2DU9A

Crystal structure of the transcriptional factor from c.glutamicum
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
116
structure length
116
Chain Sequence
b'VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGMFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted transcriptional regulators
publication title The structures of transcription factor CGL2947 from Corynebacterium glutamicum in two crystal forms: A novel homodimer assembling and the implication for effector-binding mode
pubmed doi rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Transcription
total genus 39
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2du9A00
3FM5A 4HZFA 4KIFA 4Y15A 5AIQA 2FMLA 2LF8A 2MLGA 3EDPA 2K02A 2IVMA 2JPBA 1U78A 2O8XA 3I54A 2JTVA 1CF7A 4IRGA 4R79A 4PGGA 2IA0A 1HXDA 3TDZC 1I27A 1TBXA 2BEOA 3GW2A 3V8JA 1FBSA 1TW3A 2NNNA 3F6OA 5J8CA 1IUYA 1Z1DA 3EQLF 3IWZA 1RNLA 5HLHA 3N97A 4IXAA 2FA5A 5L3FA 1BN5A 3HOSA 4BHCA 1OR7A 1U5TA 3CDHA 4BQAA 2X0LA 4RGRA 2D1HA 2QVOA 4RS8A 5HS9A 4B8XA 4OIOF 1R58A 4UVBA 1TW2A 3QP6A 4RAYA 2VT3A 1CGPA 1L0OC 5L3EA 2Q8KA 4PDKA 1ZRDA 2DQLA 3M1EA 5DD4A 3ISPA 1KYWA 3R0JA 1FBQA 2ZNYA 3P9CA 4HW0A 4S05A 1FOKA 3ML6A 2MLKA 5ILVA 1XGSA 1H9TA 1S29A 2L54A 5ICCA 4KN4X 1WWXA 3WODF 2L01A 4LK0F 1ZGJA 5HDKA 2JRTA 2XAFA 1YW9A 4GYIA 2VE8A 2ZJ2A 4D0PA 4HAMA 2HKXA 4L5IA 5FB2A 2XIGA 2VE9A 1ZLJA 3ZN1A 4RAZA 1SMYF 1LDKB 1QNTA 2DW4A 5E20A 4AWXB 1SFEA 1IN7A 2P6SA 4M71A 5JI6A 2HYGD 2K27A 2PMUA 2XAQA 3DPTA 3K9TA 5FD6A 3I53A 3FMSA 1F4KA 1XD7A 2FOKA 4G7OF 1B4AA 2VBWA 2BV6A 4QWQA 4MHGA 3JW4A 3R0AA 2CQKA 4Q48A 2AS5F 1IN6A 1QPMA 2F5CA 4EJVA 4UV9A 1IF1A 1HW1A 3ULQB 1MKMA 3IKVA 4LD5A 5HLIA 1C0WA 4UV8A 2DFIA 2NS0A 2V6CA 3HRSA 2LSOA 3H3ZA 4A6DA 4ASNA 4KICA 3V7CA 4MTDA 3GZ6A 4LG0B 1BI3A 2P7VB 3ZPLA 2J5PA 3HUGA 2CWEA 1MJAA 2DQRA 4IVNA 2NNYA 2L4MA 4LLLA 2KRFA 1PDNC 2R7DA 3BY6A 2OQRA 5D6EA 3F72A 3LA3A 1WI9A 3JAMK 3F6VA 3QU3A 4JBAA 1LJ9A 3GFMA 4XLNF 5E1WA 3C18A 3GFIA 2GXGA 4G94A 5J8FA 2PBIA 4I7HA 1KYZA 1W5SA 3Q9VA 1ZN2A 5BOXA 1SMTA 2O61A 1MGTA 1FSHA 2O3FA 2WWYA 1O3SA 1KU7A 3KEQA 4WWCA 3BP8A 1ZLKA 2GZWA 1U6GA 2HKOA 3R60A 3R61A 2PI0A 3NEUA 1S7AA 5H20A 4M73A 4HOBA 4G7ZF 4BXUA 1LQ1A 3J81K 1R7JA 2V1UA 2OBPA 3IWFA 3KZYA 1J2XA 1BI1A 1SD6A 3JSPA 4N9IA 3SZTA 3GF2A 1I1SA 4L0YB 4YFNF 3VB2A 3ECHA 1TNSA 5JHUA 4A5MA 5H6RA 3VOEA 4Q5SF 5E17F 4KT5C 2JT1A 4LK1F 1KU3A 1YQAA 2BE5F 1LDDA 4EGYA 3QAHA 3HYIA 3F21A 1ZAOA 2A61A 3B02A 3LSTA 2NYXA 5K1YA 2EV5A 1IN4A 3M9AA 3WTUC 5DEQA 2VOOA 3FMRA 1W7PA 1JE8A 1B1BA 4P9FA 3CO7C 3ZMDA 4ZZLA 3DF8A 2PMHA 3F8BA 4KN7X 3LFKA 5E8GA 2DTRA 4P5OA 2DK5A 4BAYA 3C7JA 1BC8C 1AWCA 2BBYA 2IP2A 3OV8A 3WTVC 1R5HA 1ZH5A 1YS7A 4BHPA 3ZQ7A 2Q0OA 4WCGA 2GIVA 2M87A 4ON0A 2D45A 2ETHA 1E17A 4I02A 3WGHA 1ZYRF 1WKMA 1KU2A 3TOBA 3KLOA 2V1DA 2W84A 3BDDA 3SFZA 3F3XA 4DQ2A 3EUHA 1IXCA 1RUOA 1ZG5A 1HBXG 1DDNA 1YW7A 1J0RA 1SD7A 2HGCA 2E1CA 1RZ4A 2YPRA 1KU9A 3ABUA 3BPVA 4LGWA 4L9NA 1KQ8A 1L3LA 1Z6RA 3WTSC 3T1BA 2EFPA 1USTA 5FO5A 1HW2A 5BPIA 3V4GA 2J5OA 2KIFA 3I5UA 2VN2A 3LQQA 5IT9K 1YW8A 1YLFA 2Z5UA 1FYLA 3GFLA 3WGGA 1F9NA 3KP4A 1FT9A 2KJCA 4EJTA 1Z05A 3TO9A 4E70A 3ELKA 3DFGA 2QBYA 2M8EA 3LAJA 4U7BA 2ZO4A 3QOPA 2VOPA 1W5TA 2WC2A 2RVCA 2EK5A 3QRFF 4PCQA 4GO1A 1J9IA 5LHIA 5LEJA 5CVJA 4RB1A 4L5JA 3CUQB 3G3ZA 1HSTA 3M7GA 3VEPA 1EH6A 1KA8A 1ZG3A 1K78A 1XN7A 4WX9A 2NAZA 2MH9A 5CVVA 2PN6A 3WG9A 4YIIA 1HW5A 1T98A 3I4PA 4M6YA 5D6FA 2V1XA 4MGRA 2NRAC 3P9KA 1S8NA 1YG2A 4WXHA 2P5VA 4AIKA 2PEXA 2EV0A 1OYIA 3I64A 3CO6C 5ILUA 2XRNA 2P6TA 1K7AA 1G3YA 1T2KA 4OIRF 3ROUA 4I0AA 3T0YA 3WU0A 1BIAA 2YSRA 2Y0MA 5ICEA 4KFCA 3COAC 2RNJA 3BJ6A 1G3TA 4CICA 1XDUA 2VODA 2E7WA 2FF4A 2DPDA 4FHTA 2LNBA 4IF4A 3O6BB 3NRVA 2ESHA 3HSFA 4YFXF 3TOAA 3P9IA 2DK8A 4ZYDA 3L00A 3V7SA 3DPLC 5HS8A 3HTSB 3ZP5A 2W57A 2DBBA 2ZMEA 4HQEA 5D5XB 3E6BA 3LA2A 1FP2A 1TLHB 1G6NA 2RQPA 3GXOA 1XCVA 1YS6A 1EH7A 4L9VA 4LB5A 2P4WA 4R1HA 4HF2A 3BROA 3R4KA 3HHGA 4EJUA 2K86A 1IN8A 4G8XA 3DP7A 2EFWA 3WE2A 4KDPA 5BQTA 2TDXA 4LMYA 3I59A 4IHTA 4I01A 1S6LA 1XMAA 3HSEA 3TO6A 4IPAA 3MEXA 3HRUA 4L0ZB 2HZTA 2QQ9A 5JR3A 1UHWA 3HHHA 3QU6A 2IA2A 5HDGA 5LHHA 3IL2A 3M8FA 4MNUA 3O3KA 1MDMB 5D8LB 3J80Z 2MH2A 2HFHA 5D5WB 3GUDA 1ODDA 1FP1D 1LEAA 1J59A 3ZN0A 4U0YA 4OIPF 4HX7A 4LLNA 2ZNZA 3PQKA 2XAGA 1DPRA 1XGOA 2V79A 5LRSA 5JFRA 3TDUC 4UNOA 5FFZA 3KP6A 2PLYA 1ZGAA 2K4JA 4HX8A 2OZ6A 1JHHA 5DDGA 2JZYA 4GYGA 4BNCA 3U2RA 2CG4A 2PG4A 1REPC 1Z7UA 3GWZA 4EQQA 2IJLA 3FXRA 4K2EA 2QYOA 2E1NA 2ZXJA 5E1ZB 2A68F 3V8KA 5L3BA 2W85A 2E7XA 4O6JA 4P9UA 2Q2EA 4FX0A 5A2QK 2XKOA 1NHAA 4H0EA 5DCMA 3E5QA 4HV5A 4WXDA 1ZRFA 2XKPA 5HVQC 2XGXA 5FLXZ 1X3UA 5KK1A 4N0BA 2XHKA 2Y75A 1EV7A 4M9SA 1QQIA 4M9ZA 1B9MA 2DAOA 4G9YA 3F22A 3GO5A 4KUMA 4CYDA 1Z91A 2XVCA 2O6GE 3PQJA 2QZ8A 3CTAA 1XGNA 1IRGA 5L3DA 4BH9A 2H94A 3DKWA 4PZJA 3W6KB 3MAJA 2EJRA 3FHZA 1U8RA 2A6EF 3GEZA 2B0LA 1H9GA 3ZMUA 5J6XA 1PUEE 3BJOA 1MJ9A 3KFWX 3DV8A 3J7AO 2RC4A 3O2PE 2GA1A 1YFHA 1VTNC 4MEXF 2X4HA 5LRRA 5DD8A 1ON2A 3BJAA 3S2WA 1JGSA 4RGSA 1GVJA 1ZHFA 4I2OA 1V3FA 3RKYA 2BGCA 5CVRA 1IRFA 1BIBA 2P5KA 3H92A 3AAFA 2G7HA 3R6SA 3EYIA 4O3MA 2A3SA 4GXOA 3ZMZA 1JXSA 1UFMA 5LHGA 2L3DA 1R1UA 3T8TA 3L09A 1FPQA 5TJJA 5DV5A 2CYYA 3FXUA 3D5LA 1R1TA 2QWWA 4A0ZA 2DO7A 1O7LA 3B73A 3REOA 5CJ9A 1DP7P 1KGSA 1CF7B 4I0BA 3TQNA 4U7DA 2STTA 4HBLA 5AIPA 3HSRA 3MWMA 4MQVA 3I71A 2HDCA 1ZRCA 2VBYA 2P5LC 2GWRA 2O03A 5DUKA 4B09A 1J7KA 2QM3A 2A6HF 3BPXA 4ZZDA 3NQOA 2YX7A 4LFUA 4Q4ZF 1KQ9A 1W7PD 1U5TB 4M6XA 2VONA 1P92A 5ILSA 2MA3A 2YR2A 3GFJA 3LQRA 3T8RA 4S04A 4G7HF 1T38A 3E5XA 1P4WA 2M45A 3WTZA 3FM3A 4A6EA 2HEOA 2VBZA 3IRQA 4DNCA 1QGPA 3MZYA 3RIRA 2RV8A 6PAXA 3I58A 2D1VA 2P8TA 4UVAA 3TO7A 2QQBA 1D3YA 3F8CA 2IT0A 1FX7A 4HF0A 3K0LA 2EWNA 3SXYA 1B6AA 4ESJA 3JAMZ 3ZMTA 3QPTA 3GX4X 4UVCA 3P7NA 1R00A 2F5EA 3KZZA 3H3UA 4BYYA 3U9GA 5ERIA 4CDGA 1PP7U 1UB9A 4LG0A 2ESNA 1SAXA 2FXAA 4Y13A 3SHFA 3MQ0A 1Z9CA 1RIOH 5D4RA 3OOPA 1Z6TA 4OMZA 4KIGA 1F1ZA 2QENA 4O5VA 4XSXF 5AONA 1AOYA 1USSA 1O3RA 1GXPA 2HQRA 2XAHA 1J75A 3RKWA 4TV7A 3BZ6A 4RB2C 3ERED 4M9XA 3JSOA 3J81Z 1H0MA 1MJBA 1WQ2A 2PJPA 3GVAA 2YX4A 1T0FA 2O0YA 3U1DA 5HLGA 4CHUA 2HYFA 1T39A 2FRHA 4OU0A 5ICFA 2AXLA 1WRJA 1TQMA 4HV6A 2ADUA 5DCFA 5K5RA 1O3TA 4IJAA 4CXFA 1ON1A 1J5YA 1P4XA 1HSJA 1FYMA 2P7CB 2Z9OA 5K5QA 3E6DA 2HTJA 4I98B 5L3GA 1IXSB 1IN5A 2Y48A 2BYVE 1XCBA 4A12A 4MQ9F 2ISYA 2VC1A 3M8EA 2VBXA 1G3SA 4YFKF 3E3VA 4L9TA 3W6JB 3KEOA 3MFKA 4GCVA 4HQMA 1YIOA 2CW0F 4ENNA 1FYKA 1BC7C 4KA4A 1MZBA 3GLXA 2A5YB 2OD5A 2OQGA 4N9HA 1PP8F 2QQAA 1DUXC 5JVTA 3L7WA 4WK8F 2EFNA 2COMA 3LA7A 3HOTA 4CO8A 1Y0UA 3V8LA 1G3WA 1UCRA 3MZHA 2W24A 3K1PA 5H6QA 2FNPA 2H6CA 2YU3A 1Q1HA 5D5UB 3HRTA 4OIQF 3VFZA 2W25A 1R23A 1YYVA 3WTYC 2CSOA 2PFBA 5IT3A 4HF1A 4ENMA 4XRFA 2LDUA 1O7FA 3CUQC 3EYYA 5FGMA 1R5GA 2IA1A 4U0WA 4I09A 2GXBA 4YG2F 2L02A 3IC7A 2R3SA 4L9JA 2DI3A 4PGHA 4A2UA 4UUVA 3F8MA 2M5WA 3WE3A 2EFOA 4G6QA 3Q9SA 4KNYA 4OINF 5LLQA 4JK1X 1FC3A 1IW7F 2DPUA 4ENJA 5LGTA 1FBUA 1BI0A 2KKOA 3DXJF 1OPCA 2KIMA 5TRDA 4JQFA 4YIFA 2GQQA 1XMKA 3WU1B 1OYYA 2R7FA 5K5OA 5D8KB 1GXQA 1TQIA 1W7PB 3E6CC 4L18B 1JHFA 1ULYA 2CO5A 3ECOA 4ZH4F 4HX4A 4AIJA 5LBQA 5IT9Z 1TTYA 3HRMA 3KETA 1FY7A 4KMUX 5D5VB 2KJBA 3PFIA 2UXXA 4HA8A 1ZREA 2CGPA 3K2ZA 2DLLA 4WF2A 2VC0A 2EA4A 2RGVA 5F6FA 5LGUA 1HKSA 2EA2A 4EM0B 2ISZA 2MD5A 2VT2A 2D2WA 1YO5C 1LDJA 2A69F 3DQVC 3IHUA 1T6SA 5FFXA 2MC3A 3IKTA 4Q47A 3V7RA 4ZYGA 4AVPA 1D8KA 2OU2A 5HDNA 2ZCWA 2F5FA 2DT5A 3JTGA 4NHJA 3K69A 2FSWA 2KIUA 1HKTA 1BI2A 3KP5A 3N4MA 3FMQA 1MD0A 1D8JA 1SD4A 2HWVA 4HLYA 4XBFA 3VODA 2LKPA 1QBJA 3SZPA 3RPUA 2XROA 3E5UA 3CUQA 2FBHA 1SFXA 4R8HA 1XSVA 1U3EM 2UWMA 1K79A 1D5VA 1S3JA 2VXZA 3WTTC 4EM2A 2C6YA 5KVRA 3WTXC 4GGGA 1SFUA 4M74A 2QBYB 5CVUA 2FMYA 4U88A 3LAPA 4UHTA 2V9VA 2FU4A 3E6MA 4EJWA 2K7LA 5E8IA 5DYMA 2Z3YA 4XLPF 2XV4S 1QO0D 2FE3A 2Z99A 3BOQA 2ELHA 5BMZA 4WXCA 1HKQA 4NQWA 2FEZA 1A04A 4MTEA 2K4BA 4EV0A 4RB3C 3WTWC 1ONVA 2F2EA 4ZYHA 2FQ3A 3CLOA 3RYRA 1YTYA 3RKXA 5CYVA 1R22A 5D4SA 1K78B 4OMYA 1V4RA 3FF5A 5BS6A 4KMFA 3RYPA 2IW5A 3C1DA 1FWZA 5ED4A 3Q5FA 3ZMSA 5E1XA 2MBFA 3FZVA 4EJOA 1WSUA 1HQCA 5CVIA 4ENKA 1I1GA 4EGZA 4XSZF 3EETA 3KP7A 3KCCA 5EEGA 5EEHA 3KLNA 3TGNA 4A5NA 1BJAA 1IZ1A 2XASA 1FZPB 3C3WA 2WTEA 2OAZA 3BWGA 1G4DA 3QP5A 4P55A 2G7UA 3K1NA 2RKHA 2RN7A 4CGZA 4AD9A 4CZZA 1GHCA 3RPQA 1LVAA 3RI4A 3E97A 2UXNA 1XDSA 2M30A 1IAWA 3T5XA 5LGNA 1S7OA 3RJPA 5E18F 2IPQX 2HQNA 1BM9A 1K6OA 1XGMA 1OKRA 2ZBKA 5LEKA 3RTRA 1FNNA 2OA4A 1LNWA 2A07F 1BOAA 4FT8A 3TKYA 2PQ8A 2ZMEB 3I0TA 1P2FA 2STWA 5HS7A 4HYEA 1LB2A 4HLXA 1I6XA 1FLIA 3L9FA 1MDMA 2H6BA 3HIFA 2IRFG 3K1MA 5F64A 2ACJA 3GYHX 4LB6B 1QZZA 3KP2A 5L3CA 4EVIA 1R1VA 4G6DA 1SD5A 1O3QA 2L4AA 4HDUA 1O57A 1LEBA 1ZG1A 3G73A 4LLGF 3F8FA 4F7ZA 3I59B 2GA2A 1RI7A 5A2QZ 3FXQA 4M72A 5HOOA 1B59A 3CUOA 4ETSA 3D0SA 2EB7A 1E2XA 4KYWA 5F1RA 1OMIA 4ZYEA 5BPDA 1XSDA 2EFQA 1XSXA 2GAUA 2FBKA 4Y17A 2DU9A 2HOEA 1R36A 3ZMVA 1TNTA 4MEYF 4RB0A 4A0XA 3MCZA 1P6RA 2M1BA 2Z33A 2EV6A 5DUIA 1RUNA 1I5ZA 1BBYA 5FD5A 4BHBA 2QUFA 1STZA 3GZ5A 1P4AA 4HDVA 2H27A 4RGUA 1U5TC 4FX4A 2RDPA 3J80K 2UZKA 4IRIA 1ZARA 3JTHA 3F8NA 3FX3A 3KP3A 4UXNA 4EM1A 2HS5A 2JPCA 3L2CA 3SQNA 3RDIA 1FSEA 1W4MA 3F23A 1B9NA 4EMSA 2FBIA 4NB5A 4ESFA 1KQ0A 4AIHA 4LJZF 4QLCU 5DCMB 2CFXA 4Z2YA 2H09A 2OZUA 4KIBA 1XB4A 2JSCA 2FNAA 3KE2A 2HR3A 3QPHA 1TQPA 4OOIA 2ZKZA 3LWFA 4U0VA 1U2WA 4ESBA 4P96A 3DEUA 2XAJA 5ICGA 2F5DA 2LF7A 4RGXA 4IHSA 1DPUA 4IRHA 3FWEA 3ABTA 3WGIA 1F5TA 1OYWA 2QLZA 3HTUA 5FLXK 2XUBA 1IXRC 2G9WA 2WV0A 1QZYA 2HTSA 2ZFWA 5CLSA 1UHMA 4A0YA 3CJNA 1EH8A 3IRRA
chains in the Genus database with same CATH superfamily
2LYCA 3FM5A 3DKXA 2X6YA 1LKXA 4HZFA 2PMZA 2W4SA 4FISA 1H8AC 1YRNB 4DBRA 4KIFA 2A05A 2F4OB 4Y15A 5AIQA 1JKRC 2FMLA 1BR1A 4FE4A 4AIDA 1P7IA 2LF8A 3K2AA 2MLGA 2E71A 4C9YA 2BY2A 3CJQB 3EDPA 2K02A 4D7NA 2IVMA 2JPBA 2V7FA 1U78A 4IL6C 2NVUB 2O8XA 3I54A 3L2QA 2JTVA 3DCFA 1CF7A 1R4MB 2DYSH 3PNTA 2MC4A 3IUOA 4IRGA 5C4JJ 4R79A 4PGGA 3Q0UA 2IA0A 2R5YB 1HXDA 3TDZC 3KEYA 3HDDA 1I27A 1Z3YA 1S72I 1TBXA 3V42A 3GTJJ 4C2UA 1YITI 4KT6A 2LRDA 4M3DA 3A4CA 2BEOA 3GW2A 3GTQJ 4E7IA 3JRBA 2VJJA 3V8JA 4LOCA 4UB8C 1FBSA 1TW3A 2NNNA 3F6OA 5J8CA 3S15J 1IUYA 1Z1DA 3EQLF 3IH4A 3IWZA 2PJRB 1RNLA 5HLHA 3N97A 2R4GA 2EZKA 2JA2A 5IP9J 4IXAA 2FA5A 5L3FA 3OYHA 3ZQQA 1RR7A 4GDFA 2IXSA 3LOCA 1BN5A 1VQNI 3HOSA 4BHCA 1OR7A 1N25A 3H5RA 3OYGA 1U5TA 4KITB 3CDHA 4BQAA 2X0LA 2DJIA 4RGRA 2D1HA 2HOSA 2Z16A 2QVOA 2NOJB 4RS8A 5HS9A 4B8XA 4OIOF 1R58A 4UVBA 4BDYA 3HOWJ 1TW2A 1OCCH 3QP6A 4RAYA 2KP6A 2VT3A 4IZZA 1CGPA 1YHQI 1L0OC 1IC8A 2K85A 5L3EA 2Q8KA 1GV2A 1D0ZA 4PDKA 3UKGA 1ZRDA 2DQLA 1LFBA 3ERMA 3M1EA 3OYLA 5DD4A 3ISPA 1KYWA 3R0JA 3S3MA 1FBQA 1HCRA 2ZNYA 3P9CA 4HW0A 4AVZA 1ERDA 3OY9A 4S05A 4B47A 1FOKA 3ML6A 2MLKA 4B1RA 3HBLA 4M3FA 3LSRA 4RLQA 5F0HA 4JX4A 1X4OA 1EF4A 4YIRX 5ILVA 1XGSA 1H9TA 1S29A 2L54A 2GOXB 5ICCA 4KN4X 5IOYA 1S5LC 4I76A 1WWXA 3GZNB 3GTLJ 3WODF 2L01A 2AXTC 2LBFB 4LK0F 1ZGJA 5HDKA 3M3YJ 2JRTA 4AM3A 2X6WA 2XAFA 1YW9A 4GYIA 1Y1VJ 2A5WA 3ZQGA 3JRDA 3O8GA 2VE8A 2ZJ2A 4D0PA 4NUBA 4IHVA 2DTZA 4HAMA 2HKXA 4L5IA 5FB2A 2XIGA 1GT0C 2VE9A 1Z7LA 2X85A 3PO3J 1PVEA 1WGXA 2TRTA 1ZLJA 3TBIA 4CUGA 3QODA 3ZN1A 3OSFA 2DDBA 3S1MJ 4RAZA 1SMYF 1LDKB 1QNTA 2DW4A 5E20A 1SC7A 4AC0A 4AWXB 1BJZA 1SFEA 2ZC2A 1IN7A 3IH2A 1OCRH 2EIMH 2P6SA 4M71A 5JI6A 2HYGD 2K27A 2M2EA 4FE7A 4FQGA 2PMUA 1G2HA 5J47A 1TWCJ 2XAQA 3DPTA 4ZJZA 3JR9A 1I3QJ 1QHGA 1Z0XA 3WHCA 3K9TA 5FD6A 3X2QH 3I53A 3FMSA 2WAQA 1XD7A 2FOKA 2KZGA 2QGUA 3LL7A 3PNVA 1F4KA 4G7OF 3I4MJ 1B4AA 3CP8A 2VBWA 2BV6A 3OYIA 4QWQA 4MHGA 2KISA 2M0MA 3JW4A 2V26A 3PL8A 2CQKA 3R0AA 4Q48A 4CCMA 2LVSA 2AS5F 1I6HJ 1IN6A 1QPMA 2F5CA 2FUG2 1TL8A 3H35A 4EJVA 1DU0A 4UV9A 3LMMA 1IF1A 1HW1A 3ULQB 4AYBN 3K70C 2EQRA 2CS3A 1MKMA 2JVHA 3IKVA 4LD5A 2L0KA 2NS7A 5HLIA 1C0WA 1PUFB 1U9OA 3HC7A 4W1UA 3TMOA 4UV8A 3K4CA 2DFIA 2NS0A 3OS0A 2V6CA 3HRSA 1AHDP 2LSOA 3H3ZA 4A6DA 5B3SH 2V9PA 4KICA 1WCMJ 4Y4RA 4ASNA 3V7CA 1VQ4I 2VXDA 2QKMB 4MTDA 2DA5A 3GZ6A 4LG0B 3I55I 1BI3A 2AO9A 2P7VB 5EZGA 1X3ZB 3ZPLA 2J5PA 3HUGA 1MBFA 2CWEA 1MJAA 2DQRA 4IVNA 3OYFA 2NNYA 2L4MA 2ZJQF 4KISA 4LLLA 2KRFA 3RQ4A 1PDNC 2R7DA 3BY6A 2OQRA 5D6EA 2KRHA 2GOMA 3F72A 2HYJA 1T33A 1WJBA 3LA3A 1WI9A 3RPUD 3JAMK 3F6VA 3E0JB 1KZHA 3QU3A 4JBAA 1LJ9A 1IV6A 2DA4A 3GFMA 4AYBA 3S1QJ 3JRGA 1UG2A 4XLNF 3M4OJ 5E1WA 3C2HA 3C18A 4BEHB 1D5YA 3GFIA 5C44J 2ELKA 2GXGA 1IGNA 2L7KA 4G94A 1K6YA 5M3FJ 4NNJA 2WAFA 5J8FA 2PBIA 4I7HA 1KYZA 1W5SA 2V9KA 3Q9VA 1ZN2A 5BOXA 1SMTA 2O61A 1NG6A 1MGTA 1M1EB 3KPHA 1X1AA 1LE8B 1WZ2A 1Y39A 2JQ7A 1VQ6I 1WI3A 3CCEI 1FSHA 1JUSA 4C30A 1D0YA 2O3FA 2XGCA 2WWYA 2L7FP 4HSTA 4EEFG 2KL4A 1O3SA 1KU7A 4D1QA 3KEQA 4WWCA 3BP8A 3H9JA 1ZLKA 3OIQA 4XK4A 2GZWA 3L2RA 2GM4A 4A3MJ 3ZOBA 5C4XJ 1U6GA 2HKOA 2LTPA 3R60A 3QPLA 4CCOA 2MYSA 3R61A 3RCOA 2JSPA 3NEUA 2PI0A 1S7AA 2UUZA 4A3GJ 3FBIB 2DMQA 5H20A 1RC9A 3CC7I 4M73A 1RKTA 2PX9A 4X6AJ 3VYSB 3BZCA 4HOBA 4G7ZF 4BXUA 1LQ1A 4MO7A 1MSFC 1IDYA 3J81K 1R7JA 4D7MA 2NVTJ 1MMDA 1E3HA 2OBPA 2V1UA 4CCNA 4A3KJ 3IWFA 5KNLA 2L9RA 4EATA 1Q1VA 3HOYJ 3KZYA 1J2XA 1BI1A 3WHBA 4BJTA 1SD6A 1VQ8I 3JSPA 4N9IA 3SZTA 5M5YJ 2DXIA 3GF2A 4BUPA 4L0YB 1I1SA 4YFNF 4LITA 2B7EA 5EGOB 4OAYA 3VB2A 3ECHA 5IOZA 1TNSA 5JHUA 5E3OA 3CCMI 4MFDA 1G59A 4A5MA 5H6RA 5GAHJ 5EF6A 4JYKA 3VOEA 1QA6A 4Q5SF 5E17F 4KT5C 2JT1A 4LK1F 1KU3A 1A36A 1YQAA 3BQZA 2HDWA 1JGGA 4I99C 2VPRA 2BE5F 1LDDA 3LSJA 3GBGA 4LIVA 4EGYA 1LVKA 3QAHA 3ZRGA 3ZQFA 3CCJI 2H8WA 3GTKJ 3M8JA 3HYIA 1VQKI 3F21A 1ZAOA 3GCMA 2A61A 3B02A 3LSTA 2NYXA 4IQ4A 5K1YA 2EV5A 4FETA 1IN4A 4BL0B 5FROA 3M9AA 3SZGA 3WTUC 4ABZA 2IGMA 5DEQA 2VOOA 3FMRA 1W7PA 5M5WJ 3A01A 1JT0A 1JE8A 2IS1A 1B1BA 4P9FA 2BHYA 1MBGA 3CO7C 4XORA 3ZMDA 5IY5H 3FXJA 4ZZLA 1ENHA 1ETWA 2L9VA 2K9QA 2PMHA 3A1YA 3DF8A 3F8BA 4KN7X 3CQZJ 3DBLB 3LFKA 2XF5A 3BCBA 5E8GA 2XC7A 2HXIA 2DTRA 4P5OA 2DK5A 5CPRB 4BAYA 3CMAI 3C7JA 1BC8C 1AWCA 2R7UA 2M8GX 2BBYA 2IP2A 3OV8A 5LFAA 3BLYA 3WTVC 1TWGJ 3ZQLA 4XQFA 1K61A 4HNUA 3E1SA 3L2WA 1RR8C 1R5HA 1ZH5A 1YS7A 4BHPA 5FJ8J 2B63J 1UELB 3AG4H 5HNFA 1APLC 3NWSA 3ZQ7A 2VQLA 1J09A 4QIWN 2Q0OA 4WCGA 4UUSA 1ITYA 2GIVA 2M87A 4RDUA 4ON0A 2MD0A 2D45A 2ETHA 1E17A 4I02A 2XGEA 2ZXIA 4ZC3A 3VDXA 3WGHA 2HQAA 1ZYRF 4JP0A 1ETQA 4A3EJ 1WKMA 2EH3A 1KU2A 3TOBA 3KLOA 4ZDOA 1VQPI 2V1DA 2W84A 1ACIA 1Y1WJ 3BDDA 1R9TJ 3BR0A 1IJWC 3D5RC 1R5ID 3OL4A 3LSPA 3SFZA 2CUJA 3F3XA 4DQ2A 3EUHA 1QVUA 5FKNA 3U1KA 2OV7A 1WH5A 5K7ZA 1IXCA 1W0TA 3MN2A 1RUOA 1ZG5A 3KX2A 1WJCA 1HBXG 1T08B 3CF5F 3P5JA 2WV1A 2HNHA 4LIUA 5KCMA 2KDZA 1LPQA 1DDNA 1YW7A 1J0RA 5CQEA 1SD7A 1I39A 3SDGA 2HGCA 1WJEA 2E1CA 1RZ4A 2YPRA 3F9KA 3HPHA 4JX5A 4PK4A 2F4MB 1KU9A 3CJRB 4FASD 3ABUA 2M34A 3C2BA 3MVPA 3G71I 4C2MJ 4XLFA 5GTHC 1TC3C 3BPVA 2LREA 3FXOA 4L9NA 2BW3A 4LGWA 1FMVA 2IBDA 3PFYA 2V6EA 1KQ8A 1L3LA 1Z6RA 5CKTA 3J7ZI 4YEJA 3WTSC 3T1BA 4A93J 1EKEA 4XLCA 2EFPA 1USTA 5FO5A 3CP2A 2BXZA 4Y52J 1HW2A 3BR2A 5BPIA 1V5EA 3V4GA 4C3JJ 1FJLA 2J5OA 2R7RA 2KIFA 3I5UA 2VN2A 2L9SA 3LQQA 5IT9K 1YW8A 2DT6A 1YLFA 5EZHA 2Z5UA 1FYLA 3GFLA 3WGGA 2K9NA 4RAFA 1F9NA 2HPMA 3KP4A 2VQHA 1FT9A 1WJ5A 2KJCA 2M4KA 5KAFC 4EJTA 1Z05A 4XN0A 5KHDA 3TO9A 4E70A 3KYDB 3ELKA 3DFGA 2QBYA 1Y6IA 4HRIA 3ZQHA 2M8EA 2CUZA 4E7KA 4AU7A 4DOZA 4XKBA 3LAJA 4U7BA 2ZO4A 3QOPA 1WH7A 1XC5A 4HEA2 3AL0C 2XPUA 2JA6J 2VOPA 1W5TA 2WC2A 2RVCA 2EK5A 2UV1A 3QRFF 2HVSA 4PCQA 2NVYJ 1R6RA 1OJLA 2EIJH 4GO1A 1J9IA 2F48A 5LHIA 5LEJA 1WJAA 5CVJA 4RB1A 1X19A 4BS9A 1ZGWA 4L5JA 2ZJPF 2JUGA 3CUQB 3G3ZA 3FHNA 2QEXI 1HSTA 1QU3A 4DIQA 3M7GA 3LSGA 2XB0X 3VEPA 1MBKA 1KONA 1EH6A 1KA8A 1ZG3A 3CF2A 1W36D 1XN7A 2MW8A 3ESWB 4WX9A 1K78A 2NAZA 4RM2A 2MH9A 4D9JA 5CVVA 2XRLA 2PN6A 1SFOJ 3WG9A 2DODA 4YIIA 1HW5A 3HGYA 1T98A 3I4PA 4YELA 4M6YA 5D6FA 2LC2A 4F3QA 2DA3A 2R5ZB 2V1XA 2P81A 2QF7A 3PUFA 1RESA 4MGRA 3P9KA 2E2IJ 2NRAC 1S8NA 1YG2A 3DLAA 4WXHA 4DYCA 2P5VA 3EUKL 4AIKA 3LSKA 4CYCA 2PEXA 2OTJI 2EV0A 2HXOA 1OYIA 3I64A 2QSGX 3CO6C 2VQCA 5ILUA 2XRNA 1AU7A 2P6TA 1K7AA 2HVRA 1G3YA 5FLMJ 1H89C 2QA4I 4NQWB 1T2KA 4OIRF 3ROUA 4I0AA 3T0YA 3WU0A 1BIAA 4E7JA 2YSRA 2Y0MA 3CESA 1P9QC 5ICEA 4KFCA 1SANA 2RNJA 3COAC 3BJ6A 1G3TA 4CICA 1MH3A 1FMWA 1XDUA 5B5EC 1AKHB 2VODA 2E7WA 3GTPJ 2FF4A 1TT5B 3SFIA 2DPDA 4FHTA 9ANTA 2GLOA 2LNBA 4IF4A 2VJ4A 3OL3A 3O6BB 4F93B 1JTXA 5TGTA 3NRVA 2LD5A 2ESHA 2IGOA 3SJMA 3HSFA 3UNGC 4YFXF 4C3HJ 3TOAA 3P9IA 2DK8A 1SEUA 4ZYDA 3L00A 2WB1N 3V7SA 2L7MP 3DPLC 5HS8A 1SAUA 3ZGKA 2HI3A 4BACA 3HTSB 2HQ5A 3ZP5A 3ZXSA 3PUBA 2W57A 2DBBA 5FRNA 2ZMEA 2MABA 2DJNA 3OYMA 4HQEA 5D5XB 4M6VA 1IDZA 4M3GA 3E6BA 3G4SI 2H1KA 3LA2A 1YIJI 3TP0A 1FP2A 1VZ0A 2FQ4A 2YS9A 1TLHB 1G6NA 2RQPA 3GXOA 3M07A 1XCVA 2BVMA 4XLAA 1YS6A 3BR5A 2R7QA 2DN0A 1EH7A 4L9VA 3S14J 4LB5A 2P4WA 3H0GJ 3DBHB 4R1HA 2LOOA 4HF2A 1IO2A 3BROA 4CCLA 3R4KA 4XR6A 3HHGA 4EJUA 2ME0A 1ETXA 2KLOA 2K86A 1IN8A 4BY1J 4G8XA 1V55H 3DP7A 2NXNB 4LG3A 2EFWA 3E7LA 3WE2A 3GTGJ 4KDPA 2X48A 5BQTA 1T56A 2TDXA 5K7FA 2DOEA 4E4HA 2E2JJ 1B72B 5EYRA 4LMYA 3I59A 4IHTA 3W6VA 2WB1A 3I9V2 1G8XA 4I01A 4FTHA 1MBHA 1S6LA 1UHSA 1XMAA 3HSEA 3TO6A 4IPAA 3K4KA 3H9GA 3O8HA 3W3CA 2X9DA 2DFHA 3MEXA 3HRUA 4L0ZB 3TP3A 3HOVJ 3CCYA 2HZTA 2QQ9A 2X1CA 3ABKH 5JR3A 1JI8A 1UHWA 3HHHA 3QU6A 2IA2A 5F1JA 2Y30A 5HDGA 5LHHA 3IL2A 3M8FA 4MNUA 2O9LA 1F43A 3O3KA 3FBNB 4GRIA 2V4JC 1JJ6C 3L2VA 1MDMB 5D8LB 3FXKA 3J80Z 2MH2A 2HFHA 2ID3A 1BR4A 5D5WB 1MSEC 3GUDA 3BTIA 1ODDA 1FP1D 2DMPA 1LEAA 1J59A 1BL0A 3ZN0A 4U0YA 5M5XJ 4OIPF 4HX7A 2XPWA 4F91B 4LLNA 2I5UA 3VYRB 2JMWA 5FKLA 2ZNZA 3ABMH 3PQKA 1SVOA 2XAGA 1DGWY 1DPRA 1XGOA 1TWFJ 4XM3A 2V79A 5GPAA 4B43A 5LRSA 5FLVA 5JFRA 1LFPA 3TDUC 4UNOA 2EIKH 5FFZA 2K3PA 3KP6A 3OR1C 2PLYA 5FKOA 2LY9A 1ZGAA 2K4JA 4HX8A 4CCJA 2OZ6A 1Y8QB 1JHHA 4P1WA 5DDGA 2JZYA 4GYGA 4BNCA 3U2RA 1PJRA 2CG4A 3AG2H 4ZDPA 2PG4A 2VUMJ 1REPC 2IS2A 1FTTA 1Z7UA 3GWZA 5IP7J 1DGRM 4UY8I 2OCEA 4EQQA 2IJLA 3FXRA 4K2EA 2QYOA 4II3A 1HC8A 2E1NA 2ZXJA 1HOMA 5E1ZB 4RLFA 2A68F 2QQ8A 3V8KA 5L3BA 2DA7A 2W85A 2E7XA 4O6JA 1HLVA 4P9UA 5HNHA 2Q2EA 4FX0A 5A2QK 2XKOA 1NHAA 4H0EA 5DCMA 2BW3B 2OF7A 3GTMJ 1N75A 5H2FC 2N8GA 2ZJRF 3E5QA 4HV5A 4WXDA 3D1NI 1ZRFA 2XKPA 5HVQC 4RBOA 1ZK8A 2XGXA 5FLXZ 1OLTA 1X3UA 5KK1A 4N0BA 2CMPA 2XHKA 2Y75A 1VQ5I 1EV7A 2DOAA 4M9SA 3JRFA 3IV5A 1HA8A 2K40A 2NVQJ 1QQIA 3LFUA 4M9ZA 2EZLA 1B9MA 1CQTA 2DAOA 2YUSA 3DBRB 4G9YA 3GO5A 4KUMA 3QYFA 4CYDA 3F22A 2R93J 1Z91A 2XVCA 4IHXA 2O6GE 2XF7A 3PQJA 2QZ8A 3CTAA 4NDLA 4PJNA 1XGNA 3HEFA 1IRGA 5L3DA 4BH9A 2DMUA 2FJ1A 2H94A 3DKWA 5DM7F 4PZJA 3W6KB 5EDNA 3HKZN 3MAJA 1VI0A 2EJRA 2VASA 3FHZA 2DA6A 2XGDA 3HJEA 1VQLI 5C3EJ 1U8RA 2A6EF 3GEZA 1T95A 1XS9A 2B0LA 1H9GA 3ZMUA 3EUHC 5IYDJ 3EPZA 2CV0A 5J6XA 2BOLA 3HXLA 1PUEE 5KAIC 1P7JA 3MKLA 1WJFA 5FRMA 3BJOA 3DTIA 2KFDA 1MJ9A 3DU5A 3KFWX 4BE1A 4A3JJ 4QPOA 4B4CA 3BCAA 3DV8A 2RC4A 3O2PE 2GA1A 5F08A 3OYNA 1YFHA 1VTNC 3J7AO 3IAS2 4MEXF 2X4HA 5LRRA 1YRNA 5DD8A 4B44A 1ON2A 3BJAA 2XPVA 3DKYA 3S2WA 3FDYA 2KRCA 2XSDC 1JGSA 2OJED 1ZELA 3OSGA 4RGSA 1GVJA 1IV8A 1ZHFA 3HKZA 2VLAA 4I2OA 2LG4A 2R5YA 1V3FA 3RKYA 2BGCA 2JK3A 5CVRA 1S7EA 4M3BA 4BXXJ 1IRFA 2XSJC 1BIBA 2P5KA 3H92A 1BW5A 2XB5A 3AAFA 1ZR4A 2G7HA 5JLXA 3R6SA 3EYIA 3PIOF 4O3MA 3S93A 1X1BA 4RM3A 1QRYA 4BDZA 4PSXA 2PJRA 3KIOA 2A3SA 3S8PA 4GXOA 2BVLA 3PO2J 2E1MC 3ZMZA 1JXSA 4F52A 4BKXA 1UFMA 5LHGA 2L3DA 1R1UA 3T8TA 3L09A 1FPQA 5TJJA 1B8IB 5DV5A 3SYTA 2VJIA 2DMNA 2CYYA 3FXUA 3D5LA 1R1TA 2QWWA 3OIOA 3DEEA 3G1OA 4A0ZA 2FX0A 2I10A 2H1LA 3SEQA 1OCPA 2DO7A 4BJ5C 1O7LA 2EILH 3B73A 3REOA 5CJ9A 4F92B 1DP7P 1KGSA 3N05A 1YI2I 2VL8A 1CF7B 4I0BA 3TQNA 2G0EA 4U7DA 4JX6A 2STTA 4C2TA 4HBLA 3JRIA 3S16J 2R7TA 5AIPA 3HSRA 3VYTB 4A3DJ 3MWMA 4MQVA 3JRAA 3I71A 1MBEA 2HDCA 3H0DA 1ZRCA 2VBYA 2P5LC 1NK3P 1T0FC 2M3AA 1VQ7I 4F55A 1N77A 1RETA 2GWRA 4B3AA 2MSYA 2VKEA 2CH0A 2W48A 1S9HA 3K70D 5J1UA 1V5GA 2O03A 2E5NA 5DUKA 4DBQA 4B09A 1J7KA 2QM3A 1YJWI 2A6HF 5E79C 1N78A 3BPXA 3UR3C 3K6GA 4ZZDA 3NQOA 1BOBA 3K4NA 1OISA 2YX7A 4LFUA 4Q4ZF 1GUUA 4PJJA 3I4NJ 1KQ9A 1W7PD 1U5TB 4M6XA 3JRHA 1P92A 2VONA 3GTOJ 5ILSA 2O8KA 3OYCA 2JA7J 2MA3A 2YR2A 4IEJA 4XLHA 3GFJA 4E7HA 3LQRA 3BTCA 3T8RA 4S04A 3SEZA 1RRJA 3DWLE 4G7HF 1T38A 3E5XA 1P4WA 2M45A 3WTZA 5F04A 2ID6A 2M0CA 3CCSI 2E5ZA 2LMDA 3FM3A 2BHZA 5DTDA 4A6EA 2IGNA 2VBZA 2DDAA 2HEOA 2CUEA 1JUPA 3IRQA 1Y8RB 1XG1A 4DNCA 2DMTA 2QSHX 2JN6A 1QGPA 3MZYA 3RIRA 1R71A 2RV8A 3W2AA 6PAXA 2CV1A 5B66C 3I58A 3G6EI 3AL0B 3VYUB 4D5CA 5E3NA 2RNGA 2D1VA 2P8TA 3VPRA 1T8IA 1Z21A 4UVAA 5FKKA 1HDDC 1YE9A 1SVMA 3TO7A 4JOMA 2QQBA 1D3YA 4OWRB 4PJMA 2RAEA 3F8CA 1UG0A 1MW7A 3MD2A 2IT0A 1FX7A 4HF0A 3K0LA 4ZTFA 2KHMA 2ZXHA 2ECCA 3HL2A 3MMYB 4XKCA 4DYQA 1XTAA 3PNYA 4X1EA 2LK2A 3CZ6A 2EWNA 5FKMA 3SXYA 1B6AA 1X3WB 4ESJA 3JAMZ 5J1RA 3ZMTA 3QPTA 4BBSJ 1X1PA 1D1AA 3DTKA 2COBA 1EJ9A 3GX4X 4UVCA 4ZDLA 1PUFA 2E2HJ 3P7NA 2CV2A 4MLOA 3FK6A 4A3IJ 3CCVI 3S17J 1R00A 2F5EA 3BTLA 3ZCOA 3KZZA 3BR1A 3H3UA 4BYYA 4E7SA 3U9GA 5BNGA 1B8IA 3CMEI 4PFOA 4II2A 1ZTRA 5ERIA 4CDGA 2DFEA 1PP7U 2ZMEC 4HSRA 1UB9A 4LG0A 2ESNA 4XN3A 1SAXA 2FXAA 4XOPA 3BG7A 3K4BA 3CCQI 4DW6A 1H88C 4Y13A 4A3FJ 1GLNA 3SHFA 2X6OA 1W1WE 1ORKA 3MQ0A 2OC6A 2X1EA 1Z9CA 1RIOH 1MMAA 5D4RA 2NS8A 3OOPA 1Z6TA 1R4NB 1DP3A 1NTCA 4OMZA 4KIGA 1E3PA 3HOUJ 1F1ZA 2VQGA 4XLEA 1GDTA 4XIDA 2QENA 4IHYA 4O5VA 2Y2ZA 4XSXF 3TL4X 3ASOH 5AONA 5DM6F 1USSA 1O3RA 1AOYA 2X51A 1OCOH 4QTRA 4BEHA 3RZOJ 1GXPA 2F4IA 2HQRA 2M9HA 4W97A 2K3FA 2XAHA 2IEKA 3CCUI 2H8RA 1J75A 4XL9A 3FK7A 3RKWA 1A35A 4TV7A 4A3BJ 3BZ6A 4Z6YA 4RB2C 3ERED 5IYCJ 4M9XA 2O5RA 4NBQA 3JSOA 2LLKA 4RMNA 2BY0A 4BE2A 1LE8A 3J81Z 1H0MA 4CZCA 1MJBA 1WQ2A 2PJPA 3GVAA 2YX4A 4XKWA 1YX5A 2W00A 1T0FA 2WY8Q 2O0YA 4L5EA 3U1DA 5HLGA 4CHUA 2HYFA 1ETYA 1NG7A 1T39A 3HUGB 4A69C 2FRHA 4OU0A 5ICFA 2AXLA 1WRJA 5EG0A 1TQMA 4HV6A 2ADUA 1LFUP 3BQYA 5DCFA 5K5RA 1O3TA 3BG9A 3A03A 4A3LJ 4IJAA 4CXFA 1ON1A 4DZJA 2GBYA 1J5YA 1P4XA 1QZEA 1HSJA 1FYMA 1UMQA 2P7CB 2Z9OA 1JT6A 1X1DA 5K7HA 3E6DA 2HTJA 3BG6A 5K5QA 3OYDA 4IO9F 4I98B 4Y33A 5L3GA 1OFCX 4QPQA 1IXSB 3DEWA 3I56I 1IN5A 2Y48A 2BYVE 1XCBA 4A12A 2VKHA 4BY7J 3W2WA 5HLTA 4MQ9F 2ISYA 4X0GA 2VC1A 3M8EA 1WHUA 2KIQA 2VBXA 3KYCB 1G3SA 5HODA 4YFKF 2CUFA 3E3VA 4L9TA 2W7NA 3W6JB 4E6KG 2R7XA 3KEOA 4XRSG 1W5CC 3K4JA 3MFKA 4GCVA 4HNVA 4HQMA 1YIOA 3CLQA 2CW0F 4ENNA 1FYKA 1VQMI 3BZKA 1BC7C 4KA4A 1MZBA 3GLXA 2A5YB 2OD5A 2OQGA 4N9HA 2JUCA 1PP8F 1RKWA 2QQAA 5EGOA 1WFXA 1DUXC 5JVTA 1ZKGA 3L7WA 4WK8F 3OR2C 2EFNA 4N4NB 2COMA 3LA7A 4PSWA 3HOTA 4CO8A 1Y0UA 2CQNA 3V8LA 3QYBA 1G3WA 1GVDA 1UCRA 4B48A 2JJ7A 4N4OB 2CW8A 3MZHA 2DA2A 2W24A 3K1PA 4XKVA 3GMEA 5H6QA 3NAUA 2FNPA 2H6CA 2YU3A 1Q1HA 5D5UB 3HRTA 4OIQF 3CD6I 3S32A 2LKSA 3VFZA 2WBMA 1TWHJ 5IPAA 3G2BA 3AFHA 4U87A 2HVQA 2W25A 3SDBA 3CC2I 1R23A 1YYVA 5J3LA 3WTYC 3CDLA 3HZJA 2CSOA 4CCKA 3BTJA 2PFBA 2BY3A 5IT3A 4XRMA 4HF1A 3OS2A 3CDIA 4ENMA 3QPSA 4XRFA 2LDUA 5F27A 1O7FA 2R7OA 2ZSHB 3CUQC 3EYYA 3CMMA 1R5GA 5FGMA 2IA1A 4U0WA 4I09A 2GXBA 3BR3A 5CQGA 4YG2F 2F6CA 2L02A 5IYBJ 3CJTB 3IC7A 2R3SA 3GLLA 3LSIA 2DI3A 4L9JA 4PGHA 4A2UA 2ECBA 2M5WA 3F8MA 4NC7A 4UUVA 4PJLA 2VB6A 3WE3A 2EFOA 4G6QA 1U9NA 3Q9SA 4KNYA 4XOTA 4OINF 5J1YA 5LLQA 2Y9YA 1ZQ3P 4JK1X 1FC3A 5GADJ 1IW7F 2IAIA 3K4LA 4BXFA 4ENJA 2DPUA 5LGTA 1FBUA 3PIPF 1BI0A 3BG5A 2KKOA 3DXJF 4BJ6C 2OTLI 2R7SA 4BQQA 1A6QA 3ASNH 1JKQC 1OPCA 2KIMA 3FISA 3RZDJ 1WJDA 5TRDA 4JQFA 2ZXWH 2WADA 2DYRH 3Q3SA 4BQOA 2BY1A 4H4KC 4YIFA 2GQQA 3QWLA 5J4YA 2HOTA 2FOWA 1XMKA 2DCEA 5GPCA 3WU1B 1OYYA 2R7FA 1YOVB 5K5OA 4ZTJA 5D8KB 1GXQA 1JKOC 1A5JA 2LR8A 4G12A 5EEAA 1TQIA 1W7PB 2CFOA 3E6CC 1MNEA 3A01B 3KYLA 4L18B 1JHFA 1E0EA 1ETKA 1ULYA 2CO5A 3ECOA 4ZH4F 5B1AH 4HX4A 4V2GA 1X2MA 3OYJA 4A3CJ 4AIJA 4Y3OA 2HDDA 1I50J 5LBQA 2R0QC 1UZCA 5IT9Z 1TTYA 2MGQA 2WAQN 1R49A 3HRMA 3FKIJ 3KETA 1FY7A 1VNDA 4KMUX 3VWBA 1YJ9I 1UAAA 5D5VB 2K9MA 3OYKA 2KJBA 3PFIA 2UXXA 4HA8A 4CA0A 1ZREA 2CGPA 3K2ZA 2DLLA 4UUSB 1FTZA 3S1RJ 4HPQA 4WF2A 2VC0A 2WY7Q 2EA4A 2NVXJ 3DTEA 2RGVA 1TWAJ 2LFBA 1MNMC 1GV5A 5F6FA 5LGUA 1HKSA 2EA2A 4XICA 2JRMA 1VQOI 2R7ZJ 4EM0B 2ISZA 2MD5A 2VT2A 2D2WA 1YO5C 1LDJA 3ZQIA 3OS1A 4XNFA 2A69F 3OYEA 3F0CA 2ZSIB 3MKZA 3DQVC 1AA7A 3IHUA 1T6SA 5FFXA 2MC3A 3G1MA 3IKTA 4Q47A 1IRZA 3V7RA 4ZYGA 4AVPA 1D1CA 2DOFA 1D8KA 2OU2A 3LSMA 5HDNA 1D0XA 2ZCWA 2RREA 3M1CA 2B9SA 2F5FA 1E3OC 2DT5A 3L1PA 3JTGA 2YU9J 3K69A 4NHJA 1FOXA 2FSWA 2ZB9A 2KIUA 2RQQA 1HKTA 1BI2A 4IKFA 3KP5A 3J7YJ 1U8BA 2CRGA 1RPWA 2V1NA 3N4MA 1MNDA 4C3IJ 3FMQA 1MD0A 1JKPC 1D8JA 3Q0WA 1K83J 1SD4A 2DT7B 1V5FA 1X1CA 2HWVA 3FIWA 4HLYA 2DA1A 4XBFA 1IG7A 3WU2C 3AG3H 3VODA 2BXYA 2LKPA 3HGGA 1MH4A 1QBJA 3SZPA 3RPUA 3H1CA 2HU9A 2XROA 2JA8J 3E5UA 3CUQA 1SFKA 2DFFA 2E60A 2KDOA 3FXLA 2FBHA 3OYBA 1SFXA 4R8HA 1XSVA 1U3EM 2M7AA 5E3LA 2UWMA 3OIPA 1K79A 1D5VA 1S3JA 3PJRA 2VXZA 3WTTC 4EM2A 3L2UA 2KPMA 3DLLF 2VKVA 4CSWA 3B6CA 2KZVA 2C6YA 5KVRA 1Y56A 3WTXC 3MKYB 2E1MB 4GGGA 2LKXA 1LUJB 1SFUA 1ZR2A 4M74A 1BA5A 1VF9A 2QBYB 2LP0A 5CVUA 4V2FA 2FMYA 4U88A 2E35A 3QOEA 1YJNI 2R5ZA 3LAPA 1QPIA 4UHTA 2L2OA 2V9VA 3RSNA 2QKLB 2FU4A 3H3VK 4GFBA 3E6MA 4PJ0C 2K7LA 5E8IA 4EJWA 3OMYA 2Z3YA 5DYMA 2L5QA 2OCCH 1VFCA 4XLPF 2XV4S 2K5CA 1QO0D 2FE3A 2Z99A 3BOQA 2ELHA 5TISC 5BMZA 4WXCA 3OWTA 1HKQA 2GIZA 4NQWA 3JRCA 2TCTA 4YRVA 1IRXA 2FEZA 1A04A 4MTEA 2K4BA 4EV0A 3A0HC 2M7BA 2E34A 3AG1H 4RB3C 3WTWC 4IOCF 1ONVA 2CQ7A 2F2EA 3DPUA 3OYAA 4ZYHA 2FQ3A 3CLOA 4CH7A 3RYRA 1YTYA 3RKXA 5CYVA 4S0HB 1R22A 5D4SA 3AKZA 3LSHA 1JJ8C 1K78B 2K9SA 2W82A 5EG0B 4OMYA 2EZHA 1TT0A 1V4RA 3FF5A 5BS6A 2EZIA 1AKHA 3PSIA 4KMFA 2I8DA 3RYPA 4AUXA 4V19K 2IW5A 2Q1ZB 3C1DA 5GAEJ 3LNQA 3H5AA 1MMGA 1X58A 1FWZA 5ED4A 2L9NA 3Q5FA 5GP9A 3ZMSA 2R7WA 5E1XA 2VJ5A 2Y69H 2MBFA 3FZVA 4EJOA 1JTYA 1WSUA 1HQCA 2HZDA 5CVIA 4ENKA 4CYCB 2LY2A 1W0UA 1I1GA 4EGZA 2KMUA 3K10A 4XSZF 3ZR8X 3EETA 3KP7A 1K4TA 1Z3XA 3KCCA 2ELJA 3G1LA 5EEGA 5EEHA 3KLNA 3TGNA 4A5NA 1BJAA 1IZ1A 3HM5A 2XASA 3PM1A 1FZPB 4E7LA 4ITVA 5E3MA 2OUMA 3C3WA 4NC8A 3BG3A 3I3LA 2WTEA 3RQIA 2OAZA 2O7OA 3BWGA 1G4DA 4E7ZA 3H36A 3QP5A 2E1OA 4P55A 1TZLA 2JA5J 2G7UA 3K1NA 2RKHA 2RN7A 4CGZA 5F0CA 3IAM2 1F36A 4AD9A 2CU7A 4CZZA 2VPLA 4UUTA 1GHCA 3RPQA 4IOAF 4NC6A 3IH3A 1LVAA 1SVLA 3RI4A 3E97A 2UXNA 3MZ8A 1WVRA 1XDSA 2M30A 1IAWA 3T5XA 3WG7H 1EA3A 3DU6A 4ZYAA 5LGNA 1VQ9I 3MKWB 1MMSA 5GAGJ 1S7OA 3RJPA 1W36C 1ETVA 5E18F 2IPQX 3TW7A 2X1DA 4D5FA 2HQNA 1NK2P 1BM9A 3ABLH 1B72A 1K6OA 4HG2A 1XGMA 1OKRA 2ZBKA 2Y0SN 1X2NA 5LEKA 4B3XA 3K7AJ 1TP4A 2R92J 3RTRA 3A0BC 1FNNA 2OA4A 1LNWA 2A07F 5M3MJ 1BOAA 4FT8A 4MFEA 3TKYA 3S2HJ 2PQ8A 2WAEA 2ZMEB 3I0TA 1P2FA 2LBFA 1U0JA 3H5NA 4KJZA 2STWA 5HS7A 3TW6A 4HYEA 2VIXA 1FIAA 1LB2A 4HLXA 1I6XA 1FLIA 3L9FA 1MDMA 2H6BA 3ONQA 3HIFA 3QQAA 3QYEA 2E36A 1QVTA 2IRFG 1OQYA 3K1MA 1V54H 5GTIC 3EUAA 5F64A 2ACJA 3GYHX 1A6IA 5J4VA 3CCRI 2MG4A 4LB6B 1QZZA 3BC8A 2QSFX 3KP2A 4Y7NJ 4EVIA 1R1VA 4G6DA 2XAUA 5L3CA 4IHWA 1SD5A 1PYVA 4I6ZA 1O3QA 2L4AA 5EJCA 4HDUA 1O57A 1A31A 2IS4A 2Y0SA 1LEBA 4G6TB 1ZG1A 3G73A 4LLGF 3F8FA 1YX3A 3HG9A 4F7ZA 2EINH 2GA2A 1HDPA 1RI7A 3I59B 5A2QZ 3FXQA 2Y9ZA 1OCZH 3BT9A 2BZTA 4M72A 4J01A 3NARA 3C2GA 1Y0NA 2A6TA 5HOOA 2D5VA 4BU2A 1BW6A 1B59A 1MBJA 3CUOA 3D5SC 4MIMA 4ETSA 3CMYA 1DU6A 3D0SA 2AQFA 4BQNA 2EB7A 1E2XA 4KYWA 3S3NA 2LY1A 1FIPA 1OMIA 3HB9A 4ZYEA 5F1RA 1FOYA 1XX5A 2GXAA 5DS9A 5BPDA 1XSDA 1Z67A 2EFQA 1O4XA 5LD2C 3HOZJ 1XSXA 2XF6A 3OOUA 2GAUA 4BGDA 2FBKA 4Y17A 2Z1DA 4FCYA 2DU9A 2HOEA 1R36A 4PFPA 3ZMVA 1TNTA 4MEYF 4RB0A 3BR6A 5B1BH 4A0XA 2IS6A 2ICWG 3Q0VA 3ZQCA 2MFZA 3MCZA 3JCUC 2ME6A 4DJAA 1P6RA 2M1BA 2HPIA 2Z33A 2EV6A 4HNTA 4XONA 5DUIA 1I5ZA 1RUNA 1BBYA 5FD5A 2WA0A 3S2DJ 4XMYA 2X6XA 3HPGA 4BHBA 2QUFA 3CC4I 3NWTA 1STZA 4BBRJ 4XRSA 5F0FA 2K9LA 3PSFA 3GZ5A 4UB6C 1P4AA 2AHQA 4J19A 2IGKA 4HDVA 3TEDA 1OR7C 4RGUA 2H27A 1U5TC 2M4GA 2HOAA 4FX4A 2RDPA 3RKQA 3KZIC 3J80K 4BE0A 3S3OA 2UZKA 4IRIA 2E19A 1IUFA 2L7ZA 1ZARA 2VI6A 2XDVA 3K4MA 3JTHA 1MMNA 3F8NA 3FKJA 3IP4B 3FX3A 3KP3A 4UXNA 2KT0A 4EM1A 4IX7A 2ZFUA 3FXMA 2HS5A 2JPCA 3A02A 1I3AA 3L2CA 4OAZA 3SQNA 3RDIA 1FSEA 1W4MA 3F23A 2CJJA 1OCTC 1B9NA 4EMSA 4J00A 2FBIA 4NB5A 4IQJA 4ESFA 1DQUA 1KQ0A 4AIHA 4LJZF 4RA2A 4QLCU 2Q2EB 1XPXA 1FOWA 3VSLA 5DCMB 2CFXA 4Z2YA 2H09A 2W1OA 2VKDA 1JUMA 2OZUA 4KIBA 2CQXA 1POGA 5JHFA 4M3EA 2FD5A 2AQEA 2CW7A 4ANJA 5IP6A 1K4SA 2LH9A 4DZPA 2JVGA 4RAGA 1XB4A 2JSCA 3VSKA 2FNAA 2PMZN 2P0WA 3KE2A 2HR3A 3A2KA 3QPHA 1TQPA 4OOIA 1BR2A 2CQQA 2ZKZA 2OPTA 2R7VA 1Z77A 3LWFA 4DGWB 4U0VA 1U2WA 4ESBA 3S1NJ 1ETOA 2KQRA 4PUSA 2EPFA 3DEUA 4P96A 2XAJA 1X4PA 5ICGA 3W2VA 2F5DA 4DYRA 4QSHA 3U21A 2LF7A 4RGXA 4IHSA 2JWTA 2QCOA 1XMXA 3H9QA 5JVGF 3J7AY 1DPUA 2F5VA 4IRHA 3FWEA 3CCLI 3HOXJ 2Z2SB 3ABTA 3WGIA 1F5TA 1OYWA 2QLZA 3HTUA 5JLWA 5FLXK 2XUBA 1IXRC 2G9WA 3JREA 2WV0A 1FEXA 2NOGA 3B6AA 1QZYA 2HTSA 2Y31A 1WPKA 2ZFWA 2EBIA 5CLSA 1D1BA 1MIJA 1UHMA 4A0YA 1NH3A 5J40A 1HF0A 1QHHD 3CJNA 1EH8A 3IRRA 1UJ8A
chains in the Genus database with same CATH topology
3FM5A 4HZFA 4KIFA 4Y15A 5AIQA 2FMLA 2LF8A 2MLGA 3EDPA 2K02A 2IVMA 2JPBA 1U78A 2O8XA 3I54A 2JTVA 1CF7A 4IRGA 4R79A 4PGGA 2IA0A 1HXDA 3TDZC 1I27A 1TBXA 2BEOA 3GW2A 3V8JA 1FBSA 1TW3A 2NNNA 3F6OA 5J8CA 1IUYA 1Z1DA 3EQLF 3IWZA 1RNLA 5HLHA 3N97A 4IXAA 2FA5A 5L3FA 1BN5A 3HOSA 4BHCA 1OR7A 1U5TA 3CDHA 4BQAA 2X0LA 4RGRA 2D1HA 2QVOA 4RS8A 5HS9A 4B8XA 4OIOF 1R58A 4UVBA 1TW2A 3QP6A 4RAYA 2VT3A 1CGPA 1L0OC 5L3EA 2Q8KA 4PDKA 1ZRDA 2DQLA 3M1EA 5DD4A 3ISPA 1KYWA 3R0JA 1FBQA 2ZNYA 3P9CA 4HW0A 4S05A 1FOKA 3ML6A 2MLKA 5ILVA 1XGSA 1H9TA 1S29A 2L54A 5ICCA 4KN4X 1WWXA 3WODF 2L01A 4LK0F 1ZGJA 5HDKA 2JRTA 2XAFA 1YW9A 4GYIA 2VE8A 2ZJ2A 4D0PA 4HAMA 2HKXA 4L5IA 5FB2A 2XIGA 2VE9A 1ZLJA 3ZN1A 4RAZA 1SMYF 1LDKB 1QNTA 2DW4A 5E20A 4AWXB 1SFEA 1IN7A 2P6SA 4M71A 5JI6A 2HYGD 2K27A 2PMUA 2XAQA 3DPTA 3K9TA 5FD6A 3I53A 3FMSA 1F4KA 1XD7A 2FOKA 4G7OF 1B4AA 2VBWA 2BV6A 4QWQA 4MHGA 3JW4A 3R0AA 2CQKA 4Q48A 2AS5F 1IN6A 1QPMA 2F5CA 4EJVA 4UV9A 1IF1A 1HW1A 3ULQB 1MKMA 3IKVA 4LD5A 5HLIA 1C0WA 4UV8A 2DFIA 2NS0A 2V6CA 3HRSA 2LSOA 3H3ZA 4A6DA 4ASNA 4KICA 3V7CA 4MTDA 3GZ6A 4LG0B 1BI3A 2P7VB 3ZPLA 2J5PA 3HUGA 2CWEA 1MJAA 2DQRA 4IVNA 2NNYA 2L4MA 4LLLA 2KRFA 1PDNC 2R7DA 3BY6A 2OQRA 5D6EA 3F72A 3LA3A 1WI9A 3JAMK 3F6VA 3QU3A 4JBAA 1LJ9A 3GFMA 4XLNF 5E1WA 3C18A 3GFIA 2GXGA 4G94A 5J8FA 2PBIA 4I7HA 1KYZA 1W5SA 3Q9VA 1ZN2A 5BOXA 1SMTA 2O61A 1MGTA 1FSHA 2O3FA 2WWYA 1O3SA 1KU7A 3KEQA 4WWCA 3BP8A 1ZLKA 2GZWA 1U6GA 2HKOA 3R60A 3R61A 2PI0A 3NEUA 1S7AA 5H20A 4M73A 4HOBA 4G7ZF 4BXUA 1LQ1A 3J81K 1R7JA 2V1UA 2OBPA 3IWFA 3KZYA 1J2XA 1BI1A 1SD6A 3JSPA 4N9IA 3SZTA 3GF2A 1I1SA 4L0YB 4YFNF 3VB2A 3ECHA 1TNSA 5JHUA 4A5MA 5H6RA 3VOEA 4Q5SF 5E17F 4KT5C 2JT1A 4LK1F 1KU3A 1YQAA 2BE5F 1LDDA 4EGYA 3QAHA 3HYIA 3F21A 1ZAOA 2A61A 3B02A 3LSTA 2NYXA 5K1YA 2EV5A 1IN4A 3M9AA 3WTUC 5DEQA 2VOOA 3FMRA 1W7PA 1JE8A 1B1BA 4P9FA 3CO7C 3ZMDA 4ZZLA 3DF8A 2PMHA 3F8BA 4KN7X 3LFKA 5E8GA 2DTRA 4P5OA 2DK5A 4BAYA 3C7JA 1BC8C 1AWCA 2BBYA 2IP2A 3OV8A 3WTVC 1R5HA 1ZH5A 1YS7A 4BHPA 3ZQ7A 2Q0OA 4WCGA 2GIVA 2M87A 4ON0A 2D45A 2ETHA 1E17A 4I02A 3WGHA 1ZYRF 1WKMA 1KU2A 3TOBA 3KLOA 2V1DA 2W84A 3BDDA 3SFZA 3F3XA 4DQ2A 3EUHA 1IXCA 1RUOA 1ZG5A 1HBXG 1DDNA 1YW7A 1J0RA 1SD7A 2HGCA 2E1CA 1RZ4A 2YPRA 1KU9A 3ABUA 3BPVA 4LGWA 4L9NA 1KQ8A 1L3LA 1Z6RA 3WTSC 3T1BA 2EFPA 1USTA 5FO5A 1HW2A 5BPIA 3V4GA 2J5OA 2KIFA 3I5UA 2VN2A 3LQQA 5IT9K 1YW8A 1YLFA 2Z5UA 1FYLA 3GFLA 3WGGA 1F9NA 3KP4A 1FT9A 2KJCA 4EJTA 1Z05A 3TO9A 4E70A 3ELKA 3DFGA 2QBYA 2M8EA 3LAJA 4U7BA 2ZO4A 3QOPA 2VOPA 1W5TA 2WC2A 2RVCA 2EK5A 3QRFF 4PCQA 4GO1A 1J9IA 5LHIA 5LEJA 5CVJA 4RB1A 4L5JA 3CUQB 3G3ZA 1HSTA 3M7GA 3VEPA 1EH6A 1KA8A 1ZG3A 1K78A 1XN7A 4WX9A 2NAZA 2MH9A 5CVVA 2PN6A 3WG9A 4YIIA 1HW5A 1T98A 3I4PA 4M6YA 5D6FA 2V1XA 4MGRA 2NRAC 3P9KA 1S8NA 1YG2A 4WXHA 2P5VA 4AIKA 2PEXA 2EV0A 1OYIA 3I64A 3CO6C 5ILUA 2XRNA 2P6TA 1K7AA 1G3YA 1T2KA 4OIRF 3ROUA 4I0AA 3T0YA 3WU0A 1BIAA 2YSRA 2Y0MA 5ICEA 4KFCA 3COAC 2RNJA 3BJ6A 1G3TA 4CICA 1XDUA 2VODA 2E7WA 2FF4A 2DPDA 4FHTA 2LNBA 4IF4A 3O6BB 3NRVA 2ESHA 3HSFA 4YFXF 3TOAA 3P9IA 2DK8A 4ZYDA 3L00A 3V7SA 3DPLC 5HS8A 3HTSB 3ZP5A 2W57A 2DBBA 2ZMEA 4HQEA 5D5XB 3E6BA 3LA2A 1FP2A 1TLHB 1G6NA 2RQPA 3GXOA 1XCVA 1YS6A 1EH7A 4L9VA 4LB5A 2P4WA 4R1HA 4HF2A 3BROA 3R4KA 3HHGA 4EJUA 2K86A 1IN8A 4G8XA 3DP7A 2EFWA 3WE2A 4KDPA 5BQTA 2TDXA 4LMYA 3I59A 4IHTA 4I01A 1S6LA 1XMAA 3HSEA 3TO6A 4IPAA 3MEXA 3HRUA 4L0ZB 2HZTA 2QQ9A 5JR3A 1UHWA 3HHHA 3QU6A 2IA2A 5HDGA 5LHHA 3IL2A 3M8FA 4MNUA 3O3KA 1MDMB 5D8LB 3J80Z 2MH2A 2HFHA 5D5WB 3GUDA 1ODDA 1FP1D 1LEAA 1J59A 3ZN0A 4U0YA 4OIPF 4HX7A 4LLNA 2ZNZA 3PQKA 2XAGA 1DPRA 1XGOA 2V79A 5LRSA 5JFRA 3TDUC 4UNOA 5FFZA 3KP6A 2PLYA 1ZGAA 2K4JA 4HX8A 2OZ6A 1JHHA 5DDGA 2JZYA 4GYGA 4BNCA 3U2RA 2CG4A 2PG4A 1REPC 1Z7UA 3GWZA 4EQQA 2IJLA 3FXRA 4K2EA 2QYOA 2E1NA 2ZXJA 5E1ZB 2A68F 3V8KA 5L3BA 2W85A 2E7XA 4O6JA 4P9UA 2Q2EA 4FX0A 5A2QK 2XKOA 1NHAA 4H0EA 5DCMA 3E5QA 4HV5A 4WXDA 1ZRFA 2XKPA 5HVQC 2XGXA 5FLXZ 1X3UA 5KK1A 4N0BA 2XHKA 2Y75A 1EV7A 4M9SA 1QQIA 4M9ZA 1B9MA 2DAOA 4G9YA 3F22A 3GO5A 4KUMA 4CYDA 1Z91A 2XVCA 2O6GE 3PQJA 2QZ8A 3CTAA 1XGNA 1IRGA 5L3DA 4BH9A 2H94A 3DKWA 4PZJA 3W6KB 3MAJA 2EJRA 3FHZA 1U8RA 2A6EF 3GEZA 2B0LA 1H9GA 3ZMUA 5J6XA 1PUEE 3BJOA 1MJ9A 3KFWX 3DV8A 3J7AO 2RC4A 3O2PE 2GA1A 1YFHA 1VTNC 4MEXF 2X4HA 5LRRA 5DD8A 1ON2A 3BJAA 3S2WA 1JGSA 4RGSA 1GVJA 1ZHFA 4I2OA 1V3FA 3RKYA 2BGCA 5CVRA 1IRFA 1BIBA 2P5KA 3H92A 3AAFA 2G7HA 3R6SA 3EYIA 4O3MA 2A3SA 4GXOA 3ZMZA 1JXSA 1UFMA 5LHGA 2L3DA 1R1UA 3T8TA 3L09A 1FPQA 5TJJA 5DV5A 2CYYA 3FXUA 3D5LA 1R1TA 2QWWA 4A0ZA 2DO7A 1O7LA 3B73A 3REOA 5CJ9A 1DP7P 1KGSA 1CF7B 4I0BA 3TQNA 4U7DA 2STTA 4HBLA 5AIPA 3HSRA 3MWMA 4MQVA 3I71A 2HDCA 1ZRCA 2VBYA 2P5LC 2GWRA 2O03A 5DUKA 4B09A 1J7KA 2QM3A 2A6HF 3BPXA 4ZZDA 3NQOA 2YX7A 4LFUA 4Q4ZF 1KQ9A 1W7PD 1U5TB 4M6XA 2VONA 1P92A 5ILSA 2MA3A 2YR2A 3GFJA 3LQRA 3T8RA 4S04A 4G7HF 1T38A 3E5XA 1P4WA 2M45A 3WTZA 3FM3A 4A6EA 2HEOA 2VBZA 3IRQA 4DNCA 1QGPA 3MZYA 3RIRA 2RV8A 6PAXA 3I58A 2D1VA 2P8TA 4UVAA 3TO7A 2QQBA 1D3YA 3F8CA 2IT0A 1FX7A 4HF0A 3K0LA 2EWNA 3SXYA 1B6AA 4ESJA 3JAMZ 3ZMTA 3QPTA 3GX4X 4UVCA 3P7NA 1R00A 2F5EA 3KZZA 3H3UA 4BYYA 3U9GA 5ERIA 4CDGA 1PP7U 1UB9A 4LG0A 2ESNA 1SAXA 2FXAA 4Y13A 3SHFA 3MQ0A 1Z9CA 1RIOH 5D4RA 3OOPA 1Z6TA 4OMZA 4KIGA 1F1ZA 2QENA 4O5VA 4XSXF 5AONA 1AOYA 1USSA 1O3RA 1GXPA 2HQRA 2XAHA 1J75A 3RKWA 4TV7A 3BZ6A 4RB2C 3ERED 4M9XA 3JSOA 3J81Z 1H0MA 1MJBA 1WQ2A 2PJPA 3GVAA 2YX4A 1T0FA 2O0YA 3U1DA 5HLGA 4CHUA 2HYFA 1T39A 2FRHA 4OU0A 5ICFA 2AXLA 1WRJA 1TQMA 4HV6A 2ADUA 5DCFA 5K5RA 1O3TA 4IJAA 4CXFA 1ON1A 1J5YA 1P4XA 1HSJA 1FYMA 2P7CB 2Z9OA 5K5QA 3E6DA 2HTJA 4I98B 5L3GA 1IXSB 1IN5A 2Y48A 2BYVE 1XCBA 4A12A 4MQ9F 2ISYA 2VC1A 3M8EA 2VBXA 1G3SA 4YFKF 3E3VA 4L9TA 3W6JB 3KEOA 3MFKA 4GCVA 4HQMA 1YIOA 2CW0F 4ENNA 1FYKA 1BC7C 4KA4A 1MZBA 3GLXA 2A5YB 2OD5A 2OQGA 4N9HA 1PP8F 2QQAA 1DUXC 5JVTA 3L7WA 4WK8F 2EFNA 2COMA 3LA7A 3HOTA 4CO8A 1Y0UA 3V8LA 1G3WA 1UCRA 3MZHA 2W24A 3K1PA 5H6QA 2FNPA 2H6CA 2YU3A 1Q1HA 5D5UB 3HRTA 4OIQF 3VFZA 2W25A 1R23A 1YYVA 3WTYC 2CSOA 2PFBA 5IT3A 4HF1A 4ENMA 4XRFA 2LDUA 1O7FA 3CUQC 3EYYA 5FGMA 1R5GA 2IA1A 4U0WA 4I09A 2GXBA 4YG2F 2L02A 3IC7A 2R3SA 4L9JA 2DI3A 4PGHA 4A2UA 4UUVA 3F8MA 2M5WA 3WE3A 2EFOA 4G6QA 3Q9SA 4KNYA 4OINF 5LLQA 4JK1X 1FC3A 1IW7F 2DPUA 4ENJA 5LGTA 1FBUA 1BI0A 2KKOA 3DXJF 1OPCA 2KIMA 5TRDA 4JQFA 4YIFA 2GQQA 1XMKA 3WU1B 1OYYA 2R7FA 5K5OA 5D8KB 1GXQA 1TQIA 1W7PB 3E6CC 4L18B 1JHFA 1ULYA 2CO5A 3ECOA 4ZH4F 4HX4A 4AIJA 5LBQA 5IT9Z 1TTYA 3HRMA 3KETA 1FY7A 4KMUX 5D5VB 2KJBA 3PFIA 2UXXA 4HA8A 1ZREA 2CGPA 3K2ZA 2DLLA 4WF2A 2VC0A 2EA4A 2RGVA 5F6FA 5LGUA 1HKSA 2EA2A 4EM0B 2ISZA 2MD5A 2VT2A 2D2WA 1YO5C 1LDJA 2A69F 3DQVC 3IHUA 1T6SA 5FFXA 2MC3A 3IKTA 4Q47A 3V7RA 4ZYGA 4AVPA 1D8KA 2OU2A 5HDNA 2ZCWA 2F5FA 2DT5A 3JTGA 4NHJA 3K69A 2FSWA 2KIUA 1HKTA 1BI2A 3KP5A 3N4MA 3FMQA 1MD0A 1D8JA 1SD4A 2HWVA 4HLYA 4XBFA 3VODA 2LKPA 1QBJA 3SZPA 3RPUA 2XROA 3E5UA 3CUQA 2FBHA 1SFXA 4R8HA 1XSVA 1U3EM 2UWMA 1K79A 1D5VA 1S3JA 2VXZA 3WTTC 4EM2A 2C6YA 5KVRA 3WTXC 4GGGA 1SFUA 4M74A 2QBYB 5CVUA 2FMYA 4U88A 3LAPA 4UHTA 2V9VA 2FU4A 3E6MA 4EJWA 2K7LA 5E8IA 5DYMA 2Z3YA 4XLPF 2XV4S 1QO0D 2FE3A 2Z99A 3BOQA 2ELHA 5BMZA 4WXCA 1HKQA 4NQWA 2FEZA 1A04A 4MTEA 2K4BA 4EV0A 4RB3C 3WTWC 1ONVA 2F2EA 4ZYHA 2FQ3A 3CLOA 3RYRA 1YTYA 3RKXA 5CYVA 1R22A 5D4SA 1K78B 4OMYA 1V4RA 3FF5A 5BS6A 4KMFA 3RYPA 2IW5A 3C1DA 1FWZA 5ED4A 3Q5FA 3ZMSA 5E1XA 2MBFA 3FZVA 4EJOA 1WSUA 1HQCA 5CVIA 4ENKA 1I1GA 4EGZA 4XSZF 3EETA 3KP7A 3KCCA 5EEGA 5EEHA 3KLNA 3TGNA 4A5NA 1BJAA 1IZ1A 2XASA 1FZPB 3C3WA 2WTEA 2OAZA 3BWGA 1G4DA 3QP5A 4P55A 2G7UA 3K1NA 2RKHA 2RN7A 4CGZA 4AD9A 4CZZA 1GHCA 3RPQA 1LVAA 3RI4A 3E97A 2UXNA 1XDSA 2M30A 1IAWA 3T5XA 5LGNA 1S7OA 3RJPA 5E18F 2IPQX 2HQNA 1BM9A 1K6OA 1XGMA 1OKRA 2ZBKA 5LEKA 3RTRA 1FNNA 2OA4A 1LNWA 2A07F 1BOAA 4FT8A 3TKYA 2PQ8A 2ZMEB 3I0TA 1P2FA 2STWA 5HS7A 4HYEA 1LB2A 4HLXA 1I6XA 1FLIA 3L9FA 1MDMA 2H6BA 3HIFA 2IRFG 3K1MA 5F64A 2ACJA 3GYHX 4LB6B 1QZZA 3KP2A 5L3CA 4EVIA 1R1VA 4G6DA 1SD5A 1O3QA 2L4AA 4HDUA 1O57A 1LEBA 1ZG1A 3G73A 4LLGF 3F8FA 4F7ZA 3I59B 2GA2A 1RI7A 5A2QZ 3FXQA 4M72A 5HOOA 1B59A 3CUOA 4ETSA 3D0SA 2EB7A 1E2XA 4KYWA 5F1RA 1OMIA 4ZYEA 5BPDA 1XSDA 2EFQA 1XSXA 2GAUA 2FBKA 4Y17A 2DU9A 2HOEA 1R36A 3ZMVA 1TNTA 4MEYF 4RB0A 4A0XA 3MCZA 1P6RA 2M1BA 2Z33A 2EV6A 5DUIA 1RUNA 1I5ZA 1BBYA 5FD5A 4BHBA 2QUFA 1STZA 3GZ5A 1P4AA 4HDVA 2H27A 4RGUA 1U5TC 4FX4A 2RDPA 3J80K 2UZKA 4IRIA 1ZARA 3JTHA 3F8NA 3FX3A 3KP3A 4UXNA 4EM1A 2HS5A 2JPCA 3L2CA 3SQNA 3RDIA 1FSEA 1W4MA 3F23A 1B9NA 4EMSA 2FBIA 4NB5A 4ESFA 1KQ0A 4AIHA 4LJZF 4QLCU 5DCMB 2CFXA 4Z2YA 2H09A 2OZUA 4KIBA 1XB4A 2JSCA 2FNAA 3KE2A 2HR3A 3QPHA 1TQPA 4OOIA 2ZKZA 3LWFA 4U0VA 1U2WA 4ESBA 4P96A 3DEUA 2XAJA 5ICGA 2F5DA 2LF7A 4RGXA 4IHSA 1DPUA 4IRHA 3FWEA 3ABTA 3WGIA 1F5TA 1OYWA 2QLZA 3HTUA 5FLXK 2XUBA 1IXRC 2G9WA 2WV0A 1QZYA 2HTSA 2ZFWA 5CLSA 1UHMA 4A0YA 3CJNA 1EH8A 3IRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM5 A;  4HZF A;  4KIF A;  4Y15 A;  5AIQ A;  2FML A;  2LF8 A;  2MLG A;  3EDP A;  2K02 A;  2IVM A;  2JPB A;  1U78 A;  2O8X A;  3I54 A;  2JTV A;  1CF7 A;  4IRG A;  4R79 A;  4PGG A;  2IA0 A;  1HXD A;  3TDZ C;  1I27 A;  1TBX A;  2BEO A;  3GW2 A;  3V8J A;  1FBS A;  1TW3 A;  2NNN A;  3F6O A;  5J8C A;  1IUY A;  1Z1D A;  3EQL F;  3IWZ A;  1RNL A;  5HLH A;  3N97 A;  4IXA A;  2FA5 A;  5L3F A;  1BN5 A;  3HOS A;  4BHC A;  1OR7 A;  1U5T A;  3CDH A;  4BQA A;  2X0L A;  4RGR A;  2D1H A;  2QVO A;  4RS8 A;  5HS9 A;  4B8X A;  4OIO F;  1R58 A;  4UVB A;  1TW2 A;  3QP6 A;  4RAY A;  2VT3 A;  1CGP A;  1L0O C;  5L3E A;  2Q8K A;  4PDK A;  1ZRD A;  2DQL A;  3M1E A;  5DD4 A;  3ISP A;  1KYW A;  3R0J A;  1FBQ A;  2ZNY A;  3P9C A;  4HW0 A;  4S05 A;  1FOK A;  3ML6 A;  2MLK A;  5ILV A;  1XGS A;  1H9T A;  1S29 A;  2L54 A;  5ICC A;  4KN4 X;  1WWX A;  3WOD F;  2L01 A;  4LK0 F;  1ZGJ A;  5HDK A;  2JRT A;  2XAF A;  1YW9 A;  4GYI A;  2VE8 A;  2ZJ2 A;  4D0P A;  4HAM A;  2HKX A;  4L5I A;  5FB2 A;  2XIG A;  2VE9 A;  1ZLJ A;  3ZN1 A;  4RAZ A;  1SMY F;  1LDK B;  1QNT A;  2DW4 A;  5E20 A;  4AWX B;  1SFE A;  1IN7 A;  2P6S A;  4M71 A;  5JI6 A;  2HYG D;  2K27 A;  2PMU A;  2XAQ A;  3DPT A;  3K9T A;  5FD6 A;  3I53 A;  3FMS A;  1F4K A;  1XD7 A;  2FOK A;  4G7O F;  1B4A A;  2VBW A;  2BV6 A;  4QWQ A;  4MHG A;  3JW4 A;  3R0A A;  2CQK A;  4Q48 A;  2AS5 F;  1IN6 A;  1QPM A;  2F5C A;  4EJV A;  4UV9 A;  1IF1 A;  1HW1 A;  3ULQ B;  1MKM A;  3IKV A;  4LD5 A;  5HLI A;  1C0W A;  4UV8 A;  2DFI A;  2NS0 A;  2V6C A;  3HRS A;  2LSO A;  3H3Z A;  4A6D A;  4ASN A;  4KIC A;  3V7C A;  4MTD A;  3GZ6 A;  4LG0 B;  1BI3 A;  2P7V B;  3ZPL A;  2J5P A;  3HUG A;  2CWE A;  1MJA A;  2DQR A;  4IVN A;  2NNY A;  2L4M A;  4LLL A;  2KRF A;  1PDN C;  2R7D A;  3BY6 A;  2OQR A;  5D6E A;  3F72 A;  3LA3 A;  1WI9 A;  3JAM K;  3F6V A;  3QU3 A;  4JBA A;  1LJ9 A;  3GFM A;  4XLN F;  5E1W A;  3C18 A;  3GFI A;  2GXG A;  4G94 A;  5J8F A;  2PBI A;  4I7H A;  1KYZ A;  1W5S A;  3Q9V A;  1ZN2 A;  5BOX A;  1SMT A;  2O61 A;  1MGT A;  1FSH A;  2O3F A;  2WWY A;  1O3S A;  1KU7 A;  3KEQ A;  4WWC A;  3BP8 A;  1ZLK A;  2GZW A;  1U6G A;  2HKO A;  3R60 A;  3R61 A;  2PI0 A;  3NEU A;  1S7A A;  5H20 A;  4M73 A;  4HOB A;  4G7Z F;  4BXU A;  1LQ1 A;  3J81 K;  1R7J A;  2V1U A;  2OBP A;  3IWF A;  3KZY A;  1J2X A;  1BI1 A;  1SD6 A;  3JSP A;  4N9I A;  3SZT A;  3GF2 A;  1I1S A;  4L0Y B;  4YFN F;  3VB2 A;  3ECH A;  1TNS A;  5JHU A;  4A5M A;  5H6R A;  3VOE A;  4Q5S F;  5E17 F;  4KT5 C;  2JT1 A;  4LK1 F;  1KU3 A;  1YQA A;  2BE5 F;  1LDD A;  4EGY A;  3QAH A;  3HYI A;  3F21 A;  1ZAO A;  2A61 A;  3B02 A;  3LST A;  2NYX A;  5K1Y A;  2EV5 A;  1IN4 A;  3M9A A;  3WTU C;  5DEQ A;  2VOO A;  3FMR A;  1W7P A;  1JE8 A;  1B1B A;  4P9F A;  3CO7 C;  3ZMD A;  4ZZL A;  3DF8 A;  2PMH A;  3F8B A;  4KN7 X;  3LFK A;  5E8G A;  2DTR A;  4P5O A;  2DK5 A;  4BAY A;  3C7J A;  1BC8 C;  1AWC A;  2BBY A;  2IP2 A;  3OV8 A;  3WTV C;  1R5H A;  1ZH5 A;  1YS7 A;  4BHP A;  3ZQ7 A;  2Q0O A;  4WCG A;  2GIV A;  2M87 A;  4ON0 A;  2D45 A;  2ETH A;  1E17 A;  4I02 A;  3WGH A;  1ZYR F;  1WKM A;  1KU2 A;  3TOB A;  3KLO A;  2V1D A;  2W84 A;  3BDD A;  3SFZ A;  3F3X A;  4DQ2 A;  3EUH A;  1IXC A;  1RUO A;  1ZG5 A;  1HBX G;  1DDN A;  1YW7 A;  1J0R A;  1SD7 A;  2HGC A;  2E1C A;  1RZ4 A;  2YPR A;  1KU9 A;  3ABU A;  3BPV A;  4LGW A;  4L9N A;  1KQ8 A;  1L3L A;  1Z6R A;  3WTS C;  3T1B A;  2EFP A;  1UST A;  5FO5 A;  1HW2 A;  5BPI A;  3V4G A;  2J5O A;  2KIF A;  3I5U A;  2VN2 A;  3LQQ A;  5IT9 K;  1YW8 A;  1YLF A;  2Z5U A;  1FYL A;  3GFL A;  3WGG A;  1F9N A;  3KP4 A;  1FT9 A;  2KJC A;  4EJT A;  1Z05 A;  3TO9 A;  4E70 A;  3ELK A;  3DFG A;  2QBY A;  2M8E A;  3LAJ A;  4U7B A;  2ZO4 A;  3QOP A;  2VOP A;  1W5T A;  2WC2 A;  2RVC A;  2EK5 A;  3QRF F;  4PCQ A;  4GO1 A;  1J9I A;  5LHI A;  5LEJ A;  5CVJ A;  4RB1 A;  4L5J A;  3CUQ B;  3G3Z A;  1HST A;  3M7G A;  3VEP A;  1EH6 A;  1KA8 A;  1ZG3 A;  1K78 A;  1XN7 A;  4WX9 A;  2NAZ A;  2MH9 A;  5CVV A;  2PN6 A;  3WG9 A;  4YII A;  1HW5 A;  1T98 A;  3I4P A;  4M6Y A;  5D6F A;  2V1X A;  4MGR A;  2NRA C;  3P9K A;  1S8N A;  1YG2 A;  4WXH A;  2P5V A;  4AIK A;  2PEX A;  2EV0 A;  1OYI A;  3I64 A;  3CO6 C;  5ILU A;  2XRN A;  2P6T A;  1K7A A;  1G3Y A;  1T2K A;  4OIR F;  3ROU A;  4I0A A;  3T0Y A;  3WU0 A;  1BIA A;  2YSR A;  2Y0M A;  5ICE A;  4KFC A;  3COA C;  2RNJ A;  3BJ6 A;  1G3T A;  4CIC A;  1XDU A;  2VOD A;  2E7W A;  2FF4 A;  2DPD A;  4FHT A;  2LNB A;  4IF4 A;  3O6B B;  3NRV A;  2ESH A;  3HSF A;  4YFX F;  3TOA A;  3P9I A;  2DK8 A;  4ZYD A;  3L00 A;  3V7S A;  3DPL C;  5HS8 A;  3HTS B;  3ZP5 A;  2W57 A;  2DBB A;  2ZME A;  4HQE A;  5D5X B;  3E6B A;  3LA2 A;  1FP2 A;  1TLH B;  1G6N A;  2RQP A;  3GXO A;  1XCV A;  1YS6 A;  1EH7 A;  4L9V A;  4LB5 A;  2P4W A;  4R1H A;  4HF2 A;  3BRO A;  3R4K A;  3HHG A;  4EJU A;  2K86 A;  1IN8 A;  4G8X A;  3DP7 A;  2EFW A;  3WE2 A;  4KDP A;  5BQT A;  2TDX A;  4LMY A;  3I59 A;  4IHT A;  4I01 A;  1S6L A;  1XMA A;  3HSE A;  3TO6 A;  4IPA A;  3MEX A;  3HRU A;  4L0Z B;  2HZT A;  2QQ9 A;  5JR3 A;  1UHW A;  3HHH A;  3QU6 A;  2IA2 A;  5HDG A;  5LHH A;  3IL2 A;  3M8F A;  4MNU A;  3O3K A;  1MDM B;  5D8L B;  3J80 Z;  2MH2 A;  2HFH A;  5D5W B;  3GUD A;  1ODD A;  1FP1 D;  1LEA A;  1J59 A;  3ZN0 A;  4U0Y A;  4OIP F;  4HX7 A;  4LLN A;  2ZNZ A;  3PQK A;  2XAG A;  1DPR A;  1XGO A;  2V79 A;  5LRS A;  5JFR A;  3TDU C;  4UNO A;  5FFZ A;  3KP6 A;  2PLY A;  1ZGA A;  2K4J A;  4HX8 A;  2OZ6 A;  1JHH A;  5DDG A;  2JZY A;  4GYG A;  4BNC A;  3U2R A;  2CG4 A;  2PG4 A;  1REP C;  1Z7U A;  3GWZ A;  4EQQ A;  2IJL A;  3FXR A;  4K2E A;  2QYO A;  2E1N A;  2ZXJ A;  5E1Z B;  2A68 F;  3V8K A;  5L3B A;  2W85 A;  2E7X A;  4O6J A;  4P9U A;  2Q2E A;  4FX0 A;  5A2Q K;  2XKO A;  1NHA A;  4H0E A;  5DCM A;  3E5Q A;  4HV5 A;  4WXD A;  1ZRF A;  2XKP A;  5HVQ C;  2XGX A;  5FLX Z;  1X3U A;  5KK1 A;  4N0B A;  2XHK A;  2Y75 A;  1EV7 A;  4M9S A;  1QQI A;  4M9Z A;  1B9M A;  2DAO A;  4G9Y A;  3F22 A;  3GO5 A;  4KUM A;  4CYD A;  1Z91 A;  2XVC A;  2O6G E;  3PQJ A;  2QZ8 A;  3CTA A;  1XGN A;  1IRG A;  5L3D A;  4BH9 A;  2H94 A;  3DKW A;  4PZJ A;  3W6K B;  3MAJ A;  2EJR A;  3FHZ A;  1U8R A;  2A6E F;  3GEZ A;  2B0L A;  1H9G A;  3ZMU A;  5J6X A;  1PUE E;  3BJO A;  1MJ9 A;  3KFW X;  3DV8 A;  3J7A O;  2RC4 A;  3O2P E;  2GA1 A;  1YFH A;  1VTN C;  4MEX F;  2X4H A;  5LRR A;  5DD8 A;  1ON2 A;  3BJA A;  3S2W A;  1JGS A;  4RGS A;  1GVJ A;  1ZHF A;  4I2O A;  1V3F A;  3RKY A;  2BGC A;  5CVR A;  1IRF A;  1BIB A;  2P5K A;  3H92 A;  3AAF A;  2G7H A;  3R6S A;  3EYI A;  4O3M A;  2A3S A;  4GXO A;  3ZMZ A;  1JXS A;  1UFM A;  5LHG A;  2L3D A;  1R1U A;  3T8T A;  3L09 A;  1FPQ A;  5TJJ A;  5DV5 A;  2CYY A;  3FXU A;  3D5L A;  1R1T A;  2QWW A;  4A0Z A;  2DO7 A;  1O7L A;  3B73 A;  3REO A;  5CJ9 A;  1DP7 P;  1KGS A;  1CF7 B;  4I0B A;  3TQN A;  4U7D A;  2STT A;  4HBL A;  5AIP A;  3HSR A;  3MWM A;  4MQV A;  3I71 A;  2HDC A;  1ZRC A;  2VBY A;  2P5L C;  2GWR A;  2O03 A;  5DUK A;  4B09 A;  1J7K A;  2QM3 A;  2A6H F;  3BPX A;  4ZZD A;  3NQO A;  2YX7 A;  4LFU A;  4Q4Z F;  1KQ9 A;  1W7P D;  1U5T B;  4M6X A;  2VON A;  1P92 A;  5ILS A;  2MA3 A;  2YR2 A;  3GFJ A;  3LQR A;  3T8R A;  4S04 A;  4G7H F;  1T38 A;  3E5X A;  1P4W A;  2M45 A;  3WTZ A;  3FM3 A;  4A6E A;  2HEO A;  2VBZ A;  3IRQ A;  4DNC A;  1QGP A;  3MZY A;  3RIR A;  2RV8 A;  6PAX A;  3I58 A;  2D1V A;  2P8T A;  4UVA A;  3TO7 A;  2QQB A;  1D3Y A;  3F8C A;  2IT0 A;  1FX7 A;  4HF0 A;  3K0L A;  2EWN A;  3SXY A;  1B6A A;  4ESJ A;  3JAM Z;  3ZMT A;  3QPT A;  3GX4 X;  4UVC A;  3P7N A;  1R00 A;  2F5E A;  3KZZ A;  3H3U A;  4BYY A;  3U9G A;  5ERI A;  4CDG A;  1PP7 U;  1UB9 A;  4LG0 A;  2ESN A;  1SAX A;  2FXA A;  4Y13 A;  3SHF A;  3MQ0 A;  1Z9C A;  1RIO H;  5D4R A;  3OOP A;  1Z6T A;  4OMZ A;  4KIG A;  1F1Z A;  2QEN A;  4O5V A;  4XSX F;  5AON A;  1AOY A;  1USS A;  1O3R A;  1GXP A;  2HQR A;  2XAH A;  1J75 A;  3RKW A;  4TV7 A;  3BZ6 A;  4RB2 C;  3ERE D;  4M9X A;  3JSO A;  3J81 Z;  1H0M A;  1MJB A;  1WQ2 A;  2PJP A;  3GVA A;  2YX4 A;  1T0F A;  2O0Y A;  3U1D A;  5HLG A;  4CHU A;  2HYF A;  1T39 A;  2FRH A;  4OU0 A;  5ICF A;  2AXL A;  1WRJ A;  1TQM A;  4HV6 A;  2ADU A;  5DCF A;  5K5R A;  1O3T A;  4IJA A;  4CXF A;  1ON1 A;  1J5Y A;  1P4X A;  1HSJ A;  1FYM A;  2P7C B;  2Z9O A;  5K5Q A;  3E6D A;  2HTJ A;  4I98 B;  5L3G A;  1IXS B;  1IN5 A;  2Y48 A;  2BYV E;  1XCB A;  4A12 A;  4MQ9 F;  2ISY A;  2VC1 A;  3M8E A;  2VBX A;  1G3S A;  4YFK F;  3E3V A;  4L9T A;  3W6J B;  3KEO A;  3MFK A;  4GCV A;  4HQM A;  1YIO A;  2CW0 F;  4ENN A;  1FYK A;  1BC7 C;  4KA4 A;  1MZB A;  3GLX A;  2A5Y B;  2OD5 A;  2OQG A;  4N9H A;  1PP8 F;  2QQA A;  1DUX C;  5JVT A;  3L7W A;  4WK8 F;  2EFN A;  2COM A;  3LA7 A;  3HOT A;  4CO8 A;  1Y0U A;  3V8L A;  1G3W A;  1UCR A;  3MZH A;  2W24 A;  3K1P A;  5H6Q A;  2FNP A;  2H6C A;  2YU3 A;  1Q1H A;  5D5U B;  3HRT A;  4OIQ F;  3VFZ A;  2W25 A;  1R23 A;  1YYV A;  3WTY C;  2CSO A;  2PFB A;  5IT3 A;  4HF1 A;  4ENM A;  4XRF A;  2LDU A;  1O7F A;  3CUQ C;  3EYY A;  5FGM A;  1R5G A;  2IA1 A;  4U0W A;  4I09 A;  2GXB A;  4YG2 F;  2L02 A;  3IC7 A;  2R3S A;  4L9J A;  2DI3 A;  4PGH A;  4A2U A;  4UUV A;  3F8M A;  2M5W A;  3WE3 A;  2EFO A;  4G6Q A;  3Q9S A;  4KNY A;  4OIN F;  5LLQ A;  4JK1 X;  1FC3 A;  1IW7 F;  2DPU A;  4ENJ A;  5LGT A;  1FBU A;  1BI0 A;  2KKO A;  3DXJ F;  1OPC A;  2KIM A;  5TRD A;  4JQF A;  4YIF A;  2GQQ A;  1XMK A;  3WU1 B;  1OYY A;  2R7F A;  5K5O A;  5D8K B;  1GXQ A;  1TQI A;  1W7P B;  3E6C C;  4L18 B;  1JHF A;  1ULY A;  2CO5 A;  3ECO A;  4ZH4 F;  4HX4 A;  4AIJ A;  5LBQ A;  5IT9 Z;  1TTY A;  3HRM A;  3KET A;  1FY7 A;  4KMU X;  5D5V B;  2KJB A;  3PFI A;  2UXX A;  4HA8 A;  1ZRE A;  2CGP A;  3K2Z A;  2DLL A;  4WF2 A;  2VC0 A;  2EA4 A;  2RGV A;  5F6F A;  5LGU A;  1HKS A;  2EA2 A;  4EM0 B;  2ISZ A;  2MD5 A;  2VT2 A;  2D2W A;  1YO5 C;  1LDJ A;  2A69 F;  3DQV C;  3IHU A;  1T6S A;  5FFX A;  2MC3 A;  3IKT A;  4Q47 A;  3V7R A;  4ZYG A;  4AVP A;  1D8K A;  2OU2 A;  5HDN A;  2ZCW A;  2F5F A;  2DT5 A;  3JTG A;  4NHJ A;  3K69 A;  2FSW A;  2KIU A;  1HKT A;  1BI2 A;  3KP5 A;  3N4M A;  3FMQ A;  1MD0 A;  1D8J A;  1SD4 A;  2HWV A;  4HLY A;  4XBF A;  3VOD A;  2LKP A;  1QBJ A;  3SZP A;  3RPU A;  2XRO A;  3E5U A;  3CUQ A;  2FBH A;  1SFX A;  4R8H A;  1XSV A;  1U3E M;  2UWM A;  1K79 A;  1D5V A;  1S3J A;  2VXZ A;  3WTT C;  4EM2 A;  2C6Y A;  5KVR A;  3WTX C;  4GGG A;  1SFU A;  4M74 A;  2QBY B;  5CVU A;  2FMY A;  4U88 A;  3LAP A;  4UHT A;  2V9V A;  2FU4 A;  3E6M A;  4EJW A;  2K7L A;  5E8I A;  5DYM A;  2Z3Y A;  4XLP F;  2XV4 S;  1QO0 D;  2FE3 A;  2Z99 A;  3BOQ A;  2ELH A;  5BMZ A;  4WXC A;  1HKQ A;  4NQW A;  2FEZ A;  1A04 A;  4MTE A;  2K4B A;  4EV0 A;  4RB3 C;  3WTW C;  1ONV A;  2F2E A;  4ZYH A;  2FQ3 A;  3CLO A;  3RYR A;  1YTY A;  3RKX A;  5CYV A;  1R22 A;  5D4S A;  1K78 B;  4OMY A;  1V4R A;  3FF5 A;  5BS6 A;  4KMF A;  3RYP A;  2IW5 A;  3C1D A;  1FWZ A;  5ED4 A;  3Q5F A;  3ZMS A;  5E1X A;  2MBF A;  3FZV A;  4EJO A;  1WSU A;  1HQC A;  5CVI A;  4ENK A;  1I1G A;  4EGZ A;  4XSZ F;  3EET A;  3KP7 A;  3KCC A;  5EEG A;  5EEH A;  3KLN A;  3TGN A;  4A5N A;  1BJA A;  1IZ1 A;  2XAS A;  1FZP B;  3C3W A;  2WTE A;  2OAZ A;  3BWG A;  1G4D A;  3QP5 A;  4P55 A;  2G7U A;  3K1N A;  2RKH A;  2RN7 A;  4CGZ A;  4AD9 A;  4CZZ A;  1GHC A;  3RPQ A;  1LVA A;  3RI4 A;  3E97 A;  2UXN A;  1XDS A;  2M30 A;  1IAW A;  3T5X A;  5LGN A;  1S7O A;  3RJP A;  5E18 F;  2IPQ X;  2HQN A;  1BM9 A;  1K6O A;  1XGM A;  1OKR A;  2ZBK A;  5LEK A;  3RTR A;  1FNN A;  2OA4 A;  1LNW A;  2A07 F;  1BOA A;  4FT8 A;  3TKY A;  2PQ8 A;  2ZME B;  3I0T A;  1P2F A;  2STW A;  5HS7 A;  4HYE A;  1LB2 A;  4HLX A;  1I6X A;  1FLI A;  3L9F A;  1MDM A;  2H6B A;  3HIF A;  2IRF G;  3K1M A;  5F64 A;  2ACJ A;  3GYH X;  4LB6 B;  1QZZ A;  3KP2 A;  5L3C A;  4EVI A;  1R1V A;  4G6D A;  1SD5 A;  1O3Q A;  2L4A A;  4HDU A;  1O57 A;  1LEB A;  1ZG1 A;  3G73 A;  4LLG F;  3F8F A;  4F7Z A;  3I59 B;  2GA2 A;  1RI7 A;  5A2Q Z;  3FXQ A;  4M72 A;  5HOO A;  1B59 A;  3CUO A;  4ETS A;  3D0S A;  2EB7 A;  1E2X A;  4KYW A;  5F1R A;  1OMI A;  4ZYE A;  5BPD A;  1XSD A;  2EFQ A;  1XSX A;  2GAU A;  2FBK A;  4Y17 A;  2DU9 A;  2HOE A;  1R36 A;  3ZMV A;  1TNT A;  4MEY F;  4RB0 A;  4A0X A;  3MCZ A;  1P6R A;  2M1B A;  2Z33 A;  2EV6 A;  5DUI A;  1RUN A;  1I5Z A;  1BBY A;  5FD5 A;  4BHB A;  2QUF A;  1STZ A;  3GZ5 A;  1P4A A;  4HDV A;  2H27 A;  4RGU A;  1U5T C;  4FX4 A;  2RDP A;  3J80 K;  2UZK A;  4IRI A;  1ZAR A;  3JTH A;  3F8N A;  3FX3 A;  3KP3 A;  4UXN A;  4EM1 A;  2HS5 A;  2JPC A;  3L2C A;  3SQN A;  3RDI A;  1FSE A;  1W4M A;  3F23 A;  1B9N A;  4EMS A;  2FBI A;  4NB5 A;  4ESF A;  1KQ0 A;  4AIH A;  4LJZ F;  4QLC U;  5DCM B;  2CFX A;  4Z2Y A;  2H09 A;  2OZU A;  4KIB A;  1XB4 A;  2JSC A;  2FNA A;  3KE2 A;  2HR3 A;  3QPH A;  1TQP A;  4OOI A;  2ZKZ A;  3LWF A;  4U0V A;  1U2W A;  4ESB A;  4P96 A;  3DEU A;  2XAJ A;  5ICG A;  2F5D A;  2LF7 A;  4RGX A;  4IHS A;  1DPU A;  4IRH A;  3FWE A;  3ABT A;  3WGI A;  1F5T A;  1OYW A;  2QLZ A;  3HTU A;  5FLX K;  2XUB A;  1IXR C;  2G9W A;  2WV0 A;  1QZY A;  2HTS A;  2ZFW A;  5CLS A;  1UHM A;  4A0Y A;  3CJN A;  1EH8 A;  3IRR A; 
#chains in the Genus database with same CATH topology
 2LYC A;  3FM5 A;  3DKX A;  2X6Y A;  1LKX A;  4HZF A;  2PMZ A;  2W4S A;  4FIS A;  1H8A C;  1YRN B;  4DBR A;  4KIF A;  2A05 A;  2F4O B;  4Y15 A;  5AIQ A;  1JKR C;  2FML A;  1BR1 A;  4FE4 A;  4AID A;  1P7I A;  2LF8 A;  3K2A A;  2MLG A;  2E71 A;  4C9Y A;  2BY2 A;  3CJQ B;  3EDP A;  2K02 A;  4D7N A;  2IVM A;  2JPB A;  2V7F A;  1U78 A;  4IL6 C;  2NVU B;  2O8X A;  3I54 A;  3L2Q A;  2JTV A;  3DCF A;  1CF7 A;  1R4M B;  2DYS H;  3PNT A;  2MC4 A;  3IUO A;  4IRG A;  5C4J J;  4R79 A;  4PGG A;  3Q0U A;  2IA0 A;  2R5Y B;  1HXD A;  3TDZ C;  3KEY A;  3HDD A;  1I27 A;  1Z3Y A;  1S72 I;  1TBX A;  3V42 A;  3GTJ J;  4C2U A;  1YIT I;  4KT6 A;  2LRD A;  4M3D A;  3A4C A;  2BEO A;  3GW2 A;  3GTQ J;  4E7I A;  3JRB A;  2VJJ A;  3V8J A;  4LOC A;  4UB8 C;  1FBS A;  1TW3 A;  2NNN A;  3F6O A;  5J8C A;  3S15 J;  1IUY A;  1Z1D A;  3EQL F;  3IH4 A;  3IWZ A;  2PJR B;  1RNL A;  5HLH A;  3N97 A;  2R4G A;  2EZK A;  2JA2 A;  5IP9 J;  4IXA A;  2FA5 A;  5L3F A;  3OYH A;  3ZQQ A;  1RR7 A;  4GDF A;  2IXS A;  3LOC A;  1BN5 A;  1VQN I;  3HOS A;  4BHC A;  1OR7 A;  1N25 A;  3H5R A;  3OYG A;  1U5T A;  4KIT B;  3CDH A;  4BQA A;  2X0L A;  2DJI A;  4RGR A;  2D1H A;  2HOS A;  2Z16 A;  2QVO A;  2NOJ B;  4RS8 A;  5HS9 A;  4B8X A;  4OIO F;  1R58 A;  4UVB A;  4BDY A;  3HOW J;  1TW2 A;  1OCC H;  3QP6 A;  4RAY A;  2KP6 A;  2VT3 A;  4IZZ A;  1CGP A;  1YHQ I;  1L0O C;  1IC8 A;  2K85 A;  5L3E A;  2Q8K A;  1GV2 A;  1D0Z A;  4PDK A;  3UKG A;  1ZRD A;  2DQL A;  1LFB A;  3ERM A;  3M1E A;  3OYL A;  5DD4 A;  3ISP A;  1KYW A;  3R0J A;  3S3M A;  1FBQ A;  1HCR A;  2ZNY A;  3P9C A;  4HW0 A;  4AVZ A;  1ERD A;  3OY9 A;  4S05 A;  4B47 A;  1FOK A;  3ML6 A;  2MLK A;  4B1R A;  3HBL A;  4M3F A;  3LSR A;  4RLQ A;  5F0H A;  4JX4 A;  1X4O A;  1EF4 A;  4YIR X;  5ILV A;  1XGS A;  1H9T A;  1S29 A;  2L54 A;  2GOX B;  5ICC A;  4KN4 X;  5IOY A;  1S5L C;  4I76 A;  1WWX A;  3GZN B;  3GTL J;  3WOD F;  2L01 A;  2AXT C;  2LBF B;  4LK0 F;  1ZGJ A;  5HDK A;  3M3Y J;  2JRT A;  4AM3 A;  2X6W A;  2XAF A;  1YW9 A;  4GYI A;  1Y1V J;  2A5W A;  3ZQG A;  3JRD A;  3O8G A;  2VE8 A;  2ZJ2 A;  4D0P A;  4NUB A;  4IHV A;  2DTZ A;  4HAM A;  2HKX A;  4L5I A;  5FB2 A;  2XIG A;  1GT0 C;  2VE9 A;  1Z7L A;  2X85 A;  3PO3 J;  1PVE A;  1WGX A;  2TRT A;  1ZLJ A;  3TBI A;  4CUG A;  3QOD A;  3ZN1 A;  3OSF A;  2DDB A;  3S1M J;  4RAZ A;  1SMY F;  1LDK B;  1QNT A;  2DW4 A;  5E20 A;  1SC7 A;  4AC0 A;  4AWX B;  1BJZ A;  1SFE A;  2ZC2 A;  1IN7 A;  3IH2 A;  1OCR H;  2EIM H;  2P6S A;  4M71 A;  5JI6 A;  2HYG D;  2K27 A;  2M2E A;  4FE7 A;  4FQG A;  2PMU A;  1G2H A;  5J47 A;  1TWC J;  2XAQ A;  3DPT A;  4ZJZ A;  3JR9 A;  1I3Q J;  1QHG A;  1Z0X A;  3WHC A;  3K9T A;  5FD6 A;  3X2Q H;  3I53 A;  3FMS A;  2WAQ A;  1XD7 A;  2FOK A;  2KZG A;  2QGU A;  3LL7 A;  3PNV A;  1F4K A;  4G7O F;  3I4M J;  1B4A A;  3CP8 A;  2VBW A;  2BV6 A;  3OYI A;  4QWQ A;  4MHG A;  2KIS A;  2M0M A;  3JW4 A;  2V26 A;  3PL8 A;  2CQK A;  3R0A A;  4Q48 A;  4CCM A;  2LVS A;  2AS5 F;  1I6H J;  1IN6 A;  1QPM A;  2F5C A;  2FUG 2;  1TL8 A;  3H35 A;  4EJV A;  1DU0 A;  4UV9 A;  3LMM A;  1IF1 A;  1HW1 A;  3ULQ B;  4AYB N;  3K70 C;  2EQR A;  2CS3 A;  1MKM A;  2JVH A;  3IKV A;  4LD5 A;  2L0K A;  2NS7 A;  5HLI A;  1C0W A;  1PUF B;  1U9O A;  3HC7 A;  4W1U A;  3TMO A;  4UV8 A;  3K4C A;  2DFI A;  2NS0 A;  3OS0 A;  2V6C A;  3HRS A;  1AHD P;  2LSO A;  3H3Z A;  4A6D A;  5B3S H;  2V9P A;  4KIC A;  1WCM J;  4Y4R A;  4ASN A;  3V7C A;  1VQ4 I;  2VXD A;  2QKM B;  4MTD A;  2DA5 A;  3GZ6 A;  4LG0 B;  3I55 I;  1BI3 A;  2AO9 A;  2P7V B;  5EZG A;  1X3Z B;  3ZPL A;  2J5P A;  3HUG A;  1MBF A;  2CWE A;  1MJA A;  2DQR A;  4IVN A;  3OYF A;  2NNY A;  2L4M A;  2ZJQ F;  4KIS A;  4LLL A;  2KRF A;  3RQ4 A;  1PDN C;  2R7D A;  3BY6 A;  2OQR A;  5D6E A;  2KRH A;  2GOM A;  3F72 A;  2HYJ A;  1T33 A;  1WJB A;  3LA3 A;  1WI9 A;  3RPU D;  3JAM K;  3F6V A;  3E0J B;  1KZH A;  3QU3 A;  4JBA A;  1LJ9 A;  1IV6 A;  2DA4 A;  3GFM A;  4AYB A;  3S1Q J;  3JRG A;  1UG2 A;  4XLN F;  3M4O J;  5E1W A;  3C2H A;  3C18 A;  4BEH B;  1D5Y A;  3GFI A;  5C44 J;  2ELK A;  2GXG A;  1IGN A;  2L7K A;  4G94 A;  1K6Y A;  5M3F J;  4NNJ A;  2WAF A;  5J8F A;  2PBI A;  4I7H A;  1KYZ A;  1W5S A;  2V9K A;  3Q9V A;  1ZN2 A;  5BOX A;  1SMT A;  2O61 A;  1NG6 A;  1MGT A;  1M1E B;  3KPH A;  1X1A A;  1LE8 B;  1WZ2 A;  1Y39 A;  2JQ7 A;  1VQ6 I;  1WI3 A;  3CCE I;  1FSH A;  1JUS A;  4C30 A;  1D0Y A;  2O3F A;  2XGC A;  2WWY A;  2L7F P;  4HST A;  4EEF G;  2KL4 A;  1O3S A;  1KU7 A;  4D1Q A;  3KEQ A;  4WWC A;  3BP8 A;  3H9J A;  1ZLK A;  3OIQ A;  4XK4 A;  2GZW A;  3L2R A;  2GM4 A;  4A3M J;  3ZOB A;  5C4X J;  1U6G A;  2HKO A;  2LTP A;  3R60 A;  3QPL A;  4CCO A;  2MYS A;  3R61 A;  3RCO A;  2JSP A;  3NEU A;  2PI0 A;  1S7A A;  2UUZ A;  4A3G J;  3FBI B;  2DMQ A;  5H20 A;  1RC9 A;  3CC7 I;  4M73 A;  1RKT A;  2PX9 A;  4X6A J;  3VYS B;  3BZC A;  4HOB A;  4G7Z F;  4BXU A;  1LQ1 A;  4MO7 A;  1MSF C;  1IDY A;  3J81 K;  1R7J A;  4D7M A;  2NVT J;  1MMD A;  1E3H A;  2OBP A;  2V1U A;  4CCN A;  4A3K J;  3IWF A;  5KNL A;  2L9R A;  4EAT A;  1Q1V A;  3HOY J;  3KZY A;  1J2X A;  1BI1 A;  3WHB A;  4BJT A;  1SD6 A;  1VQ8 I;  3JSP A;  4N9I A;  3SZT A;  5M5Y J;  2DXI A;  3GF2 A;  4BUP A;  4L0Y B;  1I1S A;  4YFN F;  4LIT A;  2B7E A;  5EGO B;  4OAY A;  3VB2 A;  3ECH A;  5IOZ A;  1TNS A;  5JHU A;  5E3O A;  3CCM I;  4MFD A;  1G59 A;  4A5M A;  5H6R A;  5GAH J;  5EF6 A;  4JYK A;  3VOE A;  1QA6 A;  4Q5S F;  5E17 F;  4KT5 C;  2JT1 A;  4LK1 F;  1KU3 A;  1A36 A;  1YQA A;  3BQZ A;  2HDW A;  1JGG A;  4I99 C;  2VPR A;  2BE5 F;  1LDD A;  3LSJ A;  3GBG A;  4LIV A;  4EGY A;  1LVK A;  3QAH A;  3ZRG A;  3ZQF A;  3CCJ I;  2H8W A;  3GTK J;  3M8J A;  3HYI A;  1VQK I;  3F21 A;  1ZAO A;  3GCM A;  2A61 A;  3B02 A;  3LST A;  2NYX A;  4IQ4 A;  5K1Y A;  2EV5 A;  4FET A;  1IN4 A;  4BL0 B;  5FRO A;  3M9A A;  3SZG A;  3WTU C;  4ABZ A;  2IGM A;  5DEQ A;  2VOO A;  3FMR A;  1W7P A;  5M5W J;  3A01 A;  1JT0 A;  1JE8 A;  2IS1 A;  1B1B A;  4P9F A;  2BHY A;  1MBG A;  3CO7 C;  4XOR A;  3ZMD A;  5IY5 H;  3FXJ A;  4ZZL A;  1ENH A;  1ETW A;  2L9V A;  2K9Q A;  2PMH A;  3A1Y A;  3DF8 A;  3F8B A;  4KN7 X;  3CQZ J;  3DBL B;  3LFK A;  2XF5 A;  3BCB A;  5E8G A;  2XC7 A;  2HXI A;  2DTR A;  4P5O A;  2DK5 A;  5CPR B;  4BAY A;  3CMA I;  3C7J A;  1BC8 C;  1AWC A;  2R7U A;  2M8G X;  2BBY A;  2IP2 A;  3OV8 A;  5LFA A;  3BLY A;  3WTV C;  1TWG J;  3ZQL A;  4XQF A;  1K61 A;  4HNU A;  3E1S A;  3L2W A;  1RR8 C;  1R5H A;  1ZH5 A;  1YS7 A;  4BHP A;  5FJ8 J;  2B63 J;  1UEL B;  3AG4 H;  5HNF A;  1APL C;  3NWS A;  3ZQ7 A;  2VQL A;  1J09 A;  4QIW N;  2Q0O A;  4WCG A;  4UUS A;  1ITY A;  2GIV A;  2M87 A;  4RDU A;  4ON0 A;  2MD0 A;  2D45 A;  2ETH A;  1E17 A;  4I02 A;  2XGE A;  2ZXI A;  4ZC3 A;  3VDX A;  3WGH A;  2HQA A;  1ZYR F;  4JP0 A;  1ETQ A;  4A3E J;  1WKM A;  2EH3 A;  1KU2 A;  3TOB A;  3KLO A;  4ZDO A;  1VQP I;  2V1D A;  2W84 A;  1ACI A;  1Y1W J;  3BDD A;  1R9T J;  3BR0 A;  1IJW C;  3D5R C;  1R5I D;  3OL4 A;  3LSP A;  3SFZ A;  2CUJ A;  3F3X A;  4DQ2 A;  3EUH A;  1QVU A;  5FKN A;  3U1K A;  2OV7 A;  1WH5 A;  5K7Z A;  1IXC A;  1W0T A;  3MN2 A;  1RUO A;  1ZG5 A;  3KX2 A;  1WJC A;  1HBX G;  1T08 B;  3CF5 F;  3P5J A;  2WV1 A;  2HNH A;  4LIU A;  5KCM A;  2KDZ A;  1LPQ A;  1DDN A;  1YW7 A;  1J0R A;  5CQE A;  1SD7 A;  1I39 A;  3SDG A;  2HGC A;  1WJE A;  2E1C A;  1RZ4 A;  2YPR A;  3F9K A;  3HPH A;  4JX5 A;  4PK4 A;  2F4M B;  1KU9 A;  3CJR B;  4FAS D;  3ABU A;  2M34 A;  3C2B A;  3MVP A;  3G71 I;  4C2M J;  4XLF A;  5GTH C;  1TC3 C;  3BPV A;  2LRE A;  3FXO A;  4L9N A;  2BW3 A;  4LGW A;  1FMV A;  2IBD A;  3PFY A;  2V6E A;  1KQ8 A;  1L3L A;  1Z6R A;  5CKT A;  3J7Z I;  4YEJ A;  3WTS C;  3T1B A;  4A93 J;  1EKE A;  4XLC A;  2EFP A;  1UST A;  5FO5 A;  3CP2 A;  2BXZ A;  4Y52 J;  1HW2 A;  3BR2 A;  5BPI A;  1V5E A;  3V4G A;  4C3J J;  1FJL A;  2J5O A;  2R7R A;  2KIF A;  3I5U A;  2VN2 A;  2L9S A;  3LQQ A;  5IT9 K;  1YW8 A;  2DT6 A;  1YLF A;  5EZH A;  2Z5U A;  1FYL A;  3GFL A;  3WGG A;  2K9N A;  4RAF A;  1F9N A;  2HPM A;  3KP4 A;  2VQH A;  1FT9 A;  1WJ5 A;  2KJC A;  2M4K A;  5KAF C;  4EJT A;  1Z05 A;  4XN0 A;  5KHD A;  3TO9 A;  4E70 A;  3KYD B;  3ELK A;  3DFG A;  2QBY A;  1Y6I A;  4HRI A;  3ZQH A;  2M8E A;  2CUZ A;  4E7K A;  4AU7 A;  4DOZ A;  4XKB A;  3LAJ A;  4U7B A;  2ZO4 A;  3QOP A;  1WH7 A;  1XC5 A;  4HEA 2;  3AL0 C;  2XPU A;  2JA6 J;  2VOP A;  1W5T A;  2WC2 A;  2RVC A;  2EK5 A;  2UV1 A;  3QRF F;  2HVS A;  4PCQ A;  2NVY J;  1R6R A;  1OJL A;  2EIJ H;  4GO1 A;  1J9I A;  2F48 A;  5LHI A;  5LEJ A;  1WJA A;  5CVJ A;  4RB1 A;  1X19 A;  4BS9 A;  1ZGW A;  4L5J A;  2ZJP F;  2JUG A;  3CUQ B;  3G3Z A;  3FHN A;  2QEX I;  1HST A;  1QU3 A;  4DIQ A;  3M7G A;  3LSG A;  2XB0 X;  3VEP A;  1MBK A;  1KON A;  1EH6 A;  1KA8 A;  1ZG3 A;  3CF2 A;  1W36 D;  1XN7 A;  2MW8 A;  3ESW B;  4WX9 A;  1K78 A;  2NAZ A;  4RM2 A;  2MH9 A;  4D9J A;  5CVV A;  2XRL A;  2PN6 A;  1SFO J;  3WG9 A;  2DOD A;  4YII A;  1HW5 A;  3HGY A;  1T98 A;  3I4P A;  4YEL A;  4M6Y A;  5D6F A;  2LC2 A;  4F3Q A;  2DA3 A;  2R5Z B;  2V1X A;  2P81 A;  2QF7 A;  3PUF A;  1RES A;  4MGR A;  3P9K A;  2E2I J;  2NRA C;  1S8N A;  1YG2 A;  3DLA A;  4WXH A;  4DYC A;  2P5V A;  3EUK L;  4AIK A;  3LSK A;  4CYC A;  2PEX A;  2OTJ I;  2EV0 A;  2HXO A;  1OYI A;  3I64 A;  2QSG X;  3CO6 C;  2VQC A;  5ILU A;  2XRN A;  1AU7 A;  2P6T A;  1K7A A;  2HVR A;  1G3Y A;  5FLM J;  1H89 C;  2QA4 I;  4NQW B;  1T2K A;  4OIR F;  3ROU A;  4I0A A;  3T0Y A;  3WU0 A;  1BIA A;  4E7J A;  2YSR A;  2Y0M A;  3CES A;  1P9Q C;  5ICE A;  4KFC A;  1SAN A;  2RNJ A;  3COA C;  3BJ6 A;  1G3T A;  4CIC A;  1MH3 A;  1FMW A;  1XDU A;  5B5E C;  1AKH B;  2VOD A;  2E7W A;  3GTP J;  2FF4 A;  1TT5 B;  3SFI A;  2DPD A;  4FHT A;  9ANT A;  2GLO A;  2LNB A;  4IF4 A;  2VJ4 A;  3OL3 A;  3O6B B;  4F93 B;  1JTX A;  5TGT A;  3NRV A;  2LD5 A;  2ESH A;  2IGO A;  3SJM A;  3HSF A;  3UNG C;  4YFX F;  4C3H J;  3TOA A;  3P9I A;  2DK8 A;  1SEU A;  4ZYD A;  3L00 A;  2WB1 N;  3V7S A;  2L7M P;  3DPL C;  5HS8 A;  1SAU A;  3ZGK A;  2HI3 A;  4BAC A;  3HTS B;  2HQ5 A;  3ZP5 A;  3ZXS A;  3PUB A;  2W57 A;  2DBB A;  5FRN A;  2ZME A;  2MAB A;  2DJN A;  3OYM A;  4HQE A;  5D5X B;  4M6V A;  1IDZ A;  4M3G A;  3E6B A;  3G4S I;  2H1K A;  3LA2 A;  1YIJ I;  3TP0 A;  1FP2 A;  1VZ0 A;  2FQ4 A;  2YS9 A;  1TLH B;  1G6N A;  2RQP A;  3GXO A;  3M07 A;  1XCV A;  2BVM A;  4XLA A;  1YS6 A;  3BR5 A;  2R7Q A;  2DN0 A;  1EH7 A;  4L9V A;  3S14 J;  4LB5 A;  2P4W A;  3H0G J;  3DBH B;  4R1H A;  2LOO A;  4HF2 A;  1IO2 A;  3BRO A;  4CCL A;  3R4K A;  4XR6 A;  3HHG A;  4EJU A;  2ME0 A;  1ETX A;  2KLO A;  2K86 A;  1IN8 A;  4BY1 J;  4G8X A;  1V55 H;  3DP7 A;  2NXN B;  4LG3 A;  2EFW A;  3E7L A;  3WE2 A;  3GTG J;  4KDP A;  2X48 A;  5BQT A;  1T56 A;  2TDX A;  5K7F A;  2DOE A;  4E4H A;  2E2J J;  1B72 B;  5EYR A;  4LMY A;  3I59 A;  4IHT A;  3W6V A;  2WB1 A;  3I9V 2;  1G8X A;  4I01 A;  4FTH A;  1MBH A;  1S6L A;  1UHS A;  1XMA A;  3HSE A;  3TO6 A;  4IPA A;  3K4K A;  3H9G A;  3O8H A;  3W3C A;  2X9D A;  2DFH A;  3MEX A;  3HRU A;  4L0Z B;  3TP3 A;  3HOV J;  3CCY A;  2HZT A;  2QQ9 A;  2X1C A;  3ABK H;  5JR3 A;  1JI8 A;  1UHW A;  3HHH A;  3QU6 A;  2IA2 A;  5F1J A;  2Y30 A;  5HDG A;  5LHH A;  3IL2 A;  3M8F A;  4MNU A;  2O9L A;  1F43 A;  3O3K A;  3FBN B;  4GRI A;  2V4J C;  1JJ6 C;  3L2V A;  1MDM B;  5D8L B;  3FXK A;  3J80 Z;  2MH2 A;  2HFH A;  2ID3 A;  1BR4 A;  5D5W B;  1MSE C;  3GUD A;  3BTI A;  1ODD A;  1FP1 D;  2DMP A;  1LEA A;  1J59 A;  1BL0 A;  3ZN0 A;  4U0Y A;  5M5X J;  4OIP F;  4HX7 A;  2XPW A;  4F91 B;  4LLN A;  2I5U A;  3VYR B;  2JMW A;  5FKL A;  2ZNZ A;  3ABM H;  3PQK A;  1SVO A;  2XAG A;  1DGW Y;  1DPR A;  1XGO A;  1TWF J;  4XM3 A;  2V79 A;  5GPA A;  4B43 A;  5LRS A;  5FLV A;  5JFR A;  1LFP A;  3TDU C;  4UNO A;  2EIK H;  5FFZ A;  2K3P A;  3KP6 A;  3OR1 C;  2PLY A;  5FKO A;  2LY9 A;  1ZGA A;  2K4J A;  4HX8 A;  4CCJ A;  2OZ6 A;  1Y8Q B;  1JHH A;  4P1W A;  5DDG A;  2JZY A;  4GYG A;  4BNC A;  3U2R A;  1PJR A;  2CG4 A;  3AG2 H;  4ZDP A;  2PG4 A;  2VUM J;  1REP C;  2IS2 A;  1FTT A;  1Z7U A;  3GWZ A;  5IP7 J;  1DGR M;  4UY8 I;  2OCE A;  4EQQ A;  2IJL A;  3FXR A;  4K2E A;  2QYO A;  4II3 A;  1HC8 A;  2E1N A;  2ZXJ A;  1HOM A;  5E1Z B;  4RLF A;  2A68 F;  2QQ8 A;  3V8K A;  5L3B A;  2DA7 A;  2W85 A;  2E7X A;  4O6J A;  1HLV A;  4P9U A;  5HNH A;  2Q2E A;  4FX0 A;  5A2Q K;  2XKO A;  1NHA A;  4H0E A;  5DCM A;  2BW3 B;  2OF7 A;  3GTM J;  1N75 A;  5H2F C;  2N8G A;  2ZJR F;  3E5Q A;  4HV5 A;  4WXD A;  3D1N I;  1ZRF A;  2XKP A;  5HVQ C;  4RBO A;  1ZK8 A;  2XGX A;  5FLX Z;  1OLT A;  1X3U A;  5KK1 A;  4N0B A;  2CMP A;  2XHK A;  2Y75 A;  1VQ5 I;  1EV7 A;  2DOA A;  4M9S A;  3JRF A;  3IV5 A;  1HA8 A;  2K40 A;  2NVQ J;  1QQI A;  3LFU A;  4M9Z A;  2EZL A;  1B9M A;  1CQT A;  2DAO A;  2YUS A;  3DBR B;  4G9Y A;  3GO5 A;  4KUM A;  3QYF A;  4CYD A;  3F22 A;  2R93 J;  1Z91 A;  2XVC A;  4IHX A;  2O6G E;  2XF7 A;  3PQJ A;  2QZ8 A;  3CTA A;  4NDL A;  4PJN A;  1XGN A;  3HEF A;  1IRG A;  5L3D A;  4BH9 A;  2DMU A;  2FJ1 A;  2H94 A;  3DKW A;  5DM7 F;  4PZJ A;  3W6K B;  5EDN A;  3HKZ N;  3MAJ A;  1VI0 A;  2EJR A;  2VAS A;  3FHZ A;  2DA6 A;  2XGD A;  3HJE A;  1VQL I;  5C3E J;  1U8R A;  2A6E F;  3GEZ A;  1T95 A;  1XS9 A;  2B0L A;  1H9G A;  3ZMU A;  3EUH C;  5IYD J;  3EPZ A;  2CV0 A;  5J6X A;  2BOL A;  3HXL A;  1PUE E;  5KAI C;  1P7J A;  3MKL A;  1WJF A;  5FRM A;  3BJO A;  3DTI A;  2KFD A;  1MJ9 A;  3DU5 A;  3KFW X;  4BE1 A;  4A3J J;  4QPO A;  4B4C A;  3BCA A;  3DV8 A;  2RC4 A;  3O2P E;  2GA1 A;  5F08 A;  3OYN A;  1YFH A;  1VTN C;  3J7A O;  3IAS 2;  4MEX F;  2X4H A;  5LRR A;  1YRN A;  5DD8 A;  4B44 A;  1ON2 A;  3BJA A;  2XPV A;  3DKY A;  3S2W A;  3FDY A;  2KRC A;  2XSD C;  1JGS A;  2OJE D;  1ZEL A;  3OSG A;  4RGS A;  1GVJ A;  1IV8 A;  1ZHF A;  3HKZ A;  2VLA A;  4I2O A;  2LG4 A;  2R5Y A;  1V3F A;  3RKY A;  2BGC A;  2JK3 A;  5CVR A;  1S7E A;  4M3B A;  4BXX J;  1IRF A;  2XSJ C;  1BIB A;  2P5K A;  3H92 A;  1BW5 A;  2XB5 A;  3AAF A;  1ZR4 A;  2G7H A;  5JLX A;  3R6S A;  3EYI A;  3PIO F;  4O3M A;  3S93 A;  1X1B A;  4RM3 A;  1QRY A;  4BDZ A;  4PSX A;  2PJR A;  3KIO A;  2A3S A;  3S8P A;  4GXO A;  2BVL A;  3PO2 J;  2E1M C;  3ZMZ A;  1JXS A;  4F52 A;  4BKX A;  1UFM A;  5LHG A;  2L3D A;  1R1U A;  3T8T A;  3L09 A;  1FPQ A;  5TJJ A;  1B8I B;  5DV5 A;  3SYT A;  2VJI A;  2DMN A;  2CYY A;  3FXU A;  3D5L A;  1R1T A;  2QWW A;  3OIO A;  3DEE A;  3G1O A;  4A0Z A;  2FX0 A;  2I10 A;  2H1L A;  3SEQ A;  1OCP A;  2DO7 A;  4BJ5 C;  1O7L A;  2EIL H;  3B73 A;  3REO A;  5CJ9 A;  4F92 B;  1DP7 P;  1KGS A;  3N05 A;  1YI2 I;  2VL8 A;  1CF7 B;  4I0B A;  3TQN A;  2G0E A;  4U7D A;  4JX6 A;  2STT A;  4C2T A;  4HBL A;  3JRI A;  3S16 J;  2R7T A;  5AIP A;  3HSR A;  3VYT B;  4A3D J;  3MWM A;  4MQV A;  3JRA A;  3I71 A;  1MBE A;  2HDC A;  3H0D A;  1ZRC A;  2VBY A;  2P5L C;  1NK3 P;  1T0F C;  2M3A A;  1VQ7 I;  4F55 A;  1N77 A;  1RET A;  2GWR A;  4B3A A;  2MSY A;  2VKE A;  2CH0 A;  2W48 A;  1S9H A;  3K70 D;  5J1U A;  1V5G A;  2O03 A;  2E5N A;  5DUK A;  4DBQ A;  4B09 A;  1J7K A;  2QM3 A;  1YJW I;  2A6H F;  5E79 C;  1N78 A;  3BPX A;  3UR3 C;  3K6G A;  4ZZD A;  3NQO A;  1BOB A;  3K4N A;  1OIS A;  2YX7 A;  4LFU A;  4Q4Z F;  1GUU A;  4PJJ A;  3I4N J;  1KQ9 A;  1W7P D;  1U5T B;  4M6X A;  3JRH A;  1P92 A;  2VON A;  3GTO J;  5ILS A;  2O8K A;  3OYC A;  2JA7 J;  2MA3 A;  2YR2 A;  4IEJ A;  4XLH A;  3GFJ A;  4E7H A;  3LQR A;  3BTC A;  3T8R A;  4S04 A;  3SEZ A;  1RRJ A;  3DWL E;  4G7H F;  1T38 A;  3E5X A;  1P4W A;  2M45 A;  3WTZ A;  5F04 A;  2ID6 A;  2M0C A;  3CCS I;  2E5Z A;  2LMD A;  3FM3 A;  2BHZ A;  5DTD A;  4A6E A;  2IGN A;  2VBZ A;  2DDA A;  2HEO A;  2CUE A;  1JUP A;  3IRQ A;  1Y8R B;  1XG1 A;  4DNC A;  2DMT A;  2QSH X;  2JN6 A;  1QGP A;  3MZY A;  3RIR A;  1R71 A;  2RV8 A;  3W2A A;  6PAX A;  2CV1 A;  5B66 C;  3I58 A;  3G6E I;  3AL0 B;  3VYU B;  4D5C A;  5E3N A;  2RNG A;  2D1V A;  2P8T A;  3VPR A;  1T8I A;  1Z21 A;  4UVA A;  5FKK A;  1HDD C;  1YE9 A;  1SVM A;  3TO7 A;  4JOM A;  2QQB A;  1D3Y A;  4OWR B;  4PJM A;  2RAE A;  3F8C A;  1UG0 A;  1MW7 A;  3MD2 A;  2IT0 A;  1FX7 A;  4HF0 A;  3K0L A;  4ZTF A;  2KHM A;  2ZXH A;  2ECC A;  3HL2 A;  3MMY B;  4XKC A;  4DYQ A;  1XTA A;  3PNY A;  4X1E A;  2LK2 A;  3CZ6 A;  2EWN A;  5FKM A;  3SXY A;  1B6A A;  1X3W B;  4ESJ A;  3JAM Z;  5J1R A;  3ZMT A;  3QPT A;  4BBS J;  1X1P A;  1D1A A;  3DTK A;  2COB A;  1EJ9 A;  3GX4 X;  4UVC A;  4ZDL A;  1PUF A;  2E2H J;  3P7N A;  2CV2 A;  4MLO A;  3FK6 A;  4A3I J;  3CCV I;  3S17 J;  1R00 A;  2F5E A;  3BTL A;  3ZCO A;  3KZZ A;  3BR1 A;  3H3U A;  4BYY A;  4E7S A;  3U9G A;  5BNG A;  1B8I A;  3CME I;  4PFO A;  4II2 A;  1ZTR A;  5ERI A;  4CDG A;  2DFE A;  1PP7 U;  2ZME C;  4HSR A;  1UB9 A;  4LG0 A;  2ESN A;  4XN3 A;  1SAX A;  2FXA A;  4XOP A;  3BG7 A;  3K4B A;  3CCQ I;  4DW6 A;  1H88 C;  4Y13 A;  4A3F J;  1GLN A;  3SHF A;  2X6O A;  1W1W E;  1ORK A;  3MQ0 A;  2OC6 A;  2X1E A;  1Z9C A;  1RIO H;  1MMA A;  5D4R A;  2NS8 A;  3OOP A;  1Z6T A;  1R4N B;  1DP3 A;  1NTC A;  4OMZ A;  4KIG A;  1E3P A;  3HOU J;  1F1Z A;  2VQG A;  4XLE A;  1GDT A;  4XID A;  2QEN A;  4IHY A;  4O5V A;  2Y2Z A;  4XSX F;  3TL4 X;  3ASO H;  5AON A;  5DM6 F;  1USS A;  1O3R A;  1AOY A;  2X51 A;  1OCO H;  4QTR A;  4BEH A;  3RZO J;  1GXP A;  2F4I A;  2HQR A;  2M9H A;  4W97 A;  2K3F A;  2XAH A;  2IEK A;  3CCU I;  2H8R A;  1J75 A;  4XL9 A;  3FK7 A;  3RKW A;  1A35 A;  4TV7 A;  4A3B J;  3BZ6 A;  4Z6Y A;  4RB2 C;  3ERE D;  5IYC J;  4M9X A;  2O5R A;  4NBQ A;  3JSO A;  2LLK A;  4RMN A;  2BY0 A;  4BE2 A;  1LE8 A;  3J81 Z;  1H0M A;  4CZC A;  1MJB A;  1WQ2 A;  2PJP A;  3GVA A;  2YX4 A;  4XKW A;  1YX5 A;  2W00 A;  1T0F A;  2WY8 Q;  2O0Y A;  4L5E A;  3U1D A;  5HLG A;  4CHU A;  2HYF A;  1ETY A;  1NG7 A;  1T39 A;  3HUG B;  4A69 C;  2FRH A;  4OU0 A;  5ICF A;  2AXL A;  1WRJ A;  5EG0 A;  1TQM A;  4HV6 A;  2ADU A;  1LFU P;  3BQY A;  5DCF A;  5K5R A;  1O3T A;  3BG9 A;  3A03 A;  4A3L J;  4IJA A;  4CXF A;  1ON1 A;  4DZJ A;  2GBY A;  1J5Y A;  1P4X A;  1QZE A;  1HSJ A;  1FYM A;  1UMQ A;  2P7C B;  2Z9O A;  1JT6 A;  1X1D A;  5K7H A;  3E6D A;  2HTJ A;  3BG6 A;  5K5Q A;  3OYD A;  4IO9 F;  4I98 B;  4Y33 A;  5L3G A;  1OFC X;  4QPQ A;  1IXS B;  3DEW A;  3I56 I;  1IN5 A;  2Y48 A;  2BYV E;  1XCB A;  4A12 A;  2VKH A;  4BY7 J;  3W2W A;  5HLT A;  4MQ9 F;  2ISY A;  4X0G A;  2VC1 A;  3M8E A;  1WHU A;  2KIQ A;  2VBX A;  3KYC B;  1G3S A;  5HOD A;  4YFK F;  2CUF A;  3E3V A;  4L9T A;  2W7N A;  3W6J B;  4E6K G;  2R7X A;  3KEO A;  4XRS G;  1W5C C;  3K4J A;  3MFK A;  4GCV A;  4HNV A;  4HQM A;  1YIO A;  3CLQ A;  2CW0 F;  4ENN A;  1FYK A;  1VQM I;  3BZK A;  1BC7 C;  4KA4 A;  1MZB A;  3GLX A;  2A5Y B;  2OD5 A;  2OQG A;  4N9H A;  2JUC A;  1PP8 F;  1RKW A;  2QQA A;  5EGO A;  1WFX A;  1DUX C;  5JVT A;  1ZKG A;  3L7W A;  4WK8 F;  3OR2 C;  2EFN A;  4N4N B;  2COM A;  3LA7 A;  4PSW A;  3HOT A;  4CO8 A;  1Y0U A;  2CQN A;  3V8L A;  3QYB A;  1G3W A;  1GVD A;  1UCR A;  4B48 A;  2JJ7 A;  4N4O B;  2CW8 A;  3MZH A;  2DA2 A;  2W24 A;  3K1P A;  4XKV A;  3GME A;  5H6Q A;  3NAU A;  2FNP A;  2H6C A;  2YU3 A;  1Q1H A;  5D5U B;  3HRT A;  4OIQ F;  3CD6 I;  3S32 A;  2LKS A;  3VFZ A;  2WBM A;  1TWH J;  5IPA A;  3G2B A;  3AFH A;  4U87 A;  2HVQ A;  2W25 A;  3SDB A;  3CC2 I;  1R23 A;  1YYV A;  5J3L A;  3WTY C;  3CDL A;  3HZJ A;  2CSO A;  4CCK A;  3BTJ A;  2PFB A;  2BY3 A;  5IT3 A;  4XRM A;  4HF1 A;  3OS2 A;  3CDI A;  4ENM A;  3QPS A;  4XRF A;  2LDU A;  5F27 A;  1O7F A;  2R7O A;  2ZSH B;  3CUQ C;  3EYY A;  3CMM A;  1R5G A;  5FGM A;  2IA1 A;  4U0W A;  4I09 A;  2GXB A;  3BR3 A;  5CQG A;  4YG2 F;  2F6C A;  2L02 A;  5IYB J;  3CJT B;  3IC7 A;  2R3S A;  3GLL A;  3LSI A;  2DI3 A;  4L9J A;  4PGH A;  4A2U A;  2ECB A;  2M5W A;  3F8M A;  4NC7 A;  4UUV A;  4PJL A;  2VB6 A;  3WE3 A;  2EFO A;  4G6Q A;  1U9N A;  3Q9S A;  4KNY A;  4XOT A;  4OIN F;  5J1Y A;  5LLQ A;  2Y9Y A;  1ZQ3 P;  4JK1 X;  1FC3 A;  5GAD J;  1IW7 F;  2IAI A;  3K4L A;  4BXF A;  4ENJ A;  2DPU A;  5LGT A;  1FBU A;  3PIP F;  1BI0 A;  3BG5 A;  2KKO A;  3DXJ F;  4BJ6 C;  2OTL I;  2R7S A;  4BQQ A;  1A6Q A;  3ASN H;  1JKQ C;  1OPC A;  2KIM A;  3FIS A;  3RZD J;  1WJD A;  5TRD A;  4JQF A;  2ZXW H;  2WAD A;  2DYR H;  3Q3S A;  4BQO A;  2BY1 A;  4H4K C;  4YIF A;  2GQQ A;  3QWL A;  5J4Y A;  2HOT A;  2FOW A;  1XMK A;  2DCE A;  5GPC A;  3WU1 B;  1OYY A;  2R7F A;  1YOV B;  5K5O A;  4ZTJ A;  5D8K B;  1GXQ A;  1JKO C;  1A5J A;  2LR8 A;  4G12 A;  5EEA A;  1TQI A;  1W7P B;  2CFO A;  3E6C C;  1MNE A;  3A01 B;  3KYL A;  4L18 B;  1JHF A;  1E0E A;  1ETK A;  1ULY A;  2CO5 A;  3ECO A;  4ZH4 F;  5B1A H;  4HX4 A;  4V2G A;  1X2M A;  3OYJ A;  4A3C J;  4AIJ A;  4Y3O A;  2HDD A;  1I50 J;  5LBQ A;  2R0Q C;  1UZC A;  5IT9 Z;  1TTY A;  2MGQ A;  2WAQ N;  1R49 A;  3HRM A;  3FKI J;  3KET A;  1FY7 A;  1VND A;  4KMU X;  3VWB A;  1YJ9 I;  1UAA A;  5D5V B;  2K9M A;  3OYK A;  2KJB A;  3PFI A;  2UXX A;  4HA8 A;  4CA0 A;  1ZRE A;  2CGP A;  3K2Z A;  2DLL A;  4UUS B;  1FTZ A;  3S1R J;  4HPQ A;  4WF2 A;  2VC0 A;  2WY7 Q;  2EA4 A;  2NVX J;  3DTE A;  2RGV A;  1TWA J;  2LFB A;  1MNM C;  1GV5 A;  5F6F A;  5LGU A;  1HKS A;  2EA2 A;  4XIC A;  2JRM A;  1VQO I;  2R7Z J;  4EM0 B;  2ISZ A;  2MD5 A;  2VT2 A;  2D2W A;  1YO5 C;  1LDJ A;  3ZQI A;  3OS1 A;  4XNF A;  2A69 F;  3OYE A;  3F0C A;  2ZSI B;  3MKZ A;  3DQV C;  1AA7 A;  3IHU A;  1T6S A;  5FFX A;  2MC3 A;  3G1M A;  3IKT A;  4Q47 A;  1IRZ A;  3V7R A;  4ZYG A;  4AVP A;  1D1C A;  2DOF A;  1D8K A;  2OU2 A;  3LSM A;  5HDN A;  1D0X A;  2ZCW A;  2RRE A;  3M1C A;  2B9S A;  2F5F A;  1E3O C;  2DT5 A;  3L1P A;  3JTG A;  2YU9 J;  3K69 A;  4NHJ A;  1FOX A;  2FSW A;  2ZB9 A;  2KIU A;  2RQQ A;  1HKT A;  1BI2 A;  4IKF A;  3KP5 A;  3J7Y J;  1U8B A;  2CRG A;  1RPW A;  2V1N A;  3N4M A;  1MND A;  4C3I J;  3FMQ A;  1MD0 A;  1JKP C;  1D8J A;  3Q0W A;  1K83 J;  1SD4 A;  2DT7 B;  1V5F A;  1X1C A;  2HWV A;  3FIW A;  4HLY A;  2DA1 A;  4XBF A;  1IG7 A;  3WU2 C;  3AG3 H;  3VOD A;  2BXY A;  2LKP A;  3HGG A;  1MH4 A;  1QBJ A;  3SZP A;  3RPU A;  3H1C A;  2HU9 A;  2XRO A;  2JA8 J;  3E5U A;  3CUQ A;  1SFK A;  2DFF A;  2E60 A;  2KDO A;  3FXL A;  2FBH A;  3OYB A;  1SFX A;  4R8H A;  1XSV A;  1U3E M;  2M7A A;  5E3L A;  2UWM A;  3OIP A;  1K79 A;  1D5V A;  1S3J A;  3PJR A;  2VXZ A;  3WTT C;  4EM2 A;  3L2U A;  2KPM A;  3DLL F;  2VKV A;  4CSW A;  3B6C A;  2KZV A;  2C6Y A;  5KVR A;  1Y56 A;  3WTX C;  3MKY B;  2E1M B;  4GGG A;  2LKX A;  1LUJ B;  1SFU A;  1ZR2 A;  4M74 A;  1BA5 A;  1VF9 A;  2QBY B;  2LP0 A;  5CVU A;  4V2F A;  2FMY A;  4U88 A;  2E35 A;  3QOE A;  1YJN I;  2R5Z A;  3LAP A;  1QPI A;  4UHT A;  2L2O A;  2V9V A;  3RSN A;  2QKL B;  2FU4 A;  3H3V K;  4GFB A;  3E6M A;  4PJ0 C;  2K7L A;  5E8I A;  4EJW A;  3OMY A;  2Z3Y A;  5DYM A;  2L5Q A;  2OCC H;  1VFC A;  4XLP F;  2XV4 S;  2K5C A;  1QO0 D;  2FE3 A;  2Z99 A;  3BOQ A;  2ELH A;  5TIS C;  5BMZ A;  4WXC A;  3OWT A;  1HKQ A;  2GIZ A;  4NQW A;  3JRC A;  2TCT A;  4YRV A;  1IRX A;  2FEZ A;  1A04 A;  4MTE A;  2K4B A;  4EV0 A;  3A0H C;  2M7B A;  2E34 A;  3AG1 H;  4RB3 C;  3WTW C;  4IOC F;  1ONV A;  2CQ7 A;  2F2E A;  3DPU A;  3OYA A;  4ZYH A;  2FQ3 A;  3CLO A;  4CH7 A;  3RYR A;  1YTY A;  3RKX A;  5CYV A;  4S0H B;  1R22 A;  5D4S A;  3AKZ A;  3LSH A;  1JJ8 C;  1K78 B;  2K9S A;  2W82 A;  5EG0 B;  4OMY A;  2EZH A;  1TT0 A;  1V4R A;  3FF5 A;  5BS6 A;  2EZI A;  1AKH A;  3PSI A;  4KMF A;  2I8D A;  3RYP A;  4AUX A;  4V19 K;  2IW5 A;  2Q1Z B;  3C1D A;  5GAE J;  3LNQ A;  3H5A A;  1MMG A;  1X58 A;  1FWZ A;  5ED4 A;  2L9N A;  3Q5F A;  5GP9 A;  3ZMS A;  2R7W A;  5E1X A;  2VJ5 A;  2Y69 H;  2MBF A;  3FZV A;  4EJO A;  1JTY A;  1WSU A;  1HQC A;  2HZD A;  5CVI A;  4ENK A;  4CYC B;  2LY2 A;  1W0U A;  1I1G A;  4EGZ A;  2KMU A;  3K10 A;  4XSZ F;  3ZR8 X;  3EET A;  3KP7 A;  1K4T A;  1Z3X A;  3KCC A;  2ELJ A;  3G1L A;  5EEG A;  5EEH A;  3KLN A;  3TGN A;  4A5N A;  1BJA A;  1IZ1 A;  3HM5 A;  2XAS A;  3PM1 A;  1FZP B;  4E7L A;  4ITV A;  5E3M A;  2OUM A;  3C3W A;  4NC8 A;  3BG3 A;  3I3L A;  2WTE A;  3RQI A;  2OAZ A;  2O7O A;  3BWG A;  1G4D A;  4E7Z A;  3H36 A;  3QP5 A;  2E1O A;  4P55 A;  1TZL A;  2JA5 J;  2G7U A;  3K1N A;  2RKH A;  2RN7 A;  4CGZ A;  5F0C A;  3IAM 2;  1F36 A;  4AD9 A;  2CU7 A;  4CZZ A;  2VPL A;  4UUT A;  1GHC A;  3RPQ A;  4IOA F;  4NC6 A;  3IH3 A;  1LVA A;  1SVL A;  3RI4 A;  3E97 A;  2UXN A;  3MZ8 A;  1WVR A;  1XDS A;  2M30 A;  1IAW A;  3T5X A;  3WG7 H;  1EA3 A;  3DU6 A;  4ZYA A;  5LGN A;  1VQ9 I;  3MKW B;  1MMS A;  5GAG J;  1S7O A;  3RJP A;  1W36 C;  1ETV A;  5E18 F;  2IPQ X;  3TW7 A;  2X1D A;  4D5F A;  2HQN A;  1NK2 P;  1BM9 A;  3ABL H;  1B72 A;  1K6O A;  4HG2 A;  1XGM A;  1OKR A;  2ZBK A;  2Y0S N;  1X2N A;  5LEK A;  4B3X A;  3K7A J;  1TP4 A;  2R92 J;  3RTR A;  3A0B C;  1FNN A;  2OA4 A;  1LNW A;  2A07 F;  5M3M J;  1BOA A;  4FT8 A;  4MFE A;  3TKY A;  3S2H J;  2PQ8 A;  2WAE A;  2ZME B;  3I0T A;  1P2F A;  2LBF A;  1U0J A;  3H5N A;  4KJZ A;  2STW A;  5HS7 A;  3TW6 A;  4HYE A;  2VIX A;  1FIA A;  1LB2 A;  4HLX A;  1I6X A;  1FLI A;  3L9F A;  1MDM A;  2H6B A;  3ONQ A;  3HIF A;  3QQA A;  3QYE A;  2E36 A;  1QVT A;  2IRF G;  1OQY A;  3K1M A;  1V54 H;  5GTI C;  3EUA A;  5F64 A;  2ACJ A;  3GYH X;  1A6I A;  5J4V A;  3CCR I;  2MG4 A;  4LB6 B;  1QZZ A;  3BC8 A;  2QSF X;  3KP2 A;  4Y7N J;  4EVI A;  1R1V A;  4G6D A;  2XAU A;  5L3C A;  4IHW A;  1SD5 A;  1PYV A;  4I6Z A;  1O3Q A;  2L4A A;  5EJC A;  4HDU A;  1O57 A;  1A31 A;  2IS4 A;  2Y0S A;  1LEB A;  4G6T B;  1ZG1 A;  3G73 A;  4LLG F;  3F8F A;  1YX3 A;  3HG9 A;  4F7Z A;  2EIN H;  2GA2 A;  1HDP A;  1RI7 A;  3I59 B;  5A2Q Z;  3FXQ A;  2Y9Z A;  1OCZ H;  3BT9 A;  2BZT A;  4M72 A;  4J01 A;  3NAR A;  3C2G A;  1Y0N A;  2A6T A;  5HOO A;  2D5V A;  4BU2 A;  1BW6 A;  1B59 A;  1MBJ A;  3CUO A;  3D5S C;  4MIM A;  4ETS A;  3CMY A;  1DU6 A;  3D0S A;  2AQF A;  4BQN A;  2EB7 A;  1E2X A;  4KYW A;  3S3N A;  2LY1 A;  1FIP A;  1OMI A;  3HB9 A;  4ZYE A;  5F1R A;  1FOY A;  1XX5 A;  2GXA A;  5DS9 A;  5BPD A;  1XSD A;  1Z67 A;  2EFQ A;  1O4X A;  5LD2 C;  3HOZ J;  1XSX A;  2XF6 A;  3OOU A;  2GAU A;  4BGD A;  2FBK A;  4Y17 A;  2Z1D A;  4FCY A;  2DU9 A;  2HOE A;  1R36 A;  4PFP A;  3ZMV A;  1TNT A;  4MEY F;  4RB0 A;  3BR6 A;  5B1B H;  4A0X A;  2IS6 A;  2ICW G;  3Q0V A;  3ZQC A;  2MFZ A;  3MCZ A;  3JCU C;  2ME6 A;  4DJA A;  1P6R A;  2M1B A;  2HPI A;  2Z33 A;  2EV6 A;  4HNT A;  4XON A;  5DUI A;  1I5Z A;  1RUN A;  1BBY A;  5FD5 A;  2WA0 A;  3S2D J;  4XMY A;  2X6X A;  3HPG A;  4BHB A;  2QUF A;  3CC4 I;  3NWT A;  1STZ A;  4BBR J;  4XRS A;  5F0F A;  2K9L A;  3PSF A;  3GZ5 A;  4UB6 C;  1P4A A;  2AHQ A;  4J19 A;  2IGK A;  4HDV A;  3TED A;  1OR7 C;  4RGU A;  2H27 A;  1U5T C;  2M4G A;  2HOA A;  4FX4 A;  2RDP A;  3RKQ A;  3KZI C;  3J80 K;  4BE0 A;  3S3O A;  2UZK A;  4IRI A;  2E19 A;  1IUF A;  2L7Z A;  1ZAR A;  2VI6 A;  2XDV A;  3K4M A;  3JTH A;  1MMN A;  3F8N A;  3FKJ A;  3IP4 B;  3FX3 A;  3KP3 A;  4UXN A;  2KT0 A;  4EM1 A;  4IX7 A;  2ZFU A;  3FXM A;  2HS5 A;  2JPC A;  3A02 A;  1I3A A;  3L2C A;  4OAZ A;  3SQN A;  3RDI A;  1FSE A;  1W4M A;  3F23 A;  2CJJ A;  1OCT C;  1B9N A;  4EMS A;  4J00 A;  2FBI A;  4NB5 A;  4IQJ A;  4ESF A;  1DQU A;  1KQ0 A;  4AIH A;  4LJZ F;  4RA2 A;  4QLC U;  2Q2E B;  1XPX A;  1FOW A;  3VSL A;  5DCM B;  2CFX A;  4Z2Y A;  2H09 A;  2W1O A;  2VKD A;  1JUM A;  2OZU A;  4KIB A;  2CQX A;  1POG A;  5JHF A;  4M3E A;  2FD5 A;  2AQE A;  2CW7 A;  4ANJ A;  5IP6 A;  1K4S A;  2LH9 A;  4DZP A;  2JVG A;  4RAG A;  1XB4 A;  2JSC A;  3VSK A;  2FNA A;  2PMZ N;  2P0W A;  3KE2 A;  2HR3 A;  3A2K A;  3QPH A;  1TQP A;  4OOI A;  1BR2 A;  2CQQ A;  2ZKZ A;  2OPT A;  2R7V A;  1Z77 A;  3LWF A;  4DGW B;  4U0V A;  1U2W A;  4ESB A;  3S1N J;  1ETO A;  2KQR A;  4PUS A;  2EPF A;  3DEU A;  4P96 A;  2XAJ A;  1X4P A;  5ICG A;  3W2V A;  2F5D A;  4DYR A;  4QSH A;  3U21 A;  2LF7 A;  4RGX A;  4IHS A;  2JWT A;  2QCO A;  1XMX A;  3H9Q A;  5JVG F;  3J7A Y;  1DPU A;  2F5V A;  4IRH A;  3FWE A;  3CCL I;  3HOX J;  2Z2S B;  3ABT A;  3WGI A;  1F5T A;  1OYW A;  2QLZ A;  3HTU A;  5JLW A;  5FLX K;  2XUB A;  1IXR C;  2G9W A;  3JRE A;  2WV0 A;  1FEX A;  2NOG A;  3B6A A;  1QZY A;  2HTS A;  2Y31 A;  1WPK A;  2ZFW A;  2EBI A;  5CLS A;  1D1B A;  1MIJ A;  1UHM A;  4A0Y A;  1NH3 A;  5J40 A;  1HF0 A;  1QHH D;  3CJN A;  1EH8 A;  3IRR A;  1UJ8 A; 
#chains in the Genus database with same CATH homology
 3FM5 A;  4HZF A;  4KIF A;  4Y15 A;  5AIQ A;  2FML A;  2LF8 A;  2MLG A;  3EDP A;  2K02 A;  2IVM A;  2JPB A;  1U78 A;  2O8X A;  3I54 A;  2JTV A;  1CF7 A;  4IRG A;  4R79 A;  4PGG A;  2IA0 A;  1HXD A;  3TDZ C;  1I27 A;  1TBX A;  2BEO A;  3GW2 A;  3V8J A;  1FBS A;  1TW3 A;  2NNN A;  3F6O A;  5J8C A;  1IUY A;  1Z1D A;  3EQL F;  3IWZ A;  1RNL A;  5HLH A;  3N97 A;  4IXA A;  2FA5 A;  5L3F A;  1BN5 A;  3HOS A;  4BHC A;  1OR7 A;  1U5T A;  3CDH A;  4BQA A;  2X0L A;  4RGR A;  2D1H A;  2QVO A;  4RS8 A;  5HS9 A;  4B8X A;  4OIO F;  1R58 A;  4UVB A;  1TW2 A;  3QP6 A;  4RAY A;  2VT3 A;  1CGP A;  1L0O C;  5L3E A;  2Q8K A;  4PDK A;  1ZRD A;  2DQL A;  3M1E A;  5DD4 A;  3ISP A;  1KYW A;  3R0J A;  1FBQ A;  2ZNY A;  3P9C A;  4HW0 A;  4S05 A;  1FOK A;  3ML6 A;  2MLK A;  5ILV A;  1XGS A;  1H9T A;  1S29 A;  2L54 A;  5ICC A;  4KN4 X;  1WWX A;  3WOD F;  2L01 A;  4LK0 F;  1ZGJ A;  5HDK A;  2JRT A;  2XAF A;  1YW9 A;  4GYI A;  2VE8 A;  2ZJ2 A;  4D0P A;  4HAM A;  2HKX A;  4L5I A;  5FB2 A;  2XIG A;  2VE9 A;  1ZLJ A;  3ZN1 A;  4RAZ A;  1SMY F;  1LDK B;  1QNT A;  2DW4 A;  5E20 A;  4AWX B;  1SFE A;  1IN7 A;  2P6S A;  4M71 A;  5JI6 A;  2HYG D;  2K27 A;  2PMU A;  2XAQ A;  3DPT A;  3K9T A;  5FD6 A;  3I53 A;  3FMS A;  1F4K A;  1XD7 A;  2FOK A;  4G7O F;  1B4A A;  2VBW A;  2BV6 A;  4QWQ A;  4MHG A;  3JW4 A;  3R0A A;  2CQK A;  4Q48 A;  2AS5 F;  1IN6 A;  1QPM A;  2F5C A;  4EJV A;  4UV9 A;  1IF1 A;  1HW1 A;  3ULQ B;  1MKM A;  3IKV A;  4LD5 A;  5HLI A;  1C0W A;  4UV8 A;  2DFI A;  2NS0 A;  2V6C A;  3HRS A;  2LSO A;  3H3Z A;  4A6D A;  4ASN A;  4KIC A;  3V7C A;  4MTD A;  3GZ6 A;  4LG0 B;  1BI3 A;  2P7V B;  3ZPL A;  2J5P A;  3HUG A;  2CWE A;  1MJA A;  2DQR A;  4IVN A;  2NNY A;  2L4M A;  4LLL A;  2KRF A;  1PDN C;  2R7D A;  3BY6 A;  2OQR A;  5D6E A;  3F72 A;  3LA3 A;  1WI9 A;  3JAM K;  3F6V A;  3QU3 A;  4JBA A;  1LJ9 A;  3GFM A;  4XLN F;  5E1W A;  3C18 A;  3GFI A;  2GXG A;  4G94 A;  5J8F A;  2PBI A;  4I7H A;  1KYZ A;  1W5S A;  3Q9V A;  1ZN2 A;  5BOX A;  1SMT A;  2O61 A;  1MGT A;  1FSH A;  2O3F A;  2WWY A;  1O3S A;  1KU7 A;  3KEQ A;  4WWC A;  3BP8 A;  1ZLK A;  2GZW A;  1U6G A;  2HKO A;  3R60 A;  3R61 A;  2PI0 A;  3NEU A;  1S7A A;  5H20 A;  4M73 A;  4HOB A;  4G7Z F;  4BXU A;  1LQ1 A;  3J81 K;  1R7J A;  2V1U A;  2OBP A;  3IWF A;  3KZY A;  1J2X A;  1BI1 A;  1SD6 A;  3JSP A;  4N9I A;  3SZT A;  3GF2 A;  1I1S A;  4L0Y B;  4YFN F;  3VB2 A;  3ECH A;  1TNS A;  5JHU A;  4A5M A;  5H6R A;  3VOE A;  4Q5S F;  5E17 F;  4KT5 C;  2JT1 A;  4LK1 F;  1KU3 A;  1YQA A;  2BE5 F;  1LDD A;  4EGY A;  3QAH A;  3HYI A;  3F21 A;  1ZAO A;  2A61 A;  3B02 A;  3LST A;  2NYX A;  5K1Y A;  2EV5 A;  1IN4 A;  3M9A A;  3WTU C;  5DEQ A;  2VOO A;  3FMR A;  1W7P A;  1JE8 A;  1B1B A;  4P9F A;  3CO7 C;  3ZMD A;  4ZZL A;  3DF8 A;  2PMH A;  3F8B A;  4KN7 X;  3LFK A;  5E8G A;  2DTR A;  4P5O A;  2DK5 A;  4BAY A;  3C7J A;  1BC8 C;  1AWC A;  2BBY A;  2IP2 A;  3OV8 A;  3WTV C;  1R5H A;  1ZH5 A;  1YS7 A;  4BHP A;  3ZQ7 A;  2Q0O A;  4WCG A;  2GIV A;  2M87 A;  4ON0 A;  2D45 A;  2ETH A;  1E17 A;  4I02 A;  3WGH A;  1ZYR F;  1WKM A;  1KU2 A;  3TOB A;  3KLO A;  2V1D A;  2W84 A;  3BDD A;  3SFZ A;  3F3X A;  4DQ2 A;  3EUH A;  1IXC A;  1RUO A;  1ZG5 A;  1HBX G;  1DDN A;  1YW7 A;  1J0R A;  1SD7 A;  2HGC A;  2E1C A;  1RZ4 A;  2YPR A;  1KU9 A;  3ABU A;  3BPV A;  4LGW A;  4L9N A;  1KQ8 A;  1L3L A;  1Z6R A;  3WTS C;  3T1B A;  2EFP A;  1UST A;  5FO5 A;  1HW2 A;  5BPI A;  3V4G A;  2J5O A;  2KIF A;  3I5U A;  2VN2 A;  3LQQ A;  5IT9 K;  1YW8 A;  1YLF A;  2Z5U A;  1FYL A;  3GFL A;  3WGG A;  1F9N A;  3KP4 A;  1FT9 A;  2KJC A;  4EJT A;  1Z05 A;  3TO9 A;  4E70 A;  3ELK A;  3DFG A;  2QBY A;  2M8E A;  3LAJ A;  4U7B A;  2ZO4 A;  3QOP A;  2VOP A;  1W5T A;  2WC2 A;  2RVC A;  2EK5 A;  3QRF F;  4PCQ A;  4GO1 A;  1J9I A;  5LHI A;  5LEJ A;  5CVJ A;  4RB1 A;  4L5J A;  3CUQ B;  3G3Z A;  1HST A;  3M7G A;  3VEP A;  1EH6 A;  1KA8 A;  1ZG3 A;  1K78 A;  1XN7 A;  4WX9 A;  2NAZ A;  2MH9 A;  5CVV A;  2PN6 A;  3WG9 A;  4YII A;  1HW5 A;  1T98 A;  3I4P A;  4M6Y A;  5D6F A;  2V1X A;  4MGR A;  2NRA C;  3P9K A;  1S8N A;  1YG2 A;  4WXH A;  2P5V A;  4AIK A;  2PEX A;  2EV0 A;  1OYI A;  3I64 A;  3CO6 C;  5ILU A;  2XRN A;  2P6T A;  1K7A A;  1G3Y A;  1T2K A;  4OIR F;  3ROU A;  4I0A A;  3T0Y A;  3WU0 A;  1BIA A;  2YSR A;  2Y0M A;  5ICE A;  4KFC A;  3COA C;  2RNJ A;  3BJ6 A;  1G3T A;  4CIC A;  1XDU A;  2VOD A;  2E7W A;  2FF4 A;  2DPD A;  4FHT A;  2LNB A;  4IF4 A;  3O6B B;  3NRV A;  2ESH A;  3HSF A;  4YFX F;  3TOA A;  3P9I A;  2DK8 A;  4ZYD A;  3L00 A;  3V7S A;  3DPL C;  5HS8 A;  3HTS B;  3ZP5 A;  2W57 A;  2DBB A;  2ZME A;  4HQE A;  5D5X B;  3E6B A;  3LA2 A;  1FP2 A;  1TLH B;  1G6N A;  2RQP A;  3GXO A;  1XCV A;  1YS6 A;  1EH7 A;  4L9V A;  4LB5 A;  2P4W A;  4R1H A;  4HF2 A;  3BRO A;  3R4K A;  3HHG A;  4EJU A;  2K86 A;  1IN8 A;  4G8X A;  3DP7 A;  2EFW A;  3WE2 A;  4KDP A;  5BQT A;  2TDX A;  4LMY A;  3I59 A;  4IHT A;  4I01 A;  1S6L A;  1XMA A;  3HSE A;  3TO6 A;  4IPA A;  3MEX A;  3HRU A;  4L0Z B;  2HZT A;  2QQ9 A;  5JR3 A;  1UHW A;  3HHH A;  3QU6 A;  2IA2 A;  5HDG A;  5LHH A;  3IL2 A;  3M8F A;  4MNU A;  3O3K A;  1MDM B;  5D8L B;  3J80 Z;  2MH2 A;  2HFH A;  5D5W B;  3GUD A;  1ODD A;  1FP1 D;  1LEA A;  1J59 A;  3ZN0 A;  4U0Y A;  4OIP F;  4HX7 A;  4LLN A;  2ZNZ A;  3PQK A;  2XAG A;  1DPR A;  1XGO A;  2V79 A;  5LRS A;  5JFR A;  3TDU C;  4UNO A;  5FFZ A;  3KP6 A;  2PLY A;  1ZGA A;  2K4J A;  4HX8 A;  2OZ6 A;  1JHH A;  5DDG A;  2JZY A;  4GYG A;  4BNC A;  3U2R A;  2CG4 A;  2PG4 A;  1REP C;  1Z7U A;  3GWZ A;  4EQQ A;  2IJL A;  3FXR A;  4K2E A;  2QYO A;  2E1N A;  2ZXJ A;  5E1Z B;  2A68 F;  3V8K A;  5L3B A;  2W85 A;  2E7X A;  4O6J A;  4P9U A;  2Q2E A;  4FX0 A;  5A2Q K;  2XKO A;  1NHA A;  4H0E A;  5DCM A;  3E5Q A;  4HV5 A;  4WXD A;  1ZRF A;  2XKP A;  5HVQ C;  2XGX A;  5FLX Z;  1X3U A;  5KK1 A;  4N0B A;  2XHK A;  2Y75 A;  1EV7 A;  4M9S A;  1QQI A;  4M9Z A;  1B9M A;  2DAO A;  4G9Y A;  3F22 A;  3GO5 A;  4KUM A;  4CYD A;  1Z91 A;  2XVC A;  2O6G E;  3PQJ A;  2QZ8 A;  3CTA A;  1XGN A;  1IRG A;  5L3D A;  4BH9 A;  2H94 A;  3DKW A;  4PZJ A;  3W6K B;  3MAJ A;  2EJR A;  3FHZ A;  1U8R A;  2A6E F;  3GEZ A;  2B0L A;  1H9G A;  3ZMU A;  5J6X A;  1PUE E;  3BJO A;  1MJ9 A;  3KFW X;  3DV8 A;  3J7A O;  2RC4 A;  3O2P E;  2GA1 A;  1YFH A;  1VTN C;  4MEX F;  2X4H A;  5LRR A;  5DD8 A;  1ON2 A;  3BJA A;  3S2W A;  1JGS A;  4RGS A;  1GVJ A;  1ZHF A;  4I2O A;  1V3F A;  3RKY A;  2BGC A;  5CVR A;  1IRF A;  1BIB A;  2P5K A;  3H92 A;  3AAF A;  2G7H A;  3R6S A;  3EYI A;  4O3M A;  2A3S A;  4GXO A;  3ZMZ A;  1JXS A;  1UFM A;  5LHG A;  2L3D A;  1R1U A;  3T8T A;  3L09 A;  1FPQ A;  5TJJ A;  5DV5 A;  2CYY A;  3FXU A;  3D5L A;  1R1T A;  2QWW A;  4A0Z A;  2DO7 A;  1O7L A;  3B73 A;  3REO A;  5CJ9 A;  1DP7 P;  1KGS A;  1CF7 B;  4I0B A;  3TQN A;  4U7D A;  2STT A;  4HBL A;  5AIP A;  3HSR A;  3MWM A;  4MQV A;  3I71 A;  2HDC A;  1ZRC A;  2VBY A;  2P5L C;  2GWR A;  2O03 A;  5DUK A;  4B09 A;  1J7K A;  2QM3 A;  2A6H F;  3BPX A;  4ZZD A;  3NQO A;  2YX7 A;  4LFU A;  4Q4Z F;  1KQ9 A;  1W7P D;  1U5T B;  4M6X A;  2VON A;  1P92 A;  5ILS A;  2MA3 A;  2YR2 A;  3GFJ A;  3LQR A;  3T8R A;  4S04 A;  4G7H F;  1T38 A;  3E5X A;  1P4W A;  2M45 A;  3WTZ A;  3FM3 A;  4A6E A;  2HEO A;  2VBZ A;  3IRQ A;  4DNC A;  1QGP A;  3MZY A;  3RIR A;  2RV8 A;  6PAX A;  3I58 A;  2D1V A;  2P8T A;  4UVA A;  3TO7 A;  2QQB A;  1D3Y A;  3F8C A;  2IT0 A;  1FX7 A;  4HF0 A;  3K0L A;  2EWN A;  3SXY A;  1B6A A;  4ESJ A;  3JAM Z;  3ZMT A;  3QPT A;  3GX4 X;  4UVC A;  3P7N A;  1R00 A;  2F5E A;  3KZZ A;  3H3U A;  4BYY A;  3U9G A;  5ERI A;  4CDG A;  1PP7 U;  1UB9 A;  4LG0 A;  2ESN A;  1SAX A;  2FXA A;  4Y13 A;  3SHF A;  3MQ0 A;  1Z9C A;  1RIO H;  5D4R A;  3OOP A;  1Z6T A;  4OMZ A;  4KIG A;  1F1Z A;  2QEN A;  4O5V A;  4XSX F;  5AON A;  1AOY A;  1USS A;  1O3R A;  1GXP A;  2HQR A;  2XAH A;  1J75 A;  3RKW A;  4TV7 A;  3BZ6 A;  4RB2 C;  3ERE D;  4M9X A;  3JSO A;  3J81 Z;  1H0M A;  1MJB A;  1WQ2 A;  2PJP A;  3GVA A;  2YX4 A;  1T0F A;  2O0Y A;  3U1D A;  5HLG A;  4CHU A;  2HYF A;  1T39 A;  2FRH A;  4OU0 A;  5ICF A;  2AXL A;  1WRJ A;  1TQM A;  4HV6 A;  2ADU A;  5DCF A;  5K5R A;  1O3T A;  4IJA A;  4CXF A;  1ON1 A;  1J5Y A;  1P4X A;  1HSJ A;  1FYM A;  2P7C B;  2Z9O A;  5K5Q A;  3E6D A;  2HTJ A;  4I98 B;  5L3G A;  1IXS B;  1IN5 A;  2Y48 A;  2BYV E;  1XCB A;  4A12 A;  4MQ9 F;  2ISY A;  2VC1 A;  3M8E A;  2VBX A;  1G3S A;  4YFK F;  3E3V A;  4L9T A;  3W6J B;  3KEO A;  3MFK A;  4GCV A;  4HQM A;  1YIO A;  2CW0 F;  4ENN A;  1FYK A;  1BC7 C;  4KA4 A;  1MZB A;  3GLX A;  2A5Y B;  2OD5 A;  2OQG A;  4N9H A;  1PP8 F;  2QQA A;  1DUX C;  5JVT A;  3L7W A;  4WK8 F;  2EFN A;  2COM A;  3LA7 A;  3HOT A;  4CO8 A;  1Y0U A;  3V8L A;  1G3W A;  1UCR A;  3MZH A;  2W24 A;  3K1P A;  5H6Q A;  2FNP A;  2H6C A;  2YU3 A;  1Q1H A;  5D5U B;  3HRT A;  4OIQ F;  3VFZ A;  2W25 A;  1R23 A;  1YYV A;  3WTY C;  2CSO A;  2PFB A;  5IT3 A;  4HF1 A;  4ENM A;  4XRF A;  2LDU A;  1O7F A;  3CUQ C;  3EYY A;  5FGM A;  1R5G A;  2IA1 A;  4U0W A;  4I09 A;  2GXB A;  4YG2 F;  2L02 A;  3IC7 A;  2R3S A;  4L9J A;  2DI3 A;  4PGH A;  4A2U A;  4UUV A;  3F8M A;  2M5W A;  3WE3 A;  2EFO A;  4G6Q A;  3Q9S A;  4KNY A;  4OIN F;  5LLQ A;  4JK1 X;  1FC3 A;  1IW7 F;  2DPU A;  4ENJ A;  5LGT A;  1FBU A;  1BI0 A;  2KKO A;  3DXJ F;  1OPC A;  2KIM A;  5TRD A;  4JQF A;  4YIF A;  2GQQ A;  1XMK A;  3WU1 B;  1OYY A;  2R7F A;  5K5O A;  5D8K B;  1GXQ A;  1TQI A;  1W7P B;  3E6C C;  4L18 B;  1JHF A;  1ULY A;  2CO5 A;  3ECO A;  4ZH4 F;  4HX4 A;  4AIJ A;  5LBQ A;  5IT9 Z;  1TTY A;  3HRM A;  3KET A;  1FY7 A;  4KMU X;  5D5V B;  2KJB A;  3PFI A;  2UXX A;  4HA8 A;  1ZRE A;  2CGP A;  3K2Z A;  2DLL A;  4WF2 A;  2VC0 A;  2EA4 A;  2RGV A;  5F6F A;  5LGU A;  1HKS A;  2EA2 A;  4EM0 B;  2ISZ A;  2MD5 A;  2VT2 A;  2D2W A;  1YO5 C;  1LDJ A;  2A69 F;  3DQV C;  3IHU A;  1T6S A;  5FFX A;  2MC3 A;  3IKT A;  4Q47 A;  3V7R A;  4ZYG A;  4AVP A;  1D8K A;  2OU2 A;  5HDN A;  2ZCW A;  2F5F A;  2DT5 A;  3JTG A;  4NHJ A;  3K69 A;  2FSW A;  2KIU A;  1HKT A;  1BI2 A;  3KP5 A;  3N4M A;  3FMQ A;  1MD0 A;  1D8J A;  1SD4 A;  2HWV A;  4HLY A;  4XBF A;  3VOD A;  2LKP A;  1QBJ A;  3SZP A;  3RPU A;  2XRO A;  3E5U A;  3CUQ A;  2FBH A;  1SFX A;  4R8H A;  1XSV A;  1U3E M;  2UWM A;  1K79 A;  1D5V A;  1S3J A;  2VXZ A;  3WTT C;  4EM2 A;  2C6Y A;  5KVR A;  3WTX C;  4GGG A;  1SFU A;  4M74 A;  2QBY B;  5CVU A;  2FMY A;  4U88 A;  3LAP A;  4UHT A;  2V9V A;  2FU4 A;  3E6M A;  4EJW A;  2K7L A;  5E8I A;  5DYM A;  2Z3Y A;  4XLP F;  2XV4 S;  1QO0 D;  2FE3 A;  2Z99 A;  3BOQ A;  2ELH A;  5BMZ A;  4WXC A;  1HKQ A;  4NQW A;  2FEZ A;  1A04 A;  4MTE A;  2K4B A;  4EV0 A;  4RB3 C;  3WTW C;  1ONV A;  2F2E A;  4ZYH A;  2FQ3 A;  3CLO A;  3RYR A;  1YTY A;  3RKX A;  5CYV A;  1R22 A;  5D4S A;  1K78 B;  4OMY A;  1V4R A;  3FF5 A;  5BS6 A;  4KMF A;  3RYP A;  2IW5 A;  3C1D A;  1FWZ A;  5ED4 A;  3Q5F A;  3ZMS A;  5E1X A;  2MBF A;  3FZV A;  4EJO A;  1WSU A;  1HQC A;  5CVI A;  4ENK A;  1I1G A;  4EGZ A;  4XSZ F;  3EET A;  3KP7 A;  3KCC A;  5EEG A;  5EEH A;  3KLN A;  3TGN A;  4A5N A;  1BJA A;  1IZ1 A;  2XAS A;  1FZP B;  3C3W A;  2WTE A;  2OAZ A;  3BWG A;  1G4D A;  3QP5 A;  4P55 A;  2G7U A;  3K1N A;  2RKH A;  2RN7 A;  4CGZ A;  4AD9 A;  4CZZ A;  1GHC A;  3RPQ A;  1LVA A;  3RI4 A;  3E97 A;  2UXN A;  1XDS A;  2M30 A;  1IAW A;  3T5X A;  5LGN A;  1S7O A;  3RJP A;  5E18 F;  2IPQ X;  2HQN A;  1BM9 A;  1K6O A;  1XGM A;  1OKR A;  2ZBK A;  5LEK A;  3RTR A;  1FNN A;  2OA4 A;  1LNW A;  2A07 F;  1BOA A;  4FT8 A;  3TKY A;  2PQ8 A;  2ZME B;  3I0T A;  1P2F A;  2STW A;  5HS7 A;  4HYE A;  1LB2 A;  4HLX A;  1I6X A;  1FLI A;  3L9F A;  1MDM A;  2H6B A;  3HIF A;  2IRF G;  3K1M A;  5F64 A;  2ACJ A;  3GYH X;  4LB6 B;  1QZZ A;  3KP2 A;  5L3C A;  4EVI A;  1R1V A;  4G6D A;  1SD5 A;  1O3Q A;  2L4A A;  4HDU A;  1O57 A;  1LEB A;  1ZG1 A;  3G73 A;  4LLG F;  3F8F A;  4F7Z A;  3I59 B;  2GA2 A;  1RI7 A;  5A2Q Z;  3FXQ A;  4M72 A;  5HOO A;  1B59 A;  3CUO A;  4ETS A;  3D0S A;  2EB7 A;  1E2X A;  4KYW A;  5F1R A;  1OMI A;  4ZYE A;  5BPD A;  1XSD A;  2EFQ A;  1XSX A;  2GAU A;  2FBK A;  4Y17 A;  2DU9 A;  2HOE A;  1R36 A;  3ZMV A;  1TNT A;  4MEY F;  4RB0 A;  4A0X A;  3MCZ A;  1P6R A;  2M1B A;  2Z33 A;  2EV6 A;  5DUI A;  1RUN A;  1I5Z A;  1BBY A;  5FD5 A;  4BHB A;  2QUF A;  1STZ A;  3GZ5 A;  1P4A A;  4HDV A;  2H27 A;  4RGU A;  1U5T C;  4FX4 A;  2RDP A;  3J80 K;  2UZK A;  4IRI A;  1ZAR A;  3JTH A;  3F8N A;  3FX3 A;  3KP3 A;  4UXN A;  4EM1 A;  2HS5 A;  2JPC A;  3L2C A;  3SQN A;  3RDI A;  1FSE A;  1W4M A;  3F23 A;  1B9N A;  4EMS A;  2FBI A;  4NB5 A;  4ESF A;  1KQ0 A;  4AIH A;  4LJZ F;  4QLC U;  5DCM B;  2CFX A;  4Z2Y A;  2H09 A;  2OZU A;  4KIB A;  1XB4 A;  2JSC A;  2FNA A;  3KE2 A;  2HR3 A;  3QPH A;  1TQP A;  4OOI A;  2ZKZ A;  3LWF A;  4U0V A;  1U2W A;  4ESB A;  4P96 A;  3DEU A;  2XAJ A;  5ICG A;  2F5D A;  2LF7 A;  4RGX A;  4IHS A;  1DPU A;  4IRH A;  3FWE A;  3ABT A;  3WGI A;  1F5T A;  1OYW A;  2QLZ A;  3HTU A;  5FLX K;  2XUB A;  1IXR C;  2G9W A;  2WV0 A;  1QZY A;  2HTS A;  2ZFW A;  5CLS A;  1UHM A;  4A0Y A;  3CJN A;  1EH8 A;  3IRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...