2DU9A

Crystal structure of the transcriptional factor from c.glutamicum
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
116
structure length
116
Chain Sequence
VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGMFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of transcription factor CGL2947 from Corynebacterium glutamicum in two crystal forms: A novel homodimer assembling and the implication for effector-binding mode
pubmed doi rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Transcription
molecule keywords Predicted transcriptional regulators
total genus 39
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2du9A00
2C6YA 3BDDA 4K2EA 3P7NA 4GYGA 2ZJ2A 3PQJA 2FNPA 4B8XA 2PN6A 3ZMVA 3HHHA 4L5IA 4AD9A 2JZYA 3I54A 4JBAA 2L3DA 4HX8A 1XMAA 2M5WA 2K86A 1IZ1A 4ENNA 3OV8A 5CVVA 1BBYA 1SD7A 2NRAC 3GX4X 3GZ6A 3KP3A 2YPRA 2W24A 2XROA 1YTYA 2FMLA 4P55A 1YO5C 5ERIA 3T5XA 1ON1A 4OIRF 2ZXJA 3TKYA 1G3WA 5HLGA 4LFUA 1RI7A 4GXOA 2M87A 1O3QA 1P2FA 2KJCA 3GFMA 2OAZA 2D1HA 3FZVA 1ZLKA 2QWWA 3QPHA 1ZG5A 3VFZA 3F21A 2UZKA 4UVBA 4ASNA 4PZJA 1RZ4A 5LRRA 1U78A 5DD8A 1B9MA 3DXJF 1DPRA 1Z6RA 5BS6A 3BJ6A 1T2KA 3H3UA 4KYWA 4B09A 2E7WA 2HYGD 2V1DA 4RB2C 3R4KA 3GFJA 5JVTA 3P9IA 2OBPA 1SMTA 3MQ0A 2Z9OA 1YG2A 5E18F 4E70A 3REOA 1KQ8A 4IRHA 1WWXA 2RQPA 2CG4A 1Y0UA 3FM5A 3QAHA 2ZFWA 4WK8F 3WG9A 3JSOA 4ETSA 3DQVC 2OQRA 2DO7A 4ZYHA 1ZN2A 4Y17A 3E6BA 5FD5A 3GF2A 1IRGA 4EGYA 4TV7A 5K1YA 4RB3C 3BWGA 3F23A 4KIFA 1WI9A 2P5VA 1QNTA 1ON2A 4CXFA 4A6EA 2M45A 4L5JA 4QWQA 3KP7A 1IN5A 2HOEA 2L01A 4UHTA 3QU3A 3T1BA 5FGMA 4OOIA 3M9AA 3WTZA 2XAJA 2RGVA 3CLOA 2QQ9A 2WWYA 3L9FA 4GO1A 5K5OA 3F6OA 1HKSA 1MJ9A 1IW7F 1W5SA 1ONVA 5HS9A 2HS5A 4CO8A 1K78A 1S8NA 2A6HF 2RC4A 5F1RA 3F72A 4FHTA 1FSEA 4HX4A 3GZ5A 2OZUA 3I59B 3T0YA 3R6SA 3W6KB 2GXBA 3E97A 1U3EM 4XSXF 4P9UA 4HF1A 2Q2EA 2F5CA 3Q9VA 1R1VA 1FSHA 3HTSB 3V8JA 4OMZA 4AIHA 3V8LA 4ESBA 1UB9A 2YX4A 1R00A 3E6DA 3HYIA 4FT8A 2ADUA 4MNUA 3WGIA 4Y13A 3CUQC 2PBIA 1P6RA 3ABTA 2A6EF 3L00A 2H09A 4HF2A 1ZGJA 4PGHA 3J81K 2KJBA 3RPUA 2FOKA 1TQPA 3Q9SA 1K6OA 3Q5FA 2RVCA 1YYVA 2EA4A 2P6SA 5LGUA 2STTA 3VODA 3RYRA 4LK0F 5LGTA 2ZNYA 1RNLA 4HQEA 1ZREA 5DD4A 3RDIA 4M71A 4BAYA 2BEOA 2DFIA 3FM3A 2AXLA 3DPTA 1HQCA 5HDGA 5IT9K 3KP6A 4A12A 2XAFA 4XRFA 4KT5C 4I09A 3JAMZ 2MC3A 3H92A 3DF8A 1CF7A 5FLXZ 2A3SA 4G8XA 4Q4ZF 2F5EA 5LHHA 3TDUC 4EGZA 2FXAA 2FBHA 2QQAA 2A69F 3WU1B 5L3GA 3E5UA 2P6TA 1S6LA 1QGPA 2KKOA 5A2QZ 4U88A 5H6QA 2BGCA 3P9KA 3JTGA 3SFZA 1OYIA 1KU3A 1HXDA 5HLHA 1XGOA 5LHIA 1USTA 2HTJA 4HA8A 1OPCA 2KIMA 2PI0A 4LG0B 2DK8A 4M73A 3RIRA 4ZH4F 1FNNA 3E6CC 3F6VA 1S7AA 5IT9Z 4UUVA 3OOPA 5AIQA 3JW4A 4A0XA 5FLXK 3T8RA 3CTAA 1UHWA 4CGZA 4KNYA 4UVAA 4M6YA 4AIKA 1CGPA 5E8IA 3SXYA 3I5UA 1O7FA 1MDMA 2IA1A 4EV0A 5EEGA 2VC0A 2PQ8A 1XGSA 3WTYC 1KU7A 4U7DA 4RGUA 3IWFA 4RB0A 1USSA 4S04A 2K27A 1MZBA 3BOQA 1QZZA 2G9WA 3I0TA 3ZN1A 2QVOA 2BYVE 2K4BA 1FC3A 1VTNC 4OIOF 2O0YA 3TO9A 4A5NA 2QM3A 1XCVA 3WU0A 3FMQA 3BROA 1FOKA 1OMIA 1IXSB 3DPLC 4G6QA 4I02A 1TTYA 5ICEA 5JFRA 4WWCA 1O3SA 1D5VA 2GA1A 5J8CA 3F8CA 2JSCA 2XKOA 2NYXA 1XN7A 1E2XA 4OIPF 3HRTA 2B0LA 2NNNA 1S7OA 1J2XA 4YFXF 1YQAA 5H20A 5F64A 4LB6B 3K1MA 2YX7A 4RB1A 2D2WA 1R58A 1XSXA 4EJTA 2CW0F 2XASA 1SFXA 2DQLA 4MEXF 1KQ9A 2OA4A 1R22A 4CYDA 3B02A 5BOXA 4RAYA 4HDVA 3C3WA 3RPQA 3MWMA 2NAZA 6PAXA 2RKHA 2MLKA 3ZQ7A 3KETA 2UXXA 1HKQA 2ESHA 3C1DA 3M7GA 2VOPA 1IXCA 1MGTA 5HS8A 1I1GA 3HSEA 2EV5A 1LDKB 1GVJA 4CDGA 4G7ZF 2F5FA 3HRSA 2PG4A 3W6JB 1ZRFA 2VOOA 1V3FA 2J5PA 2DQRA 5HLIA 2FU4A 5ICGA 2PMUA 1C0WA 3GWZA 1A04A 5ICFA 4A0ZA 3R0AA 4ZYDA 1QO0D 2O61A 1PUEE 4UXNA 3ROUA 2JRTA 1FP2A 1KA8A 2QQBA 4ESFA 2DI3A 1ZARA 1V4RA 3CO7C 1IN6A 1YW7A 3V7SA 3WTTC 2GWRA 3EQLF 3CUOA 4GCVA 2VBZA 3KP5A 1YW8A 5K5QA 1U5TB 3GW2A 1ZGAA 4OU0A 4P96A 4HLXA 2FF4A 3L2CA 2G7UA 5J6XA 4QLCU 2IPQX 4EVIA 3V8KA 4PCQA 4BQAA 2Y75A 2CSOA 3G3ZA 4R8HA 4BYYA 3DFGA 2Q8KA 1QZYA 5DUKA 3FHZA 1FBQA 2GQQA 4MGRA 3CUQA 4FX4A 2V6CA 1FYLA 2P7VB 2VE8A 4LD5A 3U2RA 4Q47A 4H0EA 2PMHA 2ZNZA 2GAUA 1P4AA 2EFWA 1W7PB 2O6GE 1J59A 5TJJA 1IN4A 4XLNF 5H6RA 5AIPA 3PFIA 1ZG1A 2MBFA 5EEHA 5D4RA 1UFMA 3BP8A 1LVAA 2HWVA 2HEOA 2KRFA 2PEXA 2K4JA 4MTEA 5ED4A 4M6XA 2JPCA 3V7CA 2OZ6A 5CJ9A 3E3VA 4CHUA 1T39A 3WE2A 5FB2A 1B1BA 1PP8F 3GUDA 4I98B 3I58A 1LQ1A 5D4SA 4HF0A 2RNJA 4RAZA 2A68F 2WV0A 1K78B 3P9CA 4BNCA 2FBKA 1MKMA 1T0FA 4BHBA 4LLGF 4LLNA 3VB2A 2QBYA 1R1TA 1TBXA 4KMFA 4HX7A 5D8LB 3QU6A 2D45A 1R23A 1DP7P 3EDPA 4ENJA 2FSWA 5E1XA 3CJNA 2MD5A 2LF7A 2VXZA 3LA2A 4YFKF 5ILUA 1Z91A 4LGWA 2OQGA 1XDSA 3B73A 4AWXB 4EJOA 2W57A 1QQIA 4I0AA 3WTXC 2ETHA 2HKOA 3M1EA 4KIBA 1YS6A 4M9ZA 5LRSA 2VT3A 4ZYEA 2GA2A 3N4MA 5D5UB 2GZWA 4RGRA 1J0RA 1LDJA 5D5VB 5E20A 2JTVA 3CDHA 2JPBA 2L4AA 1G6NA 2XVCA 1ZAOA 2EA2A 1WRJA 2A5YB 1KGSA 3ECHA 5A2QK 1F9NA 2CWEA 1YIOA 3RI4A 3I64A 3J80K 3I53A 2LDUA 5LEJA 2QLZA 3SZPA 3QPTA 2DW4A 3LFKA 1L0OC 3CO6C 3H3ZA 1NHAA 3FF5A 3GEZA 5LGNA 3IL2A 3U9GA 2VBYA 2HQNA 2TDXA 5DCMB 4XBFA 4KICA 1IAWA 3IHUA 1W5TA 1Z7UA 2P5KA 4M74A 2FA5A 5D5XB 4U0VA 2UWMA 4HV6A 1DPUA 2E7XA 3S2WA 3C7JA 4DNCA 2A07F 1D3YA 4YG2F 1LJ9A 5FFXA 3BPVA 1UHMA 5CVUA 3LWFA 4N9HA 1BJAA 4HOBA 4D0PA 3HTUA 1ZYRF 1R5GA 1T38A 1STZA 1FY7A 1SMYF 2O8XA 2D1VA 3ZN0A 4M9SA 5CVRA 1B59A 1OYWA 3HRMA 3L7WA 3ECOA 4MQVA 4MQ9F 2VBXA 5CLSA 3N97A 4BH9A 1H9TA 5ILSA 2VBWA 2MA3A 4I01A 5DCMA 2R7FA 3NEUA 1TW3A 4HBLA 2XUBA 4HZFA 3F22A 1XDUA 1HBXG 1GXPA 1IN7A 3F8MA 3ISPA 2ELHA 5CYVA 4BHCA 4AIJA 2FQ3A 2R3SA 5L3EA 5DYMA 2IP2A 5E17F 2VONA 1T98A 3K69A 4A5MA 4HDUA 3QOPA 3QP6A 3HOSA 3MEXA 3NQOA 2BBYA 4M72A 1H9GA 2L4MA 1JGSA 4MEYF 4EJUA 5BMZA 1JE8A 1ZRDA 3ULQB 5TRDA 5DEQA 1W7PD 1D8KA 3KZZA 1FP1D 2IRFG 1P4XA 5D6FA 4U0WA 3TO6A 3AAFA 4YFNF 1K7AA 4P5OA 1HW5A 1ULYA 2ACJA 5LHGA 3TOAA 4Q5SF 5IT3A 2PLYA 3FWEA 3WODF 4HAMA 3FXQA 2EFNA 5DCFA 5HDKA 5DDGA 1D8JA 1IF1A 2ISZA 2XAHA 3MZYA 3WTSC 1F5TA 3VOEA 1ZHFA 5JHUA 2NNYA 1XMKA 1XGMA 5L3BA 5FFZA 1ZLJA 4R79A 4L0YB 4L9JA 5ICCA 4PDKA 1TLHB 2MH9A 2WTEA 1S3JA 3LQQA 3WTUC 1XD7A 4O5VA 5E8GA 1IN8A 3DV8A 5D5WB 3ELKA 2L02A 2EK5A 3R60A 1KU9A 4UV8A 1G3SA 2FE3A 4RGXA 1SFUA 3GXOA 2YR2A 2ZCWA 1LEBA 3RTRA 1TQIA 2IA2A 4WF2A 2DTRA 3HSRA 1EH8A 1FPQA 2YSRA 3KP2A 4NB5A 1EH6A 5CVIA 2DPDA 1BC7C 3BJAA 4YIIA 3K1NA 2LSOA 2VC1A 1R5HA 5E1WA 1REPC 4FX0A 5DV5A 4U0YA 2W25A 3ZMSA 4NHJA 1U6GA 2HZTA 4EJWA 1I1SA 2EV0A 2FNAA 2H94A 1FBSA 3LA7A 2A61A 3WGGA 1HW2A 2LKPA 4RS8A 2IA0A 1PDNC 5BPDA 1BN5A 5K5RA 4KMUX 1G3TA 3I59A 3D5LA 3K9TA 4Q48A 2EFQA 4IXAA 4RGSA 1LEAA 5KVRA 1XCBA 2F2EA 2XRNA 3PQKA 3LAJA 4YIFA 3TDZC 4N0BA 1ZG3A 4Z2YA 2XGXA 4IHTA 1X3UA 4KA4A 3JTHA 3J80Z 4JK1X 5BQTA 4WCGA 3BPXA 3IWZA 4BXUA 1QPMA 2RV8A 1IUYA 3EUHA 1WKMA 5D6EA 4LG0A 4KIGA 3RKWA 2P8TA 1BOAA 2X0LA 4UV9A 3HRUA 4XLPF 3FXRA 4A2UA 2ZMEA 1FLIA 3ZPLA 3FMSA 3ZMTA 4L0ZB 4GYIA 2XAGA 2LNBA 3L09A 5DUIA 1HSTA 3KE2A 4U7BA 1TQMA 5HOOA 1IRFA 4MTDA 2HTSA 1H0MA 4HLYA 1LB2A 2CFXA 5BPIA 2H27A 3KEQA 4HV5A 5D8KB 2P4WA 1EV7A 3EYIA 2FEZA 2VODA 1R1UA 3I71A 1CF7B 4IF4A 1G3YA 4IRGA 5LBQA 1B6AA 1OR7A 3FX3A 2ISYA 2MH2A 1TNTA 2IW5A 5CVJA 1ODDA 4CZZA 1TNSA 4LLLA 2EV6A 4HW0A 1BI1A 5HDNA 4NQWA 4EM0B 1TW2A 3JSPA 2M30A 2AS5F 1FBUA 3RJPA 3WTWC 3M8EA 3CUQB 4PGGA 2VN2A 2BV6A 3MZHA 3ZMDA 4ENKA 2DT5A 2EB7A 4IRIA 1HKTA 1YFHA 2CYYA 3JAMK 2F5DA 4LB5A 4MHGA 1BI3A 2GIVA 1W4MA 2ESNA 4LJZF 3BY6A 1L3LA 2KIFA 2XHKA 1Z1DA 2W84A 4UNOA 1KQ0A 1LDDA 2G7HA 3V7RA 4S05A 1AWCA 2H6CA 3E5XA 1J9IA 3F8BA 3DKWA 1BIAA 1F1ZA 1QBJA 3HUGA 3COAC 5ILVA 2K02A 4L18B 3FXUA 3TOBA 3MCZA 3KFWX 3IC7A 2OU2A 2XIGA 3RYPA 1Z9CA 3KLNA 1O7LA 1RUNA 4IVNA 1XSVA 2QZ8A 1BI2A 1PP7U 4I0BA 2UXNA 3HSFA 1KYZA 2ZKZA 3M8FA 1FYKA 4ZYGA 1LNWA 1K79A 3U1DA 2FRHA 4ZZLA 1KYWA 4EQQA 3J7AO 4ENMA 3J81Z 1Z05A 3WGHA 3ML6A 2RDPA 1SD6A 4Y15A 2Z99A 2QUFA 2ZBKA 3KEOA 2W85A 1GXQA 3FMRA 4KUMA 3LAPA 2EWNA 1U8RA 4ZZDA 2VT2A 2KIUA 4HYEA 2WC2A 4DQ2A 3E6MA 2K7LA 3V4GA 1SD4A 2HQRA 4KN4X 4KDPA 1BI0A 2HKXA 4IJAA 2IJLA 3F3XA 3ZMUA 2M8EA 3TO7A 1HSJA 3TQNA 4CICA 3SZTA 1YS7A 5FD6A 5E1ZB 2O03A 2V1XA 1FT9A 2H6BA 1BIBA 3VEPA 5AONA 5L3CA 2Z3YA 1MDMB 3HHGA 1OYYA 2R7DA 4EJVA 1DDNA 3EETA 2NS0A 4WXHA 3MFKA 1UCRA 1FWZA 2P5LC 1FZPB 2YU3A 5JI6A 4G7HF 1JHFA 2QYOA 2ZMEB 1I6XA 1O3TA 2V9VA 1U5TA 3WTVC 3T8TA 1MD0A 4N9IA 3IKTA 3K1PA 1XB4A 1ZRCA 1J5YA 4P9FA 4OINF 4HQMA 4ESJA 2PJPA 2Q0OA 3K2ZA 5F6FA 1T6SA 5LLQA 1U5TC 3F8NA 4EM1A 4GGGA 1I27A 3ERED 3HOTA 3R0JA 2DPUA 4JQFA 2EFOA 3TGNA 1J75A 4O6JA 5KK1A 1JHHA 2P7CB 3GLXA 3IRQA 4G6DA 2RN7A 2QBYB 2EJRA 2XV4S 2JT1A 3GVAA 4G7OF 3LA3A 4KN7X 1P4WA 2FBIA 3E5QA 3QRFF 4UVCA 1SAXA 1F4KA 1RIOH 2X4HA 1Q1HA 1GHCA 2PFBA 3DP7A 4KFCA 2Y48A 1IXRC 1AOYA 3F8FA 4IPAA 1RUOA 1O3RA 3GFLA 4A6DA 3LQRA 5FO5A 3BJOA 4G9YA 2V79A 1B9NA 1DUXC 1OKRA 2STWA 3GYHX 1BM9A 1XGNA 1YLFA 3IRRA 1YW9A 2V1UA 2Z33A 3ABUA 2HFHA 1XSDA 3RKYA 4WXCA 3DEUA 2DLLA 2DBBA 3GO5A 3WE3A 5J8FA 2DK5A 4L9NA 1MJAA 4A0YA 1U2WA 4ON0A 2O3FA 4F7ZA 1ZH5A 2FMYA 2GXGA 1J7KA 3SQNA 3I4PA 4IHSA 2XKPA 3C18A 2J5OA 4M9XA 5JR3A 3R61A 5L3FA 4L9TA 5LEKA 1MJBA 2QENA 2DU9A 2Z5UA 4WX9A 3EYYA 4R1HA 4EMSA 2ZO4A 1FYMA 2M1BA 1BC8C 1SFEA 5L3DA 1SD5A 2E1CA 1EH7A 1FX7A 4L9VA 4BHPA 4I7HA 2XAQA 3HIFA 3QP5A 2BE5F 4XSZF 2Y0MA 2HDCA 2L54A 1S29A 5HS7A 3O3KA 2CGPA 4LMYA 1Z6TA 1O57A 3MAJA 3BZ6A 3KP4A 2MLGA 3KLOA 1R36A 1E17A 2DAOA 2VE9A 4WXDA 2CQKA 3O2PE 2HGCA 2EFPA 3GFIA 1G4DA 2IT0A 3G73A 4AVPA 3O6BB 3SHFA 1HW1A 3RKXA 2OD5A 2LF8A 1B4AA 4O3MA 2IVMA 4LK1F 4I2OA 3KZYA 1R7JA 2HYFA 2COMA 2E1NA 3D0SA 4OIQF 1W7PA 1P92A 5HVQC 1I5ZA 3ZP5A 4EM2A 2CO5A 1KU2A 2HR3A 1WQ2A 3KCCA 3K0LA 3IKVA 4G94A 1WSUA 4OMYA 3ZMZA 3NRVA 1JXSA 3LSTA
chains in the Genus database with same CATH superfamily
2C6YA 1S9HA 3BDDA 3WG7H 1A35A 4K2EA 2X6OA 3P7NA 4C2MJ 3J7YJ 2DODA 5HLTA 4GYGA 1VNDA 2ZJ2A 3PQJA 2FNPA 4B8XA 2PN6A 1MH4A 2L7FP 3ZMVA 3HHHA 4L5IA 1JKRC 5J1UA 4AD9A 2JZYA 3AG2H 4HSRA 3I54A 4JBAA 3LFUA 2V6EA 2L3DA 4HX8A 3VPRA 1HLVA 1XMAA 2M5WA 2VL8A 2PMZA 2K86A 2EZLA 2HVQA 1YRNB 1IZ1A 4ENNA 1LFBA 3OV8A 5CVVA 1APLC 1BBYA 1SD7A 2NRAC 3GX4X 3GZ6A 3M07A 3KP3A 2QF7A 3O8GA 1X19A 2YPRA 2W24A 2XROA 1YTYA 2FMLA 4P55A 1YO5C 2L9NA 2FD5A 5ERIA 3T5XA 1ON1A 3CCYA 4OIRF 2ZXJA 2WA0A 3DTIA 3TKYA 1G3WA 5HLGA 4LOCA 4LFUA 3CC2I 5LFAA 3IAM2 3IUOA 4IHYA 2DMTA 5JLXA 4EEFG 1H88C 1RI7A 4GXOA 2HVRA 2CQ7A 2M87A 5TGTA 4A3IJ 1O3QA 1P2FA 2K3PA 1W0UA 2KJCA 1E3OC 3GFMA 1AU7A 2OAZA 1NK3P 2D1HA 2VUMJ 3FZVA 1MMSA 1ZLKA 2IGMA 2QWWA 1T0FC 3QPHA 1ZG5A 4E7SA 1A31A 2QKLB 3VFZA 3F21A 2UZKA 4UVBA 1AHDP 4ASNA 4PZJA 1RZ4A 5LRRA 4JOMA 1U78A 5DD8A 1B9MA 1LKXA 1WJAA 2BHYA 3DXJF 1DPRA 1Z6RA 1VFCA 1TL8A 5BS6A 2TCTA 3S2HJ 3BJ6A 1T2KA 3W2AA 2R7QA 2PJRA 3H3UA 5B3SH 4KYWA 4B09A 2E7WA 1XG1A 3QPSA 2HYGD 2V1DA 4RB2C 1H8AC 3R4KA 3GFJA 3ZQQA 5JVTA 3HGGA 4KISA 5J4VA 2DDAA 1MIJA 4D5CA 2H1KA 1OR7C 3P9IA 5B1AH 2VKHA 2OBPA 3QOEA 1SMTA 3MQ0A 1LE8A 1HOMA 4BUPA 3MMYB 3GTKJ 2Z9OA 1YG2A 5E18F 2X6WA 4FE4A 4E70A 2W82A 3O8HA 2IS1A 3JCUC 3REOA 4IX7A 3HBLA 1KQ8A 2CMPA 4IRHA 1IC8A 4PFPA 5E3MA 1WWXA 2RQPA 4B43A 2CG4A 1Y0UA 3FM5A 3NWSA 3QAHA 3U21A 2ZFWA 2BVMA 4WK8F 2XPVA 3WG9A 1R5ID 3JSOA 4F52A 1OCRH 2F48A 4ETSA 3DQVC 5JLWA 4A3CJ 2OQRA 4XIDA 2DO7A 4ZYHA 1WZ2A 2KZGA 3OR2C 2YS9A 1ZN2A 4Y17A 3LSPA 3E6BA 5FD5A 2L7KA 3GF2A 4ZTFA 1IRGA 4EGYA 4TV7A 5K1YA 2P81A 2CFOA 3BWGA 4D7MA 4RB3C 3F23A 1BA5A 4B47A 2L0KA 4KIFA 1M1EB 3L2UA 3OYMA 1WI9A 2P5VA 1QNTA 4RM2A 1ON2A 4CXFA 2Y0SA 4A6EA 5FJ8J 2M45A 4L5JA 4QWQA 2NVYJ 3FXOA 3KP7A 2COBA 1IN5A 1E3HA 2PMZN 2HOEA 2L01A 4UHTA 4C2TA 3QU3A 3T1BA 2LC2A 1R4MB 3G1MA 2BW3A 5FGMA 4OOIA 3M9AA 3WTZA 3BR5A 2XAJA 2RGVA 3CLOA 2DYRH 2QQ9A 1WVRA 2WWYA 3L9FA 3W2VA 1IJWC 4GO1A 3SDBA 5K5OA 3F6OA 2Y2ZA 1HKSA 3L2WA 1MJ9A 3G2BA 5IP7J 1JKQC 1IW7F 1OQYA 1W5SA 2R7XA 1ONVA 5HS9A 2HS5A 4CO8A 1K78A 4QSHA 1S8NA 1ZR4A 1VQ9I 2A6HF 2GOXB 2VQGA 3A1YA 3ZOBA 3ABLH 2RC4A 5F1RA 3F72A 2JUGA 2F4IA 3OYCA 2EZKA 3ABMH 2LYCA 2A6TA 4FHTA 1FSEA 3OYHA 4HX4A 2XC7A 3GZ5A 1OLTA 2OZUA 3I59B 3LMMA 3HL2A 5KHDA 2EIJH 3T0YA 1GV5A 3R6SA 3W6KB 2GXBA 1FOXA 2DDBA 3E97A 2R7ZJ 1T95A 1U3EM 3S3NA 4XSXF 2VI6A 4P9UA 4HF1A 2Q2EA 2F5CA 3Q9VA 2VKEA 1R1VA 1DU0A 1FSHA 3PO3J 3HTSB 1A5JA 1IUFA 1D1AA 2LR8A 3V8JA 4OMZA 4AIHA 3V8LA 4ESBA 1UB9A 2K9NA 2YX4A 4F55A 1R00A 3JRHA 3E6DA 3HYIA 4FT8A 4B1RA 5GPCA 2ADUA 1RRJA 3ESWB 4MNUA 4ZDLA 3WGIA 1VQ4I 4Y13A 2DJIA 1X1DA 3GTJJ 3CUQC 2PBIA 3BZKA 1P6RA 2G0EA 3ABTA 4C3JJ 2A6EF 3L00A 1ZELA 2NOJB 2HPMA 1YI2I 3PSFA 4RAGA 2H09A 4HF2A 1ZGJA 4GRIA 1EKEA 2JN6A 4PGHA 4NDLA 3K7AJ 3J81K 2KJBA 3RPUA 2FOKA 3VYRB 1T8IA 3K10A 3DU6A 2EBIA 1TQPA 4XOPA 2BHZA 3Q9SA 1K6OA 2HZDA 5M5YJ 3Q5FA 2RVCA 1YYVA 2EA4A 2P6SA 4A3FJ 1WCMJ 5LGUA 1AKHA 2WV1A 1SFOJ 2STTA 3VODA 3A03A 2WAQA 3RYRA 3LSJA 3IH4A 4LK0F 1AA7A 3LSHA 3ZRGA 4PSXA 4G12A 2NOGA 3RKQA 2LBFA 5CKTA 1IG7A 3NWTA 5LGTA 1T08B 2ZSIB 2PJRB 2ZMEC 1RNLA 2ZNYA 4HQEA 4CCLA 1ZREA 3CMAI 3IH3A 3CESA 5DD4A 3RDIA 3DEWA 4XN3A 2M0CA 4M71A 4BAYA 2BEOA 2DFIA 2FX0A 3FM3A 2AXLA 3DPTA 2GBYA 1HQCA 1YJNI 5HDGA 5IT9K 3EUHC 3KP6A 4A12A 1FTZA 2XAFA 2XRLA 4MIMA 3FISA 4BQNA 4XRFA 4KT5C 4AU7A 2KQRA 4A3MJ 4I09A 3JAMZ 2MC3A 3H92A 3QYBA 3DF8A 1CF7A 2EIMH 5FLXZ 2A3SA 4G8XA 4Q4ZF 1RETA 2F5EA 2R7WA 1VQ8I 5LHHA 3TDUC 4EGZA 2FXAA 1MMGA 2FBHA 4BY1J 2QQAA 4CCJA 4HNTA 2KHMA 2A69F 1MNMC 3HDDA 2H1LA 2KDOA 4OAZA 2CV1A 3WU1B 2NXNB 1WJEA 5L3GA 3E5UA 3MKYB 3OSFA 2P6TA 1S6LA 1S5LC 2L9VA 1QGPA 2KKOA 3PSIA 2IS6A 3S2DJ 1Z77A 5A2QZ 4U88A 2MFZA 5H6QA 2LVSA 4DJAA 2BGCA 2OF7A 3P9KA 3JTGA 3SFZA 1WJBA 1OYIA 1KU3A 1HXDA 2OPTA 3ASOH 5HLHA 2W4SA 3RQ4A 2OTJI 1MBHA 1XX5A 1QHHD 2B7EA 1XGOA 5LHIA 1Y1VJ 1USTA 2HTJA 2VXDA 4HA8A 1OPCA 2KIMA 2PI0A 1MSFC 1A36A 1IDYA 1SVLA 4LG0B 2DK8A 3CF5F 4M73A 4XNFA 1MMAA 3RIRA 4DIQA 4ZH4F 1FNNA 3E6CC 3F6VA 2VLAA 1S7AA 4LG3A 1ETKA 5IT9Z 2GXAA 3OOPA 4UUVA 2CUFA 5AIQA 3JRDA 3JW4A 2VB6A 3J7ZI 4A0XA 1Z3YA 3DLAA 3PIOF 5FLXK 3ZQHA 3T8RA 1YX5A 2CJJA 2KPMA 1RKWA 3CTAA 2F4MB 5CQGA 3A02A 2X85A 1UHWA 2NS7A 4CGZA 4KNYA 3GLLA 4UVAA 4M6YA 1BR1A 1KONA 1OCOH 2K9LA 4HEA2 4M6VA 2MYSA 4AIKA 1CGPA 5E8IA 2IEKA 3I5UA 3SXYA 1O7FA 2KRHA 1VQ5I 3SFIA 3JR9A 1MDMA 2IA1A 4EV0A 5EEGA 5F08A 2VC0A 2W1OA 2PQ8A 4W1UA 4IOCF 3OYJA 1XGSA 1Z7LA 2DA5A 3WTYC 1FJLA 2K9MA 4C3HJ 1KU7A 5DS9A 4RGUA 4U7DA 4UUSA 3IWFA 3L2QA 4FTHA 1SFKA 1USSA 4RB0A 2BOLA 4S04A 3I4MJ 2K27A 1MZBA 3BOQA 1QZZA 3K2AA 1GDTA 2G9WA 3I0TA 3ZN1A 2QVOA 3OOUA 3SJMA 2OJED 5JHFA 2BYVE 4PJ0C 2IBDA 2K4BA 1FC3A 5E3LA 3ZQFA 3LSRA 1ETWA 1VTNC 4OIOF 2O0YA 1UG0A 1Y0NA 3TO9A 4A5NA 5GTHC 2QM3A 4BGDA 3PJRA 1XCVA 2E36A 3FMQA 3BROA 3WU0A 4IZZA 1FOKA 5FKLA 1OMIA 3LSGA 1IXSB 3DPLC 4G6QA 4I02A 4RMNA 1TTYA 1VQPI 1FIAA 5ICEA 2NVUB 5JFRA 4WWCA 3CDIA 1VQ7I 1O3SA 3KYCB 2JJ7A 1Y1WJ 3FKJA 1D5VA 1I50J 4A3JJ 2GA1A 5J8CA 3F8CA 2JSCA 2XKOA 2NYXA 2M7BA 2LLKA 5EGOB 3DWLE 1XN7A 1E2XA 4OIPF 2BXYA 3HRTA 2E2JJ 2B0LA 2VJ5A 4BXFA 4U87A 2NNNA 2FUG2 5IYBJ 1S7OA 1J2XA 4YFXF 2A5WA 1YQAA 2BY0A 5H20A 3CCJI 2KRCA 2LY9A 5F64A 3BTCA 4LB6B 3K1MA 1A6IA 2YX7A 4RB1A 3VWBA 2JUCA 2FQ4A 2D2WA 1R58A 1Z3XA 3PUBA 4CCMA 5J47A 2E5NA 3S16J 1XSXA 2CW0F 3H0GJ 2XASA 3QYFA 4EJTA 4BACA 1SFXA 2R7TA 2HVSA 2DQLA 4MEXF 1KQ9A 2OA4A 2E35A 3MD2A 4BEHA 2QCOA 1R22A 4CYDA 4M3DA 1FOWA 3B02A 5BOXA 1X4OA 4RAYA 4HDVA 4UY8I 3J7AY 3CCSI 3C3WA 2OUMA 3RPQA 3MWMA 2ZJRF 2NAZA 2E5ZA 4HG2A 2TRTA 6PAXA 2RKHA 2MLKA 1LPQA 3ZQ7A 5FKMA 3KETA 2UXXA 1U9OA 3HOWJ 1HKQA 3MZ8A 5IOYA 2I8DA 3HEFA 5EF6A 2ESHA 2LKXA 3C1DA 3M7GA 2JWTA 1IXCA 1MBGA 5EGOA 2GLOA 1MGTA 2VOPA 1NG6A 1OCZH 5HS8A 1I1GA 1ZGWA 1UJ8A 3GTQJ 3HSEA 2EV5A 1LDKB 4DOZA 1GVJA 4CDGA 4G7ZF 3BG5A 3FBNB 4II2A 2E60A 1X58A 2KFDA 2F5FA 3CF2A 5GP9A 3HRSA 1OCPA 2PG4A 2E19A 3W6JB 2VKDA 4D1QA 1ZRFA 1BJZA 2VOOA 1V3FA 2J5PA 2XPUA 2DQRA 5HLIA 2FU4A 4FASD 5ICGA 2PMUA 1C0WA 3EUKL 1BR2A 2JA7J 2DFHA 3GWZA 1A04A 3HOUJ 5ICFA 4A0ZA 2JMWA 3R0AA 4XKCA 4ZYDA 1QO0D 2O61A 2DFEA 1PUEE 1NH3A 3K70C 4UXNA 4M3EA 2BW3B 1ITYA 3ROUA 2JRTA 1FP2A 1KA8A 2QQBA 4ESFA 3CLQA 4OWRB 2DI3A 2HDWA 2XB5A 1ZARA 1HA8A 1V4RA 3CO7C 1IN6A 5FLVA 3ZQIA 1YW7A 2RREA 1OFCX 3V7SA 3WTTC 2GWRA 3Q0VA 3EQLF 3HOVJ 3OYFA 3CUOA 1R9TJ 4GCVA 2VBZA 1ACIA 3A0HC 3VYTB 1WJCA 2R0QC 1PJRA 3KP5A 1FMVA 3ZXSA 1YW8A 5K7ZA 3ASNH 4JX4A 4AYBA 5K5QA 4ZC3A 4Y33A 1U5TB 2KZVA 5JVGF 3GW2A 1ZGAA 4OU0A 2CQXA 4P96A 4IEJA 1RR8C 4HLXA 2CS3A 2DN0A 2FF4A 3L2CA 3S3MA 2G7UA 5J6XA 1X3ZB 2A05A 2MW8A 4JX6A 4QLCU 5HNFA 5GTIC 2BZTA 1DGWY 2IPQX 4EVIA 3V8KA 4PCQA 4BQAA 2Y75A 3OY9A 1ETXA 1BW5A 2CSOA 4FE7A 4NC7A 3OYBA 2HOTA 3G3ZA 3FXLA 2N8GA 4R8HA 4BYYA 2RNGA 3DFGA 3BG3A 2Q8KA 1IV8A 1G2HA 1QZYA 4XKBA 1X1BA 5DUKA 3FHZA 1FBQA 2GQQA 3IH2A 3CUQA 4MGRA 4FX4A 4ITVA 4V2FA 1K6YA 2V6CA 1FYLA 2P7VB 2VE8A 4LD5A 3W2WA 3U2RA 2M3AA 3CC7I 4Q47A 4H0EA 4X1EA 2PMHA 3FXKA 2ZNZA 2R5ZB 4YIRX 4A3GJ 1VF9A 2GAUA 1P4AA 2EFWA 3CJTB 1W7PB 2O6GE 4CCNA 1J59A 4PFOA 5TJJA 2M4KA 1IN4A 4XLNF 4J00A 2EH3A 5AIPA 5H6RA 5J1RA 3ABKH 3ZGKA 3PFIA 1ZG1A 2MBFA 5EEHA 5D4RA 1UFMA 4NC8A 3BP8A 3CD6I 3TEDA 1LVAA 2HWVA 2HEOA 1Y56A 2KRFA 2QKMB 3QODA 4RDUA 1IGNA 2PEXA 2O7OA 4DW6A 2K4JA 5F0FA 3ZQCA 4MTEA 2ID3A 4ZTJA 3W6VA 3OYKA 4F93B 5ED4A 4M6XA 2JPCA 2CU7A 3V7CA 5F27A 4BKXA 2DA3A 3TL4X 1JI8A 2OZ6A 5CJ9A 4B44A 5J40A 2V9KA 3E3VA 4CHUA 1T39A 4XM3A 3OMYA 5FLMJ 1OISA 1PYVA 3RCOA 3WE2A 3C2HA 2Q2EB 5FB2A 3H5NA 3L1PA 1MBFA 4MO7A 1K83J 1B1BA 4HRIA 1PP8F 1MBKA 2DT7B 2K3FA 3GUDA 4I98B 3I58A 2K9QA 3ZCOA 1LQ1A 2PX9A 5D4SA 4HF0A 2L2OA 2RNJA 3DBLB 4RAZA 4BY7J 2A68F 3G71I 2QSGX 2MD0A 4NNJA 2WV0A 1K78B 5LD2C 3MKLA 3A4CA 3P9CA 2FBKA 4BHBA 1MKMA 1T0FA 5DM7F 2CW8A 4BNCA 2OV7A 4LLGF 4LLNA 3VB2A 2O5RA 1UG2A 4BEHB 2L7MP 4CYCA 2QBYA 3ZQGA 1R1TA 1TBXA 4KMFA 2CQNA 1DP3A 4HX7A 5D8LB 3QU6A 4J19A 4PJJA 1R23A 2D45A 1DP7P 3DLLF 3EDPA 3S15J 3A0BC 4F3QA 4ENJA 2FSWA 5E1XA 5C4JJ 3JRAA 3CJNA 2MD5A 4II3A 2LF7A 2VXZA 5F1JA 2JSPA 3BC8A 1VQ6I 3LA2A 4YFKF 4YRVA 5ILUA 1Z91A 3JRBA 2JQ7A 4AVZA 3E1SA 3S32A 3HOXJ 4LGWA 2OQGA 1XDSA 2W48A 3B73A 4BU2A 4N4OB 4AWXB 2KIQA 3N05A 4EJOA 2E2IJ 3H5AA 3D5RC 2W57A 2R5ZA 1QQIA 4B3AA 4I0AA 4XRSA 4A69C 3K4JA 3WTXC 4FETA 2V7FA 2ETHA 5EYRA 1N77A 2AQEA 3CCMI 2HKOA 1R71A 1X3WB 3HKZN 2M4GA 3M1EA 1YX3A 4KIBA 3BZCA 1YS6A 2RQQA 2XGDA 4M9ZA 1SEUA 5LRSA 2VT3A 4XK4A 4ZYEA 4RLQA 3CMYA 5J4YA 2GM4A 4A3KJ 2GA2A 4I99C 3N4MA 2AXTC 5D5UB 1U9NA 3H9QA 2GZWA 4XLEA 2XB0X 4E7KA 3CJRB 4RGRA 1J0RA 1LDJA 4CZCA 5D5VB 5E20A 3OWTA 2JTVA 3CDHA 2LK2A 2JPBA 4CCOA 9ANTA 2L4AA 1G6NA 2XVCA 4RBOA 1ZAOA 2EA2A 4RM3A 1WRJA 1SAUA 1W36C 1YRNA 2A5YB 2HNHA 1KGSA 4UB8C 2QQ8A 4V2GA 2LP0A 3ECHA 3A01B 1CQTA 3CZ6A 1N78A 5KAIC 5A2QK 1F9NA 1EA3A 2CWEA 1YIOA 2DMUA 2ME0A 2NS8A 4I6ZA 3RI4A 1LVKA 2DOFA 3X2QH 1QZEA 3I64A 5E3NA 3J80K 1SANA 3HOZJ 5BNGA 4PSWA 3UKGA 2YU9J 4V19K 3I53A 2LDUA 1EJ9A 5LEJA 2QLZA 3SZPA 2CV2A 3QPTA 3OIOA 2DW4A 2MSYA 4RAFA 3CQZJ 4B4CA 1X2NA 3LFKA 4N4NB 1L0OC 4X0GA 3CO6C 3H3ZA 3GEZA 3FF5A 1NHAA 5LGNA 3IL2A 3U9GA 3M4OJ 4CSWA 4F91B 2VBYA 2WB1N 1JTYA 2HQNA 2X6YA 2TDXA 4ZDOA 1TP4A 5DCMB 4XBFA 4KICA 4ZJZA 1IAWA 2DFFA 1K4TA 3QWLA 2LH9A 3IHUA 2DMPA 5KNLA 1W5TA 1Z7UA 2P5KA 4M74A 2FA5A 3PIPF 1VZ0A 5D5XB 4U0VA 3JRGA 2UWMA 2E2HJ 3IP4B 4HV6A 4HNUA 1DPUA 2E7XA 3PM1A 3S2WA 3C7JA 4DNCA 2A07F 4XMYA 1D3YA 4YG2F 1LJ9A 1RKTA 1K4SA 2O9LA 3WHBA 4DGWB 3OYIA 5FFXA 3BPVA 4XKVA 4AC0A 3A2KA 2JA2A 1LUJB 2CW7A 1UHMA 5CVUA 4PJMA 3LWFA 2E1MB 4DBQA 5K7FA 4N9HA 1TWGJ 4QTRA 1BJAA 4HOBA 1JJ6C 4D0PA 2V26A 4AIDA 3HTUA 1ZYRF 1R5GA 5E3OA 2QSFX 1T38A 1STZA 2EINH 1T56A 1F36A 1FY7A 1SMYF 2O8XA 2D1VA 3BG7A 3ZN0A 4M9SA 5CVRA 3BR0A 1B59A 1OYWA 2IGKA 3HRMA 2E71A 3L7WA 5GAGJ 3ECOA 4MQVA 3BT9A 4MQ9F 2VBXA 5CLSA 4KJZA 3K4KA 3I56I 5IYCJ 1ZTRA 4HSTA 3KX2A 3N97A 4BQQA 4BH9A 1MNEA 5IPAA 1H9TA 2IS4A 2M2EA 5ILSA 2VBWA 2MA3A 1PUFB 4I01A 1O4XA 5DCMA 2F5VA 2R7FA 2DA1A 3WU2C 3NEUA 1UMQA 4XLHA 1T33A 4YELA 1TW3A 4CYCB 4HBLA 1E0EA 2XUBA 5GADJ 4HZFA 3F22A 1XDUA 1SVMA 2R7RA 5CQEA 1GXPA 1HBXG 1IN7A 2HU9A 3F8MA 4B3XA 3CMMA 3ISPA 2ELHA 5CYVA 4BHCA 2ME6A 2WAQN 3PO2J 3P5JA 4AIJA 2FQ3A 2DTZA 2R3SA 5L3EA 3HXLA 4MFEA 5DYMA 2IP2A 5E17F 2XF5A 2JA5J 1TWFJ 5GAEJ 2VONA 1T98A 3K69A 4A5MA 4HDUA 3QOPA 2ZFUA 3QP6A 2EQRA 3MVPA 2H8WA 1JJ8C 3HOSA 3LOCA 4I76A 3MEXA 1TZLA 5M3FJ 2MGQA 3NQOA 2BBYA 2Z16A 4E7LA 4M72A 1H9GA 2L4MA 1JGSA 4MEYF 1ETOA 4XRSG 1X1PA 4NUBA 4EJUA 5BMZA 1JE8A 2X9DA 4E7JA 1ZRDA 1D0ZA 2XF6A 3ULQB 5TRDA 1UELB 2DA4A 5DEQA 2ZXWH 1W7PD 1D8KA 3KZZA 3F9KA 2JA8J 2FJ1A 1FP1D 3CC4I 2IRFG 1GT0C 1V5FA 1P4XA 1R49A 1ETVA 5D6FA 4U0WA 3TO6A 3AAFA 4YFNF 4E7HA 1K7AA 4BXXJ 5IP9J 1OCCH 4P5OA 2D5VA 1HW5A 3TP0A 1ULYA 2ACJA 2EPFA 4XORA 3S93A 5LHGA 4XR6A 3TOAA 4Q5SF 1XMXA 4A93J 5DTDA 1J09A 5IT3A 2PLYA 3FWEA 2Q1ZB 3WODF 4HAMA 3FXQA 3K70D 2EFNA 5DCFA 3CCLI 5HDKA 3G1OA 5DDGA 1PVEA 2ICWG 1IF1A 2ISZA 1D8JA 2XAHA 3BR6A 1TWAJ 4C3IJ 4E6KG 3MZYA 5GPAA 3WTSC 1F5TA 3RPUD 3BCBA 2HI3A 3VOEA 1ZHFA 5JHUA 2NNYA 1LE8B 1FEXA 1D0YA 2EZIA 1OJLA 1XMKA 1XGMA 5L3BA 2LD5A 5FFZA 3CP8A 2ELJA 1ORKA 1ZLJA 3H5RA 4R79A 4L0YB 4L9JA 4FQGA 5ICCA 4PDKA 1WHUA 5FRNA 1TLHB 2MH9A 2WTEA 2HXOA 1H89C 1S3JA 2JRMA 1ZK8A 3LQQA 3WTUC 1XD7A 3I4NJ 5FROA 3SZGA 5IP6A 1BOBA 4LIVA 4O5VA 5J3LA 5E8GA 1IN8A 4FCYA 2AO9A 2DXIA 4FISA 5F04A 1QRYA 2AQFA 1ERDA 1MSEC 3DV8A 5D5WB 2KISA 3ELKA 4BJ6C 2L02A 3VSLA 3H9GA 4HNVA 2XSJC 4ZYAA 2EK5A 3R60A 1KU9A 4UV8A 3LSKA 1G3SA 2ECCA 2FE3A 2DMNA 4RGXA 4KT6A 1SFUA 3GXOA 2R92J 1ZQ3P 2P0WA 2YR2A 2ZCWA 3HGYA 1MMDA 1LEBA 4Y3OA 3RTRA 5C3EJ 3GTMJ 1TQIA 2Z2SB 2IA2A 2E1OA 4WF2A 3I55I 2DTRA 3HSRA 3OS1A 1EH8A 1SC7A 1VQNI 2R7SA 1GLNA 4C9YA 1FPQA 2YSRA 3KP2A 4A3EJ 3C2BA 2F4OB 1EH6A 3ONQA 4NB5A 5CVIA 3BJAA 1BC7C 2DPDA 4YIIA 3K1NA 2LSOA 2VC1A 1R5HA 5E1WA 2OTLI 1REPC 2HPIA 1X4PA 4D7NA 1MH3A 4FX0A 2V9PA 1GV2A 2Y69H 3PL8A 3S1MJ 1U0JA 1JKPC 5DV5A 4U0YA 2W25A 3ZMSA 2YUSA 2MC4A 1HF0A 1IDZA 4NHJA 2VJ4A 1U6GA 4M3GA 2HZTA 4Z6YA 3CCVI 1VQMI 4DBRA 3DCFA 1TT5B 4EJWA 4Y7NJ 2K9SA 1KZHA 1I1SA 3BG6A 3H1CA 3TMOA 1RC9A 2EV0A 2FNAA 2H94A 4XICA 2KMUA 1FBSA 2ID6A 3K4MA 3LA7A 2L7ZA 4BDYA 3A01A 1DU6A 2A61A 2CUJA 3WGGA 3GCMA 1HW2A 2H8RA 3NAUA 2LKPA 2MG4A 4RS8A 2IA0A 3OS0A 4QPQA 3VYUB 5BPDA 1PDNC 1BN5A 1UHSA 4XLFA 5K5RA 4KMUX 1G3TA 3I59A 2RAEA 3D5LA 3K9TA 4Q48A 2XF7A 2EFQA 4IXAA 1R4NB 4RGSA 1RR7A 3CCUI 3DU5A 1LEAA 3CJQB 5KVRA 3HKZA 1XCBA 1VQKI 3DEEA 2F2EA 2XRNA 3PQKA 3CP2A 4J01A 3LAJA 2EZHA 3OYNA 1TWHJ 3TDZC 4YIFA 4N0BA 5GAHJ 1ZG3A 4Z2YA 2XGXA 3UNGC 2HQ5A 3DPUA 5M5XJ 4IHTA 4BBSJ 2DOAA 1XC5A 1X3UA 4KA4A 2R93J 4RLFA 5CPRB 4AM3A 3JTHA 4YEJA 3J80Z 1BL0A 4JK1X 3AG3H 4MFDA 3PFYA 5BQTA 4WCGA 3BPXA 3IWZA 1U8BA 4BXUA 4XL9A 2XDVA 1QPMA 2RV8A 1IUYA 2HOAA 1W36D 2IS2A 3EUHA 1FOYA 1WKMA 5D6EA 3BG9A 4LG0A 3K4BA 2ZXHA 4KIGA 3RKWA 2P8TA 3CMEI 3BLYA 1BOAA 4JYKA 1D0XA 2X0LA 4UV9A 3S14J 3HRUA 3HG9A 4AUXA 3S1RJ 5F0HA 4XLPF 2X51A 3FXRA 4A2UA 2ZMEA 1FLIA 3HJEA 4BQOA 4UUTA 3ZPLA 3FMSA 1JTXA 2R7UA 3ZMTA 2DA6A 4L0ZB 4GYIA 3AKZA 2XAGA 3AL0B 2LNBA 3L09A 5DUIA 1HSTA 3KE2A 4CA0A 2R7OA 2LREA 1TT0A 2M0MA 4DZPA 2NVQJ 5FRMA 4XONA 2LBFB 4U7BA 2QA4I 2NVXJ 1TQMA 5HOOA 1IRFA 4IL6C 4MTDA 2HTSA 4BE1A 1UZCA 1XTAA 2VJIA 4E7IA 1H0MA 4NC6A 4ABZA 4HLYA 1LB2A 1DGRM 2CFXA 5BPIA 3HPGA 5H2FC 3SDGA 2H27A 3KEQA 1EF4A 4HV5A 5D8KB 3OIQA 2P4WA 1EV7A 3H36A 3EYIA 1I3AA 2Y30A 2CV0A 5K7HA 2FEZA 2HDDA 2JK3A 3JRCA 2VODA 1R1UA 3I71A 3FXJA 4D9JA 1N75A 3RZOJ 3PUFA 1CF7B 5M5WJ 1HCRA 3D1NI 4IF4A 1G3YA 4IRGA 4CUGA 1N25A 1XS9A 1Z67A 2KLOA 2DMQA 5IOZA 5LBQA 1B6AA 2K40A 2QSHX 1OR7A 1HDPA 3FX3A 2Y0SN 2LRDA 2ISYA 2MH2A 1TNTA 4UB6C 3DTEA 3HOYJ 4A3DJ 2IW5A 5CVJA 1ODDA 4CZZA 3VSKA 4L5EA 2I5UA 4JX5A 5B66C 1FIPA 1YE9A 5DM6F 3LNQA 2IXSA 1TNSA 4CCKA 4LLLA 2L9RA 3M3YJ 2EV6A 4MLOA 2Y9YA 1RESA 3QPLA 4HW0A 1VQOI 1JKOC 1BI1A 2UUZA 5HDNA 4NQWA 4EM0B 2HQAA 1TW2A 3V42A 3JSPA 2KL4A 2M30A 2AS5F 1FBUA 3RJPA 3WTWC 3M8EA 3CUQB 1POGA 1V5EA 4PGGA 3AL0C 4XKWA 2KT0A 3GTLJ 2VN2A 3HUGB 2BV6A 3MZHA 2NVTJ 3ZMDA 4ENKA 2DT5A 2EB7A 4IRIA 3G6EI 2L5QA 3FHNA 1HKTA 2L9SA 1YFHA 5KAFC 2CYYA 4XLCA 3JAMK 2R4GA 2JVGA 2F5DA 4MHGA 1B72B 4LB5A 4BE0A 1BI3A 1ENHA 1A6QA 2GIVA 1W4MA 2XAUA 2ESNA 4LJZF 3BY6A 1L3LA 2KIFA 4PK4A 3IV5A 2XHKA 1Z1DA 2W84A 4UNOA 1KQ0A 1JGGA 1ETYA 3BTLA 2ZC2A 1LDDA 1XPXA 1G59A 2WAFA 2G7HA 3V7RA 2VASA 4S05A 1AWCA 4Y52J 2H6CA 3E5XA 1QU3A 4M3BA 4RA2A 3E0JB 1J9IA 4IHXA 2QEXI 3F8BA 2VQCA 3K4LA 1D5YA 3IAS2 3DKWA 1BIAA 5C44J 1F1ZA 2KDZA 4IQJA 3B6AA 1P9QC 2EIKH 3ERMA 1MMNA 1QBJA 3JRFA 3AFHA 1NTCA 2OCCH 3HUGA 3COAC 5ILVA 4UUSB 2K02A 4L18B 3JRIA 5EEAA 2WBMA 3FXUA 3BR2A 3TOBA 2R7VA 3Q0WA 5HNHA 3KIOA 3MCZA 4P1WA 2BVLA 3KFWX 3C2GA 3IC7A 4BBRJ 2OU2A 2XIGA 3RYPA 1Z9CA 3KLNA 1W5CC 2VIXA 3CCEI 1YIJI 1O7LA 1RUNA 4D5FA 3SEZA 4IVNA 2R5YB 2X1CA 4IOAF 1XSVA 2QZ8A 4M3FA 3EUAA 1K61A 1BI2A 1PP7U 4I0BA 1IO2A 2UXNA 3HSFA 3OIPA 3OL3A 3JREA 1Z0XA 1KYZA 5FKNA 2M8GX 4JP0A 1JUSA 2ZSHB 2LTPA 2W00A 2ZKZA 3M8FA 3ZQLA 1FYKA 4ZYGA 1LNWA 5F0CA 1K79A 3U1DA 2FRHA 1Q1VA 4ZZLA 4DYRA 1KYWA 1WJ5A 2GOMA 1P7IA 4PJLA 5EG0B 4EQQA 3GTGJ 3B6CA 3J7AO 4ENMA 3J81Z 2DA2A 1B8IA 1Z05A 3WGHA 3ML6A 2RDPA 2XSDC 1SD6A 4Y15A 2Z99A 2QUFA 2ZBKA 3KEOA 2W85A 2HYJA 1V55H 3FK7A 1GXQA 1Z21A 1WH5A 2XGEA 3FMRA 4ZDPA 4KUMA 3LAPA 2EWNA 2VJJA 3H35A 2DJNA 4XLAA 1U8RA 4ZZDA 3KZIC 2VT2A 3Q3SA 2KIUA 4HYEA 2WC2A 3TBIA 3FK6A 4DQ2A 3DKXA 1ZKGA 3E6MA 1F43A 2K7LA 1YJWI 3V4GA 3G4SI 4BL0B 1WGXA 1SD4A 2LOOA 5EJCA 2HQRA 4KN4X 2B63J 4H4KC 3OYEA 1ZR2A 4KDPA 3KYLA 1BI0A 2HKXA 1Y39A 4IJAA 2CUZA 2IJLA 2CRGA 3F3XA 3ZMUA 2M8EA 3M1CA 3TO7A 1HSJA 2GIZA 3GBGA 3S3OA 3TQNA 4CICA 3SZTA 1YS7A 5FKOA 3E7LA 5FD6A 4C2UA 5E1ZB 3BTIA 3VYSB 1E3PA 2JA6J 2O03A 2V1XA 1FT9A 2H6BA 1BIBA 3I9V2 2K5CA 3VEPA 4XN0A 5AONA 3L2VA 5L3CA 2Z3YA 2WADA 1MDMB 3HHGA 1OYYA 2R7DA 5TISC 1D1CA 4EJVA 5EZHA 1DDNA 3CCRI 1VI0A 2V4JC 3EETA 2NS0A 3BQZA 2HXIA 4WXHA 1YJ9I 3BQYA 2CUEA 1NG7A 2B9SA 3OS2A 3MFKA 1UCRA 3D5SC 4XOTA 1FWZA 2V1NA 2P5LC 1S7EA 3G1LA 3W3CA 1FZPB 4IKFA 2YU3A 2ZXIA 2VQLA 5JI6A 1GVDA 2DT6A 3MKZA 1W1WE 4G7HF 1JHFA 2QYOA 2WB1A 2ZMEB 4NQWB 2BY3A 1I6XA 2X1DA 2UV1A 1LFUP 1O3TA 3QYEA 4IHVA 1BR4A 2V9VA 3K4NA 1U5TA 3WTVC 3T8TA 1TC3C 1MD0A 4N9IA 2LKSA 3IKTA 3K1PA 1XB4A 3L2RA 2KP6A 1ZRCA 2M34A 1J5YA 1R6RA 4P9FA 4OINF 5EDNA 4HQMA 4ESJA 2PJPA 2Q0OA 3K2ZA 5F6FA 1T6SA 4DYCA 5LLQA 4Y4RA 1U5TC 3F8NA 4EM1A 4GGGA 1I27A 2O8KA 3ERED 3HB9A 3HOTA 2WY8Q 4PJNA 1B8IB 2M7AA 2X6XA 3R0JA 1Y8QB 2VKVA 3BCAA 1QVTA 4IHWA 5IY5H 1W0TA 2DPUA 4JQFA 2DOEA 2EFOA 3TGNA 1J75A 3K6GA 4O6JA 1FTTA 3EPZA 1JHHA 1V54H 3GLXA 4G6TB 5KK1A 2W7NA 2P7CB 3IRQA 4X6AJ 5M3MJ 4G6DA 2RN7A 3OYLA 5EZGA 2OC6A 2ELKA 3HPHA 2LG4A 2LFBA 3K4CA 3DKYA 5B1BH 1WFXA 2QBYB 2EJRA 2XV4S 5C4XJ 2JT1A 3GVAA 4G7OF 4BJTA 3LA3A 3UR3C 4KN7X 3FDYA 3S1NJ 1SVOA 1P4WA 2FBIA 3E5QA 4B48A 4QIWN 4UVCA 5HODA 3QRFF 1SAXA 1F4KA 1RIOH 2X4HA 2LY2A 1Q1HA 1DQUA 1WH7A 5B5EC 4GDFA 4LIUA 1D1BA 3PNVA 1GHCA 1I6HJ 3LSMA 2PFBA 3MN2A 3DP7A 4KFCA 3LSIA 3NARA 2CQQA 3U1KA 2Y48A 1IXRC 1AOYA 2IGOA 2M9HA 3F8FA 2I10A 4IPAA 3OSGA 1OCTC 2R5YA 1RUOA 3AG4H 2Y9ZA 1O3RA 3GFLA 4A6DA 3DTKA 1LFPA 3BR1A 2FOWA 3LQRA 5FO5A 2ZB9A 1IRXA 3BJOA 3FIWA 2LY1A 4G9YA 1ETQA 1B72A 2V79A 1B9NA 1DUXC 1OKRA 2STWA 3GYHX 1BM9A 2BY1A 1XGNA 3FBIB 3TW6A 1YLFA 3IRRA 1MBEA 1YW9A 1RPWA 5EG0A 2IGNA 2LMDA 2V1UA 2Z33A 2E1MC 3ABUA 1HC8A 4XQFA 2HFHA 3KEYA 1I3QJ 2E34A 3Q0UA 3H3VK 4IQ4A 2ECBA 2HOSA 3BR3A 3SEQA 1XSDA 4E4HA 3RKYA 2BXZA 4WXCA 1PUFA 1HDDC 3DEUA 3GTOJ 1QPIA 2DLLA 3SYTA 3WHCA 3CDLA 2DBBA 3GO5A 3WE3A 5J8FA 3MKWB 2DK5A 2VPLA 3S1QJ 4L9NA 1MJAA 4GFBA 4A0YA 3VDXA 1U2WA 3HC7A 1WJDA 1WJFA 4ON0A 3CCQI 4A3BJ 2O3FA 4F7ZA 4A3LJ 1ZH5A 3GMEA 1X1CA 2FMYA 2GXGA 1J7KA 3SQNA 2DCEA 1JT0A 3AG1H 2WAEA 3I4PA 4IHSA 2XKPA 1I39A 3PNYA 3C18A 3HM5A 2J5OA 3LL7A 4M9XA 2DA7A 5JR3A 3PNTA 3R61A 4C30A 5L3FA 4L9TA 3H9JA 5FKKA 1JT6A 1GUUA 5J1YA 3RQIA 1QA6A 3KYDB 5IYDJ 1JUPA 5LEKA 1MJBA 1IV6A 1FMWA 3H0DA 2QENA 1P7JA 3DBHB 3RZDJ 2DU9A 2X48A 2Z5UA 4WX9A 3EYYA 4R1HA 2K85A 3KPHA 4NBQA 4EMSA 2Z1DA 2ZO4A 1FYMA 2M1BA 2ZJQF 1BC8C 1SFEA 3TP3A 5L3DA 4EATA 4DYQA 1SD5A 1YOVB 2E1CA 1EH7A 1FX7A 1WI3A 3QQAA 5KCMA 1YITI 4L9VA 4BHPA 1AKHB 4XRMA 4I7HA 4OAYA 2XAQA 3HIFA 1MNDA 4DZJA 3OL4A 3GZNB 1X1AA 4CH7A 3QP5A 2BE5F 2OCEA 4XSZF 3OYGA 2ZJPF 2Y0MA 4IO9F 1MW7A 2L54A 2HDCA 1S29A 5HS7A 3O3KA 2CGPA 4LMYA 1MBJA 1Z6TA 1O57A 3MAJA 2VPRA 3BZ6A 3OYAA 3KP4A 3OR1C 3ZR8X 2MLGA 3KLOA 1R36A 1E17A 4W97A 2WY7Q 2DAOA 1NK2P 2VE9A 3BTJA 4LITA 4WXDA 2CQKA 3O2PE 2HGCA 3I3LA 4BDZA 2Y31A 4ANJA 2XGCA 4F92B 2EILH 2EFPA 3GFIA 1G4DA 2IT0A 3G73A 1JUMA 3M8JA 4QPOA 4AVPA 2F6CA 1VQLI 5E79C 1YHQI 3O6BB 3RSNA 3SHFA 1HW1A 3OYDA 3RKXA 3F0CA 2AHQA 1G8XA 2OD5A 2LF8A 1B4AA 4PUSA 2CH0A 1Y8RB 4KITB 2JVHA 1UAAA 4O3MA 2IVMA 3FXMA 3S17J 1QHGA 4LK1F 4BE2A 1TWCJ 4I2OA 3FKIJ 3KZYA 4HPQA 1R7JA 2HYFA 3DBRB 2COMA 4S0HB 2E1NA 2VQHA 3D0SA 1W7PA 4OIQF 1P92A 5HVQC 1I5ZA 2DYSH 3TW7A 4AYBN 3ZP5A 1QVUA 1WPKA 4EM2A 2XPWA 2CO5A 3GTPJ 1KU2A 2HR3A 1WQ2A 3S8PA 3KCCA 1BW6A 3K0LA 3IKVA 4E7ZA 4G94A 1WSUA 4OMYA 2IAIA 2X1EA 2BY2A 2MABA 1Y6IA 4BJ5C 3ZMZA 2QGUA 1S72I 3NRVA 1V5GA 1JXSA 1IRZA 4BS9A 1X2MA 3HZJA 3LSTA
chains in the Genus database with same CATH topology
2C6YA 3BDDA 4K2EA 3P7NA 4GYGA 2ZJ2A 3PQJA 2FNPA 4B8XA 2PN6A 3ZMVA 3HHHA 4L5IA 4AD9A 2JZYA 3I54A 4JBAA 2L3DA 4HX8A 1XMAA 2M5WA 2K86A 1IZ1A 4ENNA 3OV8A 5CVVA 1BBYA 1SD7A 2NRAC 3GX4X 3GZ6A 3KP3A 2YPRA 2W24A 2XROA 1YTYA 2FMLA 4P55A 1YO5C 5ERIA 3T5XA 1ON1A 4OIRF 2ZXJA 3TKYA 1G3WA 5HLGA 4LFUA 1RI7A 4GXOA 2M87A 1O3QA 1P2FA 2KJCA 3GFMA 2OAZA 2D1HA 3FZVA 1ZLKA 2QWWA 3QPHA 1ZG5A 3VFZA 3F21A 2UZKA 4UVBA 4ASNA 4PZJA 1RZ4A 5LRRA 1U78A 5DD8A 1B9MA 3DXJF 1DPRA 1Z6RA 5BS6A 3BJ6A 1T2KA 3H3UA 4KYWA 4B09A 2E7WA 2HYGD 2V1DA 4RB2C 3R4KA 3GFJA 5JVTA 3P9IA 2OBPA 1SMTA 3MQ0A 2Z9OA 1YG2A 5E18F 4E70A 3REOA 1KQ8A 4IRHA 1WWXA 2RQPA 2CG4A 1Y0UA 3FM5A 3QAHA 2ZFWA 4WK8F 3WG9A 3JSOA 4ETSA 3DQVC 2OQRA 2DO7A 4ZYHA 1ZN2A 4Y17A 3E6BA 5FD5A 3GF2A 1IRGA 4EGYA 4TV7A 5K1YA 4RB3C 3BWGA 3F23A 4KIFA 1WI9A 2P5VA 1QNTA 1ON2A 4CXFA 4A6EA 2M45A 4L5JA 4QWQA 3KP7A 1IN5A 2HOEA 2L01A 4UHTA 3QU3A 3T1BA 5FGMA 4OOIA 3M9AA 3WTZA 2XAJA 2RGVA 3CLOA 2QQ9A 2WWYA 3L9FA 4GO1A 5K5OA 3F6OA 1HKSA 1MJ9A 1IW7F 1W5SA 1ONVA 5HS9A 2HS5A 4CO8A 1K78A 1S8NA 2A6HF 2RC4A 5F1RA 3F72A 4FHTA 1FSEA 4HX4A 3GZ5A 2OZUA 3I59B 3T0YA 3R6SA 3W6KB 2GXBA 3E97A 1U3EM 4XSXF 4P9UA 4HF1A 2Q2EA 2F5CA 3Q9VA 1R1VA 1FSHA 3HTSB 3V8JA 4OMZA 4AIHA 3V8LA 4ESBA 1UB9A 2YX4A 1R00A 3E6DA 3HYIA 4FT8A 2ADUA 4MNUA 3WGIA 4Y13A 3CUQC 2PBIA 1P6RA 3ABTA 2A6EF 3L00A 2H09A 4HF2A 1ZGJA 4PGHA 3J81K 2KJBA 3RPUA 2FOKA 1TQPA 3Q9SA 1K6OA 3Q5FA 2RVCA 1YYVA 2EA4A 2P6SA 5LGUA 2STTA 3VODA 3RYRA 4LK0F 5LGTA 2ZNYA 1RNLA 4HQEA 1ZREA 5DD4A 3RDIA 4M71A 4BAYA 2BEOA 2DFIA 3FM3A 2AXLA 3DPTA 1HQCA 5HDGA 5IT9K 3KP6A 4A12A 2XAFA 4XRFA 4KT5C 4I09A 3JAMZ 2MC3A 3H92A 3DF8A 1CF7A 5FLXZ 2A3SA 4G8XA 4Q4ZF 2F5EA 5LHHA 3TDUC 4EGZA 2FXAA 2FBHA 2QQAA 2A69F 3WU1B 5L3GA 3E5UA 2P6TA 1S6LA 1QGPA 2KKOA 5A2QZ 4U88A 5H6QA 2BGCA 3P9KA 3JTGA 3SFZA 1OYIA 1KU3A 1HXDA 5HLHA 1XGOA 5LHIA 1USTA 2HTJA 4HA8A 1OPCA 2KIMA 2PI0A 4LG0B 2DK8A 4M73A 3RIRA 4ZH4F 1FNNA 3E6CC 3F6VA 1S7AA 5IT9Z 4UUVA 3OOPA 5AIQA 3JW4A 4A0XA 5FLXK 3T8RA 3CTAA 1UHWA 4CGZA 4KNYA 4UVAA 4M6YA 4AIKA 1CGPA 5E8IA 3SXYA 3I5UA 1O7FA 1MDMA 2IA1A 4EV0A 5EEGA 2VC0A 2PQ8A 1XGSA 3WTYC 1KU7A 4U7DA 4RGUA 3IWFA 4RB0A 1USSA 4S04A 2K27A 1MZBA 3BOQA 1QZZA 2G9WA 3I0TA 3ZN1A 2QVOA 2BYVE 2K4BA 1FC3A 1VTNC 4OIOF 2O0YA 3TO9A 4A5NA 2QM3A 1XCVA 3WU0A 3FMQA 3BROA 1FOKA 1OMIA 1IXSB 3DPLC 4G6QA 4I02A 1TTYA 5ICEA 5JFRA 4WWCA 1O3SA 1D5VA 2GA1A 5J8CA 3F8CA 2JSCA 2XKOA 2NYXA 1XN7A 1E2XA 4OIPF 3HRTA 2B0LA 2NNNA 1S7OA 1J2XA 4YFXF 1YQAA 5H20A 5F64A 4LB6B 3K1MA 2YX7A 4RB1A 2D2WA 1R58A 1XSXA 4EJTA 2CW0F 2XASA 1SFXA 2DQLA 4MEXF 1KQ9A 2OA4A 1R22A 4CYDA 3B02A 5BOXA 4RAYA 4HDVA 3C3WA 3RPQA 3MWMA 2NAZA 6PAXA 2RKHA 2MLKA 3ZQ7A 3KETA 2UXXA 1HKQA 2ESHA 3C1DA 3M7GA 2VOPA 1IXCA 1MGTA 5HS8A 1I1GA 3HSEA 2EV5A 1LDKB 1GVJA 4CDGA 4G7ZF 2F5FA 3HRSA 2PG4A 3W6JB 1ZRFA 2VOOA 1V3FA 2J5PA 2DQRA 5HLIA 2FU4A 5ICGA 2PMUA 1C0WA 3GWZA 1A04A 5ICFA 4A0ZA 3R0AA 4ZYDA 1QO0D 2O61A 1PUEE 4UXNA 3ROUA 2JRTA 1FP2A 1KA8A 2QQBA 4ESFA 2DI3A 1ZARA 1V4RA 3CO7C 1IN6A 1YW7A 3V7SA 3WTTC 2GWRA 3EQLF 3CUOA 4GCVA 2VBZA 3KP5A 1YW8A 5K5QA 1U5TB 3GW2A 1ZGAA 4OU0A 4P96A 4HLXA 2FF4A 3L2CA 2G7UA 5J6XA 4QLCU 2IPQX 4EVIA 3V8KA 4PCQA 4BQAA 2Y75A 2CSOA 3G3ZA 4R8HA 4BYYA 3DFGA 2Q8KA 1QZYA 5DUKA 3FHZA 1FBQA 2GQQA 4MGRA 3CUQA 4FX4A 2V6CA 1FYLA 2P7VB 2VE8A 4LD5A 3U2RA 4Q47A 4H0EA 2PMHA 2ZNZA 2GAUA 1P4AA 2EFWA 1W7PB 2O6GE 1J59A 5TJJA 1IN4A 4XLNF 5H6RA 5AIPA 3PFIA 1ZG1A 2MBFA 5EEHA 5D4RA 1UFMA 3BP8A 1LVAA 2HWVA 2HEOA 2KRFA 2PEXA 2K4JA 4MTEA 5ED4A 4M6XA 2JPCA 3V7CA 2OZ6A 5CJ9A 3E3VA 4CHUA 1T39A 3WE2A 5FB2A 1B1BA 1PP8F 3GUDA 4I98B 3I58A 1LQ1A 5D4SA 4HF0A 2RNJA 4RAZA 2A68F 2WV0A 1K78B 3P9CA 4BNCA 2FBKA 1MKMA 1T0FA 4BHBA 4LLGF 4LLNA 3VB2A 2QBYA 1R1TA 1TBXA 4KMFA 4HX7A 5D8LB 3QU6A 2D45A 1R23A 1DP7P 3EDPA 4ENJA 2FSWA 5E1XA 3CJNA 2MD5A 2LF7A 2VXZA 3LA2A 4YFKF 5ILUA 1Z91A 4LGWA 2OQGA 1XDSA 3B73A 4AWXB 4EJOA 2W57A 1QQIA 4I0AA 3WTXC 2ETHA 2HKOA 3M1EA 4KIBA 1YS6A 4M9ZA 5LRSA 2VT3A 4ZYEA 2GA2A 3N4MA 5D5UB 2GZWA 4RGRA 1J0RA 1LDJA 5D5VB 5E20A 2JTVA 3CDHA 2JPBA 2L4AA 1G6NA 2XVCA 1ZAOA 2EA2A 1WRJA 2A5YB 1KGSA 3ECHA 5A2QK 1F9NA 2CWEA 1YIOA 3RI4A 3I64A 3J80K 3I53A 2LDUA 5LEJA 2QLZA 3SZPA 3QPTA 2DW4A 3LFKA 1L0OC 3CO6C 3H3ZA 1NHAA 3FF5A 3GEZA 5LGNA 3IL2A 3U9GA 2VBYA 2HQNA 2TDXA 5DCMB 4XBFA 4KICA 1IAWA 3IHUA 1W5TA 1Z7UA 2P5KA 4M74A 2FA5A 5D5XB 4U0VA 2UWMA 4HV6A 1DPUA 2E7XA 3S2WA 3C7JA 4DNCA 2A07F 1D3YA 4YG2F 1LJ9A 5FFXA 3BPVA 1UHMA 5CVUA 3LWFA 4N9HA 1BJAA 4HOBA 4D0PA 3HTUA 1ZYRF 1R5GA 1T38A 1STZA 1FY7A 1SMYF 2O8XA 2D1VA 3ZN0A 4M9SA 5CVRA 1B59A 1OYWA 3HRMA 3L7WA 3ECOA 4MQVA 4MQ9F 2VBXA 5CLSA 3N97A 4BH9A 1H9TA 5ILSA 2VBWA 2MA3A 4I01A 5DCMA 2R7FA 3NEUA 1TW3A 4HBLA 2XUBA 4HZFA 3F22A 1XDUA 1HBXG 1GXPA 1IN7A 3F8MA 3ISPA 2ELHA 5CYVA 4BHCA 4AIJA 2FQ3A 2R3SA 5L3EA 5DYMA 2IP2A 5E17F 2VONA 1T98A 3K69A 4A5MA 4HDUA 3QOPA 3QP6A 3HOSA 3MEXA 3NQOA 2BBYA 4M72A 1H9GA 2L4MA 1JGSA 4MEYF 4EJUA 5BMZA 1JE8A 1ZRDA 3ULQB 5TRDA 5DEQA 1W7PD 1D8KA 3KZZA 1FP1D 2IRFG 1P4XA 5D6FA 4U0WA 3TO6A 3AAFA 4YFNF 1K7AA 4P5OA 1HW5A 1ULYA 2ACJA 5LHGA 3TOAA 4Q5SF 5IT3A 2PLYA 3FWEA 3WODF 4HAMA 3FXQA 2EFNA 5DCFA 5HDKA 5DDGA 1D8JA 1IF1A 2ISZA 2XAHA 3MZYA 3WTSC 1F5TA 3VOEA 1ZHFA 5JHUA 2NNYA 1XMKA 1XGMA 5L3BA 5FFZA 1ZLJA 4R79A 4L0YB 4L9JA 5ICCA 4PDKA 1TLHB 2MH9A 2WTEA 1S3JA 3LQQA 3WTUC 1XD7A 4O5VA 5E8GA 1IN8A 3DV8A 5D5WB 3ELKA 2L02A 2EK5A 3R60A 1KU9A 4UV8A 1G3SA 2FE3A 4RGXA 1SFUA 3GXOA 2YR2A 2ZCWA 1LEBA 3RTRA 1TQIA 2IA2A 4WF2A 2DTRA 3HSRA 1EH8A 1FPQA 2YSRA 3KP2A 4NB5A 1EH6A 5CVIA 2DPDA 1BC7C 3BJAA 4YIIA 3K1NA 2LSOA 2VC1A 1R5HA 5E1WA 1REPC 4FX0A 5DV5A 4U0YA 2W25A 3ZMSA 4NHJA 1U6GA 2HZTA 4EJWA 1I1SA 2EV0A 2FNAA 2H94A 1FBSA 3LA7A 2A61A 3WGGA 1HW2A 2LKPA 4RS8A 2IA0A 1PDNC 5BPDA 1BN5A 5K5RA 4KMUX 1G3TA 3I59A 3D5LA 3K9TA 4Q48A 2EFQA 4IXAA 4RGSA 1LEAA 5KVRA 1XCBA 2F2EA 2XRNA 3PQKA 3LAJA 4YIFA 3TDZC 4N0BA 1ZG3A 4Z2YA 2XGXA 4IHTA 1X3UA 4KA4A 3JTHA 3J80Z 4JK1X 5BQTA 4WCGA 3BPXA 3IWZA 4BXUA 1QPMA 2RV8A 1IUYA 3EUHA 1WKMA 5D6EA 4LG0A 4KIGA 3RKWA 2P8TA 1BOAA 2X0LA 4UV9A 3HRUA 4XLPF 3FXRA 4A2UA 2ZMEA 1FLIA 3ZPLA 3FMSA 3ZMTA 4L0ZB 4GYIA 2XAGA 2LNBA 3L09A 5DUIA 1HSTA 3KE2A 4U7BA 1TQMA 5HOOA 1IRFA 4MTDA 2HTSA 1H0MA 4HLYA 1LB2A 2CFXA 5BPIA 2H27A 3KEQA 4HV5A 5D8KB 2P4WA 1EV7A 3EYIA 2FEZA 2VODA 1R1UA 3I71A 1CF7B 4IF4A 1G3YA 4IRGA 5LBQA 1B6AA 1OR7A 3FX3A 2ISYA 2MH2A 1TNTA 2IW5A 5CVJA 1ODDA 4CZZA 1TNSA 4LLLA 2EV6A 4HW0A 1BI1A 5HDNA 4NQWA 4EM0B 1TW2A 3JSPA 2M30A 2AS5F 1FBUA 3RJPA 3WTWC 3M8EA 3CUQB 4PGGA 2VN2A 2BV6A 3MZHA 3ZMDA 4ENKA 2DT5A 2EB7A 4IRIA 1HKTA 1YFHA 2CYYA 3JAMK 2F5DA 4LB5A 4MHGA 1BI3A 2GIVA 1W4MA 2ESNA 4LJZF 3BY6A 1L3LA 2KIFA 2XHKA 1Z1DA 2W84A 4UNOA 1KQ0A 1LDDA 2G7HA 3V7RA 4S05A 1AWCA 2H6CA 3E5XA 1J9IA 3F8BA 3DKWA 1BIAA 1F1ZA 1QBJA 3HUGA 3COAC 5ILVA 2K02A 4L18B 3FXUA 3TOBA 3MCZA 3KFWX 3IC7A 2OU2A 2XIGA 3RYPA 1Z9CA 3KLNA 1O7LA 1RUNA 4IVNA 1XSVA 2QZ8A 1BI2A 1PP7U 4I0BA 2UXNA 3HSFA 1KYZA 2ZKZA 3M8FA 1FYKA 4ZYGA 1LNWA 1K79A 3U1DA 2FRHA 4ZZLA 1KYWA 4EQQA 3J7AO 4ENMA 3J81Z 1Z05A 3WGHA 3ML6A 2RDPA 1SD6A 4Y15A 2Z99A 2QUFA 2ZBKA 3KEOA 2W85A 1GXQA 3FMRA 4KUMA 3LAPA 2EWNA 1U8RA 4ZZDA 2VT2A 2KIUA 4HYEA 2WC2A 4DQ2A 3E6MA 2K7LA 3V4GA 1SD4A 2HQRA 4KN4X 4KDPA 1BI0A 2HKXA 4IJAA 2IJLA 3F3XA 3ZMUA 2M8EA 3TO7A 1HSJA 3TQNA 4CICA 3SZTA 1YS7A 5FD6A 5E1ZB 2O03A 2V1XA 1FT9A 2H6BA 1BIBA 3VEPA 5AONA 5L3CA 2Z3YA 1MDMB 3HHGA 1OYYA 2R7DA 4EJVA 1DDNA 3EETA 2NS0A 4WXHA 3MFKA 1UCRA 1FWZA 2P5LC 1FZPB 2YU3A 5JI6A 4G7HF 1JHFA 2QYOA 2ZMEB 1I6XA 1O3TA 2V9VA 1U5TA 3WTVC 3T8TA 1MD0A 4N9IA 3IKTA 3K1PA 1XB4A 1ZRCA 1J5YA 4P9FA 4OINF 4HQMA 4ESJA 2PJPA 2Q0OA 3K2ZA 5F6FA 1T6SA 5LLQA 1U5TC 3F8NA 4EM1A 4GGGA 1I27A 3ERED 3HOTA 3R0JA 2DPUA 4JQFA 2EFOA 3TGNA 1J75A 4O6JA 5KK1A 1JHHA 2P7CB 3GLXA 3IRQA 4G6DA 2RN7A 2QBYB 2EJRA 2XV4S 2JT1A 3GVAA 4G7OF 3LA3A 4KN7X 1P4WA 2FBIA 3E5QA 3QRFF 4UVCA 1SAXA 1F4KA 1RIOH 2X4HA 1Q1HA 1GHCA 2PFBA 3DP7A 4KFCA 2Y48A 1IXRC 1AOYA 3F8FA 4IPAA 1RUOA 1O3RA 3GFLA 4A6DA 3LQRA 5FO5A 3BJOA 4G9YA 2V79A 1B9NA 1DUXC 1OKRA 2STWA 3GYHX 1BM9A 1XGNA 1YLFA 3IRRA 1YW9A 2V1UA 2Z33A 3ABUA 2HFHA 1XSDA 3RKYA 4WXCA 3DEUA 2DLLA 2DBBA 3GO5A 3WE3A 5J8FA 2DK5A 4L9NA 1MJAA 4A0YA 1U2WA 4ON0A 2O3FA 4F7ZA 1ZH5A 2FMYA 2GXGA 1J7KA 3SQNA 3I4PA 4IHSA 2XKPA 3C18A 2J5OA 4M9XA 5JR3A 3R61A 5L3FA 4L9TA 5LEKA 1MJBA 2QENA 2DU9A 2Z5UA 4WX9A 3EYYA 4R1HA 4EMSA 2ZO4A 1FYMA 2M1BA 1BC8C 1SFEA 5L3DA 1SD5A 2E1CA 1EH7A 1FX7A 4L9VA 4BHPA 4I7HA 2XAQA 3HIFA 3QP5A 2BE5F 4XSZF 2Y0MA 2HDCA 2L54A 1S29A 5HS7A 3O3KA 2CGPA 4LMYA 1Z6TA 1O57A 3MAJA 3BZ6A 3KP4A 2MLGA 3KLOA 1R36A 1E17A 2DAOA 2VE9A 4WXDA 2CQKA 3O2PE 2HGCA 2EFPA 3GFIA 1G4DA 2IT0A 3G73A 4AVPA 3O6BB 3SHFA 1HW1A 3RKXA 2OD5A 2LF8A 1B4AA 4O3MA 2IVMA 4LK1F 4I2OA 3KZYA 1R7JA 2HYFA 2COMA 2E1NA 3D0SA 4OIQF 1W7PA 1P92A 5HVQC 1I5ZA 3ZP5A 4EM2A 2CO5A 1KU2A 2HR3A 1WQ2A 3KCCA 3K0LA 3IKVA 4G94A 1WSUA 4OMYA 3ZMZA 3NRVA 1JXSA 3LSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6Y A;  3BDD A;  4K2E A;  3P7N A;  4GYG A;  2ZJ2 A;  3PQJ A;  2FNP A;  4B8X A;  2PN6 A;  3ZMV A;  3HHH A;  4L5I A;  4AD9 A;  2JZY A;  3I54 A;  4JBA A;  2L3D A;  4HX8 A;  1XMA A;  2M5W A;  2K86 A;  1IZ1 A;  4ENN A;  3OV8 A;  5CVV A;  1BBY A;  1SD7 A;  2NRA C;  3GX4 X;  3GZ6 A;  3KP3 A;  2YPR A;  2W24 A;  2XRO A;  1YTY A;  2FML A;  4P55 A;  1YO5 C;  5ERI A;  3T5X A;  1ON1 A;  4OIR F;  2ZXJ A;  3TKY A;  1G3W A;  5HLG A;  4LFU A;  1RI7 A;  4GXO A;  2M87 A;  1O3Q A;  1P2F A;  2KJC A;  3GFM A;  2OAZ A;  2D1H A;  3FZV A;  1ZLK A;  2QWW A;  3QPH A;  1ZG5 A;  3VFZ A;  3F21 A;  2UZK A;  4UVB A;  4ASN A;  4PZJ A;  1RZ4 A;  5LRR A;  1U78 A;  5DD8 A;  1B9M A;  3DXJ F;  1DPR A;  1Z6R A;  5BS6 A;  3BJ6 A;  1T2K A;  3H3U A;  4KYW A;  4B09 A;  2E7W A;  2HYG D;  2V1D A;  4RB2 C;  3R4K A;  3GFJ A;  5JVT A;  3P9I A;  2OBP A;  1SMT A;  3MQ0 A;  2Z9O A;  1YG2 A;  5E18 F;  4E70 A;  3REO A;  1KQ8 A;  4IRH A;  1WWX A;  2RQP A;  2CG4 A;  1Y0U A;  3FM5 A;  3QAH A;  2ZFW A;  4WK8 F;  3WG9 A;  3JSO A;  4ETS A;  3DQV C;  2OQR A;  2DO7 A;  4ZYH A;  1ZN2 A;  4Y17 A;  3E6B A;  5FD5 A;  3GF2 A;  1IRG A;  4EGY A;  4TV7 A;  5K1Y A;  4RB3 C;  3BWG A;  3F23 A;  4KIF A;  1WI9 A;  2P5V A;  1QNT A;  1ON2 A;  4CXF A;  4A6E A;  2M45 A;  4L5J A;  4QWQ A;  3KP7 A;  1IN5 A;  2HOE A;  2L01 A;  4UHT A;  3QU3 A;  3T1B A;  5FGM A;  4OOI A;  3M9A A;  3WTZ A;  2XAJ A;  2RGV A;  3CLO A;  2QQ9 A;  2WWY A;  3L9F A;  4GO1 A;  5K5O A;  3F6O A;  1HKS A;  1MJ9 A;  1IW7 F;  1W5S A;  1ONV A;  5HS9 A;  2HS5 A;  4CO8 A;  1K78 A;  1S8N A;  2A6H F;  2RC4 A;  5F1R A;  3F72 A;  4FHT A;  1FSE A;  4HX4 A;  3GZ5 A;  2OZU A;  3I59 B;  3T0Y A;  3R6S A;  3W6K B;  2GXB A;  3E97 A;  1U3E M;  4XSX F;  4P9U A;  4HF1 A;  2Q2E A;  2F5C A;  3Q9V A;  1R1V A;  1FSH A;  3HTS B;  3V8J A;  4OMZ A;  4AIH A;  3V8L A;  4ESB A;  1UB9 A;  2YX4 A;  1R00 A;  3E6D A;  3HYI A;  4FT8 A;  2ADU A;  4MNU A;  3WGI A;  4Y13 A;  3CUQ C;  2PBI A;  1P6R A;  3ABT A;  2A6E F;  3L00 A;  2H09 A;  4HF2 A;  1ZGJ A;  4PGH A;  3J81 K;  2KJB A;  3RPU A;  2FOK A;  1TQP A;  3Q9S A;  1K6O A;  3Q5F A;  2RVC A;  1YYV A;  2EA4 A;  2P6S A;  5LGU A;  2STT A;  3VOD A;  3RYR A;  4LK0 F;  5LGT A;  2ZNY A;  1RNL A;  4HQE A;  1ZRE A;  5DD4 A;  3RDI A;  4M71 A;  4BAY A;  2BEO A;  2DFI A;  3FM3 A;  2AXL A;  3DPT A;  1HQC A;  5HDG A;  5IT9 K;  3KP6 A;  4A12 A;  2XAF A;  4XRF A;  4KT5 C;  4I09 A;  3JAM Z;  2MC3 A;  3H92 A;  3DF8 A;  1CF7 A;  5FLX Z;  2A3S A;  4G8X A;  4Q4Z F;  2F5E A;  5LHH A;  3TDU C;  4EGZ A;  2FXA A;  2FBH A;  2QQA A;  2A69 F;  3WU1 B;  5L3G A;  3E5U A;  2P6T A;  1S6L A;  1QGP A;  2KKO A;  5A2Q Z;  4U88 A;  5H6Q A;  2BGC A;  3P9K A;  3JTG A;  3SFZ A;  1OYI A;  1KU3 A;  1HXD A;  5HLH A;  1XGO A;  5LHI A;  1UST A;  2HTJ A;  4HA8 A;  1OPC A;  2KIM A;  2PI0 A;  4LG0 B;  2DK8 A;  4M73 A;  3RIR A;  4ZH4 F;  1FNN A;  3E6C C;  3F6V A;  1S7A A;  5IT9 Z;  4UUV A;  3OOP A;  5AIQ A;  3JW4 A;  4A0X A;  5FLX K;  3T8R A;  3CTA A;  1UHW A;  4CGZ A;  4KNY A;  4UVA A;  4M6Y A;  4AIK A;  1CGP A;  5E8I A;  3SXY A;  3I5U A;  1O7F A;  1MDM A;  2IA1 A;  4EV0 A;  5EEG A;  2VC0 A;  2PQ8 A;  1XGS A;  3WTY C;  1KU7 A;  4U7D A;  4RGU A;  3IWF A;  4RB0 A;  1USS A;  4S04 A;  2K27 A;  1MZB A;  3BOQ A;  1QZZ A;  2G9W A;  3I0T A;  3ZN1 A;  2QVO A;  2BYV E;  2K4B A;  1FC3 A;  1VTN C;  4OIO F;  2O0Y A;  3TO9 A;  4A5N A;  2QM3 A;  1XCV A;  3WU0 A;  3FMQ A;  3BRO A;  1FOK A;  1OMI A;  1IXS B;  3DPL C;  4G6Q A;  4I02 A;  1TTY A;  5ICE A;  5JFR A;  4WWC A;  1O3S A;  1D5V A;  2GA1 A;  5J8C A;  3F8C A;  2JSC A;  2XKO A;  2NYX A;  1XN7 A;  1E2X A;  4OIP F;  3HRT A;  2B0L A;  2NNN A;  1S7O A;  1J2X A;  4YFX F;  1YQA A;  5H20 A;  5F64 A;  4LB6 B;  3K1M A;  2YX7 A;  4RB1 A;  2D2W A;  1R58 A;  1XSX A;  4EJT A;  2CW0 F;  2XAS A;  1SFX A;  2DQL A;  4MEX F;  1KQ9 A;  2OA4 A;  1R22 A;  4CYD A;  3B02 A;  5BOX A;  4RAY A;  4HDV A;  3C3W A;  3RPQ A;  3MWM A;  2NAZ A;  6PAX A;  2RKH A;  2MLK A;  3ZQ7 A;  3KET A;  2UXX A;  1HKQ A;  2ESH A;  3C1D A;  3M7G A;  2VOP A;  1IXC A;  1MGT A;  5HS8 A;  1I1G A;  3HSE A;  2EV5 A;  1LDK B;  1GVJ A;  4CDG A;  4G7Z F;  2F5F A;  3HRS A;  2PG4 A;  3W6J B;  1ZRF A;  2VOO A;  1V3F A;  2J5P A;  2DQR A;  5HLI A;  2FU4 A;  5ICG A;  2PMU A;  1C0W A;  3GWZ A;  1A04 A;  5ICF A;  4A0Z A;  3R0A A;  4ZYD A;  1QO0 D;  2O61 A;  1PUE E;  4UXN A;  3ROU A;  2JRT A;  1FP2 A;  1KA8 A;  2QQB A;  4ESF A;  2DI3 A;  1ZAR A;  1V4R A;  3CO7 C;  1IN6 A;  1YW7 A;  3V7S A;  3WTT C;  2GWR A;  3EQL F;  3CUO A;  4GCV A;  2VBZ A;  3KP5 A;  1YW8 A;  5K5Q A;  1U5T B;  3GW2 A;  1ZGA A;  4OU0 A;  4P96 A;  4HLX A;  2FF4 A;  3L2C A;  2G7U A;  5J6X A;  4QLC U;  2IPQ X;  4EVI A;  3V8K A;  4PCQ A;  4BQA A;  2Y75 A;  2CSO A;  3G3Z A;  4R8H A;  4BYY A;  3DFG A;  2Q8K A;  1QZY A;  5DUK A;  3FHZ A;  1FBQ A;  2GQQ A;  4MGR A;  3CUQ A;  4FX4 A;  2V6C A;  1FYL A;  2P7V B;  2VE8 A;  4LD5 A;  3U2R A;  4Q47 A;  4H0E A;  2PMH A;  2ZNZ A;  2GAU A;  1P4A A;  2EFW A;  1W7P B;  2O6G E;  1J59 A;  5TJJ A;  1IN4 A;  4XLN F;  5H6R A;  5AIP A;  3PFI A;  1ZG1 A;  2MBF A;  5EEH A;  5D4R A;  1UFM A;  3BP8 A;  1LVA A;  2HWV A;  2HEO A;  2KRF A;  2PEX A;  2K4J A;  4MTE A;  5ED4 A;  4M6X A;  2JPC A;  3V7C A;  2OZ6 A;  5CJ9 A;  3E3V A;  4CHU A;  1T39 A;  3WE2 A;  5FB2 A;  1B1B A;  1PP8 F;  3GUD A;  4I98 B;  3I58 A;  1LQ1 A;  5D4S A;  4HF0 A;  2RNJ A;  4RAZ A;  2A68 F;  2WV0 A;  1K78 B;  3P9C A;  4BNC A;  2FBK A;  1MKM A;  1T0F A;  4BHB A;  4LLG F;  4LLN A;  3VB2 A;  2QBY A;  1R1T A;  1TBX A;  4KMF A;  4HX7 A;  5D8L B;  3QU6 A;  2D45 A;  1R23 A;  1DP7 P;  3EDP A;  4ENJ A;  2FSW A;  5E1X A;  3CJN A;  2MD5 A;  2LF7 A;  2VXZ A;  3LA2 A;  4YFK F;  5ILU A;  1Z91 A;  4LGW A;  2OQG A;  1XDS A;  3B73 A;  4AWX B;  4EJO A;  2W57 A;  1QQI A;  4I0A A;  3WTX C;  2ETH A;  2HKO A;  3M1E A;  4KIB A;  1YS6 A;  4M9Z A;  5LRS A;  2VT3 A;  4ZYE A;  2GA2 A;  3N4M A;  5D5U B;  2GZW A;  4RGR A;  1J0R A;  1LDJ A;  5D5V B;  5E20 A;  2JTV A;  3CDH A;  2JPB A;  2L4A A;  1G6N A;  2XVC A;  1ZAO A;  2EA2 A;  1WRJ A;  2A5Y B;  1KGS A;  3ECH A;  5A2Q K;  1F9N A;  2CWE A;  1YIO A;  3RI4 A;  3I64 A;  3J80 K;  3I53 A;  2LDU A;  5LEJ A;  2QLZ A;  3SZP A;  3QPT A;  2DW4 A;  3LFK A;  1L0O C;  3CO6 C;  3H3Z A;  1NHA A;  3FF5 A;  3GEZ A;  5LGN A;  3IL2 A;  3U9G A;  2VBY A;  2HQN A;  2TDX A;  5DCM B;  4XBF A;  4KIC A;  1IAW A;  3IHU A;  1W5T A;  1Z7U A;  2P5K A;  4M74 A;  2FA5 A;  5D5X B;  4U0V A;  2UWM A;  4HV6 A;  1DPU A;  2E7X A;  3S2W A;  3C7J A;  4DNC A;  2A07 F;  1D3Y A;  4YG2 F;  1LJ9 A;  5FFX A;  3BPV A;  1UHM A;  5CVU A;  3LWF A;  4N9H A;  1BJA A;  4HOB A;  4D0P A;  3HTU A;  1ZYR F;  1R5G A;  1T38 A;  1STZ A;  1FY7 A;  1SMY F;  2O8X A;  2D1V A;  3ZN0 A;  4M9S A;  5CVR A;  1B59 A;  1OYW A;  3HRM A;  3L7W A;  3ECO A;  4MQV A;  4MQ9 F;  2VBX A;  5CLS A;  3N97 A;  4BH9 A;  1H9T A;  5ILS A;  2VBW A;  2MA3 A;  4I01 A;  5DCM A;  2R7F A;  3NEU A;  1TW3 A;  4HBL A;  2XUB A;  4HZF A;  3F22 A;  1XDU A;  1HBX G;  1GXP A;  1IN7 A;  3F8M A;  3ISP A;  2ELH A;  5CYV A;  4BHC A;  4AIJ A;  2FQ3 A;  2R3S A;  5L3E A;  5DYM A;  2IP2 A;  5E17 F;  2VON A;  1T98 A;  3K69 A;  4A5M A;  4HDU A;  3QOP A;  3QP6 A;  3HOS A;  3MEX A;  3NQO A;  2BBY A;  4M72 A;  1H9G A;  2L4M A;  1JGS A;  4MEY F;  4EJU A;  5BMZ A;  1JE8 A;  1ZRD A;  3ULQ B;  5TRD A;  5DEQ A;  1W7P D;  1D8K A;  3KZZ A;  1FP1 D;  2IRF G;  1P4X A;  5D6F A;  4U0W A;  3TO6 A;  3AAF A;  4YFN F;  1K7A A;  4P5O A;  1HW5 A;  1ULY A;  2ACJ A;  5LHG A;  3TOA A;  4Q5S F;  5IT3 A;  2PLY A;  3FWE A;  3WOD F;  4HAM A;  3FXQ A;  2EFN A;  5DCF A;  5HDK A;  5DDG A;  1D8J A;  1IF1 A;  2ISZ A;  2XAH A;  3MZY A;  3WTS C;  1F5T A;  3VOE A;  1ZHF A;  5JHU A;  2NNY A;  1XMK A;  1XGM A;  5L3B A;  5FFZ A;  1ZLJ A;  4R79 A;  4L0Y B;  4L9J A;  5ICC A;  4PDK A;  1TLH B;  2MH9 A;  2WTE A;  1S3J A;  3LQQ A;  3WTU C;  1XD7 A;  4O5V A;  5E8G A;  1IN8 A;  3DV8 A;  5D5W B;  3ELK A;  2L02 A;  2EK5 A;  3R60 A;  1KU9 A;  4UV8 A;  1G3S A;  2FE3 A;  4RGX A;  1SFU A;  3GXO A;  2YR2 A;  2ZCW A;  1LEB A;  3RTR A;  1TQI A;  2IA2 A;  4WF2 A;  2DTR A;  3HSR A;  1EH8 A;  1FPQ A;  2YSR A;  3KP2 A;  4NB5 A;  1EH6 A;  5CVI A;  2DPD A;  1BC7 C;  3BJA A;  4YII A;  3K1N A;  2LSO A;  2VC1 A;  1R5H A;  5E1W A;  1REP C;  4FX0 A;  5DV5 A;  4U0Y A;  2W25 A;  3ZMS A;  4NHJ A;  1U6G A;  2HZT A;  4EJW A;  1I1S A;  2EV0 A;  2FNA A;  2H94 A;  1FBS A;  3LA7 A;  2A61 A;  3WGG A;  1HW2 A;  2LKP A;  4RS8 A;  2IA0 A;  1PDN C;  5BPD A;  1BN5 A;  5K5R A;  4KMU X;  1G3T A;  3I59 A;  3D5L A;  3K9T A;  4Q48 A;  2EFQ A;  4IXA A;  4RGS A;  1LEA A;  5KVR A;  1XCB A;  2F2E A;  2XRN A;  3PQK A;  3LAJ A;  4YIF A;  3TDZ C;  4N0B A;  1ZG3 A;  4Z2Y A;  2XGX A;  4IHT A;  1X3U A;  4KA4 A;  3JTH A;  3J80 Z;  4JK1 X;  5BQT A;  4WCG A;  3BPX A;  3IWZ A;  4BXU A;  1QPM A;  2RV8 A;  1IUY A;  3EUH A;  1WKM A;  5D6E A;  4LG0 A;  4KIG A;  3RKW A;  2P8T A;  1BOA A;  2X0L A;  4UV9 A;  3HRU A;  4XLP F;  3FXR A;  4A2U A;  2ZME A;  1FLI A;  3ZPL A;  3FMS A;  3ZMT A;  4L0Z B;  4GYI A;  2XAG A;  2LNB A;  3L09 A;  5DUI A;  1HST A;  3KE2 A;  4U7B A;  1TQM A;  5HOO A;  1IRF A;  4MTD A;  2HTS A;  1H0M A;  4HLY A;  1LB2 A;  2CFX A;  5BPI A;  2H27 A;  3KEQ A;  4HV5 A;  5D8K B;  2P4W A;  1EV7 A;  3EYI A;  2FEZ A;  2VOD A;  1R1U A;  3I71 A;  1CF7 B;  4IF4 A;  1G3Y A;  4IRG A;  5LBQ A;  1B6A A;  1OR7 A;  3FX3 A;  2ISY A;  2MH2 A;  1TNT A;  2IW5 A;  5CVJ A;  1ODD A;  4CZZ A;  1TNS A;  4LLL A;  2EV6 A;  4HW0 A;  1BI1 A;  5HDN A;  4NQW A;  4EM0 B;  1TW2 A;  3JSP A;  2M30 A;  2AS5 F;  1FBU A;  3RJP A;  3WTW C;  3M8E A;  3CUQ B;  4PGG A;  2VN2 A;  2BV6 A;  3MZH A;  3ZMD A;  4ENK A;  2DT5 A;  2EB7 A;  4IRI A;  1HKT A;  1YFH A;  2CYY A;  3JAM K;  2F5D A;  4LB5 A;  4MHG A;  1BI3 A;  2GIV A;  1W4M A;  2ESN A;  4LJZ F;  3BY6 A;  1L3L A;  2KIF A;  2XHK A;  1Z1D A;  2W84 A;  4UNO A;  1KQ0 A;  1LDD A;  2G7H A;  3V7R A;  4S05 A;  1AWC A;  2H6C A;  3E5X A;  1J9I A;  3F8B A;  3DKW A;  1BIA A;  1F1Z A;  1QBJ A;  3HUG A;  3COA C;  5ILV A;  2K02 A;  4L18 B;  3FXU A;  3TOB A;  3MCZ A;  3KFW X;  3IC7 A;  2OU2 A;  2XIG A;  3RYP A;  1Z9C A;  3KLN A;  1O7L A;  1RUN A;  4IVN A;  1XSV A;  2QZ8 A;  1BI2 A;  1PP7 U;  4I0B A;  2UXN A;  3HSF A;  1KYZ A;  2ZKZ A;  3M8F A;  1FYK A;  4ZYG A;  1LNW A;  1K79 A;  3U1D A;  2FRH A;  4ZZL A;  1KYW A;  4EQQ A;  3J7A O;  4ENM A;  3J81 Z;  1Z05 A;  3WGH A;  3ML6 A;  2RDP A;  1SD6 A;  4Y15 A;  2Z99 A;  2QUF A;  2ZBK A;  3KEO A;  2W85 A;  1GXQ A;  3FMR A;  4KUM A;  3LAP A;  2EWN A;  1U8R A;  4ZZD A;  2VT2 A;  2KIU A;  4HYE A;  2WC2 A;  4DQ2 A;  3E6M A;  2K7L A;  3V4G A;  1SD4 A;  2HQR A;  4KN4 X;  4KDP A;  1BI0 A;  2HKX A;  4IJA A;  2IJL A;  3F3X A;  3ZMU A;  2M8E A;  3TO7 A;  1HSJ A;  3TQN A;  4CIC A;  3SZT A;  1YS7 A;  5FD6 A;  5E1Z B;  2O03 A;  2V1X A;  1FT9 A;  2H6B A;  1BIB A;  3VEP A;  5AON A;  5L3C A;  2Z3Y A;  1MDM B;  3HHG A;  1OYY A;  2R7D A;  4EJV A;  1DDN A;  3EET A;  2NS0 A;  4WXH A;  3MFK A;  1UCR A;  1FWZ A;  2P5L C;  1FZP B;  2YU3 A;  5JI6 A;  4G7H F;  1JHF A;  2QYO A;  2ZME B;  1I6X A;  1O3T A;  2V9V A;  1U5T A;  3WTV C;  3T8T A;  1MD0 A;  4N9I A;  3IKT A;  3K1P A;  1XB4 A;  1ZRC A;  1J5Y A;  4P9F A;  4OIN F;  4HQM A;  4ESJ A;  2PJP A;  2Q0O A;  3K2Z A;  5F6F A;  1T6S A;  5LLQ A;  1U5T C;  3F8N A;  4EM1 A;  4GGG A;  1I27 A;  3ERE D;  3HOT A;  3R0J A;  2DPU A;  4JQF A;  2EFO A;  3TGN A;  1J75 A;  4O6J A;  5KK1 A;  1JHH A;  2P7C B;  3GLX A;  3IRQ A;  4G6D A;  2RN7 A;  2QBY B;  2EJR A;  2XV4 S;  2JT1 A;  3GVA A;  4G7O F;  3LA3 A;  4KN7 X;  1P4W A;  2FBI A;  3E5Q A;  3QRF F;  4UVC A;  1SAX A;  1F4K A;  1RIO H;  2X4H A;  1Q1H A;  1GHC A;  2PFB A;  3DP7 A;  4KFC A;  2Y48 A;  1IXR C;  1AOY A;  3F8F A;  4IPA A;  1RUO A;  1O3R A;  3GFL A;  4A6D A;  3LQR A;  5FO5 A;  3BJO A;  4G9Y A;  2V79 A;  1B9N A;  1DUX C;  1OKR A;  2STW A;  3GYH X;  1BM9 A;  1XGN A;  1YLF A;  3IRR A;  1YW9 A;  2V1U A;  2Z33 A;  3ABU A;  2HFH A;  1XSD A;  3RKY A;  4WXC A;  3DEU A;  2DLL A;  2DBB A;  3GO5 A;  3WE3 A;  5J8F A;  2DK5 A;  4L9N A;  1MJA A;  4A0Y A;  1U2W A;  4ON0 A;  2O3F A;  4F7Z A;  1ZH5 A;  2FMY A;  2GXG A;  1J7K A;  3SQN A;  3I4P A;  4IHS A;  2XKP A;  3C18 A;  2J5O A;  4M9X A;  5JR3 A;  3R61 A;  5L3F A;  4L9T A;  5LEK A;  1MJB A;  2QEN A;  2DU9 A;  2Z5U A;  4WX9 A;  3EYY A;  4R1H A;  4EMS A;  2ZO4 A;  1FYM A;  2M1B A;  1BC8 C;  1SFE A;  5L3D A;  1SD5 A;  2E1C A;  1EH7 A;  1FX7 A;  4L9V A;  4BHP A;  4I7H A;  2XAQ A;  3HIF A;  3QP5 A;  2BE5 F;  4XSZ F;  2Y0M A;  2HDC A;  2L54 A;  1S29 A;  5HS7 A;  3O3K A;  2CGP A;  4LMY A;  1Z6T A;  1O57 A;  3MAJ A;  3BZ6 A;  3KP4 A;  2MLG A;  3KLO A;  1R36 A;  1E17 A;  2DAO A;  2VE9 A;  4WXD A;  2CQK A;  3O2P E;  2HGC A;  2EFP A;  3GFI A;  1G4D A;  2IT0 A;  3G73 A;  4AVP A;  3O6B B;  3SHF A;  1HW1 A;  3RKX A;  2OD5 A;  2LF8 A;  1B4A A;  4O3M A;  2IVM A;  4LK1 F;  4I2O A;  3KZY A;  1R7J A;  2HYF A;  2COM A;  2E1N A;  3D0S A;  4OIQ F;  1W7P A;  1P92 A;  5HVQ C;  1I5Z A;  3ZP5 A;  4EM2 A;  2CO5 A;  1KU2 A;  2HR3 A;  1WQ2 A;  3KCC A;  3K0L A;  3IKV A;  4G94 A;  1WSU A;  4OMY A;  3ZMZ A;  3NRV A;  1JXS A;  3LST A; 
#chains in the Genus database with same CATH topology
 2C6Y A;  1S9H A;  3BDD A;  3WG7 H;  1A35 A;  4K2E A;  2X6O A;  3P7N A;  4C2M J;  3J7Y J;  2DOD A;  5HLT A;  4GYG A;  1VND A;  2ZJ2 A;  3PQJ A;  2FNP A;  4B8X A;  2PN6 A;  1MH4 A;  2L7F P;  3ZMV A;  3HHH A;  4L5I A;  1JKR C;  5J1U A;  4AD9 A;  2JZY A;  3AG2 H;  4HSR A;  3I54 A;  4JBA A;  3LFU A;  2V6E A;  2L3D A;  4HX8 A;  3VPR A;  1HLV A;  1XMA A;  2M5W A;  2VL8 A;  2PMZ A;  2K86 A;  2EZL A;  2HVQ A;  1YRN B;  1IZ1 A;  4ENN A;  1LFB A;  3OV8 A;  5CVV A;  1APL C;  1BBY A;  1SD7 A;  2NRA C;  3GX4 X;  3GZ6 A;  3M07 A;  3KP3 A;  2QF7 A;  3O8G A;  1X19 A;  2YPR A;  2W24 A;  2XRO A;  1YTY A;  2FML A;  4P55 A;  1YO5 C;  2L9N A;  2FD5 A;  5ERI A;  3T5X A;  1ON1 A;  3CCY A;  4OIR F;  2ZXJ A;  2WA0 A;  3DTI A;  3TKY A;  1G3W A;  5HLG A;  4LOC A;  4LFU A;  3CC2 I;  5LFA A;  3IAM 2;  3IUO A;  4IHY A;  2DMT A;  5JLX A;  4EEF G;  1H88 C;  1RI7 A;  4GXO A;  2HVR A;  2CQ7 A;  2M87 A;  5TGT A;  4A3I J;  1O3Q A;  1P2F A;  2K3P A;  1W0U A;  2KJC A;  1E3O C;  3GFM A;  1AU7 A;  2OAZ A;  1NK3 P;  2D1H A;  2VUM J;  3FZV A;  1MMS A;  1ZLK A;  2IGM A;  2QWW A;  1T0F C;  3QPH A;  1ZG5 A;  4E7S A;  1A31 A;  2QKL B;  3VFZ A;  3F21 A;  2UZK A;  4UVB A;  1AHD P;  4ASN A;  4PZJ A;  1RZ4 A;  5LRR A;  4JOM A;  1U78 A;  5DD8 A;  1B9M A;  1LKX A;  1WJA A;  2BHY A;  3DXJ F;  1DPR A;  1Z6R A;  1VFC A;  1TL8 A;  5BS6 A;  2TCT A;  3S2H J;  3BJ6 A;  1T2K A;  3W2A A;  2R7Q A;  2PJR A;  3H3U A;  5B3S H;  4KYW A;  4B09 A;  2E7W A;  1XG1 A;  3QPS A;  2HYG D;  2V1D A;  4RB2 C;  1H8A C;  3R4K A;  3GFJ A;  3ZQQ A;  5JVT A;  3HGG A;  4KIS A;  5J4V A;  2DDA A;  1MIJ A;  4D5C A;  2H1K A;  1OR7 C;  3P9I A;  5B1A H;  2VKH A;  2OBP A;  3QOE A;  1SMT A;  3MQ0 A;  1LE8 A;  1HOM A;  4BUP A;  3MMY B;  3GTK J;  2Z9O A;  1YG2 A;  5E18 F;  2X6W A;  4FE4 A;  4E70 A;  2W82 A;  3O8H A;  2IS1 A;  3JCU C;  3REO A;  4IX7 A;  3HBL A;  1KQ8 A;  2CMP A;  4IRH A;  1IC8 A;  4PFP A;  5E3M A;  1WWX A;  2RQP A;  4B43 A;  2CG4 A;  1Y0U A;  3FM5 A;  3NWS A;  3QAH A;  3U21 A;  2ZFW A;  2BVM A;  4WK8 F;  2XPV A;  3WG9 A;  1R5I D;  3JSO A;  4F52 A;  1OCR H;  2F48 A;  4ETS A;  3DQV C;  5JLW A;  4A3C J;  2OQR A;  4XID A;  2DO7 A;  4ZYH A;  1WZ2 A;  2KZG A;  3OR2 C;  2YS9 A;  1ZN2 A;  4Y17 A;  3LSP A;  3E6B A;  5FD5 A;  2L7K A;  3GF2 A;  4ZTF A;  1IRG A;  4EGY A;  4TV7 A;  5K1Y A;  2P81 A;  2CFO A;  3BWG A;  4D7M A;  4RB3 C;  3F23 A;  1BA5 A;  4B47 A;  2L0K A;  4KIF A;  1M1E B;  3L2U A;  3OYM A;  1WI9 A;  2P5V A;  1QNT A;  4RM2 A;  1ON2 A;  4CXF A;  2Y0S A;  4A6E A;  5FJ8 J;  2M45 A;  4L5J A;  4QWQ A;  2NVY J;  3FXO A;  3KP7 A;  2COB A;  1IN5 A;  1E3H A;  2PMZ N;  2HOE A;  2L01 A;  4UHT A;  4C2T A;  3QU3 A;  3T1B A;  2LC2 A;  1R4M B;  3G1M A;  2BW3 A;  5FGM A;  4OOI A;  3M9A A;  3WTZ A;  3BR5 A;  2XAJ A;  2RGV A;  3CLO A;  2DYR H;  2QQ9 A;  1WVR A;  2WWY A;  3L9F A;  3W2V A;  1IJW C;  4GO1 A;  3SDB A;  5K5O A;  3F6O A;  2Y2Z A;  1HKS A;  3L2W A;  1MJ9 A;  3G2B A;  5IP7 J;  1JKQ C;  1IW7 F;  1OQY A;  1W5S A;  2R7X A;  1ONV A;  5HS9 A;  2HS5 A;  4CO8 A;  1K78 A;  4QSH A;  1S8N A;  1ZR4 A;  1VQ9 I;  2A6H F;  2GOX B;  2VQG A;  3A1Y A;  3ZOB A;  3ABL H;  2RC4 A;  5F1R A;  3F72 A;  2JUG A;  2F4I A;  3OYC A;  2EZK A;  3ABM H;  2LYC A;  2A6T A;  4FHT A;  1FSE A;  3OYH A;  4HX4 A;  2XC7 A;  3GZ5 A;  1OLT A;  2OZU A;  3I59 B;  3LMM A;  3HL2 A;  5KHD A;  2EIJ H;  3T0Y A;  1GV5 A;  3R6S A;  3W6K B;  2GXB A;  1FOX A;  2DDB A;  3E97 A;  2R7Z J;  1T95 A;  1U3E M;  3S3N A;  4XSX F;  2VI6 A;  4P9U A;  4HF1 A;  2Q2E A;  2F5C A;  3Q9V A;  2VKE A;  1R1V A;  1DU0 A;  1FSH A;  3PO3 J;  3HTS B;  1A5J A;  1IUF A;  1D1A A;  2LR8 A;  3V8J A;  4OMZ A;  4AIH A;  3V8L A;  4ESB A;  1UB9 A;  2K9N A;  2YX4 A;  4F55 A;  1R00 A;  3JRH A;  3E6D A;  3HYI A;  4FT8 A;  4B1R A;  5GPC A;  2ADU A;  1RRJ A;  3ESW B;  4MNU A;  4ZDL A;  3WGI A;  1VQ4 I;  4Y13 A;  2DJI A;  1X1D A;  3GTJ J;  3CUQ C;  2PBI A;  3BZK A;  1P6R A;  2G0E A;  3ABT A;  4C3J J;  2A6E F;  3L00 A;  1ZEL A;  2NOJ B;  2HPM A;  1YI2 I;  3PSF A;  4RAG A;  2H09 A;  4HF2 A;  1ZGJ A;  4GRI A;  1EKE A;  2JN6 A;  4PGH A;  4NDL A;  3K7A J;  3J81 K;  2KJB A;  3RPU A;  2FOK A;  3VYR B;  1T8I A;  3K10 A;  3DU6 A;  2EBI A;  1TQP A;  4XOP A;  2BHZ A;  3Q9S A;  1K6O A;  2HZD A;  5M5Y J;  3Q5F A;  2RVC A;  1YYV A;  2EA4 A;  2P6S A;  4A3F J;  1WCM J;  5LGU A;  1AKH A;  2WV1 A;  1SFO J;  2STT A;  3VOD A;  3A03 A;  2WAQ A;  3RYR A;  3LSJ A;  3IH4 A;  4LK0 F;  1AA7 A;  3LSH A;  3ZRG A;  4PSX A;  4G12 A;  2NOG A;  3RKQ A;  2LBF A;  5CKT A;  1IG7 A;  3NWT A;  5LGT A;  1T08 B;  2ZSI B;  2PJR B;  2ZME C;  1RNL A;  2ZNY A;  4HQE A;  4CCL A;  1ZRE A;  3CMA I;  3IH3 A;  3CES A;  5DD4 A;  3RDI A;  3DEW A;  4XN3 A;  2M0C A;  4M71 A;  4BAY A;  2BEO A;  2DFI A;  2FX0 A;  3FM3 A;  2AXL A;  3DPT A;  2GBY A;  1HQC A;  1YJN I;  5HDG A;  5IT9 K;  3EUH C;  3KP6 A;  4A12 A;  1FTZ A;  2XAF A;  2XRL A;  4MIM A;  3FIS A;  4BQN A;  4XRF A;  4KT5 C;  4AU7 A;  2KQR A;  4A3M J;  4I09 A;  3JAM Z;  2MC3 A;  3H92 A;  3QYB A;  3DF8 A;  1CF7 A;  2EIM H;  5FLX Z;  2A3S A;  4G8X A;  4Q4Z F;  1RET A;  2F5E A;  2R7W A;  1VQ8 I;  5LHH A;  3TDU C;  4EGZ A;  2FXA A;  1MMG A;  2FBH A;  4BY1 J;  2QQA A;  4CCJ A;  4HNT A;  2KHM A;  2A69 F;  1MNM C;  3HDD A;  2H1L A;  2KDO A;  4OAZ A;  2CV1 A;  3WU1 B;  2NXN B;  1WJE A;  5L3G A;  3E5U A;  3MKY B;  3OSF A;  2P6T A;  1S6L A;  1S5L C;  2L9V A;  1QGP A;  2KKO A;  3PSI A;  2IS6 A;  3S2D J;  1Z77 A;  5A2Q Z;  4U88 A;  2MFZ A;  5H6Q A;  2LVS A;  4DJA A;  2BGC A;  2OF7 A;  3P9K A;  3JTG A;  3SFZ A;  1WJB A;  1OYI A;  1KU3 A;  1HXD A;  2OPT A;  3ASO H;  5HLH A;  2W4S A;  3RQ4 A;  2OTJ I;  1MBH A;  1XX5 A;  1QHH D;  2B7E A;  1XGO A;  5LHI A;  1Y1V J;  1UST A;  2HTJ A;  2VXD A;  4HA8 A;  1OPC A;  2KIM A;  2PI0 A;  1MSF C;  1A36 A;  1IDY A;  1SVL A;  4LG0 B;  2DK8 A;  3CF5 F;  4M73 A;  4XNF A;  1MMA A;  3RIR A;  4DIQ A;  4ZH4 F;  1FNN A;  3E6C C;  3F6V A;  2VLA A;  1S7A A;  4LG3 A;  1ETK A;  5IT9 Z;  2GXA A;  3OOP A;  4UUV A;  2CUF A;  5AIQ A;  3JRD A;  3JW4 A;  2VB6 A;  3J7Z I;  4A0X A;  1Z3Y A;  3DLA A;  3PIO F;  5FLX K;  3ZQH A;  3T8R A;  1YX5 A;  2CJJ A;  2KPM A;  1RKW A;  3CTA A;  2F4M B;  5CQG A;  3A02 A;  2X85 A;  1UHW A;  2NS7 A;  4CGZ A;  4KNY A;  3GLL A;  4UVA A;  4M6Y A;  1BR1 A;  1KON A;  1OCO H;  2K9L A;  4HEA 2;  4M6V A;  2MYS A;  4AIK A;  1CGP A;  5E8I A;  2IEK A;  3I5U A;  3SXY A;  1O7F A;  2KRH A;  1VQ5 I;  3SFI A;  3JR9 A;  1MDM A;  2IA1 A;  4EV0 A;  5EEG A;  5F08 A;  2VC0 A;  2W1O A;  2PQ8 A;  4W1U A;  4IOC F;  3OYJ A;  1XGS A;  1Z7L A;  2DA5 A;  3WTY C;  1FJL A;  2K9M A;  4C3H J;  1KU7 A;  5DS9 A;  4RGU A;  4U7D A;  4UUS A;  3IWF A;  3L2Q A;  4FTH A;  1SFK A;  1USS A;  4RB0 A;  2BOL A;  4S04 A;  3I4M J;  2K27 A;  1MZB A;  3BOQ A;  1QZZ A;  3K2A A;  1GDT A;  2G9W A;  3I0T A;  3ZN1 A;  2QVO A;  3OOU A;  3SJM A;  2OJE D;  5JHF A;  2BYV E;  4PJ0 C;  2IBD A;  2K4B A;  1FC3 A;  5E3L A;  3ZQF A;  3LSR A;  1ETW A;  1VTN C;  4OIO F;  2O0Y A;  1UG0 A;  1Y0N A;  3TO9 A;  4A5N A;  5GTH C;  2QM3 A;  4BGD A;  3PJR A;  1XCV A;  2E36 A;  3FMQ A;  3BRO A;  3WU0 A;  4IZZ A;  1FOK A;  5FKL A;  1OMI A;  3LSG A;  1IXS B;  3DPL C;  4G6Q A;  4I02 A;  4RMN A;  1TTY A;  1VQP I;  1FIA A;  5ICE A;  2NVU B;  5JFR A;  4WWC A;  3CDI A;  1VQ7 I;  1O3S A;  3KYC B;  2JJ7 A;  1Y1W J;  3FKJ A;  1D5V A;  1I50 J;  4A3J J;  2GA1 A;  5J8C A;  3F8C A;  2JSC A;  2XKO A;  2NYX A;  2M7B A;  2LLK A;  5EGO B;  3DWL E;  1XN7 A;  1E2X A;  4OIP F;  2BXY A;  3HRT A;  2E2J J;  2B0L A;  2VJ5 A;  4BXF A;  4U87 A;  2NNN A;  2FUG 2;  5IYB J;  1S7O A;  1J2X A;  4YFX F;  2A5W A;  1YQA A;  2BY0 A;  5H20 A;  3CCJ I;  2KRC A;  2LY9 A;  5F64 A;  3BTC A;  4LB6 B;  3K1M A;  1A6I A;  2YX7 A;  4RB1 A;  3VWB A;  2JUC A;  2FQ4 A;  2D2W A;  1R58 A;  1Z3X A;  3PUB A;  4CCM A;  5J47 A;  2E5N A;  3S16 J;  1XSX A;  2CW0 F;  3H0G J;  2XAS A;  3QYF A;  4EJT A;  4BAC A;  1SFX A;  2R7T A;  2HVS A;  2DQL A;  4MEX F;  1KQ9 A;  2OA4 A;  2E35 A;  3MD2 A;  4BEH A;  2QCO A;  1R22 A;  4CYD A;  4M3D A;  1FOW A;  3B02 A;  5BOX A;  1X4O A;  4RAY A;  4HDV A;  4UY8 I;  3J7A Y;  3CCS I;  3C3W A;  2OUM A;  3RPQ A;  3MWM A;  2ZJR F;  2NAZ A;  2E5Z A;  4HG2 A;  2TRT A;  6PAX A;  2RKH A;  2MLK A;  1LPQ A;  3ZQ7 A;  5FKM A;  3KET A;  2UXX A;  1U9O A;  3HOW J;  1HKQ A;  3MZ8 A;  5IOY A;  2I8D A;  3HEF A;  5EF6 A;  2ESH A;  2LKX A;  3C1D A;  3M7G A;  2JWT A;  1IXC A;  1MBG A;  5EGO A;  2GLO A;  1MGT A;  2VOP A;  1NG6 A;  1OCZ H;  5HS8 A;  1I1G A;  1ZGW A;  1UJ8 A;  3GTQ J;  3HSE A;  2EV5 A;  1LDK B;  4DOZ A;  1GVJ A;  4CDG A;  4G7Z F;  3BG5 A;  3FBN B;  4II2 A;  2E60 A;  1X58 A;  2KFD A;  2F5F A;  3CF2 A;  5GP9 A;  3HRS A;  1OCP A;  2PG4 A;  2E19 A;  3W6J B;  2VKD A;  4D1Q A;  1ZRF A;  1BJZ A;  2VOO A;  1V3F A;  2J5P A;  2XPU A;  2DQR A;  5HLI A;  2FU4 A;  4FAS D;  5ICG A;  2PMU A;  1C0W A;  3EUK L;  1BR2 A;  2JA7 J;  2DFH A;  3GWZ A;  1A04 A;  3HOU J;  5ICF A;  4A0Z A;  2JMW A;  3R0A A;  4XKC A;  4ZYD A;  1QO0 D;  2O61 A;  2DFE A;  1PUE E;  1NH3 A;  3K70 C;  4UXN A;  4M3E A;  2BW3 B;  1ITY A;  3ROU A;  2JRT A;  1FP2 A;  1KA8 A;  2QQB A;  4ESF A;  3CLQ A;  4OWR B;  2DI3 A;  2HDW A;  2XB5 A;  1ZAR A;  1HA8 A;  1V4R A;  3CO7 C;  1IN6 A;  5FLV A;  3ZQI A;  1YW7 A;  2RRE A;  1OFC X;  3V7S A;  3WTT C;  2GWR A;  3Q0V A;  3EQL F;  3HOV J;  3OYF A;  3CUO A;  1R9T J;  4GCV A;  2VBZ A;  1ACI A;  3A0H C;  3VYT B;  1WJC A;  2R0Q C;  1PJR A;  3KP5 A;  1FMV A;  3ZXS A;  1YW8 A;  5K7Z A;  3ASN H;  4JX4 A;  4AYB A;  5K5Q A;  4ZC3 A;  4Y33 A;  1U5T B;  2KZV A;  5JVG F;  3GW2 A;  1ZGA A;  4OU0 A;  2CQX A;  4P96 A;  4IEJ A;  1RR8 C;  4HLX A;  2CS3 A;  2DN0 A;  2FF4 A;  3L2C A;  3S3M A;  2G7U A;  5J6X A;  1X3Z B;  2A05 A;  2MW8 A;  4JX6 A;  4QLC U;  5HNF A;  5GTI C;  2BZT A;  1DGW Y;  2IPQ X;  4EVI A;  3V8K A;  4PCQ A;  4BQA A;  2Y75 A;  3OY9 A;  1ETX A;  1BW5 A;  2CSO A;  4FE7 A;  4NC7 A;  3OYB A;  2HOT A;  3G3Z A;  3FXL A;  2N8G A;  4R8H A;  4BYY A;  2RNG A;  3DFG A;  3BG3 A;  2Q8K A;  1IV8 A;  1G2H A;  1QZY A;  4XKB A;  1X1B A;  5DUK A;  3FHZ A;  1FBQ A;  2GQQ A;  3IH2 A;  3CUQ A;  4MGR A;  4FX4 A;  4ITV A;  4V2F A;  1K6Y A;  2V6C A;  1FYL A;  2P7V B;  2VE8 A;  4LD5 A;  3W2W A;  3U2R A;  2M3A A;  3CC7 I;  4Q47 A;  4H0E A;  4X1E A;  2PMH A;  3FXK A;  2ZNZ A;  2R5Z B;  4YIR X;  4A3G J;  1VF9 A;  2GAU A;  1P4A A;  2EFW A;  3CJT B;  1W7P B;  2O6G E;  4CCN A;  1J59 A;  4PFO A;  5TJJ A;  2M4K A;  1IN4 A;  4XLN F;  4J00 A;  2EH3 A;  5AIP A;  5H6R A;  5J1R A;  3ABK H;  3ZGK A;  3PFI A;  1ZG1 A;  2MBF A;  5EEH A;  5D4R A;  1UFM A;  4NC8 A;  3BP8 A;  3CD6 I;  3TED A;  1LVA A;  2HWV A;  2HEO A;  1Y56 A;  2KRF A;  2QKM B;  3QOD A;  4RDU A;  1IGN A;  2PEX A;  2O7O A;  4DW6 A;  2K4J A;  5F0F A;  3ZQC A;  4MTE A;  2ID3 A;  4ZTJ A;  3W6V A;  3OYK A;  4F93 B;  5ED4 A;  4M6X A;  2JPC A;  2CU7 A;  3V7C A;  5F27 A;  4BKX A;  2DA3 A;  3TL4 X;  1JI8 A;  2OZ6 A;  5CJ9 A;  4B44 A;  5J40 A;  2V9K A;  3E3V A;  4CHU A;  1T39 A;  4XM3 A;  3OMY A;  5FLM J;  1OIS A;  1PYV A;  3RCO A;  3WE2 A;  3C2H A;  2Q2E B;  5FB2 A;  3H5N A;  3L1P A;  1MBF A;  4MO7 A;  1K83 J;  1B1B A;  4HRI A;  1PP8 F;  1MBK A;  2DT7 B;  2K3F A;  3GUD A;  4I98 B;  3I58 A;  2K9Q A;  3ZCO A;  1LQ1 A;  2PX9 A;  5D4S A;  4HF0 A;  2L2O A;  2RNJ A;  3DBL B;  4RAZ A;  4BY7 J;  2A68 F;  3G71 I;  2QSG X;  2MD0 A;  4NNJ A;  2WV0 A;  1K78 B;  5LD2 C;  3MKL A;  3A4C A;  3P9C A;  2FBK A;  4BHB A;  1MKM A;  1T0F A;  5DM7 F;  2CW8 A;  4BNC A;  2OV7 A;  4LLG F;  4LLN A;  3VB2 A;  2O5R A;  1UG2 A;  4BEH B;  2L7M P;  4CYC A;  2QBY A;  3ZQG A;  1R1T A;  1TBX A;  4KMF A;  2CQN A;  1DP3 A;  4HX7 A;  5D8L B;  3QU6 A;  4J19 A;  4PJJ A;  1R23 A;  2D45 A;  1DP7 P;  3DLL F;  3EDP A;  3S15 J;  3A0B C;  4F3Q A;  4ENJ A;  2FSW A;  5E1X A;  5C4J J;  3JRA A;  3CJN A;  2MD5 A;  4II3 A;  2LF7 A;  2VXZ A;  5F1J A;  2JSP A;  3BC8 A;  1VQ6 I;  3LA2 A;  4YFK F;  4YRV A;  5ILU A;  1Z91 A;  3JRB A;  2JQ7 A;  4AVZ A;  3E1S A;  3S32 A;  3HOX J;  4LGW A;  2OQG A;  1XDS A;  2W48 A;  3B73 A;  4BU2 A;  4N4O B;  4AWX B;  2KIQ A;  3N05 A;  4EJO A;  2E2I J;  3H5A A;  3D5R C;  2W57 A;  2R5Z A;  1QQI A;  4B3A A;  4I0A A;  4XRS A;  4A69 C;  3K4J A;  3WTX C;  4FET A;  2V7F A;  2ETH A;  5EYR A;  1N77 A;  2AQE A;  3CCM I;  2HKO A;  1R71 A;  1X3W B;  3HKZ N;  2M4G A;  3M1E A;  1YX3 A;  4KIB A;  3BZC A;  1YS6 A;  2RQQ A;  2XGD A;  4M9Z A;  1SEU A;  5LRS A;  2VT3 A;  4XK4 A;  4ZYE A;  4RLQ A;  3CMY A;  5J4Y A;  2GM4 A;  4A3K J;  2GA2 A;  4I99 C;  3N4M A;  2AXT C;  5D5U B;  1U9N A;  3H9Q A;  2GZW A;  4XLE A;  2XB0 X;  4E7K A;  3CJR B;  4RGR A;  1J0R A;  1LDJ A;  4CZC A;  5D5V B;  5E20 A;  3OWT A;  2JTV A;  3CDH A;  2LK2 A;  2JPB A;  4CCO A;  9ANT A;  2L4A A;  1G6N A;  2XVC A;  4RBO A;  1ZAO A;  2EA2 A;  4RM3 A;  1WRJ A;  1SAU A;  1W36 C;  1YRN A;  2A5Y B;  2HNH A;  1KGS A;  4UB8 C;  2QQ8 A;  4V2G A;  2LP0 A;  3ECH A;  3A01 B;  1CQT A;  3CZ6 A;  1N78 A;  5KAI C;  5A2Q K;  1F9N A;  1EA3 A;  2CWE A;  1YIO A;  2DMU A;  2ME0 A;  2NS8 A;  4I6Z A;  3RI4 A;  1LVK A;  2DOF A;  3X2Q H;  1QZE A;  3I64 A;  5E3N A;  3J80 K;  1SAN A;  3HOZ J;  5BNG A;  4PSW A;  3UKG A;  2YU9 J;  4V19 K;  3I53 A;  2LDU A;  1EJ9 A;  5LEJ A;  2QLZ A;  3SZP A;  2CV2 A;  3QPT A;  3OIO A;  2DW4 A;  2MSY A;  4RAF A;  3CQZ J;  4B4C A;  1X2N A;  3LFK A;  4N4N B;  1L0O C;  4X0G A;  3CO6 C;  3H3Z A;  3GEZ A;  3FF5 A;  1NHA A;  5LGN A;  3IL2 A;  3U9G A;  3M4O J;  4CSW A;  4F91 B;  2VBY A;  2WB1 N;  1JTY A;  2HQN A;  2X6Y A;  2TDX A;  4ZDO A;  1TP4 A;  5DCM B;  4XBF A;  4KIC A;  4ZJZ A;  1IAW A;  2DFF A;  1K4T A;  3QWL A;  2LH9 A;  3IHU A;  2DMP A;  5KNL A;  1W5T A;  1Z7U A;  2P5K A;  4M74 A;  2FA5 A;  3PIP F;  1VZ0 A;  5D5X B;  4U0V A;  3JRG A;  2UWM A;  2E2H J;  3IP4 B;  4HV6 A;  4HNU A;  1DPU A;  2E7X A;  3PM1 A;  3S2W A;  3C7J A;  4DNC A;  2A07 F;  4XMY A;  1D3Y A;  4YG2 F;  1LJ9 A;  1RKT A;  1K4S A;  2O9L A;  3WHB A;  4DGW B;  3OYI A;  5FFX A;  3BPV A;  4XKV A;  4AC0 A;  3A2K A;  2JA2 A;  1LUJ B;  2CW7 A;  1UHM A;  5CVU A;  4PJM A;  3LWF A;  2E1M B;  4DBQ A;  5K7F A;  4N9H A;  1TWG J;  4QTR A;  1BJA A;  4HOB A;  1JJ6 C;  4D0P A;  2V26 A;  4AID A;  3HTU A;  1ZYR F;  1R5G A;  5E3O A;  2QSF X;  1T38 A;  1STZ A;  2EIN H;  1T56 A;  1F36 A;  1FY7 A;  1SMY F;  2O8X A;  2D1V A;  3BG7 A;  3ZN0 A;  4M9S A;  5CVR A;  3BR0 A;  1B59 A;  1OYW A;  2IGK A;  3HRM A;  2E71 A;  3L7W A;  5GAG J;  3ECO A;  4MQV A;  3BT9 A;  4MQ9 F;  2VBX A;  5CLS A;  4KJZ A;  3K4K A;  3I56 I;  5IYC J;  1ZTR A;  4HST A;  3KX2 A;  3N97 A;  4BQQ A;  4BH9 A;  1MNE A;  5IPA A;  1H9T A;  2IS4 A;  2M2E A;  5ILS A;  2VBW A;  2MA3 A;  1PUF B;  4I01 A;  1O4X A;  5DCM A;  2F5V A;  2R7F A;  2DA1 A;  3WU2 C;  3NEU A;  1UMQ A;  4XLH A;  1T33 A;  4YEL A;  1TW3 A;  4CYC B;  4HBL A;  1E0E A;  2XUB A;  5GAD J;  4HZF A;  3F22 A;  1XDU A;  1SVM A;  2R7R A;  5CQE A;  1GXP A;  1HBX G;  1IN7 A;  2HU9 A;  3F8M A;  4B3X A;  3CMM A;  3ISP A;  2ELH A;  5CYV A;  4BHC A;  2ME6 A;  2WAQ N;  3PO2 J;  3P5J A;  4AIJ A;  2FQ3 A;  2DTZ A;  2R3S A;  5L3E A;  3HXL A;  4MFE A;  5DYM A;  2IP2 A;  5E17 F;  2XF5 A;  2JA5 J;  1TWF J;  5GAE J;  2VON A;  1T98 A;  3K69 A;  4A5M A;  4HDU A;  3QOP A;  2ZFU A;  3QP6 A;  2EQR A;  3MVP A;  2H8W A;  1JJ8 C;  3HOS A;  3LOC A;  4I76 A;  3MEX A;  1TZL A;  5M3F J;  2MGQ A;  3NQO A;  2BBY A;  2Z16 A;  4E7L A;  4M72 A;  1H9G A;  2L4M A;  1JGS A;  4MEY F;  1ETO A;  4XRS G;  1X1P A;  4NUB A;  4EJU A;  5BMZ A;  1JE8 A;  2X9D A;  4E7J A;  1ZRD A;  1D0Z A;  2XF6 A;  3ULQ B;  5TRD A;  1UEL B;  2DA4 A;  5DEQ A;  2ZXW H;  1W7P D;  1D8K A;  3KZZ A;  3F9K A;  2JA8 J;  2FJ1 A;  1FP1 D;  3CC4 I;  2IRF G;  1GT0 C;  1V5F A;  1P4X A;  1R49 A;  1ETV A;  5D6F A;  4U0W A;  3TO6 A;  3AAF A;  4YFN F;  4E7H A;  1K7A A;  4BXX J;  5IP9 J;  1OCC H;  4P5O A;  2D5V A;  1HW5 A;  3TP0 A;  1ULY A;  2ACJ A;  2EPF A;  4XOR A;  3S93 A;  5LHG A;  4XR6 A;  3TOA A;  4Q5S F;  1XMX A;  4A93 J;  5DTD A;  1J09 A;  5IT3 A;  2PLY A;  3FWE A;  2Q1Z B;  3WOD F;  4HAM A;  3FXQ A;  3K70 D;  2EFN A;  5DCF A;  3CCL I;  5HDK A;  3G1O A;  5DDG A;  1PVE A;  2ICW G;  1IF1 A;  2ISZ A;  1D8J A;  2XAH A;  3BR6 A;  1TWA J;  4C3I J;  4E6K G;  3MZY A;  5GPA A;  3WTS C;  1F5T A;  3RPU D;  3BCB A;  2HI3 A;  3VOE A;  1ZHF A;  5JHU A;  2NNY A;  1LE8 B;  1FEX A;  1D0Y A;  2EZI A;  1OJL A;  1XMK A;  1XGM A;  5L3B A;  2LD5 A;  5FFZ A;  3CP8 A;  2ELJ A;  1ORK A;  1ZLJ A;  3H5R A;  4R79 A;  4L0Y B;  4L9J A;  4FQG A;  5ICC A;  4PDK A;  1WHU A;  5FRN A;  1TLH B;  2MH9 A;  2WTE A;  2HXO A;  1H89 C;  1S3J A;  2JRM A;  1ZK8 A;  3LQQ A;  3WTU C;  1XD7 A;  3I4N J;  5FRO A;  3SZG A;  5IP6 A;  1BOB A;  4LIV A;  4O5V A;  5J3L A;  5E8G A;  1IN8 A;  4FCY A;  2AO9 A;  2DXI A;  4FIS A;  5F04 A;  1QRY A;  2AQF A;  1ERD A;  1MSE C;  3DV8 A;  5D5W B;  2KIS A;  3ELK A;  4BJ6 C;  2L02 A;  3VSL A;  3H9G A;  4HNV A;  2XSJ C;  4ZYA A;  2EK5 A;  3R60 A;  1KU9 A;  4UV8 A;  3LSK A;  1G3S A;  2ECC A;  2FE3 A;  2DMN A;  4RGX A;  4KT6 A;  1SFU A;  3GXO A;  2R92 J;  1ZQ3 P;  2P0W A;  2YR2 A;  2ZCW A;  3HGY A;  1MMD A;  1LEB A;  4Y3O A;  3RTR A;  5C3E J;  3GTM J;  1TQI A;  2Z2S B;  2IA2 A;  2E1O A;  4WF2 A;  3I55 I;  2DTR A;  3HSR A;  3OS1 A;  1EH8 A;  1SC7 A;  1VQN I;  2R7S A;  1GLN A;  4C9Y A;  1FPQ A;  2YSR A;  3KP2 A;  4A3E J;  3C2B A;  2F4O B;  1EH6 A;  3ONQ A;  4NB5 A;  5CVI A;  3BJA A;  1BC7 C;  2DPD A;  4YII A;  3K1N A;  2LSO A;  2VC1 A;  1R5H A;  5E1W A;  2OTL I;  1REP C;  2HPI A;  1X4P A;  4D7N A;  1MH3 A;  4FX0 A;  2V9P A;  1GV2 A;  2Y69 H;  3PL8 A;  3S1M J;  1U0J A;  1JKP C;  5DV5 A;  4U0Y A;  2W25 A;  3ZMS A;  2YUS A;  2MC4 A;  1HF0 A;  1IDZ A;  4NHJ A;  2VJ4 A;  1U6G A;  4M3G A;  2HZT A;  4Z6Y A;  3CCV I;  1VQM I;  4DBR A;  3DCF A;  1TT5 B;  4EJW A;  4Y7N J;  2K9S A;  1KZH A;  1I1S A;  3BG6 A;  3H1C A;  3TMO A;  1RC9 A;  2EV0 A;  2FNA A;  2H94 A;  4XIC A;  2KMU A;  1FBS A;  2ID6 A;  3K4M A;  3LA7 A;  2L7Z A;  4BDY A;  3A01 A;  1DU6 A;  2A61 A;  2CUJ A;  3WGG A;  3GCM A;  1HW2 A;  2H8R A;  3NAU A;  2LKP A;  2MG4 A;  4RS8 A;  2IA0 A;  3OS0 A;  4QPQ A;  3VYU B;  5BPD A;  1PDN C;  1BN5 A;  1UHS A;  4XLF A;  5K5R A;  4KMU X;  1G3T A;  3I59 A;  2RAE A;  3D5L A;  3K9T A;  4Q48 A;  2XF7 A;  2EFQ A;  4IXA A;  1R4N B;  4RGS A;  1RR7 A;  3CCU I;  3DU5 A;  1LEA A;  3CJQ B;  5KVR A;  3HKZ A;  1XCB A;  1VQK I;  3DEE A;  2F2E A;  2XRN A;  3PQK A;  3CP2 A;  4J01 A;  3LAJ A;  2EZH A;  3OYN A;  1TWH J;  3TDZ C;  4YIF A;  4N0B A;  5GAH J;  1ZG3 A;  4Z2Y A;  2XGX A;  3UNG C;  2HQ5 A;  3DPU A;  5M5X J;  4IHT A;  4BBS J;  2DOA A;  1XC5 A;  1X3U A;  4KA4 A;  2R93 J;  4RLF A;  5CPR B;  4AM3 A;  3JTH A;  4YEJ A;  3J80 Z;  1BL0 A;  4JK1 X;  3AG3 H;  4MFD A;  3PFY A;  5BQT A;  4WCG A;  3BPX A;  3IWZ A;  1U8B A;  4BXU A;  4XL9 A;  2XDV A;  1QPM A;  2RV8 A;  1IUY A;  2HOA A;  1W36 D;  2IS2 A;  3EUH A;  1FOY A;  1WKM A;  5D6E A;  3BG9 A;  4LG0 A;  3K4B A;  2ZXH A;  4KIG A;  3RKW A;  2P8T A;  3CME I;  3BLY A;  1BOA A;  4JYK A;  1D0X A;  2X0L A;  4UV9 A;  3S14 J;  3HRU A;  3HG9 A;  4AUX A;  3S1R J;  5F0H A;  4XLP F;  2X51 A;  3FXR A;  4A2U A;  2ZME A;  1FLI A;  3HJE A;  4BQO A;  4UUT A;  3ZPL A;  3FMS A;  1JTX A;  2R7U A;  3ZMT A;  2DA6 A;  4L0Z B;  4GYI A;  3AKZ A;  2XAG A;  3AL0 B;  2LNB A;  3L09 A;  5DUI A;  1HST A;  3KE2 A;  4CA0 A;  2R7O A;  2LRE A;  1TT0 A;  2M0M A;  4DZP A;  2NVQ J;  5FRM A;  4XON A;  2LBF B;  4U7B A;  2QA4 I;  2NVX J;  1TQM A;  5HOO A;  1IRF A;  4IL6 C;  4MTD A;  2HTS A;  4BE1 A;  1UZC A;  1XTA A;  2VJI A;  4E7I A;  1H0M A;  4NC6 A;  4ABZ A;  4HLY A;  1LB2 A;  1DGR M;  2CFX A;  5BPI A;  3HPG A;  5H2F C;  3SDG A;  2H27 A;  3KEQ A;  1EF4 A;  4HV5 A;  5D8K B;  3OIQ A;  2P4W A;  1EV7 A;  3H36 A;  3EYI A;  1I3A A;  2Y30 A;  2CV0 A;  5K7H A;  2FEZ A;  2HDD A;  2JK3 A;  3JRC A;  2VOD A;  1R1U A;  3I71 A;  3FXJ A;  4D9J A;  1N75 A;  3RZO J;  3PUF A;  1CF7 B;  5M5W J;  1HCR A;  3D1N I;  4IF4 A;  1G3Y A;  4IRG A;  4CUG A;  1N25 A;  1XS9 A;  1Z67 A;  2KLO A;  2DMQ A;  5IOZ A;  5LBQ A;  1B6A A;  2K40 A;  2QSH X;  1OR7 A;  1HDP A;  3FX3 A;  2Y0S N;  2LRD A;  2ISY A;  2MH2 A;  1TNT A;  4UB6 C;  3DTE A;  3HOY J;  4A3D J;  2IW5 A;  5CVJ A;  1ODD A;  4CZZ A;  3VSK A;  4L5E A;  2I5U A;  4JX5 A;  5B66 C;  1FIP A;  1YE9 A;  5DM6 F;  3LNQ A;  2IXS A;  1TNS A;  4CCK A;  4LLL A;  2L9R A;  3M3Y J;  2EV6 A;  4MLO A;  2Y9Y A;  1RES A;  3QPL A;  4HW0 A;  1VQO I;  1JKO C;  1BI1 A;  2UUZ A;  5HDN A;  4NQW A;  4EM0 B;  2HQA A;  1TW2 A;  3V42 A;  3JSP A;  2KL4 A;  2M30 A;  2AS5 F;  1FBU A;  3RJP A;  3WTW C;  3M8E A;  3CUQ B;  1POG A;  1V5E A;  4PGG A;  3AL0 C;  4XKW A;  2KT0 A;  3GTL J;  2VN2 A;  3HUG B;  2BV6 A;  3MZH A;  2NVT J;  3ZMD A;  4ENK A;  2DT5 A;  2EB7 A;  4IRI A;  3G6E I;  2L5Q A;  3FHN A;  1HKT A;  2L9S A;  1YFH A;  5KAF C;  2CYY A;  4XLC A;  3JAM K;  2R4G A;  2JVG A;  2F5D A;  4MHG A;  1B72 B;  4LB5 A;  4BE0 A;  1BI3 A;  1ENH A;  1A6Q A;  2GIV A;  1W4M A;  2XAU A;  2ESN A;  4LJZ F;  3BY6 A;  1L3L A;  2KIF A;  4PK4 A;  3IV5 A;  2XHK A;  1Z1D A;  2W84 A;  4UNO A;  1KQ0 A;  1JGG A;  1ETY A;  3BTL A;  2ZC2 A;  1LDD A;  1XPX A;  1G59 A;  2WAF A;  2G7H A;  3V7R A;  2VAS A;  4S05 A;  1AWC A;  4Y52 J;  2H6C A;  3E5X A;  1QU3 A;  4M3B A;  4RA2 A;  3E0J B;  1J9I A;  4IHX A;  2QEX I;  3F8B A;  2VQC A;  3K4L A;  1D5Y A;  3IAS 2;  3DKW A;  1BIA A;  5C44 J;  1F1Z A;  2KDZ A;  4IQJ A;  3B6A A;  1P9Q C;  2EIK H;  3ERM A;  1MMN A;  1QBJ A;  3JRF A;  3AFH A;  1NTC A;  2OCC H;  3HUG A;  3COA C;  5ILV A;  4UUS B;  2K02 A;  4L18 B;  3JRI A;  5EEA A;  2WBM A;  3FXU A;  3BR2 A;  3TOB A;  2R7V A;  3Q0W A;  5HNH A;  3KIO A;  3MCZ A;  4P1W A;  2BVL A;  3KFW X;  3C2G A;  3IC7 A;  4BBR J;  2OU2 A;  2XIG A;  3RYP A;  1Z9C A;  3KLN A;  1W5C C;  2VIX A;  3CCE I;  1YIJ I;  1O7L A;  1RUN A;  4D5F A;  3SEZ A;  4IVN A;  2R5Y B;  2X1C A;  4IOA F;  1XSV A;  2QZ8 A;  4M3F A;  3EUA A;  1K61 A;  1BI2 A;  1PP7 U;  4I0B A;  1IO2 A;  2UXN A;  3HSF A;  3OIP A;  3OL3 A;  3JRE A;  1Z0X A;  1KYZ A;  5FKN A;  2M8G X;  4JP0 A;  1JUS A;  2ZSH B;  2LTP A;  2W00 A;  2ZKZ A;  3M8F A;  3ZQL A;  1FYK A;  4ZYG A;  1LNW A;  5F0C A;  1K79 A;  3U1D A;  2FRH A;  1Q1V A;  4ZZL A;  4DYR A;  1KYW A;  1WJ5 A;  2GOM A;  1P7I A;  4PJL A;  5EG0 B;  4EQQ A;  3GTG J;  3B6C A;  3J7A O;  4ENM A;  3J81 Z;  2DA2 A;  1B8I A;  1Z05 A;  3WGH A;  3ML6 A;  2RDP A;  2XSD C;  1SD6 A;  4Y15 A;  2Z99 A;  2QUF A;  2ZBK A;  3KEO A;  2W85 A;  2HYJ A;  1V55 H;  3FK7 A;  1GXQ A;  1Z21 A;  1WH5 A;  2XGE A;  3FMR A;  4ZDP A;  4KUM A;  3LAP A;  2EWN A;  2VJJ A;  3H35 A;  2DJN A;  4XLA A;  1U8R A;  4ZZD A;  3KZI C;  2VT2 A;  3Q3S A;  2KIU A;  4HYE A;  2WC2 A;  3TBI A;  3FK6 A;  4DQ2 A;  3DKX A;  1ZKG A;  3E6M A;  1F43 A;  2K7L A;  1YJW I;  3V4G A;  3G4S I;  4BL0 B;  1WGX A;  1SD4 A;  2LOO A;  5EJC A;  2HQR A;  4KN4 X;  2B63 J;  4H4K C;  3OYE A;  1ZR2 A;  4KDP A;  3KYL A;  1BI0 A;  2HKX A;  1Y39 A;  4IJA A;  2CUZ A;  2IJL A;  2CRG A;  3F3X A;  3ZMU A;  2M8E A;  3M1C A;  3TO7 A;  1HSJ A;  2GIZ A;  3GBG A;  3S3O A;  3TQN A;  4CIC A;  3SZT A;  1YS7 A;  5FKO A;  3E7L A;  5FD6 A;  4C2U A;  5E1Z B;  3BTI A;  3VYS B;  1E3P A;  2JA6 J;  2O03 A;  2V1X A;  1FT9 A;  2H6B A;  1BIB A;  3I9V 2;  2K5C A;  3VEP A;  4XN0 A;  5AON A;  3L2V A;  5L3C A;  2Z3Y A;  2WAD A;  1MDM B;  3HHG A;  1OYY A;  2R7D A;  5TIS C;  1D1C A;  4EJV A;  5EZH A;  1DDN A;  3CCR I;  1VI0 A;  2V4J C;  3EET A;  2NS0 A;  3BQZ A;  2HXI A;  4WXH A;  1YJ9 I;  3BQY A;  2CUE A;  1NG7 A;  2B9S A;  3OS2 A;  3MFK A;  1UCR A;  3D5S C;  4XOT A;  1FWZ A;  2V1N A;  2P5L C;  1S7E A;  3G1L A;  3W3C A;  1FZP B;  4IKF A;  2YU3 A;  2ZXI A;  2VQL A;  5JI6 A;  1GVD A;  2DT6 A;  3MKZ A;  1W1W E;  4G7H F;  1JHF A;  2QYO A;  2WB1 A;  2ZME B;  4NQW B;  2BY3 A;  1I6X A;  2X1D A;  2UV1 A;  1LFU P;  1O3T A;  3QYE A;  4IHV A;  1BR4 A;  2V9V A;  3K4N A;  1U5T A;  3WTV C;  3T8T A;  1TC3 C;  1MD0 A;  4N9I A;  2LKS A;  3IKT A;  3K1P A;  1XB4 A;  3L2R A;  2KP6 A;  1ZRC A;  2M34 A;  1J5Y A;  1R6R A;  4P9F A;  4OIN F;  5EDN A;  4HQM A;  4ESJ A;  2PJP A;  2Q0O A;  3K2Z A;  5F6F A;  1T6S A;  4DYC A;  5LLQ A;  4Y4R A;  1U5T C;  3F8N A;  4EM1 A;  4GGG A;  1I27 A;  2O8K A;  3ERE D;  3HB9 A;  3HOT A;  2WY8 Q;  4PJN A;  1B8I B;  2M7A A;  2X6X A;  3R0J A;  1Y8Q B;  2VKV A;  3BCA A;  1QVT A;  4IHW A;  5IY5 H;  1W0T A;  2DPU A;  4JQF A;  2DOE A;  2EFO A;  3TGN A;  1J75 A;  3K6G A;  4O6J A;  1FTT A;  3EPZ A;  1JHH A;  1V54 H;  3GLX A;  4G6T B;  5KK1 A;  2W7N A;  2P7C B;  3IRQ A;  4X6A J;  5M3M J;  4G6D A;  2RN7 A;  3OYL A;  5EZG A;  2OC6 A;  2ELK A;  3HPH A;  2LG4 A;  2LFB A;  3K4C A;  3DKY A;  5B1B H;  1WFX A;  2QBY B;  2EJR A;  2XV4 S;  5C4X J;  2JT1 A;  3GVA A;  4G7O F;  4BJT A;  3LA3 A;  3UR3 C;  4KN7 X;  3FDY A;  3S1N J;  1SVO A;  1P4W A;  2FBI A;  3E5Q A;  4B48 A;  4QIW N;  4UVC A;  5HOD A;  3QRF F;  1SAX A;  1F4K A;  1RIO H;  2X4H A;  2LY2 A;  1Q1H A;  1DQU A;  1WH7 A;  5B5E C;  4GDF A;  4LIU A;  1D1B A;  3PNV A;  1GHC A;  1I6H J;  3LSM A;  2PFB A;  3MN2 A;  3DP7 A;  4KFC A;  3LSI A;  3NAR A;  2CQQ A;  3U1K A;  2Y48 A;  1IXR C;  1AOY A;  2IGO A;  2M9H A;  3F8F A;  2I10 A;  4IPA A;  3OSG A;  1OCT C;  2R5Y A;  1RUO A;  3AG4 H;  2Y9Z A;  1O3R A;  3GFL A;  4A6D A;  3DTK A;  1LFP A;  3BR1 A;  2FOW A;  3LQR A;  5FO5 A;  2ZB9 A;  1IRX A;  3BJO A;  3FIW A;  2LY1 A;  4G9Y A;  1ETQ A;  1B72 A;  2V79 A;  1B9N A;  1DUX C;  1OKR A;  2STW A;  3GYH X;  1BM9 A;  2BY1 A;  1XGN A;  3FBI B;  3TW6 A;  1YLF A;  3IRR A;  1MBE A;  1YW9 A;  1RPW A;  5EG0 A;  2IGN A;  2LMD A;  2V1U A;  2Z33 A;  2E1M C;  3ABU A;  1HC8 A;  4XQF A;  2HFH A;  3KEY A;  1I3Q J;  2E34 A;  3Q0U A;  3H3V K;  4IQ4 A;  2ECB A;  2HOS A;  3BR3 A;  3SEQ A;  1XSD A;  4E4H A;  3RKY A;  2BXZ A;  4WXC A;  1PUF A;  1HDD C;  3DEU A;  3GTO J;  1QPI A;  2DLL A;  3SYT A;  3WHC A;  3CDL A;  2DBB A;  3GO5 A;  3WE3 A;  5J8F A;  3MKW B;  2DK5 A;  2VPL A;  3S1Q J;  4L9N A;  1MJA A;  4GFB A;  4A0Y A;  3VDX A;  1U2W A;  3HC7 A;  1WJD A;  1WJF A;  4ON0 A;  3CCQ I;  4A3B J;  2O3F A;  4F7Z A;  4A3L J;  1ZH5 A;  3GME A;  1X1C A;  2FMY A;  2GXG A;  1J7K A;  3SQN A;  2DCE A;  1JT0 A;  3AG1 H;  2WAE A;  3I4P A;  4IHS A;  2XKP A;  1I39 A;  3PNY A;  3C18 A;  3HM5 A;  2J5O A;  3LL7 A;  4M9X A;  2DA7 A;  5JR3 A;  3PNT A;  3R61 A;  4C30 A;  5L3F A;  4L9T A;  3H9J A;  5FKK A;  1JT6 A;  1GUU A;  5J1Y A;  3RQI A;  1QA6 A;  3KYD B;  5IYD J;  1JUP A;  5LEK A;  1MJB A;  1IV6 A;  1FMW A;  3H0D A;  2QEN A;  1P7J A;  3DBH B;  3RZD J;  2DU9 A;  2X48 A;  2Z5U A;  4WX9 A;  3EYY A;  4R1H A;  2K85 A;  3KPH A;  4NBQ A;  4EMS A;  2Z1D A;  2ZO4 A;  1FYM A;  2M1B A;  2ZJQ F;  1BC8 C;  1SFE A;  3TP3 A;  5L3D A;  4EAT A;  4DYQ A;  1SD5 A;  1YOV B;  2E1C A;  1EH7 A;  1FX7 A;  1WI3 A;  3QQA A;  5KCM A;  1YIT I;  4L9V A;  4BHP A;  1AKH B;  4XRM A;  4I7H A;  4OAY A;  2XAQ A;  3HIF A;  1MND A;  4DZJ A;  3OL4 A;  3GZN B;  1X1A A;  4CH7 A;  3QP5 A;  2BE5 F;  2OCE A;  4XSZ F;  3OYG A;  2ZJP F;  2Y0M A;  4IO9 F;  1MW7 A;  2L54 A;  2HDC A;  1S29 A;  5HS7 A;  3O3K A;  2CGP A;  4LMY A;  1MBJ A;  1Z6T A;  1O57 A;  3MAJ A;  2VPR A;  3BZ6 A;  3OYA A;  3KP4 A;  3OR1 C;  3ZR8 X;  2MLG A;  3KLO A;  1R36 A;  1E17 A;  4W97 A;  2WY7 Q;  2DAO A;  1NK2 P;  2VE9 A;  3BTJ A;  4LIT A;  4WXD A;  2CQK A;  3O2P E;  2HGC A;  3I3L A;  4BDZ A;  2Y31 A;  4ANJ A;  2XGC A;  4F92 B;  2EIL H;  2EFP A;  3GFI A;  1G4D A;  2IT0 A;  3G73 A;  1JUM A;  3M8J A;  4QPO A;  4AVP A;  2F6C A;  1VQL I;  5E79 C;  1YHQ I;  3O6B B;  3RSN A;  3SHF A;  1HW1 A;  3OYD A;  3RKX A;  3F0C A;  2AHQ A;  1G8X A;  2OD5 A;  2LF8 A;  1B4A A;  4PUS A;  2CH0 A;  1Y8R B;  4KIT B;  2JVH A;  1UAA A;  4O3M A;  2IVM A;  3FXM A;  3S17 J;  1QHG A;  4LK1 F;  4BE2 A;  1TWC J;  4I2O A;  3FKI J;  3KZY A;  4HPQ A;  1R7J A;  2HYF A;  3DBR B;  2COM A;  4S0H B;  2E1N A;  2VQH A;  3D0S A;  1W7P A;  4OIQ F;  1P92 A;  5HVQ C;  1I5Z A;  2DYS H;  3TW7 A;  4AYB N;  3ZP5 A;  1QVU A;  1WPK A;  4EM2 A;  2XPW A;  2CO5 A;  3GTP J;  1KU2 A;  2HR3 A;  1WQ2 A;  3S8P A;  3KCC A;  1BW6 A;  3K0L A;  3IKV A;  4E7Z A;  4G94 A;  1WSU A;  4OMY A;  2IAI A;  2X1E A;  2BY2 A;  2MAB A;  1Y6I A;  4BJ5 C;  3ZMZ A;  2QGU A;  1S72 I;  3NRV A;  1V5G A;  1JXS A;  1IRZ A;  4BS9 A;  1X2M A;  3HZJ A;  3LST A; 
#chains in the Genus database with same CATH homology
 2C6Y A;  3BDD A;  4K2E A;  3P7N A;  4GYG A;  2ZJ2 A;  3PQJ A;  2FNP A;  4B8X A;  2PN6 A;  3ZMV A;  3HHH A;  4L5I A;  4AD9 A;  2JZY A;  3I54 A;  4JBA A;  2L3D A;  4HX8 A;  1XMA A;  2M5W A;  2K86 A;  1IZ1 A;  4ENN A;  3OV8 A;  5CVV A;  1BBY A;  1SD7 A;  2NRA C;  3GX4 X;  3GZ6 A;  3KP3 A;  2YPR A;  2W24 A;  2XRO A;  1YTY A;  2FML A;  4P55 A;  1YO5 C;  5ERI A;  3T5X A;  1ON1 A;  4OIR F;  2ZXJ A;  3TKY A;  1G3W A;  5HLG A;  4LFU A;  1RI7 A;  4GXO A;  2M87 A;  1O3Q A;  1P2F A;  2KJC A;  3GFM A;  2OAZ A;  2D1H A;  3FZV A;  1ZLK A;  2QWW A;  3QPH A;  1ZG5 A;  3VFZ A;  3F21 A;  2UZK A;  4UVB A;  4ASN A;  4PZJ A;  1RZ4 A;  5LRR A;  1U78 A;  5DD8 A;  1B9M A;  3DXJ F;  1DPR A;  1Z6R A;  5BS6 A;  3BJ6 A;  1T2K A;  3H3U A;  4KYW A;  4B09 A;  2E7W A;  2HYG D;  2V1D A;  4RB2 C;  3R4K A;  3GFJ A;  5JVT A;  3P9I A;  2OBP A;  1SMT A;  3MQ0 A;  2Z9O A;  1YG2 A;  5E18 F;  4E70 A;  3REO A;  1KQ8 A;  4IRH A;  1WWX A;  2RQP A;  2CG4 A;  1Y0U A;  3FM5 A;  3QAH A;  2ZFW A;  4WK8 F;  3WG9 A;  3JSO A;  4ETS A;  3DQV C;  2OQR A;  2DO7 A;  4ZYH A;  1ZN2 A;  4Y17 A;  3E6B A;  5FD5 A;  3GF2 A;  1IRG A;  4EGY A;  4TV7 A;  5K1Y A;  4RB3 C;  3BWG A;  3F23 A;  4KIF A;  1WI9 A;  2P5V A;  1QNT A;  1ON2 A;  4CXF A;  4A6E A;  2M45 A;  4L5J A;  4QWQ A;  3KP7 A;  1IN5 A;  2HOE A;  2L01 A;  4UHT A;  3QU3 A;  3T1B A;  5FGM A;  4OOI A;  3M9A A;  3WTZ A;  2XAJ A;  2RGV A;  3CLO A;  2QQ9 A;  2WWY A;  3L9F A;  4GO1 A;  5K5O A;  3F6O A;  1HKS A;  1MJ9 A;  1IW7 F;  1W5S A;  1ONV A;  5HS9 A;  2HS5 A;  4CO8 A;  1K78 A;  1S8N A;  2A6H F;  2RC4 A;  5F1R A;  3F72 A;  4FHT A;  1FSE A;  4HX4 A;  3GZ5 A;  2OZU A;  3I59 B;  3T0Y A;  3R6S A;  3W6K B;  2GXB A;  3E97 A;  1U3E M;  4XSX F;  4P9U A;  4HF1 A;  2Q2E A;  2F5C A;  3Q9V A;  1R1V A;  1FSH A;  3HTS B;  3V8J A;  4OMZ A;  4AIH A;  3V8L A;  4ESB A;  1UB9 A;  2YX4 A;  1R00 A;  3E6D A;  3HYI A;  4FT8 A;  2ADU A;  4MNU A;  3WGI A;  4Y13 A;  3CUQ C;  2PBI A;  1P6R A;  3ABT A;  2A6E F;  3L00 A;  2H09 A;  4HF2 A;  1ZGJ A;  4PGH A;  3J81 K;  2KJB A;  3RPU A;  2FOK A;  1TQP A;  3Q9S A;  1K6O A;  3Q5F A;  2RVC A;  1YYV A;  2EA4 A;  2P6S A;  5LGU A;  2STT A;  3VOD A;  3RYR A;  4LK0 F;  5LGT A;  2ZNY A;  1RNL A;  4HQE A;  1ZRE A;  5DD4 A;  3RDI A;  4M71 A;  4BAY A;  2BEO A;  2DFI A;  3FM3 A;  2AXL A;  3DPT A;  1HQC A;  5HDG A;  5IT9 K;  3KP6 A;  4A12 A;  2XAF A;  4XRF A;  4KT5 C;  4I09 A;  3JAM Z;  2MC3 A;  3H92 A;  3DF8 A;  1CF7 A;  5FLX Z;  2A3S A;  4G8X A;  4Q4Z F;  2F5E A;  5LHH A;  3TDU C;  4EGZ A;  2FXA A;  2FBH A;  2QQA A;  2A69 F;  3WU1 B;  5L3G A;  3E5U A;  2P6T A;  1S6L A;  1QGP A;  2KKO A;  5A2Q Z;  4U88 A;  5H6Q A;  2BGC A;  3P9K A;  3JTG A;  3SFZ A;  1OYI A;  1KU3 A;  1HXD A;  5HLH A;  1XGO A;  5LHI A;  1UST A;  2HTJ A;  4HA8 A;  1OPC A;  2KIM A;  2PI0 A;  4LG0 B;  2DK8 A;  4M73 A;  3RIR A;  4ZH4 F;  1FNN A;  3E6C C;  3F6V A;  1S7A A;  5IT9 Z;  4UUV A;  3OOP A;  5AIQ A;  3JW4 A;  4A0X A;  5FLX K;  3T8R A;  3CTA A;  1UHW A;  4CGZ A;  4KNY A;  4UVA A;  4M6Y A;  4AIK A;  1CGP A;  5E8I A;  3SXY A;  3I5U A;  1O7F A;  1MDM A;  2IA1 A;  4EV0 A;  5EEG A;  2VC0 A;  2PQ8 A;  1XGS A;  3WTY C;  1KU7 A;  4U7D A;  4RGU A;  3IWF A;  4RB0 A;  1USS A;  4S04 A;  2K27 A;  1MZB A;  3BOQ A;  1QZZ A;  2G9W A;  3I0T A;  3ZN1 A;  2QVO A;  2BYV E;  2K4B A;  1FC3 A;  1VTN C;  4OIO F;  2O0Y A;  3TO9 A;  4A5N A;  2QM3 A;  1XCV A;  3WU0 A;  3FMQ A;  3BRO A;  1FOK A;  1OMI A;  1IXS B;  3DPL C;  4G6Q A;  4I02 A;  1TTY A;  5ICE A;  5JFR A;  4WWC A;  1O3S A;  1D5V A;  2GA1 A;  5J8C A;  3F8C A;  2JSC A;  2XKO A;  2NYX A;  1XN7 A;  1E2X A;  4OIP F;  3HRT A;  2B0L A;  2NNN A;  1S7O A;  1J2X A;  4YFX F;  1YQA A;  5H20 A;  5F64 A;  4LB6 B;  3K1M A;  2YX7 A;  4RB1 A;  2D2W A;  1R58 A;  1XSX A;  4EJT A;  2CW0 F;  2XAS A;  1SFX A;  2DQL A;  4MEX F;  1KQ9 A;  2OA4 A;  1R22 A;  4CYD A;  3B02 A;  5BOX A;  4RAY A;  4HDV A;  3C3W A;  3RPQ A;  3MWM A;  2NAZ A;  6PAX A;  2RKH A;  2MLK A;  3ZQ7 A;  3KET A;  2UXX A;  1HKQ A;  2ESH A;  3C1D A;  3M7G A;  2VOP A;  1IXC A;  1MGT A;  5HS8 A;  1I1G A;  3HSE A;  2EV5 A;  1LDK B;  1GVJ A;  4CDG A;  4G7Z F;  2F5F A;  3HRS A;  2PG4 A;  3W6J B;  1ZRF A;  2VOO A;  1V3F A;  2J5P A;  2DQR A;  5HLI A;  2FU4 A;  5ICG A;  2PMU A;  1C0W A;  3GWZ A;  1A04 A;  5ICF A;  4A0Z A;  3R0A A;  4ZYD A;  1QO0 D;  2O61 A;  1PUE E;  4UXN A;  3ROU A;  2JRT A;  1FP2 A;  1KA8 A;  2QQB A;  4ESF A;  2DI3 A;  1ZAR A;  1V4R A;  3CO7 C;  1IN6 A;  1YW7 A;  3V7S A;  3WTT C;  2GWR A;  3EQL F;  3CUO A;  4GCV A;  2VBZ A;  3KP5 A;  1YW8 A;  5K5Q A;  1U5T B;  3GW2 A;  1ZGA A;  4OU0 A;  4P96 A;  4HLX A;  2FF4 A;  3L2C A;  2G7U A;  5J6X A;  4QLC U;  2IPQ X;  4EVI A;  3V8K A;  4PCQ A;  4BQA A;  2Y75 A;  2CSO A;  3G3Z A;  4R8H A;  4BYY A;  3DFG A;  2Q8K A;  1QZY A;  5DUK A;  3FHZ A;  1FBQ A;  2GQQ A;  4MGR A;  3CUQ A;  4FX4 A;  2V6C A;  1FYL A;  2P7V B;  2VE8 A;  4LD5 A;  3U2R A;  4Q47 A;  4H0E A;  2PMH A;  2ZNZ A;  2GAU A;  1P4A A;  2EFW A;  1W7P B;  2O6G E;  1J59 A;  5TJJ A;  1IN4 A;  4XLN F;  5H6R A;  5AIP A;  3PFI A;  1ZG1 A;  2MBF A;  5EEH A;  5D4R A;  1UFM A;  3BP8 A;  1LVA A;  2HWV A;  2HEO A;  2KRF A;  2PEX A;  2K4J A;  4MTE A;  5ED4 A;  4M6X A;  2JPC A;  3V7C A;  2OZ6 A;  5CJ9 A;  3E3V A;  4CHU A;  1T39 A;  3WE2 A;  5FB2 A;  1B1B A;  1PP8 F;  3GUD A;  4I98 B;  3I58 A;  1LQ1 A;  5D4S A;  4HF0 A;  2RNJ A;  4RAZ A;  2A68 F;  2WV0 A;  1K78 B;  3P9C A;  4BNC A;  2FBK A;  1MKM A;  1T0F A;  4BHB A;  4LLG F;  4LLN A;  3VB2 A;  2QBY A;  1R1T A;  1TBX A;  4KMF A;  4HX7 A;  5D8L B;  3QU6 A;  2D45 A;  1R23 A;  1DP7 P;  3EDP A;  4ENJ A;  2FSW A;  5E1X A;  3CJN A;  2MD5 A;  2LF7 A;  2VXZ A;  3LA2 A;  4YFK F;  5ILU A;  1Z91 A;  4LGW A;  2OQG A;  1XDS A;  3B73 A;  4AWX B;  4EJO A;  2W57 A;  1QQI A;  4I0A A;  3WTX C;  2ETH A;  2HKO A;  3M1E A;  4KIB A;  1YS6 A;  4M9Z A;  5LRS A;  2VT3 A;  4ZYE A;  2GA2 A;  3N4M A;  5D5U B;  2GZW A;  4RGR A;  1J0R A;  1LDJ A;  5D5V B;  5E20 A;  2JTV A;  3CDH A;  2JPB A;  2L4A A;  1G6N A;  2XVC A;  1ZAO A;  2EA2 A;  1WRJ A;  2A5Y B;  1KGS A;  3ECH A;  5A2Q K;  1F9N A;  2CWE A;  1YIO A;  3RI4 A;  3I64 A;  3J80 K;  3I53 A;  2LDU A;  5LEJ A;  2QLZ A;  3SZP A;  3QPT A;  2DW4 A;  3LFK A;  1L0O C;  3CO6 C;  3H3Z A;  1NHA A;  3FF5 A;  3GEZ A;  5LGN A;  3IL2 A;  3U9G A;  2VBY A;  2HQN A;  2TDX A;  5DCM B;  4XBF A;  4KIC A;  1IAW A;  3IHU A;  1W5T A;  1Z7U A;  2P5K A;  4M74 A;  2FA5 A;  5D5X B;  4U0V A;  2UWM A;  4HV6 A;  1DPU A;  2E7X A;  3S2W A;  3C7J A;  4DNC A;  2A07 F;  1D3Y A;  4YG2 F;  1LJ9 A;  5FFX A;  3BPV A;  1UHM A;  5CVU A;  3LWF A;  4N9H A;  1BJA A;  4HOB A;  4D0P A;  3HTU A;  1ZYR F;  1R5G A;  1T38 A;  1STZ A;  1FY7 A;  1SMY F;  2O8X A;  2D1V A;  3ZN0 A;  4M9S A;  5CVR A;  1B59 A;  1OYW A;  3HRM A;  3L7W A;  3ECO A;  4MQV A;  4MQ9 F;  2VBX A;  5CLS A;  3N97 A;  4BH9 A;  1H9T A;  5ILS A;  2VBW A;  2MA3 A;  4I01 A;  5DCM A;  2R7F A;  3NEU A;  1TW3 A;  4HBL A;  2XUB A;  4HZF A;  3F22 A;  1XDU A;  1HBX G;  1GXP A;  1IN7 A;  3F8M A;  3ISP A;  2ELH A;  5CYV A;  4BHC A;  4AIJ A;  2FQ3 A;  2R3S A;  5L3E A;  5DYM A;  2IP2 A;  5E17 F;  2VON A;  1T98 A;  3K69 A;  4A5M A;  4HDU A;  3QOP A;  3QP6 A;  3HOS A;  3MEX A;  3NQO A;  2BBY A;  4M72 A;  1H9G A;  2L4M A;  1JGS A;  4MEY F;  4EJU A;  5BMZ A;  1JE8 A;  1ZRD A;  3ULQ B;  5TRD A;  5DEQ A;  1W7P D;  1D8K A;  3KZZ A;  1FP1 D;  2IRF G;  1P4X A;  5D6F A;  4U0W A;  3TO6 A;  3AAF A;  4YFN F;  1K7A A;  4P5O A;  1HW5 A;  1ULY A;  2ACJ A;  5LHG A;  3TOA A;  4Q5S F;  5IT3 A;  2PLY A;  3FWE A;  3WOD F;  4HAM A;  3FXQ A;  2EFN A;  5DCF A;  5HDK A;  5DDG A;  1D8J A;  1IF1 A;  2ISZ A;  2XAH A;  3MZY A;  3WTS C;  1F5T A;  3VOE A;  1ZHF A;  5JHU A;  2NNY A;  1XMK A;  1XGM A;  5L3B A;  5FFZ A;  1ZLJ A;  4R79 A;  4L0Y B;  4L9J A;  5ICC A;  4PDK A;  1TLH B;  2MH9 A;  2WTE A;  1S3J A;  3LQQ A;  3WTU C;  1XD7 A;  4O5V A;  5E8G A;  1IN8 A;  3DV8 A;  5D5W B;  3ELK A;  2L02 A;  2EK5 A;  3R60 A;  1KU9 A;  4UV8 A;  1G3S A;  2FE3 A;  4RGX A;  1SFU A;  3GXO A;  2YR2 A;  2ZCW A;  1LEB A;  3RTR A;  1TQI A;  2IA2 A;  4WF2 A;  2DTR A;  3HSR A;  1EH8 A;  1FPQ A;  2YSR A;  3KP2 A;  4NB5 A;  1EH6 A;  5CVI A;  2DPD A;  1BC7 C;  3BJA A;  4YII A;  3K1N A;  2LSO A;  2VC1 A;  1R5H A;  5E1W A;  1REP C;  4FX0 A;  5DV5 A;  4U0Y A;  2W25 A;  3ZMS A;  4NHJ A;  1U6G A;  2HZT A;  4EJW A;  1I1S A;  2EV0 A;  2FNA A;  2H94 A;  1FBS A;  3LA7 A;  2A61 A;  3WGG A;  1HW2 A;  2LKP A;  4RS8 A;  2IA0 A;  1PDN C;  5BPD A;  1BN5 A;  5K5R A;  4KMU X;  1G3T A;  3I59 A;  3D5L A;  3K9T A;  4Q48 A;  2EFQ A;  4IXA A;  4RGS A;  1LEA A;  5KVR A;  1XCB A;  2F2E A;  2XRN A;  3PQK A;  3LAJ A;  4YIF A;  3TDZ C;  4N0B A;  1ZG3 A;  4Z2Y A;  2XGX A;  4IHT A;  1X3U A;  4KA4 A;  3JTH A;  3J80 Z;  4JK1 X;  5BQT A;  4WCG A;  3BPX A;  3IWZ A;  4BXU A;  1QPM A;  2RV8 A;  1IUY A;  3EUH A;  1WKM A;  5D6E A;  4LG0 A;  4KIG A;  3RKW A;  2P8T A;  1BOA A;  2X0L A;  4UV9 A;  3HRU A;  4XLP F;  3FXR A;  4A2U A;  2ZME A;  1FLI A;  3ZPL A;  3FMS A;  3ZMT A;  4L0Z B;  4GYI A;  2XAG A;  2LNB A;  3L09 A;  5DUI A;  1HST A;  3KE2 A;  4U7B A;  1TQM A;  5HOO A;  1IRF A;  4MTD A;  2HTS A;  1H0M A;  4HLY A;  1LB2 A;  2CFX A;  5BPI A;  2H27 A;  3KEQ A;  4HV5 A;  5D8K B;  2P4W A;  1EV7 A;  3EYI A;  2FEZ A;  2VOD A;  1R1U A;  3I71 A;  1CF7 B;  4IF4 A;  1G3Y A;  4IRG A;  5LBQ A;  1B6A A;  1OR7 A;  3FX3 A;  2ISY A;  2MH2 A;  1TNT A;  2IW5 A;  5CVJ A;  1ODD A;  4CZZ A;  1TNS A;  4LLL A;  2EV6 A;  4HW0 A;  1BI1 A;  5HDN A;  4NQW A;  4EM0 B;  1TW2 A;  3JSP A;  2M30 A;  2AS5 F;  1FBU A;  3RJP A;  3WTW C;  3M8E A;  3CUQ B;  4PGG A;  2VN2 A;  2BV6 A;  3MZH A;  3ZMD A;  4ENK A;  2DT5 A;  2EB7 A;  4IRI A;  1HKT A;  1YFH A;  2CYY A;  3JAM K;  2F5D A;  4LB5 A;  4MHG A;  1BI3 A;  2GIV A;  1W4M A;  2ESN A;  4LJZ F;  3BY6 A;  1L3L A;  2KIF A;  2XHK A;  1Z1D A;  2W84 A;  4UNO A;  1KQ0 A;  1LDD A;  2G7H A;  3V7R A;  4S05 A;  1AWC A;  2H6C A;  3E5X A;  1J9I A;  3F8B A;  3DKW A;  1BIA A;  1F1Z A;  1QBJ A;  3HUG A;  3COA C;  5ILV A;  2K02 A;  4L18 B;  3FXU A;  3TOB A;  3MCZ A;  3KFW X;  3IC7 A;  2OU2 A;  2XIG A;  3RYP A;  1Z9C A;  3KLN A;  1O7L A;  1RUN A;  4IVN A;  1XSV A;  2QZ8 A;  1BI2 A;  1PP7 U;  4I0B A;  2UXN A;  3HSF A;  1KYZ A;  2ZKZ A;  3M8F A;  1FYK A;  4ZYG A;  1LNW A;  1K79 A;  3U1D A;  2FRH A;  4ZZL A;  1KYW A;  4EQQ A;  3J7A O;  4ENM A;  3J81 Z;  1Z05 A;  3WGH A;  3ML6 A;  2RDP A;  1SD6 A;  4Y15 A;  2Z99 A;  2QUF A;  2ZBK A;  3KEO A;  2W85 A;  1GXQ A;  3FMR A;  4KUM A;  3LAP A;  2EWN A;  1U8R A;  4ZZD A;  2VT2 A;  2KIU A;  4HYE A;  2WC2 A;  4DQ2 A;  3E6M A;  2K7L A;  3V4G A;  1SD4 A;  2HQR A;  4KN4 X;  4KDP A;  1BI0 A;  2HKX A;  4IJA A;  2IJL A;  3F3X A;  3ZMU A;  2M8E A;  3TO7 A;  1HSJ A;  3TQN A;  4CIC A;  3SZT A;  1YS7 A;  5FD6 A;  5E1Z B;  2O03 A;  2V1X A;  1FT9 A;  2H6B A;  1BIB A;  3VEP A;  5AON A;  5L3C A;  2Z3Y A;  1MDM B;  3HHG A;  1OYY A;  2R7D A;  4EJV A;  1DDN A;  3EET A;  2NS0 A;  4WXH A;  3MFK A;  1UCR A;  1FWZ A;  2P5L C;  1FZP B;  2YU3 A;  5JI6 A;  4G7H F;  1JHF A;  2QYO A;  2ZME B;  1I6X A;  1O3T A;  2V9V A;  1U5T A;  3WTV C;  3T8T A;  1MD0 A;  4N9I A;  3IKT A;  3K1P A;  1XB4 A;  1ZRC A;  1J5Y A;  4P9F A;  4OIN F;  4HQM A;  4ESJ A;  2PJP A;  2Q0O A;  3K2Z A;  5F6F A;  1T6S A;  5LLQ A;  1U5T C;  3F8N A;  4EM1 A;  4GGG A;  1I27 A;  3ERE D;  3HOT A;  3R0J A;  2DPU A;  4JQF A;  2EFO A;  3TGN A;  1J75 A;  4O6J A;  5KK1 A;  1JHH A;  2P7C B;  3GLX A;  3IRQ A;  4G6D A;  2RN7 A;  2QBY B;  2EJR A;  2XV4 S;  2JT1 A;  3GVA A;  4G7O F;  3LA3 A;  4KN7 X;  1P4W A;  2FBI A;  3E5Q A;  3QRF F;  4UVC A;  1SAX A;  1F4K A;  1RIO H;  2X4H A;  1Q1H A;  1GHC A;  2PFB A;  3DP7 A;  4KFC A;  2Y48 A;  1IXR C;  1AOY A;  3F8F A;  4IPA A;  1RUO A;  1O3R A;  3GFL A;  4A6D A;  3LQR A;  5FO5 A;  3BJO A;  4G9Y A;  2V79 A;  1B9N A;  1DUX C;  1OKR A;  2STW A;  3GYH X;  1BM9 A;  1XGN A;  1YLF A;  3IRR A;  1YW9 A;  2V1U A;  2Z33 A;  3ABU A;  2HFH A;  1XSD A;  3RKY A;  4WXC A;  3DEU A;  2DLL A;  2DBB A;  3GO5 A;  3WE3 A;  5J8F A;  2DK5 A;  4L9N A;  1MJA A;  4A0Y A;  1U2W A;  4ON0 A;  2O3F A;  4F7Z A;  1ZH5 A;  2FMY A;  2GXG A;  1J7K A;  3SQN A;  3I4P A;  4IHS A;  2XKP A;  3C18 A;  2J5O A;  4M9X A;  5JR3 A;  3R61 A;  5L3F A;  4L9T A;  5LEK A;  1MJB A;  2QEN A;  2DU9 A;  2Z5U A;  4WX9 A;  3EYY A;  4R1H A;  4EMS A;  2ZO4 A;  1FYM A;  2M1B A;  1BC8 C;  1SFE A;  5L3D A;  1SD5 A;  2E1C A;  1EH7 A;  1FX7 A;  4L9V A;  4BHP A;  4I7H A;  2XAQ A;  3HIF A;  3QP5 A;  2BE5 F;  4XSZ F;  2Y0M A;  2HDC A;  2L54 A;  1S29 A;  5HS7 A;  3O3K A;  2CGP A;  4LMY A;  1Z6T A;  1O57 A;  3MAJ A;  3BZ6 A;  3KP4 A;  2MLG A;  3KLO A;  1R36 A;  1E17 A;  2DAO A;  2VE9 A;  4WXD A;  2CQK A;  3O2P E;  2HGC A;  2EFP A;  3GFI A;  1G4D A;  2IT0 A;  3G73 A;  4AVP A;  3O6B B;  3SHF A;  1HW1 A;  3RKX A;  2OD5 A;  2LF8 A;  1B4A A;  4O3M A;  2IVM A;  4LK1 F;  4I2O A;  3KZY A;  1R7J A;  2HYF A;  2COM A;  2E1N A;  3D0S A;  4OIQ F;  1W7P A;  1P92 A;  5HVQ C;  1I5Z A;  3ZP5 A;  4EM2 A;  2CO5 A;  1KU2 A;  2HR3 A;  1WQ2 A;  3KCC A;  3K0L A;  3IKV A;  4G94 A;  1WSU A;  4OMY A;  3ZMZ A;  3NRV A;  1JXS A;  3LST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...