2DTIA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, pyrophosphate and mn(2+)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 69
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dtiA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dtiA01
5GAN7 2AMCA 4J5YA 1X2HA 5LJ5e 1ASZA 3E9HA 1Z7MA 3BW1A 3UH0A 4WJ3M 5DY9A 3AHUA 1FYFA 1EVKA 3NETA 3QUIA 4K87A 2RA2A 1C0AA 3BY7A 1X2GA 4EMHA 5GAN6 3PZCA 3REXA 4NOYA 2DJZA 4M7AG 1SERA 5GAOp 1ATIA 2C7IA 3VQWA 2RHSB 1X56A 3HFZA 4M7AF 2EL9A 2E65A 1PYSB 4XTYA 2ZZFA 4LNSA 1N9RA 2ZIMA 1M8VA 4YYEA 3A7RA 4G84A 3JB9G 3UFGA 4RCCA 4YRSA 4M7DE 4M78B 5GANf 3V8KA 3JB9F 4YCUA 3JCMe 1I8FA 1WU7A 1NJ1A 4YREA 3IKMB 4XTXA 3RKWA 1WQ7A 1B76A 3HXYA 1BBWA 3A31A 4WI1A 4C92C 3PGGA 4N0AC 5GMKj 4M75B 1PYSA 4XU2A 4TQDA 3RF1A 1HXDA 5LJ3g 4YCWA 4EO4A 4H2WA 5GAMj 1ADJA 1NYRA 1HC7A 4K86A 4HWSA 4M78A 4M77B 4M7DG 3V7SA 4M78D 2XGTA 1E1TA 2E41A 5LJ5d 4M7DF 3V8LA 1LJOA 4A53A 12ASA 2I4LA 4XU0A 3IG2A 4ZIBA 3UGTA 4YRNA 2ODRD 1H4TA 4H2SA 1WYDA 4P3NA 4C92E 5GAOn 3G1ZA 3JB9I 4M7AC 2K57A 3A5YA 2DQ0A 5LJ5h 4XTVA 4M75A 1W66A 3JCMV 4P73C 2DU7A 3VQVA 4M75D 2J3MA 3MEYA 3RL6A 3L1AA 5GMKi 4CH6A 3QO8A 2AKWB 2DVEA 3M4PA 4XEOA 4V2SA 3HY0A 2DZ9A 4X5OA 2FYKA 4RCBA 4PJOG 4Y91A 4M77A 1X01A 3BFMA 2PMEA 1E24A 4M77D 3TEHB 4PJOF 1ASYA 5GAN3 1EQRA 1E22A 2EJGA 5GAMe 2QHSA 3NELA 2DDZA 4L87A 5GAN8 4KR3A 3JB9H 4CS4A 4RMFA 3JCMh 4OLFA 3SWNC 1QF6A 4F7UE 3HFVA 4YRFA 3VBBA 4TQFA 2AKWA 3RKYA 4J6YA 3HXWA 4XU1A 2QHUA 3RGLA 5GANj 1YGBA 2ARSA 3R07A 3IALA 2ZZGA 3NEMA 4YP0A 4M7DC 4C8QG 5GAN2 3TEHA 4J6WA 3FJPA 1N9WA 2Y90A 4P3PA 2ZT8A 4C8QF 3QO5A 2E10A 2Q7EA 2Q7HA 3JB9D 1WQWA 4PNOA 3ICAA 1EFWA 2FB7A 1QE0A 5GMKm 2P0LA 4J15A 1SESA 4F7UG 2Q5IA 4YRPA 3V7CA 3RIRA 4H2VA 4F7UF 3SB2A 3RESA 1MGQA 4XU3A 3QSUA 4EMKC 3I7FA 4JRIA 3A7UA 3LSQA 2DZCA 1KQ1A 3REUA 3JCMP 4PJOC 3HXZA 4KR2A 1H4VB 4YRIA 5LJ5g 1KMMA 4H2UA 3HFNA 3CMQA 2P5IA 1G5HA 4P71A 5LJ3f 2E64A 1KQ2A 5GANe 4PHCA 3E9IA 4HA8A 2DTHA 5GAMd 4MMLA 3JCMf 2RD1A 1LNXA 5GAOm 2RHSA 3A74A 4M7DD 3PCOB 2YLCA 4YRRA 2VC8A 1Y96B 5GAMh 1YFSA 1NJ8A 1NJ2A 3UGQA 4C92B 4PJOE 3V8JA 2ZGWA 4ZTZB 2IY5B 5K1PA 3RACA 1NYQA 3JCMg 1H641 4C8QC 4CH4A 2QHVA 2ZR3A 2DXTA 1HK9A 5GAOq 4AH6A 5HGQA 4UP9A 1USYC 4DQ2A 3QNEA 2EJFA 3QTCA 1N9SA 4P75C 2G4CA 4HT9A 4P72C 4HWOA 2ARTA 1H4QA 2DEQA 3HTZA 4HWRA 3A5ZA 3PCOA 1L0WA 2DTOA 4WF2A 4BWAA 4OP0A 4YCVA 4P74C 3A32A 5ELNA 1Y96A 4EX5A 4H2XB 4YRQA 3QO3A 1B70B 4UPAA 4XEMA 4M75E 4YRTA 1H4SA 4Q6GA 3RERA 1EIYB 3M4GA 5GAOr 1B34B 4M7AB 2CJBA 1WPYA 3HRIA 4C92A 4N0AA 1E1OA 3MF2A 4E51A 1M5Q1 3P8YA 2IY5A 5GMKe 5GAN4 4C92D 2CIMA 4C8QE 3JCMc 3ERRA 5GAN5 3JCMX 2QTXA 3W3SA 2I2LA 4M77E 4M78G 3FIFA 4TTVA 3HXVA 1Z7NA 5E3IA 4KQEA 1U1TA 5GANd 4M78F 2Q5HA 3A7AA 4QVDA 3TUPA 4WJ4A 2EJ9A 1G51A 2ZR2A 3TEGA 2CJAA 4TVWA 1B8AA 3L4GB 3P8VA 2RB6A 1B70A 5GANh 2ZT7A 2YLBA 1EIYA 2ZNIA 1WLEA 2ALYB 1BIBA 1B34A 4M7AA 4M75G 1U1SA 5GMKl 1SETA 3SWNB 5CAIA 1YFRA 4M7AD 4P73A 5ELOA 1HTTA 4M75F 2QHTA 5LJ3j 2ZZEA 4JRKA 5C51B 1B7YB 2EAYA 1BIAA 3HXUA 5K1XA 2ZCEA 5C53B 5GAMg 4M77G 3EFSA 3HFOA 3OD1A 4XTZA 4K88A 4M77F 1JRIA 4M7DB 5LJ5f 4YRKA 5KNNA 3L4GA 2EWNA 2RM4A 2I4NA 1JJCB 3KFUA 2ALYA 2I4MA 3QO7A 1JBMA 5GAOl 1YCYA 4JUVA 3SWNA 2VXFA 1TH7A 4TVYA 2E3CA 4YRMA 4MMKA 1I4K1 1J5WA 4PG3A 1B7YA 3VU3C 4CH5A 1EVLA 4UP8A 4P3OA 4EMKB 3JCMQ 4M78C 4G85A 4H2YA 1KOGA 3GIBA 5GMKh 4PJOB 5I21A 2DU5A 4M7DA 3VQXA 4EMGA 2HNIA 4TWAA 4CS3A 1EOVA 5LJ3e 2ZTGA 2ODRC 4A54A 3FB9A 1NJ5A 3HY1A 3QHSA 4NL3A 2I4OA 4H02A 1JJCA 2E5AA 2ZXFA 3M4QA 4J6XA 4H2TA 4NCXA 3L2ZA 4XTWA 3RUXA 4JLIA 1NNHA 3JCMb 4M75C 3HRKA 3JCMW 4XQ3A 3WQZA 4UP7A 2ZINA 1BBUA 2DTIA 3INZA 3NENA 4M78E 4NL2A 1G5IA 4EMKA 4TVAB 5GANg 1D3BB 2ZIOA 1X55A 4M77C 4YRJA 4PJOA 2RHQB 2ZT6A 4RQEA 4XTUA 4PJOD 1RIQA 3JB9J 4C8QB 1LYLA 1YB3A 2ZNJA 4DPGA 4BW9A 2CGHA 4CH3A 4O2DA 2PMFA 4HVCA 4ZTUB 2C8MA 3DSQA 3P8TA 1I81A 2VXEA 1I5LA 1NJ6A 4F7UB 2DXUA 1VQZA 2YHTA 4QVCA 3MF1A 4RDXA 3V7RA 4TVAA 1D3BA 4RQFA 4HWPA 5LJ5j 3VQYA 2RHQA 3RKXA 2DQ3A 4C8QA 2Q7GA 4YROA 4YRLA 3LSSA 3BJUA 2DKGA 4C8QD 2ZT5A 4YRGA 4X9DA 5LJ3d 1USYA 4H2XA 5GAMf 2AMCB 4P75A 4P72A 3EFRA 4YDQA 1X54A 3JCMd 1IL2A 4HWTA 5LJ3h 5F5WA 5C52B 4P74A 4F7UA 4M7AE 1KMNA 11ASA 1WNLA 3BDUA 4C92G 2J3LA 2XTIA 1SRYA 1GGMA 3HFZB 1ADYA 4C92F 2JN0A 3LC0A 4YRCA 1YFTA 2CJ9A 4YPFA 2E1HA 4X9CA 3JCMJ 3HXXA 4HT8A 3IKLA 1LOJA 4P71C 4CS2A 3HSBA 4Q15A 2ARUA
chains in the Genus database with same CATH superfamily
1I5OB 5GAN7 2AMCA 4J5YA 1X2HA 1QVGP 4YTLA 1Z7MA 2ECZA 5DY9A 1NLPC 3QUIA 4UC4A 2ENMA 1X2GA 3A98A 4K11A 4C5IA 4NOYA 1O9SA 1SERA 1G3YA 3OY9A 2F2XA 4OB0B 3VUZA 1ATIA 3EGXA 2D1XA 2L3PA 1PYSB 3EG0A 3CCJA 2EYQA 1RLPC 4XTYA 4OMLA 4E2FB 2KSSA 1N9RA 1KHCA 3G71A 4YYEA 1VQLA 3SD4A 4OVAA 4G84A 2V26A 4RCCA 1TWBA 1QVFP 2XI9A 4PLIA 1M90U 4E7SA 3V8KA 1ZBXA 3JCMe 1YN8A 1K9AA 1NJ1A 2K9GA 3CCSQ 5IHIA 1IRXA 3JV3A 2L89A 4FW2A 1X6GA 4E7HA 2LNHB 4C92C 1NJIC 4FW1A 4XU2A 1ZA2B 4QW2A 2DD4A 3RF1A 1MNEA 1HXDA 1ZA1B 4AT1B 5LJ3g 4EO4A 2RQTA 1NYRA 1YITQ 2KYMA 4M7DG 3OQ5A 4M78D 1PSEA 4OMNA 3EG9B 2E41A 4M7DF 3V8LA 1LJOA 2I4LA 5J26A 4DOVA 3U23A 1FX7A 3M54A 1H4TA 1IO6A 1WYDA 4P3NA 1AWWA 4LDXA 3A8OB 1IHVA 2KQWA 4EDUA 2RI5A 4M75A 3JCMV 3NTHA 3MEYA 2AKWB 4LVJA 1Q82U 2K7AA 3A8LB 2A0FB 4BE1A 4QVZA 2DZ9A 3HL8A 4X5OA 1XNIA 3HKSA 2FYKA 4RCBA 1QCOA 2KMTA 4M77A 1E24A 4ZTFA 1G3SA 4O5VA 1KHIA 2KGTA 3OYHA 4KR3A 2QQ9A 4LUDA 4RMFA 4OLFA 3OW2S 3SWNC 1M90R 3CCJQ 1XQHA 3OBYA 2LT1A 1SRMA 1GCPA 1K73U 3OSVA 4BD3A 3G71Q 1VQLQ 2DFUA 1Q7YU 3HXWA 4IUPA 2P4TA 5GANj 1NEBA 1VQNT 1YGBA 3R07A 3CMAT 2HL3A 2DL5A 2VGNA 4J6WA 1GBRA 2RN8A 2E10A 3X28B 2Q7HA 3M55A 4IURA 4FYXB 3TCJA 3CCQA 2EQMA 2FB7A 4DOWA 2P0LA 4OMQA 3TREA 5FU6B 1S72A 3H0IA 3CCLA 1WJRA 4HVWA 4LDVA 2RI3A 3V7CA 1VQKA 4H2VA 4BI4A 3SB2A 1X6OA 3I7FA 1VQ8A 3REUA 4KR2A 2IVWA 5J3BA 3E2UA 4YRIA 1KC8U 2KI7A 3P8HA 2FPEA 3GBQA 4RUGA 1Q82R 2JNGA 5GAMd 3NTKA 1H92A 1WHMA 2NUPA 3M58A 2RHSA 4M7DD 2JM8A 2O88A 4YRRA 1LVKA 2XG8D 5GAMh 1H8KA 2R58A 2ZPBB 1B3QA 3OYAA 3I56A 4PJOE 2FPFA 2ZGWA 4RG2A 2CT4A 1NYQA 2L3QA 1WZOA 1Y07A 4C8QC 4D6WA 1HK9A 2DYIA 5GAOq 5FRMA 3MEWA 4F17A 4J7FA 3OYCA 5FLXE 1K73R 4F14A 1Q7YR 1VQ7T 2E5KA 2G4CA 1KQSA 4HWOA 2DEQA 3QBYA 3C94A 3VKIA 4AFQC 5EC7A 3X24B 4BWAA 1YFNA 3CC4A 3QO3A 1QQJA 4X34A 2G6FX 3M4GA 3A8MB 5GAOr 1B34B 2OTJA 2LVMA 1VYVA 1E1OA 3MF2A 2MI6A 3VYHB 5GMKe 3ERRA 1VIFA 3FRNA 1QP3A 1NZ9A 2AHJB 2A3LA 3HXVA 2ED1A 1Z7NA 1K9MC 3CCQQ 2FZGB 4C5HA 3A7AA 4WTOB 3G4ST 2ZR2A 2RHXA 3CCST 1S72Q 3CCLQ 4GLKA 3CXCP 1KC8R 1UHCA 1VQKQ 2YLBA 1EIYA 1AZEA 1BIBA 2XDBA 1D0ZA 3G7ZA 1VQ8Q 1JB0E 4PK4A 2ZPIB 1YFRA 4M7AD 1RUWA 1E7OA 2V8IA 2LJ3A 3OS0A 1TSFA 1K76A 5LJ3j 2ZZEA 5C51B 3TSWA 4J9DA 3HXUA 2C0IA 3EFOB 2LZ6B 3NPFA 1R77A 3OD1A 2P4RA 4XTZA 1JO8A 2PQWA 3HP9A 4M7DB 2KK4A 2GTOA 4J9BA 3L4GA 1YJ9Q 5FU7B 2I4NA 2QA4A 5C0MA 3KFUA 3A8GB 2A8EA 2ALYA 2I4MA 5GAOl 4DBQA 1YJWA 3OS2A 1GCQA 4YRMA 3P8DA 1I4K1 3KUFA 4PG3A 3HTRA 4ZGDB 3VU3C 3PMTA 1RI0A 1XTDA 4P3OA 3NHNA 3JCMQ 3EH2A 3LWHA 2W10A 1OZ3A 2LJ1A 5I21A 1YCSB 2BE7D 1PCXA 4TWAA 4CS3A 4LXCA 4L59A 3I35A 2ROTA 3QWYA 2ODRC 3QZ9B 5FW9A 3HY1A 5DLQE 1YJNA 2CZ0B 2F1LA 2IIMA 4OGEA 2GCXA 3E19A 3VV0A 3QIIA 1WIEA 4M75C 4RTZA 3JCMW 4XAXB 4XQ3A 1YBYA 5EG2A 2A37A 3CCJT 4FT2A 5I2SA 5LL6S 2DVJA 3CC7Q 4B6MA 3G71T 4M78E 1SF9A 2KDSA 4EMKA 1D3BB 4J7IA 4PFOA 4M77C 1FWZA 3QWXX 3OYEA 2DRMA 3H41A 3OYYA 4PJOA 4J9HA 4RQEA 3DLLA 2CS7A 2GBQA 1F1BB 3NMZC 1KG1A 2L2PA 2DA9A 2X3WD 3CCUT 4ZTUB 3NFCA 1KC8C 3MP1A 1WJSA 1D1AA 5IHKA 4KGVB 2VXEA 3UT1A 2K5FA 1M2VA 4QVCA 3L2QA 3MF1A 2MYSA 3OYDA 1VQNA 3QDRB 3V7RA 1OV3A 2G3RA 1Q81U 2PVOB 3CMAA 4OB1B 2QDYB 4YROA 3C0CA 2IPOB 4QT7A 1B07A 3UA7A 2VUBA 1U06A 4H2XA 2F5KA 2QA4Q 4P72A 2LT4A 2WSFE 2YRCA 2XHCA 1YJWQ 4HWTA 1M4ZA 2QGFB 4P74A 4R56A 2OAUA 11ASA 1OX9A 2LJ0A 1O75A 2QEXA 1PKTA 4C92G 2MF2A 3BE3A 2EFIA 1ZLMA 2FHDA 3HFZB 2F69A 4C92F 1HSQA 1NJIU 1VYTA 4YRCA 2V8KA 3CMEA 4YPFA 3JCMJ 3C12A 3IKLA 4HT8A 2L5QA 1LOJA 3JSCA 4CRIA 3OB9A 2V1QA 2GQIA 1YJNQ 3OW2A 5LJ5e 1ASZA 3E9HA 3BW1A 5FROA 4WJ3M 1BI0A 1FYNA 1M3BA 1EVKA 2J05A 4K87A 4XK8E 2LTOA 1OI1A 1ZHIA 2GQVA 5D7UA 2DJZA 1IGQA 5GAOp 3VQWA 4LE9A 2RHSB 2EL9A 1X27A 1OU9A 2LX9A 4AG2C 1RAIB 2ZZFA 2ZIMA 2MIOA 2D8JA 3QPHA 3JB9G 1VQ7A 4OB3B 4M7DE 1X69A 2M02A 2HBWA 3S3NA 3JB9F 3EHRA 4ESRA 2H3EB 1I8FA 1WU7A 2CP0A 3IQLA 4BE0A 3IKMB 4XTXA 2KNBB 2PNIA 1TOVA 5HK3A 1S72T 3A31A 4WI1A 4LVMA 2AK5A 2F2WA 1VQNQ 3RMQA 2DXBA 2M51A 4FU6A 5KH6A 3OSSC 3PGGA 2LDMA 2PUOB 3VRZA 4TQDA 4HCBA 2XDPA 1W1FA 4RTYA 5IHNA 3MCAB 2AZVA 4N4GA 3EG1A 3L2VA 2EQKA 1QKWA 2J6KA 3UA6A 1ADJA 3URGA 4M78A 2AIRB 2KRMA 2MK5A 1AWXA 2AKKA 3G4SA 1E1TA 2QDLA 1JJ2S 1YNZA 3CCSA 4A53A 12ASA 4KH1B 4XU0A 5CR2A 1G3WA 1NJIR 1IZ6A 1NG2A 2K3YA 4H2SA 2CP7A 1YJ9T 4RTTA 2BUDA 2QEXQ 3G1ZA 2K57A 3A5YA 4OMFB 2DQ0A 4N4IA 3OYKA 1UGPB 1Y57A 2MWOA 1W66A 2HQXA 4EPCA 2DU7A 2DJQA 2FL7A 1CSKA 3L1AA 3CMEQ 3QO8A 2DVEA 4XEOA 3HY0A 1U3OA 1QW1A 3GPLA 2DETA 2CUDA 2CZ1B 2PMEA 4KT0E 3JAME 3TEHB 2LQWA 4F16A 2RHUA 1EQRA 2EQJA 2EJGA 3NELA 5GAN8 3JB9H 1RAFB 1VQ4Q 2DERA 1FXXA 1SKUB 3JCMh 4Y92A 2LC4A 3ZEHA 1QF6A 1GCQC 4YRFA 4TQFA 4E7LA 4J6YA 2QHUA 3RGLA 2YSQA 3CC7T 3IALA 3MO8A 2DEUA 2X4XA 1ZSZB 2CYZB 4OMMA 4C8QG 5L8RE 5GAN2 4R55A 1WHGA 4KUDK 3CC2T 4P3PA 2ZT8A 3MJXA 4C8QF 3QO5A 2BTTA 2Q7EA 2EPDA 1OPLA 2VKNA 3JB9D 1Q81C 1WQWA 1K0SA 4PNOA 3ICAA 1WA7A 1QE0A 4IIOA 5KYYB 3UPUA 1G5VA 1H3ZA 4F7UG 3VS3A 3G6ET 2DPPB 3NTIA 3HRUA 4LDUA 4F7UF 2XIDA 3SDZA 2ZZDA 3M0UA 2X3XD 1MGQA 3QSUA 4EMKC 1S1NA 1PM3A 2EBPA 4JRIA 3LSQA 2SRCA 1KQ1A 3JCMP 4PJOC 1H4VB 2K2VA 1LCKA 1SPKA 2EQUA 5CIUA 4H2UA 3G4SQ 3KBGA 1KQSP 2COZA 5CKBA 4P71A 2E64A 1BU1A 5GANe 2A08A 1TXQA 3CCUA 2DTHA 4J9IA 2QA4T 1K9MU 3CCRT 1LNXA 3M0TA 5GAOm 1KIKA 3A74A 2RPNA 1YJWT 4MZTA 1YFSA 2DL8A 1OOTA 3WVEB 4C92B 5J39A 2RF0A 3V8JA 3ZL7C 4JJNK 1XJWB 5K1PA 1PSFA 3RACA 1GBQA 4CH4A 2QHVA 3CCET 1R0CB 2LCCA 1UEBA 3META 4AH6A 2ABLA 2L3RA 2DXCA 4Q5WA 4D8DA 2NYSA 4UP9A 3LW5E 2EJFA 4QQDA 3AT1B 3KFVA 3VS0A 1OZ2A 4P72C 1YJNT 1K8AU 1YWOA 1JXMA 3A5ZA 4JRPA 3PCOA 2DTOA 4WF2A 1L0WA 1TU0B 2JW4A 2QAZA 4P74C 1AWJA 3A32A 1Y96A 2J06A 4PL6A 2HCKA 3VS6A 4H2XB 4YRQA 1B70B 4XEMA 3RDVA 1RACB 1UG1A 3LGFA 3QJYA 4LNPA 1FMKA 1BI3A 4YRTA 3OYGA 3OA6A 1WPYA 2A28A 3OS5A 4E51A 3DLMA 2FRYA 1W2BS 2IY5A 5I22A 3CPWS 2D9TA 2KT1A 3H9NA 3OS1A 3CEYA 3JCMX 1WLPB 2OX7A 1UFFA 3KXTA 1OU8A 2CH4A 1X2QA 1PRMC 4TTVA 5HKCA 1RLQC 2YRVA 5E3IA 3CD6A 1U1TA 2LMJA 1SSHA 5A2QE 4QVDA 5A0GA 5KYXA 2CP5A 4WJ4A 2HKQB 3TEGA 4ZTJA 2CJAA 2L8DA 2HDAA 2DE0X 6AT1B 2ZT7A 4BY6C 1C0MA 3EGDB 4M7AA 4M75G 1U1SA 1RABB 3SWNB 3EAEA 2CUBA 5CAIA 4ZN3A 4M75F 3QYHB 1K9MR 5CK9A 4JRKA 2VB6A 1B7YB 1CKBA 2XICA 5C53B 5GAMg 4M77G 3CCUQ 2LX7A 5KE2A 4K88A 4M77F 1JRIA 5LJ5f 2E4HA 2D6FA 2YUOA 2ED0A 2RHIA 5KNNA 2DM1A 5D6WA 1BK2A 1UHFA 1GXIE 1WXBA 3Q1JA 1N5ZA 3JRZA 2FO0A 1JBMA 4ZGJB 4JUVA 2QEXT 2O4XB 1TH7A 5KYWA 3PTAA 2E3CA 1WHLA 4IUVA 5M9OA 1SEMA 3CPFA 1QWFA 1XOVA 4CH5A 3CMET 4FSSA 4OGCA 4UP8A 2HSEB 1N8RU 4M78C 1PNJA 4G85A 5GMKh 4QKUA 4MDWA 2CZ7B 3UATA 1H3HA 1EOVA 5LJ3e 2ZTGA 1KK7A 1MUZA 4HCCA 2D0NA 3QHSA 1YJ9A 1JJCA 2E5AA 2ZXFA 5KE3A 2YUQA 4NCXA 4QQGA 1JQQA 3HRKA 1VQ4T 3EGUA 1N6AA 5HCKA 2KR3A 4KGZB 4LVLA 2OI3A 2O9SA 2RH2A 1G5IA 4PFPA 4TVAB 2D0QB 2ZIOA 3CD6Q 2LQNA 2ROLA 2RHQB 2ZT6A 4Y28E 4XTUA 4C8QB 3LWIA 4BW9A 2J6FA 2CGHA 1M8MA 5A0LA 4CH3A 3OYMA 4LDYA 2DBKA 4FL6A 2PMFA 4HVCA 3LLRA 3I5SA 2MCNA 2C8MA 1RADB 2CH4W 1VQ9A 4PJMA 2EYYA 4JZ4A 4MZPA 1T0JA 1M1KC 1NJ6A 2RJDA 4F7UB 2DXUA 2YHTA 2NUZA 3CC7A 4RDXA 1WX6A 3CBPA 3WXMB 3GLXA 2PZ1A 4OF1A 4HWPA 5IXBA 1OEBA 3GNFB 1JJ2A 3CC2A 3OW2P 2DQ3A 8AT1B 3FLGA 1YIJA 3E9GA 4FYWB 1TS9A 4B9WA 3LSSA 4YRLA 4IUUA 3UDCA 3GOXA 1USYA 4ELYC 2AMCB 1IHWA 4P75A 4YDQA 2FPDA 1X54A 1EFNA 1MV0B 5CO7A 2LRQA 5KYUA 2ZPEB 5F5WA 2J7IA 3G6EA 1VQOT 1D0YA 1VQMA 3UWNA 1VQPT 1Z9ZA 3BDUA 2HEQA 2XTIA 2EIFA 3EHQA 4DBHA 4BDYA 3EGXB 1GGMA 2JTFA 4C5GA 1K8AC 2JN0A 1ACMB 2XKOC 5CQYA 1Q86C 2FVUA 1BCMA 3MQZA 1ZUUA 2E1HA 4P71C 2EGEA 3CCMT 5FWCA 3OYFA 2ARUA 1NPRA 1UJYA 1MMNA 3CCRA 1ABOA 4WCIA 5KCOA 4PJLA 2RA2A 1WJQA 1C0AA 2CZ6B 3PZCA 4PFZA 3FDRA 4FT4A 3MP6A 2C7IA 4LVKA 1Z9QA 2E65A 1KSWA 3EG2A 1OYXA 1AWOA 3CCEA 1M8VA 2P0PA 2NUTA 2MAMA 1M1FA 3A7RA 5CKFA 1ZQ1A 1FMVA 1PHTA 3UFGA 3I55Q 4A4GA 5GANf 3S3OA 2LP5A 3HRTA 1BB9A 1VQ9Q 4YREA 2XK0A 3RKWA 2DIQA 1CKAA 1WHJA 3RMSA 1BBWA 1EX4A 1VUBA 2KT8A 5GMKj 1OULA 1SHFA 4M75B 3L2UA 1PYSA 4CC2A 3QXEB 3CC2Q 1ZBJA 2AT1B 2O31A 2EYXA 1YIJQ 4YCWA 5GAMj 1EZZB 1HC7A 4K86A 3DB4A 3TVTA 4HWSA 2RJCA 2GF7A 4M77B 1Q95G 4RKUE 3SEMA 1UJ0A 2XGTA 5DM7R 2YT6A 1UUEA 1D0XA 1WYXA 5LJ5d 1R0BG 3OYJA 4E7IA 3G6EQ 2SEMA 4ZIBA 3UGTA 4YRNA 4HXJA 1VQMQ 2JTEA 2KAFA 1N8RC 2EVRA 4M7AC 5LJ5h 4XTVA 2ZPFB 1BYMA 2ESWA 2JJ9A 5GMKi 2JVVA 2IG0A 4OMPA 3M4PA 4V2SA 2E5QA 3REBB 2BIVA 1AD5A 4PJOG 2JS0A 4B9XA 1RAAB 4Y91A 1X01A 3BFMA 1Y0MA 4JPBW 3CCRQ 1PD0A 3EG9A 5IN1A 2XMFA 4PJOF 1FMWA 1ASYA 2EKHA 2E70A 2RNAA 1E22A 4KH0B 2QHSA 1SHGA 4L87A 2V1RA 4KBMB 4JLGA 1PWTA 4BACA 4BI3A 1HJDA 1W2BA 3VYGA 2CP2A 3PVLA 4F7UE 3CPWA 2QQRA 1BI2A 3J81E 3CCEQ 3VBBA 1RI9A 2AKWA 2EQIA 1PRLC 1IXDA 1IGUA 4LDWA 2GGRA 2RQVA 3O8VA 5AT1B 5KYWB 2P0QA 1K4US 3NEMA 4YP0A 3CD6T 4ZN1A 3H8ZA 4DA4A 3FJPA 1M30A 2Y90A 4NS5A 1RAGB 2K6DA 3FC3A 2DX1A 4JJDA 2KRSA 1YHQT 2JTMA 1G8XA 3OYBA 1VQ4A 4J15A 2NUPB 4JRQA 4JDSA 5CCAA 4YRPA 1NBEB 2XU8A 2BZYA 3RIRA 1PKSA 3QKJA 1QVGS 1C6VX 1GFCA 1UGRB 2DZCA 3HXZA 4C0DC 1KMMA 1VQ6T 3HFNA 3CMQA 4HKEA 2P5IA 4KUIA 1G5HA 3PMIA 4KGXB 1Q81R 5IT9E 4OMOA 5LJ3f 1G3TA 1N27A 1KQ2A 4A4KA 2LQ8A 3G1JA 1X2KA 3A8HB 4HA8A 4RTUA 2HQEA 2RD1A 4J9FA 1AT1B 3PE0A 1D09B 2B8AA 1MHNA 1GRIA 3EH1A 2BKDN 2VC8A 1QVFS 2ZPGB 3THKA 2JMCA 2LCLA 5DLOA 1NJ8A 1NJ2A 3H0FA 3CCVT 1PC0A 4ZTZB 2CKKA 3JCMg 3M5AA 1TG0A 3M59A 1YI2A 4L6V5 2DF6A 2K5LA 4ELZC 4CC4B 2K2MA 1USYC 2BE9B 3RBBB 3QNEA 1N9SA 4P75C 4ZGEB 3OMGA 1BCOA 2NS6A 2F2VA 3VS4A 3HTZA 4HWRA 1VQOA 4OP0A 2QYZA 3T9NA 2DRKA 1T3LA 2RQWA 4EIKA 4EX5A 2VYTA 3I9QA 4FCYA 1VQPA 4M75E 4AFSC 5ECAA 4Q6GA 1HD3A 2R57A 1EIYB 2MWPA 4N0AA 1M5Q1 3P8YA 1X6BA 4C92D 2CIMA 1I0CA 3TQ7P 2RO0A 3M53A 2CP6A 3CCMA 2BZXA 3GNGA 4II1A 3ZBDA 2VVKA 4M77E 4M78G 4AMCA 4ATOA 1UECA 2RQRA 3GF5A 5GANd 4M78F 3I55T 2Q5HA 2YRDA 3QDFA 4ANJA 4A4HA 3TUPA 4ZNXA 1G51A 2QQSA 1VQ9T 1NE8A 3L4GB 3P8VA 1NM7A 5GANh 4GY5A 2EW3A 1ABQA 1WLEA 1B34A 2ALYB 5GMKl 4PLLA 4C0ZA 4MDXA 2OTLA 4P73A 5ELOA 1HTTA 1BIAA 2ZPHB 2GTJA 5D6YA 3MEUA 1WHKA 1YIJT 3HFOA 2A36A 2M9UA 1YWPA 2QK0A 1U5SA 3PNWC 1OX8A 5FWBA 3PVQA 3EG3A 1J3TA 2DD5A 2JMAA 3R6OA 2RM4A 1X43A 3PFSA 1VOMA 1VQMT 3GP8A 4TVYA 4MMKA 1VA7A 2RQUA 1YI2Q 1QCFA 1EVLA 1M1KU 3EFOA 4EMKB 1VIEA 3H6ZA 4H2YA 1QCNA 1KOGA 3M57A 2GNCA 3GIBA 1IB8A 4PJOB 4M7DA 4EMGA 2HNIA 3QYGB 1KD1C 1VQOQ 3J80E 1PG5B 1GFDA 4C5EA 4VUBA 5CQXA 2I4OA 2BZ8A 1VQPQ 4H02A 3M4QA 4J6XA 4H2TA 4XTWA 3RUXA 3HHTB 2RJEA 3WQZA 2DTIA 2EGCA 3INZA 2P84A 1M2VB 2DBMA 3CCMQ 1JJ2P 3S6WA 3X25B 4LN2A 4FIBA 4YRJA 3ZFJA 2K79A 3JB9J 2AZSA 4PJJA 1SG5A 2COWA 1Q86U 2JXBA 4O2DA 2XD0A 4M4ZA 3PIOA 1M2OA 4BI8B 2CSIA 4ORZA 1RAEB 5KYNA 2X51A 1G83A 3OYNA 1QMCA 1QP2A 2OTLQ 3ER0A 4Z8AA 2FRWA 2R5MA 4JJBA 1I5LA 2DNUA 1PD1A 3SFMA 4C0GA 4J9EA 2DYBA 2OAWA 5D6XA 2X4WA 4LD6A 1D3BA 4DEXA 1G2BA 2LNVA 2RJFA 2RI2A 2X35A 1ZX6A 1YHQA 2DKGA 4C8QD 2KY9A 4YRGA 4X9DA 5LJ3d 2CSQA 2QGGA 2VGMA 5GJVB 2O01E 2X4YA 2CP3A 3M4YA 4PKCC 3EFRA 1M1KR 4KRTA 1E6HA 2PUKB 2YDLA 1WXTA 2JT4A 3M0PA 1NEGA 5LJ3h 3FJ5A 1HYOA 3X26B 2E3IA 5C52B 4E7JA 4OB2B 1KMNA 5AYFA 3VS2A 3DB3A 3LH5A 4BY6B 2CREA 1GL5A 2H8HA 3PT9A 4HCKA 1R8OB 4MZMA 1ADYA 1TTHB 1VQ6A 2DL3A 3CXCS 3LC0A 2RK1A 4HVUA 2NWMA 2CJ9A 2EKOA 3H0HA 4X9CA 4CS2A 2Y4XA 3HSBA 2K4YA 4AFUC 1VQ5A 2D8HA 4X1VA 3UH0A 2MOXA 1SSFA 2DL4A 3AHUA 2DLPA 1FYFA 5FU6C 2JUFA 2VASA 3NETA 3BY7A 2P0KA 3OBWA 4EMHA 5GAN6 3REXA 1K8AR 2HL5C 4M7AG 5FRNA 1Q86R 3CCVA 3O5ZA 1X56A 3HFZA 4RMOA 3S3MA 4M7AF 1E6GA 2K3BA 3OMCA 4LNSA 3PIPA 2K5IA 2A7YA 3N5BB 2ZAEA 2H3JA 5CKDA 4YRSA 4M78B 3J7AF 2RHZA 2XDDA 1NYFA 4YCUA 2JOYA 3NGPA 4AG1C 3VS7A 1WQ7A 4BDZA 1B76A 3HXYA 3C4SA 1QVGA 2GFUA 1MV3A 3LX7A 1UB4A 1UTIA 4N0AC 5CKHA 3SHWA 4DEYA 2L3SA 4E6RA 2W0ZA 2PVDB 4FYVB 3L42A 2L0AA 4H2WA 4E7KA 1YHQQ 2QQAA 2KRNA 2JZ2A 1BKBA 3I55A 7AT1B 2E12A 3V7SA 1YP5A 2CDTA 3OYIA 1QWEA 1W2BP 1QVFA 3RR6A 4JS5A 5KCHA 3CPWP 3IG2A 4O6JA 3R6NA 3L2RA 3WVDB 2ODRD 4C92E 5GAOn 3JB9I 9ATCB 2RHYA 1K1ZA 4BUGA 1BI1A 4RTVA 4P73C 2NLUA 3VQVA 2MPXC 1VQ6Q 4M75D 3MEAA 2J3MA 1WI7A 2RK2A 2DIGA 3RL6A 4CH6A 1M90C 5IXFA 1YI2T 3ASKA 1VQ5Q 2FG0A 4HCZA 4M77D 3VJPA 2B86A 1N8RR 5GAN3 1U8RA 2DILA 1SRLA 1W4SA 2FZCB 4KULA 3VS5A 3C95A 5GAMe 2DDZA 2EYZA 3CCVQ 4CS4A 1JXOA 1RAHB 4DBRA 2VWFA 3VUBA 3HFVA 2F5TX 3RKYA 1VYUA 3E9FA 4XU1A 2J6OA 1M3CA 2ARSA 2YWWA 3P8BB 4J83A 1BBZA 2ZZGA 2QTVA 2Y4YA 2M1HA 4IUQA 4M7DC 3TEHA 1N9WA 3FEOA 1W70A 2HAXA 5FU7C 1WHHA 1T3SA 2COYA 4AFZC 3MEVA 1YITT 1EFWA 2X4JA 5GMKm 5I2MA 1SESA 1Q82C 2Q5IA 2OTLT 4BE2A 2E6ZA 3LH0A 3RESA 4XU3A 3I56Q 2KE9A 3A7UA 2HZYA 1ZSZA 2KROA 5LJ5g 2KBTA 2KEAA 4JS4A 2E3HA 1Y7XA 1JEGA 2V8JA 3X20B 4PHCA 3D7SB 3E9IA 3ULRB 4MMLA 1AHJB 1UGQB 3JCMf 4A63B 1K73C 2HSPA 5KYYA 3A5ZB 3PCOB 3CC4Q 1Q7YC 2YLCA 1M1GA 1Y96B 2HKNA 3M0RA 4RTXA 2K3XA 2R5AA 1P92A 2OTJQ 3UGQA 1M27C 2IY5B 3RNJA 2KXCA 1A0NB 3VS1A 1H641 2ZR3A 1V29B 2DXTA 2AKLA 1VQLT 1OQKA 3E1SA 5HGQA 4E47A 1QLYA 4DQ2A 3QTCA 4HT9A 2ARTA 1H4QA 3QG1A 5KYXB 1JU5C 2QQBA 3CQTA 4F04B 3I5RA 4YCVA 5ELNA 2DK3A 2HBPA 4UPAA 4FM4B 1H4SA 3RERA 2CJBA 4M7AB 3HRIA 4C92A 1KFZA 3ME9A 1M9SA 4P5NA 5GAN4 5HY6A 4C8QE 3JCMc 1NLOC 1AZGB 5GAN5 1B7TA 2QTXA 1QKXA 3W3SA 2I2LA 3FIFA 2C0OA 2I0NA 2C06A 4KQEA 1DJ7B 2O2OA 2EJ9A 3M0QA 1KJWA 4TVWA 1B8AA 3M56A 1KD1U 2RB6A 1B70A 4HT4A 4E7ZA 1MMDA 2ZNIA 4J9CA 3OYLA 1SETA 4HVVA 3TSZA 3LYIA 4A4FA 3CBMA 2QHTA 2MMPA 5IAYA 2EAYA 2YXYA 3MP8A 4ME7A 4PJNA 5L23A 5K1XA 2ZCEA 4FYYB 5I11A 1WFWA 4CC3A 3EFSA 4FSXA 2ZCFB 4LVIA 2KYBA 4YRKA 1UDLA 2EWNA 1D1CA 2HD0A 4RG8A 1JJCB 1I1JA 3EGDA 3QZ5B 2FZKB 2WSCE 2RMOA 5GJWB 3QO7A 1YCYA 1C1AA 1V1CA 4JZ3A 4RTWA 4LD9K 3SWNA 2VXFA 3CXCA 2JS2A 2KXDA 5IH2A 1J5WA 4CI0C 2QXFA 1ZUKA 2EGAA 1B7YA 2YUPA 1WGSA 2DL7A 2DAQA 1ZUYA 4BB7A 2HMAA 1QVPA 2DO3A 4J8OA 3UF4A 2DU5A 4C0DB 1VQ5T 3VQXA 1T0HA 2PVGB 1Y71A 4A54A 3FB9A 1NJ5A 2YUNA 4NL3A 4Z88A 3DKMA 5CVIA 4IIMA 3L2ZA 2E6NA 1I07A 3CCQT 4JLIA 1NNHA 3JCMb 3M0SA 1KQSS 2JM9A 2O4XA 3MKDA 3A1PA 4UP7A 2X9HA 1BBUA 2QG9B 2ZINA 1IREB 1UGSB 3CCLT 4JJCA 4J9GA 1D1BA 3F70A 4NL2A 1VQKT 3NENA 1V76A 3CMAQ 5GANg 1KD1R 1X55A 1VQ8T 1NPPA 4R0KA 4PJOD 1RIQA 3QJ6A 1LYLA 1YB3A 2VV5A 2ZNJA 4DPGA 1AEYA 1OPKA 3MHXA 1MNDA 3TU4K 3HRSA 1EIFA 4GBQA 1MMGA 2M0YA 2Z0WA 3HPWA 2QASA 4A4EA 3DSQA 5KYUB 4N4HA 2WACA 1I81A 1TUCA 3P8TA 2KVQG 1MMAA 1VQZA 1TUDA 2WSEE 4TVAA 1LPLA 2CT3A 2M16A 3MPUB 4RQFA 3I56T 4CC7A 5LJ5j 3VQYA 4DBFA 3L2WA 2RHQA 1RL2A 2OJ2A 2C0TA 3RKXA 5A0DA 4GLMA 4C8QA 1UGVA 2Q7GA 2HQHA 2DMOA 1M3AA 4D8KA 3BJUA 2ZT5A 3M9QA 1TUGB 1WDXA 4Z89A 2QI2A 5GAMf 1YITA 1UE9A 1AVZC 8ATCB 3JCMd 1IL2A 3CBOA 1WXUA 2ATCB 2FEIA 3CC4T 4F7UA 3TEEA 5C6SA 4LUEA 4M7AE 3BDLA 5CKEA 4TVRA 4L5GA 5HK0A 1WNLA 2J3LA 2GFAA 4IUTA 1SRYA 2O9VA 3LGLA 4C0FA 2OTJT 2PTKA 2PU9B 3REAB 1NYGA 1ZSZC 4IKFA 2EYWA 1W6XA 2M0OA 1ZSGA 2LCSA 1YFTA 2LQKA 2NUTB 1ARKA 1AOJA 1K0XA 3HXXA 4Z02A 4QQ6A 1VQ7Q 4Q15A 3VRYA 1X75C
chains in the Genus database with same CATH topology
5GAN7 2AMCA 4J5YA 1X2HA 4YTLA 1Z7MA 5DY9A 3QUIA 4UC4A 1X2GA 4C5IA 4NOYA 1O9SA 1SERA 1G3YA 3OY9A 4OB0B 3VUZA 1ATIA 1PYSB 3CCJA 2EYQA 4XTYA 2KSSA 1N9RA 1KHCA 3G71A 4YYEA 1VQLA 3SD4A 4OVAA 4G84A 4RCCA 2XI9A 4PLIA 1M90U 3V8KA 1ZBXA 3JCMe 1NJ1A 2L89A 4E7HA 4C92C 1NJIC 4XU2A 4QW2A 2DD4A 3RF1A 1HXDA 5LJ3g 4EO4A 1NYRA 4M7DG 3OQ5A 4M78D 1PSEA 2E41A 4M7DF 3V8LA 1LJOA 2I4LA 5J26A 4DOVA 1FX7A 3M54A 1H4TA 1WYDA 4P3NA 4LDXA 3A8OB 2KQWA 4EDUA 2RI5A 4M75A 3JCMV 3NTHA 3MEYA 2AKWB 4LVJA 1Q82U 3A8LB 4BE1A 2DZ9A 4QVZA 3HL8A 4X5OA 1XNIA 3HKSA 2FYKA 4RCBA 2KMTA 4M77A 1E24A 4ZTFA 1G3SA 4O5VA 1KHIA 3OYHA 4KR3A 2QQ9A 4RMFA 4OLFA 3OW2S 3SWNC 1XQHA 3OBYA 2LT1A 1K73U 3OSVA 4BD3A 1Q7YU 3HXWA 4IUPA 2P4TA 5GANj 1VQNT 1YGBA 3R07A 3CMAT 2VGNA 4J6WA 2E10A 3X28B 2Q7HA 3M55A 4IURA 3TCJA 3CCQA 2EQMA 2FB7A 4DOWA 2P0LA 3TREA 5FU6B 1S72A 3CCLA 1WJRA 4LDVA 2RI3A 3V7CA 1VQKA 4H2VA 4BI4A 3SB2A 1X6OA 3I7FA 1VQ8A 3REUA 4KR2A 2IVWA 5J3BA 4YRIA 1KC8U 3P8HA 2JNGA 5GAMd 3NTKA 3M58A 2RHSA 4M7DD 4YRRA 2XG8D 5GAMh 2R58A 2ZPBB 3OYAA 3I56A 4PJOE 2ZGWA 4RG2A 1NYQA 1Y07A 4C8QC 4D6WA 1HK9A 5GAOq 5FRMA 3MEWA 4J7FA 3OYCA 5FLXE 1VQ7T 2G4CA 1KQSA 4HWOA 2DEQA 3QBYA 3C94A 3VKIA 3X24B 4BWAA 3CC4A 3QO3A 4X34A 3M4GA 3A8MB 5GAOr 1B34B 2OTJA 2LVMA 1E1OA 3MF2A 2MI6A 3VYHB 5GMKe 3ERRA 1VIFA 3FRNA 1QP3A 1NZ9A 2AHJB 2A3LA 3HXVA 1Z7NA 1K9MC 4C5HA 3A7AA 3G4ST 2ZR2A 2RHXA 3CCST 4GLKA 2YLBA 1EIYA 1BIBA 2XDBA 3G7ZA 1JB0E 2ZPIB 1YFRA 4M7AD 2V8IA 3OS0A 5LJ3j 2ZZEA 5C51B 3HXUA 3OD1A 4XTZA 2PQWA 3HP9A 4M7DB 2KK4A 3L4GA 5FU7B 2I4NA 2QA4A 5C0MA 3KFUA 3A8GB 2A8EA 2ALYA 2I4MA 5GAOl 1YJWA 3OS2A 4YRMA 3P8DA 1I4K1 3KUFA 4PG3A 4ZGDB 3VU3C 3PMTA 1RI0A 1XTDA 4P3OA 3JCMQ 3LWHA 1OZ3A 5I21A 4TWAA 4CS3A 4L59A 2ODRC 3QZ9B 3HY1A 5DLQE 1YJNA 2CZ0B 4OGEA 2GCXA 3E19A 3VV0A 3QIIA 4M75C 3JCMW 4XAXB 4XQ3A 1YBYA 5EG2A 3CCJT 4FT2A 5I2SA 5LL6S 3G71T 4M78E 2KDSA 4EMKA 1D3BB 4J7IA 4M77C 1FWZA 3OYEA 4PJOA 3OYYA 4RQEA 3DLLA 2CS7A 1KG1A 3CCUT 4ZTUB 3NFCA 1KC8C 3MP1A 1WJSA 2VXEA 3UT1A 2K5FA 4QVCA 3L2QA 3MF1A 3OYDA 1VQNA 3QDRB 3V7RA 2G3RA 1Q81U 2PVOB 3CMAA 4OB1B 2QDYB 4YROA 2VUBA 4H2XA 2F5KA 4P72A 2LT4A 2WSFE 2XHCA 4HWTA 1M4ZA 4P74A 4R56A 2OAUA 11ASA 1O75A 2QEXA 4C92G 2MF2A 2EFIA 2FHDA 3HFZB 2F69A 4C92F 1NJIU 4YRCA 2V8KA 3CMEA 4YPFA 3JCMJ 3C12A 3IKLA 4HT8A 2L5QA 1LOJA 3JSCA 4CRIA 3OB9A 3OW2A 5LJ5e 1ASZA 3E9HA 3BW1A 5FROA 4WJ3M 1BI0A 1EVKA 4K87A 4XK8E 2LTOA 1OI1A 1ZHIA 2GQVA 2DJZA 5GAOp 3VQWA 2RHSB 2EL9A 2LX9A 2ZZFA 2ZIMA 3QPHA 3JB9G 1VQ7A 4OB3B 4M7DE 3S3NA 3JB9F 1I8FA 1WU7A 4BE0A 3IKMB 4XTXA 5HK3A 1S72T 3A31A 4WI1A 4LVMA 3RMQA 2DXBA 4FU6A 5KH6A 3OSSC 3PGGA 2LDMA 2PUOB 4TQDA 4HCBA 2XDPA 3MCAB 4N4GA 3L2VA 2EQKA 1ADJA 3URGA 4M78A 3G4SA 1E1TA 1JJ2S 3CCSA 4A53A 12ASA 4XU0A 5CR2A 1G3WA 1IZ6A 2K3YA 4H2SA 1YJ9T 2BUDA 3G1ZA 2K57A 3A5YA 4OMFB 2DQ0A 4N4IA 3OYKA 1UGPB 1W66A 2MWOA 2HQXA 4EPCA 2DU7A 2FL7A 3L1AA 3QO8A 2DVEA 4XEOA 3HY0A 1QW1A 3GPLA 2CZ1B 2PMEA 4KT0E 3JAME 3TEHB 2RHUA 1EQRA 2EQJA 2EJGA 3NELA 5GAN8 3JB9H 1FXXA 3JCMh 3ZEHA 2LC4A 1QF6A 4YRFA 4TQFA 4E7LA 4J6YA 2QHUA 3RGLA 3CC7T 3IALA 3MO8A 2X4XA 2CYZB 4C8QG 5L8RE 5GAN2 4R55A 4KUDK 3CC2T 4P3PA 2ZT8A 4C8QF 3QO5A 2Q7EA 3JB9D 1Q81C 1WQWA 4PNOA 3ICAA 1QE0A 1G5VA 3UPUA 1H3ZA 4F7UG 3G6ET 2DPPB 3NTIA 3HRUA 4LDUA 4F7UF 2XIDA 3SDZA 2ZZDA 1MGQA 3QSUA 4EMKC 4JRIA 3LSQA 1KQ1A 3JCMP 4PJOC 1H4VB 2K2VA 2EQUA 5CIUA 4H2UA 3KBGA 5CKBA 4P71A 2E64A 5GANe 3CCUA 2DTHA 2QA4T 1K9MU 3CCRT 1LNXA 5GAOm 3A74A 1YJWT 4MZTA 1YFSA 3WVEB 4C92B 5J39A 3V8JA 4JJNK 5K1PA 1PSFA 3RACA 4CH4A 2QHVA 3CCET 2LCCA 1UEBA 3META 4AH6A 2L3RA 2DXCA 4Q5WA 4UP9A 3LW5E 2EJFA 4QQDA 1OZ2A 4P72C 1YJNT 1K8AU 3A5ZA 4JRPA 3PCOA 2DTOA 4WF2A 1L0WA 4P74C 3A32A 1Y96A 4PL6A 4H2XB 4YRQA 1B70B 4XEMA 4YRTA 3LGFA 3QJYA 1BI3A 3OYGA 3OA6A 1WPYA 3OS5A 4E51A 3DLMA 1W2BS 2IY5A 3CPWS 2D9TA 3OS1A 3CEYA 3JCMX 3KXTA 4TTVA 5HKCA 2YRVA 5E3IA 3CD6A 1U1TA 5A2QE 4QVDA 5A0GA 4WJ4A 3TEGA 4ZTJA 2CJAA 2L8DA 2ZT7A 4BY6C 4M7AA 4M75G 1U1SA 3SWNB 3EAEA 5CAIA 4ZN3A 4M75F 3QYHB 5CK9A 4JRKA 1B7YB 2XICA 5C53B 5GAMg 4M77G 5KE2A 4K88A 4M77F 1JRIA 5LJ5f 2D6FA 2RHIA 5KNNA 5D6WA 1GXIE 3Q1JA 3JRZA 1JBMA 4ZGJB 4JUVA 2QEXT 2O4XB 1TH7A 3PTAA 2E3CA 4IUVA 5M9OA 3CPFA 1XOVA 4CH5A 3CMET 4OGCA 4UP8A 1N8RU 4M78C 4G85A 5GMKh 4MDWA 2CZ7B 1EOVA 5LJ3e 2ZTGA 4HCCA 3QHSA 1YJ9A 1JJCA 2E5AA 2ZXFA 5KE3A 4NCXA 4QQGA 3HRKA 1VQ4T 1N6AA 4LVLA 2RH2A 1G5IA 4TVAB 2D0QB 2ZIOA 2RHQB 2ZT6A 4Y28E 4XTUA 4C8QB 3LWIA 4BW9A 2CGHA 5A0LA 4CH3A 3OYMA 4LDYA 4FL6A 2PMFA 4HVCA 3LLRA 2C8MA 1VQ9A 4MZPA 1M1KC 1NJ6A 2RJDA 4F7UB 2DXUA 2YHTA 3CC7A 4RDXA 3CBPA 3WXMB 3GLXA 4OF1A 4HWPA 3GNFB 1JJ2A 3CC2A 2DQ3A 3FLGA 1YIJA 3E9GA 4B9WA 3LSSA 4YRLA 4IUUA 3UDCA 3GOXA 1USYA 4ELYC 2AMCB 4P75A 4YDQA 1X54A 5CO7A 2LRQA 2ZPEB 5F5WA 3G6EA 1VQOT 1VQMA 3UWNA 1VQPT 3BDUA 2XTIA 2EIFA 4BDYA 1GGMA 2JTFA 4C5GA 1K8AC 2JN0A 2XKOC 5CQYA 1Q86C 2FVUA 3MQZA 2E1HA 4P71C 3CCMT 3OYFA 2ARUA 1NPRA 3CCRA 5KCOA 2RA2A 1WJQA 1C0AA 2CZ6B 3PZCA 3FDRA 4FT4A 3MP6A 2C7IA 4LVKA 2E65A 1OYXA 3CCEA 1M8VA 2P0PA 2MAMA 1M1FA 3A7RA 5CKFA 1ZQ1A 3UFGA 4A4GA 5GANf 3S3OA 3HRTA 4YREA 2XK0A 3RKWA 2DIQA 3RMSA 1BBWA 1VUBA 5GMKj 3L2UA 4M75B 1PYSA 3QXEB 4YCWA 5GAMj 1HC7A 4K86A 3DB4A 4HWSA 2RJCA 2GF7A 4M77B 4RKUE 2XGTA 5DM7R 5LJ5d 4E7IA 3OYJA 4ZIBA 3UGTA 4YRNA 2KAFA 1N8RC 4M7AC 5LJ5h 4XTVA 2ZPFB 1BYMA 5GMKi 2JVVA 2IG0A 3M4PA 4V2SA 2E5QA 2BIVA 4PJOG 4B9XA 4Y91A 1X01A 3BFMA 5IN1A 4PJOF 1ASYA 2E70A 1E22A 2QHSA 4L87A 4KBMB 4JLGA 4BACA 4BI3A 1W2BA 3VYGA 4F7UE 3CPWA 2QQRA 1BI2A 3J81E 3VBBA 2AKWA 4LDWA 3O8VA 2P0QA 3NEMA 4YP0A 3CD6T 4ZN1A 3H8ZA 4DA4A 3FJPA 2Y90A 4NS5A 3FC3A 1YHQT 2JTMA 3OYBA 1VQ4A 4J15A 4JRQA 4JDSA 5CCAA 4YRPA 2XU8A 3RIRA 3QKJA 1QVGS 1UGRB 2DZCA 3HXZA 4C0DC 1KMMA 1VQ6T 3HFNA 3CMQA 4HKEA 2P5IA 4KUIA 1G5HA 3PMIA 5IT9E 5LJ3f 1G3TA 1N27A 1KQ2A 4A4KA 2LQ8A 3A8HB 4HA8A 2HQEA 2RD1A 2B8AA 1MHNA 2BKDN 2VC8A 1QVFS 2ZPGB 2LCLA 5DLOA 1NJ8A 1NJ2A 3CCVT 4ZTZB 2CKKA 3JCMg 3M5AA 3M59A 1YI2A 4L6V5 2K5LA 4ELZC 1USYC 3QNEA 1N9SA 4P75C 4ZGEB 3OMGA 2NS6A 3HTZA 4HWRA 1VQOA 4OP0A 3T9NA 4EX5A 2VYTA 1VQPA 4M75E 4Q6GA 2R57A 1EIYB 2MWPA 4N0AA 1M5Q1 3P8YA 4C92D 2CIMA 2RO0A 3M53A 3CCMA 3GNGA 4II1A 3ZBDA 4M77E 4M78G 4ATOA 3GF5A 5GANd 4M78F 3I55T 2Q5HA 4A4HA 3TUPA 1G51A 2QQSA 1VQ9T 1NE8A 3L4GB 3P8VA 5GANh 4GY5A 1WLEA 2ALYB 1B34A 5GMKl 4PLLA 4C0ZA 4MDXA 2OTLA 4P73A 5ELOA 1HTTA 1BIAA 2ZPHB 5D6YA 3MEUA 1YIJT 3HFOA 2M9UA 3PNWC 2DD5A 3R6OA 2RM4A 3PFSA 1VQMT 3GP8A 4TVYA 4MMKA 1EVLA 1M1KU 4EMKB 1VIEA 3H6ZA 4H2YA 1KOGA 3M57A 3GIBA 4PJOB 4M7DA 4EMGA 2HNIA 3QYGB 1KD1C 3J80E 4C5EA 4VUBA 5CQXA 2I4OA 4H02A 3M4QA 4J6XA 4H2TA 4XTWA 3RUXA 3HHTB 2RJEA 3WQZA 2DTIA 3INZA 3S6WA 3X25B 4FIBA 4YRJA 3ZFJA 3JB9J 1Q86U 4O2DA 2XD0A 3PIOA 4BI8B 3OYNA 1QP2A 3ER0A 2R5MA 1I5LA 3SFMA 4C0GA 5D6XA 2X4WA 4LD6A 1D3BA 2LNVA 2RJFA 2RI2A 2X35A 1YHQA 2DKGA 4C8QD 2KY9A 4YRGA 4X9DA 5LJ3d 2VGMA 2O01E 2X4YA 3M4YA 4PKCC 3EFRA 2PUKB 5LJ3h 3X26B 5C52B 4E7JA 4OB2B 1KMNA 5AYFA 3DB3A 4BY6B 3PT9A 1R8OB 4MZMA 1ADYA 1VQ6A 3CXCS 3LC0A 2RK1A 2CJ9A 2EKOA 4X9CA 4CS2A 2Y4XA 3HSBA 2K4YA 1VQ5A 3UH0A 1SSFA 3AHUA 1FYFA 5FU6C 2JUFA 3NETA 3BY7A 2P0KA 3OBWA 4EMHA 5GAN6 3REXA 4M7AG 5FRNA 3CCVA 1X56A 3HFZA 4RMOA 3S3MA 4M7AF 3OMCA 4LNSA 3PIPA 2K5IA 2A7YA 3N5BB 2H3JA 5CKDA 4YRSA 4M78B 3J7AF 2RHZA 2XDDA 4YCUA 2JOYA 1WQ7A 4BDZA 1B76A 3HXYA 3C4SA 1QVGA 2GFUA 3LX7A 1UB4A 4N0AC 5CKHA 2PVDB 3L42A 4H2WA 4E7KA 2QQAA 2JZ2A 1BKBA 3I55A 2E12A 3V7SA 3OYIA 1QVFA 4JS5A 5KCHA 3IG2A 4O6JA 3L2RA 3WVDB 2ODRD 4C92E 5GAOn 3JB9I 2RHYA 4BUGA 1BI1A 4P73C 2NLUA 3VQVA 4M75D 3MEAA 2J3MA 2RK2A 2DIGA 3RL6A 4CH6A 1M90C 1YI2T 3ASKA 4HCZA 4M77D 3VJPA 5GAN3 1U8RA 1W4SA 4KULA 3C95A 5GAMe 2DDZA 4CS4A 3VUBA 3HFVA 2F5TX 3RKYA 3E9FA 4XU1A 2ARSA 3P8BB 4J83A 2ZZGA 2Y4YA 2M1HA 4IUQA 4M7DC 3TEHA 1N9WA 3FEOA 2HAXA 5FU7C 3MEVA 1YITT 1EFWA 2X4JA 5GMKm 5I2MA 1SESA 1Q82C 2Q5IA 2OTLT 4BE2A 2E6ZA 3LH0A 3RESA 4XU3A 3A7UA 5LJ5g 4JS4A 1Y7XA 2V8JA 3X20B 4PHCA 3E9IA 4MMLA 1AHJB 1UGQB 3JCMf 1K73C 3A5ZB 3PCOB 1Q7YC 2YLCA 1M1GA 1Y96B 2K3XA 2R5AA 1P92A 3UGQA 2IY5B 1H641 2ZR3A 1V29B 2DXTA 1VQLT 3E1SA 5HGQA 4E47A 4DQ2A 3QTCA 4HT9A 2ARTA 1H4QA 3QG1A 2QQBA 4YCVA 5ELNA 2DK3A 2HBPA 4UPAA 4FM4B 1H4SA 3RERA 2CJBA 4M7AB 3HRIA 4C92A 3ME9A 1M9SA 4P5NA 5GAN4 5HY6A 4C8QE 3JCMc 5GAN5 2QTXA 3W3SA 2I2LA 3FIFA 2C06A 4KQEA 1DJ7B 2EJ9A 4TVWA 1B8AA 3M56A 1KD1U 2RB6A 1B70A 4HT4A 2ZNIA 3OYLA 1SETA 3LYIA 4A4FA 3CBMA 2QHTA 2MMPA 5IAYA 2EAYA 3MP8A 4ME7A 5K1XA 2ZCEA 3EFSA 4FSXA 2ZCFB 4LVIA 4YRKA 2EWNA 2HD0A 4RG8A 1JJCB 3QZ5B 2WSCE 3QO7A 1YCYA 4LD9K 3SWNA 2VXFA 3CXCA 1J5WA 4CI0C 2QXFA 1B7YA 1WGSA 2DAQA 4BB7A 1QVPA 2DO3A 4J8OA 2DU5A 4C0DB 1VQ5T 3VQXA 2PVGB 1Y71A 4A54A 3FB9A 1NJ5A 4NL3A 3DKMA 5CVIA 3L2ZA 2E6NA 3CCQT 4JLIA 1NNHA 3JCMb 1KQSS 2O4XA 4UP7A 2ZINA 1BBUA 1IREB 1UGSB 3CCLT 3F70A 3NENA 4NL2A 1VQKT 5GANg 1X55A 1VQ8T 1NPPA 4PJOD 1RIQA 3QJ6A 1LYLA 1YB3A 2VV5A 2ZNJA 4DPGA 3MHXA 3TU4K 3HRSA 1EIFA 3HPWA 3DSQA 4A4EA 4N4HA 2WACA 1I81A 3P8TA 2KVQG 1VQZA 2WSEE 4TVAA 2M16A 4RQFA 3I56T 5LJ5j 3VQYA 3L2WA 2RHQA 1RL2A 3RKXA 5A0DA 4C8QA 2Q7GA 3BJUA 2ZT5A 3M9QA 2QI2A 5GAMf 1YITA 3JCMd 1IL2A 3CBOA 3CC4T 4F7UA 3TEEA 5C6SA 4M7AE 3BDLA 5CKEA 4TVRA 4L5GA 5HK0A 1WNLA 2J3LA 2GFAA 4IUTA 1SRYA 3LGLA 4C0FA 2OTJT 2PU9B 4IKFA 2M0OA 1YFTA 2LQKA 3HXXA 4Z02A 4QQ6A 4Q15A 1X75C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 7;  2AMC A;  4J5Y A;  1X2H A;  5LJ5 e;  1ASZ A;  3E9H A;  1Z7M A;  3BW1 A;  3UH0 A;  4WJ3 M;  5DY9 A;  3AHU A;  1FYF A;  1EVK A;  3NET A;  3QUI A;  4K87 A;  2RA2 A;  1C0A A;  3BY7 A;  1X2G A;  4EMH A;  5GAN 6;  3PZC A;  3REX A;  4NOY A;  2DJZ A;  4M7A G;  1SER A;  5GAO p;  1ATI A;  2C7I A;  3VQW A;  2RHS B;  1X56 A;  3HFZ A;  4M7A F;  2EL9 A;  2E65 A;  1PYS B;  4XTY A;  2ZZF A;  4LNS A;  1N9R A;  2ZIM A;  1M8V A;  4YYE A;  3A7R A;  4G84 A;  3JB9 G;  3UFG A;  4RCC A;  4YRS A;  4M7D E;  4M78 B;  5GAN f;  3V8K A;  3JB9 F;  4YCU A;  3JCM e;  1I8F A;  1WU7 A;  1NJ1 A;  4YRE A;  3IKM B;  4XTX A;  3RKW A;  1WQ7 A;  1B76 A;  3HXY A;  1BBW A;  3A31 A;  4WI1 A;  4C92 C;  3PGG A;  4N0A C;  5GMK j;  4M75 B;  1PYS A;  4XU2 A;  4TQD A;  3RF1 A;  1HXD A;  5LJ3 g;  4YCW A;  4EO4 A;  4H2W A;  5GAM j;  1ADJ A;  1NYR A;  1HC7 A;  4K86 A;  4HWS A;  4M78 A;  4M77 B;  4M7D G;  3V7S A;  4M78 D;  2XGT A;  1E1T A;  2E41 A;  5LJ5 d;  4M7D F;  3V8L A;  1LJO A;  4A53 A;  12AS A;  2I4L A;  4XU0 A;  3IG2 A;  4ZIB A;  3UGT A;  4YRN A;  2ODR D;  1H4T A;  4H2S A;  1WYD A;  4P3N A;  4C92 E;  5GAO n;  3G1Z A;  3JB9 I;  4M7A C;  2K57 A;  3A5Y A;  2DQ0 A;  5LJ5 h;  4XTV A;  4M75 A;  1W66 A;  3JCM V;  4P73 C;  2DU7 A;  3VQV A;  4M75 D;  2J3M A;  3MEY A;  3RL6 A;  3L1A A;  5GMK i;  4CH6 A;  3QO8 A;  2AKW B;  2DVE A;  3M4P A;  4XEO A;  4V2S A;  3HY0 A;  2DZ9 A;  4X5O A;  2FYK A;  4RCB A;  4PJO G;  4Y91 A;  4M77 A;  1X01 A;  3BFM A;  2PME A;  1E24 A;  4M77 D;  3TEH B;  4PJO F;  1ASY A;  5GAN 3;  1EQR A;  1E22 A;  2EJG A;  5GAM e;  2QHS A;  3NEL A;  2DDZ A;  4L87 A;  5GAN 8;  4KR3 A;  3JB9 H;  4CS4 A;  4RMF A;  3JCM h;  4OLF A;  3SWN C;  1QF6 A;  4F7U E;  3HFV A;  4YRF A;  3VBB A;  4TQF A;  2AKW A;  3RKY A;  4J6Y A;  3HXW A;  4XU1 A;  2QHU A;  3RGL A;  5GAN j;  1YGB A;  2ARS A;  3R07 A;  3IAL A;  2ZZG A;  3NEM A;  4YP0 A;  4M7D C;  4C8Q G;  5GAN 2;  3TEH A;  4J6W A;  3FJP A;  1N9W A;  2Y90 A;  4P3P A;  2ZT8 A;  4C8Q F;  3QO5 A;  2E10 A;  2Q7E A;  2Q7H A;  3JB9 D;  1WQW A;  4PNO A;  3ICA A;  1EFW A;  2FB7 A;  1QE0 A;  5GMK m;  2P0L A;  4J15 A;  1SES A;  4F7U G;  2Q5I A;  4YRP A;  3V7C A;  3RIR A;  4H2V A;  4F7U F;  3SB2 A;  3RES A;  1MGQ A;  4XU3 A;  3QSU A;  4EMK C;  3I7F A;  4JRI A;  3A7U A;  3LSQ A;  2DZC A;  1KQ1 A;  3REU A;  3JCM P;  4PJO C;  3HXZ A;  4KR2 A;  1H4V B;  4YRI A;  5LJ5 g;  1KMM A;  4H2U A;  3HFN A;  3CMQ A;  2P5I A;  1G5H A;  4P71 A;  5LJ3 f;  2E64 A;  1KQ2 A;  5GAN e;  4PHC A;  3E9I A;  4HA8 A;  2DTH A;  5GAM d;  4MML A;  3JCM f;  2RD1 A;  1LNX A;  5GAO m;  2RHS A;  3A74 A;  4M7D D;  3PCO B;  2YLC A;  4YRR A;  2VC8 A;  1Y96 B;  5GAM h;  1YFS A;  1NJ8 A;  1NJ2 A;  3UGQ A;  4C92 B;  4PJO E;  3V8J A;  2ZGW A;  4ZTZ B;  2IY5 B;  5K1P A;  3RAC A;  1NYQ A;  3JCM g;  1H64 1;  4C8Q C;  4CH4 A;  2QHV A;  2ZR3 A;  2DXT A;  1HK9 A;  5GAO q;  4AH6 A;  5HGQ A;  4UP9 A;  1USY C;  4DQ2 A;  3QNE A;  2EJF A;  3QTC A;  1N9S A;  4P75 C;  2G4C A;  4HT9 A;  4P72 C;  4HWO A;  2ART A;  1H4Q A;  2DEQ A;  3HTZ A;  4HWR A;  3A5Z A;  3PCO A;  1L0W A;  2DTO A;  4WF2 A;  4BWA A;  4OP0 A;  4YCV A;  4P74 C;  3A32 A;  5ELN A;  1Y96 A;  4EX5 A;  4H2X B;  4YRQ A;  3QO3 A;  1B70 B;  4UPA A;  4XEM A;  4M75 E;  4YRT A;  1H4S A;  4Q6G A;  3RER A;  1EIY B;  3M4G A;  5GAO r;  1B34 B;  4M7A B;  2CJB A;  1WPY A;  3HRI A;  4C92 A;  4N0A A;  1E1O A;  3MF2 A;  4E51 A;  1M5Q 1;  3P8Y A;  2IY5 A;  5GMK e;  5GAN 4;  4C92 D;  2CIM A;  4C8Q E;  3JCM c;  3ERR A;  5GAN 5;  3JCM X;  2QTX A;  3W3S A;  2I2L A;  4M77 E;  4M78 G;  3FIF A;  4TTV A;  3HXV A;  1Z7N A;  5E3I A;  4KQE A;  1U1T A;  5GAN d;  4M78 F;  2Q5H A;  3A7A A;  4QVD A;  3TUP A;  4WJ4 A;  2EJ9 A;  1G51 A;  2ZR2 A;  3TEG A;  2CJA A;  4TVW A;  1B8A A;  3L4G B;  3P8V A;  2RB6 A;  1B70 A;  5GAN h;  2ZT7 A;  2YLB A;  1EIY A;  2ZNI A;  1WLE A;  2ALY B;  1BIB A;  1B34 A;  4M7A A;  4M75 G;  1U1S A;  5GMK l;  1SET A;  3SWN B;  5CAI A;  1YFR A;  4M7A D;  4P73 A;  5ELO A;  1HTT A;  4M75 F;  2QHT A;  5LJ3 j;  2ZZE A;  4JRK A;  5C51 B;  1B7Y B;  2EAY A;  1BIA A;  3HXU A;  5K1X A;  2ZCE A;  5C53 B;  5GAM g;  4M77 G;  3EFS A;  3HFO A;  3OD1 A;  4XTZ A;  4K88 A;  4M77 F;  1JRI A;  4M7D B;  5LJ5 f;  4YRK A;  5KNN A;  3L4G A;  2EWN A;  2RM4 A;  2I4N A;  1JJC B;  3KFU A;  2ALY A;  2I4M A;  3QO7 A;  1JBM A;  5GAO l;  1YCY A;  4JUV A;  3SWN A;  2VXF A;  1TH7 A;  4TVY A;  2E3C A;  4YRM A;  4MMK A;  1I4K 1;  1J5W A;  4PG3 A;  1B7Y A;  3VU3 C;  4CH5 A;  1EVL A;  4UP8 A;  4P3O A;  4EMK B;  3JCM Q;  4M78 C;  4G85 A;  4H2Y A;  1KOG A;  3GIB A;  5GMK h;  4PJO B;  5I21 A;  2DU5 A;  4M7D A;  3VQX A;  4EMG A;  2HNI A;  4TWA A;  4CS3 A;  1EOV A;  5LJ3 e;  2ZTG A;  2ODR C;  4A54 A;  3FB9 A;  1NJ5 A;  3HY1 A;  3QHS A;  4NL3 A;  2I4O A;  4H02 A;  1JJC A;  2E5A A;  2ZXF A;  3M4Q A;  4J6X A;  4H2T A;  4NCX A;  3L2Z A;  4XTW A;  3RUX A;  4JLI A;  1NNH A;  3JCM b;  4M75 C;  3HRK A;  3JCM W;  4XQ3 A;  3WQZ A;  4UP7 A;  2ZIN A;  1BBU A;  2DTI A;  3INZ A;  3NEN A;  4M78 E;  4NL2 A;  1G5I A;  4EMK A;  4TVA B;  5GAN g;  1D3B B;  2ZIO A;  1X55 A;  4M77 C;  4YRJ A;  4PJO A;  2RHQ B;  2ZT6 A;  4RQE A;  4XTU A;  4PJO D;  1RIQ A;  3JB9 J;  4C8Q B;  1LYL A;  1YB3 A;  2ZNJ A;  4DPG A;  4BW9 A;  2CGH A;  4CH3 A;  4O2D A;  2PMF A;  4HVC A;  4ZTU B;  2C8M A;  3DSQ A;  3P8T A;  1I81 A;  2VXE A;  1I5L A;  1NJ6 A;  4F7U B;  2DXU A;  1VQZ A;  2YHT A;  4QVC A;  3MF1 A;  4RDX A;  3V7R A;  4TVA A;  1D3B A;  4RQF A;  4HWP A;  5LJ5 j;  3VQY A;  2RHQ A;  3RKX A;  2DQ3 A;  4C8Q A;  2Q7G A;  4YRO A;  4YRL A;  3LSS A;  3BJU A;  2DKG A;  4C8Q D;  2ZT5 A;  4YRG A;  4X9D A;  5LJ3 d;  1USY A;  4H2X A;  5GAM f;  2AMC B;  4P75 A;  4P72 A;  3EFR A;  4YDQ A;  1X54 A;  3JCM d;  1IL2 A;  4HWT A;  5LJ3 h;  5F5W A;  5C52 B;  4P74 A;  4F7U A;  4M7A E;  1KMN A;  11AS A;  1WNL A;  3BDU A;  4C92 G;  2J3L A;  2XTI A;  1SRY A;  1GGM A;  3HFZ B;  1ADY A;  4C92 F;  2JN0 A;  3LC0 A;  4YRC A;  1YFT A;  2CJ9 A;  4YPF A;  2E1H A;  4X9C A;  3JCM J;  3HXX A;  4HT8 A;  3IKL A;  1LOJ A;  4P71 C;  4CS2 A;  3HSB A;  4Q15 A;  2ARU A; 
#chains in the Genus database with same CATH topology
 1I5O B;  5GAN 7;  2AMC A;  4J5Y A;  1X2H A;  1QVG P;  4YTL A;  1Z7M A;  2ECZ A;  5DY9 A;  1NLP C;  3QUI A;  4UC4 A;  2ENM A;  1X2G A;  3A98 A;  4K11 A;  4C5I A;  4NOY A;  1O9S A;  1SER A;  1G3Y A;  3OY9 A;  2F2X A;  4OB0 B;  3VUZ A;  1ATI A;  3EGX A;  2D1X A;  2L3P A;  1PYS B;  3EG0 A;  3CCJ A;  2EYQ A;  1RLP C;  4XTY A;  4OML A;  4E2F B;  2KSS A;  1N9R A;  1KHC A;  3G71 A;  4YYE A;  1VQL A;  3SD4 A;  4OVA A;  4G84 A;  2V26 A;  4RCC A;  1TWB A;  1QVF P;  2XI9 A;  4PLI A;  1M90 U;  4E7S A;  3V8K A;  1ZBX A;  3JCM e;  1YN8 A;  1K9A A;  1NJ1 A;  2K9G A;  3CCS Q;  5IHI A;  1IRX A;  3JV3 A;  2L89 A;  4FW2 A;  1X6G A;  4E7H A;  2LNH B;  4C92 C;  1NJI C;  4FW1 A;  4XU2 A;  1ZA2 B;  4QW2 A;  2DD4 A;  3RF1 A;  1MNE A;  1HXD A;  1ZA1 B;  4AT1 B;  5LJ3 g;  4EO4 A;  2RQT A;  1NYR A;  1YIT Q;  2KYM A;  4M7D G;  3OQ5 A;  4M78 D;  1PSE A;  4OMN A;  3EG9 B;  2E41 A;  4M7D F;  3V8L A;  1LJO A;  2I4L A;  5J26 A;  4DOV A;  3U23 A;  1FX7 A;  3M54 A;  1H4T A;  1IO6 A;  1WYD A;  4P3N A;  1AWW A;  4LDX A;  3A8O B;  1IHV A;  2KQW A;  4EDU A;  2RI5 A;  4M75 A;  3JCM V;  3NTH A;  3MEY A;  2AKW B;  4LVJ A;  1Q82 U;  2K7A A;  3A8L B;  2A0F B;  4BE1 A;  4QVZ A;  2DZ9 A;  3HL8 A;  4X5O A;  1XNI A;  3HKS A;  2FYK A;  4RCB A;  1QCO A;  2KMT A;  4M77 A;  1E24 A;  4ZTF A;  1G3S A;  4O5V A;  1KHI A;  2KGT A;  3OYH A;  4KR3 A;  2QQ9 A;  4LUD A;  4RMF A;  4OLF A;  3OW2 S;  3SWN C;  1M90 R;  3CCJ Q;  1XQH A;  3OBY A;  2LT1 A;  1SRM A;  1GCP A;  1K73 U;  3OSV A;  4BD3 A;  3G71 Q;  1VQL Q;  2DFU A;  1Q7Y U;  3HXW A;  4IUP A;  2P4T A;  5GAN j;  1NEB A;  1VQN T;  1YGB A;  3R07 A;  3CMA T;  2HL3 A;  2DL5 A;  2VGN A;  4J6W A;  1GBR A;  2RN8 A;  2E10 A;  3X28 B;  2Q7H A;  3M55 A;  4IUR A;  4FYX B;  3TCJ A;  3CCQ A;  2EQM A;  2FB7 A;  4DOW A;  2P0L A;  4OMQ A;  3TRE A;  5FU6 B;  1S72 A;  3H0I A;  3CCL A;  1WJR A;  4HVW A;  4LDV A;  2RI3 A;  3V7C A;  1VQK A;  4H2V A;  4BI4 A;  3SB2 A;  1X6O A;  3I7F A;  1VQ8 A;  3REU A;  4KR2 A;  2IVW A;  5J3B A;  3E2U A;  4YRI A;  1KC8 U;  2KI7 A;  3P8H A;  2FPE A;  3GBQ A;  4RUG A;  1Q82 R;  2JNG A;  5GAM d;  3NTK A;  1H92 A;  1WHM A;  2NUP A;  3M58 A;  2RHS A;  4M7D D;  2JM8 A;  2O88 A;  4YRR A;  1LVK A;  2XG8 D;  5GAM h;  1H8K A;  2R58 A;  2ZPB B;  1B3Q A;  3OYA A;  3I56 A;  4PJO E;  2FPF A;  2ZGW A;  4RG2 A;  2CT4 A;  1NYQ A;  2L3Q A;  1WZO A;  1Y07 A;  4C8Q C;  4D6W A;  1HK9 A;  2DYI A;  5GAO q;  5FRM A;  3MEW A;  4F17 A;  4J7F A;  3OYC A;  5FLX E;  1K73 R;  4F14 A;  1Q7Y R;  1VQ7 T;  2E5K A;  2G4C A;  1KQS A;  4HWO A;  2DEQ A;  3QBY A;  3C94 A;  3VKI A;  4AFQ C;  5EC7 A;  3X24 B;  4BWA A;  1YFN A;  3CC4 A;  3QO3 A;  1QQJ A;  4X34 A;  2G6F X;  3M4G A;  3A8M B;  5GAO r;  1B34 B;  2OTJ A;  2LVM A;  1VYV A;  1E1O A;  3MF2 A;  2MI6 A;  3VYH B;  5GMK e;  3ERR A;  1VIF A;  3FRN A;  1QP3 A;  1NZ9 A;  2AHJ B;  2A3L A;  3HXV A;  2ED1 A;  1Z7N A;  1K9M C;  3CCQ Q;  2FZG B;  4C5H A;  3A7A A;  4WTO B;  3G4S T;  2ZR2 A;  2RHX A;  3CCS T;  1S72 Q;  3CCL Q;  4GLK A;  3CXC P;  1KC8 R;  1UHC A;  1VQK Q;  2YLB A;  1EIY A;  1AZE A;  1BIB A;  2XDB A;  1D0Z A;  3G7Z A;  1VQ8 Q;  1JB0 E;  4PK4 A;  2ZPI B;  1YFR A;  4M7A D;  1RUW A;  1E7O A;  2V8I A;  2LJ3 A;  3OS0 A;  1TSF A;  1K76 A;  5LJ3 j;  2ZZE A;  5C51 B;  3TSW A;  4J9D A;  3HXU A;  2C0I A;  3EFO B;  2LZ6 B;  3NPF A;  1R77 A;  3OD1 A;  2P4R A;  4XTZ A;  1JO8 A;  2PQW A;  3HP9 A;  4M7D B;  2KK4 A;  2GTO A;  4J9B A;  3L4G A;  1YJ9 Q;  5FU7 B;  2I4N A;  2QA4 A;  5C0M A;  3KFU A;  3A8G B;  2A8E A;  2ALY A;  2I4M A;  5GAO l;  4DBQ A;  1YJW A;  3OS2 A;  1GCQ A;  4YRM A;  3P8D A;  1I4K 1;  3KUF A;  4PG3 A;  3HTR A;  4ZGD B;  3VU3 C;  3PMT A;  1RI0 A;  1XTD A;  4P3O A;  3NHN A;  3JCM Q;  3EH2 A;  3LWH A;  2W10 A;  1OZ3 A;  2LJ1 A;  5I21 A;  1YCS B;  2BE7 D;  1PCX A;  4TWA A;  4CS3 A;  4LXC A;  4L59 A;  3I35 A;  2ROT A;  3QWY A;  2ODR C;  3QZ9 B;  5FW9 A;  3HY1 A;  5DLQ E;  1YJN A;  2CZ0 B;  2F1L A;  2IIM A;  4OGE A;  2GCX A;  3E19 A;  3VV0 A;  3QII A;  1WIE A;  4M75 C;  4RTZ A;  3JCM W;  4XAX B;  4XQ3 A;  1YBY A;  5EG2 A;  2A37 A;  3CCJ T;  4FT2 A;  5I2S A;  5LL6 S;  2DVJ A;  3CC7 Q;  4B6M A;  3G71 T;  4M78 E;  1SF9 A;  2KDS A;  4EMK A;  1D3B B;  4J7I A;  4PFO A;  4M77 C;  1FWZ A;  3QWX X;  3OYE A;  2DRM A;  3H41 A;  3OYY A;  4PJO A;  4J9H A;  4RQE A;  3DLL A;  2CS7 A;  2GBQ A;  1F1B B;  3NMZ C;  1KG1 A;  2L2P A;  2DA9 A;  2X3W D;  3CCU T;  4ZTU B;  3NFC A;  1KC8 C;  3MP1 A;  1WJS A;  1D1A A;  5IHK A;  4KGV B;  2VXE A;  3UT1 A;  2K5F A;  1M2V A;  4QVC A;  3L2Q A;  3MF1 A;  2MYS A;  3OYD A;  1VQN A;  3QDR B;  3V7R A;  1OV3 A;  2G3R A;  1Q81 U;  2PVO B;  3CMA A;  4OB1 B;  2QDY B;  4YRO A;  3C0C A;  2IPO B;  4QT7 A;  1B07 A;  3UA7 A;  2VUB A;  1U06 A;  4H2X A;  2F5K A;  2QA4 Q;  4P72 A;  2LT4 A;  2WSF E;  2YRC A;  2XHC A;  1YJW Q;  4HWT A;  1M4Z A;  2QGF B;  4P74 A;  4R56 A;  2OAU A;  11AS A;  1OX9 A;  2LJ0 A;  1O75 A;  2QEX A;  1PKT A;  4C92 G;  2MF2 A;  3BE3 A;  2EFI A;  1ZLM A;  2FHD A;  3HFZ B;  2F69 A;  4C92 F;  1HSQ A;  1NJI U;  1VYT A;  4YRC A;  2V8K A;  3CME A;  4YPF A;  3JCM J;  3C12 A;  3IKL A;  4HT8 A;  2L5Q A;  1LOJ A;  3JSC A;  4CRI A;  3OB9 A;  2V1Q A;  2GQI A;  1YJN Q;  3OW2 A;  5LJ5 e;  1ASZ A;  3E9H A;  3BW1 A;  5FRO A;  4WJ3 M;  1BI0 A;  1FYN A;  1M3B A;  1EVK A;  2J05 A;  4K87 A;  4XK8 E;  2LTO A;  1OI1 A;  1ZHI A;  2GQV A;  5D7U A;  2DJZ A;  1IGQ A;  5GAO p;  3VQW A;  4LE9 A;  2RHS B;  2EL9 A;  1X27 A;  1OU9 A;  2LX9 A;  4AG2 C;  1RAI B;  2ZZF A;  2ZIM A;  2MIO A;  2D8J A;  3QPH A;  3JB9 G;  1VQ7 A;  4OB3 B;  4M7D E;  1X69 A;  2M02 A;  2HBW A;  3S3N A;  3JB9 F;  3EHR A;  4ESR A;  2H3E B;  1I8F A;  1WU7 A;  2CP0 A;  3IQL A;  4BE0 A;  3IKM B;  4XTX A;  2KNB B;  2PNI A;  1TOV A;  5HK3 A;  1S72 T;  3A31 A;  4WI1 A;  4LVM A;  2AK5 A;  2F2W A;  1VQN Q;  3RMQ A;  2DXB A;  2M51 A;  4FU6 A;  5KH6 A;  3OSS C;  3PGG A;  2LDM A;  2PUO B;  3VRZ A;  4TQD A;  4HCB A;  2XDP A;  1W1F A;  4RTY A;  5IHN A;  3MCA B;  2AZV A;  4N4G A;  3EG1 A;  3L2V A;  2EQK A;  1QKW A;  2J6K A;  3UA6 A;  1ADJ A;  3URG A;  4M78 A;  2AIR B;  2KRM A;  2MK5 A;  1AWX A;  2AKK A;  3G4S A;  1E1T A;  2QDL A;  1JJ2 S;  1YNZ A;  3CCS A;  4A53 A;  12AS A;  4KH1 B;  4XU0 A;  5CR2 A;  1G3W A;  1NJI R;  1IZ6 A;  1NG2 A;  2K3Y A;  4H2S A;  2CP7 A;  1YJ9 T;  4RTT A;  2BUD A;  2QEX Q;  3G1Z A;  2K57 A;  3A5Y A;  4OMF B;  2DQ0 A;  4N4I A;  3OYK A;  1UGP B;  1Y57 A;  2MWO A;  1W66 A;  2HQX A;  4EPC A;  2DU7 A;  2DJQ A;  2FL7 A;  1CSK A;  3L1A A;  3CME Q;  3QO8 A;  2DVE A;  4XEO A;  3HY0 A;  1U3O A;  1QW1 A;  3GPL A;  2DET A;  2CUD A;  2CZ1 B;  2PME A;  4KT0 E;  3JAM E;  3TEH B;  2LQW A;  4F16 A;  2RHU A;  1EQR A;  2EQJ A;  2EJG A;  3NEL A;  5GAN 8;  3JB9 H;  1RAF B;  1VQ4 Q;  2DER A;  1FXX A;  1SKU B;  3JCM h;  4Y92 A;  2LC4 A;  3ZEH A;  1QF6 A;  1GCQ C;  4YRF A;  4TQF A;  4E7L A;  4J6Y A;  2QHU A;  3RGL A;  2YSQ A;  3CC7 T;  3IAL A;  3MO8 A;  2DEU A;  2X4X A;  1ZSZ B;  2CYZ B;  4OMM A;  4C8Q G;  5L8R E;  5GAN 2;  4R55 A;  1WHG A;  4KUD K;  3CC2 T;  4P3P A;  2ZT8 A;  3MJX A;  4C8Q F;  3QO5 A;  2BTT A;  2Q7E A;  2EPD A;  1OPL A;  2VKN A;  3JB9 D;  1Q81 C;  1WQW A;  1K0S A;  4PNO A;  3ICA A;  1WA7 A;  1QE0 A;  4IIO A;  5KYY B;  3UPU A;  1G5V A;  1H3Z A;  4F7U G;  3VS3 A;  3G6E T;  2DPP B;  3NTI A;  3HRU A;  4LDU A;  4F7U F;  2XID A;  3SDZ A;  2ZZD A;  3M0U A;  2X3X D;  1MGQ A;  3QSU A;  4EMK C;  1S1N A;  1PM3 A;  2EBP A;  4JRI A;  3LSQ A;  2SRC A;  1KQ1 A;  3JCM P;  4PJO C;  1H4V B;  2K2V A;  1LCK A;  1SPK A;  2EQU A;  5CIU A;  4H2U A;  3G4S Q;  3KBG A;  1KQS P;  2COZ A;  5CKB A;  4P71 A;  2E64 A;  1BU1 A;  5GAN e;  2A08 A;  1TXQ A;  3CCU A;  2DTH A;  4J9I A;  2QA4 T;  1K9M U;  3CCR T;  1LNX A;  3M0T A;  5GAO m;  1KIK A;  3A74 A;  2RPN A;  1YJW T;  4MZT A;  1YFS A;  2DL8 A;  1OOT A;  3WVE B;  4C92 B;  5J39 A;  2RF0 A;  3V8J A;  3ZL7 C;  4JJN K;  1XJW B;  5K1P A;  1PSF A;  3RAC A;  1GBQ A;  4CH4 A;  2QHV A;  3CCE T;  1R0C B;  2LCC A;  1UEB A;  3MET A;  4AH6 A;  2ABL A;  2L3R A;  2DXC A;  4Q5W A;  4D8D A;  2NYS A;  4UP9 A;  3LW5 E;  2EJF A;  4QQD A;  3AT1 B;  3KFV A;  3VS0 A;  1OZ2 A;  4P72 C;  1YJN T;  1K8A U;  1YWO A;  1JXM A;  3A5Z A;  4JRP A;  3PCO A;  2DTO A;  4WF2 A;  1L0W A;  1TU0 B;  2JW4 A;  2QAZ A;  4P74 C;  1AWJ A;  3A32 A;  1Y96 A;  2J06 A;  4PL6 A;  2HCK A;  3VS6 A;  4H2X B;  4YRQ A;  1B70 B;  4XEM A;  3RDV A;  1RAC B;  1UG1 A;  3LGF A;  3QJY A;  4LNP A;  1FMK A;  1BI3 A;  4YRT A;  3OYG A;  3OA6 A;  1WPY A;  2A28 A;  3OS5 A;  4E51 A;  3DLM A;  2FRY A;  1W2B S;  2IY5 A;  5I22 A;  3CPW S;  2D9T A;  2KT1 A;  3H9N A;  3OS1 A;  3CEY A;  3JCM X;  1WLP B;  2OX7 A;  1UFF A;  3KXT A;  1OU8 A;  2CH4 A;  1X2Q A;  1PRM C;  4TTV A;  5HKC A;  1RLQ C;  2YRV A;  5E3I A;  3CD6 A;  1U1T A;  2LMJ A;  1SSH A;  5A2Q E;  4QVD A;  5A0G A;  5KYX A;  2CP5 A;  4WJ4 A;  2HKQ B;  3TEG A;  4ZTJ A;  2CJA A;  2L8D A;  2HDA A;  2DE0 X;  6AT1 B;  2ZT7 A;  4BY6 C;  1C0M A;  3EGD B;  4M7A A;  4M75 G;  1U1S A;  1RAB B;  3SWN B;  3EAE A;  2CUB A;  5CAI A;  4ZN3 A;  4M75 F;  3QYH B;  1K9M R;  5CK9 A;  4JRK A;  2VB6 A;  1B7Y B;  1CKB A;  2XIC A;  5C53 B;  5GAM g;  4M77 G;  3CCU Q;  2LX7 A;  5KE2 A;  4K88 A;  4M77 F;  1JRI A;  5LJ5 f;  2E4H A;  2D6F A;  2YUO A;  2ED0 A;  2RHI A;  5KNN A;  2DM1 A;  5D6W A;  1BK2 A;  1UHF A;  1GXI E;  1WXB A;  3Q1J A;  1N5Z A;  3JRZ A;  2FO0 A;  1JBM A;  4ZGJ B;  4JUV A;  2QEX T;  2O4X B;  1TH7 A;  5KYW A;  3PTA A;  2E3C A;  1WHL A;  4IUV A;  5M9O A;  1SEM A;  3CPF A;  1QWF A;  1XOV A;  4CH5 A;  3CME T;  4FSS A;  4OGC A;  4UP8 A;  2HSE B;  1N8R U;  4M78 C;  1PNJ A;  4G85 A;  5GMK h;  4QKU A;  4MDW A;  2CZ7 B;  3UAT A;  1H3H A;  1EOV A;  5LJ3 e;  2ZTG A;  1KK7 A;  1MUZ A;  4HCC A;  2D0N A;  3QHS A;  1YJ9 A;  1JJC A;  2E5A A;  2ZXF A;  5KE3 A;  2YUQ A;  4NCX A;  4QQG A;  1JQQ A;  3HRK A;  1VQ4 T;  3EGU A;  1N6A A;  5HCK A;  2KR3 A;  4KGZ B;  4LVL A;  2OI3 A;  2O9S A;  2RH2 A;  1G5I A;  4PFP A;  4TVA B;  2D0Q B;  2ZIO A;  3CD6 Q;  2LQN A;  2ROL A;  2RHQ B;  2ZT6 A;  4Y28 E;  4XTU A;  4C8Q B;  3LWI A;  4BW9 A;  2J6F A;  2CGH A;  1M8M A;  5A0L A;  4CH3 A;  3OYM A;  4LDY A;  2DBK A;  4FL6 A;  2PMF A;  4HVC A;  3LLR A;  3I5S A;  2MCN A;  2C8M A;  1RAD B;  2CH4 W;  1VQ9 A;  4PJM A;  2EYY A;  4JZ4 A;  4MZP A;  1T0J A;  1M1K C;  1NJ6 A;  2RJD A;  4F7U B;  2DXU A;  2YHT A;  2NUZ A;  3CC7 A;  4RDX A;  1WX6 A;  3CBP A;  3WXM B;  3GLX A;  2PZ1 A;  4OF1 A;  4HWP A;  5IXB A;  1OEB A;  3GNF B;  1JJ2 A;  3CC2 A;  3OW2 P;  2DQ3 A;  8AT1 B;  3FLG A;  1YIJ A;  3E9G A;  4FYW B;  1TS9 A;  4B9W A;  3LSS A;  4YRL A;  4IUU A;  3UDC A;  3GOX A;  1USY A;  4ELY C;  2AMC B;  1IHW A;  4P75 A;  4YDQ A;  2FPD A;  1X54 A;  1EFN A;  1MV0 B;  5CO7 A;  2LRQ A;  5KYU A;  2ZPE B;  5F5W A;  2J7I A;  3G6E A;  1VQO T;  1D0Y A;  1VQM A;  3UWN A;  1VQP T;  1Z9Z A;  3BDU A;  2HEQ A;  2XTI A;  2EIF A;  3EHQ A;  4DBH A;  4BDY A;  3EGX B;  1GGM A;  2JTF A;  4C5G A;  1K8A C;  2JN0 A;  1ACM B;  2XKO C;  5CQY A;  1Q86 C;  2FVU A;  1BCM A;  3MQZ A;  1ZUU A;  2E1H A;  4P71 C;  2EGE A;  3CCM T;  5FWC A;  3OYF A;  2ARU A;  1NPR A;  1UJY A;  1MMN A;  3CCR A;  1ABO A;  4WCI A;  5KCO A;  4PJL A;  2RA2 A;  1WJQ A;  1C0A A;  2CZ6 B;  3PZC A;  4PFZ A;  3FDR A;  4FT4 A;  3MP6 A;  2C7I A;  4LVK A;  1Z9Q A;  2E65 A;  1KSW A;  3EG2 A;  1OYX A;  1AWO A;  3CCE A;  1M8V A;  2P0P A;  2NUT A;  2MAM A;  1M1F A;  3A7R A;  5CKF A;  1ZQ1 A;  1FMV A;  1PHT A;  3UFG A;  3I55 Q;  4A4G A;  5GAN f;  3S3O A;  2LP5 A;  3HRT A;  1BB9 A;  1VQ9 Q;  4YRE A;  2XK0 A;  3RKW A;  2DIQ A;  1CKA A;  1WHJ A;  3RMS A;  1BBW A;  1EX4 A;  1VUB A;  2KT8 A;  5GMK j;  1OUL A;  1SHF A;  4M75 B;  3L2U A;  1PYS A;  4CC2 A;  3QXE B;  3CC2 Q;  1ZBJ A;  2AT1 B;  2O31 A;  2EYX A;  1YIJ Q;  4YCW A;  5GAM j;  1EZZ B;  1HC7 A;  4K86 A;  3DB4 A;  3TVT A;  4HWS A;  2RJC A;  2GF7 A;  4M77 B;  1Q95 G;  4RKU E;  3SEM A;  1UJ0 A;  2XGT A;  5DM7 R;  2YT6 A;  1UUE A;  1D0X A;  1WYX A;  5LJ5 d;  1R0B G;  3OYJ A;  4E7I A;  3G6E Q;  2SEM A;  4ZIB A;  3UGT A;  4YRN A;  4HXJ A;  1VQM Q;  2JTE A;  2KAF A;  1N8R C;  2EVR A;  4M7A C;  5LJ5 h;  4XTV A;  2ZPF B;  1BYM A;  2ESW A;  2JJ9 A;  5GMK i;  2JVV A;  2IG0 A;  4OMP A;  3M4P A;  4V2S A;  2E5Q A;  3REB B;  2BIV A;  1AD5 A;  4PJO G;  2JS0 A;  4B9X A;  1RAA B;  4Y91 A;  1X01 A;  3BFM A;  1Y0M A;  4JPB W;  3CCR Q;  1PD0 A;  3EG9 A;  5IN1 A;  2XMF A;  4PJO F;  1FMW A;  1ASY A;  2EKH A;  2E70 A;  2RNA A;  1E22 A;  4KH0 B;  2QHS A;  1SHG A;  4L87 A;  2V1R A;  4KBM B;  4JLG A;  1PWT A;  4BAC A;  4BI3 A;  1HJD A;  1W2B A;  3VYG A;  2CP2 A;  3PVL A;  4F7U E;  3CPW A;  2QQR A;  1BI2 A;  3J81 E;  3CCE Q;  3VBB A;  1RI9 A;  2AKW A;  2EQI A;  1PRL C;  1IXD A;  1IGU A;  4LDW A;  2GGR A;  2RQV A;  3O8V A;  5AT1 B;  5KYW B;  2P0Q A;  1K4U S;  3NEM A;  4YP0 A;  3CD6 T;  4ZN1 A;  3H8Z A;  4DA4 A;  3FJP A;  1M30 A;  2Y90 A;  4NS5 A;  1RAG B;  2K6D A;  3FC3 A;  2DX1 A;  4JJD A;  2KRS A;  1YHQ T;  2JTM A;  1G8X A;  3OYB A;  1VQ4 A;  4J15 A;  2NUP B;  4JRQ A;  4JDS A;  5CCA A;  4YRP A;  1NBE B;  2XU8 A;  2BZY A;  3RIR A;  1PKS A;  3QKJ A;  1QVG S;  1C6V X;  1GFC A;  1UGR B;  2DZC A;  3HXZ A;  4C0D C;  1KMM A;  1VQ6 T;  3HFN A;  3CMQ A;  4HKE A;  2P5I A;  4KUI A;  1G5H A;  3PMI A;  4KGX B;  1Q81 R;  5IT9 E;  4OMO A;  5LJ3 f;  1G3T A;  1N27 A;  1KQ2 A;  4A4K A;  2LQ8 A;  3G1J A;  1X2K A;  3A8H B;  4HA8 A;  4RTU A;  2HQE A;  2RD1 A;  4J9F A;  1AT1 B;  3PE0 A;  1D09 B;  2B8A A;  1MHN A;  1GRI A;  3EH1 A;  2BKD N;  2VC8 A;  1QVF S;  2ZPG B;  3THK A;  2JMC A;  2LCL A;  5DLO A;  1NJ8 A;  1NJ2 A;  3H0F A;  3CCV T;  1PC0 A;  4ZTZ B;  2CKK A;  3JCM g;  3M5A A;  1TG0 A;  3M59 A;  1YI2 A;  4L6V 5;  2DF6 A;  2K5L A;  4ELZ C;  4CC4 B;  2K2M A;  1USY C;  2BE9 B;  3RBB B;  3QNE A;  1N9S A;  4P75 C;  4ZGE B;  3OMG A;  1BCO A;  2NS6 A;  2F2V A;  3VS4 A;  3HTZ A;  4HWR A;  1VQO A;  4OP0 A;  2QYZ A;  3T9N A;  2DRK A;  1T3L A;  2RQW A;  4EIK A;  4EX5 A;  2VYT A;  3I9Q A;  4FCY A;  1VQP A;  4M75 E;  4AFS C;  5ECA A;  4Q6G A;  1HD3 A;  2R57 A;  1EIY B;  2MWP A;  4N0A A;  1M5Q 1;  3P8Y A;  1X6B A;  4C92 D;  2CIM A;  1I0C A;  3TQ7 P;  2RO0 A;  3M53 A;  2CP6 A;  3CCM A;  2BZX A;  3GNG A;  4II1 A;  3ZBD A;  2VVK A;  4M77 E;  4M78 G;  4AMC A;  4ATO A;  1UEC A;  2RQR A;  3GF5 A;  5GAN d;  4M78 F;  3I55 T;  2Q5H A;  2YRD A;  3QDF A;  4ANJ A;  4A4H A;  3TUP A;  4ZNX A;  1G51 A;  2QQS A;  1VQ9 T;  1NE8 A;  3L4G B;  3P8V A;  1NM7 A;  5GAN h;  4GY5 A;  2EW3 A;  1ABQ A;  1WLE A;  1B34 A;  2ALY B;  5GMK l;  4PLL A;  4C0Z A;  4MDX A;  2OTL A;  4P73 A;  5ELO A;  1HTT A;  1BIA A;  2ZPH B;  2GTJ A;  5D6Y A;  3MEU A;  1WHK A;  1YIJ T;  3HFO A;  2A36 A;  2M9U A;  1YWP A;  2QK0 A;  1U5S A;  3PNW C;  1OX8 A;  5FWB A;  3PVQ A;  3EG3 A;  1J3T A;  2DD5 A;  2JMA A;  3R6O A;  2RM4 A;  1X43 A;  3PFS A;  1VOM A;  1VQM T;  3GP8 A;  4TVY A;  4MMK A;  1VA7 A;  2RQU A;  1YI2 Q;  1QCF A;  1EVL A;  1M1K U;  3EFO A;  4EMK B;  1VIE A;  3H6Z A;  4H2Y A;  1QCN A;  1KOG A;  3M57 A;  2GNC A;  3GIB A;  1IB8 A;  4PJO B;  4M7D A;  4EMG A;  2HNI A;  3QYG B;  1KD1 C;  1VQO Q;  3J80 E;  1PG5 B;  1GFD A;  4C5E A;  4VUB A;  5CQX A;  2I4O A;  2BZ8 A;  1VQP Q;  4H02 A;  3M4Q A;  4J6X A;  4H2T A;  4XTW A;  3RUX A;  3HHT B;  2RJE A;  3WQZ A;  2DTI A;  2EGC A;  3INZ A;  2P84 A;  1M2V B;  2DBM A;  3CCM Q;  1JJ2 P;  3S6W A;  3X25 B;  4LN2 A;  4FIB A;  4YRJ A;  3ZFJ A;  2K79 A;  3JB9 J;  2AZS A;  4PJJ A;  1SG5 A;  2COW A;  1Q86 U;  2JXB A;  4O2D A;  2XD0 A;  4M4Z A;  3PIO A;  1M2O A;  4BI8 B;  2CSI A;  4ORZ A;  1RAE B;  5KYN A;  2X51 A;  1G83 A;  3OYN A;  1QMC A;  1QP2 A;  2OTL Q;  3ER0 A;  4Z8A A;  2FRW A;  2R5M A;  4JJB A;  1I5L A;  2DNU A;  1PD1 A;  3SFM A;  4C0G A;  4J9E A;  2DYB A;  2OAW A;  5D6X A;  2X4W A;  4LD6 A;  1D3B A;  4DEX A;  1G2B A;  2LNV A;  2RJF A;  2RI2 A;  2X35 A;  1ZX6 A;  1YHQ A;  2DKG A;  4C8Q D;  2KY9 A;  4YRG A;  4X9D A;  5LJ3 d;  2CSQ A;  2QGG A;  2VGM A;  5GJV B;  2O01 E;  2X4Y A;  2CP3 A;  3M4Y A;  4PKC C;  3EFR A;  1M1K R;  4KRT A;  1E6H A;  2PUK B;  2YDL A;  1WXT A;  2JT4 A;  3M0P A;  1NEG A;  5LJ3 h;  3FJ5 A;  1HYO A;  3X26 B;  2E3I A;  5C52 B;  4E7J A;  4OB2 B;  1KMN A;  5AYF A;  3VS2 A;  3DB3 A;  3LH5 A;  4BY6 B;  2CRE A;  1GL5 A;  2H8H A;  3PT9 A;  4HCK A;  1R8O B;  4MZM A;  1ADY A;  1TTH B;  1VQ6 A;  2DL3 A;  3CXC S;  3LC0 A;  2RK1 A;  4HVU A;  2NWM A;  2CJ9 A;  2EKO A;  3H0H A;  4X9C A;  4CS2 A;  2Y4X A;  3HSB A;  2K4Y A;  4AFU C;  1VQ5 A;  2D8H A;  4X1V A;  3UH0 A;  2MOX A;  1SSF A;  2DL4 A;  3AHU A;  2DLP A;  1FYF A;  5FU6 C;  2JUF A;  2VAS A;  3NET A;  3BY7 A;  2P0K A;  3OBW A;  4EMH A;  5GAN 6;  3REX A;  1K8A R;  2HL5 C;  4M7A G;  5FRN A;  1Q86 R;  3CCV A;  3O5Z A;  1X56 A;  3HFZ A;  4RMO A;  3S3M A;  4M7A F;  1E6G A;  2K3B A;  3OMC A;  4LNS A;  3PIP A;  2K5I A;  2A7Y A;  3N5B B;  2ZAE A;  2H3J A;  5CKD A;  4YRS A;  4M78 B;  3J7A F;  2RHZ A;  2XDD A;  1NYF A;  4YCU A;  2JOY A;  3NGP A;  4AG1 C;  3VS7 A;  1WQ7 A;  4BDZ A;  1B76 A;  3HXY A;  3C4S A;  1QVG A;  2GFU A;  1MV3 A;  3LX7 A;  1UB4 A;  1UTI A;  4N0A C;  5CKH A;  3SHW A;  4DEY A;  2L3S A;  4E6R A;  2W0Z A;  2PVD B;  4FYV B;  3L42 A;  2L0A A;  4H2W A;  4E7K A;  1YHQ Q;  2QQA A;  2KRN A;  2JZ2 A;  1BKB A;  3I55 A;  7AT1 B;  2E12 A;  3V7S A;  1YP5 A;  2CDT A;  3OYI A;  1QWE A;  1W2B P;  1QVF A;  3RR6 A;  4JS5 A;  5KCH A;  3CPW P;  3IG2 A;  4O6J A;  3R6N A;  3L2R A;  3WVD B;  2ODR D;  4C92 E;  5GAO n;  3JB9 I;  9ATC B;  2RHY A;  1K1Z A;  4BUG A;  1BI1 A;  4RTV A;  4P73 C;  2NLU A;  3VQV A;  2MPX C;  1VQ6 Q;  4M75 D;  3MEA A;  2J3M A;  1WI7 A;  2RK2 A;  2DIG A;  3RL6 A;  4CH6 A;  1M90 C;  5IXF A;  1YI2 T;  3ASK A;  1VQ5 Q;  2FG0 A;  4HCZ A;  4M77 D;  3VJP A;  2B86 A;  1N8R R;  5GAN 3;  1U8R A;  2DIL A;  1SRL A;  1W4S A;  2FZC B;  4KUL A;  3VS5 A;  3C95 A;  5GAM e;  2DDZ A;  2EYZ A;  3CCV Q;  4CS4 A;  1JXO A;  1RAH B;  4DBR A;  2VWF A;  3VUB A;  3HFV A;  2F5T X;  3RKY A;  1VYU A;  3E9F A;  4XU1 A;  2J6O A;  1M3C A;  2ARS A;  2YWW A;  3P8B B;  4J83 A;  1BBZ A;  2ZZG A;  2QTV A;  2Y4Y A;  2M1H A;  4IUQ A;  4M7D C;  3TEH A;  1N9W A;  3FEO A;  1W70 A;  2HAX A;  5FU7 C;  1WHH A;  1T3S A;  2COY A;  4AFZ C;  3MEV A;  1YIT T;  1EFW A;  2X4J A;  5GMK m;  5I2M A;  1SES A;  1Q82 C;  2Q5I A;  2OTL T;  4BE2 A;  2E6Z A;  3LH0 A;  3RES A;  4XU3 A;  3I56 Q;  2KE9 A;  3A7U A;  2HZY A;  1ZSZ A;  2KRO A;  5LJ5 g;  2KBT A;  2KEA A;  4JS4 A;  2E3H A;  1Y7X A;  1JEG A;  2V8J A;  3X20 B;  4PHC A;  3D7S B;  3E9I A;  3ULR B;  4MML A;  1AHJ B;  1UGQ B;  3JCM f;  4A63 B;  1K73 C;  2HSP A;  5KYY A;  3A5Z B;  3PCO B;  3CC4 Q;  1Q7Y C;  2YLC A;  1M1G A;  1Y96 B;  2HKN A;  3M0R A;  4RTX A;  2K3X A;  2R5A A;  1P92 A;  2OTJ Q;  3UGQ A;  1M27 C;  2IY5 B;  3RNJ A;  2KXC A;  1A0N B;  3VS1 A;  1H64 1;  2ZR3 A;  1V29 B;  2DXT A;  2AKL A;  1VQL T;  1OQK A;  3E1S A;  5HGQ A;  4E47 A;  1QLY A;  4DQ2 A;  3QTC A;  4HT9 A;  2ART A;  1H4Q A;  3QG1 A;  5KYX B;  1JU5 C;  2QQB A;  3CQT A;  4F04 B;  3I5R A;  4YCV A;  5ELN A;  2DK3 A;  2HBP A;  4UPA A;  4FM4 B;  1H4S A;  3RER A;  2CJB A;  4M7A B;  3HRI A;  4C92 A;  1KFZ A;  3ME9 A;  1M9S A;  4P5N A;  5GAN 4;  5HY6 A;  4C8Q E;  3JCM c;  1NLO C;  1AZG B;  5GAN 5;  1B7T A;  2QTX A;  1QKX A;  3W3S A;  2I2L A;  3FIF A;  2C0O A;  2I0N A;  2C06 A;  4KQE A;  1DJ7 B;  2O2O A;  2EJ9 A;  3M0Q A;  1KJW A;  4TVW A;  1B8A A;  3M56 A;  1KD1 U;  2RB6 A;  1B70 A;  4HT4 A;  4E7Z A;  1MMD A;  2ZNI A;  4J9C A;  3OYL A;  1SET A;  4HVV A;  3TSZ A;  3LYI A;  4A4F A;  3CBM A;  2QHT A;  2MMP A;  5IAY A;  2EAY A;  2YXY A;  3MP8 A;  4ME7 A;  4PJN A;  5L23 A;  5K1X A;  2ZCE A;  4FYY B;  5I11 A;  1WFW A;  4CC3 A;  3EFS A;  4FSX A;  2ZCF B;  4LVI A;  2KYB A;  4YRK A;  1UDL A;  2EWN A;  1D1C A;  2HD0 A;  4RG8 A;  1JJC B;  1I1J A;  3EGD A;  3QZ5 B;  2FZK B;  2WSC E;  2RMO A;  5GJW B;  3QO7 A;  1YCY A;  1C1A A;  1V1C A;  4JZ3 A;  4RTW A;  4LD9 K;  3SWN A;  2VXF A;  3CXC A;  2JS2 A;  2KXD A;  5IH2 A;  1J5W A;  4CI0 C;  2QXF A;  1ZUK A;  2EGA A;  1B7Y A;  2YUP A;  1WGS A;  2DL7 A;  2DAQ A;  1ZUY A;  4BB7 A;  2HMA A;  1QVP A;  2DO3 A;  4J8O A;  3UF4 A;  2DU5 A;  4C0D B;  1VQ5 T;  3VQX A;  1T0H A;  2PVG B;  1Y71 A;  4A54 A;  3FB9 A;  1NJ5 A;  2YUN A;  4NL3 A;  4Z88 A;  3DKM A;  5CVI A;  4IIM A;  3L2Z A;  2E6N A;  1I07 A;  3CCQ T;  4JLI A;  1NNH A;  3JCM b;  3M0S A;  1KQS S;  2JM9 A;  2O4X A;  3MKD A;  3A1P A;  4UP7 A;  2X9H A;  1BBU A;  2QG9 B;  2ZIN A;  1IRE B;  1UGS B;  3CCL T;  4JJC A;  4J9G A;  1D1B A;  3F70 A;  4NL2 A;  1VQK T;  3NEN A;  1V76 A;  3CMA Q;  5GAN g;  1KD1 R;  1X55 A;  1VQ8 T;  1NPP A;  4R0K A;  4PJO D;  1RIQ A;  3QJ6 A;  1LYL A;  1YB3 A;  2VV5 A;  2ZNJ A;  4DPG A;  1AEY A;  1OPK A;  3MHX A;  1MND A;  3TU4 K;  3HRS A;  1EIF A;  4GBQ A;  1MMG A;  2M0Y A;  2Z0W A;  3HPW A;  2QAS A;  4A4E A;  3DSQ A;  5KYU B;  4N4H A;  2WAC A;  1I81 A;  1TUC A;  3P8T A;  2KVQ G;  1MMA A;  1VQZ A;  1TUD A;  2WSE E;  4TVA A;  1LPL A;  2CT3 A;  2M16 A;  3MPU B;  4RQF A;  3I56 T;  4CC7 A;  5LJ5 j;  3VQY A;  4DBF A;  3L2W A;  2RHQ A;  1RL2 A;  2OJ2 A;  2C0T A;  3RKX A;  5A0D A;  4GLM A;  4C8Q A;  1UGV A;  2Q7G A;  2HQH A;  2DMO A;  1M3A A;  4D8K A;  3BJU A;  2ZT5 A;  3M9Q A;  1TUG B;  1WDX A;  4Z89 A;  2QI2 A;  5GAM f;  1YIT A;  1UE9 A;  1AVZ C;  8ATC B;  3JCM d;  1IL2 A;  3CBO A;  1WXU A;  2ATC B;  2FEI A;  3CC4 T;  4F7U A;  3TEE A;  5C6S A;  4LUE A;  4M7A E;  3BDL A;  5CKE A;  4TVR A;  4L5G A;  5HK0 A;  1WNL A;  2J3L A;  2GFA A;  4IUT A;  1SRY A;  2O9V A;  3LGL A;  4C0F A;  2OTJ T;  2PTK A;  2PU9 B;  3REA B;  1NYG A;  1ZSZ C;  4IKF A;  2EYW A;  1W6X A;  2M0O A;  1ZSG A;  2LCS A;  1YFT A;  2LQK A;  2NUT B;  1ARK A;  1AOJ A;  1K0X A;  3HXX A;  4Z02 A;  4QQ6 A;  1VQ7 Q;  4Q15 A;  3VRY A;  1X75 C; 
#chains in the Genus database with same CATH homology
 5GAN 7;  2AMC A;  4J5Y A;  1X2H A;  4YTL A;  1Z7M A;  5DY9 A;  3QUI A;  4UC4 A;  1X2G A;  4C5I A;  4NOY A;  1O9S A;  1SER A;  1G3Y A;  3OY9 A;  4OB0 B;  3VUZ A;  1ATI A;  1PYS B;  3CCJ A;  2EYQ A;  4XTY A;  2KSS A;  1N9R A;  1KHC A;  3G71 A;  4YYE A;  1VQL A;  3SD4 A;  4OVA A;  4G84 A;  4RCC A;  2XI9 A;  4PLI A;  1M90 U;  3V8K A;  1ZBX A;  3JCM e;  1NJ1 A;  2L89 A;  4E7H A;  4C92 C;  1NJI C;  4XU2 A;  4QW2 A;  2DD4 A;  3RF1 A;  1HXD A;  5LJ3 g;  4EO4 A;  1NYR A;  4M7D G;  3OQ5 A;  4M78 D;  1PSE A;  2E41 A;  4M7D F;  3V8L A;  1LJO A;  2I4L A;  5J26 A;  4DOV A;  1FX7 A;  3M54 A;  1H4T A;  1WYD A;  4P3N A;  4LDX A;  3A8O B;  2KQW A;  4EDU A;  2RI5 A;  4M75 A;  3JCM V;  3NTH A;  3MEY A;  2AKW B;  4LVJ A;  1Q82 U;  3A8L B;  4BE1 A;  2DZ9 A;  4QVZ A;  3HL8 A;  4X5O A;  1XNI A;  3HKS A;  2FYK A;  4RCB A;  2KMT A;  4M77 A;  1E24 A;  4ZTF A;  1G3S A;  4O5V A;  1KHI A;  3OYH A;  4KR3 A;  2QQ9 A;  4RMF A;  4OLF A;  3OW2 S;  3SWN C;  1XQH A;  3OBY A;  2LT1 A;  1K73 U;  3OSV A;  4BD3 A;  1Q7Y U;  3HXW A;  4IUP A;  2P4T A;  5GAN j;  1VQN T;  1YGB A;  3R07 A;  3CMA T;  2VGN A;  4J6W A;  2E10 A;  3X28 B;  2Q7H A;  3M55 A;  4IUR A;  3TCJ A;  3CCQ A;  2EQM A;  2FB7 A;  4DOW A;  2P0L A;  3TRE A;  5FU6 B;  1S72 A;  3CCL A;  1WJR A;  4LDV A;  2RI3 A;  3V7C A;  1VQK A;  4H2V A;  4BI4 A;  3SB2 A;  1X6O A;  3I7F A;  1VQ8 A;  3REU A;  4KR2 A;  2IVW A;  5J3B A;  4YRI A;  1KC8 U;  3P8H A;  2JNG A;  5GAM d;  3NTK A;  3M58 A;  2RHS A;  4M7D D;  4YRR A;  2XG8 D;  5GAM h;  2R58 A;  2ZPB B;  3OYA A;  3I56 A;  4PJO E;  2ZGW A;  4RG2 A;  1NYQ A;  1Y07 A;  4C8Q C;  4D6W A;  1HK9 A;  5GAO q;  5FRM A;  3MEW A;  4J7F A;  3OYC A;  5FLX E;  1VQ7 T;  2G4C A;  1KQS A;  4HWO A;  2DEQ A;  3QBY A;  3C94 A;  3VKI A;  3X24 B;  4BWA A;  3CC4 A;  3QO3 A;  4X34 A;  3M4G A;  3A8M B;  5GAO r;  1B34 B;  2OTJ A;  2LVM A;  1E1O A;  3MF2 A;  2MI6 A;  3VYH B;  5GMK e;  3ERR A;  1VIF A;  3FRN A;  1QP3 A;  1NZ9 A;  2AHJ B;  2A3L A;  3HXV A;  1Z7N A;  1K9M C;  4C5H A;  3A7A A;  3G4S T;  2ZR2 A;  2RHX A;  3CCS T;  4GLK A;  2YLB A;  1EIY A;  1BIB A;  2XDB A;  3G7Z A;  1JB0 E;  2ZPI B;  1YFR A;  4M7A D;  2V8I A;  3OS0 A;  5LJ3 j;  2ZZE A;  5C51 B;  3HXU A;  3OD1 A;  4XTZ A;  2PQW A;  3HP9 A;  4M7D B;  2KK4 A;  3L4G A;  5FU7 B;  2I4N A;  2QA4 A;  5C0M A;  3KFU A;  3A8G B;  2A8E A;  2ALY A;  2I4M A;  5GAO l;  1YJW A;  3OS2 A;  4YRM A;  3P8D A;  1I4K 1;  3KUF A;  4PG3 A;  4ZGD B;  3VU3 C;  3PMT A;  1RI0 A;  1XTD A;  4P3O A;  3JCM Q;  3LWH A;  1OZ3 A;  5I21 A;  4TWA A;  4CS3 A;  4L59 A;  2ODR C;  3QZ9 B;  3HY1 A;  5DLQ E;  1YJN A;  2CZ0 B;  4OGE A;  2GCX A;  3E19 A;  3VV0 A;  3QII A;  4M75 C;  3JCM W;  4XAX B;  4XQ3 A;  1YBY A;  5EG2 A;  3CCJ T;  4FT2 A;  5I2S A;  5LL6 S;  3G71 T;  4M78 E;  2KDS A;  4EMK A;  1D3B B;  4J7I A;  4M77 C;  1FWZ A;  3OYE A;  4PJO A;  3OYY A;  4RQE A;  3DLL A;  2CS7 A;  1KG1 A;  3CCU T;  4ZTU B;  3NFC A;  1KC8 C;  3MP1 A;  1WJS A;  2VXE A;  3UT1 A;  2K5F A;  4QVC A;  3L2Q A;  3MF1 A;  3OYD A;  1VQN A;  3QDR B;  3V7R A;  2G3R A;  1Q81 U;  2PVO B;  3CMA A;  4OB1 B;  2QDY B;  4YRO A;  2VUB A;  4H2X A;  2F5K A;  4P72 A;  2LT4 A;  2WSF E;  2XHC A;  4HWT A;  1M4Z A;  4P74 A;  4R56 A;  2OAU A;  11AS A;  1O75 A;  2QEX A;  4C92 G;  2MF2 A;  2EFI A;  2FHD A;  3HFZ B;  2F69 A;  4C92 F;  1NJI U;  4YRC A;  2V8K A;  3CME A;  4YPF A;  3JCM J;  3C12 A;  3IKL A;  4HT8 A;  2L5Q A;  1LOJ A;  3JSC A;  4CRI A;  3OB9 A;  3OW2 A;  5LJ5 e;  1ASZ A;  3E9H A;  3BW1 A;  5FRO A;  4WJ3 M;  1BI0 A;  1EVK A;  4K87 A;  4XK8 E;  2LTO A;  1OI1 A;  1ZHI A;  2GQV A;  2DJZ A;  5GAO p;  3VQW A;  2RHS B;  2EL9 A;  2LX9 A;  2ZZF A;  2ZIM A;  3QPH A;  3JB9 G;  1VQ7 A;  4OB3 B;  4M7D E;  3S3N A;  3JB9 F;  1I8F A;  1WU7 A;  4BE0 A;  3IKM B;  4XTX A;  5HK3 A;  1S72 T;  3A31 A;  4WI1 A;  4LVM A;  3RMQ A;  2DXB A;  4FU6 A;  5KH6 A;  3OSS C;  3PGG A;  2LDM A;  2PUO B;  4TQD A;  4HCB A;  2XDP A;  3MCA B;  4N4G A;  3L2V A;  2EQK A;  1ADJ A;  3URG A;  4M78 A;  3G4S A;  1E1T A;  1JJ2 S;  3CCS A;  4A53 A;  12AS A;  4XU0 A;  5CR2 A;  1G3W A;  1IZ6 A;  2K3Y A;  4H2S A;  1YJ9 T;  2BUD A;  3G1Z A;  2K57 A;  3A5Y A;  4OMF B;  2DQ0 A;  4N4I A;  3OYK A;  1UGP B;  1W66 A;  2MWO A;  2HQX A;  4EPC A;  2DU7 A;  2FL7 A;  3L1A A;  3QO8 A;  2DVE A;  4XEO A;  3HY0 A;  1QW1 A;  3GPL A;  2CZ1 B;  2PME A;  4KT0 E;  3JAM E;  3TEH B;  2RHU A;  1EQR A;  2EQJ A;  2EJG A;  3NEL A;  5GAN 8;  3JB9 H;  1FXX A;  3JCM h;  3ZEH A;  2LC4 A;  1QF6 A;  4YRF A;  4TQF A;  4E7L A;  4J6Y A;  2QHU A;  3RGL A;  3CC7 T;  3IAL A;  3MO8 A;  2X4X A;  2CYZ B;  4C8Q G;  5L8R E;  5GAN 2;  4R55 A;  4KUD K;  3CC2 T;  4P3P A;  2ZT8 A;  4C8Q F;  3QO5 A;  2Q7E A;  3JB9 D;  1Q81 C;  1WQW A;  4PNO A;  3ICA A;  1QE0 A;  1G5V A;  3UPU A;  1H3Z A;  4F7U G;  3G6E T;  2DPP B;  3NTI A;  3HRU A;  4LDU A;  4F7U F;  2XID A;  3SDZ A;  2ZZD A;  1MGQ A;  3QSU A;  4EMK C;  4JRI A;  3LSQ A;  1KQ1 A;  3JCM P;  4PJO C;  1H4V B;  2K2V A;  2EQU A;  5CIU A;  4H2U A;  3KBG A;  5CKB A;  4P71 A;  2E64 A;  5GAN e;  3CCU A;  2DTH A;  2QA4 T;  1K9M U;  3CCR T;  1LNX A;  5GAO m;  3A74 A;  1YJW T;  4MZT A;  1YFS A;  3WVE B;  4C92 B;  5J39 A;  3V8J A;  4JJN K;  5K1P A;  1PSF A;  3RAC A;  4CH4 A;  2QHV A;  3CCE T;  2LCC A;  1UEB A;  3MET A;  4AH6 A;  2L3R A;  2DXC A;  4Q5W A;  4UP9 A;  3LW5 E;  2EJF A;  4QQD A;  1OZ2 A;  4P72 C;  1YJN T;  1K8A U;  3A5Z A;  4JRP A;  3PCO A;  2DTO A;  4WF2 A;  1L0W A;  4P74 C;  3A32 A;  1Y96 A;  4PL6 A;  4H2X B;  4YRQ A;  1B70 B;  4XEM A;  4YRT A;  3LGF A;  3QJY A;  1BI3 A;  3OYG A;  3OA6 A;  1WPY A;  3OS5 A;  4E51 A;  3DLM A;  1W2B S;  2IY5 A;  3CPW S;  2D9T A;  3OS1 A;  3CEY A;  3JCM X;  3KXT A;  4TTV A;  5HKC A;  2YRV A;  5E3I A;  3CD6 A;  1U1T A;  5A2Q E;  4QVD A;  5A0G A;  4WJ4 A;  3TEG A;  4ZTJ A;  2CJA A;  2L8D A;  2ZT7 A;  4BY6 C;  4M7A A;  4M75 G;  1U1S A;  3SWN B;  3EAE A;  5CAI A;  4ZN3 A;  4M75 F;  3QYH B;  5CK9 A;  4JRK A;  1B7Y B;  2XIC A;  5C53 B;  5GAM g;  4M77 G;  5KE2 A;  4K88 A;  4M77 F;  1JRI A;  5LJ5 f;  2D6F A;  2RHI A;  5KNN A;  5D6W A;  1GXI E;  3Q1J A;  3JRZ A;  1JBM A;  4ZGJ B;  4JUV A;  2QEX T;  2O4X B;  1TH7 A;  3PTA A;  2E3C A;  4IUV A;  5M9O A;  3CPF A;  1XOV A;  4CH5 A;  3CME T;  4OGC A;  4UP8 A;  1N8R U;  4M78 C;  4G85 A;  5GMK h;  4MDW A;  2CZ7 B;  1EOV A;  5LJ3 e;  2ZTG A;  4HCC A;  3QHS A;  1YJ9 A;  1JJC A;  2E5A A;  2ZXF A;  5KE3 A;  4NCX A;  4QQG A;  3HRK A;  1VQ4 T;  1N6A A;  4LVL A;  2RH2 A;  1G5I A;  4TVA B;  2D0Q B;  2ZIO A;  2RHQ B;  2ZT6 A;  4Y28 E;  4XTU A;  4C8Q B;  3LWI A;  4BW9 A;  2CGH A;  5A0L A;  4CH3 A;  3OYM A;  4LDY A;  4FL6 A;  2PMF A;  4HVC A;  3LLR A;  2C8M A;  1VQ9 A;  4MZP A;  1M1K C;  1NJ6 A;  2RJD A;  4F7U B;  2DXU A;  2YHT A;  3CC7 A;  4RDX A;  3CBP A;  3WXM B;  3GLX A;  4OF1 A;  4HWP A;  3GNF B;  1JJ2 A;  3CC2 A;  2DQ3 A;  3FLG A;  1YIJ A;  3E9G A;  4B9W A;  3LSS A;  4YRL A;  4IUU A;  3UDC A;  3GOX A;  1USY A;  4ELY C;  2AMC B;  4P75 A;  4YDQ A;  1X54 A;  5CO7 A;  2LRQ A;  2ZPE B;  5F5W A;  3G6E A;  1VQO T;  1VQM A;  3UWN A;  1VQP T;  3BDU A;  2XTI A;  2EIF A;  4BDY A;  1GGM A;  2JTF A;  4C5G A;  1K8A C;  2JN0 A;  2XKO C;  5CQY A;  1Q86 C;  2FVU A;  3MQZ A;  2E1H A;  4P71 C;  3CCM T;  3OYF A;  2ARU A;  1NPR A;  3CCR A;  5KCO A;  2RA2 A;  1WJQ A;  1C0A A;  2CZ6 B;  3PZC A;  3FDR A;  4FT4 A;  3MP6 A;  2C7I A;  4LVK A;  2E65 A;  1OYX A;  3CCE A;  1M8V A;  2P0P A;  2MAM A;  1M1F A;  3A7R A;  5CKF A;  1ZQ1 A;  3UFG A;  4A4G A;  5GAN f;  3S3O A;  3HRT A;  4YRE A;  2XK0 A;  3RKW A;  2DIQ A;  3RMS A;  1BBW A;  1VUB A;  5GMK j;  3L2U A;  4M75 B;  1PYS A;  3QXE B;  4YCW A;  5GAM j;  1HC7 A;  4K86 A;  3DB4 A;  4HWS A;  2RJC A;  2GF7 A;  4M77 B;  4RKU E;  2XGT A;  5DM7 R;  5LJ5 d;  4E7I A;  3OYJ A;  4ZIB A;  3UGT A;  4YRN A;  2KAF A;  1N8R C;  4M7A C;  5LJ5 h;  4XTV A;  2ZPF B;  1BYM A;  5GMK i;  2JVV A;  2IG0 A;  3M4P A;  4V2S A;  2E5Q A;  2BIV A;  4PJO G;  4B9X A;  4Y91 A;  1X01 A;  3BFM A;  5IN1 A;  4PJO F;  1ASY A;  2E70 A;  1E22 A;  2QHS A;  4L87 A;  4KBM B;  4JLG A;  4BAC A;  4BI3 A;  1W2B A;  3VYG A;  4F7U E;  3CPW A;  2QQR A;  1BI2 A;  3J81 E;  3VBB A;  2AKW A;  4LDW A;  3O8V A;  2P0Q A;  3NEM A;  4YP0 A;  3CD6 T;  4ZN1 A;  3H8Z A;  4DA4 A;  3FJP A;  2Y90 A;  4NS5 A;  3FC3 A;  1YHQ T;  2JTM A;  3OYB A;  1VQ4 A;  4J15 A;  4JRQ A;  4JDS A;  5CCA A;  4YRP A;  2XU8 A;  3RIR A;  3QKJ A;  1QVG S;  1UGR B;  2DZC A;  3HXZ A;  4C0D C;  1KMM A;  1VQ6 T;  3HFN A;  3CMQ A;  4HKE A;  2P5I A;  4KUI A;  1G5H A;  3PMI A;  5IT9 E;  5LJ3 f;  1G3T A;  1N27 A;  1KQ2 A;  4A4K A;  2LQ8 A;  3A8H B;  4HA8 A;  2HQE A;  2RD1 A;  2B8A A;  1MHN A;  2BKD N;  2VC8 A;  1QVF S;  2ZPG B;  2LCL A;  5DLO A;  1NJ8 A;  1NJ2 A;  3CCV T;  4ZTZ B;  2CKK A;  3JCM g;  3M5A A;  3M59 A;  1YI2 A;  4L6V 5;  2K5L A;  4ELZ C;  1USY C;  3QNE A;  1N9S A;  4P75 C;  4ZGE B;  3OMG A;  2NS6 A;  3HTZ A;  4HWR A;  1VQO A;  4OP0 A;  3T9N A;  4EX5 A;  2VYT A;  1VQP A;  4M75 E;  4Q6G A;  2R57 A;  1EIY B;  2MWP A;  4N0A A;  1M5Q 1;  3P8Y A;  4C92 D;  2CIM A;  2RO0 A;  3M53 A;  3CCM A;  3GNG A;  4II1 A;  3ZBD A;  4M77 E;  4M78 G;  4ATO A;  3GF5 A;  5GAN d;  4M78 F;  3I55 T;  2Q5H A;  4A4H A;  3TUP A;  1G51 A;  2QQS A;  1VQ9 T;  1NE8 A;  3L4G B;  3P8V A;  5GAN h;  4GY5 A;  1WLE A;  2ALY B;  1B34 A;  5GMK l;  4PLL A;  4C0Z A;  4MDX A;  2OTL A;  4P73 A;  5ELO A;  1HTT A;  1BIA A;  2ZPH B;  5D6Y A;  3MEU A;  1YIJ T;  3HFO A;  2M9U A;  3PNW C;  2DD5 A;  3R6O A;  2RM4 A;  3PFS A;  1VQM T;  3GP8 A;  4TVY A;  4MMK A;  1EVL A;  1M1K U;  4EMK B;  1VIE A;  3H6Z A;  4H2Y A;  1KOG A;  3M57 A;  3GIB A;  4PJO B;  4M7D A;  4EMG A;  2HNI A;  3QYG B;  1KD1 C;  3J80 E;  4C5E A;  4VUB A;  5CQX A;  2I4O A;  4H02 A;  3M4Q A;  4J6X A;  4H2T A;  4XTW A;  3RUX A;  3HHT B;  2RJE A;  3WQZ A;  2DTI A;  3INZ A;  3S6W A;  3X25 B;  4FIB A;  4YRJ A;  3ZFJ A;  3JB9 J;  1Q86 U;  4O2D A;  2XD0 A;  3PIO A;  4BI8 B;  3OYN A;  1QP2 A;  3ER0 A;  2R5M A;  1I5L A;  3SFM A;  4C0G A;  5D6X A;  2X4W A;  4LD6 A;  1D3B A;  2LNV A;  2RJF A;  2RI2 A;  2X35 A;  1YHQ A;  2DKG A;  4C8Q D;  2KY9 A;  4YRG A;  4X9D A;  5LJ3 d;  2VGM A;  2O01 E;  2X4Y A;  3M4Y A;  4PKC C;  3EFR A;  2PUK B;  5LJ3 h;  3X26 B;  5C52 B;  4E7J A;  4OB2 B;  1KMN A;  5AYF A;  3DB3 A;  4BY6 B;  3PT9 A;  1R8O B;  4MZM A;  1ADY A;  1VQ6 A;  3CXC S;  3LC0 A;  2RK1 A;  2CJ9 A;  2EKO A;  4X9C A;  4CS2 A;  2Y4X A;  3HSB A;  2K4Y A;  1VQ5 A;  3UH0 A;  1SSF A;  3AHU A;  1FYF A;  5FU6 C;  2JUF A;  3NET A;  3BY7 A;  2P0K A;  3OBW A;  4EMH A;  5GAN 6;  3REX A;  4M7A G;  5FRN A;  3CCV A;  1X56 A;  3HFZ A;  4RMO A;  3S3M A;  4M7A F;  3OMC A;  4LNS A;  3PIP A;  2K5I A;  2A7Y A;  3N5B B;  2H3J A;  5CKD A;  4YRS A;  4M78 B;  3J7A F;  2RHZ A;  2XDD A;  4YCU A;  2JOY A;  1WQ7 A;  4BDZ A;  1B76 A;  3HXY A;  3C4S A;  1QVG A;  2GFU A;  3LX7 A;  1UB4 A;  4N0A C;  5CKH A;  2PVD B;  3L42 A;  4H2W A;  4E7K A;  2QQA A;  2JZ2 A;  1BKB A;  3I55 A;  2E12 A;  3V7S A;  3OYI A;  1QVF A;  4JS5 A;  5KCH A;  3IG2 A;  4O6J A;  3L2R A;  3WVD B;  2ODR D;  4C92 E;  5GAO n;  3JB9 I;  2RHY A;  4BUG A;  1BI1 A;  4P73 C;  2NLU A;  3VQV A;  4M75 D;  3MEA A;  2J3M A;  2RK2 A;  2DIG A;  3RL6 A;  4CH6 A;  1M90 C;  1YI2 T;  3ASK A;  4HCZ A;  4M77 D;  3VJP A;  5GAN 3;  1U8R A;  1W4S A;  4KUL A;  3C95 A;  5GAM e;  2DDZ A;  4CS4 A;  3VUB A;  3HFV A;  2F5T X;  3RKY A;  3E9F A;  4XU1 A;  2ARS A;  3P8B B;  4J83 A;  2ZZG A;  2Y4Y A;  2M1H A;  4IUQ A;  4M7D C;  3TEH A;  1N9W A;  3FEO A;  2HAX A;  5FU7 C;  3MEV A;  1YIT T;  1EFW A;  2X4J A;  5GMK m;  5I2M A;  1SES A;  1Q82 C;  2Q5I A;  2OTL T;  4BE2 A;  2E6Z A;  3LH0 A;  3RES A;  4XU3 A;  3A7U A;  5LJ5 g;  4JS4 A;  1Y7X A;  2V8J A;  3X20 B;  4PHC A;  3E9I A;  4MML A;  1AHJ B;  1UGQ B;  3JCM f;  1K73 C;  3A5Z B;  3PCO B;  1Q7Y C;  2YLC A;  1M1G A;  1Y96 B;  2K3X A;  2R5A A;  1P92 A;  3UGQ A;  2IY5 B;  1H64 1;  2ZR3 A;  1V29 B;  2DXT A;  1VQL T;  3E1S A;  5HGQ A;  4E47 A;  4DQ2 A;  3QTC A;  4HT9 A;  2ART A;  1H4Q A;  3QG1 A;  2QQB A;  4YCV A;  5ELN A;  2DK3 A;  2HBP A;  4UPA A;  4FM4 B;  1H4S A;  3RER A;  2CJB A;  4M7A B;  3HRI A;  4C92 A;  3ME9 A;  1M9S A;  4P5N A;  5GAN 4;  5HY6 A;  4C8Q E;  3JCM c;  5GAN 5;  2QTX A;  3W3S A;  2I2L A;  3FIF A;  2C06 A;  4KQE A;  1DJ7 B;  2EJ9 A;  4TVW A;  1B8A A;  3M56 A;  1KD1 U;  2RB6 A;  1B70 A;  4HT4 A;  2ZNI A;  3OYL A;  1SET A;  3LYI A;  4A4F A;  3CBM A;  2QHT A;  2MMP A;  5IAY A;  2EAY A;  3MP8 A;  4ME7 A;  5K1X A;  2ZCE A;  3EFS A;  4FSX A;  2ZCF B;  4LVI A;  4YRK A;  2EWN A;  2HD0 A;  4RG8 A;  1JJC B;  3QZ5 B;  2WSC E;  3QO7 A;  1YCY A;  4LD9 K;  3SWN A;  2VXF A;  3CXC A;  1J5W A;  4CI0 C;  2QXF A;  1B7Y A;  1WGS A;  2DAQ A;  4BB7 A;  1QVP A;  2DO3 A;  4J8O A;  2DU5 A;  4C0D B;  1VQ5 T;  3VQX A;  2PVG B;  1Y71 A;  4A54 A;  3FB9 A;  1NJ5 A;  4NL3 A;  3DKM A;  5CVI A;  3L2Z A;  2E6N A;  3CCQ T;  4JLI A;  1NNH A;  3JCM b;  1KQS S;  2O4X A;  4UP7 A;  2ZIN A;  1BBU A;  1IRE B;  1UGS B;  3CCL T;  3F70 A;  3NEN A;  4NL2 A;  1VQK T;  5GAN g;  1X55 A;  1VQ8 T;  1NPP A;  4PJO D;  1RIQ A;  3QJ6 A;  1LYL A;  1YB3 A;  2VV5 A;  2ZNJ A;  4DPG A;  3MHX A;  3TU4 K;  3HRS A;  1EIF A;  3HPW A;  3DSQ A;  4A4E A;  4N4H A;  2WAC A;  1I81 A;  3P8T A;  2KVQ G;  1VQZ A;  2WSE E;  4TVA A;  2M16 A;  4RQF A;  3I56 T;  5LJ5 j;  3VQY A;  3L2W A;  2RHQ A;  1RL2 A;  3RKX A;  5A0D A;  4C8Q A;  2Q7G A;  3BJU A;  2ZT5 A;  3M9Q A;  2QI2 A;  5GAM f;  1YIT A;  3JCM d;  1IL2 A;  3CBO A;  3CC4 T;  4F7U A;  3TEE A;  5C6S A;  4M7A E;  3BDL A;  5CKE A;  4TVR A;  4L5G A;  5HK0 A;  1WNL A;  2J3L A;  2GFA A;  4IUT A;  1SRY A;  3LGL A;  4C0F A;  2OTJ T;  2PU9 B;  4IKF A;  2M0O A;  1YFT A;  2LQK A;  3HXX A;  4Z02 A;  4QQ6 A;  4Q15 A;  1X75 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...