2DU9A

Crystal structure of the transcriptional factor from c.glutamicum
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
116
structure length
116
Chain Sequence
VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGMFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted transcriptional regulators
publication title The structures of transcription factor CGL2947 from Corynebacterium glutamicum in two crystal forms: A novel homodimer assembling and the implication for effector-binding mode
pubmed doi rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Transcription
total genus 39
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2du9A00
3RKXA 4A2UA 2MD5A 4HA8A 3D0SA 1TW2A 2F5CA 2ZKZA 2R7FA 4EM0B 3EYIA 5L3BA 2IPQX 1I6XA 2QLZA 3RI4A 4M72A 2EB7A 2L4AA 3FMRA 2QQAA 3HOTA 2XIGA 1QO0D 1KQ9A 1R5GA 3EETA 2WTEA 4G7OF 2LDUA 4Q47A 4N9IA 4IF4A 1YYVA 2BGCA 5LHIA 2K02A 1MZBA 5D8KB 1SFXA 2H94A 1L0OC 3T5XA 1IRFA 1TLHB 3J81Z 4LLGF 5TRDA 3WTZA 5DYMA 3CUQC 2PEXA 3WTYC 3TKYA 2GA2A 2DT5A 2RVCA 3NRVA 4WX9A 3MWMA 5LLQA 2COMA 3KP3A 3GYHX 1BJAA 2MLKA 4LLLA 2ZFWA 1U8RA 2Y75A 2RQPA 2IT0A 4Y15A 3IWZA 2ACJA 5DUIA 2XAGA 1TNTA 5BOXA 1D3YA 2Z5UA 1S6LA 1U2WA 2XHKA 1SFUA 2CSOA 5D6EA 5F6FA 3HSEA 3C7JA 3BPXA 1B9MA 3V7SA 1P92A 1YW7A 4EM2A 3F22A 4WF2A 1I27A 2IRFG 1K6OA 1HKQA 1USSA 3KP4A 4AIKA 3KZYA 4IRHA 1LEAA 3FZVA 4OIPF 5JHUA 1GVJA 4CYDA 3CO6C 5LGNA 4WCGA 2VONA 4UVCA 3KETA 4EVIA 5DCMA 5HOOA 5LHHA 3P9KA 3BJAA 4KUMA 2FNPA 4LK0F 1SD5A 2A69F 4HBLA 4M9XA 5CVVA 3G3ZA 2LF8A 3R4KA 1IRGA 2Y48A 4L5JA 5K5OA 4ESBA 4PGGA 5KVRA 1B4AA 3RJPA 4OINF 3HUGA 2GQQA 4OOIA 2O03A 4ZYDA 1Z91A 4GYIA 2D1VA 4HDUA 4ZYGA 1HSJA 2WWYA 4L9NA 1XD7A 2HYFA 2Q8KA 3K2ZA 1KGSA 1B59A 2O61A 4I98B 2P5KA 2OAZA 4U7BA 3EQLF 5L3GA 3WTUC 5HLGA 5FO5A 1IN7A 2CQKA 3I5UA 2H6CA 4NHJA 2HOEA 1WSUA 4CHUA 5FLXZ 3KZZA 4R79A 4IPAA 1HKSA 4YFNF 1EH7A 2UXXA 1GXQA 4RGUA 1ZG5A 3HTSB 2GAUA 4CZZA 5FFXA 4XSZF 1ZRCA 3M8EA 2A61A 1H0MA 2UWMA 2W85A 2JRTA 3GXOA 2HQRA 2EJRA 3P9IA 2AS5F 1FYMA 1F9NA 3GVAA 2CWEA 4HX7A 1D8JA 2R7DA 4L0ZB 1T0FA 4IHSA 3RIRA 1ZG1A 4RB3C 2EFNA 3E97A 4KYWA 2TDXA 3ZMDA 4WXHA 1REPC 1YS6A 3L2CA 3F21A 4I02A 2UXNA 1Z6RA 1WKMA 1K78B 1S29A 4UVBA 5BQTA 3B02A 2JPCA 4F7ZA 3WTTC 2JT1A 3ABUA 3E5QA 2EFOA 5HVQC 2ZJ2A 1H9TA 4KT5C 2C6YA 5HS7A 5CYVA 4EJOA 2V1XA 2L3DA 4LJZF 4RB2C 3CUQB 2H6BA 4TV7A 3JTGA 3BJ6A 3V4GA 1A04A 1O3RA 5JVTA 3FM5A 4HZFA 4BAYA 4EGZA 2HQNA 1XGSA 3TO9A 3L00A 2D1HA 2VXZA 2VT3A 2NS0A 3D5LA 2P7VB 1ZRFA 3I59B 1G3TA 3Q9VA 1U78A 4RB0A 4G8XA 2DK5A 1KU2A 2M45A 2A07F 2DAOA 2W57A 3GZ6A 1BIAA 3OV8A 4RGSA 2HKOA 2K7LA 3BDDA 4G7HF 3KLOA 3QU6A 3LA7A 2QBYB 6PAXA 2PMUA 3KP7A 3PQKA 1ZLKA 1TTYA 1UHMA 4L18B 1I5ZA 3FXQA 4EMSA 2F5DA 2QVOA 4M9SA 4QLCU 4YG2F 2FMYA 2DI3A 1QPMA 4ZYHA 1PP7U 2PMHA 1OMIA 3EDPA 1ZH5A 4Z2YA 3EYYA 3R60A 4XLPF 3DF8A 2K4JA 4OIOF 2EFQA 3F3XA 2XAQA 2HWVA 1CF7A 4KMUX 2ZMEB 3J80Z 2XGXA 3SZPA 1ZAOA 3I58A 1R23A 1LQ1A 1G6NA 5ILSA 2A5YB 2HYGD 2LF7A 2ZO4A 1H9GA 1S3JA 4MEYF 2L54A 3ZMSA 2V79A 3TGNA 4A6DA 4HV6A 4EGYA 2Q2EA 3LQRA 1HW2A 1BM9A 1P4WA 4JBAA 3MFKA 3DEUA 3WGIA 3GZ5A 5LRSA 1WRJA 3L9FA 1MJAA 5DDGA 2RDPA 3R61A 3LWFA 3HRMA 3F8MA 1LNWA 4YIFA 2DPDA 5E8IA 4KFCA 3I4PA 5D5XB 2BE5F 3K1MA 1YW8A 4ESFA 4IHTA 1TQIA 3E6DA 3O3KA 5BS6A 2G7HA 4ENKA 2VBWA 5DEQA 1FT9A 2GA1A 3AAFA 3U9GA 4KICA 3RDIA 1BI2A 2OQGA 2Z3YA 5LGUA 4HQMA 4DNCA 3FXRA 3QRFF 1T38A 4WK8F 1G3YA 2WC2A 3GFJA 2IA1A 1HSTA 3K0LA 2D2WA 2RC4A 3KEQA 2XVCA 3FF5A 1GHCA 1Z7UA 3MQ0A 1YO5C 4GGGA 3JAMZ 3NEUA 2BYVE 1Z1DA 2H09A 2YPRA 2VOPA 3VODA 2PJPA 2O8XA 1KA8A 3E6BA 4IJAA 4LD5A 1XGMA 2LSOA 1FBUA 2HGCA 1USTA 1SD7A 2VE8A 1QQIA 1BN5A 2JPBA 1IF1A 2EK5A 4S04A 3F6VA 1S7OA 4U0WA 2XRNA 4RAYA 3WTXC 3DFGA 1Z05A 5D5UB 2HR3A 4LK1F 1PP8F 1PDNC 1ZHFA 1Q1HA 2STWA 2OBPA 2IA0A 4IRGA 5LGTA 2FBIA 5FGMA 3FX3A 3GO5A 5CVRA 5LBQA 5TJJA 5HS8A 3V8LA 2K4BA 4BNCA 1O7LA 1R00A 2DQRA 4MEXF 1DPUA 1P4XA 3DQVC 3ZP5A 4KIGA 1R1VA 3VB2A 1JXSA 2HZTA 2MLGA 4AIHA 1IN4A 2CYYA 2VC0A 3WGHA 3IL2A 1FOKA 1IW7F 1J9IA 2VOOA 5LHGA 3C3WA 3E6MA 3MAJA 3GX4X 4PCQA 3HRTA 1JHHA 1HXDA 2W84A 4E70A 4A6EA 1G3WA 3V7CA 1XDSA 2P7CB 4KDPA 3KP6A 3F23A 1ONVA 3CJNA 2FEZA 4HV5A 4LLNA 1FPQA 2V1DA 2BBYA 1QZYA 4EJVA 2GZWA 2QQ9A 3T1BA 5IT9Z 2FF4A 2OU2A 1G3SA 4UHTA 3T8TA 3SHFA 1O57A 3R0JA 2Y0MA 1B6AA 1IXSB 3TQNA 1HBXG 2NAZA 1LVAA 2ISZA 1K7AA 1UFMA 2M30A 4CXFA 2P6TA 2A6HF 1RIOH 4RB1A 3KEOA 1ULYA 2P4WA 3LA2A 4G6DA 1ZLJA 4HYEA 2QQBA 4LG0A 4A5NA 1J0RA 4M74A 2DPUA 2ZBKA 3IHUA 1WI9A 2A68F 3LA3A 5L3CA 3JSOA 1ZREA 4BH9A 1FNNA 2X0LA 2KKOA 3BY6A 4M9ZA 2K86A 3ERED 3F8BA 1U5TA 2HTSA 4R1HA 3GWZA 4NQWA 1IXCA 2DK8A 4DQ2A 4MTEA 2CFXA 1NHAA 1F1ZA 2M5WA 4L9JA 4YFXF 5E1ZB 4N9HA 4ON0A 3LFKA 5CVIA 3V7RA 3DPTA 1YW9A 2VODA 1MDMB 3NQOA 5D4RA 4HLXA 1ZGJA 2X4HA 4U0YA 1AWCA 2H27A 4QWQA 4XRFA 5AIPA 3MEXA 1E2XA 1R1TA 4WXDA 2XROA 1OYWA 4LFUA 1LDJA 1W7PA 1YFHA 2W25A 2VBXA 1SMTA 3KCCA 3ZQ7A 2FBKA 4P96A 4UNOA 1U3EM 2MA3A 5DD8A 2KJBA 3RTRA 3P7NA 4ZH4F 4G6QA 2FU4A 3MZHA 1JGSA 1ZGAA 2A6EF 3M1EA 1BC8C 1X3UA 3DXJF 1CF7B 1TW3A 2ESNA 1R7JA 2GWRA 3HSFA 1TNSA 3G73A 2NRAC 2DTRA 3CLOA 1ON1A 5H6RA 2PBIA 3HYIA 4ZZDA 1XCBA 3IWFA 2OQRA 1W5TA 2A3SA 5E1XA 2E1CA 1P6RA 5ICEA 3ZPLA 4AWXB 3F8NA 3GEZA 3TDZC 4LB5A 4M73A 1OKRA 3J81K 1IUYA 2FRHA 1FP2A 3KE2A 3O2PE 1TQPA 1ZN2A 3ZMTA 2VE9A 4LMYA 4EM1A 4XBFA 5E8GA 3WGGA 1Y0UA 3HOSA 3EUHA 2ETHA 4ENNA 1HW1A 1FWZA 1FBSA 4CICA 1LJ9A 5ILVA 1HKTA 3I64A 4M6XA 2ADUA 4FX4A 1B9NA 3IC7A 4I0BA 5H20A 1XDUA 2F5EA 2EFPA 2RN7A 4HX8A 4B8XA 3Q5FA 3QP5A 4FX0A 3HTUA 3REOA 3TOBA 2CW0F 3GLXA 1LDKB 3FMQA 4A5MA 1O3TA 4UV9A 2E7XA 3H3ZA 4UV8A 1I1SA 1QGPA 2FOKA 1P4AA 4ENJA 2IW5A 2CO5A 3FHZA 1T39A 1U5TC 3BPVA 3TOAA 1V4RA 2XV4S 2CGPA 4EJUA 1FX7A 2KIFA 1W4MA 1K78A 1DUXC 4EQQA 3I54A 3WG9A 2ESHA 3IRQA 3SXYA 2GXBA 2K27A 2OA4A 1ON2A 3QOPA 2L01A 1IN8A 3ISPA 4MQ9F 3CO7C 1KYZA 4A0XA 2PG4A 2EV6A 5E20A 3Q9SA 1KU7A 4M6YA 5L3EA 2VN2A 4U0VA 2R3SA 4I7HA 4YFKF 1OYIA 1J75A 2G7UA 1MKMA 3LAJA 3K69A 4WWCA 2Q0OA 2XASA 2IA2A 4I0AA 2PN6A 3QAHA 1OPCA 4RGXA 5FLXK 3M7GA 4OIQF 3E5UA 3I59A 4I01A 5D6FA 4KA4A 2RV8A 3GFMA 4OU0A 5E18F 2DLLA 3K9TA 3M9AA 2J5PA 2O0YA 1WQ2A 2MC3A 4HF1A 3SZTA 4Q4ZF 3IKVA 3PFIA 5DV5A 2QENA 1O3SA 4HLYA 1LDDA 5F1RA 3ZMZA 4FHTA 3WTWC 3E3VA 2JZYA 1YS7A 1RUOA 3CDHA 3N4MA 3FM3A 3S2WA 1YIOA 1L3LA 1RZ4A 4KN4X 4WXCA 3GFLA 4M71A 4BHCA 3KP2A 3F6OA 5J6XA 1EV7A 5LEJA 3T8RA 5D4SA 2KIMA 5L3DA 4JK1X 1Z6TA 1SAXA 3QPTA 5HDKA 3WU0A 2RGVA 3H92A 2ZMEA 4HF0A 1BI0A 4U88A 2O3FA 3L7WA 2HEOA 3HRSA 1T98A 1SFEA 2M1BA 5L3FA 3CTAA 1D8KA 1BC7C 1W5SA 2F5FA 3WTVC 4BHBA 5DCMB 2MH2A 3C18A 3F8CA 2XUBA 1R5HA 1ZRDA 3ZN0A 5E1WA 1UCRA 4BQAA 1SMYF 1WWXA 2DFIA 4CGZA 2EV5A 4KNYA 1ZARA 2JSCA 1MGTA 3SQNA 1G4DA 3ABTA 1FC3A 1FY7A 3HSRA 2BV6A 4LG0B 5CVUA 4UXNA 1DPRA 4HAMA 3RKWA 2VC1A 4Y13A 5D8LB 5HDNA 2Z9OA 1J5YA 4GYGA 1F4KA 5DD4A 1XMKA 1U5TB 3I0TA 3R6SA 1R58A 1P2FA 2LKPA 1IXRC 3VFZA 3KP5A 5A2QZ 3RYPA 1FYKA 4P55A 3J7AO 2L4MA 1DDNA 3ZMUA 1MD0A 5CJ9A 2NYXA 2NNNA 2HFHA 3BROA 2Z99A 4OIRF 3J80K 3WE3A 3BOQA 2IP2A 5IT3A 3IRRA 1KQ0A 1J2XA 4P9UA 1LB2A 3QP6A 2YX4A 1RUNA 2M8EA 3BJOA 5H6QA 4A0YA 2QZ8A 4Q48A 1JE8A 1YQAA 4I09A 4KIFA 1FSHA 1UHWA 4JQFA 3WODF 2RKHA 1W7PB 3GW2A 2PI0A 1FYLA 3ZMVA 3VEPA 4L0YB 3ECHA 5EEHA 4L5IA 2GIVA 1I1GA 1LEBA 4S05A 1QZZA 1XGOA 4GXOA 2QYOA 5K1YA 2AXLA 4ZYEA 3K1PA 2FQ3A 1S8NA 5BMZA 2FBHA 4PZJA 2EA4A 3T0YA 1XGNA 2LNBA 1KU9A 3FXUA 3ELKA 4CO8A 5ILUA 5KK1A 3RPUA 1MJBA 3VOEA 4D0PA 1XMAA 3H3UA 5AONA 2QWWA 1KQ8A 5JFRA 5ICGA 3CUOA 2YR2A 2FA5A 2JTVA 1PUEE 4LB6B 4P9FA 4I2OA 4L9VA 2D45A 3W6JB 3V8KA 3P9CA 1BI3A 2L02A 5K5RA 5ICFA 2VT2A 4L9TA 1D5VA 1KU3A 2ISYA 2V1UA 3JAMK 1BI1A 3MCZA 3ZN1A 3DPLC 2OZ6A 1BBYA 2DU9A 3I53A 3PQJA 3QU3A 2DBBA 1T6SA 3HIFA 4RGRA 4OMYA 3U2RA 4AD9A 1S7AA 2OD5A 3V8JA 2XKOA 5HS9A 2EFWA 1T2KA 2E7WA 4H0EA 4BXUA 3DP7A 3E6CC 4G9YA 4GCVA 4A12A 5J8CA 2YSRA 2P8TA 3LQQA 5EEGA 2VBZA 4PGHA 4KN7X 4N0BA 4Y17A 2QUFA 4EJTA 3U1DA 1KYWA 2XAFA 4RAZA 4AIJA 5DUKA 4Q5SF 3FWEA 3KFWX 1UB9A 1J7KA 1ODDA 2FMLA 2DQLA 5HLHA 3LAPA 3COAC 1EH8A 1Z9CA 5J8FA 1IAWA 3R0AA 4KMFA 5ED4A 3WE2A 3OOPA 1GXPA 2VBYA 2ZXJA 4O5VA 3JSPA 3ROUA 5BPDA 1YG2A 4ASNA 2B0LA 2HS5A 3K1NA 3GF2A 1CGPA 2EA2A 2DO7A 1XB4A 2KIUA 1XSDA 1TQMA 5E17F 5HLIA 1XSVA 1AOYA 1B1BA 3MZYA 4HDVA 2P5VA 5CLSA 3WU1B 5LRRA 5A2QK 4HX4A 1QNTA 4UVAA 1HQCA 4MQVA 4G7ZF 3JW4A 4K2EA 1JHFA 2KJCA 2UZKA 1RNLA 1SD6A 3L09A 4PDKA 4IRIA 2FXAA 4CDGA 3GUDA 2F2EA 2IVMA 2ZNZA 1HW5A 4IVNA 5ERIA 4B09A 3B73A 1O3QA 2DW4A 1R36A 2E1NA 5IT9K 1MDMA 3JTHA 2MBFA 2O6GE 1YLFA 4MGRA 3I71A 5CVJA 1C0WA 2RNJA 2ELHA 3HHGA 4UUVA 4MTDA 1FZPB 3RPQA 2PLYA 2ZCWA 4KIBA 3TDUC 5DCFA 3HHHA 4P5OA 2NNYA 4YIIA 1FBQA 2QM3A 2YX7A 1TBXA 3SFZA 2M87A 1SD4A 1K79A 1XSXA 4FT8A 2HKXA 2MH9A 3RKYA 3HRUA 4ZZLA 3QPHA 2BEOA 2P6SA 1VTNC 5F64A 4ESJA 3FMSA 4O6JA 3DV8A 4AVPA 1DP7P 4LGWA 1IN5A 1F5TA 3M8FA 1R22A 1QBJA 1IN6A 5HDGA 3CUQA 1FP1D 2W24A 4U7DA 2G9WA 2V6CA 4HF2A 1R1UA 3W6KB 1ZG3A 2GXGA 3F8FA 4NB5A 2XAJA 3TO6A 2EWNA 2IJLA 1BIBA 1V3FA 2P5LC 3C1DA 4RS8A 5D5WB 1EH6A 3GFIA 4ENMA 1E17A 1XN7A 5FD5A 5K5QA 3N97A 2CG4A 1ZYRF 3F72A 2V9VA 3O6BB 2QBYA 1FLIA 3BP8A 4OMZA 3LSTA 4MNUA 2XKPA 4BYYA 2FSWA 3ECOA 5AIQA 3BWGA 1STZA 4HOBA 2STTA 1OR7A 4IXAA 3WTSC 4HW0A 2J5OA 3E5XA 4BHPA 2HTJA 3KLNA 5LEKA 4A0ZA 4EJWA 5ICCA 4G94A 1W7PD 2PFBA 5FD6A 1YTYA 3RYRA 1J59A 1OYYA 5FFZA 4EV0A 5JI6A 1RI7A 2EV0A 2FE3A 1XCVA 2KRFA 5D5VB 5BPIA 4GO1A 1IZ1A 4XLNF 2WV0A 4R8HA 4O3MA 2HDCA 3TO7A 1O7FA 3BZ6A 4HQEA 4MHGA 4XSXF 3ULQB 5JR3A 1FSEA 3DKWA 2ZNYA 2FNAA 3ML6A 2OZUA 1BOAA 4ETSA 2PQ8A 2YU3A 2Z33A 1U6GA 5FB2A 3IKTA 2XAHA 1MJ9A
chains in the Genus database with same CATH superfamily
3AG1H 3RKXA 2MD5A 4A2UA 4HA8A 3CC2I 3GTPJ 3D0SA 1TW2A 2F5CA 1X4PA 2IAIA 2ZKZA 1XPXA 2R7ZJ 3C2GA 2R7FA 2B7EA 4QTRA 2ECBA 2KISA 4EM0B 3EYIA 5L3BA 2KDZA 2IPQX 1I6XA 2QLZA 3A0HC 4Y7NJ 3RI4A 5E3NA 4M72A 4D7MA 2HOSA 3BQZA 3GCMA 2EB7A 2L4AA 4RM3A 3FMRA 2QQAA 3H9GA 3HOTA 2KFDA 2R0QC 3VYSB 2CUZA 1QO0D 1KQ9A 1R5GA 2XIGA 5IOZA 3EETA 3JRGA 2WTEA 1LE8A 4G7OF 2LDUA 4Q47A 3IAM2 4N9IA 3MKYB 4IF4A 1YYVA 2BGCA 4LIUA 5LHIA 2K02A 4YRVA 4J01A 1MZBA 5D8KB 1SFXA 2H94A 3K4NA 5LD2C 1L0OC 3T5XA 1IRFA 3CCRI 3W2AA 3K4KA 2OJED 2CU7A 1X1CA 1NH3A 1TLHB 3J81Z 4LLGF 5TRDA 5HLTA 1UHSA 1JJ8C 2NVYJ 3WTZA 3RSNA 3BG7A 5DYMA 3ABKH 3CUQC 2PEXA 2N8GA 3WTYC 1XC5A 2E1OA 2GA2A 2VJIA 2DT5A 2RVCA 4PJNA 3TKYA 3NRVA 1VQ5I 4WX9A 5IP7J 2VB6A 3MWMA 2CW7A 3ZXSA 1GVDA 2HQ5A 5LLQA 2COMA 2H8WA 1I3QJ 3KP3A 5GAHJ 1ZQ3P 5FRNA 3G2BA 1YITI 3GYHX 1BJAA 2MLKA 4LLLA 2R4GA 2L7FP 3SDGA 3OL4A 2ZFWA 2VJJA 2E2HJ 1VQ7I 3S16J 1U8RA 3TEDA 2Y75A 2RQPA 2IT0A 4Y15A 2CQQA 1I39A 3IWZA 2ACJA 5DUIA 1U9NA 2XAGA 3PUFA 1TNTA 3J7YJ 5BOXA 1LFBA 1D3YA 2Z5UA 4UUSA 1S6LA 1UAAA 3W2VA 1U2WA 2XHKA 4J19A 2CSOA 1SFUA 4X1EA 5D6EA 2OTJI 5HNHA 5F6FA 3HSEA 1LUJB 3A4CA 3C7JA 5EJCA 3BPXA 2BY1A 1B9MA 3CJTB 3V7SA 1P92A 3FKIJ 1YW7A 4EM2A 2M7BA 3F22A 4WF2A 4I76A 1TWGJ 1I27A 2ZB9A 3PSIA 2IRFG 1K6OA 1HKQA 5J3LA 1USSA 3KP4A 4AIKA 2JUCA 1ZGWA 2W1OA 1K4TA 1X1AA 3KZYA 4RBOA 2UV1A 4IRHA 2P81A 1DQUA 1LEAA 3FZVA 4D5FA 4OIPF 5JHUA 1GVJA 4CYDA 1LKXA 1OR7C 5LGNA 4WCGA 3CO6C 3TW6A 2VONA 4UVCA 3K70D 2VPLA 3KETA 1WJ5A 4EVIA 1I6HJ 5DCMA 5HOOA 3QODA 5LHHA 5J4VA 1UJ8A 3P9KA 3OYNA 3BJAA 4KUMA 2FNPA 2PMZA 1SD5A 2A69F 4LK0F 1VF9A 1WJEA 4HBLA 4M9XA 2ZJPF 1Z3YA 5CVVA 3G3ZA 4PFPA 2LF8A 2MD0A 3CCMI 5FROA 3R4KA 1IRGA 2X6XA 5J1UA 3ZGKA 2Y48A 1WJDA 4L5JA 5K5OA 4ESBA 4PGGA 5KVRA 1B4AA 3RJPA 4OINF 2WAQN 1OJLA 3HC7A 2ZMEC 1X3ZB 3HUGA 2GQQA 4OOIA 2O03A 3H0DA 5CQGA 2WAEA 4ZYDA 1Z91A 4GYIA 2D1VA 3J7AY 4HDUA 4ZYGA 1HSJA 2HQAA 2E1MB 2L0KA 3BG5A 4L9NA 2WWYA 1FOWA 1IV6A 1XD7A 2HYFA 2DA6A 3Q0UA 2Q8KA 4D1QA 3K2ZA 1JKPC 1KGSA 1B59A 4L5EA 2O61A 4I98B 2QSHX 3IUOA 2P5KA 2EBIA 2ID3A 3PNVA 2GXAA 2DA2A 2OAZA 4U7BA 4C2UA 4E7JA 2JSPA 3J7ZI 4Y52J 3EQLF 3FK7A 3D5RC 3IH3A 3K2AA 2LG4A 5L3GA 3WTUC 5HLGA 5FO5A 4ZDOA 1IN7A 2CQKA 2L7ZA 3GTMJ 4D7NA 3OYIA 4HNVA 2VASA 4DOZA 3G71I 3I5UA 4M3BA 2H6CA 4BY7J 1NK2P 4BQOA 4NHJA 2HOEA 1Y6IA 1WSUA 3KPHA 3VWBA 2LR8A 1YJWI 4CHUA 4DZPA 5FRMA 5FLXZ 2WADA 3KZZA 4A3KJ 4R79A 4IPAA 2DOAA 1HKSA 4JX6A 4YFNF 5GAEJ 1EH7A 2UXXA 1MBFA 1TWAJ 4IO9F 1DGRM 1GXQA 4RGUA 1ZG5A 5FKMA 3HTSB 5CQEA 1Z67A 2GAUA 4CZZA 2DDAA 4U87A 5FFXA 4XSZF 1ZRCA 3MKLA 3HGGA 3M8EA 2A61A 2K40A 1H0MA 2UWMA 2W85A 5GPAA 2JRTA 4XRSG 2CQNA 4FE7A 3GXOA 1ZR2A 2HQRA 2EJRA 2M8GX 3P9IA 2AS5F 1S7EA 1FYMA 4MLOA 1F9NA 3MKWB 3GVAA 2CWEA 4HX7A 4AYBN 3G6EI 3GBGA 1D8JA 3CC7I 4XORA 3MMYB 2V1NA 2R7DA 4V2GA 5HODA 4L0ZB 1T0FA 4IHSA 1IG7A 3OIPA 3RIRA 3CCSI 1ZG1A 4RB3C 2EFNA 1D1CA 2DMQA 2HDWA 4CCNA 3E97A 4KYWA 2NOJB 2TDXA 3ZMDA 3H5RA 4WXHA 1REPC 1YS6A 2W82A 3L2CA 3F21A 4I02A 2FQ4A 2UXNA 1Z6RA 1WKMA 1K78B 2DOFA 1S29A 1IUFA 4UVBA 4E7LA 2K85A 1D0ZA 4RDUA 2E2IJ 1MNDA 2MSYA 5BQTA 3OS0A 1B8IB 3B02A 4IX7A 1ETKA 4C30A 2JPCA 5GAGJ 1WVRA 4F7ZA 3WTTC 3M3YJ 2JT1A 3ABUA 3E5QA 3FHNA 2JA6J 3ABMH 4M3FA 2EFOA 2KDOA 5HVQC 2ZJ2A 1CQTA 1Y56A 1H9TA 4KT5C 3I4NJ 2C6YA 5HS7A 5CYVA 2E71A 2EIMH 2F48A 4EJOA 1OFCX 2V1XA 4XOTA 2L9NA 4IQJA 2HYJA 2CMPA 2L3DA 4LJZF 4RB2C 1D0YA 3CUQB 2H6BA 4TV7A 3JTGA 4A69C 2DXIA 3BJ6A 3M1CA 4DGWB 3V4GA 1A04A 1O3RA 1NK3P 4E7KA 2NOGA 2LOOA 3S3NA 5JVTA 3FM5A 3TP0A 1G59A 4HZFA 3DEEA 2LBFA 4BAYA 3OS1A 4EGZA 2XF6A 2HQNA 1XGSA 1I50J 2DA7A 1JT6A 2F4IA 2OCEA 2Y0SN 3TO9A 4KISA 4PFOA 1OCZH 3GTQJ 1JJ6C 4GRIA 3OYJA 3L00A 1D1AA 2D1HA 4MIMA 2VXZA 2VT3A 2NS0A 3NAUA 2AQEA 3D5LA 3S32A 1Y1VJ 2P7VB 1ZRFA 3I59B 5K7FA 1G3TA 3LSPA 3Q9VA 4XLAA 1U78A 3OY9A 4RB0A 4G8XA 2DK5A 1KU2A 2M45A 2A07F 2DAOA 2W57A 3GZ6A 1MBJA 1BIAA 3BR5A 3OV8A 4RGSA 4IOAF 2HKOA 2K7LA 2MFZA 3BDDA 2BVLA 3ZQCA 2DA4A 2DA1A 2KL4A 2PX9A 3KLOA 4G7HF 3QPLA 3QU6A 1AU7A 3LA7A 1UZCA 2QBYB 2KRHA 6PAXA 3I56I 2PMUA 3KP7A 3PQKA 4HEA2 4E7SA 1ZLKA 3CMYA 4ZC3A 3HOUJ 1VNDA 1TTYA 1UHMA 4L18B 1I5ZA 3FIWA 3AKZA 4BQNA 3FXQA 4EMSA 2F5DA 1RR8C 2QVOA 4M9SA 4QLCU 1VQ4I 2CFOA 2KHMA 4YG2F 4NC7A 4FASD 2FMYA 2DI3A 1QPMA 2VQGA 4XKWA 1LFUP 4ZYHA 1PP7U 2WAFA 2PMHA 1OMIA 3EDPA 1ZH5A 3DBRB 4C3IJ 3A01A 4Z2YA 3EYYA 1BOBA 3R60A 2F4MB 2DCEA 2DT7B 1PUFB 4XLPF 3DF8A 2K4JA 2XB0X 1K83J 3NARA 3OYGA 2EFQA 4OIOF 3F3XA 2XAQA 2HWVA 2RREA 1FIPA 1YJ9I 4KMUX 1CF7A 2LC2A 2X85A 2LTPA 2ZMEB 1ZELA 3LFUA 4XIDA 3J80Z 1AHDP 2XGXA 3SZPA 1YX5A 1ZAOA 5J47A 4A3BJ 3H5AA 3I58A 1R23A 4MFEA 5J1YA 1LQ1A 2E2JJ 1G6NA 2MC4A 2IBDA 2XF5A 5ILSA 2A5YB 1EF4A 5GADJ 2HYGD 4G6TB 2K9NA 2LF7A 1XMXA 2ZO4A 1H9GA 4OAZA 4CCOA 2HZDA 1MJ9A 1S3JA 3RPUD 5C4XJ 4MEYF 2W48A 2L54A 1BW5A 2JWTA 2V79A 3ZMSA 2AHQA 2E5ZA 3G1OA 3TGNA 4ABZA 3OSGA 1JKQC 4A6DA 4HV6A 3IV5A 4EGYA 3PIOF 2Q2EA 3LQRA 1HW2A 3VPRA 1BM9A 1P4WA 1T0FC 4JBAA 4C3JJ 3MFKA 3DEUA 3WGIA 2AQFA 3GZ5A 5LRSA 1WRJA 4YEJA 3L9FA 1TL8A 1MJAA 5DDGA 2RDPA 3R61A 5F0FA 2JJ7A 3LWFA 3HRMA 3F8MA 1LNWA 4YIFA 4RLQA 3DU6A 2ZXWH 2BW3A 3D5SC 2DPDA 2PJRA 5E8IA 4KFCA 3I4PA 3A1YA 4AC0A 1EJ9A 2BHYA 3BR3A 3KEYA 4IHVA 2AXTC 4MO7A 1B72B 5FJ8J 5D5XB 2BE5F 3K7AJ 3K1MA 3OYMA 5GTIC 1VQMI 1YW8A 3KZIC 1LE8B 4ESFA 2VL8A 3S93A 1JI8A 4IHTA 1SANA 5JVGF 2CQXA 1TQIA 1VI0A 3E6DA 3O3KA 5BS6A 4II2A 2G7HA 3MN2A 3GTOJ 4ENKA 1S9HA 4BEHA 2VBWA 2MABA 1A5JA 2XSDC 5DEQA 1Z21A 1FT9A 2GA1A 3AAFA 3U9GA 5KNLA 2QCOA 4KICA 3OWTA 3CLQA 1X3WB 1BI2A 4MFDA 2LVSA 2OQGA 3RDIA 3V42A 3A0BC 4XRSA 2Z3YA 5LGUA 4HQMA 4DNCA 3FXRA 3QRFF 1T38A 1MNEA 4WK8F 1G3YA 5IYDJ 1S5LC 3JRCA 1QHGA 3CZ6A 1ZKGA 2KZVA 1DU0A 5TGTA 2WC2A 3GFJA 1R49A 2IA1A 1HSTA 3K0LA 3OYLA 3CCLI 1SC7A 3QYBA 3L1PA 3ABLH 2EZIA 3DTIA 3MZ8A 5EYRA 2XDVA 1WZ2A 2D2WA 2RC4A 1R4NB 3KEQA 2XVCA 2ZC2A 2EPFA 3FF5A 1Z0XA 1GHCA 1Z7UA 3MQ0A 1OLTA 5FKKA 1YO5C 4GGGA 4PJJA 3JAMZ 3PIPF 3E0JB 2BY0A 3NEUA 4CUGA 3HOYJ 2BYVE 3KYDB 1Z1DA 1A36A 2H09A 2YPRA 2VOPA 1R9TJ 2OUMA 2FD5A 1OCRH 1WH7A 3VODA 2PJPA 2O8XA 2M7AA 1JKOC 2CS3A 2OV7A 4ZDLA 1KA8A 2F4OB 3E6BA 3GMEA 4DZJA 1T33A 3IH4A 4IJAA 4LD5A 5EG0B 1A31A 4UY8I 1XGMA 2LSOA 1NG7A 1FBUA 2HGCA 1MIJA 1I3AA 1HDDC 1G8XA 1USTA 1BW6A 1POGA 1SD7A 5IY5H 1VQLI 2VE8A 2XPVA 2XGEA 1QZEA 1QQIA 1BN5A 2JPBA 1IF1A 2EK5A 1XG1A 4S04A 2R7QA 3F6VA 2LD5A 3LSIA 3RQ4A 1S7OA 4U0WA 2B63J 2CV0A 2XRNA 4RAYA 1FMVA 3WTXC 5J40A 2DJIA 3DFGA 1Z05A 3F0CA 1TZLA 4LOCA 5D5UB 4CYCB 3HG9A 3OYFA 2QF7A 2HR3A 1GUUA 4B3XA 2Y31A 4LK1F 1PP8F 3M8JA 1YHQI 1PDNC 3S1QJ 1ZHFA 1Q1HA 3MD2A 2STWA 2OBPA 3GZNB 4NNJA 2IA0A 2R7UA 4IRGA 4RAGA 2D5VA 5LGTA 1WJBA 2FBIA 5FGMA 3FX3A 4HNTA 3GO5A 3EUKL 3H5NA 3JCUC 5CVRA 5TJJA 5HS8A 5LBQA 3V8LA 3HOWJ 2K4BA 4BUPA 2X6OA 4BNCA 1O7LA 1R00A 2HOAA 2DQRA 4MEXF 1DPUA 1P4XA 2MGQA 3DQVC 3ZQHA 4KIGA 3ZP5A 1R1VA 3VB2A 1JXSA 2HZTA 2YUSA 3ESWB 1E0EA 2MLGA 4AIHA 1IN4A 2CYYA 3IP4B 1XS9A 3PSFA 3BT9A 1APLC 2VC0A 1W0TA 3WGHA 4ZJZA 3IL2A 3U21A 1FOKA 4IHYA 1IW7F 3VYRB 1J9IA 2VOOA 5LHGA 4KJZA 3C3WA 3E6MA 3MAJA 4OAYA 4W97A 3GX4X 4PCQA 3HRTA 1K4SA 2Z1DA 3LSJA 3DPUA 1JHHA 4ZTJA 2V9KA 2WB1A 2EIKH 5IPAA 2PMZN 2P0WA 1HXDA 4FE4A 5M5XJ 3ZOBA 2HPIA 2W84A 4E70A 4A6EA 4BJTA 2E60A 3AL0C 4BJ5C 2WBMA 1RETA 1G3WA 3P5JA 2DFHA 3V7CA 1TT0A 1XDSA 1RRJA 2P7CB 4KDPA 4B4CA 3DWLE 3KP6A 3F23A 2KZGA 4PSWA 1ONVA 1X1DA 1YE9A 4IZZA 3CJNA 3FBNB 2H1LA 4CCJA 2FEZA 4J00A 1R5ID 4HV5A 4LLNA 5DTDA 3SFIA 1FPQA 3VYUB 1NTCA 3CDIA 4XONA 1WCMJ 3WHBA 4A3CJ 5DS9A 1MBEA 2V1DA 2BBYA 5C4JJ 2A6TA 1QZYA 1MMSA 1ERDA 4EJVA 2GZWA 2QQ9A 1KONA 1UMQA 3ZQLA 2BY2A 3T1BA 3F9KA 2FF4A 5C3EJ 3BTIA 5IT9Z 2OU2A 1G3SA 2ELKA 4UHTA 3T8TA 3SHFA 3RZDJ 4UB8C 1O57A 3R0JA 3ZQIA 2Y0MA 1B6AA 3K6GA 1IXSB 3HEFA 2R5ZB 3SJMA 3TQNA 1HBXG 3AG3H 2XC7A 4NBQA 2DMNA 2HI3A 2NAZA 1LVAA 2ISZA 1EKEA 2I8DA 1K7AA 1MBKA 1UFMA 1VQOI 2M30A 3CESA 4CXFA 2CV2A 2P6TA 2A6HF 1RIOH 4HSTA 4RB1A 3VSLA 3KEOA 4V19K 2R7SA 4D9JA 4A3DJ 3CCYA 3M07A 2M0MA 2TCTA 4XM3A 1ULYA 2GOXB 2P4WA 1QVUA 2VKHA 1DGWY 3HXLA 1ZLJA 3LA2A 4G6DA 4HYEA 3GTGJ 3CDLA 5M3MJ 2QQBA 4DBRA 1YI2I 4LG0A 2Y2ZA 4AU7A 4A5NA 5EGOB 1J0RA 4M74A 4UUTA 4JX4A 3FK6A 2ZBKA 2DPUA 4PK4A 1SVOA 3SZGA 5EZGA 3PFYA 3IHUA 1WI9A 2A68F 3LA3A 4DYRA 5L3CA 3JSOA 3VSKA 1ZREA 4BH9A 3FISA 1FNNA 2X0LA 2KKOA 3BY6A 2G0EA 3JRHA 4M9ZA 3S1NJ 2K86A 3UKGA 3ERED 5BNGA 1A6QA 1HF0A 1ETVA 3F8BA 1U5TA 2HTSA 4R1HA 3GWZA 2YS9A 4NQWA 1IXCA 2DK8A 2K3PA 1SFKA 4DQ2A 4NC6A 4MTEA 1AKHB 2CFXA 3S1MJ 1NHAA 2VIXA 2KMUA 1WFXA 4E7ZA 1IC8A 1ITYA 4E7IA 1F1ZA 2M5WA 1QU3A 1ENHA 2DFFA 4L9JA 1N25A 4D5CA 1QHHD 4YFXF 1P7JA 4A3GJ 5E1ZB 3H36A 4N9HA 4ON0A 3WU2C 2TRTA 3LFKA 5CVIA 3FBIB 3DU5A 3V7RA 3U1KA 1NG6A 3DPTA 1S72I 4CCKA 1YW9A 2VODA 1MDMB 3BLYA 2LYCA 3NQOA 1X1BA 5D4RA 4B48A 4HLXA 1OQYA 1ZGJA 3CMMA 2X4HA 3FXMA 4U0YA 3OYEA 1AWCA 2H27A 4QWQA 2O8KA 1ETXA 2JA8J 4XRFA 5AIPA 3MEXA 1VQNI 3O8HA 1E2XA 1R1TA 4WXDA 2XROA 5F0CA 1OYWA 4LFUA 2ME0A 1LDJA 1W7PA 1YFHA 2W25A 3DLLF 1VFCA 1WI3A 2VBXA 2VQLA 1SMTA 3H35A 3JRIA 3KCCA 1K6YA 3ZQ7A 2FBKA 4P96A 4UNOA 1U3EM 4S0HB 2MA3A 1FJLA 5DD8A 3H9QA 5EF6A 2JUGA 3H0GJ 4F55A 2KJBA 3HZJA 1FTZA 3RTRA 1W36C 3P7NA 1TWCJ 1RC9A 2KRCA 4ZH4F 4IQ4A 4G6QA 2FU4A 2V9PA 2ZSHB 3MZHA 1JGSA 1ZGAA 4BDZA 2A6EF 1HLVA 2KPMA 3M1EA 1MH3A 3JR9A 1BC8C 1V5FA 1X3UA 2FUG2 3AFHA 3EUAA 3DXJF 1CF7B 1TW3A 3OR2C 2ESNA 1JTXA 3ZQFA 4BDYA 1FEXA 1R7JA 2GWRA 2LREA 3S3MA 3HSFA 1TNSA 3G73A 2NRAC 2DTRA 3CLOA 3S3OA 1ON1A 5H6RA 5FLMJ 5E3MA 2PBIA 3HYIA 4ZZDA 1E3HA 1XCBA 3IWFA 2OQRA 1W5TA 2A3SA 2O9LA 5E1XA 2E1CA 1P6RA 2HVRA 3B6AA 1T95A 3VDXA 3E7LA 5ICEA 2HDDA 3ZPLA 2DMPA 3LMMA 1WJFA 4AWXB 3F8NA 3GEZA 3HKZN 2QGUA 4JX5A 3OR1C 4M73A 1OKRA 3SYTA 2WV1A 3BG9A 4LB5A 5B66C 3MVPA 5C44J 3J81K 1IUYA 3ERMA 2FRHA 1BA5A 1ETYA 1FP2A 1MBGA 3KE2A 3O2PE 4OWRB 2B9SA 1TQPA 1ZN2A 3ZMTA 2VE9A 3AL0B 1JUPA 4LMYA 1U8BA 3ZR8X 2K9MA 2XRLA 2BOLA 3BCAA 2HXIA 4EM1A 4XBFA 4YIRX 5E8GA 4XMYA 1MBHA 3WGGA 1Y0UA 3BR2A 4BE0A 3S2HJ 3HOSA 3EUHA 2ETHA 3TP3A 3L2VA 3PO3J 4W1UA 2K3FA 4ENNA 2QA4I 1HW1A 1FWZA 1FBSA 4CICA 3UNGC 4B43A 1LJ9A 5ILVA 1HKTA 3RZOJ 3I64A 4XNFA 1AA7A 4M6XA 2ADUA 2DN0A 4FX4A 1B9NA 3IC7A 4I0BA 1O4XA 2L9VA 5H20A 4XN0A 4HPQA 2LY9A 1XDUA 2F5EA 2LLKA 2EFPA 2DODA 1GV5A 2RN7A 3CF2A 1JGGA 5F04A 1MW7A 4HX8A 4B8XA 1ETOA 3Q5FA 3QP5A 4FX0A 3HTUA 1IO2A 3REOA 1WJAA 3TOBA 2CW0F 2ZXHA 3GLXA 1LDKB 3I3LA 5J4YA 3FMQA 3CJRB 4A5MA 1O3TA 1MH4A 3QYFA 5EDNA 4UV9A 4IEJA 2E7XA 2DMTA 1Z3XA 3H3ZA 2ICWG 4UV8A 2V7FA 3WHCA 1I1SA 1QGPA 2IXSA 3DLAA 2F5VA 2FOKA 1P4AA 3LSHA 2ECCA 2DT6A 4PJ0C 4ENJA 1H89C 2CJJA 4F52A 1FIAA 2IW5A 4RLFA 2CO5A 1D1BA 3FHZA 2JN6A 3Q0WA 3S8PA 1MSFC 2KT0A 4N4OB 1T39A 1U5TC 3BPVA 3TOAA 1V4RA 2WY7Q 2XV4S 3OMYA 2VPRA 2QQ8A 2CGPA 2R5YB 3BG6A 4M3EA 4EJUA 1OCPA 3C2BA 2IGOA 3I9V2 2VJ5A 1TWFJ 1FX7A 3QPSA 1BR4A 1OISA 2KIFA 1BR2A 2GLOA 1W4MA 1K78A 2R7WA 2NVXJ 4QIWN 1X19A 1DUXC 4EQQA 4DBQA 3I54A 3WG9A 2ESHA 4IOCF 2I5UA 3IRQA 1TWHJ 3EPZA 1B8IA 1XX5A 2Y9YA 3QOEA 3O8GA 3SXYA 1Y8RB 2GXBA 2R7XA 1FOXA 2BY3A 2K27A 3BZKA 2OA4A 4BY1J 1ON2A 2ME6A 5IP6A 1Y1WJ 2Y30A 3QOPA 3S14J 2L01A 5KAFC 2WA0A 3ZRGA 1IN8A 1EA3A 3K10A 3ISPA 4MQ9F 3CO7C 4BACA 1KYZA 2JMWA 4A0XA 2PG4A 2EV6A 5E20A 3Q9SA 1YRNB 1KU7A 2H8RA 4NDLA 4M6YA 5L3EA 2VN2A 2M34A 4U0VA 2M4GA 2R3SA 1P9QC 4I7HA 3PNYA 4YFKF 1OYIA 1VQPI 1J75A 2G7UA 1MKMA 2DOEA 1FMWA 3LAJA 3K69A 4WWCA 2Q0OA 3LSMA 4HRIA 5CPRB 2XASA 2XAUA 2IA2A 2EIJH 2OC6A 1MMDA 4I0AA 2PN6A 4A3LJ 3CP8A 2Y9ZA 2VQCA 3QAHA 2JA5J 1OPCA 4RGXA 1JUSA 3GTJJ 4CSWA 5FLXK 3M7GA 4GFBA 4OIQF 3HJEA 3E5UA 3I59A 4E4HA 3BR6A 3BR1A 4KT6A 3S1RJ 1UG2A 4I01A 5D6FA 1ETQA 4KA4A 4XN3A 2RV8A 3GFMA 4OU0A 5E18F 2X6YA 2DLLA 2JA2A 1TP4A 3DBLB 1V5GA 3K9TA 3M9AA 3QQAA 2J5PA 2IEKA 4HNUA 2EZKA 2O0YA 1WQ2A 2MC3A 4HF1A 2KP6A 3SZTA 4Q4ZF 2KIQA 3IKVA 3LL7A 3PFIA 1MSEC 1VQKI 4XLFA 3H9JA 3CQZJ 5DV5A 2QENA 1O3SA 4A3JJ 4UB6C 1ZTRA 4HLYA 2EINH 1HDPA 1LDDA 5F1RA 1QVTA 2E5NA 2X1DA 2IS6A 3HOZJ 3ZMZA 1VQ9I 2XGCA 4FHTA 3WTWC 4II3A 2E1MC 3E3VA 2IS4A 1R4MB 2JZYA 1WJCA 3QYEA 4F92B 1YS7A 1RUOA 5E3LA 3CDHA 1BJZA 2A05A 4HSRA 3CMEI 2K5CA 3N4MA 3NWSA 3FM3A 3S2WA 1T56A 2DA5A 2M2EA 1ZK8A 1MNMC 3GLLA 1YIOA 1L3LA 1RZ4A 3EUHC 4KN4X 4WXCA 3GFLA 2NVUB 4UUSB 4I99C 4N4NB 4M71A 4BHCA 4XKBA 3KP2A 2ID6A 3F6OA 5J6XA 1EV7A 5LEJA 3T8RA 5D4SA 1WHUA 2KIMA 5L3DA 4BE2A 4JK1X 1Z6TA 1SAXA 1PUFA 2O5RA 2WB1N 2W00A 4Z6YA 2BXZA 4AVZA 3QPTA 2E36A 2Y69H 5HDKA 3CC4I 3WU0A 5B1AH 1BR1A 2RGVA 3H92A 5J1RA 2CV1A 3HOVJ 2ZMEA 1PJRA 4ZYAA 4HF0A 1BI0A 1W5CC 4U88A 1OCTC 2O3FA 3L7WA 2HEOA 3HRSA 1T98A 1SFEA 3PO2J 2M1BA 5L3FA 2W4SA 3CTAA 1PYVA 3A03A 1D8KA 1BC7C 4ZTFA 2ZJQF 2DMUA 3IH2A 1W5SA 2F5FA 3WTVC 4BHBA 2Q1ZB 3A2KA 5DCMB 2DYSH 2MH2A 2OF7A 3C18A 3F8CA 2XUBA 5GTHC 1R5HA 1ZRDA 3ZN0A 2V6EA 5E1WA 5FLVA 1UCRA 2MW8A 2R7TA 4BQAA 1SMYF 1WWXA 3BTJA 2RNGA 2DFIA 4CGZA 1M1EB 2EV5A 1RKTA 1SVLA 4BGDA 4KNYA 3W2WA 1ZARA 1PVEA 5KCMA 4DIQA 3KYLA 2JSCA 3K4CA 1MGTA 3GTKJ 3SQNA 1G4DA 4XLHA 1VQ6I 3ABTA 2ELJA 4CCLA 1FC3A 4DYCA 3HUGB 1FY7A 3HSRA 2UUZA 3ASNH 2BV6A 4LG0B 4NUBA 2EZLA 3TW7A 5CVUA 1B72A 4UXNA 1DPRA 3WG7H 4XR6A 4HAMA 3RKWA 2L9RA 1H88C 4XLCA 2BVMA 2VC1A 4V2FA 4Y13A 5D8LB 4JOMA 3S2DJ 5HDNA 1GLNA 2XPUA 3X2QH 4BU2A 2Z9OA 1J5YA 2JVHA 4GYGA 2XSJC 4IKFA 4FTHA 1F4KA 5DD4A 3K70C 1XMKA 1Y0NA 2LMDA 2NXNB 4KITB 1U5TB 2FJ1A 3I0TA 2LFBA 3R6SA 4PSXA 1R71A 1R58A 1P2FA 2LKPA 4XKVA 4NQWB 2MG4A 3VYTB 1IXRC 3VFZA 4IHWA 3KP5A 1V5EA 3PM1A 5A2QZ 3RYPA 2LRDA 1FYKA 4P55A 3J7AO 2L4MA 1DDNA 3G4SI 3ZMUA 1MD0A 5CJ9A 2VKEA 4CH7A 2CUFA 5EEAA 2NYXA 4IHXA 2NNNA 2HFHA 3BROA 4C3HJ 4BE1A 4ITVA 4CCMA 2Z99A 3LSRA 2IS2A 4OIRF 2OTLI 1Q1VA 3J80K 1Y39A 3WE3A 3BOQA 3LSGA 2AO9A 2IP2A 5IT3A 3IRRA 1KQ0A 1OCCH 2LY1A 1J2XA 5JHFA 2Z16A 4P9UA 1ZR4A 4BJ6C 5FKOA 2HVQA 1LB2A 4AIDA 3QP6A 2YX4A 4BXFA 4BBRJ 1RUNA 2CH0A 1YOVB 3ASOH 2M8EA 3BJOA 5H6QA 4A3EJ 5EG0A 4A0YA 2QZ8A 4Q48A 4C9YA 3PL8A 1YQAA 1JE8A 4I09A 2MYSA 4KIFA 4ZDPA 4QPOA 1JTYA 1UHWA 4JQFA 1FSHA 3WODF 2RKHA 1P7IA 3IAS2 1RESA 4A3FJ 1W7PB 3GW2A 2PI0A 1FYLA 5IP9J 3ZMVA 3VEPA 1R6RA 1TC3C 4L0YB 3ECHA 3CD6I 2GBYA 5EEHA 4L5IA 3BQYA 2GIVA 1I1GA 1LEBA 2BXYA 3BR0A 5K7ZA 2CRGA 3HM5A 4LITA 4S05A 3BCBA 4H4KC 4CYCA 1KZHA 1QZZA 1XGOA 3ZQQA 3CCUI 1RR7A 4IL6C 4GXOA 4XOPA 2QYOA 2LK2A 3UR3C 4FISA 5H2FC 5K1YA 3L2QA 2AXLA 2ZSIB 4ZYEA 3BC8A 2LY2A 3K1PA 5TISC 2FQ3A 1S8NA 5BMZA 2FBHA 4PZJA 3OYBA 3OYCA 2EA4A 3T0YA 1XGNA 2LNBA 1KU9A 3FXUA 3ELKA 4CO8A 4I6ZA 5ILUA 5KK1A 2E35A 3RPUA 1MJBA 2R92J 3VOEA 2DA3A 1X2NA 2V26A 2JA7J 4D0PA 2LKXA 2VLAA 1XMAA 3H3UA 5AONA 2QWWA 4B44A 2DYRH 1LPQA 2LBFB 1KQ8A 1IDYA 5JFRA 1SEUA 3LNQA 5ICGA 1X4OA 3CUOA 2R7OA 5CKTA 2YR2A 2FA5A 4YELA 5F27A 4XK4A 2JTVA 3OSFA 2BZTA 3B6CA 4E7HA 3CF5F 1ORKA 1PUEE 3FXJA 4LB6B 4P9FA 4I2OA 3D1NI 4L9VA 2D45A 3W6JB 3V8KA 3P9CA 1BI3A 4DJAA 2I10A 5JLWA 2L02A 5K5RA 3HB9A 5ICFA 2VT2A 3DKXA 4L9TA 1D5VA 1KU3A 3FXKA 2ISYA 2V1UA 5K7HA 3JAMK 5FKNA 1E3OC 1BI1A 3MCZA 3ZN1A 4JP0A 3DPLC 3N05A 2VXDA 2OZ6A 1A35A 1BBYA 4LIVA 2DU9A 3CJQB 3I53A 2HXOA 3PQJA 2M4KA 3QU3A 2DBBA 1UG0A 2OCCH 1T6SA 1JKRC 5F1JA 2EILH 3BTCA 1V55H 2NS7A 3HIFA 4RGRA 4OMYA 3U2RA 4AD9A 1Z77A 1S7AA 3FDYA 2OD5A 1Z7LA 3BG3A 3HBLA 4XKCA 3V8JA 4B47A 5M5WJ 1FTTA 1X58A 2XKOA 4XQFA 5LFAA 2K9QA 2CUJA 5HS9A 3DEWA 2EFWA 1T2KA 2E7WA 4M3GA 4H0EA 4X6AJ 4BXUA 3DP7A 3JRBA 2RAEA 3E6CC 4G9YA 3A01B 4FETA 4EATA 2WAQA 2HPMA 1F36A 4GCVA 4A12A 2LH9A 1GV2A 3K4LA 2KQRA 5J8CA 3NWTA 4F91B 2YSRA 2P8TA 3LQQA 4Y3OA 5EEGA 2VBZA 4PGHA 4KN7X 2A5WA 3JRAA 4N0BA 3CMAI 1SAUA 4Y17A 2R5ZA 3HPGA 2QUFA 3H3VK 3JRDA 4BKXA 4EJTA 1J09A 3Q3SA 3U1DA 1VZ0A 1KYWA 2XAFA 4RAZA 4AIJA 5DUKA 2M3AA 4Q5SF 3FWEA 3CCJI 3KFWX 1UB9A 1HOMA 1J7KA 1K61A 2HVSA 1ODDA 1U0JA 2FMLA 2R93J 2DQLA 1JUMA 3RCOA 5HLHA 3LAPA 3COAC 1EH8A 1Z9CA 5J8FA 2BHZA 1IAWA 1N75A 3R0AA 4KMFA 5ED4A 3WE2A 3OOPA 3C2HA 3L2WA 2VBYA 2JK3A 3OIOA 1GXPA 1HC8A 2ZXJA 4O5VA 3JSPA 3ROUA 3DTKA 1IRZA 5BPDA 3OOUA 4LG3A 1QPIA 1IV8A 1OCOH 1YG2A 4ASNA 2B0LA 5B5EC 2HS5A 2X9DA 5M3FJ 3OYKA 3I55I 3K1NA 2V4JC 3GF2A 1CGPA 5EGOA 4BXXJ 2Q2EB 2EA2A 2DO7A 2NVTJ 4RM2A 1XB4A 2KIUA 1XSDA 2CW8A 4GDFA 2R7RA 3DBHB 1TQMA 5E17F 5HLIA 3DCFA 2VJ4A 1XSVA 4DYQA 1AOYA 2W7NA 1B1BA 3MZYA 4JYKA 3PNTA 1MMGA 4PJLA 4HDVA 2P5VA 1YIJI 2BW3B 2X1CA 1DU6A 2PJRB 5CLSA 4M3DA 4BS9A 3WU1B 5EZHA 1F43A 5LRRA 5A2QK 2GIZA 4HX4A 1QNTA 4RMNA 2E19A 2HNHA 4UVAA 1HQCA 4MQVA 4G7ZF 4AYBA 1W36D 3JW4A 1AKHA 4K2EA 3SEZA 1JHFA 2KJCA 2UZKA 1RNLA 1SD6A 3HDDA 1GT0C 3OYAA 3TBIA 2L7MP 1SFOJ 3L09A 4M6VA 4PDKA 4IRIA 4BEHB 4XL9A 3L2UA 2FXAA 4CDGA 5F08A 3CCVI 3GUDA 2IGMA 3PJRA 2RQQA 2ZJRF 3ZCOA 2F2EA 2IVMA 2ZNZA 1HW5A 4IVNA 5ERIA 4B09A 2JQ7A 3B73A 1ACIA 1O3QA 1TT5B 2DW4A 4XLEA 3CP2A 1R36A 3OL3A 2E1NA 5IT9K 1MDMA 3JTHA 4BBSJ 2MBFA 2O6GE 4P1WA 1YLFA 4MGRA 3I71A 1N78A 1X1PA 1YJNI 5CVJA 1C0WA 2RNJA 2ELHA 3HHGA 4UUVA 4DW6A 4NC8A 4MTDA 3RPQA 1FZPB 2PLYA 2ZCWA 4RAFA 3MKZA 5M5YJ 3GTLJ 4KIBA 3TDUC 5DCFA 3ZQGA 1U9OA 4EEFG 3HHHA 3LSKA 4P5OA 4HG2A 5GPCA 2NNYA 1HA8A 4QPQA 2M9HA 1IGNA 9ANTA 4YIIA 1FBQA 2QM3A 1D5YA 2X1EA 2YX7A 1TBXA 3SFZA 2M87A 1H8AC 1SD4A 2K9SA 1W1WE 3TL4X 5E3OA 1K79A 3HKZA 1XSXA 3LOCA 4FT8A 5B3SH 1QA6A 2HKXA 2MH9A 2EQRA 3RKYA 5B1BH 3HRUA 4XICA 2VUMJ 4ZZLA 3QPHA 2BEOA 2P6SA 3SDBA 2Y0SA 3K4JA 1V54H 5FKLA 4F93B 3I4MJ 2QKMB 5JLXA 1VTNC 5F64A 4AM3A 3L2RA 4ESJA 4CZCA 2YU9J 3FMSA 4A3MJ 4C2TA 4O6JA 2VI6A 3DV8A 4AVPA 1DP7P 4LGWA 1IN5A 4Y4RA 1F5TA 1MMAA 3M8FA 2Z2SB 1WPKA 3OIQA 1R22A 2GM4A 2VKVA 1QBJA 2DDBA 3H1CA 1IN6A 2DFEA 3HGYA 5HDGA 3CUQA 1FP1D 2W24A 4BQQA 2QEXI 4U7DA 2G9WA 4BL0B 2V6CA 4B1RA 1E3PA 1WGXA 4HF2A 3FXLA 1R1UA 5E79C 5KAIC 2QSGX 1G2HA 4A3IJ 3OYDA 3W6KB 3QWLA 3BZCA 3OS2A 1ZG3A 2X51A 1FOYA 3W6VA 2GXGA 4PJMA 4QSHA 4RA2A 3AG4H 4A93J 3F8FA 1A6IA 4NB5A 2O7OA 1QRYA 2XAJA 5DM7F 3TO6A 2DTZA 3K4BA 2EWNA 2L2OA 3G1LA 2NVQJ 5IYBJ 2XF7A 2IJLA 4X0GA 1BIBA 1V3FA 2P5LC 1ETWA 2QSFX 3C1DA 4RS8A 5D5WB 1EH6A 1RPWA 3TDZC 3GFIA 3FXOA 3DTEA 4ENMA 2IS1A 1E17A 3M4OJ 1XN7A 5FD5A 5HNFA 5K5QA 3KYCB 3N97A 2CG4A 3RKQA 2GOMA 1IJWC 1ZYRF 1T08B 3E1SA 3F72A 3FKJA 2V9VA 3KX2A 4ANJA 3O6BB 2F6CA 3HL2A 2QBYA 3JRFA 1FLIA 3BP8A 1UELB 4OMZA 3S17J 2FX0A 3LSTA 2COBA 1T8IA 2HU9A 2NS8A 4MNUA 2XKPA 1Y8QB 3BTLA 3OYHA 4G12A 4BYYA 2FSWA 3ECOA 5AIQA 4F3QA 2JVGA 3BWGA 4FCYA 2LP0A 1STZA 1N77A 4HOBA 2STTA 1OR7A 2IGKA 3W3CA 1XTAA 2H1KA 2K9LA 3ONQA 4IXAA 1IRXA 2ZFUA 1GDTA 3WTSC 3A02A 4HW0A 4PUSA 2J5OA 3E5XA 3HPHA 5F0HA 3RQIA 4BHPA 5DM6F 2HTJA 3KLNA 5LEKA 4A0ZA 4EJWA 3CCEI 5ICCA 4G94A 1W7PD 2L9SA 2PFBA 3PUBA 1YX3A 5FD6A 1YTYA 3RYRA 4C2MJ 2XPWA 2L5QA 5KHDA 2DJNA 2CQ7A 1J59A 1OYYA 2M0CA 3TMOA 5FFZA 5IOYA 4EV0A 5JI6A 2L7KA 1RI7A 2OPTA 4B3AA 2EV0A 2FE3A 3S15J 2R5YA 1RKWA 4AUXA 2WY8Q 3SEQA 2VKDA 4XRMA 2CUEA 1XCVA 3K4MA 4Y33A 2KRFA 5D5VB 2R7VA 3G1MA 5BPIA 4GO1A 2ZXIA 5IYCJ 3AG2H 1IZ1A 2X6WA 1HCRA 4XLNF 4CA0A 1MMNA 2WV0A 3JREA 4R8HA 3Q0VA 1LFPA 1JT0A 2KLOA 2HDCA 2QKLB 4O3MA 3TO7A 1LVKA 1DP3A 1O7FA 1WH5A 3BZ6A 4HQEA 2EH3A 5GP9A 3HOXJ 2JRMA 2XB5A 1W0UA 4MHGA 4XSXF 3ULQB 2E34A 5JR3A 1BL0A 1FSEA 3DKWA 2IGNA 1SVMA 2ZNYA 2X48A 2EZHA 2FNAA 3ML6A 2XGDA 2VQHA 1X2MA 1IDZA 3KIOA 3DKYA 2OZUA 3CCQI 4FQGA 2HOTA 1BOAA 1D0XA 2PQ8A 4ETSA 4E6KG 2LKSA 2YU3A 2Z33A 5FB2A 1YRNA 2FOWA 3IKTA 2XAHA 1U6GA 1VQ8I
chains in the Genus database with same CATH topology
3RKXA 4A2UA 2MD5A 4HA8A 3D0SA 1TW2A 2F5CA 2ZKZA 2R7FA 4EM0B 3EYIA 5L3BA 2IPQX 1I6XA 2QLZA 3RI4A 4M72A 2EB7A 2L4AA 3FMRA 2QQAA 3HOTA 2XIGA 1QO0D 1KQ9A 1R5GA 3EETA 2WTEA 4G7OF 2LDUA 4Q47A 4N9IA 4IF4A 1YYVA 2BGCA 5LHIA 2K02A 1MZBA 5D8KB 1SFXA 2H94A 1L0OC 3T5XA 1IRFA 1TLHB 3J81Z 4LLGF 5TRDA 3WTZA 5DYMA 3CUQC 2PEXA 3WTYC 3TKYA 2GA2A 2DT5A 2RVCA 3NRVA 4WX9A 3MWMA 5LLQA 2COMA 3KP3A 3GYHX 1BJAA 2MLKA 4LLLA 2ZFWA 1U8RA 2Y75A 2RQPA 2IT0A 4Y15A 3IWZA 2ACJA 5DUIA 2XAGA 1TNTA 5BOXA 1D3YA 2Z5UA 1S6LA 1U2WA 2XHKA 1SFUA 2CSOA 5D6EA 5F6FA 3HSEA 3C7JA 3BPXA 1B9MA 3V7SA 1P92A 1YW7A 4EM2A 3F22A 4WF2A 1I27A 2IRFG 1K6OA 1HKQA 1USSA 3KP4A 4AIKA 3KZYA 4IRHA 1LEAA 3FZVA 4OIPF 5JHUA 1GVJA 4CYDA 3CO6C 5LGNA 4WCGA 2VONA 4UVCA 3KETA 4EVIA 5DCMA 5HOOA 5LHHA 3P9KA 3BJAA 4KUMA 2FNPA 4LK0F 1SD5A 2A69F 4HBLA 4M9XA 5CVVA 3G3ZA 2LF8A 3R4KA 1IRGA 2Y48A 4L5JA 5K5OA 4ESBA 4PGGA 5KVRA 1B4AA 3RJPA 4OINF 3HUGA 2GQQA 4OOIA 2O03A 4ZYDA 1Z91A 4GYIA 2D1VA 4HDUA 4ZYGA 1HSJA 2WWYA 4L9NA 1XD7A 2HYFA 2Q8KA 3K2ZA 1KGSA 1B59A 2O61A 4I98B 2P5KA 2OAZA 4U7BA 3EQLF 5L3GA 3WTUC 5HLGA 5FO5A 1IN7A 2CQKA 3I5UA 2H6CA 4NHJA 2HOEA 1WSUA 4CHUA 5FLXZ 3KZZA 4R79A 4IPAA 1HKSA 4YFNF 1EH7A 2UXXA 1GXQA 4RGUA 1ZG5A 3HTSB 2GAUA 4CZZA 5FFXA 4XSZF 1ZRCA 3M8EA 2A61A 1H0MA 2UWMA 2W85A 2JRTA 3GXOA 2HQRA 2EJRA 3P9IA 2AS5F 1FYMA 1F9NA 3GVAA 2CWEA 4HX7A 1D8JA 2R7DA 4L0ZB 1T0FA 4IHSA 3RIRA 1ZG1A 4RB3C 2EFNA 3E97A 4KYWA 2TDXA 3ZMDA 4WXHA 1REPC 1YS6A 3L2CA 3F21A 4I02A 2UXNA 1Z6RA 1WKMA 1K78B 1S29A 4UVBA 5BQTA 3B02A 2JPCA 4F7ZA 3WTTC 2JT1A 3ABUA 3E5QA 2EFOA 5HVQC 2ZJ2A 1H9TA 4KT5C 2C6YA 5HS7A 5CYVA 4EJOA 2V1XA 2L3DA 4LJZF 4RB2C 3CUQB 2H6BA 4TV7A 3JTGA 3BJ6A 3V4GA 1A04A 1O3RA 5JVTA 3FM5A 4HZFA 4BAYA 4EGZA 2HQNA 1XGSA 3TO9A 3L00A 2D1HA 2VXZA 2VT3A 2NS0A 3D5LA 2P7VB 1ZRFA 3I59B 1G3TA 3Q9VA 1U78A 4RB0A 4G8XA 2DK5A 1KU2A 2M45A 2A07F 2DAOA 2W57A 3GZ6A 1BIAA 3OV8A 4RGSA 2HKOA 2K7LA 3BDDA 4G7HF 3KLOA 3QU6A 3LA7A 2QBYB 6PAXA 2PMUA 3KP7A 3PQKA 1ZLKA 1TTYA 1UHMA 4L18B 1I5ZA 3FXQA 4EMSA 2F5DA 2QVOA 4M9SA 4QLCU 4YG2F 2FMYA 2DI3A 1QPMA 4ZYHA 1PP7U 2PMHA 1OMIA 3EDPA 1ZH5A 4Z2YA 3EYYA 3R60A 4XLPF 3DF8A 2K4JA 4OIOF 2EFQA 3F3XA 2XAQA 2HWVA 1CF7A 4KMUX 2ZMEB 3J80Z 2XGXA 3SZPA 1ZAOA 3I58A 1R23A 1LQ1A 1G6NA 5ILSA 2A5YB 2HYGD 2LF7A 2ZO4A 1H9GA 1S3JA 4MEYF 2L54A 3ZMSA 2V79A 3TGNA 4A6DA 4HV6A 4EGYA 2Q2EA 3LQRA 1HW2A 1BM9A 1P4WA 4JBAA 3MFKA 3DEUA 3WGIA 3GZ5A 5LRSA 1WRJA 3L9FA 1MJAA 5DDGA 2RDPA 3R61A 3LWFA 3HRMA 3F8MA 1LNWA 4YIFA 2DPDA 5E8IA 4KFCA 3I4PA 5D5XB 2BE5F 3K1MA 1YW8A 4ESFA 4IHTA 1TQIA 3E6DA 3O3KA 5BS6A 2G7HA 4ENKA 2VBWA 5DEQA 1FT9A 2GA1A 3AAFA 3U9GA 4KICA 3RDIA 1BI2A 2OQGA 2Z3YA 5LGUA 4HQMA 4DNCA 3FXRA 3QRFF 1T38A 4WK8F 1G3YA 2WC2A 3GFJA 2IA1A 1HSTA 3K0LA 2D2WA 2RC4A 3KEQA 2XVCA 3FF5A 1GHCA 1Z7UA 3MQ0A 1YO5C 4GGGA 3JAMZ 3NEUA 2BYVE 1Z1DA 2H09A 2YPRA 2VOPA 3VODA 2PJPA 2O8XA 1KA8A 3E6BA 4IJAA 4LD5A 1XGMA 2LSOA 1FBUA 2HGCA 1USTA 1SD7A 2VE8A 1QQIA 1BN5A 2JPBA 1IF1A 2EK5A 4S04A 3F6VA 1S7OA 4U0WA 2XRNA 4RAYA 3WTXC 3DFGA 1Z05A 5D5UB 2HR3A 4LK1F 1PP8F 1PDNC 1ZHFA 1Q1HA 2STWA 2OBPA 2IA0A 4IRGA 5LGTA 2FBIA 5FGMA 3FX3A 3GO5A 5CVRA 5LBQA 5TJJA 5HS8A 3V8LA 2K4BA 4BNCA 1O7LA 1R00A 2DQRA 4MEXF 1DPUA 1P4XA 3DQVC 3ZP5A 4KIGA 1R1VA 3VB2A 1JXSA 2HZTA 2MLGA 4AIHA 1IN4A 2CYYA 2VC0A 3WGHA 3IL2A 1FOKA 1IW7F 1J9IA 2VOOA 5LHGA 3C3WA 3E6MA 3MAJA 3GX4X 4PCQA 3HRTA 1JHHA 1HXDA 2W84A 4E70A 4A6EA 1G3WA 3V7CA 1XDSA 2P7CB 4KDPA 3KP6A 3F23A 1ONVA 3CJNA 2FEZA 4HV5A 4LLNA 1FPQA 2V1DA 2BBYA 1QZYA 4EJVA 2GZWA 2QQ9A 3T1BA 5IT9Z 2FF4A 2OU2A 1G3SA 4UHTA 3T8TA 3SHFA 1O57A 3R0JA 2Y0MA 1B6AA 1IXSB 3TQNA 1HBXG 2NAZA 1LVAA 2ISZA 1K7AA 1UFMA 2M30A 4CXFA 2P6TA 2A6HF 1RIOH 4RB1A 3KEOA 1ULYA 2P4WA 3LA2A 4G6DA 1ZLJA 4HYEA 2QQBA 4LG0A 4A5NA 1J0RA 4M74A 2DPUA 2ZBKA 3IHUA 1WI9A 2A68F 3LA3A 5L3CA 3JSOA 1ZREA 4BH9A 1FNNA 2X0LA 2KKOA 3BY6A 4M9ZA 2K86A 3ERED 3F8BA 1U5TA 2HTSA 4R1HA 3GWZA 4NQWA 1IXCA 2DK8A 4DQ2A 4MTEA 2CFXA 1NHAA 1F1ZA 2M5WA 4L9JA 4YFXF 5E1ZB 4N9HA 4ON0A 3LFKA 5CVIA 3V7RA 3DPTA 1YW9A 2VODA 1MDMB 3NQOA 5D4RA 4HLXA 1ZGJA 2X4HA 4U0YA 1AWCA 2H27A 4QWQA 4XRFA 5AIPA 3MEXA 1E2XA 1R1TA 4WXDA 2XROA 1OYWA 4LFUA 1LDJA 1W7PA 1YFHA 2W25A 2VBXA 1SMTA 3KCCA 3ZQ7A 2FBKA 4P96A 4UNOA 1U3EM 2MA3A 5DD8A 2KJBA 3RTRA 3P7NA 4ZH4F 4G6QA 2FU4A 3MZHA 1JGSA 1ZGAA 2A6EF 3M1EA 1BC8C 1X3UA 3DXJF 1CF7B 1TW3A 2ESNA 1R7JA 2GWRA 3HSFA 1TNSA 3G73A 2NRAC 2DTRA 3CLOA 1ON1A 5H6RA 2PBIA 3HYIA 4ZZDA 1XCBA 3IWFA 2OQRA 1W5TA 2A3SA 5E1XA 2E1CA 1P6RA 5ICEA 3ZPLA 4AWXB 3F8NA 3GEZA 3TDZC 4LB5A 4M73A 1OKRA 3J81K 1IUYA 2FRHA 1FP2A 3KE2A 3O2PE 1TQPA 1ZN2A 3ZMTA 2VE9A 4LMYA 4EM1A 4XBFA 5E8GA 3WGGA 1Y0UA 3HOSA 3EUHA 2ETHA 4ENNA 1HW1A 1FWZA 1FBSA 4CICA 1LJ9A 5ILVA 1HKTA 3I64A 4M6XA 2ADUA 4FX4A 1B9NA 3IC7A 4I0BA 5H20A 1XDUA 2F5EA 2EFPA 2RN7A 4HX8A 4B8XA 3Q5FA 3QP5A 4FX0A 3HTUA 3REOA 3TOBA 2CW0F 3GLXA 1LDKB 3FMQA 4A5MA 1O3TA 4UV9A 2E7XA 3H3ZA 4UV8A 1I1SA 1QGPA 2FOKA 1P4AA 4ENJA 2IW5A 2CO5A 3FHZA 1T39A 1U5TC 3BPVA 3TOAA 1V4RA 2XV4S 2CGPA 4EJUA 1FX7A 2KIFA 1W4MA 1K78A 1DUXC 4EQQA 3I54A 3WG9A 2ESHA 3IRQA 3SXYA 2GXBA 2K27A 2OA4A 1ON2A 3QOPA 2L01A 1IN8A 3ISPA 4MQ9F 3CO7C 1KYZA 4A0XA 2PG4A 2EV6A 5E20A 3Q9SA 1KU7A 4M6YA 5L3EA 2VN2A 4U0VA 2R3SA 4I7HA 4YFKF 1OYIA 1J75A 2G7UA 1MKMA 3LAJA 3K69A 4WWCA 2Q0OA 2XASA 2IA2A 4I0AA 2PN6A 3QAHA 1OPCA 4RGXA 5FLXK 3M7GA 4OIQF 3E5UA 3I59A 4I01A 5D6FA 4KA4A 2RV8A 3GFMA 4OU0A 5E18F 2DLLA 3K9TA 3M9AA 2J5PA 2O0YA 1WQ2A 2MC3A 4HF1A 3SZTA 4Q4ZF 3IKVA 3PFIA 5DV5A 2QENA 1O3SA 4HLYA 1LDDA 5F1RA 3ZMZA 4FHTA 3WTWC 3E3VA 2JZYA 1YS7A 1RUOA 3CDHA 3N4MA 3FM3A 3S2WA 1YIOA 1L3LA 1RZ4A 4KN4X 4WXCA 3GFLA 4M71A 4BHCA 3KP2A 3F6OA 5J6XA 1EV7A 5LEJA 3T8RA 5D4SA 2KIMA 5L3DA 4JK1X 1Z6TA 1SAXA 3QPTA 5HDKA 3WU0A 2RGVA 3H92A 2ZMEA 4HF0A 1BI0A 4U88A 2O3FA 3L7WA 2HEOA 3HRSA 1T98A 1SFEA 2M1BA 5L3FA 3CTAA 1D8KA 1BC7C 1W5SA 2F5FA 3WTVC 4BHBA 5DCMB 2MH2A 3C18A 3F8CA 2XUBA 1R5HA 1ZRDA 3ZN0A 5E1WA 1UCRA 4BQAA 1SMYF 1WWXA 2DFIA 4CGZA 2EV5A 4KNYA 1ZARA 2JSCA 1MGTA 3SQNA 1G4DA 3ABTA 1FC3A 1FY7A 3HSRA 2BV6A 4LG0B 5CVUA 4UXNA 1DPRA 4HAMA 3RKWA 2VC1A 4Y13A 5D8LB 5HDNA 2Z9OA 1J5YA 4GYGA 1F4KA 5DD4A 1XMKA 1U5TB 3I0TA 3R6SA 1R58A 1P2FA 2LKPA 1IXRC 3VFZA 3KP5A 5A2QZ 3RYPA 1FYKA 4P55A 3J7AO 2L4MA 1DDNA 3ZMUA 1MD0A 5CJ9A 2NYXA 2NNNA 2HFHA 3BROA 2Z99A 4OIRF 3J80K 3WE3A 3BOQA 2IP2A 5IT3A 3IRRA 1KQ0A 1J2XA 4P9UA 1LB2A 3QP6A 2YX4A 1RUNA 2M8EA 3BJOA 5H6QA 4A0YA 2QZ8A 4Q48A 1JE8A 1YQAA 4I09A 4KIFA 1FSHA 1UHWA 4JQFA 3WODF 2RKHA 1W7PB 3GW2A 2PI0A 1FYLA 3ZMVA 3VEPA 4L0YB 3ECHA 5EEHA 4L5IA 2GIVA 1I1GA 1LEBA 4S05A 1QZZA 1XGOA 4GXOA 2QYOA 5K1YA 2AXLA 4ZYEA 3K1PA 2FQ3A 1S8NA 5BMZA 2FBHA 4PZJA 2EA4A 3T0YA 1XGNA 2LNBA 1KU9A 3FXUA 3ELKA 4CO8A 5ILUA 5KK1A 3RPUA 1MJBA 3VOEA 4D0PA 1XMAA 3H3UA 5AONA 2QWWA 1KQ8A 5JFRA 5ICGA 3CUOA 2YR2A 2FA5A 2JTVA 1PUEE 4LB6B 4P9FA 4I2OA 4L9VA 2D45A 3W6JB 3V8KA 3P9CA 1BI3A 2L02A 5K5RA 5ICFA 2VT2A 4L9TA 1D5VA 1KU3A 2ISYA 2V1UA 3JAMK 1BI1A 3MCZA 3ZN1A 3DPLC 2OZ6A 1BBYA 2DU9A 3I53A 3PQJA 3QU3A 2DBBA 1T6SA 3HIFA 4RGRA 4OMYA 3U2RA 4AD9A 1S7AA 2OD5A 3V8JA 2XKOA 5HS9A 2EFWA 1T2KA 2E7WA 4H0EA 4BXUA 3DP7A 3E6CC 4G9YA 4GCVA 4A12A 5J8CA 2YSRA 2P8TA 3LQQA 5EEGA 2VBZA 4PGHA 4KN7X 4N0BA 4Y17A 2QUFA 4EJTA 3U1DA 1KYWA 2XAFA 4RAZA 4AIJA 5DUKA 4Q5SF 3FWEA 3KFWX 1UB9A 1J7KA 1ODDA 2FMLA 2DQLA 5HLHA 3LAPA 3COAC 1EH8A 1Z9CA 5J8FA 1IAWA 3R0AA 4KMFA 5ED4A 3WE2A 3OOPA 1GXPA 2VBYA 2ZXJA 4O5VA 3JSPA 3ROUA 5BPDA 1YG2A 4ASNA 2B0LA 2HS5A 3K1NA 3GF2A 1CGPA 2EA2A 2DO7A 1XB4A 2KIUA 1XSDA 1TQMA 5E17F 5HLIA 1XSVA 1AOYA 1B1BA 3MZYA 4HDVA 2P5VA 5CLSA 3WU1B 5LRRA 5A2QK 4HX4A 1QNTA 4UVAA 1HQCA 4MQVA 4G7ZF 3JW4A 4K2EA 1JHFA 2KJCA 2UZKA 1RNLA 1SD6A 3L09A 4PDKA 4IRIA 2FXAA 4CDGA 3GUDA 2F2EA 2IVMA 2ZNZA 1HW5A 4IVNA 5ERIA 4B09A 3B73A 1O3QA 2DW4A 1R36A 2E1NA 5IT9K 1MDMA 3JTHA 2MBFA 2O6GE 1YLFA 4MGRA 3I71A 5CVJA 1C0WA 2RNJA 2ELHA 3HHGA 4UUVA 4MTDA 1FZPB 3RPQA 2PLYA 2ZCWA 4KIBA 3TDUC 5DCFA 3HHHA 4P5OA 2NNYA 4YIIA 1FBQA 2QM3A 2YX7A 1TBXA 3SFZA 2M87A 1SD4A 1K79A 1XSXA 4FT8A 2HKXA 2MH9A 3RKYA 3HRUA 4ZZLA 3QPHA 2BEOA 2P6SA 1VTNC 5F64A 4ESJA 3FMSA 4O6JA 3DV8A 4AVPA 1DP7P 4LGWA 1IN5A 1F5TA 3M8FA 1R22A 1QBJA 1IN6A 5HDGA 3CUQA 1FP1D 2W24A 4U7DA 2G9WA 2V6CA 4HF2A 1R1UA 3W6KB 1ZG3A 2GXGA 3F8FA 4NB5A 2XAJA 3TO6A 2EWNA 2IJLA 1BIBA 1V3FA 2P5LC 3C1DA 4RS8A 5D5WB 1EH6A 3GFIA 4ENMA 1E17A 1XN7A 5FD5A 5K5QA 3N97A 2CG4A 1ZYRF 3F72A 2V9VA 3O6BB 2QBYA 1FLIA 3BP8A 4OMZA 3LSTA 4MNUA 2XKPA 4BYYA 2FSWA 3ECOA 5AIQA 3BWGA 1STZA 4HOBA 2STTA 1OR7A 4IXAA 3WTSC 4HW0A 2J5OA 3E5XA 4BHPA 2HTJA 3KLNA 5LEKA 4A0ZA 4EJWA 5ICCA 4G94A 1W7PD 2PFBA 5FD6A 1YTYA 3RYRA 1J59A 1OYYA 5FFZA 4EV0A 5JI6A 1RI7A 2EV0A 2FE3A 1XCVA 2KRFA 5D5VB 5BPIA 4GO1A 1IZ1A 4XLNF 2WV0A 4R8HA 4O3MA 2HDCA 3TO7A 1O7FA 3BZ6A 4HQEA 4MHGA 4XSXF 3ULQB 5JR3A 1FSEA 3DKWA 2ZNYA 2FNAA 3ML6A 2OZUA 1BOAA 4ETSA 2PQ8A 2YU3A 2Z33A 1U6GA 5FB2A 3IKTA 2XAHA 1MJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKX A;  4A2U A;  2MD5 A;  4HA8 A;  3D0S A;  1TW2 A;  2F5C A;  2ZKZ A;  2R7F A;  4EM0 B;  3EYI A;  5L3B A;  2IPQ X;  1I6X A;  2QLZ A;  3RI4 A;  4M72 A;  2EB7 A;  2L4A A;  3FMR A;  2QQA A;  3HOT A;  2XIG A;  1QO0 D;  1KQ9 A;  1R5G A;  3EET A;  2WTE A;  4G7O F;  2LDU A;  4Q47 A;  4N9I A;  4IF4 A;  1YYV A;  2BGC A;  5LHI A;  2K02 A;  1MZB A;  5D8K B;  1SFX A;  2H94 A;  1L0O C;  3T5X A;  1IRF A;  1TLH B;  3J81 Z;  4LLG F;  5TRD A;  3WTZ A;  5DYM A;  3CUQ C;  2PEX A;  3WTY C;  3TKY A;  2GA2 A;  2DT5 A;  2RVC A;  3NRV A;  4WX9 A;  3MWM A;  5LLQ A;  2COM A;  3KP3 A;  3GYH X;  1BJA A;  2MLK A;  4LLL A;  2ZFW A;  1U8R A;  2Y75 A;  2RQP A;  2IT0 A;  4Y15 A;  3IWZ A;  2ACJ A;  5DUI A;  2XAG A;  1TNT A;  5BOX A;  1D3Y A;  2Z5U A;  1S6L A;  1U2W A;  2XHK A;  1SFU A;  2CSO A;  5D6E A;  5F6F A;  3HSE A;  3C7J A;  3BPX A;  1B9M A;  3V7S A;  1P92 A;  1YW7 A;  4EM2 A;  3F22 A;  4WF2 A;  1I27 A;  2IRF G;  1K6O A;  1HKQ A;  1USS A;  3KP4 A;  4AIK A;  3KZY A;  4IRH A;  1LEA A;  3FZV A;  4OIP F;  5JHU A;  1GVJ A;  4CYD A;  3CO6 C;  5LGN A;  4WCG A;  2VON A;  4UVC A;  3KET A;  4EVI A;  5DCM A;  5HOO A;  5LHH A;  3P9K A;  3BJA A;  4KUM A;  2FNP A;  4LK0 F;  1SD5 A;  2A69 F;  4HBL A;  4M9X A;  5CVV A;  3G3Z A;  2LF8 A;  3R4K A;  1IRG A;  2Y48 A;  4L5J A;  5K5O A;  4ESB A;  4PGG A;  5KVR A;  1B4A A;  3RJP A;  4OIN F;  3HUG A;  2GQQ A;  4OOI A;  2O03 A;  4ZYD A;  1Z91 A;  4GYI A;  2D1V A;  4HDU A;  4ZYG A;  1HSJ A;  2WWY A;  4L9N A;  1XD7 A;  2HYF A;  2Q8K A;  3K2Z A;  1KGS A;  1B59 A;  2O61 A;  4I98 B;  2P5K A;  2OAZ A;  4U7B A;  3EQL F;  5L3G A;  3WTU C;  5HLG A;  5FO5 A;  1IN7 A;  2CQK A;  3I5U A;  2H6C A;  4NHJ A;  2HOE A;  1WSU A;  4CHU A;  5FLX Z;  3KZZ A;  4R79 A;  4IPA A;  1HKS A;  4YFN F;  1EH7 A;  2UXX A;  1GXQ A;  4RGU A;  1ZG5 A;  3HTS B;  2GAU A;  4CZZ A;  5FFX A;  4XSZ F;  1ZRC A;  3M8E A;  2A61 A;  1H0M A;  2UWM A;  2W85 A;  2JRT A;  3GXO A;  2HQR A;  2EJR A;  3P9I A;  2AS5 F;  1FYM A;  1F9N A;  3GVA A;  2CWE A;  4HX7 A;  1D8J A;  2R7D A;  4L0Z B;  1T0F A;  4IHS A;  3RIR A;  1ZG1 A;  4RB3 C;  2EFN A;  3E97 A;  4KYW A;  2TDX A;  3ZMD A;  4WXH A;  1REP C;  1YS6 A;  3L2C A;  3F21 A;  4I02 A;  2UXN A;  1Z6R A;  1WKM A;  1K78 B;  1S29 A;  4UVB A;  5BQT A;  3B02 A;  2JPC A;  4F7Z A;  3WTT C;  2JT1 A;  3ABU A;  3E5Q A;  2EFO A;  5HVQ C;  2ZJ2 A;  1H9T A;  4KT5 C;  2C6Y A;  5HS7 A;  5CYV A;  4EJO A;  2V1X A;  2L3D A;  4LJZ F;  4RB2 C;  3CUQ B;  2H6B A;  4TV7 A;  3JTG A;  3BJ6 A;  3V4G A;  1A04 A;  1O3R A;  5JVT A;  3FM5 A;  4HZF A;  4BAY A;  4EGZ A;  2HQN A;  1XGS A;  3TO9 A;  3L00 A;  2D1H A;  2VXZ A;  2VT3 A;  2NS0 A;  3D5L A;  2P7V B;  1ZRF A;  3I59 B;  1G3T A;  3Q9V A;  1U78 A;  4RB0 A;  4G8X A;  2DK5 A;  1KU2 A;  2M45 A;  2A07 F;  2DAO A;  2W57 A;  3GZ6 A;  1BIA A;  3OV8 A;  4RGS A;  2HKO A;  2K7L A;  3BDD A;  4G7H F;  3KLO A;  3QU6 A;  3LA7 A;  2QBY B;  6PAX A;  2PMU A;  3KP7 A;  3PQK A;  1ZLK A;  1TTY A;  1UHM A;  4L18 B;  1I5Z A;  3FXQ A;  4EMS A;  2F5D A;  2QVO A;  4M9S A;  4QLC U;  4YG2 F;  2FMY A;  2DI3 A;  1QPM A;  4ZYH A;  1PP7 U;  2PMH A;  1OMI A;  3EDP A;  1ZH5 A;  4Z2Y A;  3EYY A;  3R60 A;  4XLP F;  3DF8 A;  2K4J A;  4OIO F;  2EFQ A;  3F3X A;  2XAQ A;  2HWV A;  1CF7 A;  4KMU X;  2ZME B;  3J80 Z;  2XGX A;  3SZP A;  1ZAO A;  3I58 A;  1R23 A;  1LQ1 A;  1G6N A;  5ILS A;  2A5Y B;  2HYG D;  2LF7 A;  2ZO4 A;  1H9G A;  1S3J A;  4MEY F;  2L54 A;  3ZMS A;  2V79 A;  3TGN A;  4A6D A;  4HV6 A;  4EGY A;  2Q2E A;  3LQR A;  1HW2 A;  1BM9 A;  1P4W A;  4JBA A;  3MFK A;  3DEU A;  3WGI A;  3GZ5 A;  5LRS A;  1WRJ A;  3L9F A;  1MJA A;  5DDG A;  2RDP A;  3R61 A;  3LWF A;  3HRM A;  3F8M A;  1LNW A;  4YIF A;  2DPD A;  5E8I A;  4KFC A;  3I4P A;  5D5X B;  2BE5 F;  3K1M A;  1YW8 A;  4ESF A;  4IHT A;  1TQI A;  3E6D A;  3O3K A;  5BS6 A;  2G7H A;  4ENK A;  2VBW A;  5DEQ A;  1FT9 A;  2GA1 A;  3AAF A;  3U9G A;  4KIC A;  3RDI A;  1BI2 A;  2OQG A;  2Z3Y A;  5LGU A;  4HQM A;  4DNC A;  3FXR A;  3QRF F;  1T38 A;  4WK8 F;  1G3Y A;  2WC2 A;  3GFJ A;  2IA1 A;  1HST A;  3K0L A;  2D2W A;  2RC4 A;  3KEQ A;  2XVC A;  3FF5 A;  1GHC A;  1Z7U A;  3MQ0 A;  1YO5 C;  4GGG A;  3JAM Z;  3NEU A;  2BYV E;  1Z1D A;  2H09 A;  2YPR A;  2VOP A;  3VOD A;  2PJP A;  2O8X A;  1KA8 A;  3E6B A;  4IJA A;  4LD5 A;  1XGM A;  2LSO A;  1FBU A;  2HGC A;  1UST A;  1SD7 A;  2VE8 A;  1QQI A;  1BN5 A;  2JPB A;  1IF1 A;  2EK5 A;  4S04 A;  3F6V A;  1S7O A;  4U0W A;  2XRN A;  4RAY A;  3WTX C;  3DFG A;  1Z05 A;  5D5U B;  2HR3 A;  4LK1 F;  1PP8 F;  1PDN C;  1ZHF A;  1Q1H A;  2STW A;  2OBP A;  2IA0 A;  4IRG A;  5LGT A;  2FBI A;  5FGM A;  3FX3 A;  3GO5 A;  5CVR A;  5LBQ A;  5TJJ A;  5HS8 A;  3V8L A;  2K4B A;  4BNC A;  1O7L A;  1R00 A;  2DQR A;  4MEX F;  1DPU A;  1P4X A;  3DQV C;  3ZP5 A;  4KIG A;  1R1V A;  3VB2 A;  1JXS A;  2HZT A;  2MLG A;  4AIH A;  1IN4 A;  2CYY A;  2VC0 A;  3WGH A;  3IL2 A;  1FOK A;  1IW7 F;  1J9I A;  2VOO A;  5LHG A;  3C3W A;  3E6M A;  3MAJ A;  3GX4 X;  4PCQ A;  3HRT A;  1JHH A;  1HXD A;  2W84 A;  4E70 A;  4A6E A;  1G3W A;  3V7C A;  1XDS A;  2P7C B;  4KDP A;  3KP6 A;  3F23 A;  1ONV A;  3CJN A;  2FEZ A;  4HV5 A;  4LLN A;  1FPQ A;  2V1D A;  2BBY A;  1QZY A;  4EJV A;  2GZW A;  2QQ9 A;  3T1B A;  5IT9 Z;  2FF4 A;  2OU2 A;  1G3S A;  4UHT A;  3T8T A;  3SHF A;  1O57 A;  3R0J A;  2Y0M A;  1B6A A;  1IXS B;  3TQN A;  1HBX G;  2NAZ A;  1LVA A;  2ISZ A;  1K7A A;  1UFM A;  2M30 A;  4CXF A;  2P6T A;  2A6H F;  1RIO H;  4RB1 A;  3KEO A;  1ULY A;  2P4W A;  3LA2 A;  4G6D A;  1ZLJ A;  4HYE A;  2QQB A;  4LG0 A;  4A5N A;  1J0R A;  4M74 A;  2DPU A;  2ZBK A;  3IHU A;  1WI9 A;  2A68 F;  3LA3 A;  5L3C A;  3JSO A;  1ZRE A;  4BH9 A;  1FNN A;  2X0L A;  2KKO A;  3BY6 A;  4M9Z A;  2K86 A;  3ERE D;  3F8B A;  1U5T A;  2HTS A;  4R1H A;  3GWZ A;  4NQW A;  1IXC A;  2DK8 A;  4DQ2 A;  4MTE A;  2CFX A;  1NHA A;  1F1Z A;  2M5W A;  4L9J A;  4YFX F;  5E1Z B;  4N9H A;  4ON0 A;  3LFK A;  5CVI A;  3V7R A;  3DPT A;  1YW9 A;  2VOD A;  1MDM B;  3NQO A;  5D4R A;  4HLX A;  1ZGJ A;  2X4H A;  4U0Y A;  1AWC A;  2H27 A;  4QWQ A;  4XRF A;  5AIP A;  3MEX A;  1E2X A;  1R1T A;  4WXD A;  2XRO A;  1OYW A;  4LFU A;  1LDJ A;  1W7P A;  1YFH A;  2W25 A;  2VBX A;  1SMT A;  3KCC A;  3ZQ7 A;  2FBK A;  4P96 A;  4UNO A;  1U3E M;  2MA3 A;  5DD8 A;  2KJB A;  3RTR A;  3P7N A;  4ZH4 F;  4G6Q A;  2FU4 A;  3MZH A;  1JGS A;  1ZGA A;  2A6E F;  3M1E A;  1BC8 C;  1X3U A;  3DXJ F;  1CF7 B;  1TW3 A;  2ESN A;  1R7J A;  2GWR A;  3HSF A;  1TNS A;  3G73 A;  2NRA C;  2DTR A;  3CLO A;  1ON1 A;  5H6R A;  2PBI A;  3HYI A;  4ZZD A;  1XCB A;  3IWF A;  2OQR A;  1W5T A;  2A3S A;  5E1X A;  2E1C A;  1P6R A;  5ICE A;  3ZPL A;  4AWX B;  3F8N A;  3GEZ A;  3TDZ C;  4LB5 A;  4M73 A;  1OKR A;  3J81 K;  1IUY A;  2FRH A;  1FP2 A;  3KE2 A;  3O2P E;  1TQP A;  1ZN2 A;  3ZMT A;  2VE9 A;  4LMY A;  4EM1 A;  4XBF A;  5E8G A;  3WGG A;  1Y0U A;  3HOS A;  3EUH A;  2ETH A;  4ENN A;  1HW1 A;  1FWZ A;  1FBS A;  4CIC A;  1LJ9 A;  5ILV A;  1HKT A;  3I64 A;  4M6X A;  2ADU A;  4FX4 A;  1B9N A;  3IC7 A;  4I0B A;  5H20 A;  1XDU A;  2F5E A;  2EFP A;  2RN7 A;  4HX8 A;  4B8X A;  3Q5F A;  3QP5 A;  4FX0 A;  3HTU A;  3REO A;  3TOB A;  2CW0 F;  3GLX A;  1LDK B;  3FMQ A;  4A5M A;  1O3T A;  4UV9 A;  2E7X A;  3H3Z A;  4UV8 A;  1I1S A;  1QGP A;  2FOK A;  1P4A A;  4ENJ A;  2IW5 A;  2CO5 A;  3FHZ A;  1T39 A;  1U5T C;  3BPV A;  3TOA A;  1V4R A;  2XV4 S;  2CGP A;  4EJU A;  1FX7 A;  2KIF A;  1W4M A;  1K78 A;  1DUX C;  4EQQ A;  3I54 A;  3WG9 A;  2ESH A;  3IRQ A;  3SXY A;  2GXB A;  2K27 A;  2OA4 A;  1ON2 A;  3QOP A;  2L01 A;  1IN8 A;  3ISP A;  4MQ9 F;  3CO7 C;  1KYZ A;  4A0X A;  2PG4 A;  2EV6 A;  5E20 A;  3Q9S A;  1KU7 A;  4M6Y A;  5L3E A;  2VN2 A;  4U0V A;  2R3S A;  4I7H A;  4YFK F;  1OYI A;  1J75 A;  2G7U A;  1MKM A;  3LAJ A;  3K69 A;  4WWC A;  2Q0O A;  2XAS A;  2IA2 A;  4I0A A;  2PN6 A;  3QAH A;  1OPC A;  4RGX A;  5FLX K;  3M7G A;  4OIQ F;  3E5U A;  3I59 A;  4I01 A;  5D6F A;  4KA4 A;  2RV8 A;  3GFM A;  4OU0 A;  5E18 F;  2DLL A;  3K9T A;  3M9A A;  2J5P A;  2O0Y A;  1WQ2 A;  2MC3 A;  4HF1 A;  3SZT A;  4Q4Z F;  3IKV A;  3PFI A;  5DV5 A;  2QEN A;  1O3S A;  4HLY A;  1LDD A;  5F1R A;  3ZMZ A;  4FHT A;  3WTW C;  3E3V A;  2JZY A;  1YS7 A;  1RUO A;  3CDH A;  3N4M A;  3FM3 A;  3S2W A;  1YIO A;  1L3L A;  1RZ4 A;  4KN4 X;  4WXC A;  3GFL A;  4M71 A;  4BHC A;  3KP2 A;  3F6O A;  5J6X A;  1EV7 A;  5LEJ A;  3T8R A;  5D4S A;  2KIM A;  5L3D A;  4JK1 X;  1Z6T A;  1SAX A;  3QPT A;  5HDK A;  3WU0 A;  2RGV A;  3H92 A;  2ZME A;  4HF0 A;  1BI0 A;  4U88 A;  2O3F A;  3L7W A;  2HEO A;  3HRS A;  1T98 A;  1SFE A;  2M1B A;  5L3F A;  3CTA A;  1D8K A;  1BC7 C;  1W5S A;  2F5F A;  3WTV C;  4BHB A;  5DCM B;  2MH2 A;  3C18 A;  3F8C A;  2XUB A;  1R5H A;  1ZRD A;  3ZN0 A;  5E1W A;  1UCR A;  4BQA A;  1SMY F;  1WWX A;  2DFI A;  4CGZ A;  2EV5 A;  4KNY A;  1ZAR A;  2JSC A;  1MGT A;  3SQN A;  1G4D A;  3ABT A;  1FC3 A;  1FY7 A;  3HSR A;  2BV6 A;  4LG0 B;  5CVU A;  4UXN A;  1DPR A;  4HAM A;  3RKW A;  2VC1 A;  4Y13 A;  5D8L B;  5HDN A;  2Z9O A;  1J5Y A;  4GYG A;  1F4K A;  5DD4 A;  1XMK A;  1U5T B;  3I0T A;  3R6S A;  1R58 A;  1P2F A;  2LKP A;  1IXR C;  3VFZ A;  3KP5 A;  5A2Q Z;  3RYP A;  1FYK A;  4P55 A;  3J7A O;  2L4M A;  1DDN A;  3ZMU A;  1MD0 A;  5CJ9 A;  2NYX A;  2NNN A;  2HFH A;  3BRO A;  2Z99 A;  4OIR F;  3J80 K;  3WE3 A;  3BOQ A;  2IP2 A;  5IT3 A;  3IRR A;  1KQ0 A;  1J2X A;  4P9U A;  1LB2 A;  3QP6 A;  2YX4 A;  1RUN A;  2M8E A;  3BJO A;  5H6Q A;  4A0Y A;  2QZ8 A;  4Q48 A;  1JE8 A;  1YQA A;  4I09 A;  4KIF A;  1FSH A;  1UHW A;  4JQF A;  3WOD F;  2RKH A;  1W7P B;  3GW2 A;  2PI0 A;  1FYL A;  3ZMV A;  3VEP A;  4L0Y B;  3ECH A;  5EEH A;  4L5I A;  2GIV A;  1I1G A;  1LEB A;  4S05 A;  1QZZ A;  1XGO A;  4GXO A;  2QYO A;  5K1Y A;  2AXL A;  4ZYE A;  3K1P A;  2FQ3 A;  1S8N A;  5BMZ A;  2FBH A;  4PZJ A;  2EA4 A;  3T0Y A;  1XGN A;  2LNB A;  1KU9 A;  3FXU A;  3ELK A;  4CO8 A;  5ILU A;  5KK1 A;  3RPU A;  1MJB A;  3VOE A;  4D0P A;  1XMA A;  3H3U A;  5AON A;  2QWW A;  1KQ8 A;  5JFR A;  5ICG A;  3CUO A;  2YR2 A;  2FA5 A;  2JTV A;  1PUE E;  4LB6 B;  4P9F A;  4I2O A;  4L9V A;  2D45 A;  3W6J B;  3V8K A;  3P9C A;  1BI3 A;  2L02 A;  5K5R A;  5ICF A;  2VT2 A;  4L9T A;  1D5V A;  1KU3 A;  2ISY A;  2V1U A;  3JAM K;  1BI1 A;  3MCZ A;  3ZN1 A;  3DPL C;  2OZ6 A;  1BBY A;  2DU9 A;  3I53 A;  3PQJ A;  3QU3 A;  2DBB A;  1T6S A;  3HIF A;  4RGR A;  4OMY A;  3U2R A;  4AD9 A;  1S7A A;  2OD5 A;  3V8J A;  2XKO A;  5HS9 A;  2EFW A;  1T2K A;  2E7W A;  4H0E A;  4BXU A;  3DP7 A;  3E6C C;  4G9Y A;  4GCV A;  4A12 A;  5J8C A;  2YSR A;  2P8T A;  3LQQ A;  5EEG A;  2VBZ A;  4PGH A;  4KN7 X;  4N0B A;  4Y17 A;  2QUF A;  4EJT A;  3U1D A;  1KYW A;  2XAF A;  4RAZ A;  4AIJ A;  5DUK A;  4Q5S F;  3FWE A;  3KFW X;  1UB9 A;  1J7K A;  1ODD A;  2FML A;  2DQL A;  5HLH A;  3LAP A;  3COA C;  1EH8 A;  1Z9C A;  5J8F A;  1IAW A;  3R0A A;  4KMF A;  5ED4 A;  3WE2 A;  3OOP A;  1GXP A;  2VBY A;  2ZXJ A;  4O5V A;  3JSP A;  3ROU A;  5BPD A;  1YG2 A;  4ASN A;  2B0L A;  2HS5 A;  3K1N A;  3GF2 A;  1CGP A;  2EA2 A;  2DO7 A;  1XB4 A;  2KIU A;  1XSD A;  1TQM A;  5E17 F;  5HLI A;  1XSV A;  1AOY A;  1B1B A;  3MZY A;  4HDV A;  2P5V A;  5CLS A;  3WU1 B;  5LRR A;  5A2Q K;  4HX4 A;  1QNT A;  4UVA A;  1HQC A;  4MQV A;  4G7Z F;  3JW4 A;  4K2E A;  1JHF A;  2KJC A;  2UZK A;  1RNL A;  1SD6 A;  3L09 A;  4PDK A;  4IRI A;  2FXA A;  4CDG A;  3GUD A;  2F2E A;  2IVM A;  2ZNZ A;  1HW5 A;  4IVN A;  5ERI A;  4B09 A;  3B73 A;  1O3Q A;  2DW4 A;  1R36 A;  2E1N A;  5IT9 K;  1MDM A;  3JTH A;  2MBF A;  2O6G E;  1YLF A;  4MGR A;  3I71 A;  5CVJ A;  1C0W A;  2RNJ A;  2ELH A;  3HHG A;  4UUV A;  4MTD A;  1FZP B;  3RPQ A;  2PLY A;  2ZCW A;  4KIB A;  3TDU C;  5DCF A;  3HHH A;  4P5O A;  2NNY A;  4YII A;  1FBQ A;  2QM3 A;  2YX7 A;  1TBX A;  3SFZ A;  2M87 A;  1SD4 A;  1K79 A;  1XSX A;  4FT8 A;  2HKX A;  2MH9 A;  3RKY A;  3HRU A;  4ZZL A;  3QPH A;  2BEO A;  2P6S A;  1VTN C;  5F64 A;  4ESJ A;  3FMS A;  4O6J A;  3DV8 A;  4AVP A;  1DP7 P;  4LGW A;  1IN5 A;  1F5T A;  3M8F A;  1R22 A;  1QBJ A;  1IN6 A;  5HDG A;  3CUQ A;  1FP1 D;  2W24 A;  4U7D A;  2G9W A;  2V6C A;  4HF2 A;  1R1U A;  3W6K B;  1ZG3 A;  2GXG A;  3F8F A;  4NB5 A;  2XAJ A;  3TO6 A;  2EWN A;  2IJL A;  1BIB A;  1V3F A;  2P5L C;  3C1D A;  4RS8 A;  5D5W B;  1EH6 A;  3GFI A;  4ENM A;  1E17 A;  1XN7 A;  5FD5 A;  5K5Q A;  3N97 A;  2CG4 A;  1ZYR F;  3F72 A;  2V9V A;  3O6B B;  2QBY A;  1FLI A;  3BP8 A;  4OMZ A;  3LST A;  4MNU A;  2XKP A;  4BYY A;  2FSW A;  3ECO A;  5AIQ A;  3BWG A;  1STZ A;  4HOB A;  2STT A;  1OR7 A;  4IXA A;  3WTS C;  4HW0 A;  2J5O A;  3E5X A;  4BHP A;  2HTJ A;  3KLN A;  5LEK A;  4A0Z A;  4EJW A;  5ICC A;  4G94 A;  1W7P D;  2PFB A;  5FD6 A;  1YTY A;  3RYR A;  1J59 A;  1OYY A;  5FFZ A;  4EV0 A;  5JI6 A;  1RI7 A;  2EV0 A;  2FE3 A;  1XCV A;  2KRF A;  5D5V B;  5BPI A;  4GO1 A;  1IZ1 A;  4XLN F;  2WV0 A;  4R8H A;  4O3M A;  2HDC A;  3TO7 A;  1O7F A;  3BZ6 A;  4HQE A;  4MHG A;  4XSX F;  3ULQ B;  5JR3 A;  1FSE A;  3DKW A;  2ZNY A;  2FNA A;  3ML6 A;  2OZU A;  1BOA A;  4ETS A;  2PQ8 A;  2YU3 A;  2Z33 A;  1U6G A;  5FB2 A;  3IKT A;  2XAH A;  1MJ9 A; 
#chains in the Genus database with same CATH topology
 3AG1 H;  3RKX A;  2MD5 A;  4A2U A;  4HA8 A;  3CC2 I;  3GTP J;  3D0S A;  1TW2 A;  2F5C A;  1X4P A;  2IAI A;  2ZKZ A;  1XPX A;  2R7Z J;  3C2G A;  2R7F A;  2B7E A;  4QTR A;  2ECB A;  2KIS A;  4EM0 B;  3EYI A;  5L3B A;  2KDZ A;  2IPQ X;  1I6X A;  2QLZ A;  3A0H C;  4Y7N J;  3RI4 A;  5E3N A;  4M72 A;  4D7M A;  2HOS A;  3BQZ A;  3GCM A;  2EB7 A;  2L4A A;  4RM3 A;  3FMR A;  2QQA A;  3H9G A;  3HOT A;  2KFD A;  2R0Q C;  3VYS B;  2CUZ A;  1QO0 D;  1KQ9 A;  1R5G A;  2XIG A;  5IOZ A;  3EET A;  3JRG A;  2WTE A;  1LE8 A;  4G7O F;  2LDU A;  4Q47 A;  3IAM 2;  4N9I A;  3MKY B;  4IF4 A;  1YYV A;  2BGC A;  4LIU A;  5LHI A;  2K02 A;  4YRV A;  4J01 A;  1MZB A;  5D8K B;  1SFX A;  2H94 A;  3K4N A;  5LD2 C;  1L0O C;  3T5X A;  1IRF A;  3CCR I;  3W2A A;  3K4K A;  2OJE D;  2CU7 A;  1X1C A;  1NH3 A;  1TLH B;  3J81 Z;  4LLG F;  5TRD A;  5HLT A;  1UHS A;  1JJ8 C;  2NVY J;  3WTZ A;  3RSN A;  3BG7 A;  5DYM A;  3ABK H;  3CUQ C;  2PEX A;  2N8G A;  3WTY C;  1XC5 A;  2E1O A;  2GA2 A;  2VJI A;  2DT5 A;  2RVC A;  4PJN A;  3TKY A;  3NRV A;  1VQ5 I;  4WX9 A;  5IP7 J;  2VB6 A;  3MWM A;  2CW7 A;  3ZXS A;  1GVD A;  2HQ5 A;  5LLQ A;  2COM A;  2H8W A;  1I3Q J;  3KP3 A;  5GAH J;  1ZQ3 P;  5FRN A;  3G2B A;  1YIT I;  3GYH X;  1BJA A;  2MLK A;  4LLL A;  2R4G A;  2L7F P;  3SDG A;  3OL4 A;  2ZFW A;  2VJJ A;  2E2H J;  1VQ7 I;  3S16 J;  1U8R A;  3TED A;  2Y75 A;  2RQP A;  2IT0 A;  4Y15 A;  2CQQ A;  1I39 A;  3IWZ A;  2ACJ A;  5DUI A;  1U9N A;  2XAG A;  3PUF A;  1TNT A;  3J7Y J;  5BOX A;  1LFB A;  1D3Y A;  2Z5U A;  4UUS A;  1S6L A;  1UAA A;  3W2V A;  1U2W A;  2XHK A;  4J19 A;  2CSO A;  1SFU A;  4X1E A;  5D6E A;  2OTJ I;  5HNH A;  5F6F A;  3HSE A;  1LUJ B;  3A4C A;  3C7J A;  5EJC A;  3BPX A;  2BY1 A;  1B9M A;  3CJT B;  3V7S A;  1P92 A;  3FKI J;  1YW7 A;  4EM2 A;  2M7B A;  3F22 A;  4WF2 A;  4I76 A;  1TWG J;  1I27 A;  2ZB9 A;  3PSI A;  2IRF G;  1K6O A;  1HKQ A;  5J3L A;  1USS A;  3KP4 A;  4AIK A;  2JUC A;  1ZGW A;  2W1O A;  1K4T A;  1X1A A;  3KZY A;  4RBO A;  2UV1 A;  4IRH A;  2P81 A;  1DQU A;  1LEA A;  3FZV A;  4D5F A;  4OIP F;  5JHU A;  1GVJ A;  4CYD A;  1LKX A;  1OR7 C;  5LGN A;  4WCG A;  3CO6 C;  3TW6 A;  2VON A;  4UVC A;  3K70 D;  2VPL A;  3KET A;  1WJ5 A;  4EVI A;  1I6H J;  5DCM A;  5HOO A;  3QOD A;  5LHH A;  5J4V A;  1UJ8 A;  3P9K A;  3OYN A;  3BJA A;  4KUM A;  2FNP A;  2PMZ A;  1SD5 A;  2A69 F;  4LK0 F;  1VF9 A;  1WJE A;  4HBL A;  4M9X A;  2ZJP F;  1Z3Y A;  5CVV A;  3G3Z A;  4PFP A;  2LF8 A;  2MD0 A;  3CCM I;  5FRO A;  3R4K A;  1IRG A;  2X6X A;  5J1U A;  3ZGK A;  2Y48 A;  1WJD A;  4L5J A;  5K5O A;  4ESB A;  4PGG A;  5KVR A;  1B4A A;  3RJP A;  4OIN F;  2WAQ N;  1OJL A;  3HC7 A;  2ZME C;  1X3Z B;  3HUG A;  2GQQ A;  4OOI A;  2O03 A;  3H0D A;  5CQG A;  2WAE A;  4ZYD A;  1Z91 A;  4GYI A;  2D1V A;  3J7A Y;  4HDU A;  4ZYG A;  1HSJ A;  2HQA A;  2E1M B;  2L0K A;  3BG5 A;  4L9N A;  2WWY A;  1FOW A;  1IV6 A;  1XD7 A;  2HYF A;  2DA6 A;  3Q0U A;  2Q8K A;  4D1Q A;  3K2Z A;  1JKP C;  1KGS A;  1B59 A;  4L5E A;  2O61 A;  4I98 B;  2QSH X;  3IUO A;  2P5K A;  2EBI A;  2ID3 A;  3PNV A;  2GXA A;  2DA2 A;  2OAZ A;  4U7B A;  4C2U A;  4E7J A;  2JSP A;  3J7Z I;  4Y52 J;  3EQL F;  3FK7 A;  3D5R C;  3IH3 A;  3K2A A;  2LG4 A;  5L3G A;  3WTU C;  5HLG A;  5FO5 A;  4ZDO A;  1IN7 A;  2CQK A;  2L7Z A;  3GTM J;  4D7N A;  3OYI A;  4HNV A;  2VAS A;  4DOZ A;  3G71 I;  3I5U A;  4M3B A;  2H6C A;  4BY7 J;  1NK2 P;  4BQO A;  4NHJ A;  2HOE A;  1Y6I A;  1WSU A;  3KPH A;  3VWB A;  2LR8 A;  1YJW I;  4CHU A;  4DZP A;  5FRM A;  5FLX Z;  2WAD A;  3KZZ A;  4A3K J;  4R79 A;  4IPA A;  2DOA A;  1HKS A;  4JX6 A;  4YFN F;  5GAE J;  1EH7 A;  2UXX A;  1MBF A;  1TWA J;  4IO9 F;  1DGR M;  1GXQ A;  4RGU A;  1ZG5 A;  5FKM A;  3HTS B;  5CQE A;  1Z67 A;  2GAU A;  4CZZ A;  2DDA A;  4U87 A;  5FFX A;  4XSZ F;  1ZRC A;  3MKL A;  3HGG A;  3M8E A;  2A61 A;  2K40 A;  1H0M A;  2UWM A;  2W85 A;  5GPA A;  2JRT A;  4XRS G;  2CQN A;  4FE7 A;  3GXO A;  1ZR2 A;  2HQR A;  2EJR A;  2M8G X;  3P9I A;  2AS5 F;  1S7E A;  1FYM A;  4MLO A;  1F9N A;  3MKW B;  3GVA A;  2CWE A;  4HX7 A;  4AYB N;  3G6E I;  3GBG A;  1D8J A;  3CC7 I;  4XOR A;  3MMY B;  2V1N A;  2R7D A;  4V2G A;  5HOD A;  4L0Z B;  1T0F A;  4IHS A;  1IG7 A;  3OIP A;  3RIR A;  3CCS I;  1ZG1 A;  4RB3 C;  2EFN A;  1D1C A;  2DMQ A;  2HDW A;  4CCN A;  3E97 A;  4KYW A;  2NOJ B;  2TDX A;  3ZMD A;  3H5R A;  4WXH A;  1REP C;  1YS6 A;  2W82 A;  3L2C A;  3F21 A;  4I02 A;  2FQ4 A;  2UXN A;  1Z6R A;  1WKM A;  1K78 B;  2DOF A;  1S29 A;  1IUF A;  4UVB A;  4E7L A;  2K85 A;  1D0Z A;  4RDU A;  2E2I J;  1MND A;  2MSY A;  5BQT A;  3OS0 A;  1B8I B;  3B02 A;  4IX7 A;  1ETK A;  4C30 A;  2JPC A;  5GAG J;  1WVR A;  4F7Z A;  3WTT C;  3M3Y J;  2JT1 A;  3ABU A;  3E5Q A;  3FHN A;  2JA6 J;  3ABM H;  4M3F A;  2EFO A;  2KDO A;  5HVQ C;  2ZJ2 A;  1CQT A;  1Y56 A;  1H9T A;  4KT5 C;  3I4N J;  2C6Y A;  5HS7 A;  5CYV A;  2E71 A;  2EIM H;  2F48 A;  4EJO A;  1OFC X;  2V1X A;  4XOT A;  2L9N A;  4IQJ A;  2HYJ A;  2CMP A;  2L3D A;  4LJZ F;  4RB2 C;  1D0Y A;  3CUQ B;  2H6B A;  4TV7 A;  3JTG A;  4A69 C;  2DXI A;  3BJ6 A;  3M1C A;  4DGW B;  3V4G A;  1A04 A;  1O3R A;  1NK3 P;  4E7K A;  2NOG A;  2LOO A;  3S3N A;  5JVT A;  3FM5 A;  3TP0 A;  1G59 A;  4HZF A;  3DEE A;  2LBF A;  4BAY A;  3OS1 A;  4EGZ A;  2XF6 A;  2HQN A;  1XGS A;  1I50 J;  2DA7 A;  1JT6 A;  2F4I A;  2OCE A;  2Y0S N;  3TO9 A;  4KIS A;  4PFO A;  1OCZ H;  3GTQ J;  1JJ6 C;  4GRI A;  3OYJ A;  3L00 A;  1D1A A;  2D1H A;  4MIM A;  2VXZ A;  2VT3 A;  2NS0 A;  3NAU A;  2AQE A;  3D5L A;  3S32 A;  1Y1V J;  2P7V B;  1ZRF A;  3I59 B;  5K7F A;  1G3T A;  3LSP A;  3Q9V A;  4XLA A;  1U78 A;  3OY9 A;  4RB0 A;  4G8X A;  2DK5 A;  1KU2 A;  2M45 A;  2A07 F;  2DAO A;  2W57 A;  3GZ6 A;  1MBJ A;  1BIA A;  3BR5 A;  3OV8 A;  4RGS A;  4IOA F;  2HKO A;  2K7L A;  2MFZ A;  3BDD A;  2BVL A;  3ZQC A;  2DA4 A;  2DA1 A;  2KL4 A;  2PX9 A;  3KLO A;  4G7H F;  3QPL A;  3QU6 A;  1AU7 A;  3LA7 A;  1UZC A;  2QBY B;  2KRH A;  6PAX A;  3I56 I;  2PMU A;  3KP7 A;  3PQK A;  4HEA 2;  4E7S A;  1ZLK A;  3CMY A;  4ZC3 A;  3HOU J;  1VND A;  1TTY A;  1UHM A;  4L18 B;  1I5Z A;  3FIW A;  3AKZ A;  4BQN A;  3FXQ A;  4EMS A;  2F5D A;  1RR8 C;  2QVO A;  4M9S A;  4QLC U;  1VQ4 I;  2CFO A;  2KHM A;  4YG2 F;  4NC7 A;  4FAS D;  2FMY A;  2DI3 A;  1QPM A;  2VQG A;  4XKW A;  1LFU P;  4ZYH A;  1PP7 U;  2WAF A;  2PMH A;  1OMI A;  3EDP A;  1ZH5 A;  3DBR B;  4C3I J;  3A01 A;  4Z2Y A;  3EYY A;  1BOB A;  3R60 A;  2F4M B;  2DCE A;  2DT7 B;  1PUF B;  4XLP F;  3DF8 A;  2K4J A;  2XB0 X;  1K83 J;  3NAR A;  3OYG A;  2EFQ A;  4OIO F;  3F3X A;  2XAQ A;  2HWV A;  2RRE A;  1FIP A;  1YJ9 I;  4KMU X;  1CF7 A;  2LC2 A;  2X85 A;  2LTP A;  2ZME B;  1ZEL A;  3LFU A;  4XID A;  3J80 Z;  1AHD P;  2XGX A;  3SZP A;  1YX5 A;  1ZAO A;  5J47 A;  4A3B J;  3H5A A;  3I58 A;  1R23 A;  4MFE A;  5J1Y A;  1LQ1 A;  2E2J J;  1G6N A;  2MC4 A;  2IBD A;  2XF5 A;  5ILS A;  2A5Y B;  1EF4 A;  5GAD J;  2HYG D;  4G6T B;  2K9N A;  2LF7 A;  1XMX A;  2ZO4 A;  1H9G A;  4OAZ A;  4CCO A;  2HZD A;  1MJ9 A;  1S3J A;  3RPU D;  5C4X J;  4MEY F;  2W48 A;  2L54 A;  1BW5 A;  2JWT A;  2V79 A;  3ZMS A;  2AHQ A;  2E5Z A;  3G1O A;  3TGN A;  4ABZ A;  3OSG A;  1JKQ C;  4A6D A;  4HV6 A;  3IV5 A;  4EGY A;  3PIO F;  2Q2E A;  3LQR A;  1HW2 A;  3VPR A;  1BM9 A;  1P4W A;  1T0F C;  4JBA A;  4C3J J;  3MFK A;  3DEU A;  3WGI A;  2AQF A;  3GZ5 A;  5LRS A;  1WRJ A;  4YEJ A;  3L9F A;  1TL8 A;  1MJA A;  5DDG A;  2RDP A;  3R61 A;  5F0F A;  2JJ7 A;  3LWF A;  3HRM A;  3F8M A;  1LNW A;  4YIF A;  4RLQ A;  3DU6 A;  2ZXW H;  2BW3 A;  3D5S C;  2DPD A;  2PJR A;  5E8I A;  4KFC A;  3I4P A;  3A1Y A;  4AC0 A;  1EJ9 A;  2BHY A;  3BR3 A;  3KEY A;  4IHV A;  2AXT C;  4MO7 A;  1B72 B;  5FJ8 J;  5D5X B;  2BE5 F;  3K7A J;  3K1M A;  3OYM A;  5GTI C;  1VQM I;  1YW8 A;  3KZI C;  1LE8 B;  4ESF A;  2VL8 A;  3S93 A;  1JI8 A;  4IHT A;  1SAN A;  5JVG F;  2CQX A;  1TQI A;  1VI0 A;  3E6D A;  3O3K A;  5BS6 A;  4II2 A;  2G7H A;  3MN2 A;  3GTO J;  4ENK A;  1S9H A;  4BEH A;  2VBW A;  2MAB A;  1A5J A;  2XSD C;  5DEQ A;  1Z21 A;  1FT9 A;  2GA1 A;  3AAF A;  3U9G A;  5KNL A;  2QCO A;  4KIC A;  3OWT A;  3CLQ A;  1X3W B;  1BI2 A;  4MFD A;  2LVS A;  2OQG A;  3RDI A;  3V42 A;  3A0B C;  4XRS A;  2Z3Y A;  5LGU A;  4HQM A;  4DNC A;  3FXR A;  3QRF F;  1T38 A;  1MNE A;  4WK8 F;  1G3Y A;  5IYD J;  1S5L C;  3JRC A;  1QHG A;  3CZ6 A;  1ZKG A;  2KZV A;  1DU0 A;  5TGT A;  2WC2 A;  3GFJ A;  1R49 A;  2IA1 A;  1HST A;  3K0L A;  3OYL A;  3CCL I;  1SC7 A;  3QYB A;  3L1P A;  3ABL H;  2EZI A;  3DTI A;  3MZ8 A;  5EYR A;  2XDV A;  1WZ2 A;  2D2W A;  2RC4 A;  1R4N B;  3KEQ A;  2XVC A;  2ZC2 A;  2EPF A;  3FF5 A;  1Z0X A;  1GHC A;  1Z7U A;  3MQ0 A;  1OLT A;  5FKK A;  1YO5 C;  4GGG A;  4PJJ A;  3JAM Z;  3PIP F;  3E0J B;  2BY0 A;  3NEU A;  4CUG A;  3HOY J;  2BYV E;  3KYD B;  1Z1D A;  1A36 A;  2H09 A;  2YPR A;  2VOP A;  1R9T J;  2OUM A;  2FD5 A;  1OCR H;  1WH7 A;  3VOD A;  2PJP A;  2O8X A;  2M7A A;  1JKO C;  2CS3 A;  2OV7 A;  4ZDL A;  1KA8 A;  2F4O B;  3E6B A;  3GME A;  4DZJ A;  1T33 A;  3IH4 A;  4IJA A;  4LD5 A;  5EG0 B;  1A31 A;  4UY8 I;  1XGM A;  2LSO A;  1NG7 A;  1FBU A;  2HGC A;  1MIJ A;  1I3A A;  1HDD C;  1G8X A;  1UST A;  1BW6 A;  1POG A;  1SD7 A;  5IY5 H;  1VQL I;  2VE8 A;  2XPV A;  2XGE A;  1QZE A;  1QQI A;  1BN5 A;  2JPB A;  1IF1 A;  2EK5 A;  1XG1 A;  4S04 A;  2R7Q A;  3F6V A;  2LD5 A;  3LSI A;  3RQ4 A;  1S7O A;  4U0W A;  2B63 J;  2CV0 A;  2XRN A;  4RAY A;  1FMV A;  3WTX C;  5J40 A;  2DJI A;  3DFG A;  1Z05 A;  3F0C A;  1TZL A;  4LOC A;  5D5U B;  4CYC B;  3HG9 A;  3OYF A;  2QF7 A;  2HR3 A;  1GUU A;  4B3X A;  2Y31 A;  4LK1 F;  1PP8 F;  3M8J A;  1YHQ I;  1PDN C;  3S1Q J;  1ZHF A;  1Q1H A;  3MD2 A;  2STW A;  2OBP A;  3GZN B;  4NNJ A;  2IA0 A;  2R7U A;  4IRG A;  4RAG A;  2D5V A;  5LGT A;  1WJB A;  2FBI A;  5FGM A;  3FX3 A;  4HNT A;  3GO5 A;  3EUK L;  3H5N A;  3JCU C;  5CVR A;  5TJJ A;  5HS8 A;  5LBQ A;  3V8L A;  3HOW J;  2K4B A;  4BUP A;  2X6O A;  4BNC A;  1O7L A;  1R00 A;  2HOA A;  2DQR A;  4MEX F;  1DPU A;  1P4X A;  2MGQ A;  3DQV C;  3ZQH A;  4KIG A;  3ZP5 A;  1R1V A;  3VB2 A;  1JXS A;  2HZT A;  2YUS A;  3ESW B;  1E0E A;  2MLG A;  4AIH A;  1IN4 A;  2CYY A;  3IP4 B;  1XS9 A;  3PSF A;  3BT9 A;  1APL C;  2VC0 A;  1W0T A;  3WGH A;  4ZJZ A;  3IL2 A;  3U21 A;  1FOK A;  4IHY A;  1IW7 F;  3VYR B;  1J9I A;  2VOO A;  5LHG A;  4KJZ A;  3C3W A;  3E6M A;  3MAJ A;  4OAY A;  4W97 A;  3GX4 X;  4PCQ A;  3HRT A;  1K4S A;  2Z1D A;  3LSJ A;  3DPU A;  1JHH A;  4ZTJ A;  2V9K A;  2WB1 A;  2EIK H;  5IPA A;  2PMZ N;  2P0W A;  1HXD A;  4FE4 A;  5M5X J;  3ZOB A;  2HPI A;  2W84 A;  4E70 A;  4A6E A;  4BJT A;  2E60 A;  3AL0 C;  4BJ5 C;  2WBM A;  1RET A;  1G3W A;  3P5J A;  2DFH A;  3V7C A;  1TT0 A;  1XDS A;  1RRJ A;  2P7C B;  4KDP A;  4B4C A;  3DWL E;  3KP6 A;  3F23 A;  2KZG A;  4PSW A;  1ONV A;  1X1D A;  1YE9 A;  4IZZ A;  3CJN A;  3FBN B;  2H1L A;  4CCJ A;  2FEZ A;  4J00 A;  1R5I D;  4HV5 A;  4LLN A;  5DTD A;  3SFI A;  1FPQ A;  3VYU B;  1NTC A;  3CDI A;  4XON A;  1WCM J;  3WHB A;  4A3C J;  5DS9 A;  1MBE A;  2V1D A;  2BBY A;  5C4J J;  2A6T A;  1QZY A;  1MMS A;  1ERD A;  4EJV A;  2GZW A;  2QQ9 A;  1KON A;  1UMQ A;  3ZQL A;  2BY2 A;  3T1B A;  3F9K A;  2FF4 A;  5C3E J;  3BTI A;  5IT9 Z;  2OU2 A;  1G3S A;  2ELK A;  4UHT A;  3T8T A;  3SHF A;  3RZD J;  4UB8 C;  1O57 A;  3R0J A;  3ZQI A;  2Y0M A;  1B6A A;  3K6G A;  1IXS B;  3HEF A;  2R5Z B;  3SJM A;  3TQN A;  1HBX G;  3AG3 H;  2XC7 A;  4NBQ A;  2DMN A;  2HI3 A;  2NAZ A;  1LVA A;  2ISZ A;  1EKE A;  2I8D A;  1K7A A;  1MBK A;  1UFM A;  1VQO I;  2M30 A;  3CES A;  4CXF A;  2CV2 A;  2P6T A;  2A6H F;  1RIO H;  4HST A;  4RB1 A;  3VSL A;  3KEO A;  4V19 K;  2R7S A;  4D9J A;  4A3D J;  3CCY A;  3M07 A;  2M0M A;  2TCT A;  4XM3 A;  1ULY A;  2GOX B;  2P4W A;  1QVU A;  2VKH A;  1DGW Y;  3HXL A;  1ZLJ A;  3LA2 A;  4G6D A;  4HYE A;  3GTG J;  3CDL A;  5M3M J;  2QQB A;  4DBR A;  1YI2 I;  4LG0 A;  2Y2Z A;  4AU7 A;  4A5N A;  5EGO B;  1J0R A;  4M74 A;  4UUT A;  4JX4 A;  3FK6 A;  2ZBK A;  2DPU A;  4PK4 A;  1SVO A;  3SZG A;  5EZG A;  3PFY A;  3IHU A;  1WI9 A;  2A68 F;  3LA3 A;  4DYR A;  5L3C A;  3JSO A;  3VSK A;  1ZRE A;  4BH9 A;  3FIS A;  1FNN A;  2X0L A;  2KKO A;  3BY6 A;  2G0E A;  3JRH A;  4M9Z A;  3S1N J;  2K86 A;  3UKG A;  3ERE D;  5BNG A;  1A6Q A;  1HF0 A;  1ETV A;  3F8B A;  1U5T A;  2HTS A;  4R1H A;  3GWZ A;  2YS9 A;  4NQW A;  1IXC A;  2DK8 A;  2K3P A;  1SFK A;  4DQ2 A;  4NC6 A;  4MTE A;  1AKH B;  2CFX A;  3S1M J;  1NHA A;  2VIX A;  2KMU A;  1WFX A;  4E7Z A;  1IC8 A;  1ITY A;  4E7I A;  1F1Z A;  2M5W A;  1QU3 A;  1ENH A;  2DFF A;  4L9J A;  1N25 A;  4D5C A;  1QHH D;  4YFX F;  1P7J A;  4A3G J;  5E1Z B;  3H36 A;  4N9H A;  4ON0 A;  3WU2 C;  2TRT A;  3LFK A;  5CVI A;  3FBI B;  3DU5 A;  3V7R A;  3U1K A;  1NG6 A;  3DPT A;  1S72 I;  4CCK A;  1YW9 A;  2VOD A;  1MDM B;  3BLY A;  2LYC A;  3NQO A;  1X1B A;  5D4R A;  4B48 A;  4HLX A;  1OQY A;  1ZGJ A;  3CMM A;  2X4H A;  3FXM A;  4U0Y A;  3OYE A;  1AWC A;  2H27 A;  4QWQ A;  2O8K A;  1ETX A;  2JA8 J;  4XRF A;  5AIP A;  3MEX A;  1VQN I;  3O8H A;  1E2X A;  1R1T A;  4WXD A;  2XRO A;  5F0C A;  1OYW A;  4LFU A;  2ME0 A;  1LDJ A;  1W7P A;  1YFH A;  2W25 A;  3DLL F;  1VFC A;  1WI3 A;  2VBX A;  2VQL A;  1SMT A;  3H35 A;  3JRI A;  3KCC A;  1K6Y A;  3ZQ7 A;  2FBK A;  4P96 A;  4UNO A;  1U3E M;  4S0H B;  2MA3 A;  1FJL A;  5DD8 A;  3H9Q A;  5EF6 A;  2JUG A;  3H0G J;  4F55 A;  2KJB A;  3HZJ A;  1FTZ A;  3RTR A;  1W36 C;  3P7N A;  1TWC J;  1RC9 A;  2KRC A;  4ZH4 F;  4IQ4 A;  4G6Q A;  2FU4 A;  2V9P A;  2ZSH B;  3MZH A;  1JGS A;  1ZGA A;  4BDZ A;  2A6E F;  1HLV A;  2KPM A;  3M1E A;  1MH3 A;  3JR9 A;  1BC8 C;  1V5F A;  1X3U A;  2FUG 2;  3AFH A;  3EUA A;  3DXJ F;  1CF7 B;  1TW3 A;  3OR2 C;  2ESN A;  1JTX A;  3ZQF A;  4BDY A;  1FEX A;  1R7J A;  2GWR A;  2LRE A;  3S3M A;  3HSF A;  1TNS A;  3G73 A;  2NRA C;  2DTR A;  3CLO A;  3S3O A;  1ON1 A;  5H6R A;  5FLM J;  5E3M A;  2PBI A;  3HYI A;  4ZZD A;  1E3H A;  1XCB A;  3IWF A;  2OQR A;  1W5T A;  2A3S A;  2O9L A;  5E1X A;  2E1C A;  1P6R A;  2HVR A;  3B6A A;  1T95 A;  3VDX A;  3E7L A;  5ICE A;  2HDD A;  3ZPL A;  2DMP A;  3LMM A;  1WJF A;  4AWX B;  3F8N A;  3GEZ A;  3HKZ N;  2QGU A;  4JX5 A;  3OR1 C;  4M73 A;  1OKR A;  3SYT A;  2WV1 A;  3BG9 A;  4LB5 A;  5B66 C;  3MVP A;  5C44 J;  3J81 K;  1IUY A;  3ERM A;  2FRH A;  1BA5 A;  1ETY A;  1FP2 A;  1MBG A;  3KE2 A;  3O2P E;  4OWR B;  2B9S A;  1TQP A;  1ZN2 A;  3ZMT A;  2VE9 A;  3AL0 B;  1JUP A;  4LMY A;  1U8B A;  3ZR8 X;  2K9M A;  2XRL A;  2BOL A;  3BCA A;  2HXI A;  4EM1 A;  4XBF A;  4YIR X;  5E8G A;  4XMY A;  1MBH A;  3WGG A;  1Y0U A;  3BR2 A;  4BE0 A;  3S2H J;  3HOS A;  3EUH A;  2ETH A;  3TP3 A;  3L2V A;  3PO3 J;  4W1U A;  2K3F A;  4ENN A;  2QA4 I;  1HW1 A;  1FWZ A;  1FBS A;  4CIC A;  3UNG C;  4B43 A;  1LJ9 A;  5ILV A;  1HKT A;  3RZO J;  3I64 A;  4XNF A;  1AA7 A;  4M6X A;  2ADU A;  2DN0 A;  4FX4 A;  1B9N A;  3IC7 A;  4I0B A;  1O4X A;  2L9V A;  5H20 A;  4XN0 A;  4HPQ A;  2LY9 A;  1XDU A;  2F5E A;  2LLK A;  2EFP A;  2DOD A;  1GV5 A;  2RN7 A;  3CF2 A;  1JGG A;  5F04 A;  1MW7 A;  4HX8 A;  4B8X A;  1ETO A;  3Q5F A;  3QP5 A;  4FX0 A;  3HTU A;  1IO2 A;  3REO A;  1WJA A;  3TOB A;  2CW0 F;  2ZXH A;  3GLX A;  1LDK B;  3I3L A;  5J4Y A;  3FMQ A;  3CJR B;  4A5M A;  1O3T A;  1MH4 A;  3QYF A;  5EDN A;  4UV9 A;  4IEJ A;  2E7X A;  2DMT A;  1Z3X A;  3H3Z A;  2ICW G;  4UV8 A;  2V7F A;  3WHC A;  1I1S A;  1QGP A;  2IXS A;  3DLA A;  2F5V A;  2FOK A;  1P4A A;  3LSH A;  2ECC A;  2DT6 A;  4PJ0 C;  4ENJ A;  1H89 C;  2CJJ A;  4F52 A;  1FIA A;  2IW5 A;  4RLF A;  2CO5 A;  1D1B A;  3FHZ A;  2JN6 A;  3Q0W A;  3S8P A;  1MSF C;  2KT0 A;  4N4O B;  1T39 A;  1U5T C;  3BPV A;  3TOA A;  1V4R A;  2WY7 Q;  2XV4 S;  3OMY A;  2VPR A;  2QQ8 A;  2CGP A;  2R5Y B;  3BG6 A;  4M3E A;  4EJU A;  1OCP A;  3C2B A;  2IGO A;  3I9V 2;  2VJ5 A;  1TWF J;  1FX7 A;  3QPS A;  1BR4 A;  1OIS A;  2KIF A;  1BR2 A;  2GLO A;  1W4M A;  1K78 A;  2R7W A;  2NVX J;  4QIW N;  1X19 A;  1DUX C;  4EQQ A;  4DBQ A;  3I54 A;  3WG9 A;  2ESH A;  4IOC F;  2I5U A;  3IRQ A;  1TWH J;  3EPZ A;  1B8I A;  1XX5 A;  2Y9Y A;  3QOE A;  3O8G A;  3SXY A;  1Y8R B;  2GXB A;  2R7X A;  1FOX A;  2BY3 A;  2K27 A;  3BZK A;  2OA4 A;  4BY1 J;  1ON2 A;  2ME6 A;  5IP6 A;  1Y1W J;  2Y30 A;  3QOP A;  3S14 J;  2L01 A;  5KAF C;  2WA0 A;  3ZRG A;  1IN8 A;  1EA3 A;  3K10 A;  3ISP A;  4MQ9 F;  3CO7 C;  4BAC A;  1KYZ A;  2JMW A;  4A0X A;  2PG4 A;  2EV6 A;  5E20 A;  3Q9S A;  1YRN B;  1KU7 A;  2H8R A;  4NDL A;  4M6Y A;  5L3E A;  2VN2 A;  2M34 A;  4U0V A;  2M4G A;  2R3S A;  1P9Q C;  4I7H A;  3PNY A;  4YFK F;  1OYI A;  1VQP I;  1J75 A;  2G7U A;  1MKM A;  2DOE A;  1FMW A;  3LAJ A;  3K69 A;  4WWC A;  2Q0O A;  3LSM A;  4HRI A;  5CPR B;  2XAS A;  2XAU A;  2IA2 A;  2EIJ H;  2OC6 A;  1MMD A;  4I0A A;  2PN6 A;  4A3L J;  3CP8 A;  2Y9Z A;  2VQC A;  3QAH A;  2JA5 J;  1OPC A;  4RGX A;  1JUS A;  3GTJ J;  4CSW A;  5FLX K;  3M7G A;  4GFB A;  4OIQ F;  3HJE A;  3E5U A;  3I59 A;  4E4H A;  3BR6 A;  3BR1 A;  4KT6 A;  3S1R J;  1UG2 A;  4I01 A;  5D6F A;  1ETQ A;  4KA4 A;  4XN3 A;  2RV8 A;  3GFM A;  4OU0 A;  5E18 F;  2X6Y A;  2DLL A;  2JA2 A;  1TP4 A;  3DBL B;  1V5G A;  3K9T A;  3M9A A;  3QQA A;  2J5P A;  2IEK A;  4HNU A;  2EZK A;  2O0Y A;  1WQ2 A;  2MC3 A;  4HF1 A;  2KP6 A;  3SZT A;  4Q4Z F;  2KIQ A;  3IKV A;  3LL7 A;  3PFI A;  1MSE C;  1VQK I;  4XLF A;  3H9J A;  3CQZ J;  5DV5 A;  2QEN A;  1O3S A;  4A3J J;  4UB6 C;  1ZTR A;  4HLY A;  2EIN H;  1HDP A;  1LDD A;  5F1R A;  1QVT A;  2E5N A;  2X1D A;  2IS6 A;  3HOZ J;  3ZMZ A;  1VQ9 I;  2XGC A;  4FHT A;  3WTW C;  4II3 A;  2E1M C;  3E3V A;  2IS4 A;  1R4M B;  2JZY A;  1WJC A;  3QYE A;  4F92 B;  1YS7 A;  1RUO A;  5E3L A;  3CDH A;  1BJZ A;  2A05 A;  4HSR A;  3CME I;  2K5C A;  3N4M A;  3NWS A;  3FM3 A;  3S2W A;  1T56 A;  2DA5 A;  2M2E A;  1ZK8 A;  1MNM C;  3GLL A;  1YIO A;  1L3L A;  1RZ4 A;  3EUH C;  4KN4 X;  4WXC A;  3GFL A;  2NVU B;  4UUS B;  4I99 C;  4N4N B;  4M71 A;  4BHC A;  4XKB A;  3KP2 A;  2ID6 A;  3F6O A;  5J6X A;  1EV7 A;  5LEJ A;  3T8R A;  5D4S A;  1WHU A;  2KIM A;  5L3D A;  4BE2 A;  4JK1 X;  1Z6T A;  1SAX A;  1PUF A;  2O5R A;  2WB1 N;  2W00 A;  4Z6Y A;  2BXZ A;  4AVZ A;  3QPT A;  2E36 A;  2Y69 H;  5HDK A;  3CC4 I;  3WU0 A;  5B1A H;  1BR1 A;  2RGV A;  3H92 A;  5J1R A;  2CV1 A;  3HOV J;  2ZME A;  1PJR A;  4ZYA A;  4HF0 A;  1BI0 A;  1W5C C;  4U88 A;  1OCT C;  2O3F A;  3L7W A;  2HEO A;  3HRS A;  1T98 A;  1SFE A;  3PO2 J;  2M1B A;  5L3F A;  2W4S A;  3CTA A;  1PYV A;  3A03 A;  1D8K A;  1BC7 C;  4ZTF A;  2ZJQ F;  2DMU A;  3IH2 A;  1W5S A;  2F5F A;  3WTV C;  4BHB A;  2Q1Z B;  3A2K A;  5DCM B;  2DYS H;  2MH2 A;  2OF7 A;  3C18 A;  3F8C A;  2XUB A;  5GTH C;  1R5H A;  1ZRD A;  3ZN0 A;  2V6E A;  5E1W A;  5FLV A;  1UCR A;  2MW8 A;  2R7T A;  4BQA A;  1SMY F;  1WWX A;  3BTJ A;  2RNG A;  2DFI A;  4CGZ A;  1M1E B;  2EV5 A;  1RKT A;  1SVL A;  4BGD A;  4KNY A;  3W2W A;  1ZAR A;  1PVE A;  5KCM A;  4DIQ A;  3KYL A;  2JSC A;  3K4C A;  1MGT A;  3GTK J;  3SQN A;  1G4D A;  4XLH A;  1VQ6 I;  3ABT A;  2ELJ A;  4CCL A;  1FC3 A;  4DYC A;  3HUG B;  1FY7 A;  3HSR A;  2UUZ A;  3ASN H;  2BV6 A;  4LG0 B;  4NUB A;  2EZL A;  3TW7 A;  5CVU A;  1B72 A;  4UXN A;  1DPR A;  3WG7 H;  4XR6 A;  4HAM A;  3RKW A;  2L9R A;  1H88 C;  4XLC A;  2BVM A;  2VC1 A;  4V2F A;  4Y13 A;  5D8L B;  4JOM A;  3S2D J;  5HDN A;  1GLN A;  2XPU A;  3X2Q H;  4BU2 A;  2Z9O A;  1J5Y A;  2JVH A;  4GYG A;  2XSJ C;  4IKF A;  4FTH A;  1F4K A;  5DD4 A;  3K70 C;  1XMK A;  1Y0N A;  2LMD A;  2NXN B;  4KIT B;  1U5T B;  2FJ1 A;  3I0T A;  2LFB A;  3R6S A;  4PSX A;  1R71 A;  1R58 A;  1P2F A;  2LKP A;  4XKV A;  4NQW B;  2MG4 A;  3VYT B;  1IXR C;  3VFZ A;  4IHW A;  3KP5 A;  1V5E A;  3PM1 A;  5A2Q Z;  3RYP A;  2LRD A;  1FYK A;  4P55 A;  3J7A O;  2L4M A;  1DDN A;  3G4S I;  3ZMU A;  1MD0 A;  5CJ9 A;  2VKE A;  4CH7 A;  2CUF A;  5EEA A;  2NYX A;  4IHX A;  2NNN A;  2HFH A;  3BRO A;  4C3H J;  4BE1 A;  4ITV A;  4CCM A;  2Z99 A;  3LSR A;  2IS2 A;  4OIR F;  2OTL I;  1Q1V A;  3J80 K;  1Y39 A;  3WE3 A;  3BOQ A;  3LSG A;  2AO9 A;  2IP2 A;  5IT3 A;  3IRR A;  1KQ0 A;  1OCC H;  2LY1 A;  1J2X A;  5JHF A;  2Z16 A;  4P9U A;  1ZR4 A;  4BJ6 C;  5FKO A;  2HVQ A;  1LB2 A;  4AID A;  3QP6 A;  2YX4 A;  4BXF A;  4BBR J;  1RUN A;  2CH0 A;  1YOV B;  3ASO H;  2M8E A;  3BJO A;  5H6Q A;  4A3E J;  5EG0 A;  4A0Y A;  2QZ8 A;  4Q48 A;  4C9Y A;  3PL8 A;  1YQA A;  1JE8 A;  4I09 A;  2MYS A;  4KIF A;  4ZDP A;  4QPO A;  1JTY A;  1UHW A;  4JQF A;  1FSH A;  3WOD F;  2RKH A;  1P7I A;  3IAS 2;  1RES A;  4A3F J;  1W7P B;  3GW2 A;  2PI0 A;  1FYL A;  5IP9 J;  3ZMV A;  3VEP A;  1R6R A;  1TC3 C;  4L0Y B;  3ECH A;  3CD6 I;  2GBY A;  5EEH A;  4L5I A;  3BQY A;  2GIV A;  1I1G A;  1LEB A;  2BXY A;  3BR0 A;  5K7Z A;  2CRG A;  3HM5 A;  4LIT A;  4S05 A;  3BCB A;  4H4K C;  4CYC A;  1KZH A;  1QZZ A;  1XGO A;  3ZQQ A;  3CCU I;  1RR7 A;  4IL6 C;  4GXO A;  4XOP A;  2QYO A;  2LK2 A;  3UR3 C;  4FIS A;  5H2F C;  5K1Y A;  3L2Q A;  2AXL A;  2ZSI B;  4ZYE A;  3BC8 A;  2LY2 A;  3K1P A;  5TIS C;  2FQ3 A;  1S8N A;  5BMZ A;  2FBH A;  4PZJ A;  3OYB A;  3OYC A;  2EA4 A;  3T0Y A;  1XGN A;  2LNB A;  1KU9 A;  3FXU A;  3ELK A;  4CO8 A;  4I6Z A;  5ILU A;  5KK1 A;  2E35 A;  3RPU A;  1MJB A;  2R92 J;  3VOE A;  2DA3 A;  1X2N A;  2V26 A;  2JA7 J;  4D0P A;  2LKX A;  2VLA A;  1XMA A;  3H3U A;  5AON A;  2QWW A;  4B44 A;  2DYR H;  1LPQ A;  2LBF B;  1KQ8 A;  1IDY A;  5JFR A;  1SEU A;  3LNQ A;  5ICG A;  1X4O A;  3CUO A;  2R7O A;  5CKT A;  2YR2 A;  2FA5 A;  4YEL A;  5F27 A;  4XK4 A;  2JTV A;  3OSF A;  2BZT A;  3B6C A;  4E7H A;  3CF5 F;  1ORK A;  1PUE E;  3FXJ A;  4LB6 B;  4P9F A;  4I2O A;  3D1N I;  4L9V A;  2D45 A;  3W6J B;  3V8K A;  3P9C A;  1BI3 A;  4DJA A;  2I10 A;  5JLW A;  2L02 A;  5K5R A;  3HB9 A;  5ICF A;  2VT2 A;  3DKX A;  4L9T A;  1D5V A;  1KU3 A;  3FXK A;  2ISY A;  2V1U A;  5K7H A;  3JAM K;  5FKN A;  1E3O C;  1BI1 A;  3MCZ A;  3ZN1 A;  4JP0 A;  3DPL C;  3N05 A;  2VXD A;  2OZ6 A;  1A35 A;  1BBY A;  4LIV A;  2DU9 A;  3CJQ B;  3I53 A;  2HXO A;  3PQJ A;  2M4K A;  3QU3 A;  2DBB A;  1UG0 A;  2OCC H;  1T6S A;  1JKR C;  5F1J A;  2EIL H;  3BTC A;  1V55 H;  2NS7 A;  3HIF A;  4RGR A;  4OMY A;  3U2R A;  4AD9 A;  1Z77 A;  1S7A A;  3FDY A;  2OD5 A;  1Z7L A;  3BG3 A;  3HBL A;  4XKC A;  3V8J A;  4B47 A;  5M5W J;  1FTT A;  1X58 A;  2XKO A;  4XQF A;  5LFA A;  2K9Q A;  2CUJ A;  5HS9 A;  3DEW A;  2EFW A;  1T2K A;  2E7W A;  4M3G A;  4H0E A;  4X6A J;  4BXU A;  3DP7 A;  3JRB A;  2RAE A;  3E6C C;  4G9Y A;  3A01 B;  4FET A;  4EAT A;  2WAQ A;  2HPM A;  1F36 A;  4GCV A;  4A12 A;  2LH9 A;  1GV2 A;  3K4L A;  2KQR A;  5J8C A;  3NWT A;  4F91 B;  2YSR A;  2P8T A;  3LQQ A;  4Y3O A;  5EEG A;  2VBZ A;  4PGH A;  4KN7 X;  2A5W A;  3JRA A;  4N0B A;  3CMA I;  1SAU A;  4Y17 A;  2R5Z A;  3HPG A;  2QUF A;  3H3V K;  3JRD A;  4BKX A;  4EJT A;  1J09 A;  3Q3S A;  3U1D A;  1VZ0 A;  1KYW A;  2XAF A;  4RAZ A;  4AIJ A;  5DUK A;  2M3A A;  4Q5S F;  3FWE A;  3CCJ I;  3KFW X;  1UB9 A;  1HOM A;  1J7K A;  1K61 A;  2HVS A;  1ODD A;  1U0J A;  2FML A;  2R93 J;  2DQL A;  1JUM A;  3RCO A;  5HLH A;  3LAP A;  3COA C;  1EH8 A;  1Z9C A;  5J8F A;  2BHZ A;  1IAW A;  1N75 A;  3R0A A;  4KMF A;  5ED4 A;  3WE2 A;  3OOP A;  3C2H A;  3L2W A;  2VBY A;  2JK3 A;  3OIO A;  1GXP A;  1HC8 A;  2ZXJ A;  4O5V A;  3JSP A;  3ROU A;  3DTK A;  1IRZ A;  5BPD A;  3OOU A;  4LG3 A;  1QPI A;  1IV8 A;  1OCO H;  1YG2 A;  4ASN A;  2B0L A;  5B5E C;  2HS5 A;  2X9D A;  5M3F J;  3OYK A;  3I55 I;  3K1N A;  2V4J C;  3GF2 A;  1CGP A;  5EGO A;  4BXX J;  2Q2E B;  2EA2 A;  2DO7 A;  2NVT J;  4RM2 A;  1XB4 A;  2KIU A;  1XSD A;  2CW8 A;  4GDF A;  2R7R A;  3DBH B;  1TQM A;  5E17 F;  5HLI A;  3DCF A;  2VJ4 A;  1XSV A;  4DYQ A;  1AOY A;  2W7N A;  1B1B A;  3MZY A;  4JYK A;  3PNT A;  1MMG A;  4PJL A;  4HDV A;  2P5V A;  1YIJ I;  2BW3 B;  2X1C A;  1DU6 A;  2PJR B;  5CLS A;  4M3D A;  4BS9 A;  3WU1 B;  5EZH A;  1F43 A;  5LRR A;  5A2Q K;  2GIZ A;  4HX4 A;  1QNT A;  4RMN A;  2E19 A;  2HNH A;  4UVA A;  1HQC A;  4MQV A;  4G7Z F;  4AYB A;  1W36 D;  3JW4 A;  1AKH A;  4K2E A;  3SEZ A;  1JHF A;  2KJC A;  2UZK A;  1RNL A;  1SD6 A;  3HDD A;  1GT0 C;  3OYA A;  3TBI A;  2L7M P;  1SFO J;  3L09 A;  4M6V A;  4PDK A;  4IRI A;  4BEH B;  4XL9 A;  3L2U A;  2FXA A;  4CDG A;  5F08 A;  3CCV I;  3GUD A;  2IGM A;  3PJR A;  2RQQ A;  2ZJR F;  3ZCO A;  2F2E A;  2IVM A;  2ZNZ A;  1HW5 A;  4IVN A;  5ERI A;  4B09 A;  2JQ7 A;  3B73 A;  1ACI A;  1O3Q A;  1TT5 B;  2DW4 A;  4XLE A;  3CP2 A;  1R36 A;  3OL3 A;  2E1N A;  5IT9 K;  1MDM A;  3JTH A;  4BBS J;  2MBF A;  2O6G E;  4P1W A;  1YLF A;  4MGR A;  3I71 A;  1N78 A;  1X1P A;  1YJN I;  5CVJ A;  1C0W A;  2RNJ A;  2ELH A;  3HHG A;  4UUV A;  4DW6 A;  4NC8 A;  4MTD A;  3RPQ A;  1FZP B;  2PLY A;  2ZCW A;  4RAF A;  3MKZ A;  5M5Y J;  3GTL J;  4KIB A;  3TDU C;  5DCF A;  3ZQG A;  1U9O A;  4EEF G;  3HHH A;  3LSK A;  4P5O A;  4HG2 A;  5GPC A;  2NNY A;  1HA8 A;  4QPQ A;  2M9H A;  1IGN A;  9ANT A;  4YII A;  1FBQ A;  2QM3 A;  1D5Y A;  2X1E A;  2YX7 A;  1TBX A;  3SFZ A;  2M87 A;  1H8A C;  1SD4 A;  2K9S A;  1W1W E;  3TL4 X;  5E3O A;  1K79 A;  3HKZ A;  1XSX A;  3LOC A;  4FT8 A;  5B3S H;  1QA6 A;  2HKX A;  2MH9 A;  2EQR A;  3RKY A;  5B1B H;  3HRU A;  4XIC A;  2VUM J;  4ZZL A;  3QPH A;  2BEO A;  2P6S A;  3SDB A;  2Y0S A;  3K4J A;  1V54 H;  5FKL A;  4F93 B;  3I4M J;  2QKM B;  5JLX A;  1VTN C;  5F64 A;  4AM3 A;  3L2R A;  4ESJ A;  4CZC A;  2YU9 J;  3FMS A;  4A3M J;  4C2T A;  4O6J A;  2VI6 A;  3DV8 A;  4AVP A;  1DP7 P;  4LGW A;  1IN5 A;  4Y4R A;  1F5T A;  1MMA A;  3M8F A;  2Z2S B;  1WPK A;  3OIQ A;  1R22 A;  2GM4 A;  2VKV A;  1QBJ A;  2DDB A;  3H1C A;  1IN6 A;  2DFE A;  3HGY A;  5HDG A;  3CUQ A;  1FP1 D;  2W24 A;  4BQQ A;  2QEX I;  4U7D A;  2G9W A;  4BL0 B;  2V6C A;  4B1R A;  1E3P A;  1WGX A;  4HF2 A;  3FXL A;  1R1U A;  5E79 C;  5KAI C;  2QSG X;  1G2H A;  4A3I J;  3OYD A;  3W6K B;  3QWL A;  3BZC A;  3OS2 A;  1ZG3 A;  2X51 A;  1FOY A;  3W6V A;  2GXG A;  4PJM A;  4QSH A;  4RA2 A;  3AG4 H;  4A93 J;  3F8F A;  1A6I A;  4NB5 A;  2O7O A;  1QRY A;  2XAJ A;  5DM7 F;  3TO6 A;  2DTZ A;  3K4B A;  2EWN A;  2L2O A;  3G1L A;  2NVQ J;  5IYB J;  2XF7 A;  2IJL A;  4X0G A;  1BIB A;  1V3F A;  2P5L C;  1ETW A;  2QSF X;  3C1D A;  4RS8 A;  5D5W B;  1EH6 A;  1RPW A;  3TDZ C;  3GFI A;  3FXO A;  3DTE A;  4ENM A;  2IS1 A;  1E17 A;  3M4O J;  1XN7 A;  5FD5 A;  5HNF A;  5K5Q A;  3KYC B;  3N97 A;  2CG4 A;  3RKQ A;  2GOM A;  1IJW C;  1ZYR F;  1T08 B;  3E1S A;  3F72 A;  3FKJ A;  2V9V A;  3KX2 A;  4ANJ A;  3O6B B;  2F6C A;  3HL2 A;  2QBY A;  3JRF A;  1FLI A;  3BP8 A;  1UEL B;  4OMZ A;  3S17 J;  2FX0 A;  3LST A;  2COB A;  1T8I A;  2HU9 A;  2NS8 A;  4MNU A;  2XKP A;  1Y8Q B;  3BTL A;  3OYH A;  4G12 A;  4BYY A;  2FSW A;  3ECO A;  5AIQ A;  4F3Q A;  2JVG A;  3BWG A;  4FCY A;  2LP0 A;  1STZ A;  1N77 A;  4HOB A;  2STT A;  1OR7 A;  2IGK A;  3W3C A;  1XTA A;  2H1K A;  2K9L A;  3ONQ A;  4IXA A;  1IRX A;  2ZFU A;  1GDT A;  3WTS C;  3A02 A;  4HW0 A;  4PUS A;  2J5O A;  3E5X A;  3HPH A;  5F0H A;  3RQI A;  4BHP A;  5DM6 F;  2HTJ A;  3KLN A;  5LEK A;  4A0Z A;  4EJW A;  3CCE I;  5ICC A;  4G94 A;  1W7P D;  2L9S A;  2PFB A;  3PUB A;  1YX3 A;  5FD6 A;  1YTY A;  3RYR A;  4C2M J;  2XPW A;  2L5Q A;  5KHD A;  2DJN A;  2CQ7 A;  1J59 A;  1OYY A;  2M0C A;  3TMO A;  5FFZ A;  5IOY A;  4EV0 A;  5JI6 A;  2L7K A;  1RI7 A;  2OPT A;  4B3A A;  2EV0 A;  2FE3 A;  3S15 J;  2R5Y A;  1RKW A;  4AUX A;  2WY8 Q;  3SEQ A;  2VKD A;  4XRM A;  2CUE A;  1XCV A;  3K4M A;  4Y33 A;  2KRF A;  5D5V B;  2R7V A;  3G1M A;  5BPI A;  4GO1 A;  2ZXI A;  5IYC J;  3AG2 H;  1IZ1 A;  2X6W A;  1HCR A;  4XLN F;  4CA0 A;  1MMN A;  2WV0 A;  3JRE A;  4R8H A;  3Q0V A;  1LFP A;  1JT0 A;  2KLO A;  2HDC A;  2QKL B;  4O3M A;  3TO7 A;  1LVK A;  1DP3 A;  1O7F A;  1WH5 A;  3BZ6 A;  4HQE A;  2EH3 A;  5GP9 A;  3HOX J;  2JRM A;  2XB5 A;  1W0U A;  4MHG A;  4XSX F;  3ULQ B;  2E34 A;  5JR3 A;  1BL0 A;  1FSE A;  3DKW A;  2IGN A;  1SVM A;  2ZNY A;  2X48 A;  2EZH A;  2FNA A;  3ML6 A;  2XGD A;  2VQH A;  1X2M A;  1IDZ A;  3KIO A;  3DKY A;  2OZU A;  3CCQ I;  4FQG A;  2HOT A;  1BOA A;  1D0X A;  2PQ8 A;  4ETS A;  4E6K G;  2LKS A;  2YU3 A;  2Z33 A;  5FB2 A;  1YRN A;  2FOW A;  3IKT A;  2XAH A;  1U6G A;  1VQ8 I; 
#chains in the Genus database with same CATH homology
 3RKX A;  4A2U A;  2MD5 A;  4HA8 A;  3D0S A;  1TW2 A;  2F5C A;  2ZKZ A;  2R7F A;  4EM0 B;  3EYI A;  5L3B A;  2IPQ X;  1I6X A;  2QLZ A;  3RI4 A;  4M72 A;  2EB7 A;  2L4A A;  3FMR A;  2QQA A;  3HOT A;  2XIG A;  1QO0 D;  1KQ9 A;  1R5G A;  3EET A;  2WTE A;  4G7O F;  2LDU A;  4Q47 A;  4N9I A;  4IF4 A;  1YYV A;  2BGC A;  5LHI A;  2K02 A;  1MZB A;  5D8K B;  1SFX A;  2H94 A;  1L0O C;  3T5X A;  1IRF A;  1TLH B;  3J81 Z;  4LLG F;  5TRD A;  3WTZ A;  5DYM A;  3CUQ C;  2PEX A;  3WTY C;  3TKY A;  2GA2 A;  2DT5 A;  2RVC A;  3NRV A;  4WX9 A;  3MWM A;  5LLQ A;  2COM A;  3KP3 A;  3GYH X;  1BJA A;  2MLK A;  4LLL A;  2ZFW A;  1U8R A;  2Y75 A;  2RQP A;  2IT0 A;  4Y15 A;  3IWZ A;  2ACJ A;  5DUI A;  2XAG A;  1TNT A;  5BOX A;  1D3Y A;  2Z5U A;  1S6L A;  1U2W A;  2XHK A;  1SFU A;  2CSO A;  5D6E A;  5F6F A;  3HSE A;  3C7J A;  3BPX A;  1B9M A;  3V7S A;  1P92 A;  1YW7 A;  4EM2 A;  3F22 A;  4WF2 A;  1I27 A;  2IRF G;  1K6O A;  1HKQ A;  1USS A;  3KP4 A;  4AIK A;  3KZY A;  4IRH A;  1LEA A;  3FZV A;  4OIP F;  5JHU A;  1GVJ A;  4CYD A;  3CO6 C;  5LGN A;  4WCG A;  2VON A;  4UVC A;  3KET A;  4EVI A;  5DCM A;  5HOO A;  5LHH A;  3P9K A;  3BJA A;  4KUM A;  2FNP A;  4LK0 F;  1SD5 A;  2A69 F;  4HBL A;  4M9X A;  5CVV A;  3G3Z A;  2LF8 A;  3R4K A;  1IRG A;  2Y48 A;  4L5J A;  5K5O A;  4ESB A;  4PGG A;  5KVR A;  1B4A A;  3RJP A;  4OIN F;  3HUG A;  2GQQ A;  4OOI A;  2O03 A;  4ZYD A;  1Z91 A;  4GYI A;  2D1V A;  4HDU A;  4ZYG A;  1HSJ A;  2WWY A;  4L9N A;  1XD7 A;  2HYF A;  2Q8K A;  3K2Z A;  1KGS A;  1B59 A;  2O61 A;  4I98 B;  2P5K A;  2OAZ A;  4U7B A;  3EQL F;  5L3G A;  3WTU C;  5HLG A;  5FO5 A;  1IN7 A;  2CQK A;  3I5U A;  2H6C A;  4NHJ A;  2HOE A;  1WSU A;  4CHU A;  5FLX Z;  3KZZ A;  4R79 A;  4IPA A;  1HKS A;  4YFN F;  1EH7 A;  2UXX A;  1GXQ A;  4RGU A;  1ZG5 A;  3HTS B;  2GAU A;  4CZZ A;  5FFX A;  4XSZ F;  1ZRC A;  3M8E A;  2A61 A;  1H0M A;  2UWM A;  2W85 A;  2JRT A;  3GXO A;  2HQR A;  2EJR A;  3P9I A;  2AS5 F;  1FYM A;  1F9N A;  3GVA A;  2CWE A;  4HX7 A;  1D8J A;  2R7D A;  4L0Z B;  1T0F A;  4IHS A;  3RIR A;  1ZG1 A;  4RB3 C;  2EFN A;  3E97 A;  4KYW A;  2TDX A;  3ZMD A;  4WXH A;  1REP C;  1YS6 A;  3L2C A;  3F21 A;  4I02 A;  2UXN A;  1Z6R A;  1WKM A;  1K78 B;  1S29 A;  4UVB A;  5BQT A;  3B02 A;  2JPC A;  4F7Z A;  3WTT C;  2JT1 A;  3ABU A;  3E5Q A;  2EFO A;  5HVQ C;  2ZJ2 A;  1H9T A;  4KT5 C;  2C6Y A;  5HS7 A;  5CYV A;  4EJO A;  2V1X A;  2L3D A;  4LJZ F;  4RB2 C;  3CUQ B;  2H6B A;  4TV7 A;  3JTG A;  3BJ6 A;  3V4G A;  1A04 A;  1O3R A;  5JVT A;  3FM5 A;  4HZF A;  4BAY A;  4EGZ A;  2HQN A;  1XGS A;  3TO9 A;  3L00 A;  2D1H A;  2VXZ A;  2VT3 A;  2NS0 A;  3D5L A;  2P7V B;  1ZRF A;  3I59 B;  1G3T A;  3Q9V A;  1U78 A;  4RB0 A;  4G8X A;  2DK5 A;  1KU2 A;  2M45 A;  2A07 F;  2DAO A;  2W57 A;  3GZ6 A;  1BIA A;  3OV8 A;  4RGS A;  2HKO A;  2K7L A;  3BDD A;  4G7H F;  3KLO A;  3QU6 A;  3LA7 A;  2QBY B;  6PAX A;  2PMU A;  3KP7 A;  3PQK A;  1ZLK A;  1TTY A;  1UHM A;  4L18 B;  1I5Z A;  3FXQ A;  4EMS A;  2F5D A;  2QVO A;  4M9S A;  4QLC U;  4YG2 F;  2FMY A;  2DI3 A;  1QPM A;  4ZYH A;  1PP7 U;  2PMH A;  1OMI A;  3EDP A;  1ZH5 A;  4Z2Y A;  3EYY A;  3R60 A;  4XLP F;  3DF8 A;  2K4J A;  4OIO F;  2EFQ A;  3F3X A;  2XAQ A;  2HWV A;  1CF7 A;  4KMU X;  2ZME B;  3J80 Z;  2XGX A;  3SZP A;  1ZAO A;  3I58 A;  1R23 A;  1LQ1 A;  1G6N A;  5ILS A;  2A5Y B;  2HYG D;  2LF7 A;  2ZO4 A;  1H9G A;  1S3J A;  4MEY F;  2L54 A;  3ZMS A;  2V79 A;  3TGN A;  4A6D A;  4HV6 A;  4EGY A;  2Q2E A;  3LQR A;  1HW2 A;  1BM9 A;  1P4W A;  4JBA A;  3MFK A;  3DEU A;  3WGI A;  3GZ5 A;  5LRS A;  1WRJ A;  3L9F A;  1MJA A;  5DDG A;  2RDP A;  3R61 A;  3LWF A;  3HRM A;  3F8M A;  1LNW A;  4YIF A;  2DPD A;  5E8I A;  4KFC A;  3I4P A;  5D5X B;  2BE5 F;  3K1M A;  1YW8 A;  4ESF A;  4IHT A;  1TQI A;  3E6D A;  3O3K A;  5BS6 A;  2G7H A;  4ENK A;  2VBW A;  5DEQ A;  1FT9 A;  2GA1 A;  3AAF A;  3U9G A;  4KIC A;  3RDI A;  1BI2 A;  2OQG A;  2Z3Y A;  5LGU A;  4HQM A;  4DNC A;  3FXR A;  3QRF F;  1T38 A;  4WK8 F;  1G3Y A;  2WC2 A;  3GFJ A;  2IA1 A;  1HST A;  3K0L A;  2D2W A;  2RC4 A;  3KEQ A;  2XVC A;  3FF5 A;  1GHC A;  1Z7U A;  3MQ0 A;  1YO5 C;  4GGG A;  3JAM Z;  3NEU A;  2BYV E;  1Z1D A;  2H09 A;  2YPR A;  2VOP A;  3VOD A;  2PJP A;  2O8X A;  1KA8 A;  3E6B A;  4IJA A;  4LD5 A;  1XGM A;  2LSO A;  1FBU A;  2HGC A;  1UST A;  1SD7 A;  2VE8 A;  1QQI A;  1BN5 A;  2JPB A;  1IF1 A;  2EK5 A;  4S04 A;  3F6V A;  1S7O A;  4U0W A;  2XRN A;  4RAY A;  3WTX C;  3DFG A;  1Z05 A;  5D5U B;  2HR3 A;  4LK1 F;  1PP8 F;  1PDN C;  1ZHF A;  1Q1H A;  2STW A;  2OBP A;  2IA0 A;  4IRG A;  5LGT A;  2FBI A;  5FGM A;  3FX3 A;  3GO5 A;  5CVR A;  5LBQ A;  5TJJ A;  5HS8 A;  3V8L A;  2K4B A;  4BNC A;  1O7L A;  1R00 A;  2DQR A;  4MEX F;  1DPU A;  1P4X A;  3DQV C;  3ZP5 A;  4KIG A;  1R1V A;  3VB2 A;  1JXS A;  2HZT A;  2MLG A;  4AIH A;  1IN4 A;  2CYY A;  2VC0 A;  3WGH A;  3IL2 A;  1FOK A;  1IW7 F;  1J9I A;  2VOO A;  5LHG A;  3C3W A;  3E6M A;  3MAJ A;  3GX4 X;  4PCQ A;  3HRT A;  1JHH A;  1HXD A;  2W84 A;  4E70 A;  4A6E A;  1G3W A;  3V7C A;  1XDS A;  2P7C B;  4KDP A;  3KP6 A;  3F23 A;  1ONV A;  3CJN A;  2FEZ A;  4HV5 A;  4LLN A;  1FPQ A;  2V1D A;  2BBY A;  1QZY A;  4EJV A;  2GZW A;  2QQ9 A;  3T1B A;  5IT9 Z;  2FF4 A;  2OU2 A;  1G3S A;  4UHT A;  3T8T A;  3SHF A;  1O57 A;  3R0J A;  2Y0M A;  1B6A A;  1IXS B;  3TQN A;  1HBX G;  2NAZ A;  1LVA A;  2ISZ A;  1K7A A;  1UFM A;  2M30 A;  4CXF A;  2P6T A;  2A6H F;  1RIO H;  4RB1 A;  3KEO A;  1ULY A;  2P4W A;  3LA2 A;  4G6D A;  1ZLJ A;  4HYE A;  2QQB A;  4LG0 A;  4A5N A;  1J0R A;  4M74 A;  2DPU A;  2ZBK A;  3IHU A;  1WI9 A;  2A68 F;  3LA3 A;  5L3C A;  3JSO A;  1ZRE A;  4BH9 A;  1FNN A;  2X0L A;  2KKO A;  3BY6 A;  4M9Z A;  2K86 A;  3ERE D;  3F8B A;  1U5T A;  2HTS A;  4R1H A;  3GWZ A;  4NQW A;  1IXC A;  2DK8 A;  4DQ2 A;  4MTE A;  2CFX A;  1NHA A;  1F1Z A;  2M5W A;  4L9J A;  4YFX F;  5E1Z B;  4N9H A;  4ON0 A;  3LFK A;  5CVI A;  3V7R A;  3DPT A;  1YW9 A;  2VOD A;  1MDM B;  3NQO A;  5D4R A;  4HLX A;  1ZGJ A;  2X4H A;  4U0Y A;  1AWC A;  2H27 A;  4QWQ A;  4XRF A;  5AIP A;  3MEX A;  1E2X A;  1R1T A;  4WXD A;  2XRO A;  1OYW A;  4LFU A;  1LDJ A;  1W7P A;  1YFH A;  2W25 A;  2VBX A;  1SMT A;  3KCC A;  3ZQ7 A;  2FBK A;  4P96 A;  4UNO A;  1U3E M;  2MA3 A;  5DD8 A;  2KJB A;  3RTR A;  3P7N A;  4ZH4 F;  4G6Q A;  2FU4 A;  3MZH A;  1JGS A;  1ZGA A;  2A6E F;  3M1E A;  1BC8 C;  1X3U A;  3DXJ F;  1CF7 B;  1TW3 A;  2ESN A;  1R7J A;  2GWR A;  3HSF A;  1TNS A;  3G73 A;  2NRA C;  2DTR A;  3CLO A;  1ON1 A;  5H6R A;  2PBI A;  3HYI A;  4ZZD A;  1XCB A;  3IWF A;  2OQR A;  1W5T A;  2A3S A;  5E1X A;  2E1C A;  1P6R A;  5ICE A;  3ZPL A;  4AWX B;  3F8N A;  3GEZ A;  3TDZ C;  4LB5 A;  4M73 A;  1OKR A;  3J81 K;  1IUY A;  2FRH A;  1FP2 A;  3KE2 A;  3O2P E;  1TQP A;  1ZN2 A;  3ZMT A;  2VE9 A;  4LMY A;  4EM1 A;  4XBF A;  5E8G A;  3WGG A;  1Y0U A;  3HOS A;  3EUH A;  2ETH A;  4ENN A;  1HW1 A;  1FWZ A;  1FBS A;  4CIC A;  1LJ9 A;  5ILV A;  1HKT A;  3I64 A;  4M6X A;  2ADU A;  4FX4 A;  1B9N A;  3IC7 A;  4I0B A;  5H20 A;  1XDU A;  2F5E A;  2EFP A;  2RN7 A;  4HX8 A;  4B8X A;  3Q5F A;  3QP5 A;  4FX0 A;  3HTU A;  3REO A;  3TOB A;  2CW0 F;  3GLX A;  1LDK B;  3FMQ A;  4A5M A;  1O3T A;  4UV9 A;  2E7X A;  3H3Z A;  4UV8 A;  1I1S A;  1QGP A;  2FOK A;  1P4A A;  4ENJ A;  2IW5 A;  2CO5 A;  3FHZ A;  1T39 A;  1U5T C;  3BPV A;  3TOA A;  1V4R A;  2XV4 S;  2CGP A;  4EJU A;  1FX7 A;  2KIF A;  1W4M A;  1K78 A;  1DUX C;  4EQQ A;  3I54 A;  3WG9 A;  2ESH A;  3IRQ A;  3SXY A;  2GXB A;  2K27 A;  2OA4 A;  1ON2 A;  3QOP A;  2L01 A;  1IN8 A;  3ISP A;  4MQ9 F;  3CO7 C;  1KYZ A;  4A0X A;  2PG4 A;  2EV6 A;  5E20 A;  3Q9S A;  1KU7 A;  4M6Y A;  5L3E A;  2VN2 A;  4U0V A;  2R3S A;  4I7H A;  4YFK F;  1OYI A;  1J75 A;  2G7U A;  1MKM A;  3LAJ A;  3K69 A;  4WWC A;  2Q0O A;  2XAS A;  2IA2 A;  4I0A A;  2PN6 A;  3QAH A;  1OPC A;  4RGX A;  5FLX K;  3M7G A;  4OIQ F;  3E5U A;  3I59 A;  4I01 A;  5D6F A;  4KA4 A;  2RV8 A;  3GFM A;  4OU0 A;  5E18 F;  2DLL A;  3K9T A;  3M9A A;  2J5P A;  2O0Y A;  1WQ2 A;  2MC3 A;  4HF1 A;  3SZT A;  4Q4Z F;  3IKV A;  3PFI A;  5DV5 A;  2QEN A;  1O3S A;  4HLY A;  1LDD A;  5F1R A;  3ZMZ A;  4FHT A;  3WTW C;  3E3V A;  2JZY A;  1YS7 A;  1RUO A;  3CDH A;  3N4M A;  3FM3 A;  3S2W A;  1YIO A;  1L3L A;  1RZ4 A;  4KN4 X;  4WXC A;  3GFL A;  4M71 A;  4BHC A;  3KP2 A;  3F6O A;  5J6X A;  1EV7 A;  5LEJ A;  3T8R A;  5D4S A;  2KIM A;  5L3D A;  4JK1 X;  1Z6T A;  1SAX A;  3QPT A;  5HDK A;  3WU0 A;  2RGV A;  3H92 A;  2ZME A;  4HF0 A;  1BI0 A;  4U88 A;  2O3F A;  3L7W A;  2HEO A;  3HRS A;  1T98 A;  1SFE A;  2M1B A;  5L3F A;  3CTA A;  1D8K A;  1BC7 C;  1W5S A;  2F5F A;  3WTV C;  4BHB A;  5DCM B;  2MH2 A;  3C18 A;  3F8C A;  2XUB A;  1R5H A;  1ZRD A;  3ZN0 A;  5E1W A;  1UCR A;  4BQA A;  1SMY F;  1WWX A;  2DFI A;  4CGZ A;  2EV5 A;  4KNY A;  1ZAR A;  2JSC A;  1MGT A;  3SQN A;  1G4D A;  3ABT A;  1FC3 A;  1FY7 A;  3HSR A;  2BV6 A;  4LG0 B;  5CVU A;  4UXN A;  1DPR A;  4HAM A;  3RKW A;  2VC1 A;  4Y13 A;  5D8L B;  5HDN A;  2Z9O A;  1J5Y A;  4GYG A;  1F4K A;  5DD4 A;  1XMK A;  1U5T B;  3I0T A;  3R6S A;  1R58 A;  1P2F A;  2LKP A;  1IXR C;  3VFZ A;  3KP5 A;  5A2Q Z;  3RYP A;  1FYK A;  4P55 A;  3J7A O;  2L4M A;  1DDN A;  3ZMU A;  1MD0 A;  5CJ9 A;  2NYX A;  2NNN A;  2HFH A;  3BRO A;  2Z99 A;  4OIR F;  3J80 K;  3WE3 A;  3BOQ A;  2IP2 A;  5IT3 A;  3IRR A;  1KQ0 A;  1J2X A;  4P9U A;  1LB2 A;  3QP6 A;  2YX4 A;  1RUN A;  2M8E A;  3BJO A;  5H6Q A;  4A0Y A;  2QZ8 A;  4Q48 A;  1JE8 A;  1YQA A;  4I09 A;  4KIF A;  1FSH A;  1UHW A;  4JQF A;  3WOD F;  2RKH A;  1W7P B;  3GW2 A;  2PI0 A;  1FYL A;  3ZMV A;  3VEP A;  4L0Y B;  3ECH A;  5EEH A;  4L5I A;  2GIV A;  1I1G A;  1LEB A;  4S05 A;  1QZZ A;  1XGO A;  4GXO A;  2QYO A;  5K1Y A;  2AXL A;  4ZYE A;  3K1P A;  2FQ3 A;  1S8N A;  5BMZ A;  2FBH A;  4PZJ A;  2EA4 A;  3T0Y A;  1XGN A;  2LNB A;  1KU9 A;  3FXU A;  3ELK A;  4CO8 A;  5ILU A;  5KK1 A;  3RPU A;  1MJB A;  3VOE A;  4D0P A;  1XMA A;  3H3U A;  5AON A;  2QWW A;  1KQ8 A;  5JFR A;  5ICG A;  3CUO A;  2YR2 A;  2FA5 A;  2JTV A;  1PUE E;  4LB6 B;  4P9F A;  4I2O A;  4L9V A;  2D45 A;  3W6J B;  3V8K A;  3P9C A;  1BI3 A;  2L02 A;  5K5R A;  5ICF A;  2VT2 A;  4L9T A;  1D5V A;  1KU3 A;  2ISY A;  2V1U A;  3JAM K;  1BI1 A;  3MCZ A;  3ZN1 A;  3DPL C;  2OZ6 A;  1BBY A;  2DU9 A;  3I53 A;  3PQJ A;  3QU3 A;  2DBB A;  1T6S A;  3HIF A;  4RGR A;  4OMY A;  3U2R A;  4AD9 A;  1S7A A;  2OD5 A;  3V8J A;  2XKO A;  5HS9 A;  2EFW A;  1T2K A;  2E7W A;  4H0E A;  4BXU A;  3DP7 A;  3E6C C;  4G9Y A;  4GCV A;  4A12 A;  5J8C A;  2YSR A;  2P8T A;  3LQQ A;  5EEG A;  2VBZ A;  4PGH A;  4KN7 X;  4N0B A;  4Y17 A;  2QUF A;  4EJT A;  3U1D A;  1KYW A;  2XAF A;  4RAZ A;  4AIJ A;  5DUK A;  4Q5S F;  3FWE A;  3KFW X;  1UB9 A;  1J7K A;  1ODD A;  2FML A;  2DQL A;  5HLH A;  3LAP A;  3COA C;  1EH8 A;  1Z9C A;  5J8F A;  1IAW A;  3R0A A;  4KMF A;  5ED4 A;  3WE2 A;  3OOP A;  1GXP A;  2VBY A;  2ZXJ A;  4O5V A;  3JSP A;  3ROU A;  5BPD A;  1YG2 A;  4ASN A;  2B0L A;  2HS5 A;  3K1N A;  3GF2 A;  1CGP A;  2EA2 A;  2DO7 A;  1XB4 A;  2KIU A;  1XSD A;  1TQM A;  5E17 F;  5HLI A;  1XSV A;  1AOY A;  1B1B A;  3MZY A;  4HDV A;  2P5V A;  5CLS A;  3WU1 B;  5LRR A;  5A2Q K;  4HX4 A;  1QNT A;  4UVA A;  1HQC A;  4MQV A;  4G7Z F;  3JW4 A;  4K2E A;  1JHF A;  2KJC A;  2UZK A;  1RNL A;  1SD6 A;  3L09 A;  4PDK A;  4IRI A;  2FXA A;  4CDG A;  3GUD A;  2F2E A;  2IVM A;  2ZNZ A;  1HW5 A;  4IVN A;  5ERI A;  4B09 A;  3B73 A;  1O3Q A;  2DW4 A;  1R36 A;  2E1N A;  5IT9 K;  1MDM A;  3JTH A;  2MBF A;  2O6G E;  1YLF A;  4MGR A;  3I71 A;  5CVJ A;  1C0W A;  2RNJ A;  2ELH A;  3HHG A;  4UUV A;  4MTD A;  1FZP B;  3RPQ A;  2PLY A;  2ZCW A;  4KIB A;  3TDU C;  5DCF A;  3HHH A;  4P5O A;  2NNY A;  4YII A;  1FBQ A;  2QM3 A;  2YX7 A;  1TBX A;  3SFZ A;  2M87 A;  1SD4 A;  1K79 A;  1XSX A;  4FT8 A;  2HKX A;  2MH9 A;  3RKY A;  3HRU A;  4ZZL A;  3QPH A;  2BEO A;  2P6S A;  1VTN C;  5F64 A;  4ESJ A;  3FMS A;  4O6J A;  3DV8 A;  4AVP A;  1DP7 P;  4LGW A;  1IN5 A;  1F5T A;  3M8F A;  1R22 A;  1QBJ A;  1IN6 A;  5HDG A;  3CUQ A;  1FP1 D;  2W24 A;  4U7D A;  2G9W A;  2V6C A;  4HF2 A;  1R1U A;  3W6K B;  1ZG3 A;  2GXG A;  3F8F A;  4NB5 A;  2XAJ A;  3TO6 A;  2EWN A;  2IJL A;  1BIB A;  1V3F A;  2P5L C;  3C1D A;  4RS8 A;  5D5W B;  1EH6 A;  3GFI A;  4ENM A;  1E17 A;  1XN7 A;  5FD5 A;  5K5Q A;  3N97 A;  2CG4 A;  1ZYR F;  3F72 A;  2V9V A;  3O6B B;  2QBY A;  1FLI A;  3BP8 A;  4OMZ A;  3LST A;  4MNU A;  2XKP A;  4BYY A;  2FSW A;  3ECO A;  5AIQ A;  3BWG A;  1STZ A;  4HOB A;  2STT A;  1OR7 A;  4IXA A;  3WTS C;  4HW0 A;  2J5O A;  3E5X A;  4BHP A;  2HTJ A;  3KLN A;  5LEK A;  4A0Z A;  4EJW A;  5ICC A;  4G94 A;  1W7P D;  2PFB A;  5FD6 A;  1YTY A;  3RYR A;  1J59 A;  1OYY A;  5FFZ A;  4EV0 A;  5JI6 A;  1RI7 A;  2EV0 A;  2FE3 A;  1XCV A;  2KRF A;  5D5V B;  5BPI A;  4GO1 A;  1IZ1 A;  4XLN F;  2WV0 A;  4R8H A;  4O3M A;  2HDC A;  3TO7 A;  1O7F A;  3BZ6 A;  4HQE A;  4MHG A;  4XSX F;  3ULQ B;  5JR3 A;  1FSE A;  3DKW A;  2ZNY A;  2FNA A;  3ML6 A;  2OZU A;  1BOA A;  4ETS A;  2PQ8 A;  2YU3 A;  2Z33 A;  1U6G A;  5FB2 A;  3IKT A;  2XAH A;  1MJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...