2DU2A

Crystal structure analysis of the l-lactate oxidase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
374
structure length
374
Chain Sequence
b'MNNNDIEYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactate oxidase
publication title The crystal structure of L-lactate oxidase from Aerococcus viridans at 2.1A resolution reveals the mechanism of strict substrate recognition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 131
structure length 374
sequence length 374
chains with identical sequence B, C, D
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2du2A00
2RDUA 2HTMA 4PC8A 4UC5A 1KFKA 3P7YA 3EX3A 1V7YA 2XFWA 2Y62A 4MIMA 2BXVA 1T0OA 2Z1BA 2AQWA 2QJGA 2V5BA 3SJ3A 5FI8A 3MYPA 1TTJA 4LS0A 1SPQA 4YCOA 5CZ0A 1EWDA 4RV8A 3TNOA 1YADA 2QAPA 3G0SA 3QW3A 1FWTA 3N9RA 3ATZA 1DL3A 3NVTA 1NEYA 3P80A 4JYDA 4LRTA 3UWYA 1FQ0A 4MJZA 4DELA 1DQWA 2RDTA 5H2ZA 3QRHA 4GE8A 5AHIA 3UPWA 2QJIA 5DN1A 3NPUA 1GQNA 1AK5A 1ALDA 3BPWA 4BF9A 5D05A 3GXPA 1LRTA 3TXVA 2RDWA 3WJWA 5G2HA 4RZ6A 3W2UA 4ML9A 1P4CA 1SSDA 4H4IA 4HSOA 5DXYA 4E38A 2P10A 3KVJA 2V2HA 1XUZA 1SO5A 3NQ7A 3MP3A 1VRDA 1YDOA 2C6QA 3FJLA 4WY0F 3BVJA 1M6JA 3GXTA 2EKCA 2JKPA 4ZQRA 3VKJA 4MVAA 3W85A 2ALDA 1MO0A 1TV7A 3TQVA 5D2VA 3SR7A 4DBEA 1TREA 2GOUA 4Z0SA 3IGXA 5K9CA 3BW2A 4Z0JA 3RK8A 1YXCA 4X9SA 3W1QA 2ZQ0A 4ZZ9A 1QWGA 1PCKA 2CU0A 1GWJA 2GQ9A 1OF8A 4MYAA 5D33A 3OBKA 2J24A 1GVRA 4NZFA 2XN2A 3PBVA 4LRSA 2Z6JA 3HMJG 5TIMA 3W1NA 1W31A 3T7VA 3TC7A 3ANYA 1I45A 1G4EA 1SSGA 5IM51 3MWAA 3RF9A 3TJXA 1I4NA 3P67A 3P62A 2FPYA 4O12A 1J4EA 2C0AA 3SW6A 1Q6QA 2GJLA 1PL9A 3TX9A 1ZAHA 4KWWA 3BW3A 3BG3A 2YYTA 3NL2A 4DO5A 4N02A 4O17A 1LRQA 1QCWA 2X1RA 4NJIA 4FNUA 1W3NA 3NG3A 2Q3OA 1O95A 4NJGA 5CZSA 4MZYA 3W7IA 1W37A 1F6KA 3PUOA 5F1UA 3NA8A 2V5LA 1DBTA 1I2NA 5D02A 1NSJA 5G4WA 4UXDA 3M0ZA 5D38A 4JDYA 4M6PA 1H5YA 5K4XA 1YYAA 5AC7A 2NXIA 4IMFA 1ICSA 2B7OA 3GAKA 3FKKA 3PBUA 2B7NA 3FYPA 1QPOA 3N3MA 4WQ6A 2OT0A 1S5WA 4CQ8A 5F2GA 1WOAA 2JKAA 3DBPA 3GNNA 3O15A 4A29A 5BNKA 3O6DA 3QC3A 4JTGA 1H51A 4WXYA 3CU2A 3GVGA 4IXXA 3WK2A 3LBMA 3ABRA 1RZMA 2Y89A 5KZDA 4N4PA 4DEFA 1O5KA 2Y70A 4AVFA 5I3FA 3C2OA 1TV5A 1ZNNA 3DHFA 3EKLA 3CEPA 1YDNA 4ZMGA 3PBWA 3U8GA 4WXZA 2QDGA 3WJZA 2QUVA 4QIUA 4AH7A 5HWJA 5K9DA 4LV9A 1WA3A 3MBDA 1ME9A 1TJPA 1SZGA 4PL2A 4EF9A 1DKWA 3CM4A 5I3HA 2FB2A 3F4WA 1F5ZA 1TCDA 4S2BA 4D2JA 2X1SA 4JTKA 4UTTA 3M44A 4AXKA 4BWLC 3W73A 4Y90A 4B5NA 3LLFA 4FX6M 4K7YA 3QJAA 1ICPA 5LHEA 3FFSA 3W7CA 1D3HA 3OVRA 5K3VA 5TQLA 4LWWA 2TYSA 1KBJA 4OV4A 2CZ5A 2CLEA 2V2CA 5DCBA 1H7PA 1Y0EA 3C2VA 1R2RA 1JJKA 1FBAA 3NDOA 3W84A 1ZAIA 2J9ZA 3EWBX 3W1TA 4WX2A 3QZEA 1UCWA 1F6PA 4UFKA 5LNVA 1FWNA 1A53A 4NXKA 2QCHA 1JULA 1X7FA 2DP3A 1ADOA 3W1MA 5EBUA 3O8AA 2CLOA 4NXSA 5E1QA 1DQXA 3W2KA 3G24A 4RXFA 3L5LA 1F7BA 2H6RA 4TIMA 5AHEA 5DCDA 4ZQMA 3MMTA 3SECA 2QCCA 3UD6A 4K8HA 3M1ZA 3IV3A 3C56A 3BLIA 1SZFA 2VOMA 2YW4A 3HG5A 1N55A 2WJZA 4TU1A 1O5XA 5EY5A 2CWNA 2VENA 3LHZA 1XKYA 5I3KA 1S5VA 4JGDA 4MLRA 1UBSA 1LM1A 3C2RA 5LZLA 3E96A 1OX5A 4GXMA 2NUWA 3GZ3A 4ZL1A 1SFLA 1FWWA 1QPQA 1UUMA 2A5HA 4UFHA 4JY8A 8TIMA 1XM3A 3TE9A 5CG7A 1O60A 1KLYA 1KFLA 4GC4A 3ZWTA 2TMDA 3A5FA 4FIQA 3TIMA 4YCPA 3M9YA 3A9IA 3R5EA 3MJYA 3VI2A 4XQ6A 3OEXA 4O19A 2OJPA 2JK2A 4OGZA 4JX6A 3LX9A 2LLEA 1K8XA 3SZ8A 5BRBA 4U28A 2YXGA 3JR2A 5F2IA 5C55A 3LV6A 1W54A 3S9YA 2C16A 3WJSA 4HKPA 2FPVA 3IGSA 4OHQA 1X1OA 2Y63A 4IXHA 3P74A 2QCEA 3LM7A 3W7OA 1JCJA 4LU0A 3C61A 4N9EA 3TXZA 1IIGA 2NX3A 1AMKA 1LCOA 4J9JA 5DBUA 2YYUA 2ZZ3A 4IPJA 3O63A 4BFAA 4HT3A 2QJHA 2PE4A 1KW1A 1PHQA 3YPIA 2FB3A 2QR6A 2WOQA 4PH6A 3S5YA 5AFDA 3NXFA 1Q3NA 2X30A 4RCXA 3DH7A 4X22A 4MPQA 3LI0A 1FUYA 5E93A 1TTIA 3MP5A 3PY2A 1FCBA 2EHHA 1Z41A 3LHVA 3B05A 3CC1A 2VFHA 2W0UA 1XBXA 3R13A 2PC4A 3P5ZA 3QH2A 3LI1A 4BI7A 1YTDA 1NF0A 1VQTA 5C2XA 5D09A 3IVTA 1CX9A 4X2RA 1JQXA 3A22A 2EAWA 3S5NA 4WY0B 3OVQA 3LHWA 1VGAA 1XXXA 3WK1A 2ZZ7A 4IMEA 1VZWA 3N19B 1KM3A 3W76A 3G1VA 5EKYA 5I3GA 3MP4A 3M41A 3NQVA 3IVSA 4Z08A 3W88A 1QNVA 1FCVA 1M5WA 4HNTA 3L68A 3R8RA 3NO5A 5CPMA 1B57A 1K02A 4NT0A 4FB7A 1FXQA 4NJKA 1TPWA 1KTNA 3I7RA 1Z48A 4JTHA 2ZTJA 2VFFA 1WOBA 3DFSA 2FQIA 1KLZA 3HG4A 4JTSA 4MY8A 4RZ4A 1KV8A 4CNPA 5K9XA 1JVNA 4ZQCA 3SGZA 3KVKA 1OFQA 4LC6A 1YTEA 4NNAA 1MXSA 4ZVJA 5HNRA 5FEWA 3W83A 3RU6A 2J27A 3QEZA 3UWQA 1ME7A 5HR7A 3LV5A 1QR7A 3HQ1A 5EL1A 4MY1A 3M5XA 2D73A 1KM5A 3HPXA 3DFNA 4GFSA 5DLCA 3GIYA 3QQ0A 3RNDA 4CNNA 2DORA 4WY0A 5HWMA 1SO6A 3LB0A 4PFMA 2X16A 4JYFA 2DZXA 2H8ZA 3IRDA 2YR1A 3G3DA 4IMCA 4O10A 4XTDA 3HGOA 2YZRA 4O0ZA 4NX0A 4O16A 1QAPA 5LNUA 2GVGA 4EF8A 3M43A 4XTIA 1TV8A 3MO7A 5TBOA 3IIOA 3WFAA 1QMLA 3I7SA 1XC4A 1OYAA 3RLUA 2P1FA 4ADUA 4GUIA 1AW2A 2B7PA 3SIZA 5G1YA 1K3UA 2Z2UA 3LXBA 5I3JA 3ABSA 4LVFA 4NU7A 4QITA 5EYWA 1IXOA 4AEOA 2V81A 4P2VA 1EEPA 1UJPA 2J9XA 4N9BA 1IIHA 2TSYA 5KZEA 3W7KA 1DVJA 1T96A 4WOQA 3WJXA 4HSNA 2RHGA 1RQBA 4UR7A 4A2SA 3KXQA 5KZMA 2A1YA 4M19A 3W75A 2A6NA 1VLWA 3BLEA 1RVGA 3TCEA 1CI1A 3TAKA 1VR6A 3TQ0A 3PUEA 5G4EA 2A7RA 2VFIA 1FDJA 1W8SA 1LP6A 2Y7EA 3HB9A 1P0KA 4QSHA 1G6CA 1XCFA 3FS2A 1DOSA 3N14A 2Z6IA 1EB3A 3DI0A 4XBKA 3ZS4A 1QO2A 2NXGA 1G7UA 2GUUA 1FDYA 4DBDA 1MEWA 3T78A 5EMUA 3W2JA 2W6RA 2PCQA 4CLMA 2A21A 5DXXA 3KVLA 1VYSX 4LVBA 5D2YA 3LRLA 1XBVA 3PULA 1FCUA 2Y61A 5F4WA 3TK7A 5SWUA 2Y7DA 3TSBA 3HOJA 3W1RA 2Q8LA 2VKZG 4RR4A 4MOZA 4UMBA 5BMXA 3IIXA 3LDVA 3T40A 3TU9A 5IBXC 3FIGA 4JYEA 1JCMP 3W86A 4QNWA 2YGYA 1FWRA 2DZSA 2DJLA 1GT8A 3GB6A 5BOOA 1T99A 4JN6A 2QCLA 1JCXA 5CSRA 2GQ8A 4MY9A 1TPB1 1TQXA 1YLVA 4RJEA 3C2FA 2ZRZA 3EX4A 1BWLA 3G0XA 3W7GA 5LNRA 1W0MA 3R2GA 4JR5A 3FKRA 3KHJA 4O4VA 1AL7A 4X3ZA 5C5YA 1NAL1 2ZA2A 4DF0A 3G1SA 2V0TA 1G7VA 4GUFA 3UXAA 4O14A 1P5BA 4MZ1A 1W56A 1WDWA 3MI3A 3UZJA 2QAFA 2ZZ6A 1LYXA 1EUNA 5K7JA 4UFIA 3MW7A 3C52A 3TMQA 2V2DA 4R34A 1F73A 5G1TA 5FEPA 2O7QA 1EX5A 4GNJA 1GZGA 3HGSA 3PSVA 2BTMA 2ZA1A 7TIMA 1TMHA 2A7NA 4S2CA 2GVLA 1TRDA 1I2RA 4M6VA 2CZFA 5F2MA 2I9EA 1WYIA 5EA9A 3T44A 2ZZ4A 3NQ6A 2NX9A 3GLCA 5D2WA 1ZAJA 2VFDA 4LVDA 2V30A 1JCYA 3QSRA 4O8RA 3NPWA 1ML1A 1ZY9A 4BWLA 3TKFA 5FF0A 2ISWA 3N2MA 3P61A 4FNQA 3IIVA 3LXAA 3CWNA 4R7JA 2DZUA 2QCNA 4DF1A 4BR1A 1H60A 5KINA 1KM4A 4GWEA 1AL8A 4XBSA 3OIXA 5BMWA 3THQA 3PSWA 4O4WA 1EPXA 3H55A 1CW2A 5F4XA 3UZ5A 4HN4A 2YSWA 4AF0B 4QISA 4Y8FA 3M5VA 5ABTA 3G1HA 3EWUA 2WNNA 3GDLA 4N2YA 1XBZA 4MFDA 3TH6A 1G67A 3UY8A 3QW4B 3TW6A 4AAJA 2E68A 1KM1A 5AYYA 2WNZA 3W22A 3DXIA 1OX6A 3LCLA 4FXRA 1L6YA 5FF4A 3MBFA 3FA5A 5HULA 5D37A 1GVFA 1P1XA 1X1ZA 4IQLA 3NQFA 4Y96A 3UPBA 5F2LA 1D9EA 1KFBA 1OYCA 3Q94A 2A0NA 4QM1A 3S5OA 1F05A 3CWOX 4KFOA 3A21A 4Q33A 2HS6A 3NEVA 1P0NA 1OK6A 3G0UA 3KRZA 3IGUA 3QPZA 4N9CA 2H8XA 1W1ZA 2R91A 4Z1CA 3GDTA 5H91A 2ZFAA 3PS7A 3SGUA 4UTKA 1OVDA 4NVTA 3O06A 2E6YA 1VYPX 4O1CA 4AF0A 1EP2A 3QFEA 3W3OA 4DPQA 1L6WA 1PCWA 1J5TA 1SUXA 4UFJA 1KM6A 1AG1O 2FDSA 3EXSA 4JY9A 4L4LA 3P8JA 4O18A 4IWWA 3W74A 1A5BA 1LLWA 3O16A 2OT1A 4UTHA 5HJLA 4DF2A 4OBTA 2ZRVA 1OFAA 3B0PA 1R2TA 3E12A 3STGA 4TR9A 3DZ1A 1MEIA 2EPHA 3TFXA 4EOUA 5K4ZA 2CLMA 4M5PA 1HTIA 4AWSA 2Q8ZA 1X6UA 2PRLA 1H62A 2KZHA 1OYBA 4S1FA 3CQ0A 4FO4A 1TPC1 4LW7A 1W5PA 3E0IA 3TC6A 1XDMA 2C1HA 2YFNA 4JTTA 5DY3A 2RFGA 3W1LA 4JX5A 1H7WA 1GTEA 2F7FA 3VFLA 3KX6A 4FNPA 2WSYA 3W7MA 5LHFA 2WSRA 4HIBA 3L21A 4UIOA 1H1ZA 1NF7A 3TSMA 5AHFA 3LTSA 1KTCA 3B03A 1SW0A 2AAMA 3F1QA 1LROA 3CPRA 2CLKA 4IPIA 2YCEA 3STFA 2VFEA 3NL3A 3M7WA 3KFTA 3F03K 2A85A 3HG3A 1N7KA 2X1UA 1VHCA 4UTTC 2BWGA 2FLIA 1KM2A 1LOSA 5KSWA 1S5TA 3QSTA 4YL2A 3VNDA 2WQPA 1TQJA 2HSAA 2ZBTA 4JXCA 1JCLA 3CT7A 1THFD 2BSLA 4POCA 1LOLA 5FEZA 2NV2A 4HNNA 3G3MA 4ONVA 6ALDA 4W9TA 3NYZA 3LLDA 4E0CA 2QDHA 3W7LA 1TTPA 1FXPA 3QYQA 4RX0A 2A7PA 3MHGA 5D2TA 4MFEA 3HGJA 3AO0A 1RD5A 2VXNA 1KBIA 5AN7A 4PEKA 2DZWA 2ZRXA 5DCEA 1LTDA 1TPEA 3S1WA 3PVFA 1W5MA 2BX7A 1FX6A 5AHMA 3F4NA 4XUGA 3S6DA 2ISSA 4UR8A 3O1NA 4UFMA 4R33A 1UB3A 3TUUA 1RPXA 2ZRYA 3SSJA 4A2RA 3L66A 4JTIA 1C29A 4ORMA 1WBJA 4FNTA 3W71A 3JS3A 2A6LA 4PTNA 3ABQA 4LVAA 1LORA 3NZRA 1EA0A 1JUBA 3Q37A 3UWVA 2A4AA 3MUXA 3TA6A 4IX2A 1TPUA 3W1PA 3W2MA 4FIRA 3IIPA 4UFLA 4AWTA 1VLIA 4H3DA 2G96A 1ONRA 3T4CA 4RLIA 3NQGA 1G69A 1QDSA 4LNYA 4MYXA 3QMRA 2Y7GA 4NJHA 4OV9A 5G2WA 1VCFA 4DO4A 4WJEA 4BI6A 5U7SA 3KVMA 3N34A 3G8RA 4HNVA 1IXNA 4K36A 2NWRA 1OFBA 1VCGA 3BGJA 1VPXA 1SW7A 1QFEA 3N2XA 2PURA 4HPXA 2R8WA 4GJ1A 3W72A 1M7PA 1J2WA 1F76A 3SFKA 1WXJA 2V82A 3EWZA 3DKLA 4JS3A 4N9DA 3U6WA 4ICNA 1RV8A 3QF0A 2X2GA 3W23A 3EXTA 4XZ9A 4JTLA 3LTYA 2WPBA 1V5XA 3INPA 4HPJA 1LRNA 4FNSA 4U4MA 3THAA 3G18A 4IOTA 3HPZA 4H6KA 5LKYA 4UMCA 1ICQA 1E51A 4IUOA 5C54A 4OU1A 4RZ5A 2J6XA 4I7VA 2I14A 4E2DA 4G1KA 4GRSA 3EXRA 5LGXA 4CNOA 4UTUA 4N6EA 2DZPA 2FIQA 3NM1A 1X8FA 1H1YA 2PRHA 2VC6A 3NPXA 3B0VC 1G4TA 3EEGA 1PVNA 3HIJA 2E1DA 1XDLA 2XN0A 1R2SA 2EGZA 1YXYA 4YMZA 1GPWA 3S1XA 4HNUA 3S0CA 2CLFA 4IX0A 3W07A 4BI5A 4UCGA 4K37A 2B0MA 2R14A 1K03A 2O7SA 1KFJA 2NUXA 4L4MA 4NNBA 4O52A 3VE7A 5DELA 3C6CA 2DU2A 1U5JA 1OFEA 4PL1A 3W7RA 1JCNA 1ZENA 3DAQA 1OG0A 4RK8A 1WV2A 4KFPA 2YW3A 3BO9A 2TRSA 1AW1A 1XI3A 2C19A 3MHUA 3CB8A 1JRCA 1VS1A 2B7QA 2GVJA 1A50A 1MEHA 2AGKA 3P81A 2QCFA 3SY5A 4EVZA 3G1AA 2PRMA 1GTHA 3FJ6A 5T26A 3OA3A 2QUTA 1Q6RA 1PV8A 4GUJA 1VCVA 3HO8A 1K8YA 3LRKA 4LTSA 1G4SA 4M6QA 1K8ZA 5AYXA 2BZNA 5KTLA 5L6UA 2E5BA 4MJMA 1ME8A 1H7XA 1TJRA 2GQAA 3L0KA 4IMGA 2QCGA 1GVQA 1FY6A 2ABAA 3N73A 1H7NA 2E5CA 2GJNA 1SR9A 3GX9A 2E09A 4Y6GA 4Q4KA 2DJXA 3BK0A 4GUGA 4FXSA 3HGRA 1JUEA 3C4UA 1OABA 1O4UA 2V8ZA 3Q58A 1B4EA 1I2QA 4RKAA 4LVGA 4BK9A 3BLFA 1XL9A 4I7WA 2UV8G 2C14A 3A23A 1ZFJA 3QMTA 3S5ZA 4UTLA 4WZHA 4O54A 1VYRA 1JQVA 1M7OA 1RR2A 4WD0A 2C15A 3L65A 3NGJA 4KFNA 3W7JA 3H53A 4O1DA 3DFOA 1EIXA 1QPNA 4RXGA 3IEBA 3UY7A 2ZTKA 2RKXA 5I3IA 1OHLA 4UTWC 3STEA 4CQAA 1H63A 5AB3A 4LS1A 1GYNA 5LNSA 4FX7A 4JDBA 1OF6A 3Q2DA 5G2IA 2ZDRA 3U2OA 3GYEA 4FEZA 4UNLA 4K8EA 3W9ZA 3W7QA 1VJIA 1KFCA 2Y85A 3LGEA 5AC6A 3CEUA 3PWAA 3WJYA 1PHWA 4O15A 3HF3A 3GXNA 3LCXA 3GDRA 3L67A 3RLVA 2G97A 4MKNA 3GKFA 1YDVA 2C18A 3CLMA 3WK0A 3RFAA 4QNEA 1FWSA 3OG3A 3FYOA 3LTPA 2I1OA 2BLEA 3PUDA 5J5RA 4EWND 3C8FA 3MI6A 2E5DA 3PR2A 4O13A 3STCA 1TRIA 1EP1A 2QCDB 2VEKA 5CZJA 4IGHA 3I65A 3LERA 2R94A 4AHQA 4K39A 4HHPA 4IJBA 3TW7A 1F74A 1GG0A 2ZRUA 4M7TA 2WSQA 4LS2A 3P60A 1W5QA 3GR8A 5C6MA 1ZJIA 5AYZA 3SI9A 5J5DA 3C2EA 3P84A 1H50A 3KRSA 1Q45A 1TPFA 4LY8A 3A5VA 2F84A 3NQDA 3GKAA 2WNQA 3DI1A 4NNCA 2JGQA 2ZA3A 1BTMA 3EWYA 5FF3A 4I9AA 4WUIA 3W87A 1PS9A 3MHFA 5A5WA 3PB2A 3BGGA 4FF7A 4JD4A 1A5AA 2NX1A 3O05A 1SO3A 2VEIA 1LBLA 3B0UX 3RMJA 4JICA 4ZQPA 3MYOA 4IMDA 3NPVA 3W7DA 1Q6OA 4NX5A 1HFBA 3TROA 5GVJA 2ZZ1A 3NNTA 1U83A 3BV4A 1JR1A 1WAUA 2QCDA 3G1YA 3BG5A 2H3DA 3C3NA 4DPPA 3C0JA 2H3BA 4N4QA 4UMAA 3EKZA 3IVUA 1K7XA 5CSSA 5D03A 3S1UA 4C1LA 3GNDA 1DV7A 3EWXA 2ISVA 4MUZA 5F1VA 3TR2A 3CIXA 3MI2A 4I7UA 1JRBA 1Q6LA 3LCFA 3UWWA 1OFDA 3M5YA 3TJLA 2Z0IA 5E0KA 3QMSA 4OE7A 2JBMA 3IIZA 2QF7A 3UNDA 1EP3A 2OZ0A 3DKJA 1B4KA 5KMYA 4CCCA 4NJJA 4ADTA 2C13A 1BWKA 3D0CA 2JGYA 3W1XA 2ATSA 1PIIA 3T55A 4FNRA 3NQEA 1GG1A 3ABOA 1YTKA 5D04C 4CCDA 3W2LA 4PODA 5LSMA 3PF3A 5U4NA 1WX0A 3LCWA 3LOTA 3WK3A 3M16A 1A5SA 1IF2A 3HPSA 3EX1A 3DU0A 1YPFA 1S3HA 1D3GA 5HUOA 3W70A 2QEZA 3B4UA 2WO5A 1OFRA 1OJXA 4O1AA 3S8HA 3M47A 1NFBA 5EPDA 1LOQA 5HWNA 4LUJA 2P0OA 3GDMA 5D32A 1HO4A 2VEPA 1KA9F 1KM0A 4JNMA 2B4GA 3NM3A 4KKXA 1R47A 2FFCA 3UQNA 1TPH1 4TMBA 1B3OA 4O53A 2ZCGA 3E49A 4LV4A 4UUIA 1L6SA 1T8XA 2YX0A 3TMLA 4DO6A 3KRUA 5DBTA 3L2IA 2H90A 4Z1AA 3PBYA 4K6AA 3EX6A 2NV1A 1SU5A 5L9FA 1XUUA 2HMCA 3CHVA 3ZR4A 3PB0A 3FEMA 5K2ZA 5FF7A 3W7PA 1OK4A 4NZJA 1UASA 4AB4A 3CIWA 1KFEA 3NQAA 1PE1A 3L9CA 4ZQOA 1QOPA 3G1FA 3TV8A 4LC8A 4LUIA 3TAOA 2NXHA 1C8VA 1ZALA 1UUOA 3B04A 3NQ8A 4QQ3A 1VHNA 2FTPA 3R12A 4YWIA 3DFQA 2RH9A 1QPRA 4AHPA 3M5ZA 5FESA 1SW3A 1YPIA 1GJPA 1TTQA 2W79A 5LGZA 5AHLA 4UTMA 3QQ1A 4YLWA 2Y88A 1LZOA 3QPYA 4A22A 3NQ2A 3CTLA 4N6FA 1SZEA 4P61A 4XWUA 3G1DA 2GPTA 1I8JA 1QOQA 2E6FA 3BARA 4JTUA 2CW6A 3W7HA 2ZYFA 3LCGA 3OHIA 2G5WA 4O11A 4CQ9A 1R30A 4TX9A 1LBFA 2ZZ5A 1GVSA 4O1BA 2C3ZA 3A24A 1TPDA 2V9DA 1ZCOA 6TIMA 3S42A 3DFPA 1LDCA 2NWSA 4YXGA 3V75A 3W7NA 2Y6ZA 2CLLA 2QUUA 4OT7A 3GAYA 4JX4A 1R46A 3K30A 2OX1A 2G95A 2QCMA 3O6YX 3B06A 3W1AA 2WV8A 4M7SA 3UXDA 4GUHA 3I68A 4K38A 1GEQA 3W7EA 1HO1A 2A2IA 1QO5A 1TPVA 1B9BA 3TQKA 5MHBA 3GR7A 1RQEA 1EWEA 5AC8A 1W5OA 3TFCA 1A5CA 3DFTA 2J88A 1YXDA 2VFGA 1SFJA 2OMAA 1H61A 1ZHAA 3DENA 3EB2A 1FDZA 3OVPA 1GVOA 5HR6A 4UNKA 3NQMA 4DQWA 5F4SA 5CPLA 4R53A 4A21A 3L5MA 4ADSA 1RQHA 4JEQA 2NUYA 3LHUA 3USBA 4EIVA 3FLUA 1AW5A 1TIMA 2CFFA 5HUPA 5G5IA 2OCZA 1L2UA 3N9SA 4O57A 3LCIA 2ATMA 5BW6A 3NOEA 1MZHA 4O0KA 3UYCA 1BEUA 1H7OA 4KWVA 4NQ1A 4PA8A 4MLJA 2CZDA 3UWUA 3G8EA 1XFBA 5D2XA 1TB3A 4JTEA 4QAIA 4AWUA 4A3UA 1C9DA 4NUWA 2E6DA 3DHDA 4OQVA 3GK0A 2E77A 4ORIA 1DORA 4Z1BA 4C1KA 1JUKA 1Z42A 4UTJA 4UTIA 3JRKA 4JTJA 4QJ1A 2JKEA 5CKSA 2ZZ2A 5HMSA 3R89A 2Y7FA 2YDAA 4Z1DA 1MSSA 1I2OA 3GDKA 3VCRA 1TSIA 3W6YA 3NR0A 4ALDA 4AHOA 1W5NA 3NL6A 3NL5A 1IXQA 2EF9A 3BG9A 3ZWSA 2IQTA 5CGQA 2NLIA 1IXPA 3P5YA 1KTBA 3TSDA 4O28A 1OX4B 1Z44A 3E02A 4XKYB 1HL2A 3AJXA 2CZEA 2YFOA 3H54A 4TO8A 4LT9A 3ZFHA 1DJNA 3ELFA 3PG9A 3TDFA 2FJKA 5AHNA 2HS8A 4ZQNA 3L5AA 3P8IA 3LHYA 1DHPA 3G1XA 1VC4A 4Y9AA 1HG3A 1W3TA 2X1TA 3LHTA 2VEMA 1OFOA 4WOZA 2DZVA 3PC0A 3O07A 3KOFA 3L0GA 3BW4A 3NZ1A 1N8FA 3W1UA 2VELA 3LCHA 3LBCA 5DY2A 2CLIA 4JTFA 4AMAA 3VE9A 1IGSA 3UWZA 4JIQA 2ZRWA 1GOXA 3I7QA 4MZ8A 3NAVA 1WQ5A 4FX8A 3HBLA 3M6YA 3EX2A 5HINA 5CZTA 1XBYA 3G22A 4O50A 3I6RA 5HQEA 1NVMA 1G4PA 1OX4A 3LRMA 3DGRA 3FOKA 4XKYA 4UTWA 5FEXA 3KAOA 5LNWA 1VH7A 5KITA 1DJQA 3LXCA 3NQCA 1BKSA 3HG2A 5A8GA 1HUVA 2CLHA 4PCFA 1O94A 1OFPA 5D30A 4E2BA 3EWWA 4JIPA 1K7EA 3PG8A 1F2JA 5IBXA 3PM6A 1K7FA 1W3IA 4DXVA 3B8DA 5AOUA 3L0NA 1TO3A 3P82A 1I2PA 5CPNA 3W2NA 2XN1A 4TMCA 4GBUA 4Q32A 3QM3A 4LOCA 2TPSA 3V1PA 2Q3RA 1SO4A 1L9WA 2ABBA 1H7RA 2J9YA 3ATYA 3PAJA 1SQ7A 3S1VA 1LLZA 3O6CA 4K7VA 1GYLA 2WKJA 2YPIA 1LBMA 4CCEA 5CPOA 2FPTA 1WBHA 4OWGA 1FCQA 1KV5A 1SZNA 5FF2A 1EUAA 3E9AA 2QKFA 1TYGA 3HJZA 2E6AA 2NZLA 2DZTA 4FHAA
chains in the Genus database with same CATH superfamily
1XC6A 2HTMA 1KFKA 3EX3A 4HTBA 2Y62A 3DFYA 4U5KA 2O9PA 3L4ZA 3FY1A 1HKVA 3TN4A 2V5BA 2H9AB 4LS0A 3U7VA 4C6BA 5CZ0A 1G1YA 2BS9A 1DJYA 4RV8A 2QAPA 3N9RA 4LRTA 4M1BA 4GCAA 2FFIA 3ABZA 3P3BA 3I10A 5CH9A 1XD0A 2TAAA 2UY5A 5JQ9A 4C6LA 2PDNA 1P48A 3NQ7A 2UY3A 4WCJA 3BVJA 4GKLA 1M6JA 2F2HA 4IIFA 1X8CA 4MVAA 3VOHA 1TV7A 4OFCA 3SR7A 3IGXA 1HVXA 1RLDA 1KRMA 4L61A 1XX1A 4KS0A 3RK8A 1MQQA 5I09A 3QTGA 5TNVA 2QS8A 4X9SA 1PEZA 1GVRA 1M7XA 3AHTA 4JHMA 4C6NA 2Z6JA 4V28A 2CERA 3CK5A 2ZE3A 4DRSA 3ANYA 4Q4RA 3SB0A 3W27A 4EXAA 2X2YA 2O9RA 1J0HA 3PHAA 4F0MA 3VKCA 3KCLA 4AZBA 1JZ2A 4H9ZA 3TJXA 1X97A 1RH9A 2YCJA 4RZBA 3BCFA 1TZ9A 2GJLA 4DWDA 4IM4A 1QASA 3BW3A 2CBJA 3BG3A 4MF4A 3H6OA 3O7UA 3BAIA 1E6XM 2VI0A 4C6OA 3NG3A 5F7UA 4LX4A 4QLKA 1W37A 2G3JA 3AC0A 1QW8A 3A13A 4R88A 4GH1A 1DBTA 5HAOA 3RITA 4NY2A 5D02A 5G4WA 3BMWA 2CKSA 1XIIA 2FTYA 5D38A 1G9HA 2HPIA 3EB4A 3PPFA 4K2SA 1QPOA 3RJYA 2ANUA 3W00A 1ADSA 1WOAA 4KCUA 3O15A 3OA5A 5ABHA 5BNKA 4B90A 1K6WA 2DIEA 1EC7A 4WXYA 4Q8TA 4ERIA 3GVGA 3A47A 3ABRA 3URBA 3EWDA 3AAMA 1WKYA 4IUGA 4DEFA 4ZO7A 3TZFA 4BZYA 4KEZA 1YPXA 2Y70A 1WZAA 5E6ZA 3CEPA 1YDNA 4ZMGA 3WJZA 3RUBL 5HWJA 5K9DA 4O8AA 1BYCA 1WA3A 3MBDA 4E2VA 1V51A 1AH0A 3QHOA 4PL2A 3GG8A 4EF9A 5CG0A 3CM4A 1BXCA 4JIEA 1F5ZA 1TCDA 4S2BA 4CVWA 1WO2A 3FSUA 1HGWA 1OCBA 4AXKA 4IFKB 3BSMA 1VPQA 3UZYA 3TTQA 3H4XA 4D6DA 5I07A 5LHEA 3EOSA 5GJMA 3W4RA 2QDEA 5K3VA 5TQLA 3AROA 4LWWA 3SN1A 4ZXOA 2CLEA 2V2CA 1OC7A 3UGRA 1PB0A 4DBSA 1Y0EA 2XHYA 1R2RA 3W84A 3W28A 2I5GA 3CMFA 3QZEA 3OZOA 3TP4A 1FWNA 1KRBC 1E3ZA 4Q8NA 1FVPA 4ZSUA 2QCHA 5FSEC 2DP3A 1ADOA 1OG6A 2CZVA 4XIAA 4DJDC 2CLOA 5E1QA 4X63A 3L5LA 5KETA 3OOQA 2H6RA 2GJXB 3H26A 3O9NA 4KERA 1Q7QA 1IT0A 3QY6A 3MU7A 4PMUA 3MMTA 4Q8QA 2YA0A 4GZEA 3L2LA 1HL8A 1P7TB 1W8GA 4HNOA 4DJDD 3PJUA 4CCZA 3H7UA 5CCZA 4ZOEA 2GVYA 1IQ8A 1XIJA 4CN4A 2WJZA 1VBGA 2XH2A 1E4LA 1KXVA 3CMGA 1NDZA 2VENA 3KL0A 2XGBA 3LHZA 4V15A 3WSUA 2XIOA 4BKNA 2NT0A 3ANVA 3GTXA 2QLYA 3UW6A 1UBSA 2G3FA 1TV3A 2NQLA 3GZ3A 2DDXA 1UUMA 3NDZA 4IL0A 2A5HA 2B31A 2P88A 1NWUA 1VFTA 5CG7A 1FH8A 2FZNA 5H8MA 1KFLA 3CV6A 3A5FA 4FIQA 4QCEA 4YCPA 4ML4A 3A9IA 3MMWA 4YIWA 1BGGA 3WD4A 2OJPA 5EB8A 2JK2A 4OGZA 5ABGA 1V3KA 5I78A 3DFHA 3AJ7A 2YXGA 5C55A 3BURA 1OGBA 1FOBA 3EOLA 1TUXA 5CJ5A 3SJNA 5C9ZA 8RUCA 1CB2A 1RXOB 5M5DA 1GHSA 4NP7A 4CNUA 1B3YA 2J78A 1R87A 1QHZA 1TZ7A 3W7OA 1BSLA 1UIPA 1P0DA 2W4XA 4PSPA 4J9JA 5DBUA 3KTSA 3AUOA 4LF2A 4BFAA 1E6RA 4WDXA 3GIQA 5M17A 1P0BA 1R6WA 2XSAA 1Y65A 4PBGA 4RCXA 1P6CA 4X22A 3LI0A 1M9HA 1C8XA 4H41A 1ISYA 2W0UA 2BHYA 1XBXA 3R13A 2AOSA 3KOXA 2D0HA 5D09A 1PAMA 4J27A 4B15A 4P5UA 4IQDA 1KB3A 1KBKA 4J2MA 1JQXA 3EZ4A 4Q4OA 3OVQA 4QS6A 4D72A 5M1TA 1XRVA 1UD5A 3N19B 1KM3A 3W76A 3TTSA 4I6VA 1S2CA 4S3BA 3EOEA 4MMWA 3M41A 4Z08A 3C2YA 1M5WA 1JF6A 2OODA 3R8RA 4D8AA 2ZUTA 3HV8A 3UEQA 1DWIM 3WQDA 4JTHA 3AS1A 2FKPA 1KV8A 5K9XA 3KVKA 1EKOA 3OLDA 3BAWA 4NNAA 3UVAA 3SAZA 2WB5A 3W83A 2J27A 3UJFA 2VCCA 1RBLA 5HR7A 2E9MA 5C9WA 4H9TA 2CXGA 4MY1A 2D73A 1KM5A 1W1TA 2XU2A 3GRIA 4GH3A 3VABA 4UB9A 3ZR6A 2J66A 3GIYA 5A6MA 3QQ0A 2BY1A 4WY0A 3UA3A 5HWMA 1SJAA 2H8ZA 1QHPA 3IRDA 3G3DA 4O10A 1UWRA 1C9WA 1UZ4A 2XDFA 3ITTA 3UA4A 4XD6A 2Y5SA 3FGCB 4XZMX 2WZHA 3QGVA 3N4FA 3CAKA 4QROA 3BQ5A 2GWNA 1XC4A 4MHBA 1OYAA 2GSEA 2P1FA 4WVXA 1I9CB 3VNYA 2E3ZA 5G1YA 5A6BD 1Q66A 4X9YA 1ISXA 3ABSA 3W53A 4NU7A 5EYWA 3WNKA 4W5ZA 1EOKA 2J9XA 4F0KA 3NDYA 2TSYA 4IPPA 1GZJA 1EDQA 4H9YA 2V3DA 5T91A 5LA0A 1RQBA 1XCWA 4XV0A 4XO7A 4ZE5A 3VOJA 3M0IA 5KZMA 2A1YA 2OEKA 4M19A 1AZ1A 3ZLHA 3PUEA 1JPKA 1W8SA 3ZLFA 2Y7EA 3V5FA 4RDZA 2Z24A 3HB9A 3KP1A 3FS2A 3N14A 2V38A 3ZS4A 3QZAA 3U2EA 1HJWA 3VD9A 1G7UA 4RE3A 2GUUA 4GHRA 4GFIA 3T78A 4OJYA 1V6YA 1UWAA 2PCQA 3V4BA 3AIRA 1L6FA 4DZIA 5DXXA 2A79A 3RM4A 1R85A 1W3KA 1FCUA 5F4WA 3HJEA 3CUJA 4JFVA 2WKGA 5SWUA 3MKCA 5CLTA 3HOJA 4PYSA 1JEZA 4MOZA 3IIXA 3T40A 3MB9A 1JCMP 1AJZA 4PMXA 4YU1A 1BYAA 3GB6A 5BOOA 4NSBA 4KIRA 3K8KA 4TQTA 1EBHA 5CSRA 5E5CA 1J8VA 2XINA 4DB7A 3N12A 2O9OA 2ZRZA 5E0CA 3W7GA 4BHYA 4GINA 5E09A 2ZA2A 3GM8A 2AMGA 4DF0A 2V0TA 4UQAA 4GUFA 1P5BA 2I5IA 1ZBWA 1WDWA 3MI3A 2WANA 3K4DA 4C6QA 4LCRA 3MW7A 3C52A 1PX4A 1XYBA 2PDWA 3CV2A 5FEPA 4GNJA 3HGSA 1E55A 2BTMA 2IPJA 7TIMA 4S2CA 4B2DD 3PK7A 1ONWA 2OLHA 4M6VA 4JEJA 5F2MA 1WYIA 3JW7A 3T44A 2ZZ4A 3NQ6A 1JF5A 5D2WA 1ZAJA 2O55A 4IIGA 3QSRA 1ML1A 1RBOB 3D6NA 5FJIA 1XISA 4JBRA 3TKFA 2ISWA 1TVLA 1XS2A 2FDMA 5CPQA 3OG2A 2VDHA 4L9ZA 3PNZA 4R7JA 3BXWA 3GNXA 3DIPA 5A6LA 3C0QA 3OIXA 1V0MA 5BMWA 3THQA 3PSWA 4D6GA 3H55A 5F4XA 1PSCA 3AWNA 4HN4A 3W26A 2VD9A 3T0TA 4Y8FA 3MT1A 2PGWA 1W6TA 3DG7A 3GDLA 5TD4A 3WUFA 3C0LA 1Y8BA 4GYFA 1YBQA 2PGEA 3UY8A 3TW6A 2E68A 1J01A 1OWQA 2IS7A 3CXOA 3F4DA 2FHBA 4M81A 5FF4A 4PRRA 5D37A 1GVFA 1P1XA 1HJSA 3PTDA 4D6CA 3ZJKA 1F3XA 3SCVA 5CAHA 4IFOA 1LQAA 2A0NA 1BVWA 4GZJA 5IOBA 3CWOX 3TTYA 2C0HA 3A21A 1XLEA 2OZ3A 1OK6A 3B8SA 3G0UA 3KRZA 3WLKX 3ZYZA 1W1ZA 2R91A 4H1ZA 1CGVA 3FDKA 3SGUA 1ZQ5A 5CQ1A 2E6YA 3UG4A 4AF0A 3CT2A 2GUBA 2V5JA 3RO8A 4NILA 1J5TA 7ODCA 2VX6A 4D6HA 3H23A 2FDSA 4JY9A 1ZJHA 3P8JA 4L1XA 4AY1A 1LLWA 5HJLA 2DIJA 3B0PA 2NQ9A 4QGCA 5DX7A 3E12A 3RM8A 3ITCA 3DZ1A 5K4ZA 4W86A 1OYBA 3BE7A 4S1FA 2A3AA 2X09A 1KD0A 1RA5A 4JTTA 5A8OA 2AL2A 2RFGA 3BGAA 5HANA 1P1MA 1XW8A 1H7WA 4GG9A 3ARYA 2F7FA 3KX6A 3W7MA 5LHFA 2WJFA 2WSRA 2WHJA 3N6JA 2PWUA 1A49A 4XZHA 4UIOA 3TJ4A 1H1ZA 4F9DA 5LIUX 5AHFA 4WR3A 3LTSA 4NIRA 3B03A 1SW0A 4XZBA 4Q7IA 3F1QA 1LROA 1UKPA 5IFPA 2VFEA 2VR4A 2HEJA 2V5CA 1VFHA 3F03K 3CYVA 3ZXWA 2DSZA 1A3WA 3HG3A 3QY7A 2X1UA 3GU9A 2RJGA 5HNTA 1LOSA 3VIOA 2WQPA 4HMEA 1XF0A 1TQJA 1XYFA 2P50A 2FZ9A 2ZX8A 1O12A 3CTTA 2BSLA 3RJXA 4LUYA 1RBAA 5FEZA 2XIBA 5HPOA 3NYZA 1TTPA 4MSSA 1R3TA 1LUCA 5D2TA 5FACA 3AO0A 3WG6A 1OB0A 2I57A 3LQGA 4O0QA 3PVFA 3UZXA 3S6DA 2ISSA 3O1NA 2FH8A 2VQUA 4LAMA 2ZX5A 3TUUA 1EPVA 3PZOA 1RPXA 2XM1A 3N04A 1POKA 4DXXA 4A2RA 1WBJA 2GSJA 3WQ6A 3WDHA 1R38A 1LORA 3NZRA 2HWGA 3UWVA 1EGMA 4Q8OA 4CQCA 3OP2A 3W1PA 4AWTA 5T8GA 1XIDA 4LY4A 3T4CA 1G69A 3IK4A 1L8PA 1GEHA 4LFYA 3FEQA 1RP8A 4EP8C 2Y7GA 3IAQA 1CECA 4OV9A 3SCQA 3NSMA 4WJEA 3HQOA 4JNYA 3CQIA 3POCA 2D1ZA 1A3XA 1RK5A 4YYCA 2NWRA 3BGJA 1UH2A 1VPXA 4UQCA 1UZDA 3T2PA 1M7PA 4BY3A 2WC4A 1LQ0A 3EWZA 1HXJA 3U6WA 3QOMA 4KEUA 2YBVA 1B2YA 1XWYA 3W23A 5BZAA 4B16A 4XZ9A 4JTLA 4AX6A 2WPBA 2WMHA 1I0BA 3FDGA 3SUWA 3MSGA 1M7JA 3OZYA 1DPMA 2FH6A 4UMCA 3VMPA 4OU1A 1R3WA 4E2DA 4G1KA 4GRSA 4N6EA 5GJPA 3S2MA 3CS2A 1H1YA 4MNMA 3V0SA 1PVNA 3TWAA 1P43A 1MW0A 4AC1X 1XDLA 1YXYA 2REQA 4RW3A 4H6QA 1JDDA 1KFJA 1UR4A 1QUMA 4NNBA 3M0YA 2QV5A 4DNMA 4XZNX 3C6CA 4PE8A 1A4MA 3SCUA 3VDBA 3W7RA 1JCNA 1ZENA 4HU3A 4EANA 5I03A 1WV2A 4KFPA 4YPJA 2YW3A 1AW1A 1O1ZA 4AFYA 5CJMA 4ICCX 1A50A 2AGKA 2WMIB 3VIKA 3G1AA 3FNDA 4G1NA 1FWHC 4KETA 1UR2A 3AFBA 5FJJA 3FAWA 4LH8A 4GK8A 3HO8A 1K8YA 2NSOA 1G4SA 1HNYA 2OG9A 4QFUA 1TWZA 2BZNA 4DZ5A 2XZ7A 5L6UA 1Q7MA 4GLEA 4W8AA 2L5HA 1BYDA 4MJMA 1UIOA 3ARVA 5HXMA 3KLLA 2PLJA 3QY8A 4LALA 4KPLA 2QUMA 4HPGA 4IMGA 2QCGA 1TVNA 4R5EA 1WKFA 1UR1A 1W9VA 2WZEA 1SR9A 2C7FA 4J1OA 3BK0A 5CC7A 4D6FA 1O4UA 1J6OA 4LVGA 3VZZA 2UV8G 4FXJA 4EKJA 2C14A 3WUEA 1SVDA 3S5ZA 1TV4A 4O54A 2OWWA 1RR2A 4JCMA 1E4NA 4GYPC 3L65A 4KFNA 1HL9A 3AYSA 4NI8A 1KQZA 1WZLA 1TMLA 2WWDA 1LWIA 1HX0A 3UY7A 2RKXA 3ANUA 3O3RA 1OHLA 3CQKA 4UTWC 5I3IA 4XB3A 3GVQA 1KXTA 1ZS2A 4LS1A 1GYNA 5G2IA 2ZDRA 3U2OA 4LSBA 4FEZA 3WQ4A 4K8EA 3W7QA 1KFCA 3H8AA 3PWAA 1PHWA 3GU1A 3CZLA 4J40A 4ZA0A 3QGAC 3GKFA 3CLMA 3S9IA 2PUZA 3VUPA 1YE6A 3FYOA 1BRLB 1ELSA 4ZENA 4DUVA 3WCZA 2OSYA 1UG6A 1IR1A 4PMNA 2E5DA 4EPEC 1S2WA 2G4JA 4JL1A 2Y8KA 3MUAA 1DE6A 1XHGA 1EP1A 2QCDB 3WLMA 3QR1A 4B5VA 2YBUA 1XCXA 1BWVA 4GGBA 1BYBA 5FD0A 3DGBA 4HHPA 4CU7A 1EJTC 2WVVA 2NQHA 4M7TA 4MTVA 3GR8A 1ZJIA 1Q7ZA 2BHZA 1VEOA 2EPKX 3C2EA 1AQFA 1Q45A 1Q4WA 1DWGM 1XGEA 4BQ2A 3LSBA 2DY3A 4ES4A 2WBKA 3AHXA 1JXJA 3AIQA 2OLSA 3PB2A 3B0XA 4JD4A 3D46A 4NZ3A 1OD8A 1U1JA 1RJPA 2CHNA 1YQ2A 1Z9AA 3QR0A 3WMBA 4M82A 2WM0A 1GQJA 4ZGYA 3NNTA 1U83A 3BV4A 1CCWB 3DYMA 1MXDA 4BQ3A 3FVDA 4MJ4A 2H3DA 3H24A 3C0JA 4C6CA 3BAJA 1W1A1 4N4QA 3UXLA 3EKZA 3V18A 3VDHA 4ZB5A 2ZUNA 3WQ5A 4OIFA 4ROQA 3GNDA 4C1LA 3ONBA 5F1VA 3TR2A 3THUA 3QV8A 3WELA 1JZ4A 2EQDA 4I7UA 4CVUA 4JTRA 3LCFA 3V1HA 3K1DA 1E6NA 1ZP3A 1YHTA 4QLLA 4Q4QA 2JBMA 3U5UA 1R3RA 5EFFA 1V0LA 4DAIA 1B4KA 1A80A 2JGYA 3T55A 1W9BM 2WLZA 3ABOA 5E0FA 4OUEA 4A8RA 1US3A 1EJSC 3VGGA 2VO5A 5U4NA 3ZJ8A 3AXIA 2XVLA 4O1FA 1A5SA 1IF2A 2GLKA 3B4YA 1D3GA 5HUOA 3GZAA 2IKJA 4HA3A 1UH3A 5I5RA 4KCTA 2YKKA 4L80A 1NFBA 1LOQA 1JD9A 2ZIDA 5HWNA 4W4QA 2P0OA 2OSWA 2PWGA 1R3SA 1O7AA 1KA9F 4DLFA 1DHKA 1QXLA 3ZO9A 2FZ8A 1XRFA 4GPNA 1XLBA 1XLGA 1EHNA 3TTOA 1NU5A 2YX0A 3TMLA 2XFYA 3PBYA 3EX6A 2IKGA 3UCCA 2NV1A 2PGRA 1B3VA 2EPLX 3CHVA 1BVNP 3FEMA 4W93A 3AI0A 3LU2A 3UR8A 2WC3A 2F6XA 4AYGA 3NQAA 2DVXA 5JIWA 4A05A 2OQYA 1HKMA 2WCGA 4IQJA 4YTQA 4F66A 2VURA 3NQ8A 2CYGA 2FTPA 3NFUA 1RP9A 3TW9A 3M5ZA 1SW3A 1YPIA 7REQA 5AHLA 3LBOA 4YLWA 3QPYA 1LZOA 3NQ2A 3B40A 3AMCA 3QTPA 1WUEA 4G7FA 3H21A 2E6FA 2J4GA 3BARA 1TWIA 4ZO8A 3W7HA 3K8MA 4HMNA 2ZYFA 2VCAA 3OHIA 4GXWA 1W1IE 1LBFA 5HMDA 2XIMA 2WZIA 4IG2B 2CEQA 3WLSA 1ZCOA 6TIMA 2D69A 3TYUA 4V1YA 1J0IA 2PBOA 3VILA 1W9UA 3V75A 2Y6ZA 1R46A 2G95A 2QCMA 3B3DA 4NAEA 5BU6A 4GZ7A 3SRKA 4AD4A 3W1AA 2WV8A 3VPLA 4GUHA 4M51A 3VKAA 4K38A 4IL2A 2A2IA 3F4CA 1FWIC 3GR7A 3TFCA 4P7RA 1A5CA 3DFTA 2QW5A 2VFGA 1SFJA 2G3NA 5JH2A 2GK1B 1H61A 4S3CA 2ACRA 4RE2A 1FDZA 4UOJA 1GVOA 5HR6A 3A4XA 3NQMA 1DTNA 1F8IA 1CT5A 2FMNA 3A4AA 1RQHA 3L12A 5EU9A 2J7HA 3LNPA 5HUPA 1L2UA 4RV3A 1B90A 3MDWA 4K1GA 1EJRC 3NOEA 1XD1A 5BXPA 1LG2A 3JVAA 4KWVA 4IJRA 3G8EA 1AD1A 1GJWA 5D2XA 3W6MA 4A3UA 4LCQA 3GVRA 1C9DA 2VGIA 3DHDA 3LZ5A 4AVOA 1UMYA 2PP1A 3BLOA 2E77A 1NWRA 1DORA 4Z1BA 1Z42A 3CHDA 1J6PA 1UZHA 2JKEA 2ZZ2A 5FJUA 2XH4A 1ECQA 4WSKA 3AISA 1DWHM 2YZ5A 1XG3A 1W5NA 4AD1A 3EWCA 4GYKA 2DSWA 3BG9A 5CGQA 3REQB 3AIWA 2UBPC 1KTBA 4X0VA 2ZC1A 3BL3A 3E02A 3APTA 4JKLA 1HL2A 3H54A 2J8FA 2VC5A 4TVDA 1DJNA 3ZFHA 4B91A 3ELFA 3M0LA 1QU4A 4I8DA 5ENLA 5EMMA 4Y9OA 3OJGA 1DHPA 1ZJAA 4Y9AA 1AZ2A 4OVXA 1IEXA 2VEMA 1J5SA 2RGMA 5E6YA 4HOWA 3LNMA 4PRTA 2WQDA 2DW7A 2CXEA 3LBCA 3VE9A 3H2OA 4G9PA 1GOXA 1NWTA 4R9OA 3V5CA 3NAVA 4C1NB 1REQA 3ITOA 4FX8A 3UBPC 1NDVA 2D2GA 4YHEA 3A12A 1PWLA 4E8GA 3GH5A 2RJHA 4CD4A 2XIJA 4XKYA 1GOOA 4LAKA 1DJQA 1UQZA 1WDPA 3LXCA 4NZCA 4TX8A 1HUVA 3ZT6A 1O94A 4YVVA 4DJEC 3EWWA 1UMLA 1LT7A 3V5OA 2VX5A 3PM6A 2BOFX 7ENLA 1C90A 3A3HA 3BOXA 1W3IA 1EXBA 3B8DA 5AOUA 4AEEA 1I2PA 4Z2IA 2XN1A 2JQXA 5ECVA 4OBSA 2TPSA 4Z17A 3LMZA 2Q3RA 2J9YA 3AALA 4BS0A 5LXEA 2VP8A 3PAJA 1SQ7A 2VJXA 3O6CA 1GYLA 3GTNA 2WKJA 3ZR5A 3P0WA 1LBMA 4C5YA 4OWGA 1A5KC 5A6TC 1KV5A 5FF2A 1QW9A 4QAWA 3E9AA 1QVBA 3HJZA 4AW7A 3EDJA 1BG4A 3WLJA 1QJWA 1UBPC 4MIMA 2BXVA 1KCLA 5CJNA 3PZTA 4GA8A 1H3GA 4MGGA 2POZA 3NQBA 4HNCA 1SPQA 2GDUA 3RRXA 2HE5A 2UZ9A 3CBWA 2FZDA 3TNOA 4DI8A 3G0SA 5LA1A 3QW3A 3EMQA 1GVYA 3P80A 4JYDA 1WUFA 1JYNA 1FQ0A 1A5UA 1DQWA 2RDTA 3QFWA 1Z69A 2A3HA 3UPWA 1GQNA 3BPWA 4BF9A 5D05A 3GXPA 1LRTA 4PMYA 2PTWA 3GG7A 1P4CA 3AHYA 3CQJA 5DXYA 3AHVA 2P10A 4NRRA 1SO5A 3FJLA 4WY0F 4Q8MA 3V0TA 3GC5A 1JYXA 4U5IA 2QZRA 3GXTA 2EKCA 4XVDA 2VZOA 5A1AA 4AQLA 3W85A 1MO0A 4IZGA 4L7ZA 3G2GA 3E2VA 4Z0SA 3ZZ1A 5K9CA 1L6GA 4GVFA 4JIIX 1YXCA 4J3UA 4W88A 3W1QA 1HW6A 4ZZ9A 3T42A 1QWGA 3BQ6A 2PDFA 1TCMA 5D33A 3OBKA 2WBGA 2D23A 1S2AA 4E8CA 5AKQA 1SMAA 3P14A 3HMJG 4IISA 1W31A 3T7VA 1T6MA 3GFZA 4K68A 3AUJA 1OCNA 2CNCA 3P62A 2FPYA 4KGJA 5XINA 3N25A 3WD0A 1Q6QA 1E56A 1CNVA 1PL9A 3DYOA 4WDWA 1U22A 3NL2A 3CIVA 2I7GA 4DO5A 3B9EA 2YOCA 4A35A 3GSMA 2IW0A 4V2XA 1YMYA 5G4HC 4FNUA 1W3NA 3EAUA 2Q3OA 4NJGA 1F3WA 4MZYA 1FKXA 4W7WA 2Q6ZA 2V5LA 1UD2A 3N29A 1YNYA 2MANA 1PKNA 5K4XA 1YYAA 5AC7A 1ICSA 3GAKA 1HF6A 2B7NA 3FYPA 4WQ6A 4ZODA 2JKAA 3GNNA 1PZ1A 4A29A 1UKOA 3R7MA 4MM1A 3SUTA 4IXXA 3WK2A 2G4FA 4IIHA 2PU1A 4I9TA 4C7FA 4N4PA 3TZNA 4C6IA 2Z7KA 4AVFA 5I3FA 4IPNB 4GJIA 4C91A 3PBWA 3U8GA 4DJFA 4WXZA 2QUVA 4AH7A 2V5DA 3SCWA 2JEQA 1PIGA 5DRCA 1SZGA 1H1NA 1DKWA 3VOCA 4PCTA 5EFDA 3F4WA 4MPKA 4D2JA 2X1SA 1L8NA 5D9PA 4JTKA 3M44A 3W73A 1PDZA 3ZLGA 3MDUA 4B5NA 4FX6M 3RG6A 3K4WA 5CLWA 4NF7A 1AQMA 3QJAA 4HMDA 4ACZB 4ZFCA 3AZTA 2JALA 3W7CA 3N1AA 3U7BA 2VCBA 3I3BA 2FZBA 3NXLA 2ODOA 1KBJA 2YB4A 1H7PA 4L65A 3CUXA 3SSZA 1FBAA 5DFAA 1ZAIA 3MY9A 1FWEC 1QTWA 3B9DA 1UCWA 3LPGA 5LNVA 3E1F1 2J7BA 5GJNA 2DSUA 4BA0A 4UOZA 2E0PA 3W2KA 1DQXA 4XBJA 3CL6A 2KX9A 4LUTA 2VMFA 1M01A 3GXFA 4JIHA 2QPSA 2R6OA 5HATA 3UD6A 4K8HA 5A2BA 1YNPA 2VUNA 3IV3A 2DT2A 1VBJA 1SZFA 1UR0A 3NOYA 2VOMA 3AICA 1VRXA 3O0KA 3HQNA 1UR8A 3UR7A 1JYVA 1MI3A 5EY5A 4W7UA 4MNLA 1XKYA 3XIMA 1S5VA 3WD1A 1XRSA 5LZLA 4ZL1A 1SFLA 1IZJA 3KRBA 1VBHA 5J8LA 4JY8A 1US2A 1XM3A 3VZYA 4GD0A 4H7ZA 3K13A 5DMNA 4GC4A 2WSPA 3VI2A 4PMDA 2YDRA 3OEXA 1KCZA 3WLOA 1BFNA 1I0DA 3L7RA 1Q8AA 2OZ8A 3SZ8A 4HA0A 4U28A 3RGTA 3OLIA 3S9YA 9XIMA 1XPYA 2FPVA 3WL0A 3IGSA 1OADA 4UCFA 2WJEA 1V03A 3SY1A 2Y63A 4IXHA 4ZB0A 3OLGA 5C70A 2QCEA 3RR1A 3C61A 5I6SA 2PP0A 3QZ6A 4P8WA 3VOIA 1LCOA 3I3DA 5KZ6A 3O63A 4HT3A 3RAOA 3YPIA 2QR6A 3S5YA 5AFDA 3NXFA 2GQ3A 1Q3NA 2YIHA 1IR2A 4GABA 3EA3A 5E93A 4BF7A 3GY1A 2HE8A 3MP5A 3H22A 4TUFA 2NQ5A 4JTQA 1F6YA 4DO7A 2BG5A 1NF0A 1GPFA 1VQTA 4L6HA 5C2XA 3GNOA 4C60A 3GVVA 1CX9A 1EZWA 2EAWA 6REQA 4WY0B 3LHWA 5CSYA 2QUNA 1J79A 2ZZ7A 2VYOA 4E4PA 3RDKA 3NCOA 4Y8EA 3G1VA 5EKYA 4L9XA 3ALFA 3R0DA 1NH6A 3WH9A 1T7LA 2O4QA 4CN1A 3W25A 2W92A 5CPMA 5M03A 1B57A 3ONCA 3RCYA 2A3CA 4HB7A 4RZ4A 1JVNA 1V3JA 3NJ3A 1M1BA 1GKRA 2XH7A 1DJGA 3ENLA 5HNRA 3FV9A 3QEZA 2WJDA 3UWQA 3N18A 4C6DA 4S39A 4B92A 1QR7A 2DUZA 3H2NA 3KOWA 3HPXA 5DLCA 2PDHA 1BKHA 1XJBA 3RNDA 4CNNA 3VM7A 4S3KA 2VNCA 4E4UA 3GR4A 3PBGA 1CGTA 3KS6A 2EG6A 3HGOA 3MKVA 4O0ZA 4O16A 1CLVA 4PCNA 6XIAA 5LNUA 2GVGA 3VM5A 1W91A 4XTIA 1F4AA 5TBOA 2Q71A 2X42A 4XSLA 3I7SA 2RGLA 5KEZA 3NSXA 2J77A 1KXQA 1A5NC 3RR4A 1IEVA 4GUIA 4I3GA 1K4HA 1VEMA 4DWSA 1K3UA 2Z2UA 4YTSA 1R8LA 1OD0A 1CLXA 3S3GA 4LVFA 4AEOA 4QITA 3VOFA 1PKYA 1A0CA 2V81A 1EDTA 1EEPA 5JH1A 3V7PA 5LXXA 4MJ2A 4PFHA 1W1PA 4QE5A 3WF4A 1DYSA 1CXHA 5CGTA 4WOQA 2OYKA 3WJXA 2UY4A 3TEVA 3VCNA 4AWEA 2I56A 4A2SA 3ZVHA 3IJ6A 4Y9MA 3CHFA 4F0LA 1AH4A 2F61A 4CD7A 2DQXA 1MDRA 2PZNA 3U4FA 2QIIA 2G0WA 5C7VA 1AVAA 4AZCA 1CI1A 3TAKA 1VR6A 4AD0A 5LIYX 2A7RA 3CZGA 5I02A 4IP7A 4Q8PA 4DI9A 4J3TA 1P0KA 4LUSA 2DT1A 3QHMA 5EMKA 2IKHA 1FDYA 3Q65A 2JE8A 3SQSA 2Z1SA 3PZIA 1MW2A 1JNEA 4E8DA 3BAXA 4RDWA 3B9OA 4QJ4B 1XBVA 3PULA 3SRDA 1SJDA 3TK7A 1EEXA 1J0ZA 4Y9NA 4UMBA 3W37A 5IBXC 3FIGA 4JYEA 2YGYA 1UWQA 2DZSA 4Q6JA 5BXSA 2DJLA 4J2PA 3EGJA 1OGGA 3IJ9A 3HN3A 1PKLA 4MY9A 1TPB1 3N2BA 5I3DA 1CTNA 1IYXA 5LNRA 4OUIA 2V3GA 3WH7A 2H9AA 1OIFA 5A6KA 5C5YA 1NAL1 4GVIA 1UHVA 2VZTA 1G7VA 3UXAA 3IJLA 4MZ1A 3N4EA 3MUIA 4DYEA 3OGRA 2DZAA 4HTYA 3AMKA 4ENLA 5T9CE 4ASTA 2V2DA 2R1MA 4R34A 1F73A 5G1TA 4HBKA 2O7QA 1GZGA 3TLLA 3PSVA 3DUGA 5A69A 2A7NA 5RUBA 1YBQB 4ZO6A 4FP1A 4GIRA 1JDFA 3LD5A 5EA9A 4WDUA 2W9MA 1ZLPA 2VFDA 4MB3A 1MW1A 2V30A 3KS5A 3IUDA 4BWLA 4FLQA 2E25A 1EC8A 1RAKA 1JD7A 3N2MA 4FNQA 3N17A 3SIMA 3KL3A 1J12A 3IIVA 3WDQA 1C7SA 2QF8A 2WVUA 2VOTA 4P7LA 1QK2A 3LPPA 1H60A 3RN6A 4Q6XA 4LPCA 1XIGA 1MW3A 4I5RA 5BOEA 1CW2A 4F48A 3VNIA 4AF0B 1HKWA 4F79A 4KF1A 1RUSA 4ZB2A 1TJ0A 2WHKA 1F9CA 3WF1A 3WNNA 3G1HA 1PXGA 3CPGA 3WLRA 4AZHA 3KBJA 1G67A 4V1XA 1KM1A 3KUMA 2WNZA 3WKZA 3TCSA 3DXIA 1UQYA 1OX6A 3LCLA 4FXRA 1UP2A 4B9YA 5CBJA 3A3XA 4Y96A 1CXFA 3TTEA 4I8YA 1D9EA 1KFBA 3S2NA 2JEPA 3MCMA 1SJBA 3QOKA 5DMYA 4KFOA 2BODX 1TELA 2QGHA 4Q33A 1UH4A 1EHAA 4JQ2A 2AL2B 1X1NA 4Z1CA 5H91A 2ZFAA 1ZTVA 4TVUA 3AXMA 1JAKA 2JF6A 3N9KA 1VYPX 2F6KA 1JZ6A 2PDIA 4FR6A 4DPQA 1W3LA 4R27A 1EO7A 2GFTA 4OECA 3LG3A 1SUXA 1KM6A 5EMYA 2VTFA 3EXSA 4MKVA 4C6FA 4EWJA 4IWWA 3E74A 4US5A 4UTHA 4XG1A 5BROA 1OFAA 3CO8A 4PUWA 4OZOA 1QNSA 6A3HA 2OO0A 2P3EA 2NT1A 4KMQA 3TFXA 2CLMA 4M5PA 3C8NA 4TV5A 1X6UA 3CQ0A 1FWCC 4L1WA 3WH8A 4LW7A 1W5PA 4AIOA 3HM7A 1XDMA 1UOKA 2YFNA 1NY1A 5DY3A 1IWBA 3W1LA 1VBUA 4PUMA 1LUCB 4RL3A 3EA1A 1E5NA 1OC5A 4K1WA 1JL8A 4KQNA 1RVKA 3V16A 2NQJA 2Y8UA 4HYRA 3AMLA 2QJNA 2CLKA 4IPIA 2YCEA 5C71A 2G3IA 3NL3A 3KFTA 5DO8A 4EXBA 3KBMA 1LL4A 4YHGA 3LYEA 1R7AA 1VHCA 4UTTC 5GPRA 4CU8A 1VPYA 4QLJA 5IDIA 3OGSA 3C86A 4F8XA 1EIBA 4AIBA 2YDSA 4YTRA 2ZBTA 1V02E 4JXCA 3R94A 4LYQA 5HPCA 1THFD 4JN7A 4POCA 1LOLA 2GJXA 2Z2BA 3JUGA 1OEPA 3JU2A 4IIBA 1GOWA 1XLCA 3W29A 3MSYA 3WQOA 1V8EA 3WLNA 2QDHA 1P7TA 1V0NA 4XZLX 3KL5A 4CU6A 3MHGA 3JZUA 2VXNA 4CGTA 2BV9A 2ZRXA 3IJ7A 3DX5A 1LTDA 1TPEA 3R25A 1W5MA 1DIDA 5C2CA 1XH0A 3F4NA 3TYBA 3KZSA 3CYJA 1UB3A 3R6IA 1F3TA 4PUNA 4HSHA 1BHGA 1ZPTA 3SSJA 3CQHA 3ECQA 3L66A 4JTIA 4ORMA 1S3TC 3H2EA 3JS3A 1H41A 3ABQA 4LVAA 2A4AA 3TA6A 3IIPA 1VLIA 3ARWA 4RLIA 3GFXA 4DAFA 4AYSA 4FLSA 4LNYA 2BB0A 1DE5A 4NJHA 2Z1WA 5U7SA 1P6WA 1EBGA 4HNVA 4K36A 7XIMA 3QYSA 2REQB 1IZCA 3N2XA 1IWAA 3OTRA 3TN5A 4J28A 4HZ6A 4HPXA 2R8WA 4UQEA 2ZUMA 3CV7A 4RE4A 2WCAA 1EFZA 1J2WA 2J6VA 3SFKA 2PDGA 2V82A 1E1CA 4GY7A 1RV8A 3IS4A 3QF0A 3EXTA 4JPGA 2RUSA 1V5XA 2P8BA 2PWVA 4FNSA 4U4MA 4LQ1A 3THAA 8CGTA 3U9IA 5LKYA 4YJ5A 3VGEA 1E51A 2IQ0A 2J6XA 4I7VA 2I14A 1BQGA 2AQVA 1BQCA 3EXRA 4U3CA 1GYMA 3F4VA 5BRPA 4A8NA 2FIQA 3NM1A 2PRHA 2QHAA 4DZHA 3TYCA 5HQMA 3PNUA 3UG8A 4B3ZA 5C9RA 3AWOA 3IGHX 4P7QA 2XN0A 3SO7A 1R2SA 1EQCA 2J74A 2WNWA 4YMZA 4HNUA 3V36A 2QXWA 2CLFA 4UCGA 3HZ3A 3ITXA 2NUXA 4L4MA 4O52A 4C90A 5DELA 2DU2A 1OFEA 4PL1A 3MUY1 2CBIA 2PB1A 3BAYA 5D8ZA 1CZ1A 1GHRA 3FJNA 4NAFA 4RK8A 1B30A 3S6OA 2PDKA 2QIWA 2TRSA 4XK2A 1VS1A 2B7QA 4H9UA 3K2GA 3LPFA 3SY5A 1GTHA 2J7GA 8XIAA 3TQPA 1XLMA 3OA3A 4L4PA 1GQLA 1PV8A 1P6BA 4LTSA 2QVNA 3ERPA 4M6QA 5AYXA 2EPMX 5KTLA 2WMJA 4GQRA 5A8PA 4DVOA 4UQBA 1HJXA 4JFWA 2P0IA 1TJRA 5AVNA 1KXHA 3MQTA 1FH9A 2WMGA 1EH9A 1PYMA 1H7NA 2E5CA 2E09A 4GVGA 4Y6GA 3SADA 2DJXA 4XX6A 3FGCA 1JUEA 3WBAA 3GNRA 4DXKA 2HZGA 4BK9A 3NGFA 2YBTA 3U5YA 2PDPA 3A23A 1D8CA 1ZFJA 1NWSA 3LS9A 3C5QA 1JZ7A 3ITLA 1JQVA 2C15A 2WVVB 2BY3A 3B9AA 3W7JA 3H53A 3IWPA 3DFOA 4O1DA 7TAAA 5CBBA 4RXGA 5I06A 5FL0A 2QDDA 5D9NA 2V3EA 2Y0FA 4JDBA 1OF6A 4FOJA 4G7EA 3TYDA 1POJA 4U33A 2Y85A 1JXKA 3CEUA 4NRSA 3WJYA 5AC4A 2OEJA 4MKNA 1YDVA 2C18A 1QBBA 1FWSA 3MUCA 1CBGA 4LBRA 1IEIA 1Q4NX 3C8FA 3PR2A 4O13A 3STCA 5T9BG 5CZJA 3LERA 5CAKA 4AZ6A 1B3WA 4AHQA 2HQAA 1FFQA 4U2YA 4DUWA 4LS2A 1NELA 1W5QA 1MDLA 1UD4A 3SI9A 5J5DA 3H7RA 3P84A 1D7FA 2UY2A 1TPFA 4LY8A 1Q2SA 1QI4A 3A5VA 3NQDA 3GKAA 3THCA 3Q45A 3QLLA 2WNQA 3DI1A 2ZA3A 1E43A 1LF1A 1JDAA 5FF3A 5FSDC 3S47A 2OOGA 4FOUA 1VFUA 5A5WA 4L4OA 4FF7A 3SN4A 3BICA 4AZ7A 2D3NA 2NX1A 3O05A 1SO3A 2VEIA 4M80A 1HZYA 1Q6OA 2FGBA 4NX5A 1TVPA 2XIIA 2ZZ1A 1JR1A 1WAUA 2YDQA 3C3NA 4DPPA 2D22A 4UMAA 4REQA 4A3RA 2EBNA 2Q02A 3F2BA 3S1UA 2ISVA 4MUZA 3CUHA 4JCLA 1GKQA 4L56A 1JRBA 1SMDA 1UWIA 1PDYA 3UWWA 1NDYA 3RRAA 3NSNA 2Z0IA 4S3AA 4OE7A 3VNMA 2QF7A 1CXLA 2OZ0A 3EOUA 4H7VA 3IRSA 3UR5A 4KIEA 4NJJA 3D0CA 3W1XA 3AQUA 2HNHA 1GG1A 3L4VA 1E72M 5LSMA 2E1WA 1UA3A 3PF3A 2OU4A 4FF5A 2XSXA 1XINA 4TTGA 4ZBCA 3ITYA 5I00A 3EX1A 3OODA 1OFRA 4IIEA 3HFTA 2ZX7A 3OYXA 1M03A 2X0SA 5EPDA 4ZTXA 4LUJA 1ZZMA 4DNHA 3TN3A 1C7TA 7REQB 1KM0A 3CH0A 1BF2A 2B4GA 2F6UA 3NM3A 1MWOA 2C1IA 1X6LA 3VNJA 4EACA 3UQNA 4TMBA 2GWGA 3ISIX 4O53A 1ZL1A 2XH0A 3S46A 3VIFA 3TA9A 2ON3A 3A6OA 1U30A 3B8IA 4GI9A 4PTMA 3KRUA 1YKWA 4HK7A 3L2IA 4QR6A 1VIZA 1SU5A 4W8BA 3FXGA 3QC0A 5CGMA 1GOQA 3TOPA 3EPNA 3W7PA 1F61A 2VRQA 3WEMA 1GZ1A 2Q09A 2PLCA 4B4HA 2OVLA 3L9CA 4IF2A 1R9XA 4QE4A 4LUIA 4F0HA 3M0KA 4NAEB 1UUOA 1O66A 1SZRA 3SEPA 4UZSA 4AHPA 1ZRQA 5FESA 5G1MA 5LGZA 4GI4A 4MB1A 4UTMA 3QQ1A 4A22A 2GGJA 4N6FA 4PTXA 2PDLA 6TAAA 3ARQA 3G1DA 4DJFC 4JTUA 3GC4A 3K46A 1R3VA 3B97A 4PULA 3LCGA 4ROPA 2PBGA 3LMYA 1R30A 2ZZ5A 1GVSA 4O1BA 3ZMRA 4PR4A 1TPDA 4DJFD 3UXKA 3GVWA 4Q7BA 3KWXA 4YXGA 4N42A 1E0XA 1EXPA 3W7NA 4JX4A 1G94A 5BYWA 1CB7B 3O6YX 4M7SA 4B5WA 3EDEA 1OIMA 3UZWA 3I68A 2PAJA 3W7EA 2HVMA 1HO1A 2WMFA 3K4AA 2PTXA 2HK1A 1TPVA 2FJUB 4ZOAA 2W5FA 3TQKA 5MHBA 4QCFA 1EWEA 2VL4A 2J88A 3DENA 3WFZA 2PF8A 3DEQA 3LENA 4HP5A 4B5XA 2X05A 4YNGA 2R1NA 4UNKA 1JIBA 3WQFA 3MMUA 3D47A 1GVEA 2NUYA 3USBA 4EIVA 4CQDA 2WK2A 3WBWA 3I6EA 2BOGX 4O57A 1DQUA 1FHDA 1B5TA 3QV9A 4OTKA 5BW6A 1MZHA 4NHVA 3AYRA 1H7OA 4NQ1A 2E8YA 3UWUA 1XFBA 4QAIA 2C79A 4OQVA 4H9VA 2Y1HA 5HNNA 1H09A 3EOOA 4UTIA 5CKSA 5HMSA 3R89A 4KH2A 4JL2A 4Z1DA 1I2OA 4TXEA 1AODA 1TSIA 1REQB 4ALDA 4AHOA 2C91A 2X40A 1OY0A 5HMFA 2NLIA 4A4AA 1S2UA 1IXPA 4A6GA 3W01A 2I16A 4B9ZA 3HV9A 2AQOA 4O28A 4XAZA 4ERAA 1EYEA 1Z44A 3TNBA 4XKYB 3TWBA 3HURA 4HPHA 3OQEA 4LT9A 2KAUC 5IXEA 1T41A 3TDFA 3PG9A 1ECEA 2V5KA 4ZQNA 3LLXA 3P8IA 3LHYA 1K9TA 3G1XA 5GQBA 3LHTA 4LB4A 4PMOA 1OFOA 4WOZA 2DZVA 2W62A 3KOFA 1WB0A 2GVEA 1WXYA 3NZ1A 1R9ZA 4GQGA 1SFTA 5D4YA 3W1UA 2VELA 1QI0A 5DY2A 3AMDA 4XZIA 4AMAA 1U2YA 4O1EA 1XGZA 4GOAA 3WQPA 3ICJA 2OO6A 3N15A 3B8WA 4C6KA 1WQ5A 3TLQA 2OELA 3M6YA 3EX2A 1TWDA 4E6MA 1XBYA 1U5VA 3G22A 5XIMA 2P5NA 3PZQA 3MVIA 1NVMA 1OX4A 1XLLA 3GS6A 3FOKA 1V77A 4NZ5A 5LNWA 3APYA 3WZ0E 4JFUA 4TOQA 3HG2A 1KR0A 4F2BA 5A8GA 4PCFA 1VP5A 1OFPA 5D30A 4HU8A 1XV8A 4ZO9A 5JMUA 3W81A 3H2FA 1XLAA 1K7FA 3TYEA 5H8UA 1I1WA 2OZTA 2CETA 4S3DA 4GNVA 4DHGA 3W2NA 3BJFA 4TMCA 2OFJA 4Q32A 3CUIA 3W6LA 5BU9A 5A6AA 4GY1A 4KRTA 2ABBA 2ISFA 1W17A 3C3UA 3PUGA 1ONXA 1V0KA 1OSEA 4K7VA 4HA4A 3UESA 2Z29A 2AKMA 1O68A 1SM9A 1UPPA 1UP3A 1SZNA 1IV8A 3E0WA 4DM2A 1TYGA 3CGTA 3KCJA 2O0TA 3UJSA 2DZTA 4A3YA 4WRHA 4HGXA 4IHCA 1LG1A 2YJQA 4UC5A 2VC7A 3MV11 1OCJA 1V7YA 5DRIA 3H7VA 3U2ZA 1FA2A 1AA1B 5HDRA 1Q6DA 1D7KA 3SUVA 2FHFA 3SJ3A 3WLTA 3MYPA 1TTJA 4HYVA 2BVTA 4KCWA 4YCOA 1EJ7L 1MMFA 4XUYA 3NVTA 1NEYA 5AVHA 3UR2A 4DELA 2ACQA 5H2ZA 4GE8A 1C93A 2QJIA 2C8NA 4DWSC 2D2HA 3VDCA 1AK5A 1ALDA 3TXVA 2PC8A 2HDJA 1GW9A 3U3HA 4ML9A 2FTWA 3RMEA 4H4IA 3KVJA 1XUZA 4R7WA 8A3HA 4D9PA 3BV7A 2XGZA 3MP3A 1VRDA 1YDOA 2C6QA 4DWSD 3WQEA 2I17A 2D0GA 3N4AA 4WGXA 1TE6A 4ZQRA 1EQPA 3VKJA 1RJQA 2ALDA 3MZ2A 4NZ4A 3KM8A 1TREA 1EX1A 1KBLA 5JIPA 3WNMA 3BW2A 4Z0JA 1ODZA 2J25A 4P8XA 3OW1A 2ZWZA 1JGIA 3DC8A 1GWJA 4MYAA 1TJ2A 2J24A 3UVIA 3I4KA 2XN2A 4LRSA 5TIMA 3W1NA 1X39A 2W67A 4LXFA 1JG9A 1G4EA 3DERA 3SY8A 1NP0A 3MWAA 1Z7AA 4AXNA 3P93A 1EGZA 5FJOA 3SW6A 1HIZA 4KWWA 3M0JA 1IEWA 1FWFC 3VKKA 4F9JA 2VR5A 4O17A 1LRQA 3RX2A 4ATWA 3GXDA 5GNZA 4NJIA 4CNSA 4HCLA 1U1UA 1WDRA 1O95A 4MWAA 1KWKA 2VX4A 3W7IA 1UROA 1F6KA 3PUOA 3NA8A 4AY7A 5B7ZA 3M0ZA 2E9LA 4JDYA 4M6PA 2PODA 2YL8A 2W66A 2NXIA 4IMFA 2B7OA 2VM8A 3N3MA 2OT0A 1S5WA 5F2GA 4MADA 1A0EA 3QV7A 5M3WA 5DT5A 3DBPA 2NV9A 7CGTA 1ZBKA 3O6DA 2IPFA 3QC3A 1H51A 2GGEA 3AYVA 1EJXC 3LBMA 1RZMA 3UETA 4PBEA 3AXKA 4DM1A 1O5KA 2CESA 5CC6A 4KWOA 3OPSA 3C2OA 1TV5A 1ZNNA 3DHFA 4YVXA 3WQVA 4GIEA 2VGGA 4MG4A 1V3IA 4NKCA 1AH3A 3WENA 1MYRA 4PGLA 4XISA 2JF7A 4V27A 4LUTB 2FB2A 3EDDA 1OINA 4BWLC 1K1DA 3LLFA 3F5JA 4K7YA 1T40A 3V3WA 2CKRA 4I6KA 2PTDA 1D3HA 1E0VA 1RJRA 4HA1A 4PB4A 2TYSA 2CZ5A 1YW1A 4DYKA 5DCBA 3C2VA 4QXIA 3NDOA 3VK5A 1U1HA 3LA4A 2BVDA 4WX2A 2XWDA 1F6PA 4UFKA 1GUVA 1A53A 4NXKA 1JULA 2OX4A 3QKZA 2QMJA 4H6RA 3PN8A 5EBUA 3O8AA 4NXSA 1F7BA 3VXGA 3GXMA 1IZKA 3Q4DA 4JQ4A 2C71A 4TIMA 4HHMA 5AHEA 3TYZA 1E70M 3ZQ9A 1KCKA 3BC9A 3SECA 5LA2A 2WWCA 3M1ZA 3C56A 1IE7C 1WKDA 2YW4A 3HG5A 4W5UA 2BGQA 4F4RA 4ZE4A 2CWNA 1KGUA 3GXIA 1M41A 2PU0A 1F07A 5I3KA 1LM1A 3II1A 2EKGA 3E96A 1OX5A 3NEHA 4GXMA 4ZOBA 2J7FA 1QI5A 1FWWA 3UZZA 1VFOA 3CNYA 4S3GA 4UFHA 3KW3A 8TIMA 1VF8A 3G6MA 3TE9A 1O60A 2ZUUA 3ZWTA 1V6TA 2TMDA 3TIMA 3MJYA 2ACUA 4XQ6A 2PCEA 4O19A 1ITCA 3LX9A 4LB3A 1K8XA 5BRBA 3KDNA 2DZBA 3LV6A 3IACA 4PEEA 7PTDA 4R9XA 2D24A 4US5D 3VC5A 4AZGA 2CPUA 4MDOA 1DWFM 4BQ4A 1X1OA 1MNZA 3WNOA 2HCVA 4NI3A 3P74A 4AG0A 2BDQA 4GIAA 3LM7A 1JCJA 2PA6A 3BZGA 4LU0A 1R5YA 3L4WA 1QWKA 4N9EA 3HTWA 3L4UA 5JBDA 3TXZA 2NX3A 1AMKA 4GVHA 2ZZ3A 1TR1A 1E9LA 4L1GA 3CL8A 1DXEA 2FB3A 3USZA 1FWGC 4PH6A 2YB1A 4FLRA 3ZSTA 1JFXA 2ONEA 2X30A 3KHDA 3DH7A 4CKQA 4MPQA 3KEHA 3M07A 1TTIA 3ZOAA 5I79A 3LEPA 3PTQA 3PY2A 3ORWA 1FCBA 3LHVA 3B05A 3CC1A 2AL1A 4JFTA 1O5QA 1KQYA 3WUGA 1V3LA 2PC4A 3P5ZA 3QH2A 4WSJA 1JCTA 1YTDA 2GK1A 3FW6A 1W2VA 1SYTA 3BUVA 3A22A 2QNEA 1E15A 1QRQA 2W91A 3WQWA 4QEHA 3WQCA 2AAAA 1VGAA 2CCRA 3VD5A 4IMEA 3LK6A 1IT8A 2FVMA 1VZWA 5I3GA 2JIEA 3CAQA 3URQA 3MP4A 2Z1KA 1BGAA 3NQVA 3W88A 1QNVA 1FCVA 5JUVA 4HNTA 3L68A 4XAGA 3EDKA 1MUWA 3H4WA 1K02A 4NT0A 3UPMA 2VEGA 1FXQA 3I7RA 1E1EA 2ZTJA 2VFFA 3DFSA 2FQIA 1KLZA 4JTSA 4QDWA 4CNPA 1MQRA 4ZQCA 1G5AA 1LL6A 1WZMA 4HCDA 3AYTA 4PCSA 4DWSB 1I6NA 4Z2HA 3RPDA 2HXTA 1VFFA 1CXIA 4JQAA 3WEZA 3RU6A 3CO4A 1ME7A 4ZFMA 1E4MM 2GUYA 3LV5A 3HQ1A 3AS3A 3VU2A 1NFGA 4FOKA 3M5XA 2WAGA 4YWSA 3GHSA 2JFEX 3AMGA 2DORA 2VD8A 3LB0A 3PZUA 3EDFA 4XSMA 3W24A 3WD2A 4CD8A 2X16A 3O2LA 1WDQA 1E9ZB 2YR1A 1ITQA 1EJVC 4FS9A 2YZRA 3RCNA 4AZCB 4D1IA 3KBNA 4QHRA 3R58A 1QAPA 3IK2A 2ZKMX 2Y5EA 4EF8A 5C0QA 3M43A 3IIOA 1G01A 3G77A 3KE0A 3KBWA 3WFAA 5I23A 4LUSB 2CITA 4L9YA 3RLUA 4GO8A 4U3AA 4B3LA 2B7PA 5LYRA 5I3JA 4AVNA 4JN8A 1YNQA 1UJPA 2W27A 4N9BA 2Z25A 1PX8A 3W7KA 3TONA 4CD5A 3WH5A 1XLHA 1T96A 1QNRA 1ITUA 3VGBA 4HSNA 4AY8A 2WHLA 1V6WA 1OT2A 3KXQA 1FHUA 2J13A 4GNKB 3RXZA 4TX6A 2A6NA 3GD6A 1W3HA 1VLWA 3T0CA 2HVNA 2ESCA 1LP6A 3RX3A 3UJRA 1CGYA 3WN6A 4QSHA 1G6CA 1XCFA 2YA1A 1DOSA 1KO0A 1FP8A 2Z6IA 4GI6A 3ITVA 1WZKA 2AKZA 2QVHA 5I7GA 4PTDA 4DBDA 1F8MA 1MEWA 3IUIA 5EMUA 2W6RA 4CLMA 1UUQA 2Z2AA 2EJ1A 3UG3A 2OOFA 1UA7A 4UNIA 1UJQA 3DCPA 4UQ9A 3N6HA 3LRLA 3MV01 1GW1A 3WBYA 4H8VA 4RE0A 2Y61A 4LAOA 3VGHA 3TSBA 2WZTA 4X2PA 4XAYA 3PWIA 2Q8LA 2VKZG 1UD8A 1ISVA 2PFHA 1Z89A 3MZNA 1X98A 3GO2A 4YTUA 5DQPA 1FWRA 2HISA 4KEVA 4AUBA 2Y5JA 1GT8A 4Z42C 1EJWC 1ONEA 2QCLA 4JN6A 4PB5A 2ADAA 4IPLA 1BLIA 1TQXA 1A4LA 2ZDSA 4RJEA 1Q6FA 2YCIX 4C6MA 3EX4A 3G0XA 1W0MA 3E5PA 3R2GA 4JR5A 1UP0A 3FKRA 1XSIA 3PPHA 3WBXA 4F40A 1J9YA 1AL7A 4X3ZA 3G1SA 2ZZ6A 1EUNA 3CZJA 2J8TA 5K7JA 2XVKA 4A3QA 4YN5A 1V93A 1YIXA 1EX5A 2R82A 3T4WA 4WKFA 1M3UA 4J3XA 5CSUA 1XICA 2GVLA 1TRDA 3BJSA 4D6EA 2I9EA 2QPUA 1HJVA 1YRRA 2R9RA 4QJ3B 2HBVA 3ARZA 3S2CA 4H83A 4LVDA 3SCOA 3GU2A 4O8RA 1HGYA 3NPWA 3BDKA 1ZY9A 5FF0A 3CUGA 3LXAA 2YLLA 2DZUA 2QCNA 4DF1A 4BR1A 2W3ZA 5KINA 4GX8A 3S1GA 1XR2A 4XBSA 1K9FA 4O4WA 3I3EA 1H2JA 3UZ5A 1D2KA 2YSWA 1UC5A 1R9YA 2ZUVA 4Z1YA 1UWSA 3EWUA 2WNNA 4PCPA 4N2YA 5A8NA 1JDCA 4AAJA 3QW4B 5HNUA 3W22A 3NZQA 3MBFA 5HULA 2ZUWA 4AD5A 5MKGA 3G1RA 1X1ZA 1XYCA 3NQFA 1ZGDA 4I9MA 3BLPX 3F2CA 5F2LA 4YTTA 1OYCA 1CDGA 5HMEA 3S5OA 1F05A 1CGUA 2HS6A 3NEVA 1P0NA 1TA3A 3IGUA 3QPZA 4UZUA 1S5NA 2H8XA 1E73M 2IPWA 1OVDA 5FAGA 4O1CA 5HJXA 3QFEA 3W3OA 9CGTA 2E8ZA 1PCWA 2C1GA 4BCEA 2EJAA 2DFAA 2PDJA 4MWAE 4D71A 3CL7A 3W74A 3O16A 2OT1A 3NIYA 4UBPC 1CGXA 4IMAA 4DF2A 1V7AA 1DXFA 3PPGA 4GY0A 2ZRVA 2EEXA 5C9XA 2YLAA 5TF0A 1XQKA 1R2TA 5CC5A 4ZOCA 1E6QM 4EAMA 1YDYA 1XLFA 3GHRA 1KNWA 2E