1H4SA 4QQDA 1G3SA 2MF2A 4M75C 4JRIA 3IKMB 1NPRA 2D0QB 4OGCA 2RHIA 1WQ7A 3P8YA 4E47A 1M90U 3IG2A 3O8VA 2D6FA 2DKGA 4C8QE 4G85A 3M4PA 2ZZDA 3CC2T 1TH7A 4AH6A 4M75F 3TUPA 2QHVA 3HXWA 3CMET 2DVEA 3SWNA 4XAXB 4OP0A 1LYLA 2Q5IA 4J7IA 3M5AA 2ARUA 3HY1A 4CH4A 3PGGA 5C0MA 3OD1A 2PVGB 1UGRB 1YJ9A 3S3MA 2Y4XA 3QO8A 5GANf 2LT4A 5A0LA 3E9IA 4F7UF 2E3CA 3OYCA 1ASZA 1ADYA 3DB3A 1BI2A 3CXCS 3LLRA 1Q86C 3PIOA 3CCMA 1W2BS 3WXMB 3DLLA 4ZTJA 2QHTA 1BKBA 2RHYA 2R57A 4CS2A 4RMOA 1YBYA 4EX5A 2LCCA 3A8OB 2ODRD 1BIBA 4NS5A 3A7UA 4MZMA 4EPCA 1VQ6T 2LQ8A 2Q5HA 2ZCEA 1VIFA 3PCOA 3META 3JCMc 2E41A 3JRZA 4M77C 2VXFA 3L4GA 4M7AD 5HKCA 1N27A 3X20B 2KDSA 3VJPA 3HFZB 3QYGB 3TREA 1K73U 2DU7A 3CD6T 4XEOA 1JRIA 4B9WA 2I4LA 3OYHA 4J6YA 1YIJA 4HWRA 3KFUA 1H4QA 3P8HA 3C12A 3HXXA 5D6XA 3M4GA 3OYGA 2EQKA 3A32A 4M7AC 3CCLT 3UWNA 4A4EA 4HT8A 4RG2A 3CCEA 1N8RC 1VQNA 2PMFA 2I4MA 4P71C 3JCMf 3V8JA 1FX7A 3HFZA 4WI1A 2E5AA 3VQVA 3H8ZA 1QP3A 1YI2A 2ZPEB 3TEHB 1YITA 2YLCA 3NTKA 5KNNA 3G7ZA 4P73A 3MEAA 5CO7A 4XTXA 4FL6A 4XTVA 2P5IA 1SERA 2JNGA 2LC4A 3OA6A 2QHSA 2ZZGA 5GANe 5C51B 3P8DA 2DXBA 3F70A 4M78C 1VQPA 1SESA 1H3ZA 4A4FA 4CI0C 4LNSA 4YRGA 4DA4A 3I55T 5GAOp 2DPPB 2EYQA 3CD6A 2GQVA 3J7AF 2RHQA 1VQ4T 3L2VA 3MCAB 5LJ5f 2JZ2A 3L4GB 2RJCA 4ZTUB 1U1TA 1PYSA 2QHUA 4UP7A 4LDWA 3JCMh 1Y71A 1PSFA 3VUZA 4PJOF 1FXXA 1Q7YC 4EO4A 1YI2T 3OYIA 3A8GB 3A5ZB 1X56A 4O2DA 3OQ5A 4L59A 3RESA 3OMGA 1WYDA 3X24B 3CXCA 4H02A 3GLXA 2OAUA 1L0WA 4YCWA 3HRKA 2A3LA 3JB9I 1Q7YU 1VQ8A 3FDRA 4PJOA 3QIIA 3V8LA 2RK2A 2LDMA 2XU8A 1EQRA 3NEMA 2V8JA 1HTTA 2RI5A 3LH0A 4MMKA 2EAYA 3HP9A 1KC8U 2VGMA 1X01A 3A7AA 1X75C 2CJBA 1QP2A 1NYQA 2G3RA 3KBGA 4BE1A 1RL2A 4KBMB 3NFCA 4IUVA 4P71A 4LVJA 3TEGA 4X5OA 1KC8C 2O01E 4MZPA 4OB1B 4NL2A 3SB2A 2ODRC 5CKDA 2RHXA 4DQ2A 1B76A 4J15A 2ZR2A 3OYNA 3LSQA 3GOXA 4LVLA 3CCUT 4CH5A 3DLMA 3UDCA 4WJ3M 1R8OB 3KUFA 3V8KA 5GAOq 1WU7A 3OYEA 2F5TX 4C92B 4M7AF 4K88A 4A4GA 5LJ3e 4G84A 4FSXA 3G71A 4C0DC 5HY6A 2J3MA 3OBWA 4C5HA 2ZNJA 2L5QA 1VQLT 4M7DE 3M54A 2CZ0B 4H2SA 4F7UE 2RJFA 1BBWA 3VUBA 1JJ2A 4RKUE 4BI8B 2ALYB 4YRNA 3VV0A 4M7DA 3GPLA 4N4GA 4ELZC 1Y96B 3REUA 1UGSB 1XQHA 3M55A 4ME7A 3ASKA 3JB9D 11ASA 2C8MA 1JB0E 4XTZA 4C92G 1VQLA 1SSFA 1B34B 2K57A 1NJ2A 2DZ9A 2NLUA 3DB4A 3V7RA 5GAN2 3Q1JA 4H2TA 3RIRA 2DU5A 3JCMV 3KXTA 2EQUA 1O75A 3OYFA 4XU1A 3MO8A 2WSCE 2XDDA 3CC2A 3RKWA 2JN0A 3OSSC 3GF5A 2OTLT 4M75B 3QUIA 4DOWA 2XHCA 4UC4A 4H2YA 1G3YA 1BI0A 5GANh 2O4XB 5J39A 3A5ZA 1YJNA 3HFVA 5KE2A 3M56A 3OBYA 5A0GA 5LJ5g 4PLLA 3CPFA 4DPGA 4M77A 2KSSA 3JB9G 3HRIA 1O9SA 1NJ6A 1B8AA 3JB9J 1HK9A 1VQ8T 1NE8A 4FU6A 1B34A 4Q6GA 1VUBA 4F7UB 5DLQE 3E19A 3S6WA 4R56A 4XQ3A 3OS0A 1NZ9A 4XTUA 5CQXA 4BY6C 5LJ5j 2KAFA 2V8KA 4A4KA 2BUDA 2DIGA 4K86A 5IT9E 4M7DC 1KD1U 2LRQA 4C92E 4ZGJB 1VQ5A 3MP1A 3PTAA 3VBBA 1GGMA 1N9SA 3QZ9B 3MEYA 1M1FA 5GANj 2QEXA 1M9SA 3NELA 4LDYA 3CMAA 2A7YA 3R07A 5ELNA 2C06A 2FL7A 2KQWA 2LT1A 5CR2A 1VQOA 4ZTZB 3HFNA 2QA4A 2CKKA 4P73C 4CH6A 4YRQA 2QQAA 2DTHA 4RDXA 3C94A 3FB9A 1E1TA 3LW5E 3NETA 2CZ7B 3CEYA 2I4OA 1UEBA 2RHUA 4XEMA 3NTIA 2XI9A 4M7AE 1X55A 1BYMA 4LD6A 4PJOB 2LTOA 4TVRA 2D9TA 1NJIC 5CKBA 2ZTGA 2XIDA 4RCBA 4C92D 2QA4T 4IURA 4X34A 1MGQA 2EL9A 4UP9A 2Y90A 1VIEA 1PSEA 1Q82C 1D3BB 4IUUA 4NL3A 3W3SA 2E10A 1RIQA 2G4CA 4O6JA 3A31A 1IZ6A 2PVDB 4BDYA 3JCMW 2IY5A 3J80E 2K2VA 2DK3A 3IKLA 2ARSA 4QQGA 1Z7MA 3LSSA 3JB9H 2B8AA 2K3YA 3P8TA 1YJNT 1Q86U 1ZHIA 4ZGEB 3M4YA 4WJ4A 4YRPA 2DQ3A 2RHQB 2O4XA 4CRIA 2LVMA 3QJ6A 3MP8A 1U1SA 5HGQA 1XNIA 5KH6A 4TQFA 1WJQA 5CIUA 3CCSA 2ZXFA 2DIQA 4OF1A 2CJ9A 2ZINA 2Q7GA 3GNFB 5K1PA 4XU2A 2YRVA 4L87A 3OYDA 5J3BA 3JCMJ 2RH2A 2Q7EA 3SD4A 3TU4K 4HWPA 4H2UA 4M7AG 4KT0E 5I21A 2DTIA 2EIFA 3MEVA 1N6AA 3MHXA 4PJOE 4OMFB 4YRLA 1EIYB 4JRQA 2XGTA 3GNGA 4OVAA 3OYBA 5GAMe 4P75C 2MWOA 5LJ3f 1D3BA 5DM7R 4A4HA 3BJUA 2ZNIA 3QDRB 1KG1A 5I2MA 3OY9A 4YCUA 4L6V5 4N0AC 3VQYA 2RHZA 1EVKA 1P92A 4HWSA 4IUPA 1N9WA 3LWIA 1XOVA 4CH3A 2VXEA 4C8QB 2ZIMA 3JCMQ 4YDQA 5CKFA 2X4XA 4YTLA 2HAXA 2L3RA 4BI4A 4YRSA 1LNXA 2DD5A 3EFRA 1J5WA 2X4JA 4OLFA 5LJ5d 1WQWA 1RI0A 1DJ7B 1VQ9A 5IN1A 1HXDA 1G3WA 4JJNK 4PJOD 4HVCA 1KMNA 2ZPBB 1Z7NA 2F5KA 5J26A 3GIBA 1M5Q1 3NENA 4II1A 3MEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 A;  4C92 F;  1QF6 A;  2J3M A;  2RM4 A;  2ZNJ A;  3FIF A;  3BFM A;  3ICA A;  5GAM d;  5GAO l;  4EMK C;  2PME A;  4M7D E;  2CIM A;  4EMK A;  3QO3 A;  4YRO A;  3PZC A;  4H2S A;  4F7U E;  4P3N A;  1BBW A;  1WLE A;  1WNL A;  2CGH A;  1JJC B;  4JLI A;  2AMC A;  2E65 A;  3QNE A;  5GAN 3;  1YFT A;  4A54 A;  2ALY B;  4YRN A;  2YHT A;  4M7D A;  4NCX A;  2E1H A;  4H2W A;  4XTW A;  1Y96 B;  4J6W A;  1VQZ A;  4PG3 A;  3REU A;  5GMK j;  3ERR A;  3VU3 C;  4M77 D;  5GAN g;  3UGT A;  3V7C A;  4M75 G;  5GAN 8;  5GAM h;  4KQE A;  3JCM g;  4XTY A;  4YRM A;  4Y91 A;  4M75 D;  2E64 A;  3JB9 D;  5GAN 5;  5ELO A;  11AS A;  2C8M A;  4XTZ A;  4XU0 A;  4C92 G;  2ZR3 A;  3DSQ A;  2DXT A;  1X2H A;  1B34 B;  3RF1 A;  2K57 A;  1NJ2 A;  4YRR A;  2DZ9 A;  1ATI A;  3V7R A;  2I4N A;  1G5H A;  4M78 F;  5LJ3 j;  5GAN 2;  4H2T A;  3RIR A;  1I4K 1;  2DU5 A;  3JCM V;  2FB7 A;  1H4S A;  3I7F A;  3RAC A;  4XU1 A;  4M75 C;  4JRI A;  3IKM B;  3BW1 A;  3QSU A;  4TWA A;  1SET A;  3EFS A;  1WQ7 A;  5LJ3 d;  3P8Y A;  3RKW A;  1B70 B;  2ZZF A;  2JN0 A;  5GMK m;  3IG2 A;  2DKG A;  4C8Q E;  4G85 A;  3M4P A;  3JB9 F;  4M75 B;  1TH7 A;  3QUI A;  4M75 F;  5DY9 A;  4AH6 A;  3TUP A;  4H2Y A;  1I5L A;  4P75 A;  4M7A B;  2QHV A;  4E51 A;  3HXW A;  5GAN h;  4M7A A;  1G51 A;  2DVE A;  2ZIO A;  3A5Z A;  3SWN A;  4P74 C;  2ART A;  1KMM A;  3HFV A;  4OP0 A;  1B70 A;  4M77 E;  1FYF A;  2CJA A;  1KOG A;  5C52 B;  1LYL A;  2Q5I A;  4Q15 A;  5LJ5 g;  2ARU A;  2YLB A;  4TTV A;  3HY1 A;  4CH4 A;  3PGG A;  4BW9 A;  4HA8 A;  3RUX A;  4DPG A;  1EOV A;  4PJO C;  4M77 A;  3INZ A;  1EVL A;  1PYS B;  3OD1 A;  3JB9 G;  3HRI A;  3HXV A;  5GAO r;  1NJ6 A;  1B8A A;  5GAN d;  3JB9 J;  4C8Q F;  3UH0 A;  3JCM d;  4PNO A;  3QO8 A;  5GAN f;  1YB3 A;  2RHS A;  3E9I A;  4F7U F;  1HK9 A;  2E3C A;  4M7D G;  1ASZ A;  2C7I A;  1B34 A;  4Q6G A;  1ADY A;  2RD1 A;  3JCM X;  4C92 C;  1WPY A;  4JRK A;  1G5I A;  4F7U B;  12AS A;  1N9R A;  4HWO A;  2QHT A;  4YP0 A;  4PJO G;  4UP8 A;  4P3P A;  3SWN C;  4XQ3 A;  4CS2 A;  2ALY A;  1E24 A;  4XTU A;  2J3L A;  4C8Q D;  4EX5 A;  3RL6 A;  2ODR D;  5LJ5 j;  2I2L A;  1BIB A;  5GAM f;  3JCM b;  3A7U A;  2AMC B;  4K86 A;  2Q5H A;  2ZCE A;  1BBU A;  4M7D C;  3PCO A;  2RA2 A;  1YFS A;  1JBM A;  3JCM c;  4C92 E;  4C8Q A;  3VBB A;  2E41 A;  4M77 C;  2ZZE A;  2VXF A;  1GGM A;  3L4G A;  1N9S A;  3MEY A;  4M7A D;  4M78 B;  3HFZ B;  5GAN j;  1NJ1 A;  3MF1 A;  2DU7 A;  4XEO A;  1JRI A;  2I4L A;  3NEL A;  4J6Y A;  4HWR A;  1X54 A;  3VQW A;  3KFU A;  2XTI A;  1KQ1 A;  4HT9 A;  3R07 A;  5GAO m;  5ELN A;  1NNH A;  4A53 A;  1LJO A;  4YYE A;  1H4Q A;  4KR2 A;  4C92 A;  2ZGW A;  3HXX A;  3M4G A;  4V2S A;  3A32 A;  4ZTZ B;  4M7A C;  1I8F A;  3HFN A;  4P73 C;  4CH6 A;  5GAN 4;  3L1A A;  4YRQ A;  2RB6 A;  2DTH A;  4HT8 A;  5LJ3 g;  4RDX A;  3RER A;  3FB9 A;  1W66 A;  1E1T A;  1USY A;  2PMF A;  3NET A;  2I4M A;  3HY0 A;  4P71 C;  3JCM f;  3V8J A;  1USY C;  2I4O A;  2VC8 A;  4XEM A;  3HFZ A;  4M7A E;  3P8V A;  4F7U G;  4WI1 A;  2E5A A;  3VQV A;  1X55 A;  2EJF A;  1HC7 A;  4EMH A;  4TVY A;  3TEH B;  4M77 G;  4YRE A;  2YLC A;  1H4T A;  5K1X A;  2HNI A;  4PJO B;  5KNN A;  4P73 A;  4CS3 A;  4RQF A;  3PCO B;  4M78 G;  1E1O A;  2ZTG A;  3RKX A;  4J6X A;  4RCB A;  4XTX A;  4C92 D;  3HSB A;  3UGQ A;  4XTV A;  2P5I A;  4TVA B;  1SER A;  3QO5 A;  1MGQ A;  5GMK e;  2QHS A;  5GMK h;  5GAN e;  1SRY A;  2EL9 A;  2ZZG A;  3QTC A;  5C51 B;  4UP9 A;  2Y90 A;  3JCM e;  5CAI A;  4UPA A;  4M78 C;  1D3B B;  3V7S A;  5GMK l;  5LJ5 h;  1SES A;  4NL3 A;  2ZT5 A;  3W3S A;  2E10 A;  1C0A A;  1H4V B;  2DTO A;  3MF2 A;  4PHC A;  4LNS A;  4YRG A;  5F5W A;  1RIQ A;  2G4C A;  5GAO p;  1NYR A;  2DDZ A;  3A7R A;  3A31 A;  3HXU A;  2RHQ A;  3FJP A;  2ZT8 A;  3JCM W;  3QHS A;  5LJ5 f;  2IY5 A;  4M77 F;  4QVD A;  4EMG A;  3IKL A;  2ARS A;  1Z7M A;  2AKW B;  1X2G A;  3L4G B;  1KQ2 A;  4RMF A;  3G1Z A;  4ZTU B;  4M77 B;  3LSS A;  4KR3 A;  3JB9 H;  4MML A;  1U1T A;  3M4Q A;  1PYS A;  2QHU A;  4UP7 A;  3E9H A;  3JCM h;  3LC0 A;  3P8T A;  5E3I A;  4RCC A;  1B7Y B;  4PJO F;  4YRK A;  4P72 A;  4K87 A;  4EO4 A;  4WJ4 A;  4YRP A;  4XU3 A;  4YRT A;  2DQ3 A;  2FYK A;  3SWN B;  3HXZ A;  2RHQ B;  1ASY A;  3L2Z A;  3HFO A;  1U1S A;  2DXU A;  5HGQ A;  3IAL A;  1X56 A;  4TQF A;  2P0L A;  2ZXF A;  4O2D A;  4RQE A;  4TVW A;  3RES A;  3WQZ A;  3RGL A;  4NOY A;  1WYD A;  3BY7 A;  2CJ9 A;  2ZIN A;  2Q7G A;  4C8Q G;  5K1P A;  4YRF A;  4H02 A;  4XU2 A;  4L87 A;  1L0W A;  1B7Y A;  4J5Y A;  2RHS B;  4N0A A;  4WF2 A;  3HRK A;  4YCW A;  1M8V A;  2QTX A;  1EFW A;  1JJC A;  3JB9 I;  3JCM J;  5LJ5 e;  5GAN 7;  1ADJ A;  2Q7E A;  4EMK B;  1BIA A;  4X9D A;  3REX A;  4HWP A;  2AKW A;  4PJO A;  4H2U A;  4M7A G;  3V8L A;  3VQX A;  2Q7H A;  3TEH A;  5I21 A;  2DTI A;  2EWN A;  1EQR A;  2EJ9 A;  3NEM A;  4X9C A;  4M75 E;  1H64 1;  5LJ3 h;  1HTT A;  5GAN 6;  2IY5 B;  4M78 E;  4PJO E;  2DQ0 A;  5GAM g;  3A74 A;  4MMK A;  2EAY A;  1YFR A;  3A5Y A;  1NJ8 A;  1QE0 A;  1X01 A;  3QO7 A;  4YRL A;  1EIY B;  2XGT A;  3A7A A;  2ZT7 A;  1YGB A;  2CJB A;  1NYQ A;  5GAM e;  4M75 A;  4P75 C;  4QVC A;  5LJ3 f;  1D3B A;  4HWT A;  3UFG A;  1Y96 A;  4YRC A;  5GAM j;  3BJU A;  1E22 A;  2ZNI A;  4P71 A;  4H2X B;  4TVA A;  4YCU A;  4M7D D;  4N0A C;  3AHU A;  3VQY A;  3TEG A;  4X5O A;  1EVK A;  4HWS A;  4C8Q C;  5C53 B;  3JCM P;  4NL2 A;  1N9W A;  3SB2 A;  2ODR C;  1I81 A;  4CS4 A;  1YCY A;  2EJG A;  4JUV A;  4CH3 A;  4P74 A;  2ZT6 A;  4M78 D;  4YRJ A;  2DEQ A;  4DQ2 A;  2VXE A;  4C8Q B;  2ZIM A;  3CMQ A;  1B76 A;  3JCM Q;  4J15 A;  4YDQ A;  2ZR2 A;  2DJZ A;  5GMK i;  4YCV A;  5GAO n;  4TQD A;  3LSQ A;  4YRS A;  1LNX A;  4P72 C;  4H2X A;  3EFR A;  4CH5 A;  4YPF A;  1J5W A;  4H2V A;  4WJ3 M;  4OLF A;  5LJ5 d;  1WQW A;  4BWA A;  3HTZ A;  1NJ5 A;  4P3O A;  3V8K A;  5GAO q;  1HXD A;  4PJO D;  1EIY A;  4HVC A;  1WU7 A;  4F7U A;  4M7D B;  3RKY A;  4C92 B;  4M7D F;  1KMN A;  4YRI A;  3BDU A;  4M7A F;  4K88 A;  1LOJ A;  1Z7N A;  5LJ3 e;  3GIB A;  4G84 A;  1M5Q 1;  3NEN A;  1IL2 A;  3HXY A;  2DZC A;  4ZIB A; 
#chains in the Genus database with same CATH topology
 1X6G A;  4M78 A;  4C92 F;  2DL4 A;  2RM4 A;  4LDX A;  3FIF A;  2F69 A;  3ICA A;  2K5F A;  4EMK C;  2X35 A;  1SEM A;  4EMK A;  4YRO A;  3M9Q A;  1G83 A;  1OQK A;  4C5E A;  1RAE B;  1WNL A;  2E65 A;  3QNE A;  1KK7 A;  1MV0 B;  2IIM A;  3UA6 A;  2QI2 A;  4FT2 A;  5KYW B;  2QTV A;  4NCX A;  2E1H A;  1ZX6 A;  4Q5W A;  4XTW A;  4H2W A;  2ZPF B;  4J6W A;  5HK0 A;  3I56 T;  4PG3 A;  2R5A A;  1VQ7 T;  3CD6 Q;  3BDL A;  1FWZ A;  1I5O B;  1YWO A;  2FVU A;  4M75 G;  5GAN 8;  2JW4 A;  3JCM g;  3R6O A;  2E70 A;  2MWP A;  5CVI A;  2E12 A;  3EG9 B;  2FPF A;  2HL3 A;  3MEU A;  1YIJ T;  4XU0 A;  3CXC P;  3DSQ A;  2YRC A;  1X2H A;  3QYH B;  1I0C A;  1IGQ A;  1BI1 A;  1JXO A;  2HQE A;  1OI1 A;  3URG A;  3UT1 A;  4YRR A;  1ATI A;  4FYV B;  4GLM A;  2I4N A;  4E7L A;  1G5H A;  2QQB A;  2JS0 A;  4DBR A;  1I4K 1;  3CCL A;  2ZPI B;  1YCS B;  1NLO C;  2K3X A;  3I7F A;  2HQX A;  3D7S B;  2FRY A;  4JS5 A;  3BW1 A;  2BKD N;  1D1A A;  3QSU A;  5I2S A;  3EGX A;  2AK5 A;  1YP5 A;  1X27 A;  4PJJ A;  1SET A;  3EFS A;  5A0D A;  1UHF A;  4J9B A;  2ZZF A;  3PMT A;  2F2V A;  5GMK m;  3CCE Q;  1YJ9 Q;  3LWH A;  2NS6 A;  3VS6 A;  4AG2 C;  1VQ8 Q;  2DA9 A;  3QJY A;  5FRM A;  5DY9 A;  2GFA A;  4P75 A;  4E51 A;  4KH0 B;  4JLG A;  1G51 A;  3VRY A;  2ZIO A;  4QQ6 A;  3OW2 P;  4P74 C;  4JDS A;  2K2M A;  3H0I A;  1B70 A;  1FYF A;  1W4S A;  3E9F A;  3CCS T;  2CJA A;  1KOG A;  5C52 B;  3OMC A;  4Q15 A;  3IQL A;  4TTV A;  2J6F A;  3G4S A;  4BW9 A;  6AT1 B;  3RUX A;  2FZG B;  2KK4 A;  1D1C A;  3FLG A;  1EOV A;  3INZ A;  2GCX A;  2K5I A;  2AT1 B;  3HXV A;  5GAO r;  2OTJ T;  4C8Q F;  3UH0 A;  3JCM d;  2OTL A;  5FRN A;  1PKS A;  1UTI A;  1WHG A;  1YB3 A;  2RHS A;  3CCM T;  4AG1 C;  2X4W A;  1C6V X;  2C7I A;  2R5M A;  2RD1 A;  3JCM X;  5CK9 A;  1WPY A;  2AHJ B;  1N9R A;  1MUZ A;  2SEM A;  2CZ6 B;  1QVG A;  4YP0 A;  1YN8 A;  4J8O A;  1F1B B;  3M0R A;  3MKD A;  1ACM B;  4E7Z A;  3SWN C;  5HK3 A;  2KBT A;  2ALY A;  2RPN A;  5FU7 C;  1E24 A;  2EVR A;  2J3L A;  4C8Q D;  5AYF A;  3RL6 A;  2CP2 A;  5KYW A;  1ABQ A;  2KYB A;  2V8I A;  2I2L A;  3QG1 A;  1K8A C;  3X28 B;  2AMC B;  1W1F A;  2DL5 A;  4JS4 A;  1BBU A;  2K7A A;  1MV3 A;  2RA2 A;  4Z89 A;  1JBM A;  3QWX X;  1YFS A;  2RQR A;  3L2R A;  4C8Q A;  3DKM A;  4BI3 A;  1SHG A;  1G3T A;  3CMA T;  3QWY A;  1X69 A;  2DE0 X;  3EG3 A;  2ESW A;  1AWX A;  1NJ1 A;  4JZ4 A;  1NPP A;  1AWO A;  2QDY B;  3CCJ A;  1X54 A;  3L42 A;  2XTI A;  1UEC A;  1B7T A;  5GAO m;  1ZBX A;  4LD9 K;  1OYX A;  2ABL A;  1OU9 A;  3VRZ A;  2A8E A;  4KR2 A;  2ZGW A;  2M0O A;  4V2S A;  2PQW A;  4X1V A;  1I8F A;  2GGR A;  3PVQ A;  4LVK A;  3REA B;  1QVP A;  4FIB A;  5GAN 4;  3L1A A;  1RUW A;  3CPW S;  5LJ3 g;  5CKE A;  2HD0 A;  1Y07 A;  2JTE A;  5C6S A;  2NUZ A;  1USY A;  2RO0 A;  1WYX A;  1M1G A;  1USY C;  4JJD A;  2D8J A;  3CPW P;  2EJF A;  1HC7 A;  2JT4 A;  3M58 A;  2KMT A;  4TVY A;  5CCA A;  3CCR A;  4C0Z A;  2LCL A;  1H4T A;  2HNI A;  3PT9 A;  2KY9 A;  4XK8 E;  3CCQ A;  2NWM A;  3TVT A;  3PCO B;  4M78 G;  1QVF A;  1WJS A;  3RKX A;  2CS7 A;  3UGQ A;  3E1S A;  5D6W A;  1M90 C;  2MMP A;  5GMK e;  1TS9 A;  1SRY A;  3HTR A;  4BY6 B;  3TCJ A;  1G5V A;  5CAI A;  1GRI A;  2QYZ A;  4UPA A;  4CC3 A;  2RF0 A;  5LJ5 h;  3CC7 T;  3M0S A;  3OYM A;  1H4V B;  1C0A A;  1U8R A;  3G71 T;  3MF2 A;  4PHC A;  3UA7 A;  3CCQ T;  5F5W A;  2DO3 A;  4LVM A;  2M16 A;  3CC4 Q;  1NYR A;  2EGA A;  2X9H A;  4QKU A;  1YHQ T;  4QVZ A;  5IAY A;  2ECZ A;  3A7R A;  2V1Q A;  1NEB A;  1UUE A;  1QKX A;  4J9C A;  3QDF A;  4QVD A;  1WXU A;  1Q7Y R;  4EMG A;  4F17 A;  2SRC A;  3E9G A;  3FC3 A;  1XTD A;  1X2G A;  1KQ2 A;  1X2Q A;  3CCQ Q;  1HJD A;  4KR3 A;  3M4Q A;  4AFU C;  2IVW A;  2NUP A;  2KXD A;  2Z0W A;  3E9H A;  3LGL A;  3LC0 A;  5E3I A;  2ED1 A;  4YRK A;  2NUT B;  2ROL A;  4MZT A;  1R0C B;  1IB8 A;  3LH5 A;  1EIF A;  1Y0M A;  4P72 A;  4GLK A;  3NPF A;  3MP6 A;  3OW2 A;  1TOV A;  4XU3 A;  3C4S A;  1YJW A;  3SWN B;  3HXZ A;  3CCR T;  4E2F B;  1ASY A;  3EG1 A;  3L2Z A;  2DXU A;  2M51 A;  3IAL A;  2P0L A;  4E7I A;  3A8L B;  2OTJ A;  4RQE A;  4EDU A;  4TVW A;  4LDU A;  1NJI U;  1QW1 A;  3HHT B;  4OML A;  4EIK A;  3VKI A;  1JEG A;  4YRF A;  4DBH A;  3ZBD A;  2RHS B;  4WF2 A;  5GJW B;  1TUG B;  3OB9 A;  1EFW A;  3OS5 A;  2LZ6 B;  2DL7 A;  5FW9 A;  3X25 B;  3OW2 S;  4QT7 A;  2PUK B;  1K4U S;  2KI7 A;  2ZPG B;  5GAN 7;  1ADJ A;  1OU8 A;  1VYT A;  4RTW A;  1BIA A;  2EBP A;  4EMK B;  2XG8 D;  1GXI E;  3VQX A;  2Q7H A;  2IPO B;  2EJ9 A;  4X9C A;  5CKH A;  2DXC A;  1H64 1;  2PNI A;  4KUI A;  4HT4 A;  3FRN A;  2WSE E;  2YRD A;  5GAN 6;  1K73 C;  2IY5 B;  1Z9Q A;  4M78 E;  3EHR A;  1OUL A;  4RTT A;  1T0J A;  1YFR A;  1QE0 A;  8ATC B;  4HCC A;  2J6O A;  2ZT7 A;  1YGB A;  1AHJ B;  3HL8 A;  4HCZ A;  3CCM Q;  2XKO C;  2DEU A;  1Q81 U;  4HWT A;  3FEO A;  4YRC A;  2QEX T;  3MPU B;  2ENM A;  2EQJ A;  3P8B B;  1VQK Q;  5KCH A;  3LGF A;  2ED0 A;  2DET A;  1UB4 A;  1RAI B;  2LJ0 A;  2WSF E;  2O31 A;  4BE0 A;  4M7D D;  3AHU A;  4B9X A;  3VYH B;  2P0Q A;  4C8Q C;  1OPK A;  3VS2 A;  3JCM P;  1X6O A;  4RG8 A;  1CSK A;  2EJG A;  4JUV A;  1D0Z A;  3CCV Q;  1BBZ A;  4YRJ A;  3CMQ A;  2YUO A;  2KRS A;  5GMK i;  2LNV A;  2JS2 A;  4PKC C;  3OYJ A;  4ZGD B;  1VQ9 T;  4TQD A;  3EH1 A;  4P72 C;  3G4S T;  4H2X A;  1ZSG A;  2HKN A;  2YSQ A;  1GL5 A;  4H2V A;  1QVG S;  1OZ2 A;  3CCJ T;  1NJ5 A;  1WZO A;  4Z02 A;  5LL6 S;  3RMS A;  1EIY A;  4F7U A;  4M7D F;  1EZZ B;  2VYT A;  3BDU A;  3PFS A;  1UGV A;  3CBM A;  4FW2 A;  2DRM A;  2DZC A;  3C95 A;  2JTM A;  4N4I A;  3M0T A;  3BFM A;  2AKL A;  2MIO A;  3RDV A;  2PME A;  2E3I A;  2CIM A;  1Q82 R;  2E6N A;  3T9N A;  3JV3 A;  4LN2 A;  3GBQ A;  1WLE A;  4VUB A;  1JJC B;  1KHC A;  3HPW A;  4LNP A;  2FEI A;  4BE2 A;  1YFT A;  1KHI A;  2FG0 A;  4R55 A;  1FMK A;  5GMK j;  3ERR A;  3VU3 C;  4M77 D;  1UFF A;  5GAN g;  3C0C A;  1MND A;  4KQE A;  3QPH A;  4YRM A;  4PLI A;  4Y91 A;  2HDA A;  1WHM A;  2LJ1 A;  8AT1 B;  2E64 A;  5GAN 5;  1M2V A;  2IG0 A;  4OB2 B;  2DXT A;  2PVO B;  3TEE A;  1LPL A;  1BI3 A;  1V29 B;  4OB0 B;  3RF1 A;  2DMO A;  3EGD B;  4LDV A;  3RR6 A;  1FMW A;  4M78 F;  1Z9Z A;  2HBP A;  3MJX A;  3I56 A;  3AT1 B;  3L2U A;  1QVF S;  4F04 B;  3H9N A;  3OYK A;  3RAC A;  2CZ1 B;  2M02 A;  1YJW T;  3I55 A;  4OB3 B;  1WX6 A;  4TWA A;  4FSS A;  2OAW A;  5LJ3 d;  2XDB A;  4K11 A;  1B70 B;  1UG1 A;  1PNJ A;  4FYW B;  5D6Y A;  2EGE A;  2P4R A;  1D0X A;  2KRN A;  1K0X A;  1SSH A;  2EKO A;  3JB9 F;  3OYL A;  1I5L A;  4M7A B;  1ZUK A;  1NLP C;  2P0K A;  4M7A A;  1WLP B;  4GY5 A;  3S3N A;  1S72 A;  2OI3 A;  2ART A;  1KMM A;  1KD1 R;  2KYM A;  1HD3 A;  1Q81 C;  1JU5 C;  3H41 A;  4M77 E;  5FRO A;  3ER0 A;  3GP8 A;  4OMN A;  3G6E A;  3CMA Q;  3QBY A;  2YLB A;  1NBE B;  2E6Z A;  3VS7 A;  3QKJ A;  2FPD A;  2WAC A;  4HA8 A;  2QQ9 A;  2X51 A;  4J9D A;  3NMZ C;  4PJO C;  4CC2 A;  1EVL A;  1PYS B;  2FZC B;  2JXB A;  4LVI A;  3OYA A;  2R58 A;  4LXC A;  5GAN d;  2K5L A;  4PJM A;  2P4T A;  4PNO A;  3MQZ A;  2RI3 A;  2ZPH B;  1MMG A;  2XDP A;  3CC2 Q;  2JTF A;  4MDW A;  4M7D G;  4Y28 E;  4D6W A;  3HKS A;  1N8R U;  4C92 C;  3VS3 A;  2YUQ A;  4JRK A;  5KYX B;  1KQS S;  2BZX A;  1G5I A;  12AS A;  2JOY A;  3CCV T;  2ZAE A;  4HWO A;  2QQS A;  2MAM A;  3PMI A;  3RNJ A;  2E5Q A;  1QCF A;  4PJO G;  4UP8 A;  4P3P A;  1K73 R;  1LVK A;  2VKN A;  3OS1 A;  1H3H A;  4HVV A;  1AWW A;  2KVQ G;  5GAM f;  3JCM b;  2VUB A;  4C5I A;  4FW1 A;  1RI9 A;  2H3J A;  2VV5 A;  1RAH B;  2DD4 A;  1IHV A;  2ZCF B;  4E7K A;  2ZZE A;  3NGP A;  3PVL A;  4N4H A;  1S72 T;  4M78 B;  4J9H A;  2CYZ B;  2GFU A;  2VGN A;  3MF1 A;  1VQ5 T;  2C0T A;  1ZSZ C;  4JRP A;  2QQR A;  2MCN A;  3VQW A;  1WIE A;  2HSP A;  3EAE A;  5A2Q E;  1KQ1 A;  1M2V B;  2GTO A;  4J7F A;  4HT9 A;  2JM8 A;  1NNH A;  4A53 A;  1LJO A;  4YYE A;  3HRS A;  4C92 A;  2CUB A;  2RI2 A;  1E7O A;  3QXE B;  1D0Y A;  2K3B A;  2OTJ Q;  3CCS Q;  1OEB A;  3WVE B;  2X4Y A;  1WJR A;  1JJ2 S;  2DNU A;  2RB6 A;  2EPD A;  3VS5 A;  2GF7 A;  3RER A;  1W66 A;  4WTO B;  2JVV A;  1YJW Q;  4KH1 B;  3HY0 A;  1ZQ1 A;  2K4Y A;  1GBR A;  2VC8 A;  4C5G A;  1K9M U;  5KCO A;  1OX8 A;  3M53 A;  3P8V A;  4F7U G;  1KQS A;  3CBP A;  3CCU A;  1IRE B;  4EMH A;  1Q82 U;  2QAS A;  4M77 G;  4YRE A;  1OZ3 A;  1RAG B;  5K1X A;  5KYU A;  4RQF A;  4CS3 A;  2DAQ A;  1CKA A;  1E1O A;  1IO6 A;  1CKB A;  2QGF B;  4J6X A;  2XK0 A;  3HSB A;  4TVA B;  2LX7 A;  3QO5 A;  3CC7 A;  3QTC A;  5GMK h;  1ZSZ B;  2EFI A;  3M57 A;  3JCM e;  2KEA A;  2QXF A;  1MNE A;  4BUG A;  3SFM A;  1W70 A;  3V7S A;  5GMK l;  1WHJ A;  2ZT5 A;  1B07 A;  2AKK A;  2DTO A;  2W0Z A;  1GFD A;  2RQW A;  3HRT A;  3U23 A;  2MI6 A;  3VS4 A;  3ZL7 C;  3OS2 A;  2DDZ A;  3A1P A;  4BD3 A;  3OYY A;  3UPU A;  3HXU A;  4J9F A;  4PL6 A;  2PU9 B;  2M1H A;  3FJP A;  2ZT8 A;  3QHS A;  1GBQ A;  4M77 F;  5EG2 A;  1MHN A;  1VQK A;  1UGP B;  4JJB A;  2L8D A;  2AZS A;  4FT4 A;  3RBB B;  1YJN Q;  2AKW B;  1VQ4 A;  1AWJ A;  4RMF A;  1PRM C;  3G1Z A;  1ZLM A;  1VQM A;  4M77 B;  4MML A;  1C0M A;  4HVU A;  4ZN3 A;  1YIT Q;  1M1K U;  2LQW A;  1TXQ A;  5FWB A;  4RCC A;  1VQN T;  1YHQ A;  2DL8 A;  3I5S A;  4ZN1 A;  1B7Y B;  4K87 A;  4J83 A;  3EGD A;  4YRT A;  2FYK A;  1TUC A;  3PNW C;  4C0G A;  5CQY A;  2BZY A;  3WVD B;  2L89 A;  1VQ6 A;  3HFO A;  3H6Z A;  1K8A U;  1VQK T;  4F14 A;  5KYY B;  1KC8 R;  4KUD K;  1W2B A;  3WQZ A;  2AIR B;  4QW2 A;  2BTT A;  3RGL A;  4NOY A;  4P5N A;  3BY7 A;  1VQM T;  1PKT A;  2HBW A;  4C8Q G;  4BB7 A;  2XIC A;  1PD0 A;  1B7Y A;  4J5Y A;  4N0A A;  3CQT A;  1M8V A;  2QEX Q;  2QTX A;  1VQ7 A;  1JJC A;  1KIK A;  2JUF A;  3CCV A;  5LJ5 e;  2BE7 D;  5FLX E;  1H92 A;  4X9D A;  3G6E T;  1U5S A;  3REX A;  4BDZ A;  2AKW A;  4KGZ B;  1WA7 A;  3TEH A;  2CP6 A;  1Y7X A;  2COY A;  2BIV A;  3CCE T;  2EWN A;  4C0D B;  3CBO A;  2HCK A;  3A8M B;  4M75 E;  5LJ3 h;  3S3O A;  2HMA A;  2L2P A;  5KE3 A;  2DQ0 A;  3N5B B;  5GAM g;  3A74 A;  1AZG B;  2L3Q A;  3A5Y A;  1NJ8 A;  3QO7 A;  2XMF A;  2Y4Y A;  3ME9 A;  4M75 A;  2FHD A;  4QVC A;  2EQM A;  2P0P A;  3UFG A;  1Y96 A;  4RTV A;  4HCB A;  2DBM A;  1YJ9 T;  1JO8 A;  3LX7 A;  3L2W A;  5GAM j;  1E22 A;  4C0F A;  4PK4 A;  4H2X B;  3G71 Q;  4TVA A;  4KUL A;  4OGE A;  1ZA2 B;  5L8R E;  4ESR A;  4HKE A;  3LYI A;  2RJD A;  2AZV A;  2M0Y A;  1LCK A;  5C53 B;  2DYB A;  4IUT A;  4FM4 B;  1I81 A;  2LQK A;  4CS4 A;  1YCY A;  3JAM E;  4P74 A;  2ZT6 A;  4M78 D;  2DEQ A;  1M1K R;  2DJZ A;  1UGQ B;  3M59 A;  1M27 C;  2K79 A;  3SDZ A;  4BAC A;  4Z88 A;  2CT4 A;  4YCV A;  1M4Z A;  5GAO n;  3J81 E;  4L5G A;  2M9U A;  2CDT A;  5FU6 B;  4ZTF A;  4YPF A;  2QK0 A;  2VWF A;  1YWP A;  4MDX A;  1JJ2 P;  4BWA A;  1PD1 A;  3HTZ A;  2XD0 A;  2BZ8 A;  4P3O A;  2E3H A;  4ATO A;  3X26 B;  4KGV B;  3ZEH A;  4ELY C;  4RTY A;  4M7D B;  3RKY A;  1K1Z A;  4YRI A;  1LOJ A;  3ZFJ A;  2RJE A;  1UJY A;  1IL2 A;  3HXY A;  4DOV A;  4ZIB A;  1QF6 A;  1WHH A;  3QZ5 B;  2RK1 A;  4PJL A;  5GAM d;  2L3S A;  5GAO l;  3L2Q A;  1VQO T;  4PFP A;  2K6D A;  3HRU A;  2JJ9 A;  3QO3 A;  1JQQ A;  1UJ0 A;  3PZC A;  3CCL Q;  3A8H B;  5FU6 C;  4AMC A;  4AFS C;  5DLO A;  4P3N A;  2CGH A;  3JSC A;  1VOM A;  1RAA B;  3CPW A;  1OOT A;  1WXB A;  4JLI A;  1VQP T;  2OX7 A;  4IUQ A;  2DX1 A;  2AMC A;  2LX9 A;  5GAN 3;  4O5V A;  2EQI A;  4LUD A;  3RMQ A;  1K9M C;  4A54 A;  2KT1 A;  2YHT A;  4E7H A;  1VQZ A;  1M1K C;  1KD1 C;  3NTH A;  1U3O A;  3UGT A;  3CC4 A;  3V7C A;  1YIT T;  5GAM h;  4LE9 A;  4XTY A;  1I1J A;  4M75 D;  3VYG A;  5ELO A;  4DBQ A;  2FPE A;  2ZR3 A;  4HCK A;  3PIP A;  1SF9 A;  1PWT A;  4E7J A;  3THK A;  3OSV A;  5M9O A;  3SEM A;  3CME A;  5FU7 B;  1FMV A;  5LJ3 j;  2PUO B;  2CUD A;  1WGS A;  4IKF A;  3CC4 T;  2FB7 A;  1H4S A;  2EYZ A;  4QQD A;  1G3S A;  2MF2 A;  4PJN A;  2DFU A;  4M75 C;  4JRI A;  1V1C A;  3IKM B;  1YI2 Q;  1M8M A;  1NPR A;  1SRL A;  2D0Q B;  3NHN A;  2CT3 A;  4PFO A;  4OGC A;  1TTH B;  2RHI A;  1WQ7 A;  3P8Y A;  5D7U A;  4E47 A;  1M90 U;  1UHC A;  3IG2 A;  3O8V A;  2D6F A;  1ZUY A;  2DKG A;  4C8Q E;  4G85 A;  1PHT A;  3M4P A;  2ZZD A;  3CC2 T;  1TH7 A;  4AH6 A;  4M75 F;  3TUP A;  1QVG P;  2QHV A;  1RLP C;  3HXW A;  3CME T;  2DVE A;  5IXB A;  3I5R A;  3SWN A;  4XAX B;  4OP0 A;  1IRX A;  4LUE A;  5IHN A;  2F1L A;  1LYL A;  2RMO A;  3UF4 A;  4J7I A;  2Q5I A;  1AOJ A;  3M5A A;  2ARU A;  1NG2 A;  3BE3 A;  1ZUU A;  2FO0 A;  3HY1 A;  4JZ3 A;  1QKW A;  4CH4 A;  3PGG A;  1FYN A;  1T3L A;  3EGX B;  4J9I A;  5C0M A;  3OD1 A;  2PVG B;  1UGR B;  1YJ9 A;  3S3M A;  2Y4X A;  3QO8 A;  5GAN f;  1GFC A;  2LT4 A;  5A0L A;  3E9I A;  4F7U F;  2E3C A;  5ECA A;  3OYC A;  1ASZ A;  1G2B A;  1ADY A;  1N5Z A;  3DB3 A;  1BI2 A;  3CXC S;  3LLR A;  1Q86 C;  2HL5 C;  3PIO A;  4AFZ C;  3CCM A;  1W2B S;  3WXM B;  3DLL A;  4ZTJ A;  2QHT A;  1BKB A;  2RHY A;  1SRM A;  2R57 A;  4CS2 A;  4RMO A;  1YBY A;  2EKH A;  4EX5 A;  2LCC A;  3A8O B;  2ODR D;  1BIB A;  4NS5 A;  3A7U A;  4MZM A;  4EPC A;  2D8H A;  1VQ6 T;  2LQ8 A;  2Q5H A;  2ZCE A;  1VIF A;  1J3T A;  3PCO A;  3MET A;  3JCM c;  1BK2 A;  2E41 A;  3JRZ A;  4M77 C;  5KYU B;  2VXF A;  3L4G A;  2FZK B;  3I9Q A;  4M7A D;  1PRL C;  5HKC A;  1N27 A;  3X20 B;  2KDS A;  3VJP A;  3TSW A;  1IGU A;  3HFZ B;  3QYG B;  3TRE A;  1K73 U;  2DU7 A;  1VQ7 Q;  3CD6 T;  1JRI A;  4XEO A;  4B9W A;  2I4L A;  1M30 A;  3OYH A;  4J6Y A;  1YIJ A;  4HWR A;  3KFU A;  1H4Q A;  4AT1 B;  3P8H A;  3C12 A;  3HXX A;  5D6X A;  3M4G A;  2CH4 W;  3OYG A;  2EQK A;  3A32 A;  4M7A C;  3CCL T;  3M0U A;  3UAT A;  3UWN A;  4F16 A;  4A4E A;  4HT8 A;  4RG2 A;  3CCE A;  2O9V A;  1TG0 A;  1N8R C;  1VQN A;  2PMF A;  1MMD A;  2I4M A;  1WHK A;  4P71 C;  3JCM f;  3V8J A;  2E4H A;  1FX7 A;  2HEQ A;  3HFZ A;  4WI1 A;  2E5A A;  3VQV A;  1I07 A;  3H8Z A;  1QP3 A;  1YI2 A;  2ZPE B;  1ARK A;  3TEH B;  1YIT A;  2RN8 A;  2YLC A;  3NTK A;  5KNN A;  3G7Z A;  5KYN A;  4P73 A;  1R0B G;  1VQM Q;  3MEA A;  5CO7 A;  3CME Q;  2J05 A;  4XTX A;  4FL6 A;  1X6B A;  4XTV A;  2P5I A;  1SER A;  2JNG A;  3CCJ Q;  1YIJ Q;  2LC4 A;  3OA6 A;  2QHS A;  2ZZG A;  5GAN e;  5C51 B;  3P8D A;  2YUN A;  2DXB A;  3F70 A;  4M78 C;  1VQP A;  1SES A;  1RAC B;  3EHQ A;  1H3Z A;  4A4F A;  2EYW A;  4CI0 C;  4LNS A;  4YRG A;  2LMJ A;  4DA4 A;  3I55 T;  5GAO p;  2DPP B;  1KJW A;  2EYQ A;  3CD6 A;  2GQV A;  3J7A F;  2RHQ A;  1VQ4 T;  3L2V A;  3MCA B;  5LJ5 f;  2JZ2 A;  2LQN A;  2VAS A;  1NYF A;  3FJ5 A;  1SG5 A;  1GCP A;  2EGC A;  3L4G B;  2KT8 A;  2RJC A;  2EYX A;  2EYY A;  4ZTU B;  1QCN A;  1U1T A;  1PYS A;  2QHU A;  4UP7 A;  4LDW A;  3JCM h;  1Y71 A;  1PSF A;  1E6G A;  3VUZ A;  4PJO F;  1FXX A;  5GJV B;  1Q7Y C;  4EO4 A;  1WXT A;  4B6M A;  1YI2 T;  1WDX A;  3OYI A;  3A8G B;  3A5Z B;  4OMM A;  5FWC A;  1X56 A;  2PTK A;  4O2D A;  3OQ5 A;  4L59 A;  3RES A;  1VQO Q;  2D1X A;  3OMG A;  2HZY A;  1WYD A;  3X24 B;  2GNC A;  3CXC A;  4A63 B;  4H02 A;  3GLX A;  2OAU A;  1L0W A;  1UDL A;  4YCW A;  3HRK A;  3M0Q A;  5I11 A;  2A3L A;  2K9G A;  1RAD B;  2HKQ B;  2JM9 A;  2KE9 A;  3JB9 I;  1Q7Y U;  3EG0 A;  2CSI A;  2MYS A;  1K76 A;  1VQ8 A;  2YDL A;  3FDR A;  4PJO A;  1OPL A;  3QII A;  3V8L A;  2A37 A;  2RK2 A;  1KQS P;  2LDM A;  2XU8 A;  1EQR A;  3NEM A;  2V8J A;  1HTT A;  2RI5 A;  2W10 A;  3LH0 A;  4MMK A;  2EAY A;  3HP9 A;  2ATC B;  1KC8 U;  2HSE B;  2VGM A;  1X01 A;  3O5Z A;  1JXM A;  3A7A A;  1X75 C;  1QLY A;  2CJB A;  1QP2 A;  1NYQ A;  4RTZ A;  2G3R A;  3KBG A;  4BE1 A;  2D0N A;  1RL2 A;  4KBM B;  3NFC A;  1NJI R;  2CP5 A;  1QVF P;  4IUV A;  2RQT A;  4P71 A;  4LVJ A;  4J9E A;  1SHF A;  3TEG A;  4X5O A;  2OTL Q;  1Q86 R;  1SKU B;  1KC8 C;  2O01 E;  4MZP A;  4OB1 B;  4NL2 A;  1W6X A;  3SB2 A;  2ODR C;  5CKD A;  2DM1 A;  1HYO A;  3KFV A;  1VQ9 Q;  2RHX A;  4DQ2 A;  3EGU A;  3G4S Q;  1B76 A;  4J15 A;  2ZR2 A;  1AT1 B;  4JPB W;  4CC4 B;  3CC7 Q;  1AZE A;  1V76 A;  3OYN A;  1QMC A;  3LSQ A;  4E6R A;  3GOX A;  4LVL A;  3EG9 A;  2CP7 A;  3CCU T;  4CH5 A;  2DVJ A;  3DLM A;  3UDC A;  3A98 A;  4WJ3 M;  1R8O B;  1S72 Q;  4OMO A;  2QAZ A;  3KUF A;  3V8K A;  5GAO q;  1PG5 B;  1VQ5 Q;  1WU7 A;  3OYE A;  1M3B A;  1RAF B;  2F5T X;  4C92 B;  7AT1 B;  4M7A F;  4K88 A;  4A4G A;  5LJ3 e;  2DBK A;  4G84 A;  1PCX A;  4FSX A;  4ZNX A;  3G71 A;  1XJW B;  4C0D C;  1YHQ Q;  2VB6 A;  5HY6 A;  2J3M A;  3OBW A;  4C5H A;  2ZNJ A;  2L5Q A;  2QA4 Q;  2A0F B;  1VQL T;  4M7D E;  2V26 A;  4HVW A;  3M54 A;  2CZ0 B;  4H2S A;  4F7U E;  2O88 A;  2RJF A;  1VQ4 Q;  1BBW A;  1X2K A;  2J6K A;  1TSF A;  1GCQ A;  3VUB A;  1PC0 A;  1JJ2 A;  4RKU E;  2F2X A;  4BI8 B;  1YFN A;  2ALY B;  4YRN A;  3VV0 A;  4M7D A;  1PM3 A;  3GPL A;  4N4G A;  4ELZ C;  1Y96 B;  3REU A;  1X43 A;  4IIO A;  2DYI A;  1UGS B;  1XQH A;  2MOX A;  3M55 A;  4KRT A;  4ME7 A;  4GBQ A;  4ORZ A;  3ASK A;  3JB9 D;  11AS A;  2C8M A;  1JB0 E;  4XTZ A;  1EX4 A;  1WFW A;  2QG9 B;  4C92 G;  2KR3 A;  1VQL A;  1SSF A;  3E2U A;  1B34 B;  2K57 A;  1NJ2 A;  3EFO B;  2P84 A;  2DZ9 A;  2KNB B;  2NLU A;  1OX9 A;  3DB4 A;  3V7R A;  4ANJ A;  2QGG A;  5GAN 2;  3Q1J A;  4H2T A;  3RIR A;  1YNZ A;  2DU5 A;  1WI7 A;  3JCM V;  3KXT A;  2EQU A;  1BCO A;  1O75 A;  3OYF A;  4XU1 A;  3MO8 A;  2WSC E;  2XDD A;  4FYX B;  1BCM A;  5IXF A;  1QWF A;  2MPX C;  2X3W D;  2O2O A;  1HSQ A;  3CC2 A;  3RKW A;  2C0I A;  1MMA A;  1UE9 A;  2JN0 A;  2RNA A;  4CC7 A;  1EFN A;  1U06 A;  3OSS C;  3GF5 A;  2LNH B;  5KYY A;  2YXY A;  2OTL T;  4M75 B;  2CP0 A;  3QUI A;  4DOW A;  2XHC A;  4UC4 A;  4H2Y A;  1G3Y A;  1BI0 A;  1H8K A;  1W2B P;  5GAN h;  2O4X B;  5KYX A;  5J39 A;  3A5Z A;  3I56 Q;  1TUD A;  2COW A;  1YJN A;  3HFV A;  2H8H A;  5KE2 A;  3M56 A;  3OBY A;  5A0G A;  1ZA1 B;  5LJ5 g;  2GBQ A;  4PLL A;  2DRK A;  2GQI A;  1K0S A;  3CPF A;  4DPG A;  2LP5 A;  4M77 A;  2NUP B;  5IH2 A;  2KSS A;  3JB9 G;  3HRI A;  1O9S A;  1NJ6 A;  1B8A A;  1VQ6 Q;  4D8D A;  3JB9 J;  3TQ7 P;  2L0A A;  1HK9 A;  2I0N A;  5IHK A;  1VQ8 T;  2DER A;  1NE8 A;  4FU6 A;  1B34 A;  4Q6G A;  1NYG A;  4FCY A;  1VUB A;  4F7U B;  5DLQ E;  4PFZ A;  4RTX A;  3E19 A;  1E6H A;  5L23 A;  3S6W A;  4M4Z A;  4R56 A;  4XQ3 A;  3OS0 A;  1NZ9 A;  4XTU A;  5CQX A;  4BY6 C;  2X3X D;  2KGT A;  1OV3 A;  5LJ5 j;  2KAF A;  2LJ3 A;  2MK5 A;  1RLQ C;  2V8K A;  1NEG A;  1VA7 A;  2KXC A;  4IIM A;  4A4K A;  2BUD A;  2DIG A;  4K86 A;  2C0O A;  5IT9 E;  1AD5 A;  4M7D C;  1KD1 U;  1IXD A;  2LRQ A;  4DEY A;  4C92 E;  4ZGJ B;  1M90 R;  1VQ5 A;  3MP1 A;  3PTA A;  3VBB A;  1GGM A;  9ATC B;  1N9S A;  4DEX A;  1C1A A;  3QZ9 B;  3MEY A;  1M1F A;  1N8R R;  3M0P A;  5GAN j;  2QEX A;  1M9S A;  2V1R A;  3NEL A;  2J06 A;  4LDY A;  5EC7 A;  3G6E Q;  3CMA A;  2A7Y A;  3R07 A;  1M3A A;  5ELN A;  1BU1 A;  5I22 A;  4AFQ C;  2C06 A;  4DBF A;  2FL7 A;  2KQW A;  1VYV A;  2LT1 A;  5CR2 A;  1VQO A;  4ZTZ B;  2J7I A;  3HFN A;  2QA4 A;  2CKK A;  4RTU A;  4P73 C;  4CH6 A;  4YRQ A;  1AVZ C;  2QQA A;  3CCU Q;  2DTH A;  4RDX A;  3C94 A;  3FB9 A;  1E1T A;  2CH4 A;  3LW5 E;  1Q95 G;  3NET A;  2CZ7 B;  3CEY A;  2I4O A;  1UEB A;  2RHU A;  4RUG A;  4XEM A;  3NTI A;  2XI9 A;  4M7A E;  1X55 A;  2YUP A;  1WHL A;  4HXJ A;  1BYM A;  4LD6 A;  4PJO B;  2LTO A;  4TVR A;  2D9T A;  1NJI C;  2O9S A;  1R77 A;  1QWE A;  5CKB A;  2ZTG A;  2DL3 A;  2XID A;  4RCB A;  4C92 D;  2QA4 T;  4IUR A;  4X34 A;  3H0H A;  1MGQ A;  4OMP A;  2EL9 A;  2A08 A;  2CSQ A;  4UP9 A;  2Y90 A;  1VIE A;  1PSE A;  1Q82 C;  1D3B B;  4IUU A;  4NL3 A;  4FYY B;  3W3S A;  2E10 A;  2LCS A;  4OMQ A;  1RIQ A;  2G6F X;  2G4C A;  1Y57 A;  1VQP Q;  4O6J A;  3A31 A;  1IZ6 A;  2PVD B;  3G1J A;  2OJ2 A;  4BDY A;  3JCM W;  4J9G A;  3J80 E;  2IY5 A;  2K2V A;  2DK3 A;  1A0N B;  3IKL A;  2ARS A;  2NYS A;  4QQG A;  1Z7M A;  3LSS A;  3JB9 H;  2B8A A;  1ZBJ A;  2EW3 A;  3TSZ A;  2K3Y A;  1RAB B;  3P8T A;  1YJN T;  1Q86 U;  2QDL A;  2F2W A;  1ZHI A;  4ZGE B;  2DIL A;  3M4Y A;  1K8A R;  2DLP A;  4WJ4 A;  4YRP A;  2DQ3 A;  1VQN Q;  1VYU A;  3I35 A;  2RHQ B;  2O4X A;  4CRI A;  2YT6 A;  2DJQ A;  2LVM A;  2L3P A;  3QJ6 A;  3MP8 A;  1U1S A;  5HGQ A;  1TWB A;  1XNI A;  5KH6 A;  5IHI A;  4TQF A;  1WJQ A;  5CIU A;  3CCS A;  2CP3 A;  2ZXF A;  2E5K A;  4Z8A A;  2DIQ A;  3VS1 A;  4OF1 A;  1GCQ C;  2CJ9 A;  2ZIN A;  2Q7G A;  3GNF B;  5K1P A;  2YWW A;  4XU2 A;  2RQU A;  2YRV A;  4L87 A;  3OYD A;  5J3B A;  1IHW A;  2HQH A;  1MMN A;  2NUT A;  3JCM J;  2GTJ A;  2KRM A;  1S1N A;  1QCO A;  2RH2 A;  2DF6 A;  2Q7E A;  1Q81 R;  3SD4 A;  3TU4 K;  4HWP A;  4H2U A;  4M7A G;  2PZ1 A;  4R0K A;  4KT0 E;  5I21 A;  2DTI A;  3EFO A;  1TU0 B;  1D09 B;  2B86 A;  2A28 A;  2EIF A;  3MEV A;  3PE0 A;  1N6A A;  1AEY A;  3MHX A;  4PJO E;  3I55 Q;  4OMF B;  4YRL A;  1EIY B;  5HCK A;  4JRQ A;  3EG2 A;  3GNG A;  4OVA A;  5AT1 B;  2XGT A;  1T0H A;  1M2O A;  3OYB A;  5GAM e;  4P75 C;  2MWO A;  5LJ3 f;  1D3B A;  3CCR Q;  3ULR B;  3H0F A;  5DM7 R;  4A4H A;  3BJU A;  1ZSZ A;  2ZNI A;  1BB9 A;  3QDR B;  2BE9 B;  1KG1 A;  1T3S A;  5I2M A;  3EH2 A;  3OY9 A;  4YCU A;  4L6V 5;  4N0A C;  1VQL Q;  3VQY A;  4KGX B;  2ROT A;  2RHZ A;  1EVK A;  2A36 A;  2RQV A;  1P92 A;  4HWS A;  1KSW A;  4IUP A;  2JMA A;  1N9W A;  2FRW A;  4Y92 A;  1K9M R;  3LWI A;  1XOV A;  4CH3 A;  3REB B;  2VXE A;  4C8Q B;  1ABO A;  2ZIM A;  3JCM Q;  4YDQ A;  4WCI A;  5CKF A;  2KRO A;  2X4X A;  4YTL A;  2HAX A;  2VVK A;  4D8K A;  1D1B A;  2CRE A;  1B3Q A;  2L3R A;  1K9A A;  4BI4 A;  2COZ A;  4YRS A;  1LNX A;  4E7S A;  3VS0 A;  3R6N A;  2DD5 A;  3EFR A;  1J5W A;  2X4J A;  4OLF A;  5LJ5 d;  1WQW A;  1RI0 A;  1DJ7 B;  1VQ9 A;  2JMC A;  4JJC A;  5IN1 A;  1HXD A;  1G3W A;  1M3C A;  4JJN K;  4PJO D;  1NM7 A;  1SPK A;  4HVC A;  1G8X A;  1KMN A;  1QQJ A;  3SHW A;  1KFZ A;  2ZPB B;  1Z7N A;  2F5K A;  5J26 A;  3GIB A;  1M5Q 1;  3NEN A;  2H3E B;  4II1 A;  3MEW A; 
#chains in the Genus database with same CATH homology
 4M78 A;  4C92 F;  2RM4 A;  4LDX A;  3FIF A;  2F69 A;  3ICA A;  2K5F A;  4EMK C;  2X35 A;  4EMK A;  4YRO A;  3M9Q A;  4C5E A;  1WNL A;  2E65 A;  3QNE A;  2QI2 A;  4FT2 A;  4NCX A;  2E1H A;  4H2W A;  4Q5W A;  4XTW A;  2ZPF B;  4J6W A;  5HK0 A;  3I56 T;  4PG3 A;  2R5A A;  1VQ7 T;  3BDL A;  1FWZ A;  2FVU A;  4M75 G;  5GAN 8;  3JCM g;  3R6O A;  2E70 A;  2MWP A;  5CVI A;  2E12 A;  3MEU A;  1YIJ T;  4XU0 A;  3DSQ A;  1X2H A;  3QYH B;  1BI1 A;  2HQE A;  1OI1 A;  3URG A;  3UT1 A;  4YRR A;  1ATI A;  2I4N A;  4E7L A;  1G5H A;  2QQB A;  1I4K 1;  3CCL A;  2ZPI B;  2K3X A;  3I7F A;  2HQX A;  4JS5 A;  3BW1 A;  2BKD N;  3QSU A;  5I2S A;  1SET A;  3EFS A;  5A0D A;  2ZZF A;  3PMT A;  5GMK m;  3LWH A;  2NS6 A;  5FRM A;  3QJY A;  5DY9 A;  2GFA A;  4P75 A;  4E51 A;  4JLG A;  1G51 A;  2ZIO A;  4QQ6 A;  4P74 C;  4JDS A;  1B70 A;  1FYF A;  1W4S A;  3E9F A;  3CCS T;  2CJA A;  1KOG A;  5C52 B;  3OMC A;  4Q15 A;  4TTV A;  3G4S A;  4BW9 A;  3RUX A;  2KK4 A;  3FLG A;  1EOV A;  3INZ A;  2GCX A;  2K5I A;  3HXV A;  5GAO r;  2OTJ T;  4C8Q F;  3UH0 A;  3JCM d;  2OTL A;  5FRN A;  1YB3 A;  2RHS A;  3CCM T;  2X4W A;  2C7I A;  2R5M A;  2RD1 A;  3JCM X;  5CK9 A;  1WPY A;  2AHJ B;  1N9R A;  2CZ6 B;  1QVG A;  4YP0 A;  4J8O A;  3SWN C;  5HK3 A;  2ALY A;  1E24 A;  5FU7 C;  2J3L A;  4C8Q D;  5AYF A;  3RL6 A;  2V8I A;  3QG1 A;  2I2L A;  1K8A C;  3X28 B;  2AMC B;  4JS4 A;  1BBU A;  2RA2 A;  1YFS A;  1JBM A;  3L2R A;  4C8Q A;  3DKM A;  4BI3 A;  1G3T A;  3CMA T;  1NJ1 A;  1NPP A;  2QDY B;  3CCJ A;  1X54 A;  3L42 A;  2XTI A;  5GAO m;  1ZBX A;  4LD9 K;  1OYX A;  2A8E A;  4KR2 A;  2ZGW A;  2M0O A;  4V2S A;  2PQW A;  1I8F A;  4LVK A;  1QVP A;  4FIB A;  5GAN 4;  3L1A A;  3CPW S;  5LJ3 g;  5CKE A;  2HD0 A;  1Y07 A;  5C6S A;  1USY A;  2RO0 A;  1M1G A;  1USY C;  2EJF A;  1HC7 A;  3M58 A;  2KMT A;  4TVY A;  5CCA A;  3CCR A;  4C0Z A;  2LCL A;  1H4T A;  2HNI A;  3PT9 A;  2KY9 A;  4XK8 E;  3CCQ A;  3PCO B;  4M78 G;  1QVF A;  1WJS A;  3RKX A;  2CS7 A;  3UGQ A;  3E1S A;  5D6W A;  1M90 C;  2MMP A;  5GMK e;  1SRY A;  4BY6 B;  3TCJ A;  1G5V A;  5CAI A;  4UPA A;  5LJ5 h;  3CC7 T;  3OYM A;  1H4V B;  1C0A A;  1U8R A;  3G71 T;  3MF2 A;  4PHC A;  3CCQ T;  5F5W A;  2DO3 A;  4LVM A;  2M16 A;  1NYR A;  1YHQ T;  4QVZ A;  5IAY A;  3A7R A;  4QVD A;  4EMG A;  3E9G A;  3FC3 A;  1XTD A;  1X2G A;  1KQ2 A;  4KR3 A;  3M4Q A;  2IVW A;  3E9H A;  3LGL A;  3LC0 A;  5E3I A;  4YRK A;  4MZT A;  4P72 A;  1EIF A;  4GLK A;  3MP6 A;  3OW2 A;  4XU3 A;  3C4S A;  1YJW A;  3SWN B;  3HXZ A;  3CCR T;  1ASY A;  3L2Z A;  2DXU A;  3IAL A;  2P0L A;  4E7I A;  3A8L B;  2OTJ A;  4RQE A;  4EDU A;  4TVW A;  4LDU A;  1NJI U;  1QW1 A;  3HHT B;  3VKI A;  4YRF A;  3ZBD A;  2RHS B;  4WF2 A;  3OB9 A;  1EFW A;  3OS5 A;  3X25 B;  3OW2 S;  2PUK B;  2ZPG B;  5GAN 7;  1ADJ A;  4EMK B;  1BIA A;  2XG8 D;  1GXI E;  3VQX A;  2Q7H A;  2EJ9 A;  4X9C A;  2DXC A;  4KUI A;  1H64 1;  5CKH A;  4HT4 A;  3FRN A;  2WSE E;  5GAN 6;  1K73 C;  2IY5 B;  4M78 E;  1YFR A;  1QE0 A;  4HCC A;  2ZT7 A;  1YGB A;  1AHJ B;  3HL8 A;  4HCZ A;  2XKO C;  1Q81 U;  4HWT A;  3FEO A;  4YRC A;  2QEX T;  2EQJ A;  3P8B B;  5KCH A;  3LGF A;  1UB4 A;  2WSF E;  4BE0 A;  4M7D D;  3AHU A;  4B9X A;  3VYH B;  2P0Q A;  4C8Q C;  3JCM P;  1X6O A;  4RG8 A;  2EJG A;  4JUV A;  4YRJ A;  3CMQ A;  5GMK i;  2LNV A;  1VQ9 T;  4TQD A;  4PKC C;  4ZGD B;  3OYJ A;  4P72 C;  3G4S T;  4H2X A;  4H2V A;  1QVG S;  1OZ2 A;  3CCJ T;  1NJ5 A;  4Z02 A;  5LL6 S;  3RMS A;  1EIY A;  4F7U A;  4M7D F;  2VYT A;  3BDU A;  3PFS A;  3CBM A;  2DZC A;  3C95 A;  2JTM A;  4N4I A;  3BFM A;  2PME A;  2CIM A;  2E6N A;  3T9N A;  1WLE A;  4VUB A;  1JJC B;  1KHC A;  3HPW A;  4BE2 A;  1YFT A;  1KHI A;  4R55 A;  5GMK j;  3ERR A;  3VU3 C;  4M77 D;  5GAN g;  4KQE A;  3QPH A;  4YRM A;  4PLI A;  4Y91 A;  2E64 A;  5GAN 5;  2IG0 A;  4OB2 B;  2DXT A;  2PVO B;  3TEE A;  1BI3 A;  1V29 B;  4OB0 B;  3RF1 A;  4LDV A;  4M78 F;  2HBP A;  3I56 A;  1QVF S;  3L2U A;  3OYK A;  3RAC A;  2CZ1 B;  1YJW T;  3I55 A;  4OB3 B;  4TWA A;  5LJ3 d;  2XDB A;  1B70 B;  5D6Y A;  2EKO A;  3JB9 F;  3OYL A;  1I5L A;  4M7A B;  2P0K A;  4M7A A;  1S72 A;  4GY5 A;  3S3N A;  2ART A;  1KMM A;  1Q81 C;  4M77 E;  5FRO A;  3ER0 A;  3GP8 A;  3G6E A;  3QBY A;  2YLB A;  2E6Z A;  3QKJ A;  2WAC A;  4HA8 A;  2QQ9 A;  4PJO C;  1EVL A;  1PYS B;  4LVI A;  3OYA A;  2R58 A;  5GAN d;  2K5L A;  2P4T A;  4PNO A;  3MQZ A;  2RI3 A;  2ZPH B;  2XDP A;  2JTF A;  4MDW A;  4M7D G;  4Y28 E;  4D6W A;  3HKS A;  1N8R U;  4C92 C;  4JRK A;  1KQS S;  1G5I A;  12AS A;  2JOY A;  3CCV T;  4HWO A;  2QQS A;  2MAM A;  3PMI A;  2E5Q A;  4PJO G;  4UP8 A;  4P3P A;  3OS1 A;  2KVQ G;  5GAM f;  3JCM b;  2VUB A;  4C5I A;  2H3J A;  2VV5 A;  2DD4 A;  2ZCF B;  4E7K A;  2ZZE A;  4N4H A;  1S72 T;  4M78 B;  2CYZ B;  2GFU A;  2VGN A;  3MF1 A;  1VQ5 T;  4JRP A;  2QQR A;  3VQW A;  3EAE A;  5A2Q E;  1KQ1 A;  4J7F A;  4HT9 A;  1NNH A;  4A53 A;  1LJO A;  4YYE A;  3HRS A;  4C92 A;  2RI2 A;  3QXE B;  3WVE B;  2X4Y A;  1WJR A;  1JJ2 S;  2RB6 A;  2GF7 A;  3RER A;  1W66 A;  2JVV A;  3HY0 A;  1ZQ1 A;  2K4Y A;  2VC8 A;  4C5G A;  1K9M U;  5KCO A;  3M53 A;  3P8V A;  4F7U G;  1KQS A;  3CBP A;  3CCU A;  1IRE B;  4EMH A;  1Q82 U;  4M77 G;  4YRE A;  1OZ3 A;  5K1X A;  4RQF A;  4CS3 A;  2DAQ A;  1E1O A;  4J6X A;  2XK0 A;  3HSB A;  4TVA B;  3QO5 A;  3CC7 A;  3QTC A;  5GMK h;  2EFI A;  3M57 A;  3JCM e;  2QXF A;  4BUG A;  3SFM A;  3V7S A;  5GMK l;  2ZT5 A;  2DTO A;  3HRT A;  2MI6 A;  3OS2 A;  2DDZ A;  4BD3 A;  3OYY A;  3UPU A;  3HXU A;  4PL6 A;  2PU9 B;  2M1H A;  3FJP A;  2ZT8 A;  3QHS A;  4M77 F;  5EG2 A;  1MHN A;  1VQK A;  1UGP B;  2L8D A;  4FT4 A;  2AKW B;  1VQ4 A;  4RMF A;  3G1Z A;  1VQM A;  4M77 B;  4MML A;  4ZN3 A;  1M1K U;  4RCC A;  1VQN T;  1YHQ A;  4ZN1 A;  1B7Y B;  4K87 A;  4J83 A;  4YRT A;  2FYK A;  3PNW C;  4C0G A;  5CQY A;  3WVD B;  2L89 A;  1VQ6 A;  3HFO A;  3H6Z A;  1K8A U;  1VQK T;  4KUD K;  1W2B A;  3WQZ A;  4QW2 A;  3RGL A;  4NOY A;  4P5N A;  3BY7 A;  1VQM T;  4C8Q G;  4BB7 A;  2XIC A;  1B7Y A;  4J5Y A;  4N0A A;  1M8V A;  2QTX A;  1VQ7 A;  1JJC A;  2JUF A;  3CCV A;  5LJ5 e;  5FLX E;  4X9D A;  3G6E T;  3REX A;  4BDZ A;  2AKW A;  3TEH A;  1Y7X A;  2BIV A;  3CCE T;  2EWN A;  4C0D B;  3CBO A;  3A8M B;  4M75 E;  5LJ3 h;  3S3O A;  5KE3 A;  2DQ0 A;  3N5B B;  5GAM g;  3A74 A;  3A5Y A;  1NJ8 A;  3QO7 A;  2Y4Y A;  3ME9 A;  4M75 A;  2FHD A;  4QVC A;  2EQM A;  2P0P A;  3UFG A;  1Y96 A;  4HCB A;  1YJ9 T;  3LX7 A;  3L2W A;  5GAM j;  1E22 A;  4C0F A;  4H2X B;  4TVA A;  4KUL A;  4OGE A;  5L8R E;  4HKE A;  3LYI A;  2RJD A;  5C53 B;  4IUT A;  4FM4 B;  1I81 A;  2LQK A;  4CS4 A;  1YCY A;  3JAM E;  4P74 A;  2ZT6 A;  4M78 D;  2DEQ A;  2DJZ A;  1UGQ B;  3M59 A;  3SDZ A;  4BAC A;  4YCV A;  1M4Z A;  5GAO n;  3J81 E;  4L5G A;  2M9U A;  5FU6 B;  4ZTF A;  4YPF A;  4MDX A;  4BWA A;  3HTZ A;  2XD0 A;  4P3O A;  4ATO A;  3X26 B;  3ZEH A;  4ELY C;  4M7D B;  3RKY A;  4YRI A;  1LOJ A;  3ZFJ A;  2RJE A;  1IL2 A;  3HXY A;  4DOV A;  4ZIB A;  1QF6 A;  3QZ5 B;  2RK1 A;  5GAM d;  5GAO l;  3L2Q A;  1VQO T;  3HRU A;  3QO3 A;  3PZC A;  3A8H B;  5FU6 C;  5DLO A;  4P3N A;  2CGH A;  3JSC A;  3CPW A;  4JLI A;  1VQP T;  4IUQ A;  2AMC A;  2LX9 A;  5GAN 3;  4O5V A;  3RMQ A;  1K9M C;  4A54 A;  2YHT A;  4E7H A;  1VQZ A;  1M1K C;  1KD1 C;  3NTH A;  3UGT A;  3CC4 A;  3V7C A;  1YIT T;  5GAM h;  4XTY A;  4M75 D;  3VYG A;  5ELO A;  2ZR3 A;  3PIP A;  4E7J A;  3OSV A;  5M9O A;  3CME A;  5FU7 B;  5LJ3 j;  2PUO B;  1WGS A;  4IKF A;  3CC4 T;  2FB7 A;  1H4S A;  4QQD A;  1G3S A;  2MF2 A;  4M75 C;  4JRI A;  3IKM B;  1NPR A;  2D0Q B;  4OGC A;  2RHI A;  1WQ7 A;  3P8Y A;  4E47 A;  1M90 U;  3IG2 A;  3O8V A;  2D6F A;  2DKG A;  4C8Q E;  4G85 A;  3M4P A;  2ZZD A;  3CC2 T;  1TH7 A;  4AH6 A;  4M75 F;  3TUP A;  2QHV A;  3HXW A;  3CME T;  2DVE A;  3SWN A;  4XAX B;  4OP0 A;  1LYL A;  2Q5I A;  4J7I A;  3M5A A;  2ARU A;  3HY1 A;  4CH4 A;  3PGG A;  5C0M A;  3OD1 A;  2PVG B;  1UGR B;  1YJ9 A;  3S3M A;  2Y4X A;  3QO8 A;  5GAN f;  2LT4 A;  5A0L A;  3E9I A;  4F7U F;  2E3C A;  3OYC A;  1ASZ A;  1ADY A;  3DB3 A;  1BI2 A;  3CXC S;  3LLR A;  1Q86 C;  3PIO A;  3CCM A;  1W2B S;  3WXM B;  3DLL A;  4ZTJ A;  2QHT A;  1BKB A;  2RHY A;  2R57 A;  4CS2 A;  4RMO A;  1YBY A;  4EX5 A;  2LCC A;  3A8O B;  2ODR D;  1BIB A;  4NS5 A;  3A7U A;  4MZM A;  4EPC A;  1VQ6 T;  2LQ8 A;  2Q5H A;  2ZCE A;  1VIF A;  3PCO A;  3MET A;  3JCM c;  2E41 A;  3JRZ A;  4M77 C;  2VXF A;  3L4G A;  4M7A D;  5HKC A;  1N27 A;  3X20 B;  2KDS A;  3VJP A;  3HFZ B;  3QYG B;  3TRE A;  1K73 U;  2DU7 A;  3CD6 T;  4XEO A;  1JRI A;  4B9W A;  2I4L A;  3OYH A;  4J6Y A;  1YIJ A;  4HWR A;  3KFU A;  1H4Q A;  3P8H A;  3C12 A;  3HXX A;  5D6X A;  3M4G A;  3OYG A;  2EQK A;  3A32 A;  4M7A C;  3CCL T;  3UWN A;  4A4E A;  4HT8 A;  4RG2 A;  3CCE A;  1N8R C;  1VQN A;  2PMF A;  2I4M A;  4P71 C;  3JCM f;  3V8J A;  1FX7 A;  3HFZ A;  4WI1 A;  2E5A A;  3VQV A;  3H8Z A;  1QP3 A;  1YI2 A;  2ZPE B;  3TEH B;  1YIT A;  2YLC A;  3NTK A;  5KNN A;  3G7Z A;  4P73 A;  3MEA A;  5CO7 A;  4XTX A;  4FL6 A;  4XTV A;  2P5I A;  1SER A;  2JNG A;  2LC4 A;  3OA6 A;  2QHS A;  2ZZG A;  5GAN e;  5C51 B;  3P8D A;  2DXB A;  3F70 A;  4M78 C;  1VQP A;  1SES A;  1H3Z A;  4A4F A;  4CI0 C;  4LNS A;  4YRG A;  4DA4 A;  3I55 T;  5GAO p;  2DPP B;  2EYQ A;  3CD6 A;  2GQV A;  3J7A F;  2RHQ A;  1VQ4 T;  3L2V A;  3MCA B;  5LJ5 f;  2JZ2 A;  3L4G B;  2RJC A;  4ZTU B;  1U1T A;  1PYS A;  2QHU A;  4UP7 A;  4LDW A;  3JCM h;  1Y71 A;  1PSF A;  3VUZ A;  4PJO F;  1FXX A;  1Q7Y C;  4EO4 A;  1YI2 T;  3OYI A;  3A8G B;  3A5Z B;  1X56 A;  4O2D A;  3OQ5 A;  4L59 A;  3RES A;  3OMG A;  1WYD A;  3X24 B;  3CXC A;  4H02 A;  3GLX A;  2OAU A;  1L0W A;  4YCW A;  3HRK A;  2A3L A;  3JB9 I;  1Q7Y U;  1VQ8 A;  3FDR A;  4PJO A;  3QII A;  3V8L A;  2RK2 A;  2LDM A;  2XU8 A;  1EQR A;  3NEM A;  2V8J A;  1HTT A;  2RI5 A;  3LH0 A;  4MMK A;  2EAY A;  3HP9 A;  1KC8 U;  2VGM A;  1X01 A;  3A7A A;  1X75 C;  2CJB A;  1QP2 A;  1NYQ A;  2G3R A;  3KBG A;  4BE1 A;  1RL2 A;  4KBM B;  3NFC A;  4IUV A;  4P71 A;  4LVJ A;  3TEG A;  4X5O A;  1KC8 C;  2O01 E;  4MZP A;  4OB1 B;  4NL2 A;  3SB2 A;  2ODR C;  5CKD A;  2RHX A;  4DQ2 A;  1B76 A;  4J15 A;  2ZR2 A;  3OYN A;  3LSQ A;  3GOX A;  4LVL A;  3CCU T;  4CH5 A;  3DLM A;  3UDC A;  4WJ3 M;  1R8O B;  3KUF A;  3V8K A;  5GAO q;  1WU7 A;  3OYE A;  2F5T X;  4C92 B;  4M7A F;  4K88 A;  4A4G A;  5LJ3 e;  4G84 A;  4FSX A;  3G71 A;  4C0D C;  5HY6 A;  2J3M A;  3OBW A;  4C5H A;  2ZNJ A;  2L5Q A;  1VQL T;  4M7D E;  3M54 A;  2CZ0 B;  4H2S A;  4F7U E;  2RJF A;  1BBW A;  3VUB A;  1JJ2 A;  4RKU E;  4BI8 B;  2ALY B;  4YRN A;  3VV0 A;  4M7D A;  3GPL A;  4N4G A;  4ELZ C;  1Y96 B;  3REU A;  1UGS B;  1XQH A;  3M55 A;  4ME7 A;  3ASK A;  3JB9 D;  11AS A;  2C8M A;  1JB0 E;  4XTZ A;  4C92 G;  1VQL A;  1SSF A;  1B34 B;  2K57 A;  1NJ2 A;  2DZ9 A;  2NLU A;  3DB4 A;  3V7R A;  5GAN 2;  3Q1J A;  4H2T A;  3RIR A;  2DU5 A;  3JCM V;  3KXT A;  2EQU A;  1O75 A;  3OYF A;  4XU1 A;  3MO8 A;  2WSC E;  2XDD A;  3CC2 A;  3RKW A;  2JN0 A;  3OSS C;  3GF5 A;  2OTL T;  4M75 B;  3QUI A;  4DOW A;  2XHC A;  4UC4 A;  4H2Y A;  1G3Y A;  1BI0 A;  5GAN h;  2O4X B;  5J39 A;  3A5Z A;  1YJN A;  3HFV A;  5KE2 A;  3M56 A;  3OBY A;  5A0G A;  5LJ5 g;  4PLL A;  3CPF A;  4DPG A;  4M77 A;  2KSS A;  3JB9 G;  3HRI A;  1O9S A;  1NJ6 A;  1B8A A;  3JB9 J;  1HK9 A;  1VQ8 T;  1NE8 A;  4FU6 A;  1B34 A;  4Q6G A;  1VUB A;  4F7U B;  5DLQ E;  3E19 A;  3S6W A;  4R56 A;  4XQ3 A;  3OS0 A;  1NZ9 A;  4XTU A;  5CQX A;  4BY6 C;  5LJ5 j;  2KAF A;  2V8K A;  4A4K A;  2BUD A;  2DIG A;  4K86 A;  5IT9 E;  4M7D C;  1KD1 U;  2LRQ A;  4C92 E;  4ZGJ B;  1VQ5 A;  3MP1 A;  3PTA A;  3VBB A;  1GGM A;  1N9S A;  3QZ9 B;  3MEY A;  1M1F A;  5GAN j;  2QEX A;  1M9S A;  3NEL A;  4LDY A;  3CMA A;  2A7Y A;  3R07 A;  5ELN A;  2C06 A;  2FL7 A;  2KQW A;  2LT1 A;  5CR2 A;  1VQO A;  4ZTZ B;  3HFN A;  2QA4 A;  2CKK A;  4P73 C;  4CH6 A;  4YRQ A;  2QQA A;  2DTH A;  4RDX A;  3C94 A;  3FB9 A;  1E1T A;  3LW5 E;  3NET A;  2CZ7 B;  3CEY A;  2I4O A;  1UEB A;  2RHU A;  4XEM A;  3NTI A;  2XI9 A;  4M7A E;  1X55 A;  1BYM A;  4LD6 A;  4PJO B;  2LTO A;  4TVR A;  2D9T A;  1NJI C;  5CKB A;  2ZTG A;  2XID A;  4RCB A;  4C92 D;  2QA4 T;  4IUR A;  4X34 A;  1MGQ A;  2EL9 A;  4UP9 A;  2Y90 A;  1VIE A;  1PSE A;  1Q82 C;  1D3B B;  4IUU A;  4NL3 A;  3W3S A;  2E10 A;  1RIQ A;  2G4C A;  4O6J A;  3A31 A;  1IZ6 A;  2PVD B;  4BDY A;  3JCM W;  2IY5 A;  3J80 E;  2K2V A;  2DK3 A;  3IKL A;  2ARS A;  4QQG A;  1Z7M A;  3LSS A;  3JB9 H;  2B8A A;  2K3Y A;  3P8T A;  1YJN T;  1Q86 U;  1ZHI A;  4ZGE B;  3M4Y A;  4WJ4 A;  4YRP A;  2DQ3 A;  2RHQ B;  2O4X A;  4CRI A;  2LVM A;  3QJ6 A;  3MP8 A;  1U1S A;  5HGQ A;  1XNI A;  5KH6 A;  4TQF A;  1WJQ A;  5CIU A;  3CCS A;  2ZXF A;  2DIQ A;  4OF1 A;  2CJ9 A;  2ZIN A;  2Q7G A;  3GNF B;  5K1P A;  4XU2 A;  2YRV A;  4L87 A;  3OYD A;  5J3B A;  3JCM J;  2RH2 A;  2Q7E A;  3SD4 A;  3TU4 K;  4HWP A;  4H2U A;  4M7A G;  4KT0 E;  5I21 A;  2DTI A;  2EIF A;  3MEV A;  1N6A A;  3MHX A;  4PJO E;  4OMF B;  4YRL A;  1EIY B;  4JRQ A;  2XGT A;  3GNG A;  4OVA A;  3OYB A;  5GAM e;  4P75 C;  2MWO A;  5LJ3 f;  1D3B A;  5DM7 R;  4A4H A;  3BJU A;  2ZNI A;  3QDR B;  1KG1 A;  5I2M A;  3OY9 A;  4YCU A;  4L6V 5;  4N0A C;  3VQY A;  2RHZ A;  1EVK A;  1P92 A;  4HWS A;  4IUP A;  1N9W A;  3LWI A;  1XOV A;  4CH3 A;  2VXE A;  4C8Q B;  2ZIM A;  3JCM Q;  4YDQ A;  5CKF A;  2X4X A;  4YTL A;  2HAX A;  2L3R A;  4BI4 A;  4YRS A;  1LNX A;  2DD5 A;  3EFR A;  1J5W A;  2X4J A;  4OLF A;  5LJ5 d;  1WQW A;  1RI0 A;  1DJ7 B;  1VQ9 A;  5IN1 A;  1HXD A;  1G3W A;  4JJN K;  4PJO D;  4HVC A;  1KMN A;  2ZPB B;  1Z7N A;  2F5K A;  5J26 A;  3GIB A;  1M5Q 1;  3NEN A;  4II1 A;  3MEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...